1J7VR

Human il-10 / il-10r1 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
b'GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-10
publication title Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 35
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR01
1ORSA 3D39B 3OTTA 4WEBL 4Z7VF 1I8KB 1BHGA 2D31A 5DJZB 1FG2A 2HKHL 4PG2A 3BFOA 4ETYA 2GSGA 3LOWA 1FC2D 3V6FB 4UBDD 4MD5A 2IWGA 3PG2A 1OT2A 3CFCH 4JB9L 4X6DB 4DUVA 3ARYA 3UTSA 2YZ8A 4U1KB 4IS6B 4PGBA 4BZ1H 4BSVA 3O2DH 2Q87A 4U1NB 2VDLH 2XKUA 1T5WA 3MFGB 1HQRB 2VERN 2W9DL 1QQDB 3ARBC 2IF7A 3W11D 4HKZA 3IFNL 2GTWA 3RDTB 5HGHA 4WWKC 4OLVL 2AJ3B 2BNQA 4WI4A 3CVHH 3HNSL 1FSKC 1HZHL 3X3FH 1XFPA 4ZOEA 2BRQA 2E6QA 3IS0X 4TRPH 3TA3B 3TN0B 4ODUA 4R4FH 2MPAL 4MDJA 4NO0A 4NWUL 3BDYH 4P23C 4O00A 2OCFD 2HJKB 1UJTA 4GRWF 1DZBA 1ZGLP 4J23A 4IOIA 1BPVA 3VCLA 2NY1D 3EAKA 1OM3L 5FHAH 4KTEL 4P3CL 4YAQB 4DN3L 1KENH 3FB7A 1CT8B 4LKCA 1CDGA 2UYLA 4L3CB 3BIKA 5I8KL 2CDFA 4ZPTA 1MJJA 2F53B 4HIIB 2LU4A 3ULUH 1S5HA 2G75A 1R5WB 1GAFH 3F58L 3RGHA 2DQGL 1JN6B 4R8WH 3NABH 1I8MB 4XGZA 3GIVA 4YBLB 1CD1B 4GXUM 5D7JB 1U8NB 1CLZH 3T8XB 1IM3B 5EUOE 3JWOH 1IAOA 2ED8A 1S9YB 4YFLI 5HDQH 1QFPA 1JK8A 3ZTJG 5ISZB 3STLB 3LN4B 3R4DA 4NQVB 2F54D 4KHTH 3T0EB 3HNTL 3H9SB 2HVJA 1HH9A 4BH8A 3FB5B 2PYED 1FNGB 1MJ8L 2LTQC 3ALXA 4HG4K 2HJFA 5J6HB 1GZPA 5DK2A 4ZUTB 2E7LC 4X9IA 3C5ZC 2V5SA 2N7AA 1IVLA 5I2IA 1RVFH 3HC3L 3IDMB 5FDWA 4JFDD 4XPTH 5DQ9A 1U93A 1X5AA 1UA6H 3PWUA 4QTIL 1N59A 1N2RB 4DVBB 1DQLH 3IXAA 4P4KC 4ZQKA 4HCRL 5E56A 1E6OH 1TJGH 5FYKU 5DJ2B 5DD3L 3VXRE 5DMKB 5KVFH 5C0FA 5GS2H 4Q9RH 3HRPA 4CBPA 3AREB 4K7FA 4R0LB 2M26A 1FPTL 4OIBA 4BH7A 3RKPA 2FX7L 1NKOA 5J8OA 2WNGA 4C56A 1JPFA 4JFXB 1R5VB 2UZYB 3C09C 3FFCD 3ZYOA 2G9HB 3UTPE 3H0TB 5I1LA 2J2ZA 4LVNC 2ITDB 1WCBA 1W2KT 3BDXA 3V4UL 1JZ6A 1Q0XL 4QXTB 5L9DL 5BS0D 4KMTL 4PLJD 1DDHB 4GUPB 1KXTB 4KY1H 4FZ8H 4Z5RB 5DVNA 1A5FH 4HUXA 4MA1B 1EEYB 3FMGH 2E7BA 3B9EA 2AQ3A 3DBXA 3TESA 5DVOA 2EC9U 2ZCLL 5LGKA 4G42A 2FX8H 1GZQA 2YOCA 3K0WA 1YNKL 3OHXB 3NVQA 3MRCB 4R9HA 1A6VL 5C70A 5IF0B 5TQ2L 1FFOA 2DD8L 4KDWA 3RWIA 3SE3C 1MREH 2VDKL 2Q6WB 1UXWA 1HYSC 3FHAA 2YBRA 2YA1A 4J3SA 4GRWB 2YWZA 3K8MA 3RAJH 3B8YA 3IU4L 1P4LB 1AD9A 4MCYA 2JB6B 3ZE1F 3U6RB 5KOVC 3L3KB 5ICYB 2PUQT 3E6FB 2NX5E 2F58L 4LARH 2ED7A 2ZUUA 2OL3L 4M5YH 1CU4H 3KLDA 4HK3J 4ODVH 4FN0A 1WBXA 4UT7H 2WBWB 5CP7A 5BRZD 1F45A 3SKMB 3DSNA 4NC1C 3KLHC 1MSPA 5DDHB 4XCFH 4JFEA 1T20B 4PTUB 1OW0A 4XRCA 3O2VL 2AK1L 1MJUL 3O4LA 4XCCH 2HTLD 4X83A 4OGYH 3OX8A 5GJTH 1QOKA 3EJYC 3MRPA 1TDQA 3LHPH 4PREB 3F5WB 4OLXL 1UXSB 4QOKD 1FYHB 3BD3A 4MD0A 1EHNA 5EU6E 1F11A 2MSPA 3GB7A 4TSAL 1C5CL 4D8PB 1JTOA 4PGEA 4LGRB 3PWNB 1RHFA 4UNTA 1KJ2A 5CGYD 4Y2DB 3VXTB 4YDJB 3HS0A 3ZO0A 4G6KL 1A0QH 2GAZB 3QDGB 1X6NA 4BUHA 1UVQB 2R1WB 1WF5A 4H25B 2NY6D 4X6BA 2NNAB 1NGQL 3GJFH 3S97C 4RGND 1NMAL 5DXWA 3MNWA 4QWWC 1ZWIA 4Y4FA 3RGVD 3BW9B 5HYFA 3QO0A 3M1BB 4JREC 1WQVT 1Y6MR 1JWMA 1CN4A 3EGSA 3IDNB 2OR8A 4G8GB 3ZSSA 2H41A 4JPKL 1RI8A 1M71B 4GBXD 1FFPB 2ICWJ 3VGHA 3QA3A 4ZS6D 3UP1A 3ARSA 2IC2A 4KKCC 4I2XB 2QHRH 2IANB 4V1DD 4LKXB 3B5GA 4WUUA 1YEFH 3ET9F 4KVCH 4K2UH 2CSPA 4G6JL 3I6LE 4U0RB 1LNUB 2N4IA 1MHHB 5JW4Q 4F57L 4F58H 1T7ZA 4ZAKD 1DBBH 4FQJL 2X70B 2EE6A 3HI5L 3GBLA 2OR7A 4R90L 2WIMA 3UJIL 5HVHC 5GSRA 5DRXA 5DMGD 2VDPH 1ZT4A 2VXSL 5D5MB 2Q8AH 5ACLA 4P9ML 2G2RB 3VRJA 3O45A 4U1HA 5CBEB 4LDEB 3CFDA 1OGAA 1YN6A 1U95A 4JR9H 3U36A 1XCTA 3REVB 1RUKL 3D18B 5FM5O 5F89A 1PEWA 1N5AA 3WN5B 1G9MC 4BSWA 1N0XH 4PRHB 3G5ZA 1INDL 1QPPA 1KCUL 3HN3A 1T22B 3TLRA 1E0OB 1DANU 1QHPA 2B20A 5FGBA 1AXTL 3HCVB 4NJAH 5CJ8A 2ZUVA 4HUUB 3WUWA 4N8VG 1S9VB 1AGEB 4NQCB 4YFEA 1LE5A 4IRJC 3P0GB 4PPTA 2AGJH 3OAYH 2R1YA 4M5ZL 8FABB 5EPMB 4X5XB 1JFQL 5SX4I 5F3HA 2X1OA 4WGVB 4ENED 1YC8A 2VDQL 4P59H 3GMPA 5IW6A 4P5KB 1QEWB 5C09B 1DLFL 1NCBH 2HFGH 4LRIC 2QBWA 3MV01 3S5LG 3W0WA 2AKRB 5I8OL 4APQC 3D87B 5E95B 3TCLB 1WAAA 2AJYH 1QFUH 3BJLA 5CS7A 1J11A 3NA9H 3RWJA 2HLAB 5E8PB 3T3ME 5CIPB 2R0WL 4JN2B 3U2SB 5E6ID 2WUCH 4LCYB 5JUEH 3VJ6A 2PO6C 3S3JA 4LSQL 4WI5A 2XNAA 3G04A 3U4AA 3HG1A 5JLZA 3HAEB 5INCA 7FABL 2VDRH 1IGIH 3B6SB 4EN3A 4OI9A 3EUUA 1LO5A 1CLYH 5FKPA 3QUMA 2YC1A 1HCVA 4NO3B 4QRPA 2I9TA 5A1AA 4UQ3B 1X5HA 3PL6B 5EO9B 4PRIE 2UWEA 2DDQL 4GXUN 5IQ7H 1GOHA 4P57A 3EHBC 2WP3T 3EOAA 2EXYC 5HTSA 4PV9A 3D0VB 4J7RA 3RA7L 3FTGA 2X10A 3RJQB 4MMZC 5HI5C 2X4TA 5E08L 3MXWH 4GMTH 4DZ8B 4QT5B 1EFXD 4UDUB 4WTZA 5E5MA 1UZ8B 3DX7A 2XRAH 3IAQA 3I6KA 4GAGL 4OCNC 3QNZB 4O5LL 2EEDA 5DI8A 4HK3N 4J3TA 4LSVL 3DUHA 4M4RA 5DS8A 2NLJB 5TGBA 1R3JB 4G9FB 3MLVL 4AEFA 1RUQH 5FEBA 1CL7I 3FO9B 1AE6L 3BVNB 5JXAL 1EGJA 1IFHH 4OAWB 2J4WH 3Q6GL 2WINA 3QG7H 5JZ7C 4Q9BA 1LDPL 1IBGL 2D0FA 5IJKA 3VXOB 1NBYA 4ISVA 2YMXL 1F6LL 4S1RL 2IGFL 4J6RH 3T08A 3NN8B 1QR1A 1HNFA 1BVKA 1FO0B 3MUJA 4KHXL 5ECJE 3QQ4A 4OD1L 4F7MA 1NJ9A 3EYQC 3OKMB 4ZFZA 2P47B 5CILH 4HZLB 5J9PA 3G5VA 4MD4B 2I24N 2ZOLA 2OTWB 2IFFL 2R4SH 1EHXA 3MO1B 3H9HA 5EWIH 3GMMA 4XP6L 3C87A 1U42A 4M1GH 2J88L 4PJGB 4LBEA 4PJ5A 1PLGH 3TZVC 4CNIA 