1J7VR

Human il-10 / il-10r1 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-10
publication title Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 35
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR01
4GKSB 2VXSH 3KPSE 3K80A 3QIBA 5CEXA 1F4HA 4F58L 4XVTL 4ZUVA 4MWFB 5CJ8A 1AR1C 1KF9B 3LVEA 2PXYB 1MLBA 3AREA 4G43B 4Q6YA 1JPGA 1R5VA 5KZCB 4S11A 4J6RL 3M07A 1I9IL 3GBMH 4Q9CA 5J6HA 1NBVH 1YEGL 3GMOA 1ZA6A 4J3SA 3TVMC 1N3NB 2DDQL 4WHYH 4CNIB 3X14B 4NBYB 1IAOB 1IGYA 4Y88A 3O2DL 2PYEB 4P9HH 5DMKA 4JQXA 2ARJA 4NO0B 4Y19B 1CTNA 2YPVL 1KT2B 5BXFA 4LHUA 4KV5F 2JCCF 3J7HA 3AMLA 4EXPX 5DEGA 3TBTB 4WJ5A 4M6ML 4K7FB 3MMEA 2P45B 1REIA 4GOSA 4U1HB 2A9MH 2AAVA 5DXWA 3O6KH 3MLZL 4XC1L 4LARH 1OP5H 4HIHB 1KJ2A 2F5BL 4P48A 1B90A 4FQCH 3THML 3GHEL 4TQEH 4D94A 2A1WL 1QSFD 2Y6SD 5L6YH 2G5RA 1CD1B 1HSAB 3MA9L 3O8XD 4JY5L 1YEKH 4HFWA 1LO2L 2EDKA 4MJ4A 1R3KA 5EU6A 5DHVH 5EU7E 3OJ2C 5JO5B 4BZ2H 3ZKSD 4ZDHA 4IOSD 1VFAB 4K71B 4YHIB 2YEZA 1T22A 4M62H 1CZ8H 4DVBB 2Z9TA 3TIEA 3Q5OA 1C16A 4PJGE 5BW7A 4F37F 4YBLC 2NY1B 5LWYH 1C5CH 5TE6L 1XF4B 3HI6H 1JWMA 3OX8B 5E9DD 3JWDH 3EFDL 5E6IC 4P9HC 3X3FH 1H8NA 1J0IA 3T0EB 4YJZL 4U1IB 4TVPE 1GPOL 3RGVD 1JZ3A 5CJXC 4QYOA 4UMGA 5FECB 4ENEC 4G42B 3CX5K 1JTOA 3D3VE 5DTFA 1PG7X 1UWGL 3LB6C 3PWUB 2J6EL 5TFSH 5D2LA 3ZKMD 1XGYL 1M7DB 1KC5L 5IROA 1FQ9C 2C7UB 3MCLH 2Y07H 1BF2A 1BD2B 1I85A 2XOTA 2BNRB 3VRIB 3PIQA 1EH9A 4PRPE 5EOCJ 2P42B 2X89A 3B2UD 1A4JB 4H88L 5L8KB 2OK0L 3GNMH 4NFCA 4P46A 3H3KA 3MODH 3QI9C 3VFVA 3E6HA 1MQKL 1CL7I 1URLA 1YECL 4LLMB 4U3HA 3SGEH 1GZPA 3H9SE 2HFGH 2X44D 3CXHK 2DI8A 3QFDA 4FTVB 3UP1A 3O6ML 3O6LL 1OLLA 3GMLB 3MGTA 5DVMA 5FB8A 5DSCA 2Z93A 4P59L 1XGTB 2C3WA 1B3JA 3BKYL 1FC1A 3PQYA 1HQ4A 5F88B 3RDTB 5D7LD 3NVQA 1A7OL 4JANA 2SEBB 4W6XB 3N9GH 5J0BA 3ARQA 4NFDA 5F9WB 4BH7B 4PY7A 3BH9B 4POZC 4IM8A 4FQQA 4ODXA 3IU3A 4DUWA 5KOVC 4YHMH 4KJPD 4LNRB 5I1LB 3JWDC 1TZGL 1QLRB 1WJ3A 4JPKH 5EZIL 4ORGA 3DRQA 3U0WH 4K8RD 2VZSA 4G80B 4OGYH 2MNUA 3ARBB 1JYWA 3MV9E 2AK4D 4WFFD 2NXYB 3EYUH 4NUGH 4ODWB 5TDPB 2GYSA 1FYTA 5C7XH 1VADB 1HHJA 3BQUB 5K33A 1EHLL 1AGBA 2EH8L 4JZNA 4PJFF 4ZUUA 4RA0C 2I9LA 4MYWB 5H2BA 2ZUWA 2IQAA 4YXKL 1MWAL 4IDJL 5HPOA 4HH8A 3NCJH 4EI5C 4JPVL 1J8KA 3RVVC 3AB0C 3W9EB 2XYCA 3TH3T 3IAGC 5D2NC 4NQTA 3NZHH 4OZIF 2X9XA 5B38G 1NEZB 2H9GB 4JVPA 4NKOA 5C2UB 3PHQA 4QRPD 2KH2B 3A6BH 1TJGL 2Q7YA 2YPKB 3HR5A 4MX7A 4OTXL 2FBJL 2RQ8A 2PTTA 4WI2A 5GRJH 5IEKB 1N5YH 1HYSC 3R1GH 3C60C 4RFEB 4C56B 1NGPL 3ZE0E 5EOCL 3MFGB 2LFGA 4O9HL 3KPSB 4KZDH 2NW2B 4MAYB 3E8UH 2I9TB 2IADB 5TF0A 3ROLA 5I1JL 4ZFOA 5IIEA 5HDOA 1A4KA 4RBPH 1HCFX 1MVFA 4S1SL 5EO1B 1RZGA 3B9DA 4KY1H 3HFMH 3CUPA 4MNGA 4JVWA 5KJRL 2R0KL 1TCMA 4R9HA 4PGJA 3FONA 4NWTL 4O58L 5K9OB 4Q2ZA 4C59B 4LIQL 3LN9A 3NFNB 3TNNB 5HI5D 2XWBB 4NQXA 2XFXA 1EEZB 2NNAA 4NJAH 2X5PA 4PIRF 4X6FA 2FZ3B 2Q3AA 4KKLD 4LLAA 5IVXA 4F57H 5LXGL 4WO4B 3AY4A 4ODSH 1FO0B 2E6PA 4OKVA 5C08A 1DQML 5JW4R 1EERB 3TBVA 3QIWB 2VSCA 5E2VH 1JN6B 3MFFA 4RGMB 2PCPA 5I16A 2PO6B 4PJ8A 1Y6KR 2XWJB 12E8H 1IGJA 1LO3L 4XPGH 3A67L 3ARDD 1OPGH 4L3CA 2VLJA 2APTA 4PJIA 4PJXF 4HUWA 1AGDA 1KIRB 1CXEA 3H0TA 3AM8A 3UTOA 4WI8A 5L88H 1HKLL 3P77B 3ZZ1A 4DN4H 5DD0L 4WTWA 3BPNB 2R2HB 1YQ2A 2GJ6B 1B2WH 5HVHB 2F53D 2ICES 4UB0L 4CVXA 1RJLA 4RGOH 1V7ML 2NMSA 3IAQA 1HYRC 2IGFL 2KPNA 1GGCL 3GM8A 1KPRA 1CBVL 1KACB 1V3MA 1HSBA 3OF6D 5E2WH 3WHXA 3BZEA 3RNKB 3RL1A 1EHNA 1BPVA 2DLTA 1U95B 2YN3A 5DT1H 3R06A 2GJZB 2YD3A 3QUZB 1M6OA 1E4WH 2R9HC 1KN4L 1JHKH 3KPLB 2JIXA 1DBKH 1MCLA 3K2MC 4KQ4L 1A9EA 1LD9A 5BRZB 1AE6H 1MF2H 1F4YL 3B5GA 1S7XB 2V9TA 4R97B 4QRQB 3HE6D 1ZLSH 4KHTH 3WIIH 5JHDA 3D3VB 5GJTL 4LQFL 1PGRB 1P2CB 4UNVA 4ZAKB 3VI3F 2XG4A 2B7DT 3G5VB 4X0KA 1R5WA 3BRFA 1IT9L 3PQYE 3MQIA 1D5BB 2PXYC 1T6WA 4NQEE 5JMRA 3QPQC 3MRHA 5JOPD 1A14H 3E2HB 5DYOB 3MV7D 4PS4H 2F15A 3U0PA 1BREA 1E28A 1YEDB 4ZUWA 1VSCA 2VLME 3DXAD 3EYFB 4NHCL 5ITBH 5EU5B 4MLSA 1XMWA 1NEUA 4XX1G 1Q9KB 5MEOA 1CDJA 4X7EC 2A6KA 2JB6A 2FB4H 3PWJA 4XNMA 3MV8D 4Z0XB 1Z9SA 3MRQB 3ZE1F 2ADFH 3BAEL 1ZHBB 1E4KC 1CXHA 2WWKO 2VL4A 4NRYB 5CJBA 4HUUB 1NCAL 3I9GH 3FB5B 5DRXB 3D0VA 5F7EH 3BZDA 1YMMB 5DRWB 5FKPA 3GSVB 5C0CD 1T0NB 2BSTA 4XPBH 1S7SB 1EJ6A 5D1ZB 1T1ZA 5FO7A 3I85A 2ZJSL 4PGBB 1FVDB 3HUJF 3CSBA 5DEFA 2ADGA 3ARYA 3VRJB 4I1NB 3ARRA 1ZWIA 4JDTL 2PW2A 1MY7A 4QXGH 3TYGL 4XWGH 5HVFB 5A40E 1NC4D 2GTWB 5GRXG 4WDIB 1NBZB 1HDMA 3KVQA 3L3OA 4G8IB 2J8UF 3C87A 3EYOA 4AT6A 3MV9B 5C9KA 4K71C 4KTEH 5IK3A 4KROD 2ICEB 2G5BB 4E5XB 3DO7B 2XTLA 3MXVH 2JB5L 3JTTA 2OXHA 1DL7H 3VGGA 3CH1B 2HTKC 2NR6D 4OF6A 4U1MA 3QIBB 1B6UA 2NW3A 2DJSA 2NY1C 2Q8BH 1QRNB 5I8OL 2DKSA 3LV3B 4KJQC 2X4UB 4I18B 1ZVHA 3AREB 1QEWA 1DQLH 3TV3L 3CK0H 4J3XA 3LPWA 2OXGA 3T0EC 1DLFH 2EDTA 1OTSD 2QHLA 3CSPA 5HDLA 4MNGE 4OGAD 5EUOF 4YX2H 4GG6A 1MOEA 4BK4A 3SN6N 5DMKB 1G7MA 1X6NA 1KB5A 5IBTH 4LPTA 4LHQB 3MLYH 5JUEL 5BXFB 1HEZB 3DX8A 4KK8C 5DEGB 5ETUA 1JGUH 4WJ5B 3MRLA 3MMEB 3DI2B 5GS0D 3LRGA 1D6VH 1HIML 3QNZB 3U7WL 5C1MB 4LGSB 1MQ8A 1H3WM 5IVXE 2DD8L 4R26L 3TT1H 5C08E 3F5WB 3MOAL 