1J7VR

Human il-10 / il-10r1 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-10
publication title Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 35
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR01
4O2FB 2X70B 1EJOH 3V0VA 3PG2A 3S37H 1BZ9A 4MXWH 3ARRA 3MRIA 1K8IB 1MWAL 1X9QA 3JWDH 4JDVB 4DKDC 1QFWI 3MLYH 1SJXA 1CR9H 2YKLL 3RTQB 1OGAA 2CKBH 1JJUA 5IVXB 1LK2A 4I18C 1BOGA 1TITA 2BNUB 3GMNB 1U2HA 4K94C 3MV01 4PBVC 5TH2B 1LO2H 1FSKB 3QI9D 1KFAH 2DYPA 12E8H 1NGXB 3P9LA 2Q6WB 2KDGA 4H5SA 4NFBA 2XQBH 3D6GA 1ZLWK 4PRPB 1NC2A 1QBAA 5DD6B 3D18B 1A7PH 3NCYS 2YUXA 3M8OH 2V2TA 4YWGH 4X8JB 4KK5C 4JZJB 4UT7H 4PRPD 3VFTB 1I8KA 5F88A 5DTFA 2Z91A 2Y4SA 3GJFH 5D72H 4DVBB 1VACA 4OZHF 4QRPE 3NCJH 3SJVE 4F7MB 2XZAH 1I9IH 5FGBC 2GJZB 1CQYA 4LRIC 1IFHH 1NFDE 5FO7A 3P77B 1UYWL 3QR2A 3B5GA 4P2OC 5TQ0L 1MCSA 2YZ1A 4Z0BH 4ZUTB 3LKQB 3KVQA 1BZ7B 2BSSA 4NFDA 4LSRH 1GAFL 1U3HC 2CLVB 2XKNB 3MRKB 5FA4B 4U1IA 1BBJA 3HZMA 2VUYA 4KHXH 5EU6E 2NXYC 3MJGX 4D0CB 2XTJE 4NN6B 2P46B 5INCB 5ACLA 4A6YL 4JM2F 4P2RA 1OAZH 3Q3GB 5E2WL 1IC5L 2IFFL 5C9KA 2EIZB 4KVCH 2FO4A 5HGAB 3H42L 2GY7B 4WW2B 3S88L 4JAMB 1T89C 1JYWA 3D2UB 4FFWC 4HHAB 4TUOA 3UBXG 4IM8A 3CLFL 4U6XA 1Q94A 2AABH 3RKDC 4LCCA 1T2JA 1B88A 4WUUB 4MA8H 4OZFB 4X4YB 3PWNA 5DS8A 4G7YL 3LEXB 3C5ZC 3DVFA 1VENA 2AEQL 2ZUWA 4PJFB 4QYOA 1EO5A 4X4MA 5TE7L 5B38B 1LO3H 4GAGH 1T5WA 3LD8B 2OQJA 4WUUD 3K8LA 1J9CT 2ESVA 5CSBA 3SE9L 5HHQA 5C0GB 5IMOB 3LDBB 1IQDB 2ZKHL 3W2DH 3F6LA 3INUL 3TZVA 3PIQB 3WSQH 4HS3A 1H5BB 1MAJA 3OKDB 4ODSH 5J0BA 5ELIA 4NYLB 5CBAB 1IGFH 4WRLA 5CZKA 5F1IA 4GQPH 3T0BA 1L4IA 4I77L 2CDFA 3BDYH 1YPZE 3T1FA 4UU9A 1IBGL 2NLJA 5D2NC 2JE8A 4NBYB 1XF4B 1M1SA 1MJJA 3B9AA 4KJQD 1GGBH 1QHPA 1UJ3C 5DEZA 2G75A 3G08B 2Y1VA 4NQVB 5FKPB 4GRLA 4HPOL 1AJ7L 3EHBD 2DQHL 3HRZA 4HKXA 2ICWA 1NCWH 1JGDA 4LK4A 1CQKA 1EHLL 3T4AA 2VIRB 4NUGH 1T1WA 4G8EA 1X4ZA 3CMOL 1ZGLM 1KJ2L 3DX8B 1I9JL 5IGXL 5GS2D 1QRNE 3GIZL 1YA5A 5LAXB 3RWIB 3QCTH 5DFWH 2X4RB 2IBGA 4DN4L 5ILTL 3MZGB 4JREC 5EUOB 1CD1B 3PL6B 3LH2L 4KRPB 2XACC 4U1HB 4JFEE 2MCG1 3E6HB 3O8XA 5I71B 1AGFA 4GAFB 5DFTA 4O51A 4ACPA 3EAKA 2HG5A 1MNUH 2IG2H 2EZ0D 4NKDA 1IEHA 2O61B 3LN4A 3NFNB 3O6FD 5DC4B 3OKMB 3W0WB 3RGHA 3LEYH 5HPMB 2YN5A 3CSYA 4PG2C 4UI2A 4CW1A 4CN4A 4L4VB 5L2KA 4I9WE 1KEML 2MWCA 2QHLA 1FGVH 3W0WD 2R2EB 3GIVB 4W4OA 3ZYZA 4P48A 3G9VA 4BQ6A 3B6SB 4MZ2A 3RBSA 4FZEL 4X9IA 5E08H 4X4XB 4L4VD 4NRYB 1PQZB 1BVZA 4KKCC 2JK5A 3IDJA 1R24B 1KN2H 1CS6A 5L8KB 3DSNA 4U4BA 1M71A 5IT2L 3SGKA 4G8IB 3PDOB 1OP5K 1A1NB 3IS0X 4FN0A 3KJ6H 2OTPA 3SE8L 5FYJU 4KI1A 5I1GL 1NEUA 3MYJA 4LPXA 5FUCC 3EZ8A 5EO9B 2VTFA 1DDHB 5GGSA 3BIBX 4KK8C 4HWBA 5FV2A 4FQPA 3WUWG 1T3FB 1A22B 1NAKL 3S8WA 1KJMB 3SY0B 4R26H 1AXSB 1D5IH 3KPSE 2AK4E 3MUGA 5CHNB 4HZAA 5DJAA 5J13C 1ORQA 2VDRL 4LAJH 3MRCB 3OKOA 4YXHL 4LMQI 4P4KB 1MRDH 2YEZB 4ZAKA 1L9NA 5IB1A 3RRQA 4L8CA 5HY9B 3MNWB 1LP9B 4U0RC 4QHKJ 3B9KD 3H2WA 1S7UA 1OF2B 3HG1A 1J86A 4P4KD 4S1DC 1NCCL 4WWKA 1LO4H 3BFOA 5J06A 5FXCH 4P23B 3UTPD 1MFAH 2C4FT 2XA8H 3UJIH 1MCEA 3WN5B 1IL1A 5BV7L 3F7YA 1NCUA 2ZUSA 4TUJA 3JV6A 3QDMD 1MF2H 3FO9B 4NBZB 4R97C 1ZT7B 1IAOA 4DOHB 1KTLB 5E9DD 1T1YB 1K5NA 4GOSA 3GI8H 4XNZB 1IEBA 2PUQT 5DK2A 3QP3A 3ZHKA 2HH0L 4OLWL 4JFDD 2V17L 4ZNEA 4WUKH 1NCBL 1MHPH 4OD1L 2AEWA 1WBXA 3O11B 4FQ2H 4NZRL 5F9OH 2EDQA 4XMLL 4U6YB 4EI5C 3UPRB 2F5BH 4PGCB 1HSAA 3VWKC 5HHPA 1T66D 3G9AB 5E8DL 5FYLH 1U91B 3SDXB 3SDDB 3PQYA 1C5DA 2DLFH 1OT2A 2VISB 5I1LA 3QXDB 3BQUC 3DGGA 5TFSL 5A2LH 1HKFA 4OD2B 3SDDD 1QSFE 5EZLB 2A9ML 5EBLB 1XAUA 1AH1A 3DWTA 2P42B 4TULH 1YJDL 1IILE 3IDIA 1W72B 4KUCD 4QHUA 4U6VL 4FABL 1C7SA 5JIKA 3Q6GH 3B2VL 1R5VA 4JDTL 1ZA3B 1CFBA 4ORGB 5DD5H 3MCKB 2E6QA 2VN7A 2IAMC 4BJLA 4MNGA 3K74B 3FJTA 4OZIF 3O9WC 1IM3B 3VCLA 2GK0A 5I8EB 4OLZH 1K2DA 4X6CA 1RJYB 2IQ9H 4F7PA 3UP1A 2Y07L 5C0IB 5B8CC 4PJCA 3FTGB 3LIZH 3MLZH 4PLKC 4Z76A 3BKYL 3MXVL 2VR4A 4PJDB 2DQCH 4UB0L 1RJZA 1MQKL 2IJ0C 2KKQA 3DUSA 3VFWA 4ELMB 4JY6B 3C9NA 4FQCH 1NBVL 2VZVA 1H3VA 4AY0A 1N5AB 3L5HA 3EYFB 4IMLB 4R4FH 3RWCB 3KLDA 1FYHB 4GXVL 1U3YA 4P59L 4R96A 4ZSOA 3EFFA 2GSGB 3OKEA 4PJAF 3KPRB 1T7XA 3QEQA 4X80H 2L4OA 5JPNA 1WFOA 4L4TE 2H1PL 1G6VK 2HKFH 1GPOH 3M17A 4G7VL 3QEUB 4Z77A 2A2QT 2UZXB 3MNVA 4HIHA 5E6IB 2RB8A 4M7LL 4HWZA 5C0EA 1XT5A 2Z0BA 2O26U 2XZQL 4IRJA 4MAYB 1KB9J 2UZYB 1KTDB 2RCSH 4BK4A 4EN3B 5E6ID 1U8LA 5DJ0A 3TPUA 3BW9A 2AV1B 4DUXA 3I84A 3FN3A 1KIRB 3EW3B 1NJ9A 5DYOB 1QA9B 4JN2A 1KCRL 4O2EA 5ALBL 2IGFL 2W92A 5HGHB 3P0YH 1FZKB 3PP3K 4YIQA 4E5XA 4GQ9L 1JPFA 2NY5H 3HNTL 2UVFA 5MEPB 1QKZL 5I66A 1JHLL 2DRUA 2VLRB 1OP3K 1KJVB 4LSUH 5T3ZD 3QXAA 3SGJA 4XP4H 3FB7B 5GJTL 3G5YB 4LHJB 3T0EA 1CT8A 2V2WB 3MOAL 5J6HB 4NWTH 2VLRD 2VZSA 5I74C 3HMXH 2SEBB 4FHBD 1J0HA 5JHLH 2EECA 2VE6A 3IFPB 3HPJB 5JXAH 4CADA 1DCLA 4MD0A 3JTSA 3RUGB 3D85B 1KCVL 2V9QA 3BH8B 2HVJA 5ICZB 4YQXL 1YEJH 3WBDA 3L7EA 4U1SB 3UDWA 2J7LA 3D85D 4WEUD 5J3HD 4AG4L 3B8YA 4MYWB 5BZDA 1LGVA 2F53A 2VXVH 1UB5B 1WGOA 4RAUB 1AD9A 3EUUA 4GW1A 3TJEH 3MRRA 3RPIB 4LLAA 4APQC 4RMQA 3PABB 4AENB 