4LRNL 2FJFB 1RK1B 2HT3D 5J13B 1JV5B 2MQ0A 3WXVH 1BVLA 3MJ8B 5TE4L 1NGXB 2YK1H 2D7PA 3EDEA 5FUOH 3IETA 3X11A 4LU5H 4PJAB 5JQ6H 4HKXB 4FNLH 4POUB 1BM3L 1A64A 2EH8L 4NKOB 5F96H 3CAFA 3OKOB 1PGRB 2Z31C 1WFUA 2VUYA 2VLJE 5KSAC 1PKQE 3ARTA 2YPLD 3P3YA 2Z9TA 4PJCE 1JGEB 2DQDL 2Z0BA 1BJ1J 2VRAA 4NZJA 3CVHB 3CFBA 3MGAA 3X14B 2CK2A 3WHE0 1G7HB 1N3NB 4PY7A 5D1ZB 5GRZA 3MUZ1 4Z8FH 1KGCE 3MLRL 5KS9B 1ZT7A 4XBGA 1S9WB 2VQ1A 3GBML 4Y4KC 4NNXB 1V7MH 2ERJB 4WW2B 2AEWA 5KW9H 5FOBA 3UDWC 1X5ZA 5I17A 4YHLH 5BV7B 4TSBL 2UV3A 4OJFL 1RZKH 2XPGB 5F88A 1MFAH 3W39A 4X8XA 1BBJA 1J8HE 1NLDH 5IFAL 1UH2A 1WISA 3WO4B 4LCIH 2V9RA 4IRSA 3KPRA 1OSZB 2A6IA 2A77L 3D5OF 4AIXA 5DZNA 2XN9B 1H0DA 2GFBB 3FAWA 3SPVA 3KYKL 3UO1L 3DVIA 2J8HA 3HLAA 3CFEA 4J3OC 5HGAB 3NCCB 3TPUB 3V0VB 3FONA 1DUZA 4ELMA 5HYSA 5JIHA 1RFDL 2AXJA 1OLLA 4XNMB 1MAML 4LFHD 4ZFOL 2AK4A 1UCBL 5C9JA 1U58B 4ETQA 5E4EB 4KK9D 3RWFB 1J88A 3TT1H 1MFDH 4CMHB 3VDBA 3JUZA 1KEMH 1FN4A 3ARFD 1F4HA 4X6EA 3U46A 4GG6E 1GXEA 3Q3GA 1OAYH 3QCTH 4I3GA 4J12A 3U0TB 3UYRH 3L7EA 5DJ8A 4K23L 1GC1L 3VXME 1AIFB 4OCXH 4M8QB 4JKMA 4YC2C 1A7QL 1LEIB 5IESH 5E9DA 2D0HA 1ZLWK 4M6ML 3BD4A 1S9XA 2DTSA 1FE8H 5F9OH 4HC1H 5JTWA 1YYLL 1A21A 2Y25A 2DMKA 1PY9A 2X4SB 4JY5H 4J3XA 1N8ZB 4I0PC 4ZSOE 2ATKB 3GI8L 3PGCB 5ANMA 1FNEA 1MJ7H 5DFVC 3SGEH 4JM2F 1FFNB 2X7LA 5JA9A 5JW5B 4P2RE 1AQDA 3KYAA 4M7ZC 5DQDH 1JTPA 1KNOB 5EU7E 2BVOB 3VG0L 1UB5B 5D2NA 3O11B 3MRGA 3D85A 2APBA 3OKNA 4MS8C 3SE8L 3OXSB 3L5IA 2ZCKL 2F15A 3SDDA 4GAJL 4WU5B 4IIQA 1NCNA 1SY6L 4X9HA 3T04D 2DICA 1VFOA 4U1GB 4NJ9L 3DSFL 1BAFL 2B8OT 1BLNA 3C8KB 3LCYA 4N8CL 4DZBA 5EIQA 2JJVA 4OSUL 4XMLH 4NN6B 5E2WH 4EUPG 5I1AA 2AXGB 3NIGE 3E1F1 3BKJH 1F3DJ 3U7AA 2A74A 3LD8B 1LO4L 3Q6FB 3EJJX 3MV9E 4ZXBB 5IBTH 1RIVL 1FNSH 1SYVA 1WTGT 3FN0H 4PJEF 1ADQA 3TBSB 4NRZB 2YD1A 4PJ8C 1CDUA 1H9VA 5B3NA 3QUYA 3KHQA 2DTMH 4K3DH 1C16A 4PJFE 1F97A 2XG4A 3WSQL 1DBJL 2GHWB 2QQKL 3PDGA 4KDTA 4CL7A 4L9LC 5DJXA 3FOMA 2JELH 5HDBF 5GGTH 5JPMA 4M6OL 3MCKA 2BHZA 4Z0BL 3QIUB 2EE3A 4OLWH 1VFAB 1F90L 1XIWA 1UB6A 4YE4H 4AJ0A 1RZJH 4HJJL 1GGCL 4TSCH 3U82B 1G7MB 5DUPH 2J8UB 5ADPH 2YRLA 1U41A 4ONGL 3CCHA 4YPGB 1A6WH 2HLFC 1WWWX 5IHUL 5C8JA 3SDXF 2BZDA 5C0GB 4P9HC 2DWDA 5CUSH 4HKBA 1JNNL 2E6PA 3W81A 1D5XB 2MKLC 4YPJA 3VRIB 5I1KH 2APFA 3UPRB 1ND0A 5TJWK 4X99A 4HXBH 5GISH 3BZEA 1BZ9A 4CW1B 1O7VA 4MQSB 1KJVA 3R1GL 1BFVL 2NZ9D 5TE6H 3UTPD 2VLKB 3JVGA 2LVCA 5HHOA 2FBOJ 2Z4QA 4RWYL 3MBXH 4MWFA 4JAMA 2BRRL 1EUTA 3NZHH 4M1CD 5AZ2H 3WJJA 4C55A 1I9IL 2AJZA 1NLBL 3BKMH 1CYGA 5IWLC 3EDJA 4LSSH 3WFEH 4L29B 1YEDA 3WS3A 4XNQB 1I1FB 1EJ6A 4DTGL 5E00A 2XFXB 4LLUA 1ZS8B 3BGFC 1GPOH 1DE4A 4Y2OA 4KQ3H 2BNQE 5EOTB 1YNTA 5MERB 4CVWA 5HYQB 1NFKA 1D6VH 2OXHA 2AEPL 2ADGA 5DJYB 1MWAA 4U7KA 3GDBA 2VDNH 3DYPA 5FO7B 3OKDA 4RRPG 1BD2E 3B9DA 1OF2B 1Y18A 3I2CH 5GRJH 1E27A 4JGMA 3QFDB 2YUZA 4FXLA 3FJTA 1URLA 3LZFH 4GKNB 4QHLA 1XF2B 5EUKA 2UY6A 1P4IL 3WIHA 5C7XL 3IJSA 3MCLL 5IB2A 5SWSE 5BZWB 3TA3C 3TN0C 5L2KB 1KEGH 1A3RH 5GS0L 3SKOA 3ORJA 5E99L 1TQBC 4RX4D 2X4OB 4K8RC 5IFHH 2LVEA 1TETL 5F97E 4Y89A 1BIIA 3PDOA 2FGZA 3MV8B 4GJTB 5DURD 4FG6C 2BVYA 1ES0A 2WM0A 4Z95H 2X2YA 5I66A 3PABA 3LKNB 1ZANL 1KT2A 2FH8A 5E70A 4GRLA 4HT1H 1H5BB 3HFMH 3NIDF 1NANH 1UYWH 2YD7A 1NDGB 4NQTA 4C4KO 3MBEA 3UBXG 1FFQA 4YHML 1YMHA 4NQEA 4I0KA 5E03A 4PJEB 3JV5A 3MLUL 5MHSE 3THMH 2GJZB 3LEVL 4HS6B 2X6MA 4ZPVB 4YBLC 5HSFA 4LLAA 3T1FA 1IEHA 4FQXD 3T4YA 4HQQL 1H3PH 5ESQA 2P5WA 1RMFH 3K2MC 1UM4L 2VN4A 1MF2L 1MHPH 2A83B 3T0EC 1C12B 4NYLB 2EIBA 3CZJA 3LQZA 3FO2A 2Y07H 1U8PA 2F54B 5KN5B 2X4NA 2PYEB 3O9WB 3DJ9A 4NRXA 1IAIM 3L5WA 2ORBL 4UMGA 4NSKB 4PJ9C 5I1IH 2BXZA 5GRUL 5BW7A 2G60H 3I6LD 1KJ3H 3EFDL 1R0AH 1TNNA 3IDYB 1A6UL 4JFDB 3FOLB 1RZFH 3KPTA 1YEEH 1QNZL 2YD6A 2I25N 2FB4H 3FO1A 3UMTA 4XP5L 4Q9QH 2W91A 3RWCA 1KN2L 4KI5D 4DEPB 3T65A 5AD0B 4X6FA 4XHJC 3GSQB 3ZHDA 4XPFH 3CVIL 2IPTH 1H8NA 2YEZB 1NFDF 2MCPL 1G6RA 2QSVA 5EO1B 1PX3A 1G7PA 2I26N 5DJDB 4L8SC 1CK0H 3FFCB 2Z93A 5LGJB 4FA8A 2FL5B 3EZ8A 4JB9H 2ZNXA 2VLLB 4M7LT 3VWJD 3ZDZF 1XF5B 1AXSA 3I6GB 1I1AD 3IFPA 5BS0B 1T80A 3HZMA 4NDMA 3L6FB 3N50A 3NCJL 3DI3B 2FSEA 4PGCA 2W9DH 2ZSWB 3IFNH 3RZWA 4N8VA 4O2FB 2HWZL 1GRWA 1KJ2L 5DTFA 2CKBL 1M7IB 5T1MB 1HZHH 5IGXL 3S96A 1PYWB 4BZ2L 1LK2B 5AZEH 1IM9D 1MCDA 3JUYA 5DD0L 2IJ0C 2P46B 3MROA 4F3FB 2DQIL 2YD5A 3DX9A 2PYFB 3R06B 4NWUH 4X8JB 1XGPB 2WWMC 3FCTA 2JE8A 4JHZA 5MEOB 3WKML 3S5LA 1W0YT 4G6ML 3JWNC 4PTTB 4KU1A 1TCRA 1DQDH 5K9OB 4KK6C 3NCEB 2XQYK 2BVQA 3P73A 5MENE 3RVUC 2K7QA 4KTEH 4P3CH 1KCVH 1L7IL 4JHWL 2DQCL 1UC6A 4JFEE 1NC2A 1P7KA 4KROD 4MZ3A 3B9KD 3I3BA 3MRKB 1T4KB 5C07D 3GRWH 4OFIA 3P0VL 1U8HB 2ZG1A 1QRND 4U6XA 4JG1L 5FUZH 5C0BD 1H3GA 2H2PD 1OP3K 4DCQA 5ABDE 4JDVB 1OP5K 5BRZB 3L9RA 4OZHB 3RVXD 3TIDA 4G8EA 4PRID 5F7UA 4OCMC 1YMME 3D69B 5EU3B 3QPQC 5I76B 5DJ0A 3O3UN 4CU7A 4LDOB 1H3XA 4NUJA 1J05A 1XT5A 5E7BA 1HHGB 5EIIB 1FYTA 4HEPG 2FZ3A 4QHUB 1CQYA 4FZEL 12E8H 1NUFA 4GFTB 1I7RA 5A2KH 4M7LH 3ARBA 5F9DC 5D7IB 5CJOH 3MRQA 2VABB 4QOKB 5TDNA 2E7MA 1D9KD 4MSWB 3HNTH 4PP2A 