1IQWH 3O6FA 4YAQA 4O2CA 5T33H 5GRWA 5DHYB 4RGND 3TGXA 1NCUA 4ETYA 1KTRL 2BDNL 2DWEB 1IAIL 1AGCA 4PGEA 1G7PB 2RJMA 4PJCF 2F5AH 2YUWA 2R0WH 3MUZ1 5ITFB 5KS9A 2HKHH 2VLJE 2MHAB 3Q48A 4PJIE 1HH9A 5DJYA 2C3XA 1H15B 4RX4D 1E4XI 1LGVA 2WANA 3F6IA 4LCCB 1CDIA 4KJWC 4UUJA 2W0FB 4N0FA 5DDHB 4WW1A 4DK6A 2YK1L 3MLSL 3MBEB 4ZDHB 1IQDA 3MROB 1R5IA 4BM7A 3RDTC 3CDGB 1KPVB 3K8LA 1FIGH 4KXZH 2YEZB 3V0WL 5F9WC 4Z7NE 4LLYA 1W0VA 4AL8L 4FFYL 5E8DL 3INUH 4K8RL 2VABA 4JCMA 1D5MA 5E5MB 4LDLB 4MDIA 4LLDA 1MRCL 3BWAA 4MJID 1JWMB 2EYRA 3MBXH 3ARBC 3MRRA 4HSQA 4W6WB 4B7IA 4EQ3A 1YEFL 4TSCH 1S9VA 2NXYC 2P8LA 4NOBA 1NANI 4LEXL 4APQA 2IEPA 2HTLD 1UWEL 3QDJA 3BQUC 1JWUA 4R7NA 5JHDE 4UT6H 1X5IA 2UUDK 5DTFB 3NABH 3CFCH 1NGZA 2FBOJ 3BKJL 3GSQB 3RVXD 1GSMA 3CX2A 3OXSB 2GK0B 1S8DA 1TQBB 5C6TH 4ONGH 1FE8L 4WV1A 4M7JL 4G9FD 4NO5A 1FO0H 5GGSY 1FFPA 2EKJA 2BFVH 4BFBD 5EU3B 2NY2D 3PIQB 1Q9WA 1ZHKA 3PDGA 1KN2L 1KCSH 1NFDB 1OAUH 2VXQH 1MCHA 3WUWG 3RI5K 1S5IL 2OCFD 3UCRA 4NQDD 4IOFC 3W11C 2I26N 4YK4B 5J4MA 3P11H 5EIQA 5DA4A 3E6HB 2H26A 2YWYA 3I75B 1GZPB 2R4RL 3QFDB 4KAQL 4OQ1A 3D0LA 4OLXH 2PETA 3BRGC 5FYKE 4MAYC 4XAWL 1JZ7A 4JRXD 3DLQR 2RCSL 3OAZK 3PQYB 5EBMA 1HQ4B 1QR4A 2AI0L 4NQEB 4QY8B 4BQ6A 3QH3B 2VDQL 3RJDA 5EPMB 5CJOL 1YMHB 4FQQB 4MCZB 4ODXB 32C2A 5J56B 5HJ3A 4XI5C 3NAAL 1A7QL 4JFXA 4NZUH 1MH5A 1U8MB 1RZIB 3DTXA 3NA4A 4KK5D 1JPFB 1F6AA 3Q2CA 1T1XA 1FPTL 1T20A 3BKCL 4XVJH 1WFTA 4WY7L 4HS3A 5CINH 4XMLL 2YD1A 4ODVH 5DR5H 5LBSL 4W4OA 2R1XA 1A7NH 4OLEA 3BP7A 4XXCC 1DVFD 2CIKB 4L3ED 4RQQA 4ZUUB 4JZNB 4WO4C 3IFLH 4GRLB 3QIWC 2H32A 4OLUL 4ZS6D 3RX7A 5FDWA 4RGMC 4UT7L 4LFHD 2PO6C 5BV7L 5IFJB 1TETH 2QSTA 4KRMB 4PJ7F 1CICD 1T83C 3MJ6A 3P30H 3HMXA 4YHZH 4M6OH 3MA7A 1G0DA 2Q86A 4OBRA 1KCUL 1OAYL 2HN7B 4HUXB 1FORH 4EDWH 2Y7QA 4CDGC 1AI1H 2ZP0T 3LQMA 4LAJH 3BPNC 5EU7C 3SKJH 2XXMB 1SY6H 5HVHC 4QEGA 4KMLB 4YXLH 4OQTA 1UH3A 2PTTB 1XGQB 1HOCA 2HJKA 3I6LD 1AO7A 4DOHE 3SJVD 3FOLA 1M4KA 2EEBA 3QHFL 3WLWD 5AUMA 3QUZC 2VDKL 3B8SA 2JK5A 1A1MA 3DYPA 2XI9A 4ZFOB 1MJJA 1QLEH 3EO0A 5SWSA 1RJCA 1ADQA 5IIEB 1Z9LA 1VCAA 3O2WH 2IQ9L 4OB5L 1U8NA 5SWZA 3QZWB 4Z76B 4U2ZA 5J1SC 1DN0B 1A21A 5C6PB 4OCNC 3NCBB 5KS9E 1RZGB 1OAQL 5T3XD 4R2GB 5EC1B 4R97C 3CUPB 4ALAL 1D5ZB 3CVHB 1INEL 3WFDL 1WZ1L 4N0CC 1N0XH 1Z0NA 4M93B 3D1MC 4TUOA 3UJIH 4PJ9A 1B6DA 5FKAA 1Y6MR 4ZAKC 1BWMA 1Q94A 3D18A 3MOBL 4EN3A 3NCEB 1KG0A 4JFPB 1UM5L 3E2HC 1UGNA 2DYPA 5FA3A 4ETQB 4X5WB 5TF1H 2AW2A 4NYLA 1LK2B 4BSWA 4FA8A 2VC2H 2VLKA 5IVXB 3TJHD 4HK0B 2ADJB 1FGNH 1UT9A 2A9NL 4OKVB 3FAXA 3BD5A 1XR9A 4OZGF 3MFFB 2MQ0A 2Y5EA 1F4XL 4G8EA 5I16B 2MQ3A 1YJDH 5CKGA 2VLJB 3FCTA 3V5HA 2JELH 4PJIB 4HUWB 1AGDB 4IBLT 3H0TB 1CGVA 3QDJE 1JUFA 4LLVB 2DQDH 1WAAF 1T66C 3D39D 2G60L 1OW0C 4M5YL 1GOGA 3QG7L 2K7QA 5CZXD 4CVXB 5IGXL 4XMKH 1RJLB 1AD0A 1KPRB 4WHYG 1A1NA 3RPIB 3BZEB 4ODBD 1JV5B 3RL1B 3U46A 5C0AE 1F45A 2ZUXA 5IT2H 4PTTA 4WWKB 1M6OB 3WS6C 4J3WA 5HPMA 1TZIA 1HWHB 3QNXB 4JM2B 3RVTC 2EEAA 2JIXB 4YIQA 1T1YB 3P4MB 4ZOCA 1DZBA 1CF8H 1FN4A 3IRZA 2W0LA 2IALB 3K74B 2ENSA 1VEMA 3HNVH 3TBWA 5KSBA 1CE6A 2GW5A 2CO6B 1W0WB 4MQ7B 3KHOA 2Z31D 4F33B 3FB7A 4HPOH 2YMXL 5JHDB 4AEHL 3QIBC 5IFHH 1GGUA 5HHVH 4AH2B 2FHFA 4X0KB 5C70A 5F21B 3P9LA 2UZIH 3ARSA 5ESAB 5GRUH 4V1DA 2DQJH 4I18C 3AREC 3RVUC 5JPMB 4TRPL 1BP3B 3MRHB 4K55A 1EX0A 3LKPA 3C2AL 5KANI 2WIIB 3VXMA 1OAKH 4H20L 3VH8A 3VGDA 4ZUWB 4GT7A 5FYLE 4ZNCD 1YJDC 2MCPL 4OCWL 2JB6B 4M9PA 3PWJB 4PYGA 3TT3L 5F1SA 4RMRA 3SE9L 5GS0L 4FQXB 5HHXH 3QWQB 2NTFA 5IB1A 1T5XA 4BFGA 3SKMA 1ED3A 1QSVA 3UBXI 3E0GA 5K93A 2FLRT 4LASL 3BYYA 4PJ5A 3G5YB 3SE8H 2YPLD 2CLZA 5FKPB 1CDCA 3GSOB 3DV6A 5IB3A 4LSTH 1T1ZB 3F58L 5MENB 4Z78A 4R7DB 2EXYC 3DRTA 1OB1A 2ADGB 4ODHH 5BO1H 4WW2A 3C5SA 2CRYA 1NLBH 3FO0L 1F3RB 4WUUA 4X83A 5D9SA 3UZQA 1UFUA 1ZWIB 4JO1L 5EO9A 2PW2B 5GGVL 1MHCB 3CXDH 4LCCC 2D9QB 4QXWA 3F12A 5DMIL 2D7TL 1XCTB 3L3OB 3PGFL 3SGEI 3MBEC 4LDOB 4JDVA 1IM3B 1FVCA 2CUMA 5IK3B 3I84A 3V7MA 1AO7E 3KJ4B 1HNGA 3STBA 4MA8H 4JRYD 2HRPH 1DSFH 3BEWA 3JTTB 3N1MC 2Y06H 3IDJA 3IAPA 4Y1AB 3ZTNL 1T21A 1U6AH 2NX5A 3H9HA 5BW7C 3HRPA 3KLDA 1SBBA 2L0DA 2QSQA 1NMAL 4X5XB 4JG1H 5SWSE 2X09A 4WU5B 1EPFA 1F4WL 3IDXH 5IBLC 3O4LD 2BSRB 2FH8A 5SWZE 3BZFA 1HHGB 4XAKE 3TO4D 4YDIL 1INDH 4Z0BH 4TPRH 1DBJL 5IMOA 1FL5B 4L8CB 2AXGA 4LSSH 2EE2A 3V6FA 4CJ0A 4J4PD 4CVUA 4U6YA 1OSPH 1IM9A 2XZCL 2EIZB 3TPKA 5DD1H 2HFEA 3BJ91 2OTUA 1P7KA 4PG9B 1TQBC 2KQMA 3IKCB 1AY1L 5K9KB 3NMEA 4WEUD 1IEBB 1I85C 5ECJE 3WNKA 2RFXA 2D31B 4P99A 4ISVB 4PTUA 5FYJE 4XP9H 3WMSA 1Z5LB 3MSPA 1W8OA 4K7PL 4P2OB 4FG6C 1M71B 1TCRA 4XP4L 3D2UD 5I18L 3PNWB 4O5LL 1EEQA 5D7JA 1U3JA 1AJ7H 1MUJB 5MEQA 1FFNB 4HZLB 3ZDXE 1QYGL 4PGEB 4RMVA 4TUJB 3PWLA 2LE9A 3O3DA 4YK4C 1I9JL 3A6OA 4R96A 4OIIL 4LHJB 4RDQF 3QQ4B 2XV6B 5HI4C 4HC1H 4H8WH 3QJHA 1ACYL 1NSNH 2DKUA 1WIOA 1G9MH 1K6QL 1VACB 1WIUA 3V0AC 2DM7A 1BFVH 2V2XA 4UUJB 4N0FB 4B53A 1KENH 5JR1L 1R5IB 3B9KD 4OM0H 2QADB 3DIFB 1K9TA 4U1JB 2BJMH 4LCIL 2E6QA 3VXRE 1U3HD 1LO4H 3FMGL 3QUMA 4LP4A 4JKMA 4Y5YA 5IOPB 4WFGE 5E1AB 1D5MB 