4V1DA 5DQDL 1WC7B 3BVNA 4MD5A 1TZIA 2ICEA 5DEFB 3U4EA 2EH7L 1FP5A 4JHAL 4U3XA 5HDOA 1T04B 1YNLH 3WUZA 2OL3B 5D6CA 4GG6A 4JKWA 4NSKB 3CFJA 4CMMB 1WITA 1OAQL 1CFNA 3MUHL 3MLWH 1N64L 5AEAA 5EN2B 2FB4H 3ECBB 3NFSH 4BKLB 5HDBF 3TBWA 2D03H 1UM5H 1T22B 5GS3A 5C9JA 1MI5A 1IEAA 2DICA 2VYRE 2C7UB 3S5LA 1MPAH 1CFQB 4H1LB 4QRUA 2MQCA 4UIKL 1E6JL 3QPQC 3ZE2E 3L9RB 1HINL 2J8UE 1RQ5A 2CLRA 2R1WA 4UTBH 2R0ZL 5DRNB 3RVVC 5L6YH 4G5ZH 2LABA 4XCYA 1NUNB 4K7PH 4OF5A 3GB7B 3QO1B 4C83B 4HZLB 1UZ6F 5DJDB 1DBAH 1DVFB 3HCVB 3V52H 2R8SH 3QFJE 2VDNL 3IU4H 5CUSL 4EDXA 1AFVL 3VXMB 3WS6C 2CRMA 3WS3A 2YD9A 5C0FA 1BEYL 3F8UB 1MHCB 1EAPA 5DUPL 3LSOA 1DVFD 4ZS6D 1N4XL 4M7JH 2EXWC 3J7HA 4KKBD 2ENSA 1OM3L 3VXMD 1JI2A 3RTQA 3MLUL 2NY3B 3BEWB 3N50A 1JF1A 3EO0A 1Z5LB 1CE1L 5K33A 2LQRA 3RX8A 5HBBA 3HI5H 2UZIL 1OGAE 4XVUD 1SJEA 4X5WA 4YHMH 1P7KB 2NYYD 4QF1B 4HUUA 4G80B 2Q8AH 1YNTB 2NX5A 2BDNL 4LKCB 2GW5A 3VH8B 3HUJF 3KPQA 4N9GA 1BPVA 1JPGB 1JNNL 2PETA 1E4WL 5DD0L 3O45B 1A4KA 3BD4A 5LQBL 1ZLWH 2ITCB 4P2RD 1HZHL 2YA0A 1I1YB 3KWWB 4TVPD 4HT1L 3OB0K 4L3EA 3TNNA 1Q72L 3KLAA 1MVUB 2LE9A 1HEZB 2A6IB 1MCWW 4GH7B 2XZZA 1V3LA 1B4JL 3P77A 3CVHB 3FQUB 3GMLA 1JNLL 4XNYL 2AV7B 1L7IH 1SM3H 4OLEA 1EFQA 3ARGC 4WVRA 4RA0C 3NZHL 1JVKA 2K1MA 5ANMA 2P7TB 4F33A 4XPTH 2F74A 1IKFH 3OAUH 4FQJL 2X89A 4R8WH 4NN7B 2DOCA 3O3AA 2WQ8A 1CFSA 1I3GH 2YS4A 4HBCL 5FGBA 1X4XA 1FRGL 4LRIA 1AQDA 1R5IA 2HLAB 1B6DA 2E8YA 3I75B 2BVTA 4JAMA 4JRYA 1ACZA 3OR6B 2Y06L 5HVHC 4P2OA 3KLHC 1YNKL 4LSDA 4F2MA 1UB6A 4OLVL 4XXCC 5EO0B 5HHMD 5ABDE 2PF6A 5F9JB 1PYWA 2YPKB 2D7NA 3CZFB 1JZ2A 3L1OL 3RP1A 3T04D 4JFZL 3DETC 3VGHA 2YPLB 1B2WL 4M48L 2BP3A 1MIMH 3NA9L 3BDBA 4P9HC 1T89A 3QUYB 4RMTA 4X4ME 3HZKB 5IEHB 4LARH 2YPLD 1RZKH 3DHMA 1RIVH 3LKSA 1BQHG 1LILA 1A8JH 2ESVE 4WNQB 3QG6A 5AYUL 4E0RB 3NIFE 1MY5A 5CBEB 4G6AC 5DGQA 2YWYA 5DVKA 3QHZL 3QUYD 4GRLD 1JRHH 2D2OA 2KZWA 2FJHA 3TYGH 2YMXH 5CBAA 1TFHA 4H0GA 4LIQL 1XF2A 3MRQB 1IAKB 4OUUA 4X9FA 5CGYC 2OP4H 4MXQD 4OF3A 3VFPA 5BCAA 4YHPB 1XCQB 3QQ4A 3BH9A 5DURB 3VD3A 3ALXA 4PJ8B 2Q20A 2RJMA 3FFCE 3VD9A 4M61B 5DURD 2MQ0A 3C5SA 1T2XA 4BH8A 4M8VA 3NTCL 3WV0A 3T65B 4Z5RA 1NGQH 3S35H 1G6RB 2A0LC 3CFKA 1DANU 2VIRA 1ZHKB 4L8SA 4OZHB 1AGEA 5D2NA 4O9HH 1A5FH 2QQNL 3LCYA 5EPMB 3BP4A 5IESH 1UJ3A 1R3HB 1FZJA 1RZ8A 1RZFL 4JCLA 1H3PH 3BN9D 2BSTB 1S5HB 1LNUA 5D7JB 5ITBL 3PL6A 1FYTE 4KQ3L 1CK0L 1S7SA 3U30B 3IVKA 2DMBA 2A6KA 4X6BB 5CJOL 2DQJH 4ZPVA 3H7BB 1G9NL 2W59A 3X3FL 4ISVA 2ZCKH 4MHHI 2ZUYA 4JM2B 2GCYB 5F7EH 3VWJC 5J1AA 3VGAB 1CZ8H 4UUJA 3O0RL 3I02B 3AS2A 4ZUWB 4HK0A 4X6FA 4QXTB 4ENED 4JM2D 3FB6A 1NAMA 4G8GE 4DEPB 3BMWA 5GZOC 2FWOA 3DX6B 1QSEB 3VJ6A 1A4JB 3DMMD 4MSWB 5JW5A 4DGVH 5FM5O 5L2KE 5E2TH 4ZYKB 2J2ZA 3DYPA 3BKML 4OV5A 1E4XI 1Q9KA 1F3JB 1WV7T 2XI9A 1HILA 3B9EA 4WO4D 1OLZA 4RX4D 4ZAKD 5HGGS 1UG9A 2Q7NA 3MBEB 1VPOL 4PG2A 4AM0B 1K3IA 2X4UB 2F58L 2CKNA 3DGCR 3EJZD 1FDLH 4OGXH 4YDVB 1GCFA 3HG1D 5D7LB 5EU7E 2NY1C 4KU1A 1X5GA 2ZPKL 4PRHA 3LMJL 1FNEB 2DMCA 1D6EB 4KV5E 4PP1D 3MBED 5HYJE 2XT1B 1KJ3L 4LSQL 5D7LD 1KJMA 4K3EL 3SY0A 1N6QL 2G60L 4LNVA 3TBTB 5E8PB 3AAZA 4KQ4H 2EE9A 5EZIL 1EO8H 4MS8C 1UH4A 1GIGH 3WHE1 1MUJA 2YC1B 4LSTL 2R4RL 3UTSE 5KTEL 1EMTH 4D8PB 5IVOA 4P57A 4OGZA 1CFVL 4IOIA 1RJLA 3L3HA 4ZXBB 2H26A 1RUQH 4M8QB 4P23A 1SEBA 4EEEA 5EBMB 5FOBA 2G2RB 5ISZA 1ONQB 3MLXH 1QBML 4OFDA 2GITA 1FO0B 3D87B 4Z8FH 2G9HB 3AREB 4M6NL 4U1NA 4MDJB 4RZCB 1U3JA 4F80A 4I1NB 1KF9B 1M05A 4PV8B 3QUML 4X7TA 4XNUL 1FVDA 3KYKL 6FABH 1J8KA 3PQYD 3RNKA 2LFGA 3KPLA 1R3JB 1ZT7A 4QWWD 3ARED 2EE6A 4ODHH 5IK3A 4QHLB 4UIMB 3CLEL 3QDGA 3GMOB 1JPTL 3G5VB 3G5ZB 1O5DT 1U8JA 3T4YB 5FO8A 1GGIL 3QRGL 4ONFH 5KOMC 4TPRL 1XR8A 5BQ7B 1CICC 3V6ZA 4KFZC 2FX9L 3CDFA 4U6HB 3O11A 3TWCH 5GS0C 2CLZB 2J12B 4XBGA 4NGHL 1RURH 4KWUA 2XICA 2F19L 3U7WL 3QNXB 1DQQA 4M7ZB 3C6LC 2DAVA 2DJSA 1DBBL 3WDJA 1NANH 6CGTA 1BJ1J 1Q0YH 1RUKL 1ZLSH 2E8ZA 1Q9WB 2VISA 2J6EA 4M5YL 2O93L 3RKPA 5IB5B 5CINL 4JPKL 1VGKA 1XGPB 5EC1B 4NUJB 4WFFE 1MHHB 1W72A 3GNMH 1NCDH 3MV7A 3NIDF 1PKQB 3RGVC 3GZKA 4AH2B 2OR9H 1N8ZB 4EI5A 7FABH 1XR9B 3EO9L 3E0GA 4LRNL 1HQ4A 4J8RB 1ZLVK 1N5YL 1TZGH 2A83B 4LSSL 1K4DA 4XC3H 1IM3A 4K94L 4F7TB 4O5LH 4POYA 5CAYB 3BQUA 3D0VB 2AJZB 4M6OH 1I7ZA 4LQFL 4UV7H 2VZUA 4XVJH 4FXGA 4MNGE 1OQXA 2XXMB 4MB3A 1W0VB 4JFPA 3QPXH 5DGRA 3RZCB 4P3CL 5I17A 4QOKB 2BY1A 1A6ZA 3QEQD 1BVKA 5DJZA 4LIQE 1BAFL 4PJCE 3S6CA 3ULVL 2ILLA 5FM8A 4QOKD 4MJ6A 5DT1L 3QFDB 5DDHA 2IAMA 4HJJH 3ROOB 3O3UN 5DMIL 3JBG7 3DI3B 3IJHA 4IRJD 5C0BA 4LCWE 4QXUH 1HSBB 4LDLB 3L5JA 1D5MA 3RU8H 1GYAA 3G6DH 1IVLA 2C4XA 2YN3A 4P5MA 5MEOA 1KSRA 5DUML 4RNRA 4NWUL 3MLRL 4I48A 4EKXA 4ZSOE 3ZTJG 1FGNL 1FNLA 4KJYB 1CBVH 3N0PB 5C2BH 4XPAL 5I9QC 1T0NB 1MCPH 4GBXB 1J8HA 3RWJA 3LB6D 3KPNB 3T0ED 3THML 4UILH 4HAFA 1TVHA 4X7DC 4U1LA 2XTLA 2VXSH 4JANA 4KUZH 5EUKA 3DHJA 4LLMB 2AV1A 4ONHB 3ZDXF 1KIRA 1XF3B 5DYOA 5HDQH 4UOW0 1LEGB 5D96B 3T77B 4Z7WF 3FZUD 4WDIB 1IGML 5HGHA 1KPVB 1ETZB 1FZKA 5IJVA 2YOCA 5EWIH 1A3RL 5JOEA 2ORBL 1E0OB 4NKIL 1BFTA 5IVZB 4MB4A 1HHJA 2F53D 