5IBUG 3VXSA 5EULV 1DQML 2X1WL 3ZYZA 4N0CC 3BH8B 1Q94B 3FT2B 4L3AA 1X5YA 3AY4C 1MJ8H 3G6JF 1FH5H 4PB9H 1JUFA 3ZHLA 1ZHBA 4P23A 5DQJA 5DVMA 2XWJA 4QF1A 4XCYA 1EHLH 1LO3H 4WHTB 2HT2D 4RGNB 1ED3B 4UQ2B 3DUUA 5GGSB 1U3ZA 1SEBA 3RGVB 3QI9C 1FL6A 4MHHI 3MV7B 1L4IA 3ABZA 4M93B 4DKEL 1S7RB 1Z9LA 2BOCB 1CR9L 4HCRH 1C1EL 3O3AB 4GBXB 3MREA 5DD3H 1S7XB 2Y7QB 4ESKA 3G08B 4V1DB 1J1PH 4MAYC 1HKFA 5DJ6B 4CRPA 1SVCP 2FX7H 3VXQA 4FQHB 4Z7QF 1JIBA 2RFXA 1OTUC 2CDEB 3P11L 5TE7L 4ZAKB 4YIQB 3LDBB 5HYJD 1OAQL 2FEDD 1FV1A 4HAGA 5EC2B 3VDAA 3GUTB 1G7LA 4PJDB 4MNHA 1BQLH 3HE7D 1NGYB 5HVGB 4ALAL 5TDOB 4HJGA 4X4XA 3QZWG 3VFMA 1Q0XH 4AM0B 1CICD 2QR0A 3S4SB 4CJ1A 4M61B 4WCYL 3GMRB 1HHHB 5C6TL 4YO0B 2QEJA 4GW1A 3BYYA 1JYXA 3QUML 3QAZC 4HW6A 4TPRL 3TBWA 5J0BA 1A1OA 1T1XB 3TBTA 4P5TC 4UIMA 1SJXA 4H8WC 5IK3A 1XCQB 3SJVA 1HWGB 2I07A 5LCVL 1YNKH 3QSKB 1KGCD 4HHAB 1FRGH 4Z7UB 1A6VH 1V3MA 2DD8H 2OTPA 2A9NL 3ZE0F 4NWTH 3C9NA 5KSUA 4Z0XA 3W0WE 4MNQE 4LCCB 1U2HA 2A38A 5F7LB 1QUNA 3AAZB 3IU4H 1R24B 3DI2B 3VI3F 2YUWA 3N1PC 1BBDH 3B2UC 5I73B 1X5GA 3WHXB 4ZO8A 2VO5A 1EGJL 2F58H 4LIQL 1P7QD 5BVPH 1Q9WA 2OL3H 4ZO9A 3H42H 2P7TA 3LRGA 4CVZB 2DWEB 3CGTA 5I8CB 3MYJB 2VXTH 4Q9CA 3HG1E 5CMAB 2DYPD 5SWZD 2D7TL 3H3PH 2BJMH 3FFDA 4JCMA 1IGML 4YHKL 5I8EB 4Z6AT 5ICZB 1HXMA 3UJJH 4IEFB 1NAKH 3ARPA 1IL1B 2UWEE 4K7PL 4RSVA 3NFPB 3RVTC 5E6IB 1NBZB 1KELH 5EC1B 1TPXB 2VR9A 3NMEA 1TZIA 4GT7A 4OIAA 3OR7B 3IFOA 1KB9K 3PL6C 5IB3B 3VXMD 3O3BB 2JCCF 3GIZL 3FT3B 1TCMA 3MUGA 4RMQA 4TNWK 1DVFC 3KYMA 3HZKA 4LIQE 3U0PB 1KG0B 1YC7A 4X0KB 1J87A 3TVMD 3WFHB 4JJ5B 1XZ0B 4MJ4A 1TTUA 2BCKA 4ONFL 4ONOA 4UV4H 1D5ZA 5GGRA 1ZSDA 1C08B 3IXTB 1O5DT 1UJ3C 4EVNA 4OCYL 1AR2A 4XVTH 3UTZB 4AQOA 3CFJB 4UB0H 1JWUB 5J12B 4JDZA 4P2RD 1RULL 2B4CC 5E24E 4UTBH 2EE2A 1AC0A 2J12B 5I16A 3P77A 4P5MB 3L95A 1KTLB 3V52L 3BO8A 5IMOB 2H26B 2C3VA 1U9KA 1IARB 5FFLA 5FHBL 1RIHH 2ZWLT 1K6QH 3BRFA 2C4FU 2OX5A 5D8JL 4PB0H 2ZZUT 4PS4L 4RA0C 5C08E 4KZDH 4PJ7F 5CGTA 2FRGP 2W0LA 2X4UB 5C71A 2X4PB 4MNGA 4L8DB 3LQAC 4RNRB 3ZT6A 4P9MH 1HXYB 4GAYB 1PSKL 3BDBA 1ODAA 5AEAA 4UILL 4BQ9A 2KZ1B 1QLRB 1EIBA 3LV3A 4N90D 1RUKH 4XVUD 5K9KA 4CADA 1BOYA 2A9ML 4PJIB 1ITBB 3KJ6L 4XXDB 2NTSP 3AU1B 3BUYB 3LSOA 4YK4B 4EUPA 3QEGL 5DO2C 4BFEA 2X1QA 1LP9F 1AXTH 1OT1A 2PW2B 3OXRB 1S7TB 2IH1B 4DK3A 3K80A 1N64L 4HDIA 4HH9A 4F7CB 1ZT1A 32C2A 4M5ZH 5IVXA 5EUOF 1QSFA 4Y4HB 4JZJA 5DD6A 4EJ1C 2V2WA 3LKOB 4RFNC 2QTEA 2OJEB 1NL0L 5D2LB 5SX5K 2VDQH 3L1OL 3LPFA 1JVKA 4NOFA 5EB9A 2SEBB 5EDXA 1HINL 5F1NB 1OAUL 1UZ6E 4ZS7L 5I8OH 4XH2A 2VDOL 5LGHL 2ERJC 4WW2C 4WFFE 4J4PD 5DRWB 3QCVH 2FX9L 4Y5XC 3QG6B 1G9NH 5BV7C 1I3VA 4LK4A 3GI9L 2H6PB 4A2MA 1FVCA 1CDHA 2QADB 2ADFH 5C0CA 3C5JB 3MRMA 3U4EB 3WO4C 2AK4E 5A16B 2RBLA 4TVPH 2QLVB 3KDMA 1P9MA 4JFFA 4NC0B 1CFQB 1YEGL 1MVUA 1EO5A 2VZUA 1TZHA 1AR1D 1Q9KA 4L4TA 4W6WB 7FABH 4JO3H 5CSBA 1B2WH 1MRFL 3HPJB 3O6ML 4G80A 4HIXL 5F7YC 3SGDH 4QRTB 3UTSD 2P45B 2NY5H 2X4RB 2VE6B 2PNDA 2DL9A 3WCYA 1A7BA 1QRKA 5FF6A 1ZGLB 2WSKA 3RNQA 1NPUA 3KPSA 1NCAL 3NTCL 4HPOL 5I6XB 3SDAA 1WWBX 3MJ9H 3KYOA 3TF7C 2E5EA 2R9HD 1BOGA 3FQNB 4MXQD 5E08H 1IGTB 2VITA 4IRJA 5KVMC 4MJ6B 2BNQD 4I5BB 4PBXA 2W65A 4PYGA 5BQ7B 3AGVA 3B43A 2P8MA 4KFZC 5B22A 1I8IA 4W68A 2NY4C 3PQYA 5DHYA 1TTFA 1UEMA 1WIOA 1LDSA 3CXDH 2GW5A 3MLVH 5ANME 4NO0D 1FNHA 1ADQL 1AE6H 2Q7YB 2NR6D 4Y0GA 3E6HB 2BVEA 1CFTA 3MNZA 3Q6GH 5HGDA 1RJYA 4APQA 1LDPH 4L3EA 1U8MB 2XWTA 2IGFH 5D96B 4RRPA 2WK2A 5SWSD 3S36X 1FGVL 3DYMA 1CGYA 2GSIB 4KHXH 4RGOL 5CLWA 2V7HB 2FR4A 4IDJH 4ZFGL 3QUZB 4QHNA 3BQUC 5CAYB 3TEUA 1CI5A 3CSYA 5FYJL 1QFOA 4KMQA 2PO6A 3QPXL 4EI5D 4JDTL 5C9KA 3IDGA 4FQ1H 5E2VL 1MCNA 3OV6A 2J88H 3B4NA 4OCLC 4X7TA 3D39E 5DT1L 4OV5B 1VEOA 4OKVA 1AO7A 1V7NL 1VEMA 2ICEA 4TULL 3LB6D 4XI5D 1RAMA 2MHAB 3G5YB 2EC9T 5TE4H 3RX8A 3MRIB 1QBAA 2QSCL 1TQCB 3EO9L 3JTSA 4RCAA 2QJDA 4ZD3H 1F5WA 3GSWA 4OFDA 1OTSD 3QJFB 3FQXA 3V6OE 3PWPB 3DXAA 2EH8H 4QHKI 3KPOA 1EV2E 3UBXA 4U1GC 3RUGF 2R2EA 3GJFA 2WBKA 3GNML 5FCUL 2DL2A 2MOVA 1QBLL 3T0WA 1H3TA 2B1AL 2DQDH 3OKEA 4NO2A 1BMGA 1I3RB 3OGCB 3RU8L 5GS0D 5H94A 4P3WA 1QG3A 2YRPA 3QIWB 4HIJA 3WLBB 3DNKA 4WNQA 3EYFA 4UIKL 5FYJE 3NFSH 3QWOB 4JRXA 3VD7A 5J89A 1WIUA 3CSGA 4HK0B 1IE5A 5L2JB 5HPMB 2YUXA 2ICES 3SEPA 2BVPB 3QIUC 4NQSB 4TSBH 4KKLC 3L3IB 4QHMA 5JO5A 4L8BA 1FNFA 4IRZL 3DETC 3SE9L 2CLVB 3RY6C 1X5IA 4M6NL 4C56D 4WFED 4DWHA 2IQ9L 5EN2B 2X42A 1Z9SA 5EZOL 2CLRB 5EOCH 4G6AD 3LY6A 4EIZC 4FQ2H 2RJMA 4JFQA 2R0LH 1K8DB 3UO1H 1FZMB 1DBKL 2F53E 1P1ZA 3B3IB 4AT6A 1RFDH 3LH2L 1IEAA 5J6GA 1HKLL 3E3QE 3ILPB 2HJLA 2VN7A 5AYQA 5JOFA 2Z31A 3DARA 4Z7WA 3TYFA 4PJXF 2EDJA 3VFRA 3STZA 5KSAA 5DFWH 5AWNH 2HVKA 3RPKA 4F7PB 2Y5TA 6CGTA 2NCMA 2H3NA 5GS1B 3MACH 1FBIH 5TF1H 3GMOA 5JDSA 1KPUA 4HIHA 2B1HL 1IQWL 5ITFA 3H9SE 5DD5H 1I3UA 3BIBX 4K23H 1GC1H 3A0OA 3RVVD 5L0QB 1UADC 2BSSA 3IDIA 3T0VA 4ZUSA 1WBZB 3P30L 3MOAH 3UYPA 5TPWL 4J8RB 4NKMA 2PN5A 3NCFB 3K4AA 1BJ8A 3CPLA 3V95A 3UDWA 5BJTA 4OLYH 5FK9B 3TO2B 5ALCL 1BZ7B 4X6CA 1EEUA 3HZVA 2M8XA 4ODBD 4GKOA 4PUBH 3GI8H 5A2LH 3HPLB 5GGUB 