3S36H 5C09D 1UB6B 3UO1L 1I8KA 3MRDA 1SBSL 4POUB 2E7BA 1UENA 3LKNA 1JRHH 1P7QD 1I1AD 5C0BA 4Y4HD 3CVHH 5IJKA 3BSZL 2AQ2A 2IPUG 1S9VB 1X5JA 1KCLA 2P8LB 1UZ6F 1A3RL 1AH1A 2X9WA 4U0QB 5KSBE 1S7VA 5D1QB 4FQIL 1CS6A 5DJDA 2FD6L 3HC3L 1JWUB 2CK0L 1MVUB 4GSDH 4KMTL 2NY0B 5C07D 3T4AB 1NGZB 4M7ZB 2V5TA 4GRLC 2B1AH 4JFQB 4PB9L 1RZ8A 1UQSA 1G9NH 1S8DB 3K4AA 4JO4H 3MRKB 4V1DE 4PRIA 5T3ZD 3FQNA 5CEZD 4XGZB 5JW4Q 5HHOD 1B9ZA 3VXME 3DX9B 1L0XA 4KFZC 5T1DL 3ECBB 5C0AB 2VSDA 5F70A 1Q9WB 1H3TA 3K2UL 1SJEA 4OZ4A 3CFBB 1RUKL 3HLAB 4GAGL 4JR9L 1O7SA 5CSZA 2VIRA 1KYOJ 4H8WC 2DLIA 1CL7L 2HJFB 4JHWL 2OJZH 3IETA 5H35B 4POYA 3W82A 1YPZA 3ZL4L 2VN7A 4JJ5A 4MSWB 3S35L 4QCIA 3KXFA 1MSPA 2X70B 3QQNA 3LOWA 2DQFA 1CFVH 4XCFL 3V7AG 2IG2H 4F9PA 3VDBA 5F7LB 3E3QC 3SCMA 5F1NA 1UCBH 4ZODA 1JPST 3CLFH 5JXAH 1GYAA 3O3EA 3DROB 2JLLA 3KPNB 3GRWA 5E1HB 5T3XL 3K0WA 5TDNB 2Q6WB 2H3NA 1X5XA 5GGTL 4WUUE 4TULH 4TN9A 3M17A 1ZLUK 3TP4A 4R2GC 3X11B 1UXWA 32C2B 1J1PL 5HJ3B 5A2KH 1QBML 3P2TA 1U9KA 4OLWL 4LOUD 3RNQB 4UILL 5CWSA 1TVDA 4M93C 5J9PB 1OT1A 1U36A 2X4OA 3QEQB 1G6RA 1QSEE 1MH5B 3I6GB 3DTXB 3ILQC 4P3DA 4G8GA 1KTDB 3BESR 4JFED 1FZMB 5D1XD 4RRPG 1D9KA 1EHXA 1OAXH 3QHTC 3DJ9A 1G9NC 1AXSA 1RIUL 3BP7B 2R1WA 5JMOC 4RQQB 3SGKC 4DZBB 3UTSE 3AY4C 2BERA 3LQZB 1JJUA 3L3DA 4XPAL 3HRZA 1R0AH 2NPLX 4LLWB 3VU2A 2YBRB 2QV2A 5C0EB 4R3SB 4K3JH 2J2ZA 5BZDA 5LKNA 4U6TA 4C57C 2VDMH 1U8HA 1DP0A 2FO4B 3M45A 3TH4T 2ATKB 3P3YA 4NRZB 3AM8C 1NAMA 4GG8A 3QIUB 1NJ9A 4NKMA 1OGAD 4D8PB 2Y7QB 1GJIA 1G7IB 2ZUVA 5GRYA 3GJFK 1OQOA 1HHHB 4LSQL 2L7JA 3CSYB 4D0CB 2EH7H 4FNLL 4QGTA 2H8PB 4I4WB 3UTTB 1AO7B 4NM4H 5ISZB 4F7CA 2XQBL 1SJXA 3FOLB 3RGHA 3PL6A 3HG1A 5AUMB 3TIDA 4C4KT 2A0LC 2F74A 2ESVB 1ZAGA 4WWKC 3O0RL 1YN7A 1H3PH 2JK5B 3RUGB 5AG8A 4JM2C 1QNZH 3VFPB 2AK1H 4I77H 1U8NB 1JNHA 2HFTA 4IIQA 4M4PA 5IHZA 4GQ9H 3O9WD 5DUML 4XP1H 1EFXB 4ZOBA 1EV2E 2QJDA 5IW1A 4N5EC 3JWNC 4PJ9B 5FKAB 4NWUH 3RVWD 4HX1A 1Q94B 4ONHB 3HAEG 5HHNA 2Y5TA 5LGJB 5GRVK 3U4AA 2DYPB 3KYKH 1NUNB 2VERN 1A6TB 1MIEH 4BSWB 5ADOH 3BGMA 2AQ3A 1CLZL 4IRJD 2BNUB 4PJBA 2GAZA 1XR9B 2VISB 4RNRB 4JFOA 1GAFH 5C0JA 5C0BE 4G8EB 3GKZA 4FQXC 4YHPB 4PV8A 1AR1D 1I4FB 3FCTB 3V5HB 1MAMH 5F7YC 4PYHA 2VZVA 1XR8A 3V52H 1T4KA 1JUFB 1U41A 4ZFFB 2CDEA 4ZO6A 1MFBH 3U4BH 3TVMD 5IW6A 4IHOB 4N0UB 3KGRA 5A2FA 3OJDB 1CDGA 2DI7A 5DEZA 3K4DA 2HP4A 4PY8I 5DK3A 5F44A 1AD0B 2DQUH 3WXWL 3GIZH 4RIRA 1CD0A 1A1NB 4N1EA 3QO0A 4JFZH 3FO1A 4S10A 1LEIA 2DM3A 4OIAA 3VXRB 3CH8A 4I5BA 4N90D 2BHYA 3LQAH 1WBXB 4MNQA 5E08H 3BE1L 1DQJA 1FZKA 5T5FH 5HPMB 4O2FB 3J8F7 1TZIB 5DJ0A 5DMGD 4UQ3A 5FOBA 4XXDA 5IJVB 4UV7H 3UJJH 3VD7A 3IXAB 4RMWA 4A6YA 2C3VA 1N6VA 1N4XH 3KXFE 3KJ4C 4ZO7A 3C9NA 1MHHA 1UG9A 5KSBB 1FBIL 2FJFA 2PTVA 3FB7B 4GO6B 5DJ2A 5ID0B 4YHLL 3VXNA 5DWUH 4D9LL 3CFJB 2JJTC 1NEZG 2D7OA 3IRPX 4HIJA 3OKEA 1JZ4A 3MLVH 1XF3A 1MLCA 2GK2A 2J5LC 3BIKA 3GJFA 1QVOA 3LKPB 5IG7A 1OTTC 1Z9MA 2ARWA 1HZHL 1CVSC 5KVFH 4M48H 5AZEH 3HNTL 4Y8AA 4KWUA 1S9YA 4X4MA 1RULL 4WHDA 3FFDB 1CT8A 1C7TA 3ARFA 3PWNB 1EUTA 1OL0A 3OGCA 1PQZA 4G8GE 3ZDZE 1YEJH 3TBSB 5IB1B 5F3BA 1T5XB 3RA7L 1QFPA 2BVEA 5ACLA 1ED3B 4M7KL 1IGFL 5E6ID 4WI6A 3DVGA 2CLZB 4NIKB 3VMNA 1OAZL 2HLFC 4GW4B 3DV6B 1VKXA 3O2DA 4J1UA 4MVBC 4P2OC 5HDBF 2Z0BA 4Z8FL 3O11A 4DCQA 3S98A 4ENED 4DN3H 3NACH 3N1FC 3DRTB 1P7HL 1OB1B 3HZVA 3LQAC 1VFBA 2ZOLA 5B39A 3PWPB 2CLRB 3C5SB 2P47B 3LB6D 5ENWB 5KVGH 1B4JL 3K3QA 4LBEB 5D9SB 5EO9B 3K1DA 3BW9B 4FN0A 4M43H 1U8PB 5HHPB 4X9HA 1OP3K 3TZVA 1VEOA 1CU4L 1QSEB 4QKXB 4PJEB 2QADC 2F8VA 4ODUB 1IILE 4XPHL 3O41A 5AYUH 3RU8L 2B0SL 3ZE2E 3SBWC 2Q8AL 3VA2C 3MGOA 1IFHH 3IDJB 3QI9D 4QHKI 1MI5D 3GI9H 1RURL 4CAGA 5TE4H 1T21B 3QCUH 3ULVH 3UTSB 5F9OL 1Q38A 2D03L 3MLUL 2P7TA 4X6EA 2EZ0C 1NGWB 1ZSDB 2PKDA 2RHEA 2WAHA 4HQQH 4OJFH 3BZFB 3CFDB 5K59E 2GSIB 1S7RA 2NYYC 1P4LA 5D7IA 5FM5M 4X6CA 3D69A 5D1QC 2A2QT 1X3DA 2A77L 5IMOB 1RZKH 2ZPKL 4UQ2A 2BNQB 3LEYL 2E27H 2NY0C 3BPLB 4POZD 4FABL 4M7ZC 5T3ZL 2ORBH 5CEZL 1IM9B 5EOTB 3T1WA 3S34H 4TSBL 3CFKB 3RWDB 1IAKA 1P7KB 3T0BA 5B8CA 4XCCL 4OI7A 4MJ2A 1M05A 3CPLA 5T1KB 1EJOH 1GGTA 4OFYA 4HEPG 5BQ7A 2RFXB 1I8LC 4QTIH 2VDNH 4O02L 2VUYA 5JDSA 2DQTH 2I5YL 1S7TB 2QQKH 3IFPB 3U9PH 1FGVL 1KCVL 1TJHH 3NTCL 4YDKL 5FDYA 4PJBE 3TWCH 3V6OE 3BGFC 3W2DL 5D7JB 3WL9B 1HHIB 2J6EA 5MEQB 5KVDL 3N85L 3UDWC 3PWLB 2YS4A 3O3DB 3SE3A 4XMPH 4R96B 5H94B 4KTYA 1D5IL 4P9MH 2YRLA 1A6UH 1N0LA 1E4XL 2D7NA 3G08A 1HQRA 4OQTH 3KPRD 3QJHB 3RVVD 1UVQB 1CDHA 1RHHB 5F7KC 4AJ0A 2V2XB 2ZOKA 2IFFL 4LMQI 4QLRA 5KSAB 3VFSA 4JHAH 4PJGF 7FABL 2NCMA 1XGPA 3BN3B 3ULVC 4KI5D 1JMZA 3FN0H 3EFFA 2UUDH 5IVNA 1QSZA 3FRPA 1IVLA 3GMNA 4MNQE 3WKMH 1MFEL 3C60D 4OCRH 2CO7B 4NHUB 2DM2A 1ES0A 1I8KB 1E6OL 3MRDB 2X4TA 4HIEB 4OCSL 5JOFB 4LCWD 2CGRH 2BY0A 4KKAD 1RZKC 5C6WH 2H2PC 5C0BB 3RWGA 1S5HA 1TXKA 4J3UA 4Q58C 1XIWB 3EYVB 1NBQA 5GISL 4HJGA 4ZS7L 43CAA 4H1LA 5FO9A 4HV8B 3U1SH 3QHZH 3IU4L 5ANMA 5DJDB 4TNVF 5LQBH 1RIHH 4ODTL 2H45A 3IJSB 2N56A 3VE0A 3MTRA 4JDZB 2A74A 5GJSH 4KVNH 2B1HL 1BQHA 2OTPA 5ESVA 2AJ3B 1RAMA 3MCG1 5FYJH 