5FA3A 2OI9B 2XY2A 5CWSA 1BGXH 1QNZL 5MEQA 3PP3H 3K4AA 4QRRB 4GKOA 1FZOB 4JDZB 5LCVH 1WSST 4YLQT 4LLVB 5GS2H 4HJGA 1LQSR 1I8LC 5ICZA 1EJ6A 2EDHA 2XZCH 4WFED 4M62H 1F45A 4U1SA 4G3YL 4MGXA 1OD7A 4LEOB 5KS9A 5JHDB 4RA3A 4OZIB 4Z18A 3I6LD 5BO1L 2E27L 3FCTB 4PJIF 3QNZA 4PRNB 1T0MA 1PLGL 5JHDD 1EUUA 1OAXH 1RZIB 2ZJSL 4AENA 2GT9A 2W65B 3VRIB 1H3GA 4Z0XB 3S36X 2UWEF 4NCC1 4XNQB 1OTTD 1WWAX 4EZMA 3WIIL 2YKLH 4V1DE 2WAHA 4YFLI 4HJ0D 4KROB 3RL2B 3RVWC 1N7ML 1MIEH 4NZTL 4LP5A 5EO1A 3HE7B 4GG6E 2E6PA 3V6OA 1CXKA 4K23H 1G0DA 4KROD 2B2XH 4WHCA 4H1LG 4R7DB 4N5EC 3I6KA 5J57B 5I75C 3BZ4A 5GGQH 5GS1B 4PJAB 3HE7D 1IRAY 3X11A 1C12B 1QHOA 1M7IB 1MLBB 2H9GA 4JZOA 1MI5E 4PP2B 3MRHA 2HT3D 4Y4KB 1QOKA 4PJXB 1RSFA 2IPUK 5TE4L 1P4IH 4N0FA 5MP6L 1HI6A 4Y4KD 2O5ZL 4MXVF 2PN5A 1N2RB 3X3GH 1A1OB 1I1AA 1OB1B 1T20B 2NX5D 1QPPA 4ETQB 3DUUA 3OXRB 4I18B 3CNKA 1ND0A 1VKXA 5TQ0H 4MX7A 2H3NB 3DXAA 4N90E 2P24A 1HHGA 4LBEA 1II4E 5FECA 5ID1A 4DZBB 4LF3B 1WCBB 4ZUUA 3NACL 5IVXE 3H9SB 2V9RA 5E00B 1IC5H 5IHZB 2PO6B 1P7KA 5E95B 1M7DB 1FJ1B 3WS6A 43CAA 1YNTA 2PO6D 2AJ3A 4UDTA 3DPBA 5EZJA 1R6VA 3U9PL 4ZUVB 4JJ5A 5E1AB 4N0RA 4EBQL 3BP6A 5D2LF 5C6TL 1BP3B 1UVQB 4HGMA 3GHBL 4L9DA 4JQXC 2L7JA 3QIWB 2OJEA 1F8TL 4PUBH 1FIEA 3BPLC 3B2UC 1U92A 1U3HB 2LAGB 3RI5F 3SE9H 2XWTB 4P2OD 2NXYB 4L3EE 4X98A 2VABA 3QIWD 3REWA 2YBRA 1KT2B 3OB0H 1A0QL 1U3HD 3TVMC 2ZKHH 4URTB 4QRQB 2NXYD 3P40A 2N7BA 4P5TC 3QJHA 4P49A 3GGWB 2AJYL 3ULVE 1G1CA 5ANME 4ZO6A 5LXGL 1Y6NR 1NSNL 3O6LL 5IBUG 4NN5C 3LEVH 4I77H 2AGJH 1IBGH 4BFBD 1P7QA 3TLRA 2X6MA 1NMAH 1CDIA 5EOTB 4FFWD 3S4SA 2EYRB 1JYNA 5ESVB 4OFVA 2JTDA 1MFCL 1OY3B 1G0XA 4DVRL 3ARGA 3C5ZB 1U0QA 1XGTB 2NY5C 5GRXG 4HXBL 4UV4L 4JRYE 4Y16B 3RKDD 5F9JA 4YDIL 5BRZA 2J6EL 4PJHA 2D4DA 4OGAC 4PTTA 4F7CA 2NNAB 3HB3C 3C5ZD 3E8UH 1RULL 3TN0B 3DIFB 3REVA 2XRAH 5I6XC 4KI5E 4M43L 1L7TL 3L3DA 1EHLH 1W72L 3HPLB 5H94B 5HI4C 1UC6A 2UWEA 3TN0D 3EYOB 4OZ4B 3VMPA 3IKKA 1HCFX 3HS0B 3CFBB 2WZPD 2ARWA 4HIJA 4H88L 3F7VB 5ILTH 32C2A 1JP5A 4YGVB 1FFNB 1I1FB 1YEIL 2MHAA 4XHQA 3ULUC 1ZEAL 1JGUL 3SOBL 3TBVA 2RGSA 3MRQA 1CGVA 1A3QA 3KYMA 3O41B 4YHOL 1D9KB 4KMTH 4YHPA 1PD6A 5FYKL 1U41A 2M8XA 2Z8SA 4ELKA 3HA0A 5CEZL 1S5IL 3GI9L 4IJ3B 1D9KD 3MC0A 3OKYA 3U4BH 4P9ML 4D3CH 5TDNB 1X5IA 3H3KA 3HUJB 3PWUA 5T3XL 5FK9B 1CDCA 1I3UA 3ZE0F 4NQXA 3HHRB 1EXUB 2P5EA 2NTSP 2X41A 4F58H 2AXGB 4KMQA 3QIUC 3QUZB 1UQSB 3MRMA 5BOZG 5I30H 2LVCA 3ZTJH 1A1MB 4LPCA 3SKMA 1E28B 5HYQA 4ZFZB 3GSNA 3CCHB 2ZUQC 5IT2H 4NT6B 1G9MH 1QQDA 4PD4J 3NABL 4HF5L 3IAPA 1BD2B 5T3ZH 1B0RB 4HH9B 4ZDHA 4G43A 4BFIB 5IB4B 1Z6JT 1NAKH 1ROWA 5CP3H 3W81A 2YXFA 4O58L 3W9DB 2XWBA 2DLHA 1F6FB 4XAKD 4Y2DB 1BQLL 3VFRA 3DLQR 4YXHH 2C4FU 3D9AH 1WJ3A 4PPTA 3FOMA 4PRHD 2EDRA 3D39B 3RHWF 3WFCH 1ZVSB 2Z8VC 3BZEA 5HYFA 2VXUH 3BPNC 1NCCH 4KKCD 3SE4C 2P5WA 3AXLA 3BUTA 4I0PA 3MCLH 4YO0B 4PGZA 5I8CA 2Q3AA 2M26A 4X6EB 3RNQB 5EB9A 2B1HL 5IEKB 4WJ5B 4ZFFA 2IPUG 4MNQB 4TN9A 2APVA 1I8IB 2HN7B 1U8OB 2PXYC 4KK8D 4LOUC 5FB8B 5FO9A 1ZKAA 3PV7A 4PLJC 3FQXB 4QT5B 3UBXI 2VWEE 4HUWB 2ZOLA 5AG8A 4U0RB 1DQJA 4OD1H 2VDKL 1C5CL 2DQIH 3T3ME 4NZRH 3VXTA 2AJUH 2XWJA 4A2LA 4L3CA 5E8NA 4PR5B 4TQEH 4XP9H 2BHYA 3PGDA 3BAEL 5D5MA 1DBKH 3CFDB 2EC9T 4OBRA 4YHNA 2XY1A 3BGAA 3V6FA 3B9VA 3QDGD 4OGYH 1LWRA 2Z4QA 4S1DD 5EIIA 4FRWA 1DEEA 3RIFF 4E41B 1LP9E 4M8QA 1QFHA 3A67L 1GZPB 1YECL 4PJGF 4I4WA 1NGPL 4E41D 1HH9A 4W68A 1JYVA 4PJ7F 1FNSL 2JCCA 4U6VH 3MNZA 5D71H 4FABH 3IJSB 5ISZE 4D94A 2XNAB 4JDTH 4PJEA 3DO7B 3BE1H 1MH5B 2EE2A 2VC2L 4TSBH 4R6UA 3KXFA 2CK2A 5FDWA 3AC0A 4QHLA 2QHRL 5C70A 1A47A 3MLVH 4NO2B 4TOYL 1DFBL 2B20A 4DOHE 4UQ2A 1EZVX 5IR1A 1QUNA 2Y07H 3VWKB 4JLRB 3QDGE 3BSZH 3DBXA 5CZXC 2WW8A 4KC3B 5C0AA 3MA7B 4PJ5A 4EI5D 2CK0L 4NIKB 3BKYH 4Y89A 3VWKD 1EGJA 4MWFA 4TSCL 4JGUA 5BZWA 1J1PH 2Y5TB 4R7NA 1Z9MA 2R9HC 4HKBB 3QBTB 5KN5A 3BQUD 4K8RC 1YY8A 3PHSA 1HXMB 2X44D 1QEWA 4Y4HC 3OR7A 1ZWIB 5TGBA 5HPOA 5HTSA 1NMBL 3QWRD 1CICA 1R3LA 4I8DA 5C0JB 3O9WB 3IDXH 4XBEL 1IM9A 1TNMA 3FRPA 3P4NB 5DD3L 3C6LA 2D9QB 2IAMD 3MV7E 1UKTA 2Q86A 5B8CB 4QTIH 2P1YA 3O9WD 3CVHH 3MJ8A 5C0BD 3CH1B 3MACH 1TETL 4HGWB 4BUHA 2XXCB 3V5KB 4EOWL 3LS5L 4M7LH 3HLAA 5I19L 3VXUB 3CU1A 2XZQH 5CFHA 1S7QB 1CDBA 3ZDYE 5DO2C 1SVZA 2W0FB 1WBYB 4NO5B 3J8F7 4K3JL 3UJTH 5FEBA 4ODVL 3AUVA 1LD9A 3ULSB 2VLJB 3KPPA 4BZ1L 4Q58C 2DTML 4HV8B 2JB6B 1KCRH 3UYRL 1GL4B 5FYKE 2IGFH 3E3QC 4RSVA 4PFEA 3UROR 5CEZE 2KBGA 5KSAB 4GQ9H 2Y7QA 1Y0LA 2ZUVA 3EGSA 1CYGA 1YUHB 1JHLH 4HMEA 1VDGA 4QHMB 2EDYA 1SEQH 4G9DB 1MFNA 2X1XR 4Y19B 3V7AE 2APXA 1IAMA 5TPWL 5GJTH 4OM0H 3V5HB 5I18L 3LQZB 5T3XE 1QFWM 4OTXL 1FLRL 4JRXA 3T8XB 3LKPA 1YEDA 4Y19D 4WEMB 4H26B 35C8L 1JZ6A 2VLKA 2X1PA 3D48R 4OZGB 1ULVA 1KCVH 4HS6B 1RUPH 4YQXH 1S7VA 1I4FB 4MCZA 3TBYB 3ARFB 3O2VL 4U7MA 3KPNA 2R1YB 5E5RB 2VOTA 4QCIB 4BQ8A 4ONGH 1H15B 3L3KA 4N5UA 1G7LA 1H3WM 3FO1A 1J8HE 3KPMB 1DP0A 3FO0L 4ODTH 2X4OB 1DUZB 3JWOL 5MHSE 4RCAA 3VGDA 3VXSA 4Y1AA 2EDKA 4JVUA 2X4QA 3HZVB 1S3KL 4FQHA 5CJQL 1ODAA 3JUYA 2B0SL 2Z92B 3SPVA 3ZT7A 4NKOB 2H2SC 4N0YL 4BK5A 3STZB 