5AAMA 3INUL 5F72S 2FJHB 3W11C 3VG0H 4JRYA 5JORA 4NO5B 5LXGL 2ADJA 1DUYB 2R4RL 1KIQA 1F3JA 1HSBB 2NY7L 4X4YB 4JFED 3RBSA 2B2XH 3SE8H 1CXEA 2ZCKH 3GSNA 1NCDL 5IKCA 1INQA 4OLZH 5DRNB 5F3BA 1CTNA 4YBQD 5D71L 4NN5B 2E7HA 3LMJL 3LKPB 4NJ9H 3ZKXB 1BAFH 4R6UA 5DURB 2NY1C 4XTRD 3QQ3A 3RZCA 3OPZH 3L3JB 1MRCH 4OSUH 1A6TB 5IFJA 3Q5OA 4FFWC 5HJ3A 5FV2A 2BMKB 5ID0A 2MMXA 1LO4H 4YR6A 3EOTH 4XNZB 4XVJH 4HS3A 5EFIB 1XAUA 1YEJH 1G6RL 1IGYB 2GCYA 4Y4FD 5EOQL 3HI6H 3ZMRA 1F58L 3WSQH 1DBJH 5CZXD 1BZQK 3S37H 1I7UA 3JTTA 3ARGC 4TTGA 2CRZA 1Q9LB 2Z8VC 2FIKA 3LKQB 1JYVA 5KSBA 2EECA 1BFOA 4P48A 1D3CA 4U49A 4WUUD 4E9LA 1BQHG 3ESVF 5FM4A 2OL3B 1F90H 4PJHB 5E5RB 3IGAA 3KG5A 1FZOA 4PV8A 4U31A 1WZMA 5AAWA 4D94A 3HNVL 1KPRB 1N7ML 1SYSA 4N5EC 4NRYA 2H9GA 3UBXI 4HUWA 2PF6A 3BHBB 4NFDA 1IGJB 1KTRL 5IHUH 5MP6L 1DBAH 4YHPA 1OGAD 4H26B 4PG9B 1X5KA 2H32A 4ODHL 4B7LA 3BAEL 3F12B 3PWJA 4Q97A 1BFVH 1V05A 4ZNEA 4WHCA 1VKXA 4U0QB 3KR3L 4RWYH 5GIRA 4X7EC 1XGQB 1T7XA 2DLFH 1RJLA 3SOBL 2BRRH 1ZVSB 4M7JL 4DKDC 3MFFB 4RISH 4QTHB 1T2XA 1Y0LA 1HEZA 5ID1B 2Q1EA 3QZWA 6FABL 1BFTA 3ZDXE 3QDGE 2NY2D 1ZHLB 2KUTA 2EDFA 4MB5A 3SN6N 1UFUA 4EDXA 4MXWH 3TJHD 4NOBA 4I18C 3LQMA 4L9LA 3AS2A 4PBWD 2M1KA 3V5HB 2VAAA 2PKDA 1M05B 3C60C 2YSSB 3BZFB 2UY7A 4O02L 5DD1L 3OG4B 3R0NA 1WEJH 4G8GE 3VWJB 2EIZB 4PLJC 3MRHA 1CGVA 2AEPH 4XAWL 2CO6B 3W0WD 4MNQD 1A7OL 5D70H 1I1AB 2DQEL 4I2XE 4PJCF 1AGBA 4UT6L 2IANE 3GO1L 3BOVA 4X98A 1I1RA 2ESVA 2EDYA 2V5MA 4F8QA 1AJ7L 4LDLB 3MA9L 1I3GL 2FCBA 1P4IH 5JR1L 4TNWF 1A14L 2YRZA 4WDIA 5GS0H 3DGCR 4O58H 1G7JB 1IM9B 3U7WL 4GKSB 3QH3A 4ZTPH 4RIRA 1B4JH 2B5IB 3HG1D 3V0WL 1QD0A 2R23A 3PHOA 4EN3D 3ULVF 4OZIB 4MX7B 4QRPD 2VL5B 3PE9A 5IW3A 4OCWH 1JYWA 4HXAL 1OSPH 2DIAA 3GHBL 3PUCA 4YDLB 3G5XB 1DL7L 5ETUA 5EZLB 3QNYB 3IRPX 4ZG1A 1HIML 4NHCH 2IEPA 1EH9A 3BISA 2EYTA 5I74C 4PRHE 3GHEL 4KROB 3B9KB 3TIEA 5IWLA 1FYTE 5C07B 4TUOA 1B3JA 3MLUH 1AXIB 1QRNB 2VLRA 5C0BB 1NEZB 1T1ZB 3LEVH 4MQTB 5GHWL 2JB5L 3L5HA 3IF1A 4KRPC 3MLYL 4PRIB 3RL1A 3VXSE 1CXLA 4U1NA 3W9EB 4KRMB 5D1XB 2VDMH 4QXGH 4MGXA 3EYVB 1IT9H 4D0BB 1QYGL 3DMMA 2EH7L 3GKWH 3O3DA 4GG6F 2Y06H 4FS0A 3LN5A 3MUHL 1XGRA 3RIFK 2ZUSA 3PGDA 3MRRA 1D9KB 2RB8A 1KLGB 4XCEA 1V3LA 5CGYC 3S88H 2CRYA 1QTYT 4R4BB 1OWWA 1OCWL 3MGTA 5F21B 2ORBH 2FBJH 4BFIA 4NC2B 3S35L 4EXPX 4EBQH 5CEYB 2NY6C 4HLZG 4S2SA 1E4XI 2W60A 3T4AB 1DR9A 4LAJH 4RGNC 1T1YA 3BPNB 3EFDH 3GSRA 1MCPL 4JZNA 5F9AC 1ZLVK 4QRQB 3RGVC 5KAQF 1HQ4B 1LE9A 1A6UH 5JOEA 4YFLF 3VA6A 5C08D 4M93C 3O8XC 5DYOB 5FCSH 1JCKA 3OR6A 2B7DT 1ZAGA 4G43B 4ZS6C 1DJSA 2OJZH 3VFTB 4XP5H 2PTTA 2HMIC 3ZTNL 1NFIB 3QQNA 4JFPA 4AMKH 1MOEA 15C8L 1PY4A 3EOYG 2E9BA 4NQXB 4UZGA 3S3PA 4I3RH 3WIFB 3O2WH 1J10A 1FAKT 3G6AA 4OF5A 2R39A 3VFPA 4KRLB 3LDBC 1SJEB 5CZKA 1K2DB 3FRUB 1T83C 1I7ZB 1PEZA 5HYJB 4N0YH 4MJIA 2IALB 1MHCA 3CFCL 3HE7B 2F19L 5GGTA 1DSFL 5ISZA 1A6AB 4G9FE 2VDLL 1CICB 1PKQB 4PRAB 3UEZA 2P43B 4N0UA 4MQ7B 3VFWA 3ZZ1A 2VR4A 4NKDB 3NIGF 4NN7B 4R7NA 2HWZH 1KJ2H 5FA4B 3D25A 2OQJB 5IJVA 2P8LA 4PJ9A 3MRDB 4N0FA 2DIJA 2B39A 5DD0H 3OAUL 4D9RE 4R4FL 3QUXC 2XA3A 4HGWA 3SY0A 3BDYL 3WE6B 1QO3A 5FDYA 4GSDH 3GMNA 4DVBA 3WKMH 1LQSR 2EDWA 1F4XH 3CJJA 5ERWA 3VRLE 1DEDA 1B88A 2GK0B 1GGUA 2G5RA 5B8CB 2AP2A 2AK4D 5FHAL 4WU7A 4AH2A 4HSQA 4JHWH 2DQCH 1BWMA 1TVHB 2BOBB 1KENL 1P7QB 4JO4L 3UAJC 4Z7VA 4U6VH 5DSCB 1R5VA 5F7DA 5L6YL 2D7OA 3RL2A 4JG1H 2P1YA 4L8SA 4M4PA 1T3FB 5SWZB 4R8WL 1E28B 3NABL 2D3VA 1DDHA 3SDYL 1S7SA 3D3VA 4DJMA 2VWEC 1YY8B 3ZL4L 2JIXD 2WBJC 1HOCB 3QDMA 1CLOH 3ZKND 1A02N 4RZCA 1A6ZA 4LF3B 2HFEA 4KHTL 1S78D 5IR1B 1QLFB 3VXMB 5IF0A 1PG7X 1K8IA 2EIEA 1XH3A 3LEYL 4MA3B 5CINL 1KN4H 4N8PA 4UDTB 1E4KC 2NY0D 2YZ1A 2CD0A 1RVFL 2XOTA 3D85D 4X4MA 3SCMA 2DF3A 4ZSOB 3WV0A 1UA6L 3K7UA 1Z6JT 5J12C 1GGBH 4HX1B 3SDDD 1DQLL 1CR9H 2FWOA 1J0JA 4UINL 1E6OL 1TJGL 3ULUE 2MCG1 1IAIL 4ZFOB 1JP5A 4U6HB 2A6DB 4MNGE 4Q9RL 2Z8SA 1TJHH 2RCSH 1RJZA 3P11H 1REIA 4FTVA 4LCUA 4QHKJ 4U1SA 3JWDC 4JGJA 3SGEI 1KTDA 3NA4A 1OARH 3GSUA 3TC9A 1K5NA 5D6DC 4UU9B 5DRZB 3NCMA 3NH7H 4AIZA 4ALAH 4DGIH 3K4DA 5E8OA 1ZTXH 1WFNA 2ITCB 3EYOA 4WCYH 4FQQB 4B7IA 3KJ4B 5C6TH 4KY1L 4F9LC 5MEPA 1A5FL 2HT3C 4KWUA 1YJDC 3CU7A 3FMGL 5FGCE 3QUMH 4XZUA 1CF8L 3DROB 1S3KH 3DV6A 4U1LB 1P4BH 4QGTA 2XA8H 3AY4A 4JY6A 5IVXE 4YK4C 43CAB 2FX8L 3P4MA 3RTQA 1NAMA 5LCVH 1XIWD 5FYJD 1MHEA 4NQUA 3WEXB 1JHTB 1T2QL 3CSPA 4BKLB 2WLYA 4FMFA 4L1DA 4PJFB 1IC5H 4KK5D 4GOSA 2H2SC 4RAUB 3IDNA 3QI9A 2FH6A 3FQUA 3KS0J 2H1PL 4M48H 1CVSC 4B5EA 1N4XL 3CXHK 3HE6A 4LMQI 3UTQB 3MODH 2BHYA 1PQZB 4JPWH 3W5NA 3TH2T 4XX1G 3BKCL 4LIQH 5DJCB 4Z7NE 3MR9B 4JPIB 4LARL 4MAYA 1LNUA 1AI1L 3CUPB 1CU4L 4YNYA 2VQUA 4LLDB 1ONQA 3RPIB 4I4WA 1KIRB 2WUBH 2XZQH 4UT7L 5TDPB 3QXTA 3WS6C 3OKLB 2D7TH 2DQHL 2F53D 3IDJB 2AJVH 4LEOA 3MNVB 3WNLA 2HP4A 4PRBA 3NGBB 4OF3A 1MI5A 3FQWB 2ZCHH 2IQAB 3KLAB 3ARVA 4XCFL 3CMOL 3SBWC 4K7PH 5DJAB 4OZ4B 3VJ6B 1ORSB 1I9RL 4XCCL 1HE7A 2I60H 3D18A 2GEEA 2D31B 5GJTL 3VW3L 1FG2B 1DN0A 3LHPL 3U30C 2GSGB 1JYNA 2ARJA 4P5TA 5BXFA 1TIUA 4MD5B 3EJZD 4OGAD 3UTSB 5LJYH 4OUOA 