5D72L 3S37H 2Z8SA 3FQWA 1U0QA 4P4KA 2CMRH 4Z7VB 3OV6A 3C08L 3MXWL 3GFUA 4PRNB 4X4ME 4OZ4B 5IFAH 1RK1A 3OAZH 3QIUC 4OI9A 4OGZA 4CJ1A 2VMFA 2B20A 5DQDH 2BZDA 5CSZB 3STLA 4XP6L 1LDPL 4X8JA 1RJYA 2MPAL 5IB5A 3BEVA 3EJZC 1DE4A 5C86A 3ZHDA 3IGAA 2FEDC 2P24A 2DQFB 4LSDA 4GS7B 1NUDA 4G3YL 5F1NB 2W65A 2BVOA 2CKBB 5F93C 5CS7A 4OLYL 3JZ7A 4MMZC 4XNUH 4KQ3H 2H3NB 2XZAL 4LHUG 3IS1X 2QSVA 5FHAL 2HYMA 3M17B 1QA9B 2YD5A 3IS0X 4DVRH 5ELIA 1Q9OA 3GSRB 3KYMA 4MA1B 4HKXB 2EYSB 4UIKL 3HPLB 4LLQB 1CLOH 1G7JB 3V9FA 2X4OB 4JN1L 5L7XH 4PJ9C 1TZHA 4P3DB 3CZJA 2NY3B 5CILH 1UA6L 3S8WA 3QUXB 4WI3A 4MAUL 2R9HD 2HT4D 3FTGB 1D9KB 2E8ZA 1G6VK 3GSWA 2FECI 2QQLL 4OZFA 1JVKA 3HRZB 1ROWA 3IJYB 3L6FA 1JGLL 3WDJA 3GHBH 3T1FA 3G6JE 3SDAA 5DJ8B 4D0BB 1RIVH 1X4YA 2PXYD 2DLEA 1RJZA 3EO1A 3QPQD 1FYHB 5KZCD 1FSKC 1KLUA 1ZHNB 2VWEE 5D5MA 2X4RB 1PYWB 2J4WH 1NJ9B 4NKMB 1K4DB 5LGHH 4NBZB 5D8JH 3AGVA 3OBAA 1JL8A 4P3WA 1J05A 4PB0L 3ZE0F 1WBZB 4YDJB 2PYED 1KELL 4NO0D 4Y19D 4I48B 3L3KA 4YHOH 3C5ZA 1JCKA 4F3FB 3IFNL 2OR7A 1T04A 3VG0H 1S7QA 4F7CB 3TNMA 4ZYKB 1N26A 4P23B 1ITBB 3TIDB 3P73B 4JG0L 1MCPL 2F74B 5EORL 4HMEA 3QPXL 3VG9B 2P5WB 3FB6A 3QISA 1YN7B 4K23H 3SKOB 2E7MA 1T0MA 2D3VA 3LH2H 5D4QA 1BFOA 5I71B 1T89A 1EEYA 1TTGA 1ZTXH 5I2IA 1JNHB 5FCUL 4IIQB 1YNTA 4PR5A 5ALBL 4NC1C 3V4UH 1I75A 1DFBH 4EKXA 2R69L 1IEHA 5J11B 1EMTH 2BVTA 2R4SH 1T6VN 3C6LB 1N6UA 4HX1B 3RTQB 5I1EL 2VXSL 3ALWA 4KU1A 2FWOA 5CLWA 5EZLB 1WTLA 2FYYA 3TF7C 5I66A 3PJSA 1QP1A 1BM3L 4S1QH 4CU6A 5BS0A 2WUBL 4Z18A 4PJBB 4MCYB 2GAZB 3QFJE 1PKQA 3VGBA 4XB8A 1FNAA 3RWJA 2HTKD 1NBVL 2XXCB 3I50H 1XH3A 4JO2L 2R2CA 2YR3A 5C0IA 1UEMA 1Q0YH 4DKFH 3MLRL 2DQGH 4O2EB 5HYIA 4KJQD 2XQYK 1OD9A 1S7UA 3L9RA 5HGBA 3F7VB 5ANME 1XR8B 1T4KB 2OSLA 3BD4A 4WIQA 1EAPB 1FRGH 4L4TE 4NUJA 3ROOB 5IW6B 4PPTA 4L4VB 2LQRA 2EO1A 4HHAA 4JJHA 4JE4B 1CFTB 1F90H 4R4NC 2R29H 3A0OA 3P4NB 4LARL 4Q9RH 1DR9A 4CRPA 4XNZB 5BJTB 1G7HA 4XH2B 3VXSB 3EYQC 4HG4K 4HZAA 4I5BB 4FQCL 4MNQB 2XTJD 4QHMA 4TQEL 1BD2D 1QR1A 5F89A 1DQJB 1FZKB 2R0ZH 2BNRD 1NLDL 5FF6B 4U05A 4CUCA 5F7DA 5FOBB 3GMRB 3CJJA 3WXVH 1ZANH 2X6MA 1QSFA 5ESQB 1ZLWK 4KDVA 2XN9D 1NCWL 3O8XA 2ZKHL 1IKFH 4P5MB 4BZ2L 5BOPA 1MPAL 3B4NA 5DD3H 2APBA 3V4PH 5TH2A 5FXCH 4YEEA 5EFIB 4BZ1H 3WFEH 4EEEA 4F9LA 2FO1A 2BX5A 3BX7C 3HN3A 4LSRH 4GW1A 4KHXL 1CZ8L 4M62L 5FYKU 4JFDD 1MJUL 1OSZA 5EBLA 5JW3L 1XF3B 1MLCB 3BIKB 3GJFB 3OAUH 4NNXA 4LVEA 3WIHH 4KJWD 1QVOB 5IQ9A 4QRSA 3UTPE 5LWYL 1YN6B 3GIVA 3BMVA 3RDTD 3NPZB 3HI6L 2AEQL 2MOVA 5DQJB 1OT2A 1S9YB 3JWDL 5IESL 4CVZA 3UAJC 3X3FL 3BPLC 4U1LA 3RZCD 5E9DA 3NIDF 4E0RA 4NPYB 1PQZB 2A6IA 2VR4A 1SVCP 3JV4A 2CR3A 3TN0B 1WC7A 1XF2B 3QZWG 3BXNA 4NGHH 4OZIB 4XCNA 5TFSL 3BI9X 2NXYD 1UEYA 3GSNL 3ES6B 2O5ZH 2AV1A 5GGUB 4LIQE 5CMAB 3QWOB 3BQUD 4HWEL 5D7JC 3HZVB 4P2RB 4UIMA 4PJHA 1VFBB 2EDHA 1DQDH 3BKMH 3LS5H 3MV01 2J3SA 5HTSA 5H37H 3GNML 1DDHA 3VA6A 4Z7UB 2CKNA 1P9MA 5D5ME 4EUPA 5I15H 2EC9T 3HCVA 4Q9BA 3DX6A 3U4EB 3JWOH 3IF1A 2QKIA 2HFGL 1ZMYA 5IB2B 1K8DB 2ED9A 5J6GA 5KSAC 4MD4A 3A6CL 2M1KA 4R8WH 2WLZA 1CVRA 2OMNA 4H0HB 2WP3O 1F11B 3NGBB 3O41B 2F19H 1OP5K 4IOFD 3W11D 2CKBH 1SYVA 3MGOB 4FXKA 2QR0A 3KDMA 3GRWH 3AU1A 2ITDB 1D5XA 3H9YA 4JPWH 3ESUF 4R90H 3W81A 4C56D 1TVHA 5D7LA 4FQ2L 2P7TB 4X6EB 3KPSD 5TQ0H 1FNEB 3EOTH 4MAYD 3G6JB 3K8MA 4QXUH 3DSFH 1S7RB 1CE1L 4JPKL 4Q7DA 1XIWC 3IDNA 3L1OH 3U0WL 4WNQA 3VFNA 2MTPA 4OGYL 4UQ2B 3GSUA 4GFTB 1G7LB 3W39B 4HIXH 4NUGL 4BQ8A 4G8FB 2Z8VC 3QJFA 3EJJX 2AK4A 2IAMD 5I19L 1YUHB 5HGAA 5IVXF 3K46A 2DQCH 5C0RH 4WVRA 1QLFA 3F8UB 4PJXB 2R2BB 1M05B 3MREA 4X6BB 5A16B 4IRSB 5JQ6H 5KVMC 3S88H 1F58H 4JN2A 4MHHI 2PYFB 4DW2H 5BS0E 2FL5A 3MRBA 4HGWB 4NO3B 3NCJL 5TQ2H 1AXIB 2FLBT 1PKQE 4YFLI 3QUYB 4PJIF 4PREB 2XA8L 4WO4D 3NZHL 4MS8D 4NJ9L 5FGRA 4NC2B 3STZA 4HKZA 2NY6D 2R56L 1WVZA 3QIWD 3JWOC 4XCEA 4NCC1 3QNYA 4L5FH 3GBNH 3A6BL 4NFBA 1WFNA 4Q6IB 2C26A 2PO6D 4QRPA 3FQUA 4IS6B 5DLMH 1HQRB 3Q5YA 1RFDH 5I74B 4GS7C 4F9PC 5CKAA 1N5YL 5KG9B 2VDOH 3R1GL 4Z7NF 1YYLH 4XZUA 5E00B 3FHAA 1FNSH 2WINA 3VFSB 4KZDL 1U3ZA 4XWOC 1RK0A 1RZ7H 3EGSB 2X2YA 2GJ6D 1YNKH 3EFFB 2IWGA 1IGMH 3FAWA 4KK9C 1P4IL 3TYFA 1RVFH 4QRRB 5E5RB 4FMFA 4M1CC 3SPVB 2F8OA 4MA1C 4E9LA 1VA9A 3V95A 1ES0B 5B3JF 4HBQA 3QFJB 3HZKB 1A3LH 3AS3A 1TVBA 4KY1L 3HFML 2AXFA 2NY3C 3EKCA 1R3LA 1QSFE 3LSOB 4LSVH 1S5HB 3QUXC 1CK0H 3SQOH 1U91A 1D9KC 4HJGB 6CGTA 5DFVC 3UPRB 1OHQA 5ANMB 5HYSB 2EICA 3UXFA 5B3NA 4NJAL 2VZ3A 3WNMA 4JY6B 5BRZD 2FATL 4LU5H 4EI6A 2ICCA 4WI7A 3VE0B 4L4TB 1AXTL 2A74B 4N0CD 3KNBA 1FJ1B 1P69B 2Y72A 3D3VD 3Q6GH 1BQHB 3AVEA 5SWQB 4YFLF 3O81A 1T7VA 4ZAKD 3FQWB 2P8MA 3O3AA 3L3GA 5E2VL 1FZOB 1GIGL 5AZ2L 1IC7L 5IHUH 1D7FA 1BIHA 1I1FA 2HA1A 3SGJA 4AM0A 5IKCA 4OGXH 1RK1B 1HH6A 4PD4K 4XPGL 4A2LA 2BVQB 3MYJB 5E9DE 4MJ5B 2XWTA 1R3JA 3ZDYE 5FV1L 1RJYB 1ZLUH 4GKOA 1E27A 1MWAB 3MO1A 3FZUD 3BEVB 1NCCH 4PG2A 5L88L 4LKCB 4PRAA 1H8SA 1JGEB 1B2WL 2P24B 4HPYH 3V6ZB 5GZOC 3KLAA 1KBGH 3GBLA 4P23C 4Y4FD 4YH6A 2F53A 4YEFA 4AQ1B 1VGEH 2J8UB 4JQIH 5F96H 1U2HA 5E2WL 3VG9C 5JOEA 4ZD3H 3D9AL 2Y23A 1YMMD 