2Z8RA 1TJIL 2FR4A 4M1CC 4YHKL 1N64H 3RL1B 3FT4A 1BIIB 3FQRA 3GBNH 5SWQB 3VFMA 4BYHA 1J88A 4LLVA 4F7EA 4JPWL 2X1OA 4LCYB 4GO6B 4OFYA 1HXYB 3FFDB 3RUGE 4XP1L 5JOPE 1CE6B 3S5LG 4M7KL 4APQB 1HINH 4GFTB 5SWSA 3GMRB 2FH6A 3AFLA 4XZUB 4M1DH 5F89B 1G1YA 4C56B 1JK8B 4APQD 1U58A 3TYFB 5CUSH 1G7IA 3QXUA 5EU5A 3GSNL 1CIDA 1AFVH 4NKMB 1FFRA 3IFOA 4HQQL 2PYEA 2YRPA 3C87A 3K3QA 5F7UA 1BEYH 5DUPH 4XNQA 1N4XH 3P30H 5I1DA 1O7SA 1M7XA 3MLUH 4XWGH 3MRPB 3EOTL 5DA0B 4GAJL 4HWBH 1OSZB 2EDXA 3EZJB 2VL5B 4KKAC 3VI3F 3OKLB 3RX7A 4OF8A 4NRZB 3TH3T 3ZZ1A 1FZMA 4MA3B 3SQOH 3CFIC 3MV9B 3S37X 3V6OE 3DXAD 5A43C 1JRHI 1PX3A 1ADQL 5DJXB 4Z7NE 1JNNH 3QPQD 1NGYA 3C8DA 3FQTB 3PWJB 5DD0H 3RVVD 3VD7A 5B39B 3OJ2C 4PGDB 5LQBH 1JGEB 2YHGA 3ETBF 1JI1A 1X6NA 4HT1H 5ICYA 1RAMA 5E2VL 5DJ8B 4PB9L 3VFGL 4F15C 4J2XA 2AJXL 1OB1A 4OIBA 1IT9L 2VR5A 4ODWB 2DN7A 1B4JH 1T4KB 1AHWC 1RU9H 2OK0L 3F12A 1GGUA 4XNYH 4YUEL 1CGXA 2EXWD 1BOYA 3C60C 4ODBD 2J5LB 1OTUC 2OZ4H 4EUPB 5C8JA 3SDCB 4I3RL 4IIQC 4DZBA 2AERT 4FQJH 3PJSA 4RGOL 5IFJA 3CMGA 2GUOB 2X4TB 4WU5A 3SDCD 3GHEL 4K3DH 4MAUH 4HBCH 4HUVB 4PRIA 1R5WB 4G6FD 5HHNB 4NNPL 5FUZL 2YPVL 2FATL 4L9LA 3BRDA 1I1CA 2Y06H 1LE9A 3QAZC 3D5OF 4D9QD 2I9TB 4OLVH 3UZVB 1FAIL 2IH3B 4JB9L 5L88H 1FG9C 4FQIL 5IKCB 1DUYB 1NL0H 2IADA 3DV6A 4NQSA 5T1LA 5GSRB 2HKHL 3IRZA 3WFDL 3WO4B 5DHYA 2GTZA 2P8PA 3L1OH 3WE6B 4HD9A 3TCLA 1FL6A 4Z95L 1P7QD 1WQVT 3NA9H 4PJIB 1CLZL 1OTSC 2W60A 4BH7A 1X5JA 3OAZK 3AS1A 4PS4H 1X7QB 5BRZD 5MENB 1NH6A 3UMTA 2GSIA 3QHZH 4DGIH 4LCIH 1NCNA 2PW1B 3UZQA 3VFNB 1WFNA 1XGRA 5HVHB 5MEND 1Q8MA 4JQXA 3PP4H 4Q2ZB 4JY4B 5GRYA 3QIBB 4OQTL 5E8EA 1U2CA 1R3KA 4OM1H 5AUMA 4IRSB 4XRCA 4I0CC 3KLHD 1FH5L 4IBLT 1EGJL 1QVOA 3TVMA 1RK1A 3QQNA 3DV4B 1EEZA 3AS3A 4P5TA 2BFVL 4U05A 3ZKMD 1X5HA 3DETD 5CS7A 3OZ9L 3QT2A 5BRZE 1QFWL 1M6OA 4ERSH 4PJHE 4BELD 4JFHE 3QEGH 2J88H 5H94A 5KJRL 5IQ9A 3EYOA 4OZ4A 4WFHD 2A6DB 5LBSH 2ED8A 2QQNH 3MGAA 1OPGH 4G6AD 1KG0B 4Y4FA 5ERWA 2CPCA 2V5TA 4HWUA 5K9JH 3CXDL 3QQ3B 4HSQA 5ITBH 2P5ED 3MODL 3MUJA 3NIGF 3U82B 4OB5L 4KQ3H 1CK0H 1KOAA 1QBLL 2H2PD 1C5BL 2QEJA 2X5PA 4U6TA 1A14H 5CJOH 4MCYB 4Z7VA 5CGYD 3X3FH 5BVPL 1AKJB 3AU1B 3C2SA 4LEXL 2FGZA 3D1MC 3VE0A 2LU3A 1I7RB 3O0RH 4ZPTA 4YGAB 5ACMA 5GRJH 4L1HA 1T5XB 3HNSL 4CVXB 5L0QB 5H2BB 5ACZB 4P5KA 4BQ9A 2R23A 4GG8A 2ITDB 1NEZB 2NY7H 4P2QB 2A0LD 1GGYA 4XPHL 5D2LB 2AI0L 5EOCJ 2DM4A 2BK8A 5CILL 5CEXA 1JNHB 4OIIH 3BIKA 5JOFA 5H8DA 1AP2B 3WMSA 4DK3A 1FFPA 1C16B 3CCHA 4HW6A 3UC0L 5FYJL 1VFBA 2BNRA 3VWJB 1DLFL 2FYYA 4MDIB 4PY8I 1TXKA 4XCNB 1CDHA 4J3OC 5J8OA 1AGDA 1B0RA 1D6VL 3VWJD 1RVFH 1LEKA 3MLTA 3QIUA 4XNXL 2CKBB 3LHPL 1N6QH 1HIMH 1IGJA 5EDXA 3U2SB 3G04B 3PV6A 5EZIH 5BXFB 4M00A 3SDYL 1UWGH 1I9EA 2I5YH 1REIA 5GZOD 1KB5A 5C71A 5C07A 1MLCA 5F7KC 4XNMA 5SX5K 2QR0B 5DJYA 2CXGA 3L95B 2BVQB 1CGSH 5I73C 1QSEE 1HK6A 1EEYB 1R0AH 3BWAA 3L3OA 5F9DC 2EYTB 4AMKH 3GJFB 5ENWB 4DZ8B 2P5WE 1U6AL 3JV5A 3R1GL 1NLBL 2X4PB 3RNQA 3KYKH 2A6JA 2NY1D 4JPIB 2PW2A 2Y36H 3LV3A 2FEEI 4JY5L 1OLLA 3O6KL 4XVTL 2DJUA 2A9NL 1P1ZA 5KSVB 2QQKL 3CLEH 2MKLC 3SE4A 3GRWA 4JFQA 1NC4A 4WWID 3GMMA 4MJIB 4LGSB 1UCTA 1GGIH 1T7ZA 3SO3C 1KLUA 1X4YA 1MFDL 4TPRH 1J1XL 4MNHA 4LGPB 2FX9H 2WIIB 4XBPA 4LHUB 3KJ4C 4OCRL 4MJID 4NCDA 3ORJA 1JHKH 2F19H 4PRBA 4XPBH 1UM6H 1YMHB 3CFDA 3KXFD 4LLDA 3UTQB 5EFIA 2Z31B 4P3DB 4XAWH 3BKJH 2PXYA 4AEIL 4JHWL 2H8PA 4KTYA 5D5ME 4GKNA 2YR3A 2BMKA 1A7QL 3AROA 5CINH 4U1GC 5F1NA 5DUBA 2ZUUA 3L5XL 4HCRA 3VFUA 4XCCL 1OHQA 1H3UA 4XC1H 3VDCA 3GMPA 4OCYL 4Y5YA 5C0AD 1XGYL 2J8OA 4PJ5D 3EYQC 2VSCA 2FSEB 4LRNH 4YZFF 1QFUH 4NOFA 4QTHB 1I7TB 5KVFL 2VH5H 4K94H 3HAEB 5F97E 5T5FL 4PJEE 3TBSA 2ARJB 3DURA 4LQFH 3MV11 3TO4A 1CICD 3GSOB 5F9WC 3WFZA 1ZXQA 1JL8A 4ZMAT 1B0GB 5GS0D 4JKMA 4P3CH 4X9HA 3FOLA 3GMQB 2X4SA 1IM9D 2CD0A 3HNVL 3MGTA 4JG0L 5I1EH 4PGEA 3C6LD 2JELH 3CH8A 3C6SB 3ULVH 3VRJA 3PWPB 5BOPA 3EOAB 4HKBA 3TNMB 1HNFA 25C8L 3S34L 3GUTA 3MRJA 4F3FB 2GQHA 5J7CC 2OYPA 2HMIC 3P9MB 5K9OB 1W8NA 2P4AB 4HS8L 1SY6A 1VFAA 1JWSB 5I1KL 3QB7C 2EIBA 3RGVD 3SDAA 5C0JA 2IFGA 5F44A 2D31A 4NWUH 8FABB 2DIAA 2XQYK 1X5YA 4DJMA 1FL5A 1FGNH 3DYOA 1PKQE 2JB5H 2E7HA 3U1SL 5K9KB 2ADGB 2R4SL 1QACA 2NCMA 2GI7A 5D7KD 1PZ5A 2VZ3A 3IGAA 1NFDF 2H32A 4Y4HA 1ZHNA 4JRXD 3THMH 3JXAA 5HVWA 1AIFB 1RUAH 4FQXB 4PRDA 5DRXB 1J0ZA 2ADJA 3C09C 4NO5A 4HULB 3FT3B 3WL9A 4FQXD 1ZHLB 5D70H 4HV8A 3LN5A 3OAYH 1X5LA 3NN8B 3MRGB 1H8NA 2DLIA 1IGMH 3V0WL 5KSAA 2WP3O 3UAJC 3LQAL 4X0KA 2XN9D 1A3RH 1U8HB 3L3IA 2ORBH 5HVGB 3HR5B 4Q9RL 4NKIH 1CU4L 2B4CL 5BVJA 2IQAA 4Y5XC 1ZE3C 5GQBA 5DMYA 1QNZH 1FC2D 3G6JB 1F11B 3VXSD 4PJGB 5I9QB 2A74A 4UT9L 1AGCA 1SBSL 3IDYC 1OT1A 4S2SA 1SJHB 4PJ7B 1WBZB 3QCUL 1EBPA 2FZ3B 1S9XB 5TF1H 5JPMA 2ZNXA 2W9LA 2VLKE 2D0FA 5E0QA 2IALA 1WAAF 5J6GA 5BW7A 5FYJE 3MRNA 1URLA 5EZOL 2A77H 5F7MC 5KZCB 4B7IA 2R1XB 5BO1H 4F57L 2B39A 5BV7C 3CC5A 4HKZA 1ZSDA 3K0WA 5FAAA 1U93A 1XFPA 4HIIA 2ZJSH 2OXGA 1F42A 3ZT5A 4KY1H 4OFYD 1BQSA 5GGUB 3EOBA 3VFVB 1ACYH 5ICXA 2KH2B 1DL7H 5C08A 2AK1H 4Y1AE 2X7LB 4L3AA 3UYPA 3LPWA 3WIIH 5DI8A 3OHXB 