4PGBB 4BSVB 3PQYE 1YYMH 1EBAA 4KK9C 3N0PB 1T5WB 3FZUD 4LVOC 3Q48A 5JW4M 3LS5H 1IGFL 1QLEH 4HKZB 3ARFC 2GTWB 5HGHB 2BNQB 5B39G 2J8UE 4LGSB 4P5KA 4XNXH 5H35A 4MQXC 3IJYA 4ODUB 4MDJB 4NO0B 2GITA 4IMLA 2A6JA 4R4ND 3DOSA 2QHRL 4Z7OE 5ADOH 5H37G 3GMLA 4IOIB 3GRWA 5D96C 4KVCL 4K2UL 3VCLB 4F58L 3V52H 2WAHA 1DBBL 2O5YL 1AO7E 4R2GD 4ZODA 4GRLD 5CIPA 5C0JA 4PS4H 2A0LD 4XP4H 3FB7B 3MBED 2FEEI 2VDPL 4JQVC 2PTUA 3E8UH 4NQED 4F37K 4LKCB 2Q8AL 4XBEL 2UYLB 1YECH 3BIKB 1H15A 3DXAE 2CDFB 4UILH 4ZPTB 1HSAA 1MJJB 3V2AR 1S5HB 2G75B 4JR9L 4K71B 1MCJA 2A73A 2L7JA 4XGZB 3GIVB 5C0ND 2DJSA 4FHBD 4DFIA 1N0XL 4MMXC 3WXWH 3SHSA 1IAOB 2FO1A 1DVFA 1EHAA 1DLHA 5T3XL 2HFTA 4LHUG 1JK8B 2DLEA 3DUSA 3S3SA 1DEEA 4NJAL 3QNZA 4G3YL 4JRXE 1UJ3A 2HVJB 1HH9B 4BH8B 1NANI 2AGJL 4DQOL 1Q38A 3X3GL 3SE4A 3FRPA 2HJFB 4R96A 3DIFA 5DK2B 4OAWA 3AVEA 4KXZH 4OKDA 4M43H 4P59L 3VFOA 5I2IB 3PHSA 5FAAA 1CD9B 5L2KE 5L8JB 5LWYL 1BQHA 3QQ9D 5DK0A 1HINH 1U8KB 2HFGL 5FDWB 3C5SA 5DQ9B 1U93B 2VDOH 3PWUB 4XPAL 1T0MA 3IXAB 3MV8E 4MD4A 2UVEA 2VZ1A 3NA9L 4AY0A 3GI9H 1HH6A 2D7MA 1B4RA 5C0FB 1TNMA 4K7FB 1PG7W 5ILTL 4BH7B 1RU9H 3ROOA 2WUCL 1E6JH 3Q5TA 4C56B 5T3XE 1JPFB 4H0GA 3VWKD 1A2YB 1QFWI 1CLYL 4U1JA 1W0WA 5I1LB 3O6MH 4OLEA 4HKXA 1WCBB 4FQPA 4YHYC 4Y2DD 4I9WE 3BEVA 2NTFA 1RZIA 4R7DA 3LKSA 4K9EH 5MI0B 1QSEA 3BUTA 4YEFA 3NAAH 4HUXB 4R26H 5KANI 3NTCH 4HPOH 1TFHA 1C7TA 3DBXB 1S7WA 4S1DC 3MXVL 2XRAL 1T0NA 4G42B 4AQ1B 5FV1L 2B0SL 1GZQB 2RIKA 3OQ3B 2F54E 1OP3H 4NQDA 5L0QC 4M1CC 1OP5H 2XY2A 2O61A 1FFOB 1RUQL 1BVZA 1MFBL 3RWIB 5KSVA 4KJWD 4HULB 1UXWB 2J4WL 2YBRB 4V2CB 3ZTJH 3K3QA 5CHNA 4BQCA 1AD9B 4Y5XA 4J6RL 4MCYB 4GO6B 4RGOH 4D9LL 1NC2D 1U36A 3AFLA 4AEEA 3PXJA 4WI7A 3MRJA 1WBXB 2R4SL 4NPYA 5EWIL 5HY9A 2OP4L 5CP7B 4M1GL 1PLGL 5FGRA 2FD6L 1JHKH 3WXVL 1HN1A 2P24A 2J5LB 4PRHD 3TBYA 4JFEB 1KCRH 3T1WA 2QSCH 4XNUH 4XRCB 5FUOL 1AHWC 1FYTD 4LU5L 1DQQA 3O4LB 2A6KA 3OX8B 1AH1A 2ZUQB 2BNUB 4FNLL 4NN5C 4UOJA 3ARBD 1AD0A 4LGPB 3DPBA 4MD0B 1VB9A 1F11B 3VXSD 3GNMH 3GB7B 2CDGA 2G5BA 4PGEB 2B1AH 2UWEF 4HMCA 1KJ2B 3QEHA 3HS0B 5DF0A 3NZ8A 4PRPA 3X17A 2CUHA 3ZDYE 4F80A 1LEIA 2R15A 1AKJA 5KSBE 4NP4H 5C2BL 1FHGA 3H9ZA 2I9LA 1LILA 4X6BB 5DGRA 1N6QH 4JO2L 3I75A 3MNWB 1ZWIB 4Y4FB 3QO0B 4O4YH 5IW1A 1JWMB 3EGSB 1V7ML 4JO1H 4FQXC 3QA3B 5KW9L 2HA1A 3BQUA 4YHLL 4S10A 3VXNB 1CXKA 1RZKL 1MWAH 2YKLH 4WUUB 1MFAL 1G7IA 3MLWL 1NLDL 3VMOA 3O6KH 3UTTA 4LCIL 4Y1AA 3C2AH 2OZ4A 3TNMA 2BFVH 1VACA 4OIIL 4DUXA 5CCKH 5GSRB 3WIHH 5DRXB 2N56A 2EYRA 1FL5A 1ZT4B 2Z8RA 2FLBT 3VRJB 3O45B 4U1HB 3S7GA 1IC4H 4IHOA 3CFDB 1OGAB 1YN6B 1BJ1H 1U95B 3GSXA 3U36B 1XCTB 1KULA 3OAZK 3QWRA 1MFDL 3RNKB 3LVEA 2Y6SD 5F89B 2CR3A 4FXGA 1N5AB 4BSWB 3G5ZB 4QYOA 4NUGH 1IQWH 4TQEH 3UYRL 3VFSA 4LHJB 3EDKA 4G9FD 5EZIH 5IG7A 3BH9A 4MDIA 2HRPH 1YQVH 4OCXL 5HHNA 1FJ1A 1EERB 3P30H 3WUWB 5IESL 1K4CA 1RURH 4E42A 1NCTA 2NY2B 5JW4N 1LE5B 4J1UA 2R1YB 3BSZH 2V7NA 3O6FC 2ESVE 4QKXB 4RGNE 5ALCH 2DQJH 5F3HB 2J8OA 2HFFA 3VWJC 3MV7E 3O0RL 4D9RD 4UT9H 1GH7A 1KXVC 1M6OA 4PLKC 5HHPB 4NBZB 2P49B 3GMPB 3SO3B 5IW6B 1HK6A 3W0WB 3MV11 1HHJA 1U8QA 3MPCA 4V1DE 2HH0L 3RKDD 1NDMA 5LXGH 4NNPH 2R2HA 3RWJB 2HKFL 2R4RH 5I75B 1AGFA 2ZG2A 3MTRA 2ADIA 3VRIA 4AL8L 3SKUD 1UZ6F 4U3HA 3SDCA 1P53A 2XNAB 3G04B 1AP2A 3K81A 3HG1B 5JLZB 4D0DA 5INCB 2C1OA 4EN3B 5ALBH 2AV1A 1LO5B 2PR4H 5FKPB 3QUMB 2YC1B 4CDGC 2E8ZA 2VLRE 1W8NA 4QRPB 4YDLC 2I9TB 1IEBA 2DQFB 3OB0K 1YEIH 2UWEB 3KGRA 4XMLL 3KNBA 4P57B 4KROC 4UUJA 1QACA 3B9KC 1CG9A 3EOAB 4PV9B 1R3LA 3FTGB 3H7BA 4MJ2A 2X4TB 1T2JA 4Z7UE 5E5MB 1Z5LA 3DX7B 3I6KB 1C5BH 3RVXC 4K3DL 2DBJA 2PW1A 1MY7A 3MRFA 5DS8B 5ENWA 5TGBB 3RIAK 2GTZA 1WICA 1F3RB 1F4YH 4JM2A 5GGTL 4X80H 4ZUWB 1Q72L 2WINB 1VFBA 1EBPA 1DBMH 5CJXC 1NBYB 4ISVB 1Z9OA 1RZJL 1QR1B 1D7FA 5DUPL 5F1OB 1CBVH 4OZGA 4DAGL 5ADPL 1P7HL 3QQ4B 4F7MB 1NJ9B 4ZFZB 4P4RA 4YJZL 2EDBA 5T1LA 2FO4A 5J9PB 5C0AA 3G5VB 4WV1A 3DRQA 2ZOLB 5FA3A 3K46A 2IAMC 5MP6H 2XKSA 3H9HB 3BPNC 3L3HA 3GMMB 5CUSL 5ESVA 4B50A 4LBEB 4PJ5B 4YGVA 4QCIA 4LLWA 5HHVL 2WANA 4LMQE 1TVDA 3BAEH 3BXNA 4HXBL 5E94A 3ROLB 5SX5H 1I85C 1INEH 5TE6L 1BVLB 5I9QC 5GGQL 1IMHC 3QFJA 4RBPH 3WL9A 3X11B 4OBRA 3IETB 3SOBH 3MBXL 2KBGA 4LAQH 4PJEA 1WGOA 4LSDA 5GRVK 3NZHL 4M7JH 5AZ2L 4GLRH 4JKKA 1KUMA 2H8PA 2C7UA 3SGJC 1XF4A 4WTZG 4LSSL 2CMRL 3WFEL 3QHZH 4RGMB 1QSFD 2FEDC 3ARGA 1K3IA 3WYRA 4DOHB 4KUZH 3CFBB 3QUKA 4X6DF 2PXYC 4O02H 5K9QI 1UACH 2ILLA 4GQ9L 4PY7B 5DD1H 1W0VA 1JRHH 1CICC 3QXUA 4BQBA 3WFCL 4XBGB 2VQ1B 4CVXA 3IFLH 2VDNL 4UT6H 1N6VA 4G8FA 1YPZA 4XWOD 3I2CL 1SBBA 1AJ7H 5FOBB 1UH4A 2EZ0D 5I17B 3Q2CA 3MA9H 4IMKA 3SDXA 1CDJA 3LZFL 5C0CD 5JR1H 5F88B 2X1PA 3W39B 4DKAA 1A3RL 3QJHA 3U7WH 4JFFD 3ZKQD 4Q58C 1JZ2A 4OTXL 4JFDA 4M02A 3ZKMD 4IRSB 4L4TD 3KPRB 2A6IB 3BPCA 1I7TA 1HI6A 4TVSa 5DVKA 4XAKE 1WUNT 4EIGB 1H0DB 3SPVB 1HHKA 3HLAB 3V0AC 3CFEB 3GHBH 5B8CC 4LPVA 3FONB 1DUZB 4Z95L 4ELMB 5AD0A 3PWLA 5HYSB 4P46C 4H0HB 1CXHA 1HIMH 2X4QA 4KUCD 2AK4B 4HT1L 4WFHD 1CGSL 3AB0B 3TWCH 3F7YA 2OS7A 5ACMA 4RAVA 3GHEH 1FVDA 4OT1H 4PJIE 4ETQB 3FB8A 4XVSH 3GZKA 3SDAD 1U3HA 