3G5XB 3OF6A 1IMHC 4LAQH 4PJHE 5I71C 1KB9K 4L8SA 1P6FA 4JEGB 2AVGA 5D1ZD 2E7HA 4IIQC 1F02I 3GM0A 3BZ4B 1SYSA 3IXTA 2EDEA 1DBKL 1TNMA 4Y5VA 4JFYA 1Q9OB 2CRMA 4GRWE 4KJYA 5AWNL 5J11C 1FDLH 4UAOB 1CLYH 5A2LH 1BVKB 3C6LC 3DMMB 1AE6L 1MF2L 2B8OT 1YEIL 2O5YH 3RTQC 5INCA 5HI3C 5TDOB 1ZK9A 2Z92A 2G2RA 4HS6B 3WIIL 2IAND 3S96A 2IPUK 3RVTD 5FGBA 3HE6A 3IJHA 1ZS8A 2ARJQ 5ALCL 3OKNB 4HH9A 3WNNA 1GGIH 1FAIH 3MRIB 1BLNA 3RFZC 4XC3H 5GIRA 3GJFH 1GHFL 1WFUA 3LN4B 5JW4N 3V6OC 4PS4L 1MAJA 5D7LE 3BP6A 2VQUA 4UU9B 3MV7A 1OP9A 1GZQB 4KZEH 4PY8J 1HWGB 4BFIB 2HLAA 5EZJA 3FB8A 3WHE0 1QRND 4HK3N 3DXAA 5E2JA 2FB4L 3RVUD 4YNYA 2OTWA 2CD0A 3SDYL 4PLJC 1SJHB 1NKRA 2ADFL 5D5MB 3MV8A 1DN2A 3SDXE 1F8TH 3QA3A 4WFHE 1OWWA 3ZLQC 5HGHA 5HVWA 1I9IH 3MACH 3I9GL 1CFSB 2AK4E 1YEGH 5JIPA 5F7EL 3WJLA 4XPBL 1X4XA 3LS4H 5BMFH 3L3KB 5CLTA 3QO1A 5HYJB 2ICWJ 4OUUB 5KW9L 4XNZC 1CN4A 4DK3A 4ESKA 3BDYL 1KJMA 2YPVH 4GMSL 3VWKB 5D7SL 1YDPA 2XKNB 2ADIB 4YLQT 2Q1EA 4QHNA 1V3JA 2VQ1A 5CD3A 5KS9F 4M6MH 5FYJU 5GSVA 5D7KD 5J57B 1T0MB 3LEVH 1BFOB 4LKXA 4QXGL 2DTML 1UM4H 1S9KC 1FLTX 5I2IB 2FNBA 4PR5B 3LN5B 2EXYD 4X7SL 4R6UA 2CRZA 1ZVSA 1NC4A 4XB7A 4HFUL 1NMBH 4NN5B 2OQJA 1J8HB 1ZXQA 4EIGB 1DANT 3S4SB 1FNGB 4KTEL 4OCXH 1KXTB 4CADB 3K7UA 3PP3K 4G7YH 1PY9A 2WW8A 1UKSA 1LO2H 3MBED 1H3GA 3PJSB 4ZG1A 1S9XA 2QLVB 5BS0B 3LKQA 1DQLL 1WEJL 4C55A 5J89A 4ZTPH 3CK0L 2DWDA 2N1KA 5JXEC 4C4KO 3RWJB 5MHSD 1H5BB 3EHBD 4GKZB 4BSVA 4PBWD 1WCBA 2WBJD 3G04A 5C0IB 4LPYA 1T5WB 3VFWB 4YX2L 3TN0C 3EZ8A 4PRHA 3WKNA 5IBLD 5IBTL 5TE6H 2RIKA 3CCHB 4LEOB 2EDQA 3H6JA 5HGBB 2A73A 5C8JA 2J8HA 1EUUA 3X3GL 3EFDH 1TTFA 4FQHB 4NUJB 4WUKH 1D6VL 4M5ZH 1GPOH 4HHAB 4N0YL 2CRIA 1X4ZA 5ID1A 1IQWL 1F13A 1UWGH 1G7HB 2J6EH 1HXYA 1XGYH 4AEEA 4ZUTB 1MHEB 1QR1B 2F5AL 4U6HB 2DRUA 3I2CL 2I27N 4E42A 5DJXB 2HKHL 3CLEL 4LSPH 4FG6D 3RKDC 3VFUA 3AS2A 4RX4A 3NGBC 2K3TA 4JZJB 3MRCA 3HMWL 4H88H 2G75A 1N64H 3RWEA 1DUYA 5TH2B 1MELA 3ULVF 3EO9H 1P84J 2F53E 3NIGE 4XNYL 4OZHA 1FIGL 1MQKH 2YN5A 2BCKB 2VZUA 2FX7H 2R23B 35C8H 3INUL 3UTQA 1A6WL 1HHKA 5F3HA 2D9CA 3O6MH 2L4OA 5IQ9B 3VMPA 4QRSB 3AROA 3MRMA 4P59H 1U58B 3GIVB 4LGPB 1BHGA 4NQED 1PX4A 3TFKD 2CDFA 2VWEC 2C1OA 4G6JL 4MJIA 1A7OH 4TSCL 4E41D 3U30B 2KBGA 4N1HB 3TCLB 1LEKA 4UT6L 3JV4B 4PRDA 2ZCLL 3KPMB 1WC7B 5ICZA 3NABL 4UTAL 3CFCL 5LVEA 4IRSC 4X6DA 4FFZH 1ZE3C 3L3IB 4XCNB 1OP3H 3AFLA 4F7TB 4J3TA 1ZT7A 4W4NA 3VWJB 5C6TL 4M4RA 5GGSA 3QCTH 4XNQB 3DX7B 3MUGA 3OKDB 1LHZA 2BFVL 1PSKL 4M03A 4G9FA 3QUYC 5JOPE 1VFUA 2YSSA 1EO8H 4OFIA 5I1CH 4Y2DB 3I3EA 3MV7E 2GT9B 4HUMB 4GRLD 4Z7QE 4AEFA 4OCYH 5JW4M 1KCSL 1OAUL 2VXQL 2EH8H 3IDIA 1BEYL 4QTHB 4YO0B 4YDLC 4JHBA 4Q6IC 3VI4E 3MCKB 3WNOA 4GRWB 1WIPA 3F62A 3MV8E 1MWAH 3P11L 5I74C 4YXKH 3HCVB 5HDQH 4NQDA 5EN2B 4HIIA 4XVSH 3V8OA 5J6GB 3VFGH 4OLXL 3CC5B 3MJ9L 2OBGA 1L6ZA 5FFLA 1L9MA 3TPUA 1OOAA 1GVIA 1FV1B 1SYVB 4Q9QL 3WLBB 1TJGH 2QR0B 4JRXA 3C5JA 3BDXA 3BOVA 1MCDA 4KGJA 1NGPH 5K9JL 4O9HH 3QDMB 2X4SB 5F1IA 2VR5A 3QXAB 1X7QB 3QXDA 4UDTA 2AJVH 5I1JH 4WNQB 3RI5F 3BO8A 3BH8A 3GSUB 4K2UL 5AG9A 5BVPL 3QXWA 3SDXB 4R2GD 1EXUA 4XVJL 3FN3A 5CINL 5M7QA 1A6ZA 4ODVL 5DR5L 2AK4B 1A7NL 5KJRH 2R0KH 5BVJA 4J2XA 2I07B 4O58H 1JHTA 3IFLL 3ILQD 2VZ1A 4CBPA 4LF3A 4LIQH 1DVFA 4L3EA 4X7TB 4U2YA 1F3DH 1TNNA 3O45B 4JY4A 4JN2B 3ZDXF 2PUQT 5HHQA 1TETL 2X4PA 1SQ2N 4M6OL 3UC0H 1CICA 1PD6A 3WEXA 4ZXBA 3FOMB 5LXGH 1BJ8A 1FORL 4PJFA 4PRHE 4EDWL 5IEHB 2CDGA 1AI1L 2VAJA 4EOWL 4AIXA 1JNLH 1SY6L 2PNDA 3RP1A 1BX2A 4XHQA 4HKJB 3VH8G 4YXLL 5J06A 1QRKA 4MJ6A 1N2RB 1SJVA 4UINL 1SM3H 3A67H 4XZUB 3RWIB 4OF3A 1K5NB 5INDB 5E24E 5L2KB 3SJVA 3H8NA 4LCYA 1IAIM 5C0GA 3T4YA 4K3EH 3TYFB 3O2WL 5IP4A 4UB0H 1V7MH 4RGNE 2IGFH 4GH7B 2OR9L 1GGCH 1CBVH 4UAOC 3DMMC 4IMLA 4M8VA 1NDMB 5KSBF 1TVBB 5MERA 2A0LD 4FQJL 5EWIH 1A7RH 1TMCB 4WWKD 1R3LB 1N0XL 4PGCB 4JM2D 5T1LB 3MPCA 1L6XA 4DWHA 5GGTA 3UJIL 3QB7C 5EZOL 2JIXD 3TJEL 2D0FA 3M8OH 1KN4H 4DZ8B 3BVNB 4ZPTA 1HE7A 5CHNB 4HD9A 4OZHE 5TF1L 1Q1JH 5GPRA 5EU4B 3WE6B 2GIYA 2YD6A 1Q0XL 4N5ED 1N8ZA 4HJ0C 1C12A 3TA3B 4WRLA 5LAXB 1JI1A 2V9QA 3W5MA 3M1BB 3L3GB 3HZMA 5HY9A 3IVKA 1I1FB 3HI5L 3WYRA 1IT9H 4ERSH 4AM0B 3CMOH 1FHGA 1QO3A 3VXTA 2GY7B 2JELL 3QEHA 3NN8B 1R3JB 1NC2B 1LP9E 4ONFH 3NZ8B 1J1OH 4MA3B 5BV7B 2DQDL 4TNVK 5A2IH 3GUTA 4X6DE 4S0SD 4U1KA 4FQXD 3FQRA 2QQQA 3D39A 4U33A 3VXUD 3VWKC 3KLAB 3ZSTA 1W0YT 4WW2F 3BAEH 4M6NL 4DFHA 4X98B 1KEGL 4G9FE 3FQXA 1BMGA 1QFWH 5IT2L 1CTOA 1T89C 1XCQB 5GGRY 1BQLL 2YRZA 5MEND 5E8OA 4EBQH 3DURB 4P2QB 3IXTB 2ITCB 1UJ3B 4NN5C 5F9DC 3UYRH 2OL3L 5J1TC 2ENYA 4NQDE 1NH6A 4ZSOA 3HNVL 4M8QA 1KIQA 3QQ3B 5INCB 1T2QH 1XEDA 4KDWA 2Z92B 5I1IH 2G2RB 1X5HA 5EH1A 1LMKA 5L2JB 2E5EA 4YPGA 2Z31A 5AD0A 2FECL 4HH9B 4O51A 1IAMA 3HE7A 2UZIL 4JRXE 4OV6F 4OLZH 1TQCB 4XBPB 4OFDA 5I8KH 1OAKL 4Y1AD 2VLRB 4WHTA 5HYQB 4C58B 1H5BC 2W59A 3JVGA 43C9A 5F9JB 4GAYA 3OWEA 4HWZA 4NQSB 4X4YB 5EZJB 1QFHA 4Y89A 3VFRA 2FSEA 5T5NG 1FH5H 2MCG1 4WGVB 1JNJA 1BIIB 4K9EL 4M61B 4JVUA 4JQVA 4TYUA 4LPCA 1KJVA 4R0LA 1OTTD 4FXGA 2GI7A 3FRUA 1KCRH 3WS3A 3EJYC 1YYMH 3SGDH 