4K9EL 1Z9SA 3BJ91 5E2UL 2XKSA 1N7MH 4M4PA 5D7IA 1BF8A 2I25N 2O5YL 2EDTA 5SX4H 3VXNA 3VXRB 2JIXA 3RI5K 3T0AA 4EIZC 4HG4J 3QZWB 1A9EA 1NAMH 4QRRE 4O2CB 3P4LA 3A6CL 2V7HB 2B1AL 3KPOA 3GSQB 3S36L 4WV1A 4NQCA 3ULUL 3T2OA 3BHBB 3MRBA 1T21A 3H3BC 2W0KA 2ZWLT 4NNXB 1DSFH 1YJDC 4FNLH 1UXWA 3QISA 5SWSE 1R3IL 4OZIE 2DJ4A 1UWEH 4PJ9C 4TSAH 5INDA 5KVEH 1RZJL 3VG0H 1QBBA 3O2DA 3SKJL 4ESKA 1WTLA 2YA1A 5HGBB 4MD4A 2ERJB 2PYEE 3RWGB 2GJ6B 1U95B 2HFGL 1ZOXA 4J7RA 3RVWD 2IBZX 4GUPB 5I75B 1YEFH 2WBJB 3KYNA 3F6IA 1A6UL 2GJ6D 2Q76B 4RWYH 3GJFK 2X40A 1ZA6A 3NH7H 3FT2A 2WBWB 4NRZA 3KR3H 1CL7H 4N5ED 4PIRF 5DQJA 1RFDL 4AIXA 5AD0A 2LTQC 2AJVL 1FIGH 1XF5B 5F96L 3EYVB 5A2KH 2FD6L 2VDQL 3SJVA 2AEPH 1KB5L 3V4VL 2XYCA 1SYVA 1YMMB 3WFHA 5L2JB 5LGJA 5B39A 4Z7UB 5H35B 4FQ1L 4EBQH 4NQEA 1SYSB 4PJBA 1DEDA 4X6DA 2ZOKA 5SV3A 4NO0B 3GHBH 2DWDA 2OR8A 1YMMD 1OW0A 4PJXE 3D69A 4FQLL 5CJ5A 5HHOB 5MERA 4D0BA 5I0DA 2IH1B 4EUPG 1M4KA 1T4KA 2MKWA 1F4AA 3ZKQD 1DQLL 2OXHA 3AY4C 1FNGA 5HHOD 1A0QH 5I16A 5H37G 4B7LA 1I75A 4BSWA 4CNIA 2GAZB 3TO2A 3S3PA 1TCRA 4CDHA 3WYRA 4PLOB 5C0DB 1FNFA 5LXGH 1TJHL 3IFNL 1VFMA 3NFPB 1MREH 4C57C 2OCFD 4ZOAA 5E7BA 2QKIB 3I6GB 3H9SE 3PHQA 5TDOA 3P4MA 3TZVC 1AHWA 1IGTB 4PRIE 4PB0L 5KG9A 3C60A 4JZNB 3E1F1 3Q5TA 3S4SG 3BPLB 1DUYA 1B0WA 3CFEA 4RFNC 3P0VL 4YDIH 3N9GL 2J6EH 3BO8B 1JCKA 1HYRC 4DAGH 1RULH 4HCRL 3IF1B 3B2UD 1RIHL 1FC1A 3VXQB 1TJGL 3BPOC 3CUPB 1UH2A 2CDGB 2X1QA 2XQYG 2P8LA 4PGBA 4LMQE 1EFXB 5ADPH 3VGFA 3ZHLA 3H3PL 4FTVB 4M93C 1FG2B 5HYSA 5IBTH 4Z7OE 1PDKA 3T0VA 4BQCA 1YPZA 5F3BA 4NN5B 1DBML 5BS0A 4WGVB 3MBXH 4Q9BA 3IDGB 3AB0C 3ARUA 3O3DA 2BVPA 3FQNA 3RHWK 1OGTB 3IU3B 3WJLC 4TRPH 1ZEAH 4FFZL 3SOBH 2LVEA 3V4PL 5C7XH 2AP2A 1FVCB 1F3DH 3RDTA 1BFOB 5IB3A 2C1PB 3FN9A 4IDJH 1T2QH 5DD1L 1BLNA 2V2XB 2R2HA 1OAYH 5CEZH 1S5IH 1NPUA 3RWHB 4JRWA 2IPTL 4HK3J 3HE6C 4MLSA 3OB8A 1JPST 1JZ5A 1TTUA 1GH7A 3WFEL 2X05A 4JFFB 3ZT6A 4OGAD 3O8XC 4JJHA 4NM4L 1CG9A 3ESVF 3HB3D 1E4KA 1BFVH 4DN3L 4AEHH 3OBAA 2DQUL 1J87A 4AEFA 4JFFD 5F70A 4O4YL 1U8NA 1SY6L 4GMTL 1MRFL 3L3JA 5HI4D 5IMKA 1S9YB 3D0LA 4HUXB 5AWNL 1QLEL 4IDLA 4JFEA 4XVSH 1A6TB 2IBZY 5A16B 2AXFB 3Q0HA 1OARH 3H9ZA 4ZUSB 4AIZB 3A0OA 1CCZA 4W4OC 5EU3A 1FORL 1RY7B 4QY8B 1TZHB 4PG9A 4KTDL 4KXZH 4F37K 2F8OA 4JR9L 4LHQB 4EXKA 1MAML 3JZ7A 4LLQA 3RIFK 3MJ7B 1A7RL 1I8MB 1HDMA 4YE4L 5MI0B 3S35X 2VLMD 4Z7VE 1BX2A 2V9TA 4G42A 5AZEH 5JW4R 4AT6A 3QHTC 4NHUB 5KW9H 3BYTA 3GSRA 4LVEA 3F62A 1BQLH 4KUCF 2BNRD 5IF0A 4AL8H 2AKRB 3TH2T 2WMPA 4X7EC 2OJZH 2R56H 4XPGL 4L5FH 1QFOA 2KUTA 2BSRB 5GISH 1DBJH 2CDEB 2CXKA 2NY6C 1HH6A 5JR1L 4Y5VC 3ULUE 1I7UB 3HZYB 2WUCH 5E4EB 5D1ZA 4Z6AT 4FXKB 3H6JA 3B3IB 3QULA 1MWAA 5DVNA 4HX1A 4GSDH 4E42B 1J10A 4KZEL 2VAAB 1RUMH 2JJUA 3F58H 4L29A 3U0TB 3KPSA 4J3XA 5LVEA 4WWKC 3VI4E 5JW3H 3MRFB 2QADB 5HJ3A 1FAKT 1VADB 2BNRE 2DBLL 2EC9U 3WUWB 5D7SL 4PRAA 1MCIA 1RHHA 3O4LB 1BD2E 2VERN 4R2GC 1U8MB 1Q9LA 4BFEA 2VDKH 4S0SD 2VITB 1XIWC 1HHIB 3O4LD 1CFTA 3BAEH 4K7FB 4NZUH 5IB2B 4S1QH 2K9UA 5IW1B 1BM3L 4HAGA 3CDCA 2FDBP 1NC4D 1U9KA 3D39E 2VNCA 4X9GA 3SO5A 3LKOB 3WXVL 5C07E 1YECH 3UTTB 1U8QA 2EYTA 1N3NB 2KPNA 5LWYL 4YHYB 1FNSH 2HFEB 5SX5H 5E94B 2V7NA 3MUY1 4FQQB 3NCBB 3K7UA 5FCUL 2VC2H 4LOUD 2DDQL 5HDLA 2A73B 2WM0A 1KN4H 5GRVK 4XTRC 2CO7B 4ZS7L 1JV5B 4MNQE 3T2NL 2GTWB 3LKRB 1MFEH 1DFBH 5TDPA 5CP7B 2BOBB 3EFDL 3IFLH 4KZDL 4P2YA 5E6ZA 5DK0B 1NDGA 3SKOB 4X4ZA 2OTWA 2CIIB 1V05A 2CK0H 2O5XH 4N8CH 3O2DL 4R4BA 5J1SC 1KV3A 4G6ML 3VFSB 1F58H 1SJVA 4NQDB 2ICWI 2D7TH 2FX8L 1S78C 2F54A 3W39A 1AO7B 5F72S 4WEBL 4RIRA 3KS0H 4R0LC 1V3KA 4HK3N 3AS0A 1OAKL 1AO7D 5IV2A 2ZSVB 1IGYA 3WLWC 1S7RB 1RZGA 3CZJA 4DTGH 5E5MA 2R2BB 3HAEG 5DZOA 1K8DA 3MMEA 3ZE2F 1NBZA 2J8UF 3FRPG 3L5WB 3OKNB 5J12B 3QQ9C 1IAIH 1FVEA 1TETH 5FHAL 2DQTL 4EUPH 4EOWH 3LS5H 5C92A 3EJYC 5CZXD 4RQQB 3DX7A 1RIUL 1IE5A 3NZ8B 5CEYB 2RQ8A 1XCTB 3ARDB 5ITFB 5DJCB 4WHTA 2BC4B 4XGZB 4K3JH 4WCYH 4ODVH 2WWKT 4OCWH 4PTUB 4BZ1H 1U8IA 2R9HD 1W0WB 1NGZA 1E4XL 2DTMH 4DUVA 1CD9B 3UYOD 4K8RD 3ARBC 3LY6A 2W0LA 2R69H 5KVGH 3NBNA 1I9RL 4CJ0A 1MJUH 1Q9OB 1G9NC 2R29L 4LLWB 4Y4HD 4M9OA 3AMLA 5EC2A 1YEEH 4JFOA 3UX9B 5CKAA 5I18H 5GGVL 1J1OL 4OTXH 2C3WA 1KJ2A 4YDLB 4LVNB 3H0TA 3FAWA 2CR3A 1KGCD 5F1SA 4RAVA 1BJ8A 4LLYA 3NVQA 4U2YA 3ZSSA 3IXAA 5EOQL 2VDOH 4I5BA 2XOTA 3DROB 2P8MB 1QLRB 4MJ5A 3QDJA 2EE3A 4R3SB 4F9LC 4KKLC 4XMKL 3CK0H 1MCNA 4LVHB 3WEXA 3DRQA 4O00A 5FCSH 2ZCHL 3S9DB 4NM8L 1Y18B 1RZ7L 5J89A 3O3BA 4C4KO 2FEDC 4OKVB 1BVLB 4LSPH 1AD0A 3C5JB 4FG6C 4H0IA 5DZLA 1JUFA 1S3KH 5CJQH 1YN6B 2B0SH 2BCKA 2VLJE 1PG7H 1CXEA 4YHLH 4QHNB 1SMOA 2UYLA 2WINA 1OAUL 3FHAA 4HLJA 5DHVA 4WU7A 3U83A 2FBJL 2EDNA 4NO3A 4DGYL 5C09B 5I1CL 2R0LL 4P9HH 1MELA 1PAMA 1X5KA 4YNYA 4ALAH 1ZLUH 4UBDC 2V5SA 2VL4A 5C09D 2X42A 4CVZB 4N8VA 3U0PB 2VXTH 4M6ML 2R15A 2NW3B 1N0LA 5F3HB 3RJDA 1JGVL 3SKNB 1IGIL 4OZGE 3FN0L 4H20L 4XP1H 1BWWA 3V4UL 2F5AH 2HVKB 4Y5XA 1KYOK 5JORB 3GSXA 1DQDH 2WQRA 3PGFH 3QA3B 4CKVX 2IPKA 1HQRA 3W9EB 4QRSB 1NUDA 2JIXD 5ID0A 1KBGH 4UOW1 4P46B 4CN1A 3GSNH 3NIFF 3TA3B 4LKXB 