3D3VE 1KIUA 4CUCA 3FFCA 1T21A 2HN7A 3QDME 4I18A 5LGJA 1FN4B 3THML 3DVFA 4X6EB 3U46B 2JB5H 3C60A 3Q3GB 4NM4H 3PQYD 2WP3O 3L7EB 5DJ8B 3MOBH 2XTJE 3L3DA 1IKNA 1H3PL 2OSLB 3TBVA 2AS5M 5KVDH 4ELKA 5E9DB 1KYOJ 5EBLA 4L3ED 3V6BR 1S9XB 1F8TH 3BJ91 5D2LE 4NKQB 1ZVYA 2JIXB 4HGMA 1QFWM 1MHPL 5GJSH 2WWKO 5HD8D 3SGDI 1C8PA 2Y07L 2FHCA 1NAML 5ANMB 5B39A 2CXGA 1FNEB 4PD4J 2PO6D 1XGPA 5J4MA 3NCBB 5I1IL 2E8YA 2X7LB 5T1KA 3S35H 1AQDB 1OAKL 2MQCA 3TVMC 1LO2L 5KTEL 4PGDA 1GJIA 2NY0B 2O5XH 1KFAL 5D2NB 2Y1VA 1AO7D 4K7PY 4DGVH 3MRGB 3D85B 3MYZA 5A2FA 1RZFL 4OGXL 3VFVA 3OKNB 4FTVE 3N1MC 4M6AA 2FB4L 4F7TA 1DQJA 1OD7A 3DRTA 3SDDB 2EXYD 4Q9QL 4IIQB 3DXAD 3DO7A 2W0PA 3MJ7A 1R3HA 5EU7C 5HI5D 1EO8L 1WK0A 2IPTL 5F9WB 3I85A 4ZDHB 1HHIA 3HR5A 1BLNB 1TTGA 4DZBB 4NZDA 3W5MA 4GW4A 1CK0L 5FECA 2L4OA 5I1AB 1J0IA 4GXVH 2A74B 4CN4A 3BRDA 2NQCA 1VSCA 2F19H 1SYVB 2F9BT 1DSFH 4JRXD 4LHUA 5C3TA 5E1AA 1C16B 4JLRB 5GQBA 3BGMA 3EYQD 5F7WC 5DJXB 3FOMB 4HUKB 1MCIA 5JPMB 3MCKB 5L2KD 3RWHA 4ERSH 2OTUA 5AZEL 4X7SL 1A4KA 4HWNA 1XIWB 2OI9B 3OAUH 5IUSA 1UB6B 3F7RA 5GGSA 3J7HA 3MJGX 3RGVA 3ALWA 5F1IA 1BEYH 3T09A 3O8XA 3MV8D 4JM4L 1M7DA 3CCHB 4L9DA 1DQDL 4LP5A 2CJUL 5C8JB 4J3UA 1MI5E 2DWDB 1KCVL 4UI2A 4HKBB 4Y5VB 4K55A 2VH5H 5T3XD 2VXQH 4JO4H 1ND0B 4X99B 1NFDA 2XQYG 4X9BA 3GRWL 4KTYA 1XR9A 3BZEB 1UWEH 1U8JA 1BZ9B 1ZA3A 3PWPE 5L6YH 1KJVB 2R56L 5FUZL 1CCZA 2COQA 4LPTA 1T83A 4J4PC 3V5KA 5HHOB 2Z4QB 3NGBC 4I9WD 4YUEL 4MWFB 4JAMB 5DUBA 4W6YB 3SDYH 2AJZB 1R3IL 1X44A 4H1LG 12E8L 1RZGA 5E1HB 3ZL4H 2DBLH 1YEDB 4QXWA 5I1DA 2XV6B 3WS3B 4LQFL 4M7LL 5CJOL 5D6CA 5E00B 1VGEH 4LLUB 1DE4B 3WFBH 1NMBH 1FZKA 1B0RA 1YNTB 3O9WD 1WT5C 3C08H 3L3GA 4EUPH 2BSED 1FH5L 4PB9L 3ZDXF 3LEYH 2ADGB 3QUXA 1FGNH 1HDMA 3TH3T 5CINH 1EO7A 4Z18A 4MXQC 2R9HC 3GSOA 2NW2A 4E41A 4JRYD 1M4KA 1Y18B 1EHLL 1LO3L 4N1HB 4HJ0D 3FQRA 3HI1A 4QHLB 4R3SB 5EUKB 3PWVA 3IJSB 5IB2B 1R3KA 3RRQA 3PF2A 4UINH 3SKOB 2BK8A 5I8CA 1IAIH 3IDXH 4Y7MA 4P3DA 2MKWA 1ACYH 1J1PL 1BIIB 3QEUA 5F7EH 2CLZA 5GSVA 1CZ8L 1ES0B 5I66B 3RZCD 3PABB 1D5BA 1KT2B 4R2GB 4JHAH 3T77A 4GRLB 2O26U 3LQAL 3KPQB 1BQLL 1TXKA 2V17L 2CK0L 3MBEB 3UCRA 1KTKE 1P84J 4ODXA 1YMHB 5D5MF 4EI5C 4NQEB 5CJQL 2WBJA 2L0DA 2WIIA 1YEKH 1J1OL 4K71C 5IBLC 3GKZA 1G9MH 1QSVA 3N85L 4XI5C 4LPXA 1CF8H 3T1FB 2JK5A 3T4YB 3G6JA 4JG0H 4FOMA 1OTSC 5ESQB 1PZUB 5AYUH 4LCWE 1FRGL 3TO4D 1E4KA 4CGTA 1T2QH 5FIEA 3D9AL 4LVEA 4XP9L 1EFXA 1X3DA 3OKKA 5L88H 3LQZB 3FO2B 4NWTL 1EJOH 1U8PB 4S0TD 3CU1A 5DC4B 5BCAA 2YD2A 5ELIA 3KWWA 1JGUH 1PVHA 2H1PH 2X4NB 5GZOD 1N4XH 4NRXB 3L5WB 1BBDL 5CEZH 5GS0C 4OZFG 4P2QA 3BKCH 1EAPA 5FO8A 1YZZA 1WJ3A 4H5SA 5BVPL 4TUJA 1KBGL 1AI1H 3H42L 1GIGH 5DHVA 2ID5A 1A7PH 2PTVA 2RGSA 2VXTL 2DQHH 4O2CA 3FO1B 3H3PL 2BJML 4NHUA 2VNCA 3RWCB 3CDYA 4RNRA 5CFHA 3UJJL 3T65B 5IB1A 3UROR 1NAKL 3CMOH 4X6FB 4OI7A 1BWWA 3VE0A 4WJ5A 1I9RH 2EC8A 1BFSA 1QSEE 4XC3L 1KLUA 2KKQA 1KELL 3T0DA 1G6RB 2Z91A 3MRNA 3VW3H 3VWKB 1G7PB 3W9DA 2IFGA 3A6BH 3KPPA 2Z93B 3K1DA 4MZ2A 3AU1A 3MZTA 4LSTH 4ZUUA 1B6DA 1PX4A 1AXSB 1ERNA 3IFPB 3CH8A 5HI4C 5TFSL 3HZMB 3HMWH 4NDMB 2AXFA 2YPLA 1UWXK 1GOGA 4PGCB 2ESVD 3NPSB 1IGFH 2VL4A 4PJHE 4N8VB 3TM6A 4UV4L 2IH3A 2F5BL 1FQ9C 2YS4A 5CSZA 3MV7D 5DTFB 3BZDA 5TQ0H 4XVTL 3S96B 3ELAT 4UB0L 3RVVC 2NXZC 5F7KC 3MROB 5KVEH 3DX9B 4E0RA 3M17A 1AGDA 2KPNA 4UTBL 4OD2A 5AUMA 4DFHA 4BYHA 3S5LB 2BY1A 3WS6A 4A6YA 5E8NA 1TCRB 3RIAF 2O5YH 1ZHKA 2BVQB 1RIHL 1K6QL 2W0FA 4PRNA 4PB0L 4KZDL 2BNRA 1NC2B 1P7KB 1YQ2A 3SBWA 4KV5E 5E8EA 3WLWC 1ZA6B 5GGVH 5EU4A 3N06B 1VENA 1MNUL 4XBEH 5D1QA 3KXFA 4U6XB 2VLRD 4KI5E 5FYLH 5C92A 3BPOB 4K94L 4PJGF 4DCQB 2VKXA 3VRLF 3V6ZB 5BVJA 5E0QA 3TIDB 4G8EB 4HWBA 4E5XA 2JCCA 2J5LC 1KJMA 3IT8D 4HKJA 3AUVA 4DK6A 2BC4A 2EKSA 1J5OL 5C0IA 5DJ0B 4F9PC 4NUJB 4QRSA 1J05B 4PJAF 1FYTB 2UUDK 2FZ3B 4YBQC 5T3XH 3DMMD 4WO4C 3JV4A 1I7RB 3NFNA 3ARBB 3MRQB 1MCOL 2HG5A 3ARFA 5TDNB 4G3YH 1QVOA 4PP2B 3IVKA 3VXSB 1TJIH 4XTRC 1DFBH 3QCUH 5T5NF 4DQOH 1CD8A 4U33A 5JDJA 3X3GH 4YHIA 1JUFB 3EDFA 1ZHBB 3HC4H 3QXDB 4P23B 5DGQA 2APVA 5KAQG 1SEQH 1UKTA 5DQJB 2XWJB 4QF1B 5LWYH 3JZ7A 4GS7B 4XCYB 5IHLB 4Y5YA 5KS9F 1B0WA 3DUUB 5JW3H 1SEBB 3UTTE 1I9JH 3REWA 2C3HA 3S36H 1J9CT 1FL6B 3KVQA 4Y1AE 5CZXC 4XXCA 3VG9C 3VGAB 5BZDA 1LK3L 4XPAH 3HUJE 4OZIE 2W9LA 4PJ7A 4WW2F 1FIEA 3VFNA 3QCVL 4ZOBA 3P4OA 1G9NL 1VA9A 3MREB 1MQ8A 3PP3H 4JQVA 1MFNA 1BX2A 3E2HC 5J1AA 1RIUH 2ADFL 1RZ7H 4WVRA 5ILTH 3VXQB 4TVPL 3U9PH 3RP1A 1J1XL 4U05A 2RFXB 3O3EA 4JFYA 5C07E 1QZ1A 3ULUF 4MJID 4JO3L 1FV1B 3BP5A 1YUHA 1B2WL 1G7LB 1QRNE 5C0BE 3GSNH 4MNHB 4DKFH 3ARRA 4HJGB 2VZOA 3ES6A 2NY5L 3LKRA 4X4XB 3OGOE 2BSRA 3VFMB 2QR0B 1LP9A 4GW1B 5HYIA 1FNAA 4HBQA 1RUPL 4K3JH 3DX6A 1A9BA 3MJ9L 3TBWB 2IBZX 3P9WB 2IPUK 3MXVH 5EUOA 1I3RA 4UIMB 2B0SH 5IK3B 3SJVB 4PJ9D 2I07B 4PR5A 4GKZA 2WWKT 3QDJA 3RHWF 3CXDL 1FL3A 4URTB 1MFBH 1ETZA 3ARDA 3C9NB 2NY2C 5KSUB 4Z0XB 5L2JA 4TVPE 2P5EA 4POYA 2EDTA 2CGRH 3F7QA 2BHUA 4JQIH 1Y6KR 4D9LH 1WITA 4IDJL 5IROC 1Q9WB 5HVWA 2GJ6A 2P7TB 1A9EA 3P9LA 2ZSVA 4XAKD 4FQ1L 2OP4H 1W72A 3VXRA 3FFDB 2R2CA 3PV6A 2FD6H 