2ATPA 3SE8L 4DQOH 5KBNC 1MCRA 2Z91A 2FR4A 2YPLA 3L7FA 3QO1B 2AJSL 4EDXA 4FQLL 4L3EE 3UJTL 3ARPA 1KCKA 2FJGA 3U0TB 1JK8A 5JUEH 1KJMB 3DVNB 5TE7L 4ODHL 5BO1L 4JFHD 1NCDH 1U8KA 3NCYP 3ABZA 4QHNB 2VQ1B 4RMTA 2BMKA 4KDTC 1A0QH 1HIMH 2BP3A 4NZDA 4LKXB 3VXQA 4MVBD 4P2OD 4LLUB 3REWB 1JYNA 4RAHA 1XGRA 4GRWH 4S1RH 3MOAH 2FCBA 4OAWB 1IRAY 4JZJC 5DK2B 3U6RB 4AQOA 3TEUA 2IMNA 1QBLH 1KTLB 3HUJA 2BDNH 5E6ZA 5T5NF 2BY3A 1IAIH 1KNOA 1JGDB 4ZO9A 3IFOB 1EO7A 4JFFB 4MA8L 2HRPL 1DSFL 1XT5A 3I6LE 2VDRH 5H37G 4JRYA 4NP4L 1U6AL 1I3UA 2F54D 3FO9B 3QUKB 5KSVB 2WM0A 5SX4H 2OZ4L 4OD2A 4YQXH 1FNFA 2VRAA 2QADD 4X7FC 3MLSH 3UTZA 3LKQB 4YXHH 2NY7H 5ICYA 5E94B 1IZKA 3O4LA 3CXHJ 4RAUA 4GW5A 4Z0BL 3U30C 1I8MA 3QG6A 1WWBX 3TO4A 1AP2B 4TPRL 1FCCA 2J7LA 4AL8H 4LSSL 5CBEA 3OG4B 5T3XE 3O4OB 2EZ0D 4PRHB 4OD1H 25C8L 3LHPH 1OSPL 4P5KB 5C0DA 4J4PA 1AKJD 2A6DA 2NYYD 3QRGH 5GGQL 3VWJC 1YEFH 5D1QD 1ZLWH 2ZZUT 5EO0B 5IVZA 4ELMB 3HS0A 4LEXH 5FOJA 2E9JA 4JLRB 2NY0D 4Y2DC 5EUOA 5C3LD 2XPGA 4X9IA 1YC8A 1U8IA 5F7FA 1C08A 1R3HA 3MJ7B 3BUYA 3T08A 1AJ7L 1I9RH 2V2TB 3W0WB 4DUXA 3D2UA 1HXYB 3B2UC 4LRIA 4RGNB 4M7JH 5C0AD 3Q6FA 2XG5A 1H0DB 3FFCA 4HLZH 3KPQA 3DETC 1CWVA 1O5DT 4Q74A 4HC1L 4PV9A 5ACZA 3VFUB 2Q3ZA 1ORSA 1KN2H 1NSNL 4I8DA 1G9ML 2P5ED 4IOIA 2B4CH 5C9JA 3MRCB 1F3JA 2QTEA 1S5IH 6FABH 5FGCE 4KRLB 3D39E 3G5ZA 1KENL 3RWEB 1DUYB 3S3JA 4OM0L 4MQXC 1DJSA 3B9KA 3SKNA 1LK3H 2R4RH 3B3IA 4FRWA 5DJAA 4KAQH 1IGCH 5J12B 1HHKB 1XZ0A 3MRJA 5DQ9A 2DMKA 1ZLVK 1E4JA 1U3HA 3S36L 1UJTA 3CMGA 5E0QA 4KJPC 1BGXH 1CGUA 2CQVA 5JNYA 3OKKB 5C09A 3ZDZF 3ULVD 2CDFB 3N50A 2RCSH 2ZUSA 1U93A 2AI0H 4JAMB 1QZ1A 5D6CB 1JZ2A 1P7QA 1I1AA 2VDQH 4GXVH 4IJ3B 1CI5A 4Y4HA 3LKSA 4ZSOE 1SEQL 4U6XB 1LP9B 3GGWA 4GSDL 5E8PA 3QEQD 3NAAH 2B1AL 4OF0A 2GUOA 2O61B 2H2PD 1X5FA 1Y18A 3H3PL 3BHBB 4O4YL 5C07A 1G9NL 3V5KA 2YC1A 4JO4L 5I1DB 2QSCH 1ZT7B 5F8QC 4U3XA 3OKOA 5GGSB 1FPTH 4HW6A 3BKCH 3MJ8B 4NCC2 4WY7H 4L8BB 1Z2KA 4YDVB 5HHOA 2W0KA 3BIAX 1X5ZA 5JZ7C 4I0PD 2FX9H 2AJUL 1ONQA 2X42A 5E8NB 5L0QB 4K94L 4OLUH 4UT7H 5BV7H 4EQ2A 2B4CC 4JKKA 1LWRA 4X99A 3T8XA 2XNAA 1LO5A 3GB7A 4CMMB 5CBAA 3QIUD 3Q0HA 4WI5A 3Q3GB 4OT1H 1CFVL 4M1GH 2IG2L 5FUZH 3SE4A 2YPLE 3TPUB 1UCBL 2NLJA 4GKNA 4X80H 1WBYB 2DS4A 4U1SA 3EJZD 1KLGA 1WT5C 4JRXB 3B2VH 3PF2A 4KUZL 3VXOA 3CDYA 3MLWH 5ISZD 3UTTD 5K59F 2FEDD 5GRZA 1L7IH 4I13B 4TULL 5E2TL 2HG5B 1FG2B 3VCLB 2ZUTA 2ESVD 2VITA 3QHFH 2C1PB 4LGRB 1MCCA 2VDKH 1ZT4B 3QXDB 1P4BH 2EKSB 2R39A 2ZSVA 3HHRB 4XAKD 2IQ9H 5EBWA 2DLHA 1U8JA 2H6PB 1IL1A 1N59A 4JFEA 1EFXD 3VDCA 4MD5B 1Q72H 4ZO8A 1OAQH 3LD8B 4JRYE 3GMPA 5BVJB 3WFDH 4PJBF 3TA3C 3B83A 4KGLA 4N68A 4KKBC 5EOQH 4L3EB 2A6JA 3E6FB 2IH3A 3G6AB 1R0AL 5GZND 4QF1B 2DYPD 3KPPA 5CGYC 1PG7H 1BVLB 3O4LE 5CZVH 2UWEA 1UM5H 3FT3A 1BQSA 2RAMA 1BFSA 5I17B 2AJYL 2Z4QA 1VPOH 2V9RA 1MRDH 3WEXB 1KPUA 4ZXBB 5J3HD 4JZOA 4P4RA 5BV7C 3HAEB 4AIZB 2A9NH 3P0YH 3JTSB 1OGAA 1LNUB 1BX2B 2CR6A 2OM5A 5JPNB 1F4XH 1RUML 4MJ6B 3WFBH 4IMKA 3ZO0A 1KTKE 3RWHB 2PTUA 1PKOA 1D6EB 1QFOA 3BGAA 2HKFL 4DEPB 4LCYB 4NKDA 2G60H 3T0AA 2HVJB 3L5HA 5C0GB 2AGJH 1FFOB 3QG7H 2AK1L 1UJ3C 5IGXH 1X5YA 2WV3A 3WN5A 5JTWA 3ZHLA 3VXRD 4CN4A 3PWVA 3EOBA 4GQ9L 1ZEAH 4IMLB 3FFCE 2W9DL 4J8RA 5IBUG 4NC0B 1UC6A 5MERB 3OHXA 4XP1L 4WFGD 1BAFL 3O9WA 1PFCA 1OM3L 3HA0A 5CIPA 3ZT7A 3TH2T 4NWUL 4W68A 4G6FB 1OF2A 3SO3B 1OQXA 4EXKA 5LGKA 2VNCA 1TQCC 1A5FH 3KYKL 4ZUSB 1MIEL 3D85B 1C12B 1UYWL 1HXMB 2R2EB 4AEHH 1I1YA 1E0OB 1K2DA 1NPUA 3KWWB 2R0LH 1U8OB 4IRJA 3MRPA 3L95B 5C09E 3HZMB 3IVKB 2CSPA 1GAFL 3BT2H 4W81A 1MIML 1FL3B 2IH1A 4H20H 3QEHB 4CVWA 2DB8A 3V52L 4HDIA 5I1AA 1INQB 1TLKA 2MCPH 4H0IA 2VL5A 4OSUH 5FGSA 3SY0B 1MFBL 3U4BL 2DBLL 4HUNB 2GKIA 5C07E 3FQRB 3TVMA 5GS0H 2DQUL 4JFZL 3VFOA 5E7BA 5T3ZE 1NUFA 5CEZE 4M7LL 3FQXB 4LASH 5IR1A 5HHOE 2X1QA 4Z7UF 3R0NA 2HFFA 2VE6A 1UM6L 5E08L 5E8OB 5T5FL 3F58H 3VJ6A 4F8TA 4F7PA 4R4ND 3PWPD 4W70A 5F6HI 1J87A 4UV7L 3P9MB 2D7QA 3JV6A 3T3PF 3FO0H 2D7MA 4LRNL 1GGBL 1ZVYA 4P5TB 4JO1H 2BC4A 3V8CA 2VUOA 4KROC 5EU6E 1RUAH 4EVNA 4NO2B 1QSED 2H1PH 4HBCL 5DWUL 3PDOA 5AD0B 5DMIH 1S9WA 3PGFH 3HE7B 2FGZA 3G6JF 4TTDC 1CGSH 4XBEH 1T1WB 3R8QA 5KVFL 4M48L 4YHNA 3PABA 3X12A 1HK6A 3UTSD 4HWZB 3O3UN 5I8CA 3ZTNH 1KEML 1K4CA 3O4OC 3MUY1 3VFRB 2FSEB 3WFHA 4BQBA 1NMAH 3D5OF 3L3HA 4K3DH 4XBGA 1KJVB 2P8PB 4R0LB 1F4WH 2DQEL 4J12A 3FRPG 3HC0B 2NZIA 3BP5A 3PV7A 1G1YA 3FRUB 1I8IA 3DNKA 3QQ9C 1VFMA 1KXQE 5DZNA 3WS3B 2J8OA 1I7RA 5I30L 1KIPB 4JFEE 2BNQD 2ATPB 3RY6C 2CLVB 1N5AA 3CFEB 4UNTA 1F4AA 5GS0C 4DAGH 5E6IA 1IM9D 1U92A 5F6IB 2YPLB 3I6KA 3L7FB 4N8VA 4NZTH 5D2LE 2FJGB 4Y16D 2AQ1A 5CJXA 4K7PX 1JK8B 3PP3H 1FZJA 4H1LG 5T1KD 4AYFA 5KVGL 4RGNC 4S1DC 5HYSG 3IT8D 5MI0B 2UWEE 2BMKB 3MRNB 5GS3A 1WV7T 5DI8A 3ULUL 4PJGB 4U49A 4P0DA 4AENB 4UTBL 4YR6B 5JA9A 4MMXC 1XGRB 1BQHG 1Y0LA 3LRSB 2JJUA 3JV0A 1RUQH 5D7JD 5IWLC 4XP4H 1HI6A 2X7LA 1OGAE 4N0RA 2V7HB 3BP4A 3RL2A 1X5GA 1EVTC 2AXJA 4JPIB 5AYUL 3LPFA 1IFHL 4MLIA 3REVA 2ID5A 5J12C 3T3MF 3QCUL 3ULVL 3QI9A 1A9BA 1ACYH 1MI5A 3GSXA 4GBXB 4ZFZA 5KSAD 2GQHA 2HVKA 