5JQ6L 3G6AB 3WFBL 4GS7B 2QJDA 2VN4A 3PWVB 3MROB 4MQ7A 4L8BB 2OSLB 2EKSA 2DB8A 5IOPA 2ZCLL 1G7QB 4M1GL 2H2SD 1KELH 3KLSA 4PBWD 4M1CD 4GAJH 5C08E 4YK4B 5IM7B 1G9EA 1MFBL 3DVIA 4WI9A 3GO1L 5AZ2L 4BZ2L 3IJYB 4GAYB 3FB8A 1MJ7L 1U8KB 1KIQA 5D7IE 5T1KB 4HFWB 3RTQC 2XKUA 3BPCB 5T1KD 4NZJA 4C59B 2FJFB 4U1JB 1LO5A 1OD9A 1J11A 3ABZA 4QRPB 4NQCE 1WLHA 2ADIA 3ES6B 4JFYA 1NFDB 4GXUN 3DTXB 2MSPA 2AJXH 3DX9A 4QRPD 3SJVD 3STLA 5B4MC 2OBGA 1XZ0A 3KYOA 1UZ8A 4JZJC 5C6PB 3QI9B 2OK0H 4YUEH 3UTZB 5FOJA 5FGSA 3S37L 4JO3H 3ZE1E 1PY4A 1H8SA 4HMDA 5D1XA 5F1KC 2NZIA 4DFHA 4DK6A 1GZQB 4I3RH 1BREA 5EU6B 3JWDL 2XTJB 3MLYL 4NDMB 1CR9L 1INEL 2BVEA 2H6PA 4KKAD 5KSBA 2OLDA 3GHEH 4FXLA 2Q76A 3VRLF 5EU6D 2RFXB 1LEIB 2XTJD 3KNBA 4HFUL 3QUXA 4YHIB 1QO3A 1LO2L 1KFAL 4MMXC 2HJKB 2FGWH 12E8L 3ULVC 1ZHBA 3EYVA 4DFIA 3BEVB 2YPVH 5FUZH 4Z78A 4PJ9A 1GVIA 3QO0A 2DM2A 4BFGA 4NN6C 2UY6A 4GW5A 1YDPB 1A7PL 1BQUA 1F97A 2XPGA 1RK0B 1VGEH 2IBBA 3M8OL 2HKHH 4YWGL 5FV1L 2B5IB 5DEGA 4UT7L 3QNYB 4NPYB 4WW2C 2BHUA 2P43B 1S8DB 2PTVA 3LQMA 4Z95H 4XT1C 5D72L 4NQEE 4PJBE 4K55A 5BJTA 3MREB 4X6DE 3NCJL 4IIQB 2XZAL 1I9IL 3KDMB 2JKXA 1C08B 1IFHL 2EEBA 2WUBH 2LU4A 4N1CA 4WI7A 1OTUD 4KI5C 3Q6FA 2EH8L 2HFFA 2COQA 3FB5A 4KV5F 2PTUA 4Y8AA 1YC8A 4Z0BL 1AR2A 3V79C 4P4RB 3MJ9H 4LSRL 3LD8C 5DLML 1J18A 5E99L 4OAWA 4EDWH 3LDBC 4HIEB 3PWLB 1N59B 4QRTB 3TIEB 1S7WB 4KVCL 4N0UA 5DF0A 1FH5H 1PG7W 3M1BA 3AY4A 4ODXA 4WI8A 3V0AC 1INDH 1KPRB 3F5WB 5D93B 3UBXA 1YEHH 4RFEA 2CR6A 3OF6A 4YPGB 3BO8A 4J3TA 2BFVH 2FO1A 3RAJH 2AABL 1CVSC 3WNMA 4D9LL 3EYSH 3OZ9H 1G7MB 1GGCH 3QYCA 2EC8A 4KAQH 5EA0H 3CX2A 1ZV5A 1ZGLA 1H0DB 2EEDA 4MA8L 5I1HH 2CDGA 1WWBX 3EHBC 1OTSD 5GS0H 3HAEH 1G7HB 1PBYA 4XMPL 5D6DA 3WIFB 1LO3L 4ZTOH 2X9YA 2Y9RT 2FX7H 1QRNB 3S98A 3ZTNH 1VEMA 4GLRI 3GSUA 4NNYA 1BQHB 1ZS8A 4QXGL 5DJ6A 4MQXC 3HTLX 1QRND 3W2DL 5IFHH 2QLVB 1KCUL 2PKDA 1FL3B 3CPLA 1HKLH 1CDYA 1A6AA 1Z0NA 4L8SC 1MCCA 5BS0E 1OCWH 3FFCA 4ODSL 4PYHA 1FVCA 4BZYA 2JJWA 4OCSL 4JFED 5JZ7C 4LEXH 5ESAB 4YAQB 4ZOCA 2XFXB 2ZG1A 3TIDB 3OKKA 2VQ1B 3HC3L 3FRUB 3PL6C 3V5DB 5I2IB 2FJGB 4KRPC 3H9HB 1RJCA 2EZ0C 3OGCA 2FECI 5EBWB 3RWFB 2Z35A 1D5BB 5I71C 1ZT4A 3BGMA 3WJLA 3FHQA 3L6FB 4B0MM 1FPTH 4ZFOB 4KK9C 4XPHH 4I9WD 9CGTA 1WT5C 4WW1A 3BP5A 3JV4B 5CILH 1FYTA 1V7MH 4NUGL 3QWOB 1T03H 2IANA 3HE6A 5EORH 3P73B 3ROLB 1S7TA 1ES0B 3RVUC 1NDMA 5FYJH 3QH3B 3O6FB 1Q0XL 2G5BB 4JHZA 1AE6H 4LASL 1DLHB 1EBAA 3BJLA 3KHOA 3JWNC 3GJEA 4G8GA 4X6CF 4KRMB 1CLCA 2EYSB 1I3VA 1QYGH 4X5XB 1GHFL 3LHPH 5CSZA 2AK4B 3U7YL 4PJCF 1MNUL 4GRMB 1V7NH 3MR9A 1F6LL 1JN6A 2IG2L 4ODUA 5FF6B 3BZFB 3CX5K 1ZVHA 5JDSA 3KPSD 2AK4D 2VWEC 2GYSA 2P45B 2Z93B 1A2YA 1TQBB 3LEYL 1S9WB 1NCTA 5IQ7H 2J4WL 2PCPA 4D0DA 1ED3B 1A7NH 5B21A 1T1XB 3Q5OA 3BKCH 4P2QE 1AGBB 2FL5B 3MLSH 2AW2A 3OJMB 3ZLQC 3SE3C 5HYJA 4YXKH 4YR6A 1U6AH 3R1GH 3OPZH 1KN2L 2VAAA 5KSUB 4JVPA 5JQHC 1WZLA 3QEHA 4P23C 4XP5H 4LLUA 2A9NH 3FMGL 2QQKH 3CXHK 1FFOB 3WN5C 3Q1SH 2Y23A 4Y5VA 3NAAH 3WUWA 1FN4B 3O3EA 5CJBA 3UTSA 3B9KB 2AVGA 3S96A 1MFDH 4XB8A 1WK0A 3GSVB 4YDKH 4BSJA 4OCRH 4R26L 3RWDB 1P4LB 1JHTA 3JTTB 1D5IL 3F7PC 2PTTB 2MCPH 3MGOB 3O6MH 3TFKD 5M94B 1U8PA 4KDTA 4L8DA 4JHWH 3QDMB 1T66C 1QSFB 3UTTA 1D5XA 4XCCH 3SCMA 5IMLB 5IW6B 1LO4L 5E9DB 4OCYH 4PV9A 1Z2KA 3TH4T 5DRWA 1KEGH 4DCQB 1QSFD 3UJIL 1XIWA 5D1QA 5T1DL 4JFDB 2HJFB 3BP7A 2FCBA 5E8OA 5CIPA 2FIKB 5DRZA 2F54D 1KPUA 1FLTX 2A73A 3DVNA 3OJDB 2EXYD 4XCEA 4AEEA 3UO1L 4PY7B 4OLXL 1KCSL 4GW4A 5GIRB 3GI8L 3MCG1 5DK0A 1KIPA 1D3CA 2KL6A 2N4IA 1E6OL 4ORZC 1WEJH 1F90H 4U1MB 4HKJB 1JTPA 4LCUB 4YHZH 2YUWA 3BI9X 3D25A 4UDUB 5JA8B 4FQ2L 4UT6L 3VU2A 1HHKB 3OX8A 4FOMA 2F5BL 3U9UA 4H8WL 5GRVL 4R90L 5FYLL 1NBYB 2VMFA 2OTUB 4EXPX 5DMKB 4GG6F 2DLFL 4HS8H 1YN7A 2F54E 4U1KB 1CF8L 5I1KH 3ILPB 2EDFA 3EYQD 5JLZB 2YSSB 2QQQA 5JO5A 4ONOA 1P53A 4L4TB 5I8KL 2X10A 3IDUA 5F9WB 3Q6GL 3L7FA 4Z7QE 3GSWA 4IS6A 1MCRA 5DQ9B 1AC6A 3U1SH 5DD5L 3PGCA 4NJAL 4L4TD 5JNYB 1WUNT 3R06B 4R0LA 5CMAB 3HMWL 3IDMB 5SWZA 2IQ9L 4EI6B 1X6LA 3GKWL 1EAJA 1ORSB 4XXDA 2QSVA 1AXTL 2BC4A 2YD4A 4JO1L 4LCWA 3LIZL 3MLZL 5GXBB 3JUZA 3QUKB 1HOCB 5GGRY 4H25A 2DQCL 1EA9C 3V0WH 4F8QA 4MAYC 1UXSA 4G6JL 2HMID 3PWPE 4EN3C 4Q9RH 3L3GA 1F4HA 3WDIA 3N1QC 2GY5A 1E27B 1FE8H 1XH3B 4JO2H 5ETUB 5DXWA 4J1UB 2ATKB 2N1KA 3N1GC 5GRUH 1KLGB 1G7JB 1G7PB 2AXHA 4UT9H 1SBSH 4OSUH 2PYFB 1CGWA 5J4MA 2I9LA 4X80L 3ARBA 3D3VA 1LE5B 2E3VA 1KNOB 4R3SA 1A9BA 3LKNB 4G8FA 1J05B 3X12B 1GPOL 4RRPG 4WTXA 1B6UA 2BNQA 3ZL4L 5DWUL 5IG7A 5FKAA 5T1MB 3QDJE 2LAAA 4ZQKB 1CL7I 4F57H 2VAJA 3GEWB 2HTKC 2RCSL 1T1ZB 1I3RB 4U3CA 5GGRB 1J5OL 4HBQA 3VFOA 3P4OA 2CIKA 4GRWE 3ULVF 1MJ8L 4F9LA 5HD8D 2DIBA 2W9EH 3MRLB 2NW2A 1QSVA 4EVNB 3QDAA 1F4YH 5L9DH 4BSVB 4LSUL 3O81A 1DE4B 1WVZA 2R0WH 3QJFB 3FQWB 1S9VA 4XP4L 4YDJA 3T1WA 3X13A 3RY6C 5F93C 2NTFB 1QR1A 5CD3B 1F6AB 2YK1L 3MV8A 4OUOA 4NWTL 3HMXL 4U0QB 1P2CB 2NY2C 4G9FA 3G6JE 1XGUB 1YEGH 3ZO0A 3HI1A 1QLFB 2B1AH 5JHLL 3R8QA 4WI3A 3S36H 2VDPL 5BV7B 3U6RB 3ULUH 3BUYB 2HJLB 4DKFL 4GKSA 4KI5F 2J8UB 2HVKA 43C9B 3E6FB 3V6OC 1JWMA 