4O51A 4YWGL 3FO0H 2EYSA 4LVNB 5I75C 1HXMB 3MRLA 5IIEA 4Z7NF 1JF1A 3D3VD 4ZD3L 5HYJE 2Q76B 2H32H 3QDMD 3GK8L 5FM8A 3BIAX 5HPOA 1TZIB 3ZT7A 4IDLA 4OFVA 4LVHC 3IFOB 1RJCA 3GSVA 3BESR 3S9DB 2XTJD 4KKAC 3LAFA 1JMXA 3MUGB 4Y4HD 4HH8A 5KOMC 4Q6IA 4JFZH 3P4NA 4J8RA 3KYMB 5C2BH 3HZKB 5LAXB 4WUKH 4JO2H 2BCKB 3SCMD 1D5ZB 3NFSL 1BZ7A 5GGRB 5GZNC 1ZSDB 4N5UA 1WC7A 5FYKL 4EVNB 2VC2L 3RVUD 5GRYA 1OPGL 3QWQB 4OZGE 2DI7A 2LU7A 1X5XA 4JDZB 3B5TA 3RX7A 2DLHA 2V5TA 1UM6L 2QADD 4YDKH 5D4QA 3QXAA 4N9GA 5I1JL 2DLGA 5I16B 3P77B 3MLWH 1KYOK 4HWUA 3L95B 4ODTL 1EEQA 4FTVD 3UC0H 1B0GB 3BO8B 2NX5A 2NW3A 5I1CH 2C3VB 2J8UF 3PDDA 5EOCL 2GY5A 3QPQD 4OIIH 4FQ2L 2R0LL 4EI6A 2IPKA 5SWZE 1AHWA 3SGKA 4MNGB 5I18H 4TUKH 4PD4K 2NY3C 3RUGA 1G7QA 1JWSA 3DECA 5D9SA 4HPYH 4HFWA 1CFNB 1D5IH 2JJTC 3LV3B 4KAQL 4N0CD 5AWNL 4ODWB 2ICWA 3DGGA 5K9KB 4CADB 1OD9A 3MACL 1FBIL 5FYKE 5TF1L 3RTQD 1JHLL 2Z35A 3LSOB 5FKAA 4EUPB 1ULVA 5DD5L 4X5WA 3P9MA 2XZCH 5A3ID 5EU6A 3C6LA 3X12B 5CP3A 2VXVL 5FGCB 3MOAL 3QI9D 1SJHA 4RGMC 1LO0H 4HDIB 4HH9B 2R1XA 1ZT1B 1YPZE 3HE6D 32C2B 4FQXA 5IVXB 1QSFB 4JZJB 2P48B 3VGGA 4OLYL 1NGWA 4PY8I 2V2WB 3GMQA 3O6LH 1A7NL 3N9GH 3SDXE 3O0RH 4PUBL 3QUZD 1CGXA 3VFGH 5IHZA 1RD6A 3D6GA 4X7FC 1E4WH 4Y16C 1OTUD 3V4VL 2CRIA 3KPNA 4XH2B 4HUVA 3D1MC 3ULSA 2RHEA 2ZKHH 2CIIA 2C1PA 3IYLW 4WW1A 2HH0H 2QQQA 1RQ5A 1MI5D 2VUOA 2HKFH 4BQ6A 3CFKA 1YNLH 1FVCB 2B2XL 3B9AA 4K8RH 5C0CB 5A2JH 3MRMB 2VOTA 4PJXA 4AL8H 4OLZL 3PWPD 3KDMB 1JGVH 4JFFB 3MLXL 1MVUB 1TZHB 1MUJA 1EPFA 1Q9KB 4L4TB 3U9UA 5I71C 1U8IA 5EOCJ 4G80B 2EO9A 3LIZH 4FP8H 3K2UL 4N90E 3OPZL 1MRCL 4QTHA 5ACZA 3DX8A 5ID1A 5FF6B 5E2JA 3RNQB 3OG6B 4OM0H 1FVEA 1VGKA 3QIWD 3EOTL 4XPBH 4XVJL 1F4AA 3SDAB 3KYOB 1YEJL 1BOGB 4LL9A 4NT6B 3O4OB 4H1LA 2ZJSL 3HI6L 3O6FA 2W65B 3I50H 1X6LA 2FYYA 5C0DA 2UZIH 5I1HL 2P8MB 4F33A 5EBGA 1I8IB 4PLNC 3S37L 3VWJA 1JL8A 4O2EA 3PQYB 4Z76A 5DHYB 5GGRY 4OCRH 2WQ8A 1Q72H 3W82A 1CFTB 4I48A 3MNZB 5EZJA 5HGDB 1RJYB 4OFYD 4APQB 4L3EB 3ZKNC 4WTXA 2XWTB 1I8LC 4L4VA 3HRZA 4U1IA 1S78C 3N1GC 3S34L 4DAGH 2OYPA 1A3QA 1X9QA 2DLTA 2FR4B 5I19H 3RVTD 4QHNB 4BA8A 3CSYB 4OQTA 1OP9A 1KIPA 1Z2KA 2PO6B 1DBAL 3IDGB 3OJVC 3V7AE 2VSCA 4BFBD 5CEXA 4X7TB 5HHVH 4OKVB 1AO7B 2ICEB 4WY7H 4NM8H 4H0IA 2YD8A 2QL1A 5GGQH 2MQ3A 3SDDC 3JTSB 1DVFD 3GSWB 2DLFL 5JIKA 3FQXB 1IRAY 3DXAB 4KMLB 3KPOB 2ZNWA 3UTSE 3UBXB 4RISL 1MPAH 2R2EB 2XACC 4PRIA 4X9GA 3GJFB 2CMRH 3L5JA 4TN9A 4MXWL 2EE9A 3OKEB 4NO2B 1U92A 3V6OC 2XKNA 4DW2H 1YEHH 4LCWD 5H94B 4GQ9H 3BP6A 4HIJB 4WNQB 1WEJL 5BO1H 1KF9B 3EYFB 1P84K 3WFCH 5CJXA 1EAJA 1S7QA 5D70L 4JRXB 3S98A 3BMWA 2OMNA 1VPOH 1U8OA 4KDTC 1UKSA 5F7NC 5JXEA 3RDTC 3NIFE 3ZDYF 3B5HA 1MCEA 5KSBF 1LEGA 1AGCA 3LS4H 2IAMA 4OF7A 2OI9C 4QHMB 5JO5B 4L8BB 4OZFA 4O58L 2ICWI 2XZAH 4GRWH 4ZTPL 4JEGB 1YDPA 1B4JL 4OTXH 1NCWH 4G7YL 1K4DA 2CIKA 4JFQB 4XC1H 1IQDA 1FIGL 4OCWL 1OSPL 4KXZI 1P1ZB 4AT6B 1IEAB 5DO2D 4Y5VC 5J6GB 3WBDA 3EOBA 1QSED 2JLLA 4NHCL 4Q2ZA 2HJLB 1CGSH 5JOFB 1O0VA 4Q6YA 3TYFB 4Z7WB 1F13A 3VFRB 1UWGH 1LEKA 3STZB 5KSAB 1G1CA 2BVTA 2HVKB 1KC5L 2Y5TB 2H3NB 3TT3L 1ZKAA 5LG1A 4HF5H 3RWEA 4OZHF 2XIDA 3JBG7 4Y8DC 1NC4A 1UQSA 1KPUB 1HILA 3E3QC 4HIHB 5JDSB 4ZYKA 4NQDD 5ITFB 2PXYA 3WJJC 2OK0H 2CH8A 4P2OA 5D7JC 2VLJA 2VDML 1PKQA 4HWEH 2BSSB 3IDIB 4ZUSB 4QXGL 1JJUA 4GG8B 4PJCA 1IT9L 2QKIA 4NKMB 2YD9A 1H3UA 3DV4A 3GKWL 5D7IF 3CPLB 2Y06L 25C8H 1BECA 4X6CB 2VIRA 3HZVB 3QULA 1J0HA 1NAMH 3S88L 4M1DH 2P42B 3M07A 1GL4B 3FZUC 1T1WB 1D5MA 2FBJL 4EBQL 1OAKH 1OTTC 3B9VA 2X89A 1LO2H 5KTEH 1MH5A 1KFAH 2KQNA 4JRYB 3LEXA 4U3XA 2IMMA 2ADJB 1KIQB 1F3JB 4WTWA 2R0ZH 4WFEE 4OGXH 4RMSA 4C56E 5HGBA 4D0CA 5IM7A 4P46A 1J8HA 1TVHA 3GSNB 5IKCB 1INQB 2Y9RT 2OJZL 4LOUD 2F74A 2NMSA 1A1MA 1VFMA 2FECL 4R4NC 1F2QA 2E3VA 3AREC 4R0LC 5F3BB 4AMKL 2F8VA 3T0BA 4KK8D 4MA7L 1EO8H 2DYPA 3WFDH 3DVNA 3RWDA 4I3RL 3O2WL 4KJQD 3HMXH 2NY4D 4OCSH 4GRLC 3QQ3B 3RZCB 4PRPD 5IFJB 2A0LC 5HJ3B 4N0YL 4PJDF 3MBEC 1AKJD 5IOPA 5ID0B 1YY9D 1Q8MA 2VB5A 4YR6B 5K93A 5IQ9A 4HS3B 1ZXQA 4LASH 1B6UA 1YJDL 4GG6A 2GCYB 4MA1C 3RWGA 4H8WH 1I7UB 1PG7H 2EDXA 3JTTB 3JXAA 5C0NC 5IBUB 3BQUD 2FIKB 2JJSA 3JV0A 5KSBB 1BFOB 2QQNH 3IJHA 3OBAA 3W2DL 4Z7UF 4X7SH 4M7ZB 3TO4B 3IGAB 3TVMA 3UTTD 5DEFA 1FZOB 4Y1AD 4PV8B 3TFKC 1MIML 4UAOB 4EQ3A 4Z7QE 5B38B 1NGZA 2FHFA 3DURA 2YPKA 4S1SH 1SYSB 4GSDL 4NRYB 2H9GB 2XWBA 2W92A 4JM4H 2ZPKL 1F4XL 1T6WA 4HUWB 4KPHH 4P2RA 5HHMD 2CJUH 5BW7C 5FB8A 4YHPB 1NUDA 3FN3A 5CD3A 4G8IA 2D4DA 3HKFA 3QQ9C 2OLDA 2H32B 2MFNA 3QWRD 4U6VL 5DR5H 3O4LE 1OGTB 4A6YL 3PWJB 4LEXL 2R56H 1VKXB 5C1MB 5CIPH 3TNNB 4UU9A 1MFEH 4JGUA 5GIRB 1F2XK 4YUEH 2X9YA 1RJLB 2YD3A 4WRLA 1X4XA 1XR8A 3CMGA 5D1XD 4ZNCD 5JNYB 4JN1H 2KL6A 1H3VA 1Y0LB 5IP4A 1HEZB 1R3IH 1NBQA 5ESAA 3QZWB 3F6IA 3ZE2E 1RZ8A 3VWKC 3I84A 2OMBA 1S9KC 4EDXB 5CWSA 4LQFH 1CLOL 3ARQA 5TH2A 1OQOA 4L9LB 3MV9A 2VAAB 4LLQA 4LNRA 4WWKA 3Q1SH 3ECBA 4KKLD 4M03A 4Y2DC 4MA8L 3QIBD 3DETD 3MLZH 1KV3A 2HRLA 1FLRH 3MRHB 3L3OA 4XP1H 3OB0H 3PHQA 5IHBA 4RAUA 2Q3AA 4TVPD 1KN4L 2X5PA 3NPSC 5DUMH 1AGBB 1WVZA 4M3JA 5JHLH 4WUUE 1W8OA 4X98B 