3NCYS 4HQQL 1IJ9A 4QT5A 3FT4B 3H7BB 5JR1H 4HKBA 4RAUB 4IJ3C 4PRPB 4ZQKB 4LCIH 2BK8A 2FGWH 2FIKA 2IBZY 1MFNA 3JUZA 1U42A 1QG3A 5HGDA 4U1GB 5C0BD 2COQA 4UDUB 4R4BB 3S34L 3DARA 2IPTL 5CP7A 1XIWD 3H9SB 4L29A 4NBXB 1FYTE 3ARGB 5JIHA 3BSZH 3LRHA 5CFHA 3P4OA 3V0VA 1A3RH 1J0YA 1R24B 3OKLA 1BBJA 4KUCD 4QTIL 2DQTL 2QQKL 3ARUA 2C4FT 2FD6H 1TJHL 3UBXA 1CXFA 3TWCL 2JJSA 2XPGB 4JKPH 3VRLE 5ILTH 1U8IB 1VESA 4I3RL 3ZTJH 1BOGA 1CIDA 1J0HA 1U8LA 3BUYB 3CVIL 5L0QC 2R1YA 2UYLA 4NNYA 4JM4L 2AV7B 5E56A 3WV0A 1FLRL 2VXUL 3GSNA 4XMPL 4DTGH 3HAEH 2EC9U 4OZFG 4P9ML 5IF0B 1A6UL 3FFCB 1VENA 3ARXA 1JTPA 5T1DH 3DHJA 5CD5C 1MFAH 3MC0A 4PV9B 4KKCC 3S35X 1ORSB 1G9EA 3VFMB 4F7MA 1RUKH 4JR9H 3KPRA 1F3JB 3WHE1 5A3IC 4MZ3A 1NKOA 4F80A 2XA3A 4JHWH 3CZFA 5HYEA 3U7YH 1IC5L 3SKNB 1L7TH 5CEXB 1K8IA 3IDGA 1XZ0B 3WKML 4OCRL 4ZUVB 4XCFH 5HVGB 4N90E 1MLBB 3C60A 2Z35A 1RU9L 1JPGB 1R5VB 1YA5A 3EIFA 4XWOD 5FA4A 3OPZL 5EC2A 4LCWA 1U93B 1U8QA 5J6HB 4KK9D 3GMOB 4AMKL 1ZA6B 4M1CD 1IGYB 3QWRD 3U1SL 2ARJB 2WLYA 2FJHA 1QBMH 2PR4H 3GGWB 3LD8C 5LQBL 4I2XA 1BVZA 1HN1A 4UILH 5CCKH 5GXBB 2NY3D 4XHJD 4LHUB 1CCZA 5GJSL 5C07B 3V5KB 3QUXD 3NFSL 2BOCA 2EE3A 3HNSL 4P57A 3KS0H 4JGMA 1D9KD 5C0FA 3OKOB 3S37L 3EBAA 5DFVD 1NDGA 3S4SG 1QKZH 1DEEA 3KR3L 3LZFL 3I02A 4C83A 4D0DA 5HHOB 5D5MF 1DLHA 1C8PA 3OG6B 4P49A 1KJ2B 4ZXBC 5IFAL 3QULA 1CIUA 4MDJA 2ZUQB 5KN5A 2KKQA 5FHBL 3GMQA 4L1DA 1P1ZA 2C4XA 2DLFH 1I1RA 4KVCH 4FP8L 1ZV5A 3SKUD 2OI9B 4H0GA 4HMCA 2GEEA 4HJJL 2F8XC 4HFWB 1JFQH 2XNAB 4PLNC 3GB7B 1TITA 1YQVL 1R3KB 5EU6B 3OR7A 4G7VL 5GGVY 2E3VA 4DEPC 5IMMA 2AEIT 2G9HA 4KK6D 1KLGB 4M02A 4LSQH 4BUHA 1T22B 2CXKA 4KQ3L 5E95B 1QFWI 3TIEB 4FNLH 1A22B 1C16B 1QFUH 4P23D 2XQBH 4F15B 2HAZA 5F7WC 3KLHC 2VXTH 4QHUA 4MNHA 2EIBA 3ARTA 2P5WD 4OF7A 1AGFA 1DBML 1B0WA 5B22A 5DMYA 1T3FA 2XRAL 3T2NL 4FZ8H 3S97C 2GCYA 2W38A 5L7XL 1JWSA 3O0RH 4XPFL 1MRFH 3SO3C 2H2SC 5CILL 3DVIA 1EGJL 1KGCD 1L0QA 1KFAL 1U8JB 4QYOB 1FNLA 4N9OB 5JHLL 4FZEH 5KTEH 4S2SA 5DUMH 3SDDD 3C6LD 1MI5E 3NIFE 5D2LB 3RTQD 5F1KC 5HI3D 3TO2A 2A6JB 4DGYL 4GKSA 4DGVH 3GHBL 3KPPB 5IV2A 1V05A 3C2SA 4NNPL 4YFEA 1NFIA 4MWFA 4MZ2A 1OCWL 2PXYA 5D8JL 4P46B 2HT2D 1MCQA 1EEUA 3VFVB 3ORJA 4K7PY 3SGDI 1IAOA 1G84A 3G6DH 2PYEA 3BFOA 4Y19A 4PLJD 4HCRH 3MGTB 1MCEA 5FB8B 2ZWLT 5DSCB 2Z93B 1KT2A 2OP4H 2F58H 1E4KA 4NZJA 5D6DC 4L3AA 3TBTA 4K23L 1JIBA 4L4VD 2B2XH 2RR3A 4JANB 4Y2OA 3IDMA 1I9EA 1P6AB 4PY7B 2YUZA 3WXWH 5DC4B 3IU3B 3HZYA 3VXSD 1H3XA 4HIHA 1DFBL 4P5TC 4J8RB 5MP6L 3OHXB 1AFVH 3AC0A 4ORGB 1EMTL 2PF6A 3DRQB 1I3RA 2R4SL 1M1SA 4TVPH 4DGIH 5KVEH 3FT2A 1IAII 5CIPB 3SOBH 3I3DA 3T0WA 4NKIH 2DBJA 3ZKXB 3HE7C 1FYTB 3P40A 5EA0L 1HHJB 4KI5E 1AGBB 1FBIH 5SX4I 2AJXH 5JO5A 2I9LB 4NQCA 5H2BB 2E7LC 4YHIA 1I1YB 2ZG1A 4YHLH 1S3KH 2IQAB 4D9LH 1GC1H 4DVBA 3I50L 3ZDYF 1WWWX 4R0LC 2ZCHH 2XQYG 1DBBH 1Q0YL 4DKFL 2LVEA 2CJUL 1CQKA 5TJWK 4GG6E 4NKOB 5DRZA 5IHLB 3PHQB 5JXED 3T0XA 1MJ8H 3QYCA 2Q7YB 5F6IC 3HR5B 1JE6A 5DGQA 4MX7B 2AERT 3GI8L 5CSBA 1MCIA 1WZKA 3L5XH 3P4LA 4GAJH 5E03A 2CK2A 3TN0D 5JA8B 2R29L 3HPJA 5MI0C 4Q9RL 3RA7H 3VFOB 4I3SL 1PY4A 4TOYH 4M7KH 3PP4H 3OKMA 4GRWF 1F5WA 3ROLB 4QHLA 1M7DA 2VE6B 3QT2A 2R0ZL 1OAZH 2FRGP 2C7UA 4OM1H 1BD2A 4Z8FH 1A4KB 3CIQA 4P2RD 2X9YA 2BNRA 4YPJA 3VRIA 4BYHA 1X6LA 1RI8A 5EIIA 4ZMAT 1DANU 4MNGB 1YEHH 1ERNA 2HT3C 4D9QE 2XN9A 3FONB 1IKFL 2BC4B 1A4JA 3EDKA 4H5SA 4Q2ZB 4EVNB 4BZ1L 5DJZA 4NQXB 2XFXB 4R4FL 3RPKA 1TPXB 2NNAB 4LLMA 4LSRL 4GBXC 1CU4H 2V5YA 3QEGH 4Z9KB 4HLZG 3OAUL 4X6FB 3WIHL 4JFDA 3QDHA 4IEFB 1UACH 3DOSA 4XPHH 3RU8H 1GC1C 1XGTA 4YHNB 3PABB 4D3CL 3X12B 3WBDA 5C08B 3OKYA 1RURH 5F88A 3RDTA 3TBVB 1K4CB 1FNHA 3SDXF 1A02N 1MNUH 2D03H 2PCPB 4U1GC 4PJ8B 3BH9A 1IGJB 3RZCA 2DLGA 4L3CB 3BP5B 1IEAA 1I8IB 4XCYA 3ARGC 5LCVH 5DZOA 3RX5A 4NGHL 4QXTA 1N5AB 4G80A 4FFVC 3NA9H 5DF0A 1U92B 1K3ZA 2O5ZL 4N8VB 1AHWA 4FABH 1T7XA 4G5ZL 5TDPA 5CEZH 1CGWA 1VADA 1KV3A 4HAFA 1HSBB 4HXAH 3U7AA 1FZJB 3WHXB 2W60A 2Q20A 3BQUA 4IRSD 5FIEA 1RHFA 4LRIC 5E6YA 1KJ2H 3BKML 4OFYD 3AMKA 4YUEL 2X41A 3R06B 5DI8B 4MXWH 2DOCA 2I5YH 5I15L 1RUPH 1KCVH 3NTCH 3QUYD 1NL0H 1HI6B 3VGHA 1J10A 5IMKA 1A9EB 4X4ZA 1LD9B 3ALXA 3N85H 4WEMB 4R8WL 1NEZA 2H9GA 1WWAX 2PYEE 3K1KC 2F19L 4Y19E 2R8SH 1LDSA 2CKBL 5DJ6A 2FH6A 3EYSL 2ICWA 2YRPA 2D4FA 1N7MH 4R90L 5IEKA 1MI5B 1FL6A 1R5WB 3GSXB 4ZFZB 4RFEA 4BJLA 2HVKB 4P3CL 1NGQL 2ZNWA 5CAYB 3QCVL 2N4IA 3KPSA 4QXUL 4URTB 3U0PB 7FABH 2WWMC 1E28B 4MAYA 2I9TA 2IADA 4QRRD 4PJDA 3ALPA 4GMTL 5MEOB 5ERWA 4JQXC 2A6KB 1JP5A 3QFJD 1MFEH 4HIXL 4XNMB 5KSUA 2NY5L 4UT9H 1E6OH 4OCSH 5EO1A 3T2OA 2DQCL 4RWYL 3LY6A 5C0RL 2IAMA 1JPTL 3WFZA 1QBAA 4FQ1H 3D0VB 3S88L 3NFNA 2BSTB 3OKLB 4ZS7H 1BBJB 1F58L 2XWBA 3IU4H 1EEZA 2YZ8A 4NQCE 5FO7B 4L4TD 3OB0K 1F2QA 4U7MA 1LO0L 5DEFB 2ZUQC 1AIFA 4N8CL 1U8LB 2FZ3A 3LEXA 2UYLB 2X1WL 3GSNB 4WCYH 2FX8H 5D72H 2CH8A 2OI9C 4WO4A 3MNVA 1ZLVH 4LL9A 3GBNL 3EOYG 3C08H 1JN6A 3MXWH 4WFED 4ZNEA 1RFDL 4AIOA 1HDMB 2PO6A 3NIGF 3SE4C 4NZRH 1T83A 1TFHA 8FABA 3EYOB 4AT6B 1YYLL 3QDGD 3S5LA 15C8H 4XP6H 4B41A 1FNSL 2YHGA 5AEAA 3P77A 1DUZA 