1MQ8A 4OFIA 3MSPA 5C0CA 2ADFL 3X14A 3JVGC 4I2XB 5JMOC 3RWEA 3QFJB 2CH8A 3PHOB 4Q6IB 3OXSB 4XX1E 3CDGB 4RWHA 1INQB 1A7OL 2VXVL 4KRNA 3TJEL 1NFKA 3V0VB 3QFJD 4OCXH 1BZ9B 2VLLB 3SKJH 5IWLA 4IHOA 2I07A 2DWEA 2L0DA 4YX2H 1WICA 2HFGH 1DVFC 1KYOJ 1I1AC 1OGAB 1A6UH 3FONA 1LK2B 1LDPH 3PNWA 1BOGB 3IJYA 1PJ9A 1SBBA 4OF7A 2HTLC 3VXOB 5BMFH 4NBXB 1RFDH 2N7AA 3QUMA 1OGAD 2AJVH 2DYPB 3P9LB 5F96H 3RPKA 3NFSL 5IHUL 2FD6H 3W82A 3UPCA 3M45A 2NY3C 4NQUA 2D03L 4JFXA 3VXRE 1KB5H 1TVBA 5K93A 1KCLA 1H8OA 1NC2B 2DYPD 3GM8A 2X1WL 1JF5A 2V2TB 3NPSC 4O2FA 2X70A 4LU5H 4DKEL 1NC2D 1I8KB 4UTBL 5F88B 5TE6H 5L6YL 1K8IA 4FQLH 2Z91B 4G5ZL 5DTFB 1VACB 2NZ9C 4PJ9D 4JDVA 1KENL 1UM4H 5D9SB 3V52L 2R8SL 3QI9A 4TNVF 5IVXA 4LFHD 3G5XB 3B83A 1YYLH 5FO7B 2BNUA 3GMNA 4N0CC 2D0GA 4YXLH 4X99B 5TH2A 1BF2A 4M7JL 1DTUA 1NGXA 2Q6WA 2BSSB 2LTQB 3GRWH 4YEFA 4U1IB 1BBJB 3HZMB 1TJHH 1EVTC 4PRPA 2RFXA 5DD6A 2BVUA 2EDLA 3D18A 5LJYH 2W07A 4NHCL 3HI5L 4P99A 4JKPL 4P2RB 5FYLE 4X8JA 2BHZA 2XV6B 4X7CC 5KSBE 3BEVA 4S11A 4S10A 2FO4B 4JZJA 4JM4H 3VFTA 3WJJC 4NN7C 3ZHDA 2VDLL 3LZFL 1CGYA 4U2ZA 4DVBA 1YDPA 4KXZI 3F65A 3ZYOA 4ZO9A 2UY7A 3K1KC 5DFVC 4F7MA 1A6VL 3P0VH 3O4OB 3N9GH 5DSCB 1AQKL 2GJZA 4TUOB 3VW3H 2BX5A 1AI1H 4U6XB 2E7CA 1Q94B 2ZP0T 4EQ2A 4Z7UE 1S8DA 4K3GA 4KPHH 2HA1A 4LCCB 1KULA 4F8TA 1JBJA 5DS8B 4RGMB 4ZUTA 3MRDB 3LKQA 5T33H 1DQML 1BZ7A 4QYOB 3I3EA 4XI5C 2CLVA 2XKNA 3MRKA 3H3PH 1T5WB 5FA4A 2OQJB 2ESVB 4UINL 4NZDA 1X3DA 4D0CA 5HHQB 1OSPH 5INCA 2NPLX 3BISA 1DBMH 3Q3GA 3NCYP 4KDVA 2EIZA 3C8HA 2ESVD 4IOFD 5HGAA 4XPTL 3OAUL 4HS3B 4WW2A 5HHMB 4R8WL 2NR6C 3QUYC 5IBUB 3T3MF 5TQ2H 3D2UA 4KHTH 3RVXC 3JWOC 3TZVD 4C4KT 5F1IB 4HHAA 5DD1H 3TIEA 1K6QH 2CDFB 1T7VA 4UU9B 2IPTH 2NLJB 4OD3L 3F5WA 3WFEH 4WUUA 4X4YA 4OZFA 4N0UE 1MJJB 1MRCH 3LEXA 4YPGA 4PJFA 5B38A 3FFCD 4Q74A 3AM8C 2G75B 2Y25A 5DJ2B 4WTZG 1G7MA 4FZ8H 1SY6H 4GRLB 3BRFA 5C0GA 1MRFH 5IMOA 3HRZB 2E5EA 1QLEH 1IQDA 4PJ8C 4HKXB 2YZ8A 3ARSA 5E03A 2ICWB 1JGDB 3PIQA 3T4AB 1H5BA 1MIML 3SGDI 4J23A 3OKDA 1T1WB 4G8EB 4LARL 4NYLA 1RZKL 1RIVL 4K8RH 5LGHL 4FTVE 3CFCH 3BGFC 2H32H 4TVSa 1JRHL 3BN9C 5D8JL 5HHVH 2B7DT 3TYGL 1NLDH 1XF4A 1FYTD 1JZ8A 3ARVA 3O8XB 1I85A 2AQ1A 1AGFB 4O51B 2DM7A 2IAND 3HE6D 5T5NF 2XG5A 2HG5B 3G08A 1HHHB 5D7JC 4NKDB 4NQVA 5FKPA 3O8XD 3LN4B 3U30C 3RWFA 1PW3A 4ZTPH 5IFAH 5ADOL 5KVDH 1L0QA 4POUB 4XPGH 4LPWA 4HC1A 4ENEC 4G8GD 3O2WL 3CSYB 1QFPA 2QSCL 4CW1B 3DX8A 3UPAA 4JQIH 2PR4H 3MA9H 1NGQL 4MA1B 3S35L 5LAXA 3RWIA 3IAQA 3AGVA 4RGNE 2QSQA 4DEPC 1LHZA 2X4RA 3QWOA 5L2KD 2BJMH 2JK5B 5EUOA 3MLPA 1CD1A 2E6JA 1ES0A 1A5FL 3IDJB 4U1HA 4KZEH 2BRQA 3E6HA 1W8OA 3UJJH 2IANE 1M71B 4CVUA 5IESL 3B43A 3IXTB 4I0PC 1H3PL 5CGMA 2VO5A 2O61A 3NFNA 3ZDYF 3MYJB 1WT5A 2DQJL 3OKMA 3W0WA 1PZUB 5GGSB 2IWGA 5DC0A 5HYJD 3DMMB 4PP1C 5HPMA 3BN3B 1TTFA 1CZ8L 4L4VA 3L5IA 1IMHC 3I2CL 2R2EA 3GIVA 3MUGB 5DVMA 5DJAB 5IP4A 1WFTA 1ORQB 5FHBH 2WLZA 3EOYG 4S1RH 1IAII 3B6SA 1BM3H 4WO4B 4X4XA 3OKOB 4NRYA 1PQZA 3ISWA 4HXAH 3IETB 2NY6D 3KPTA 4ZAKB 4HDIB 5IB1B 1WFUA 4L8CB 1R24A 2JJVA 3UTSD 1S7UB 3HG1B 3WXVH 1PVHA 4DGVL 4G8IA 3PDOA 5E2TL 1A1NA 3RVTC 3ZKXB 4JQVC 1KC5H 3HI6H 5EO9A 3CX5J 1IL1B 4WWKD 3F7YB 1DDHA 4KDWA 4TUJB 3IKCB 3JV6B 4ZXBC 3RFZC 5FCUH 1T3FA 3SGEI 4OI8A 3OWEA 4NJ9H 2E9JA 1AXSA 4OGXL 4ZS7H 1IAOB 5CHNA 3T2NH 4QWWC 4R2GD 3EFDH 4KZDH 3B9KA 3HRPA 1K5NB 4JGMA 3MRCA 4P4KA 1B90A 2YEZA 4X7SH 1IEBB 3SE3A 3MJ6A 1EH9A 5DK2B 5HY9A 3MNWA 1P4LA 1LP9A 3WLBB 3T2PA 2ZNWA 1C1EL 4XB7A 5ALCH 4KQ4L 1OF2A 1WBXB 5I1JL 4D9RE 1EO8L 2ID5A 1GIGL 2KQNA 4HIXL 1ZTXL 1HSAB 2CMRH 5HHPB 2RHEA 3BZDA 3WN5A 4WEBH 3PQYB 1C5DB 4KTEH 1ITCA 5I1LB 3DGGB 5E9DA 4M7ZC 1OAKH 4WFGE 3FO9A 4UTAH 3UTTE 4WFFD 3F7RA 3GM0A 4A2MA 3EDEA 1KTLA 3IDIB 1VESA 3RUGF 1UH3A 1T1YA 4QHUB 4Z8FL 4BUGA 4LAQH 6FABL 1R5VB 5GZNC 4XTRD 5KS9F 2VKXA 2DQTH 4ODHL 4MNGB 4XPFL 2GK0B 4J3SA 4U6YA 1PX4A 1K2DB 4X6CB 3WNPA 4F7PB 4C58B 3UPRA 3NCEB 4PGCA 2MJWA 1F2XK 1U91A 4V2CB 2W91A 3SDXA 3SDDA 4Q97A 3TWCL 2UUDK 3QXDA 4Z76B 1RJZB 1S78D 4OD2A 4WY7H 5EZLA 5EBLA 3DUSB 3VFWB 3RZCC 2DLGA 4NQDE 3WXWH 3RBGA 4QGTA 3C9NB 5C3TA 1J1OH 4PY8J 1P6FA 1KB9K 1ZA3A 4ORGA 1WISA 3WLWD 4LCWD 1ZANH 3MCKA 1RHFA 4EIGB 4Z7NF 3GNML 4R96B 1NCDL 4ZSOB 3EFFB 5FIEA 2LV4A 3OKEB 4G6KH 5EOQH 5I8EA 2MTPA 2OR9L 1RJYA 3QEQB 3QQ9D 3N85H 5JPNB 5C0IA 1U42A 3FTGA 2YD8A 4OQ1A 3M17B 5CD5C 4HPYL 3EYUH 4XC3L 5IROC 1GJIA 4Z77B 3Q48A 4O5LL 1T83C 4LSVH 4HIHB 3MNVB 4PJDA 4UV7L 2GJJA 4XVJL 4NM8H 2MFNA 4HWZB 5C0EB 3LB6C 4IRJB 2D7OA 3K1DA 3P11L 4ELMA 5SWZE 1Q1JL 1U8LB 4JY6A 5DJ0B 5E56A 3TPUB 3N06B 4UAOB 4GBXC 3BW9B 5J11B 2Z9TA 1FFQA 3ZYIA 1N5AA 1NJ9B 4PREB 1GGTA 1PEZA 3EYFA 3QCVH 3GK8H 4IMLA 4GKZB 4JN2B 4JKLA 4KGLA 4O2EB 5CJ8A 3RWCA 1IC4H 5HVFB 3ELAT 1P7HL 2GSGA 4YIQB 4E5XB 1JPFB 2FEEL 3KPRA 5I1CH 2AJSH 2R0LH 1T0PB 3QXAB 2GFBB 1G7PA 4XCFH 3G6DL 4RAHA 3T0EB 1CT8B 2PYFA 3QEUA 5FGCB 3ZDZE 4LDEB 3DVGB 5C0RL 5E6IA 4KKLD 2VE6B 4CADB 4MD0B 1F4XL 1ZT1B 4MAYA 3JTSB 1KTDA 4NCC2 2HVJB 4H20H 4EN3A 5C2BL 2BRRH 3D3VE 1MCPL 1K4CB 2FEDD 2BNQE 1QA9A 5BZDB 5CLTA 2F53B 1I3RA 4FG6D 