1BGXL 2ESVB 3I02A 3QRGL 1VADA 3MLTA 4D3CH 5EU5A 1PQZA 4QRUA 4IOSD 1OL0A 1GGBL 2B4CH 4WDIB 4NGHH 3QH3B 4RIRB 3SDCD 4KJWC 3BYTA 3EIFA 1Q9OA 3V79C 2R23B 3PHOB 3VH8G 4DVRH 3MZGB 3OKLA 4QY8A 1L7TL 4U0RC 4J4PA 1TJHL 2RCSL 1OGAE 4ZUVB 5T5FL 1MCHA 1CZ8H 1NBVH 5F1SA 5ETUB 3BD5A 2AV7A 4W4OC 5K9JL 4OZ4A 3LQAH 1OARL 2EYTB 1EA9C 5J3HC 5B4MD 2V17H 2CK0H 4JY4A 3NH7L 4DGIL 3TIEB 5A2IH 1R5IA 3I9GH 2PCPA 3BPOC 1S8DA 1ZTXL 5CJQH 4TUOB 4QRRA 4NNYA 2FJGA 3KHOA 3UJTH 2VLRB 1WBYA 3MMEA 1J1OH 2D2OA 1G6VK 3BGFB 3IF1B 3RL1B 2BERA 3N85H 4EOWH 3WN5C 1S3KL 1WT5A 5CGMA 4JM2D 4PJIF 1P4BL 4WI6A 1NMCB 2XA8L 5LBSH 1MCQA 1CFSA 5IVZA 2E7LA 3C5ZA 3DMMB 3D9AH 4XP9H 3O3DB 3IKCA 1JPGA 1QPXA 3LN5B 3R8QA 4JJHA 2BY3A 2ENYA 2GT9A 1IC5L 1XGRB 5CD5D 3PGDB 4YHNA 3JV6A 3MRRB 2V2TA 4XCEB 3RVWD 3EO1A 5T1LD 1WAAE 1GGIH 4M48L 4P4KA 2HAZA 5C0AD 4PJ7E 3X13A 3MGTB 1TQBB 4U6TA 3MODL 4JPWL 1I1CA 4BFIB 1BD2A 5D2LF 4GS7C 4S2SB 2W60B 4MJ5A 1T1YB 1KBGH 4YHOL 3GSRB 4JZNB 4U1MA 1D6EA 3VGAC 1LE9B 4PFEA 5SWSA 4BELD 2WUBL 2XZQL 3OB8A 5BV7H 4RFOH 3OR6B 3QFJD 2W38A 4FFWD 1CFBA 2AJVL 2UVFA 3ZKSD 3T0AA 2PTTB 3L5XH 5DA0B 5MEQA 4QRPE 4EEEA 3CK0H 2ZCHL 1DN2A 4JFPB 4EI5A 3HZYA 5IEKA 1LP9E 3CH1A 4QO1A 4XC3H 1W72L 4AEHH 3BP7A 1J0YA 2I60L 1AQKL 3G6AB 3VFPB 2DAVA 3LRHA 3ARGD 3GBNH 3G9VA 4JFOA 5FYKD 1JNHA 5D7KE 4FFVD 4PRDA 1MAKA 4MJIB 1MHCB 2QSQA 1NUNB 4I8DA 4FFYL 5JHDA 3QDJE 1YYML 5D93B 3KS0H 4PY8J 5TFSH 1JMZA 3SE3A 4N0UB 4N5ED 3VFWB 3LS5L 3LPGA 2Y6SC 3VD5A 1YN7A 5KG9A 4LLYA 4N68A 1QLEL 2F5AL 4R7NB 2GUOA 2FGWL 2F5BH 2P5EE 2VZ3A 3HTLX 4KJPC 1DCLA 3D25B 5IJVB 1T7YA 2P8LB 4PJ9B 4GLRI 4N0FB 1T03L 4XNXL 5CZVL 1U8KA 1S5IL 4HGWB 2GJ6E 3PP4H 2Y72A 4OBSA 3SY0B 5H2BA 4U6YA 1QO3B 3GMNB 5ADOL 5ERWB 1S7UA 4ORZC 4PJ5E 2I5YL 5LVEA 1JRHI 2HTKC 4YDVA 4PP1C 4C57C 4AH2B 4WU7B 2KH2B 2R0KL 2Q8BL 4XP4L 3ISWA 4Z7VB 3E8UL 1U3HD 1P2CA 2BSTA 1MNUH 4HLZH 5F7DB 1KB5A 1A2YA 3RL2B 1YECL 2OZ4H 4K94H 3VXUA 2DM7A 2J1KA 4L8SB 4F2MA 3RKDC 5J13C 3C60D 5IMLA 2JKXA 4MAUL 5JPNA 4F7EA 4YQXH 2VYRE 4WGWB 2V2XA 1J5OH 3BMVA 1S7SB 3CFIC 3WXWL 2V9TA 1RPQA 2Q86A 1Y6NR 1U8LB 1IZKA 1T5XA 4DOHE 3D3VB 1OB1A 1I1YA 4YDIL 1K85A 4DN4H 3EDDA 3QDMB 1FCCA 1T6VN 1MCOH 4RZCB 4JVUA 1EXUA 4XNYH 3K74B 1A6ZB 2HFEB 1YA5A 2R69H 4U7SA 3QYCA 3FAXA 4GRMB 5K59E 2XTJB 1K8IB 4CN6A 5FUCE 4RWHA 3ZYIA 2ATPA 5EORH 5F9JA 1XH3B 4EKXA 1Q0YL 5T1KD 5D1ZC 2CUIA 3FQTA 1JGDA 3PIQB 1ZHNA 4M43L 3DVGA 1NSNH 4OLUH 3SCMB 3VI4E 2J6EA 5IEHB 4KVNH 3KPRE 1LK3H 5IB4A 2FWOB 2BDNL 4P2CG 1MLBA 3JSSA 4HIEB 5ICXA 4ELME 3FT4A 1EDQA 3RUGE 1RU9L 3ILQC 1E6JL 5J1SC 3P4LA 1J1XH 1RJZB 4KRPD 5MENA 4X7CC 4FTVB 4LCUB 3ULUC 4U1SB 4MHHG 1KTDB 2EDLA 3GSUB 4F9PA 1HCFX 1PZ5A 4FQCL 1K5NB 3QHFL 4AIZB 1LD9A 2BNUA 4GW5A 3T0XA 3JWOC 5E8OB 2BY0A 4WO4A 4K9EL 5F7HA 3EYOB 3ZLQC 4KQ4L 5E4EC 4LHUD 5INDA 1OQXA 1XGYH 5MEPB 3NAAL 4R26L 1YMMA 4CMHC 4XZUB 1RUPH 5E9DE 1FDLH 4FFZH 3DV6B 2CKBA 4W81A 3QNXA 4JY6B 3P4MB 3AS1A 3RTQB 2LABA 1NAMB 3LPWA 4Z78A 5KVGH 1MHEB 4WHYG 2Z92A 3RY5A 4LHQB 4XMPH 3QO1A 2EXWD 4AZ8A 3EFFA 4LRIA 3T3PE 2P44B 3O8XD 3QI9B 5DMIL 3FQUB 4JPVH 3EW3B 3WIIH 2DQTH 4JZJC 1JGLL 2HMID 5SWQB 3HE6B 5D2NE 3EKCA 3VXNA 1JPTH 5IB5A 1FAIH 2NXYD 43C9A 1XF3B 4MAYB 4PJXE 1CTOA 4YNYB 4YH6A 1ONQB 3CLEH 4I4WB 1QA9A 1N5YL 2VISA 1T66D 4FQIH 4XWOC 5DMJB 4LEOB 2EZ0C 4YWGH 1A4JA 4PRBB 1JHKL 4G6FD 1SBSL 1MI5B 3BP4A 4OQTL 1EEZB 3BWAA 4V2BA 3HB3C 4K7PX 1KCRL 5F7FA 4XNUL 3B2VL 1P9MC 1JPSL 1AY1L 3ZKMC 3RNKA 3GK8H 3QAZB 4LQ1A 1DN0B 1AFVL 4QXUH 1GSMA 7CGTA 2ARJB 4P5TB 5BXFB 3MA7A 1MCLA 4YX2L 3LRSA 4N1EA 2I27N 3BZ4A 4NN6C 2D7QA 3OJDA 3LD8C 3QUXD 4Q74A 5B21A 4ZXBC 1XGUA 2IG2H 3SDAC 4NP4L 5BMFH 4E41D 5DZLA 3O4OC 3BEWA 1N6QL 3P0YH 1A1NA 2K7PA 3MRBA 4PGZA 1UM5H 4CMMA 5DEGA 5FYKH 4O4YL 4NZUL 4L4VE 2VC2H 3GGWA 4OF6A 4CAGA 4D9QE 1OPGH 2XZZA 5HHPA 4JO1L 3WFZA 1QR4A 3GJEA 5H35B 5IROA 3IJYB 3UAJD 4G7VH 1UM6H 1C5DA 2GITB 4IMLB 4MNQA 2A6JB 3D0LA 5CKGA 4JZOA 1MWAL 2YKLL 3CDFA 5I1JH 4PJHF 2J7LA 4DGYL 3GMLB 4FXKA 1KSRA 2WW8A 3O6KL 5IMMA 1F00I 5DC9B 3TZVA 4ODTH 3CC5A 5HD8C 3C2AL 4OF0A 2BFVL 1UGNA 4HZAA 4PYHA 3C6SA 5C0JB 5CCKL 1MCWW 3WIHL 3NACL 5HHOE 5T1DH 2Y36L 2R8SL 3TPKA 4UTAH 2WBJD 3OMZA 3BWUC 2YN5A 1H15B 4HV8A 1IC4L 1QHOA 2E9WA 1HSAB 5I1GL 4XBPA 2DQFA 5C0EB 4NBXB 4KAQH 4IBLT 2A73B 4KV5F 1IAII 1B90A 1JHLH 4NUGL 2DKSA 4TQEL 1DVFB 1XGTA 4HBCH 1DLHB 5EZIL 4KI5F 3BKYL 2HRPL 1E4XH 3DUSB 1YQVL 1CFVL 1DEEB 2MJWA 2VXVH 2VJXA 1UCTA 1L9NA 1ZOXA 2XQBL 4Y4KA 3H9YA 1UJ3B 1RURL 1SM3L 1H8OA 1A8JH 4PIRF 3BSZL 3OSKA 5SV3A 1CDIA 4ZUWA 3P2TA 4UBDC 2DQJL 4R96B 3DIFB 4LCWB 4P2QD 4YXHL 1A7NH 5EBMA 4UT9L 3VFOB 2AABL 3CX2A 4XCNA 1BQHB 4UNUA 5DK0B 1CXFA 3V4VH 3PV7A 3OJ2C 3C5SB 1KCSH 4BK5A 2X09A 4ZFFA 3V5DA 1C7SA 4KZEL 1T0MB 1WZ1H 1G1YA 5D7LA 1KPVA 4NNPL 1QP1A 1FCGA 1UWXH 1HH6B 3WUZA 3ULVL 1F4WH 3HAEG 3O4LD 1J0KA 1X7QA 3ROOB 5DWUH 3MLXH 3ROLA 1EMTL 3VFUA 2JJTA 4OZIF 3HUJF 1DANT 5C08A 4NQEE 5H37H 3KYNA 5ALBL 3CZFA 2PR4L 5EIVA 3QEQA 4U1JB 4TNVF 1HNGA 1I4FA 1W0WB 2V5RA 1S7VA 3UZQA 1YEIL 4TTDD 3T3MF 3K2UH 1H5BC 3BEVB 2NTFB 1IC7H 1RZIB 2Y4SA 3LKSB 4ONHA