3MYZA 1IGML 2GJ6A 4F15C 2NW3B 4U1MB 1K8IB 2D0GA 1I3GL 3U48A 3MJ9A 4RDQG 5CP3A 2XTJE 2J5LB 1QEWB 1BD2E 3LMJH 3G9VA 3RNKA 5FA4B 5EC2B 4OLYH 2GJZA 3RAJH 1CK0L 1JYXA 2XZAH 5CIPH 3SQOL 2XN9E 1YNLL 1OVZA 4GG6B 1C5BH 3KPLA 1G7MB 3PHOA 1KB5B 3UX9B 5ABDE 2Y25A 3B5HA 3DMMD 5HXMA 2LU7A 4LU5L 2XIDA 4YBQD 5BRZA 2NY4B 3DX8B 5IROC 5ETUB 2BOCB 3SDCA 4QRQA 3MRLB 1EBPA 4JFDE 4Z7QF 4DOHB 2AEWA 3D3VA 5CEYA 1XF5A 2VLKE 1P2CA 2HH0H 3VI4F 3O6FB 4YAQB 4O2CB 4OGXL 3DECA 4P46C 5DYOA 1AGCB 1IGTA 1YEDA 3EYFA 5KS9B 1CGXA 1HH9B 5DJYB 1Q9KA 1Z6JT 1V7NL 3S7GA 3MRQA 3ET9F 4F7EA 2DN7A 1ZHBA 4WW1B 4Y4FA 3VXPA 1IQDB 3OR7B 4ZD3L 5IMMB 4NRYA 1SY6A 2NXZD 4PB0H 3DPBA 4DFIA 5HYJD 5DRWA 1YMMA 1KELH 3GSVA 4LLYB 2I60H 1S7SA 1W0VB 2FHCA 5D1ZA 2MKLC 3VWKD 2W07A 2VABB 2J1KA 2EXWC 4PGBA 5HGGS 1FVDA 3RX8A 5I0DA 4MNHB 1AGFB 4JG0H 3HC4H 1MCPH 1T3FB 4LLDB 4MDIB 1CLYL 1S7WA 3BWAB 2EYRB 5HDBE 2GCYB 3QPXH 4HGMA 1JWSB 1CG9A 3MRRB 2O5YL 4X9GA 4CU8A 3ZKXC 2FHBA 4APQB 5FCUH 4Y4KA 5ALBH 3WS6A 5CJQH 2GTWA 3QDJB 2IANA 1M7XA 4R7NB 1GGIL 1J8HD 5I1KL 1FAIL 2EE6A 2VR9A 4G8IA 3MZGB 5KAQG 1S78C 5IQ7L 2DIBA 3UEZA 1Z0MA 2ICEA 2G5BA 4E5XA 2Q7NA 2QHRH 3DO7A 3TO2B 4WV1B 4NO5B 5I1EH 1FFPB 4KZEL 3CH1A 5IV2B 5FEBA 2VAAA 1ZHKB 3QXUA 5BS0D 1NFIB 1QRNA 4PJDE 1BM3H 3BGFB 3LV3A 2X4UA 4I18A 2WUBH 1F8TL 5J1AA 1PBYA 4ELMF 3MACL 4JO2H 5F6HJ 3ZKNC 2H26B 3LS4L 5BMFL 4PJ5E 3MLRH 1F97A 2J88H 3D0LB 2OJEA 3CAFA 5DVLA 4UOW0 1UXSA 1HEZA 3EJYD 5KOMC 4HUKB 4G6AC 5GS1A 5EBMB 5GRVL 4WWID 3D87B 3ZYJA 5KAQF 3QNZA 4QOKA 1P53A 3LEVL 5DMGC 1UM4L 3IDMB 1A6VH 4NN7B 4ZFGH 3HZYB 4XPTL 3F5WA 5CJ5A 5DK0A 3WD5H 4JFXB 1NMBL 5DHYA 3K81A 1BFTA 2DWEA 4RAVA 4ZNEE 2KDGA 1I3RB 1H8OA 1G7PA 1JZ8A 2DQHH 4OCXL 3S6CA 2WQRA 3FT2B 2GHWB 4OZHF 1TPXC 1NLDH 5ITFA 4HWBL 1F6AB 1F2XK 1SHMA 1LE9A 2MHAA 1T1XB 4G6KL 1T20B 4G7YL 1H15A 4HS3B 2OL3A 4CN1A 1SEBA 2ERJB 2R1XB 4LCCA 4YE4H 4YGAB 1NCWH 2ZKHH 5E99L 2N7AA 4AG4L 2NX5E 2GJ6E 2VDPH 2W0FA 5DDHA 1MPAH 3MBEA 4D9RD 4NQCB 3MROA 2H32B 4ZTPL 5FM4A 3CDGA 2BXYA 3LIZH 1KPVA 4N9GA 5FDWB 4KHXH 4PJ8C 1MJUH 1LP9F 1OARL 5L9DH 5JW3H 3U2SA 3OMZA 5MEPA 2WBJA 3MA7B 1W72L 4X6DF 2Q86B 2E9BA 5E5MA 5DRZB 2AEQH 4WEBH 3DI3B 5IESH 2QQNL 1I7ZA 1J1XH 1V5JA 5BRZE 2E6JA 4M5ZL 4WUKL 3WFCL 1HOCB 3P0VL 5FYKH 2HJKB 2EDNA 3HPJB 5IUSA 3BDBA 2VYRE 4OFVA 3GSQA 3VWJD 4MA7L 2QBWA 2I25N 2GK0A 3OKMB 3OXSA 5EUKA 1A1MB 3ZYIA 4QHLB 1J0ZA 5SWSB 1MJJB 3EO0B 3GSNH 2WBKA 2XTJB 1I1CA 4Y2DD 1A1OA 5SWZB 4OF5A 4HWEH 4LSPL 2APFA 5EU3A 5EIIB 1NFDA 2XN9B 2AJZA 4H5SB 3ZTJG 4LFHG 4J7RA 4TUOB 1N64L 1KJ3H 3EO9L 1VEPA 4KTDH 4FS0A 3D18B 5DJZB 3DETD 4YWGH 4EN3B 1MJ7H 3I75A 1KG0B 2FX7L 35C8L 5FA3B 4DKEL 1YMME 2V17H 3A6CH 4JFDB 3BN9C 3NH7L 4NYLB 1I7TA 2VLKB 3I3BA 3MLXH 4LMQE 4XRCA 5F72S 4MQXD 1F3DJ 4NQEA 4QY8A 3QH3A 1UWXK 4M1DL 4HS8H 2OZ4A 5DD5L 1MFDH 4FQ2H 5EPMA 3EUUA 1YMHA 3QDMD 2R15A 3WJJA 4MCZA 3P9WB 3RZCB 4E41A 1KB5H 1IEAB 4XCYB 1CE1H 1FSKB 4FFZL 2IANE 1U8MA 1RZIA 4QXTB 4WFHD 1MFCH 3AAZA 1JPFA 5I1HH 5DUPL 2JJSC 3QCTL 3GO1H 1AHWB 4PRIE 1MEXL 2X1PA 2UVEA 1EO8L 5I19H 5I1CL 4JGUA 3PV6A 4JREB 2W60B 2CIKA 4OCYL 3U46B 4B5EA 5HSFA 5DHXB 4GRLA 3TLRA 4PTTB 1QRNE 4PBVC 5IFJA 3JSSA 5HDQL 4YIQB 4YHKL 3VFTA 5JZ7D 5IMKB 1FN4B 3N1QC 1YPZE 4XVSL 5SX5K 5E4EB 2XA8H 3VFGL 4NJ9H 3TBWB 1TDQA 2HN7A 1HNFA 1CE6B 2R56H 4HUXA 2E8YA 5DJ6B 3F7PC 4KI5C 1YC7A 4HC1A 2BRRL 2ICWB 4KXZI 1FL6B 1XGQA 3P9LB 4JKLA 2O5XL 4V1DB 2BY2A 1AD9A 5L2KD 4QOKE 5D71L 1WQVT 3RY5A 3VXMB 5D7KE 3VH8B 1E6JL 4K07A 4KKAC 2FDBP 2AJVL 2IBGA 3H42H 2Y1VA 3FO2A 4HXBL 4PJDB 1P4IH 5ERWB 1ODAA 2ZG2A 3QZWA 1H9VA 4Z76A 5DUBA 5EDXA 5KSUB 1DN0A 4M6AA 2D2OA 2M2DA 4M3KB 4OLVL 2NY4C 2ZCKL 2NTFB 5EC1A 5T1LD 3SKMB 1D5ZA 3CVHA 2IAMB 3L7EA 1A6PA 4PJ5B 4JO3L 1EIBA 4QRTA 2VDLH 3T2QA 5IB3B 3O6FC 4CGTA 1WK0A 4Z78B 2FATH 4JFPA 1AIFB 4ETQA 1AXTH 1WWCA 1DBAH 4WW2B 4X5WA 3UC0L 3LEXB 3TA3D 2Q87A 4WUUB 1LK2A 4HK3J 4KKBD 4HK0A 5MHSE 3SGKA 2ADJA 3IKKA 3MUHL 3MNVB 3O2VH 2NY6B 1ZHLA 1JNLL 5HHME 2QEJA 5CGYD 2V7NA 1GIGH 1VGKA 5AZ2H 1X5AA 1IC7H 3F12B 1SM3L 8FABB 3ZT5A 1NC2D 1JGVL 5C0NC 4JDVB 1FVCB 3S5LB 2WIMA 3V4VL 3HKFA 3BEWB 4LLVA 2FIRT 1AQKH 4UV4L 1YZZA 3HG1E 1DUZB 2OR8A 2FEEI 2NX5B 1T03L 3H9HB 4K3EL 3WO4B 2DL2A 2YWZA 5FYLH 3RPIA 1JV5A 3D9AH 5EWIL 1A7RL 1ZOXA 4APQC 3PDDA 4P2QD 1NFDE 2C3HA 3FL7A 4WWKA 3W9DA 3RZWA 1YEEH 2AXGB 4IDLA 3QNXA 1EA9C 3M8OL 4JM2A 4I3GA 3V6FB 1JHLH 2CXGA 2HT4C 2W92A 3PHOB 4PGZA 3FHQA 1T1YA 3P4MA 4U6YB 2KQNA 1KIUA 5AWNH 2W9EL 1B88A 3WSQH 1FVEA 2HFEB 2IALA 4XP5H 2OTUB 4L9LA 1Q1JL 1YEIH 4WV1C 1ZGLP 4MQ7A 1W0WA 3SDCB 4F33A 2H32H 5CEYB 4BKLA 4Z7WA 1NFKA 1XF5B 4PTUB 5ALCH 3FN9A 4AH2A 3BRDA 4MXVE 5DURB 1PVHA 1TCRB 4ERSL 4NM8L 5ESAA 3RQ3A 5JPMA 1GHFH 3CMOL 3HMXH 2VLRD 5I9QB 3B6SA 2WIIA 1IGTB 2UVFA 4FFWC 3SEPA 4E41E 4ONFL 3VW3H 1J1OL 4C54A 4EI5D 4P2YA 1W2KT 1MCBA 3SDYH 4F7EB 1IC4L 4FQXA 1V8HA 3VXUA 4Y4FB 3VXPB 1PEZA 3GKWH 1EK3A 5GS2H 3NIDE 3G5YA 5GGRA 3S3PA 1QFWL 4NN7C 2HMIC 3GSOA 4EBQL 1ADQH 1RZFL 3QUMB 1HYSD 5KW9H 4Y5YB 5MENA 4R7DA 3BDYH 4GMSH 5D7SH 4WTZA 3U79A 3UYRL 4TSAH 3LKNB 1X5LA 4Q0XL 1S7WB