2VXSL 5GGRA 4RISH 4J3UA 5MEPA 1F4WH 1JMXA 1AD9B 1A6WL 1F00I 2VLRA 1UACL 1KJVA 4GW1B 3ARPA 3MRRB 4OLYL 4TUKH 5HDQL 3FB7A 3G5YA 4V1DB 3BVNB 2V2WA 2GKIA 1TZIB 2ICEB 4LPUA 4M1GH 4MD5B 4Q7DA 3U4EB 5J6HA 1ZMYA 2IC2A 2C5DC 5DHXB 5EWIL 2SEBA 4V1DD 1MFBH 3IFPA 3HPJA 5D6CB 3GO1H 2DQGH 3RUGA 3D85A 3BH8A 3CFJB 1CFNB 2ATPB 1IGCL 1MJ7H 1YC7A 4ZD3L 1YQ2A 2BSED 1QLFA 3TBWB 3MV8E 5C9JB 1MI5B 2W38A 4HC1L 1IEAB 4CN6A 3CSGA 4G9FE 1TVDA 4PJHF 3S5LB 3KYAA 1T6WA 1UB5A 3HE7C 4RAUA 4M62L 43C9A 4QRUB 1V3MA 2J8HA 4LGRB 1MI5D 3RPIA 3PABA 2CLRB 2R1WB 1L6ZA 3DRTB 3RY6A 4Q6IA 1WC7A 4XCYB 5A2FA 1MWAH 5DEFA 4R4ND 5C0CE 4Y4KC 1MCJA 1T04A 1OAXL 4EDXB 1MSPA 2OL3A 2VLLA 5AAMA 4NSKA 3WS3B 4CMMA 5C0FB 1EAPB 2X09A 3LSOB 2C3VB 3GBLA 3FO2B 5EN2A 3ECBA 3R4DA 1INEH 4BKLA 4BM7A 4N90D 1JF1B 1T22A 3EO0B 4MJ4A 3JVGA 2C7UA 4HFUH 1MIEL 1VFUA 3VXOA 4HEPG 3RTQD 1SJEB 4X5WB 1CFQA 4H1LA 4K23L 2B2XL 5LGKA 3L9RA 4HUUB 5DRNA 2NX5B 5GGQL 3KPQB 3GB7A 3QO1A 4C83A 4HZLA 4K3HA 4N9GB 2BOCB 4LFHG 5DJDA 1DVFA 3HCVA 2PO6C 3EJJX 5GRZA 1A4KB 1EUTA 3VXMA 1FQ9C 4L9LC 1UYWH 3TT3L 1P4IL 2YRZA 1MHCA 1J0YA 5B4MD 3R0NA 4L3EB 3TNNB 3KLAB 5D9SA 4F9PA 4JPVL 3X3GL 1GAFH 1QZ1A 1GOFA 1WZMA 3G5XA 3BEWA 1Z5LA 1L9MA 2EH8H 1T6VN 3GMLB 3QHFL 4L3ED 1Z3GL 4X99A 4A6YH 2FBOJ 3S3SA 3QIWC 5E2WH 2IFFH 5ANMB 3H42H 4F33B 1WZKA 5DLMH 2F74B 5E99H 4QF1A 2I24N 4G80A 2DLEA 2MPAL 3S88H 4LKCA 3O3AB 4OT1L 3VH8A 1CFSB 3ULVD 1JPGA 4KK5D 3B5TA 5F6IC 3QG7L 5GSVB 4PRPE 1AQDB 1R5IB 3CLFH 2X89D 3O45A 2ED9A 2ITCA 4JRYB 3LQAC 1JE6A 1CD0A 4P2OB 1I1YA 3KWWA 4G7YH 2GIYA 4F2MB 5DSCA 2B4CC 1MVUA 1UB6B 2AEQH 5DK3A 1HEZA 3LRSB 5TE7H 5I0ZA 2A6IA 3K8KA 4JRYD 4D9LH 1PYWB 3CVHA 3D2UD 3FQUA 2AV7A 3MRDA 2RAMA 1CI5A 3NOIA 4XMPH 1WAAE 3N1FC 4OLUL 4PUBL 3INUH 4KI5D 4Y16C 4OJFL 1CXFA 2P7TA 4ZODA 3QXWA 3WJJA 4WHYG 4QXGH 3TN0C 3H8NA 2MQ3A 3LKSB 3K2UL 2CQVA 3VGEA 3QG6B 1KCUH 2HLAA 4HWEL 3I75A 3OR6A 1LK3L 2FJHB 4OCSH 2APWA 5FM5M 1XF2B 5EO0A 4Y4FC 3LEVL 3W11C 4OUUB 2AGJL 3HC3H 3VFPB 2YPKA 3CZFA 1NMAL 3A6BL 3QQ4B 3BH9B 4HPOH 1AJ7H 1D7FA 2DQHH 5A3IC 5D5MF 1CIUA 4K9EC 4Q0XL 2YPLA 4PGJA 2DQFB 4WUUE 5DJ2A 1L0YA 1EPFA 1D9KC 2OR7A 3C5SB 1GOHA 3DNKA 4BH8B 3CMOH 3QUYA 2XG4A 4PJFE 1KJ2H 3HZKA 5IEHA 3E8UL 1I9JH 4Z5RB 5IGXH 2XRAL 3GIZH 4IJ3C 1U36A 4WNQA 4E0RA 5CBEA 3CFKB 4RBPK 4DN4H 4L8SB 1AGEB 2AEIT 2JCCF 4MQXD 2E9BA 5D2NB 1NGWB 1NCAL 2DI8A 3LH2H 4PJEF 2M2DA 1IAKA 2YWZA 3BP4B 1Q0XH 1AXIB 1UJ3B 4W70A 1FZJB 1RZ8B 3AM8A 1UCBL 3QUZC 5IW3A 4LASH 1LNUB 1XCQA 5JZ7D 1S7SB 5K59E 3IVKB 2A6KB 4JG1L 4PJ8A 5DMGC 1GHFH 3P2TA 4EQ3A 4ZPVB 3U7YH 4GRWH 4ISVB 3PL6D 4M61A 1HHHA 4KMTL 1RZJC 4KRPD 4YBQC 15C8L 5J1AB 4UUJB 1KEMH 1MCOL 2FLRT 3T65A 4HK0B 4X6FB 2YA2A 3U4BL 1G6RA 3TF7C 1EHAA 4FZEH 3FB6B 3WKNA 4D3CL 1NAMB 4KK9D 1ZHKA 2J4WH 4OZHA 5DHVH 4JREB 3MOBL 2JLLA 4F58L 2FWOB 5L7XL 3VJ6B 2KZ1B 4Y2DC 1UT9A 5HI5C 4QGYA 5EPMA 1QTYT 5JW5B 1R3HA 1UA6L 2BSTA 3RVUD 2VQUA 1S5HA 5D7JA 3SE8H 5I30L 4OV5B 5DA4A 1Q9KB 1XGQB 1TCMA 5I1GH 4X6BA 1HILB 3H7BA 3FKUS 4XHJC 5EUOE 3QDHA 3IXTA 1G9ML 4JM2A 2GCYA 1EEUA 3FMGH 3I02A 4ZUWA 4PRHB 4QXTA 5T3ZL 2H41A 3DMMA 2VDRH 1IJ9A 1A02N 2P44B 1ADQA 3W0WE 3DX6A 1QSEA 3AAZB 3JSSA 1A4JA 5B3NA 4MSWA 3RA7L 1PGRB 4L4VE 4ZYKA 4WO4A 4RX4A 3D9AL 3IETA 1MUJB 4HDIA 4K07A 3WFCL 1J0IA 1F3JA 5E24E 4P57B 5BV7H 2VXUL 4IOIB 1RJLB 3L3HB 3MZTA 2ZG3A 2H26B 3MBEA 4AM0A 2L7UA 2X4UA 3KG5A 1SEBB 2FNBA 3T08A 4YDVA 3MCLL 5FOBB 5D7LA 5ISZB 5T1DH 3BWUC 1FNEA 2GITB 5J13B 1D6EA 2K7PA 3IKCA 4P23D 2Z8WC 3RY5A 4U1NB 4FMKA 1M05B 1P69B 4X7TB 2DQDL 5ISZD 1FVDB 3QWQB 2HH0H 4OLWH 2V17H 2OZ4A 3RNKB 1NCBH 3KPLB 4Y5YC 4IMKA 3TBTA 5E8PA 3UO1H 3LN9A 4OLXH 1KCSH 5IK3B 1OWWA 3QDGB 5FDYA 2EEAA 4XMLH 1VFOA 1U8JB 5FO8B 1E6OH 2W0PA 2YC1A 3WLBA 4JQVA 1XR8B 4HGKC 4POZC 1AY1L 5E8DH 2OL3L 3V6ZB 4D8PA 4F37F 2DQIL 2IEPA 4TTDC 3T2QA 2XIDA 2AJUL 4UT6H 4TQEL 4XBGB 5TFSH 4XP9L 4ZXBA 5B3JE 3B5HA 3UTPE 3TO4C 1DQQB 1DBKL 3H7LA 5JIPA 5EBMA 4H8WH 2A9MH 2G2RA 4R90H 1ONQA 4YBLC 4R97B 4OGYL 4IOSD 1YJDH 1FO0A 4OFPA 2G9HA 3AREA 4MDJA 4RZCA 3GFUA 3QDME 3B2VH 4PV8A 1CF8H 5HYIA 3VXPB 1VGKB 4ZNCD 3B9DA 4RDQF 1R3JA 5F7YC 5E9DE 4JHBA 5I8KH 4JCMA 4UIMA 3MV7B 1X5FA 5D71L 1JF6A 4W4NA 3GMOA 3G5VA 3G5ZA 3T4YA 5C1MB 4EI5B 4JFDE 4GMSL 1HQ4B 3BE1L 5HGDB 4NJAH 2ZSWB 5BQ7A 3MV7D 4TSBL 4U6HA 1K4DB 4OQTA 5E4IA 3SDAC 2CLZA 3MLVL 3BQUB 1GSMA 3HMWH 3MXVH 1OP9A 1I7ZB 3QNXA 4UB0H 3GKWH 1MQKH 4FXGB 3BSZL 1AXTH 2EIEA 4JFPB 4JO1H 4M6AA 2K3TA 4ZFGL 4OV6F 5I17B 3HFML 1Q9WA 2DMKA 1OVZA 1A6ZB 1BVKB 1UENA 2BXZA 5DJZB 2KQMA 5IB5A 1NBVH 1XF1A 3SDXE 1XGPA 5EC1A 2CUMA 4NUJA 1J1PL 4P2CG 4U31A 4MJ6B 4G6JH 1MHHA 4GXVH 2DI9A 4P59H 2IAMB 5DDHB 5FYKD 1Z9LA 2UUDH 5CEZD 1PKQA 5F7WC 3IJHB 1YYML 4AH2A 1N8ZA 1A6PA 5C0BB 1XR9A 2DKMA 2VJXA 4J8RA 4TVPL 4CAGA 1D5MB 1ZGLP 2A83A 2H1PH 5T3XD 4OBSA 5KSAC 1VSCA 4P5MB 4G7VH 4F7TA 5MEOB 4FFVC 3D0VA 3IDXL 2AJZA 4RNRB 4I48B 2E9IA 3OAYK 2C3GA 1W0VA 4KRLB 4QTIL 4PJXF 2AAVA 3RZCA 4PLKD 3CVHL 4QOKA 1FCGA 3KPRD 3ZL4H 5DWUH 3MACL 3I9GL 1J8HB 1O0VA 3RWJB 4WHYH 1MCLA 2VZTA 1TVHB 5ALBH 2CJUL 3QFDA 4U1LB 3ROOA 4PJDE