1J7VR

Human il-10 / il-10r1 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
molecule keywords INTERLEUKIN-10
total genus 35
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j7vR01
1AHWA 4XPBL 2BMKB 3V0VA 1JPSL 1T1XA 5E94B 3ZKMC 3T8XA 4PJFF 5C9JA 1A1OA 4OZ4B 2D3VA 2PYEE 5CINH 1AGFA 1ZT1A 3W5MA 4HX1B 1CGSH 2EDLA 3MRBB 4HMCA 1FZOA 4L3CB 4XCFL 2UV3A 2NY3B 5HGAA 1EJ6A 1MAML 4UT9L 4LLMB 1FPTH 3HZKB 1ED3B 4G9FB 3SCMD 3HHRB 4G9FE 3QXAB 4XZUA 5E1HB 5HYSG 1XF3B 2CK2A 4Q2ZA 1OSZA 1ZMYA 3IDNB 3LQZB 5C70A 5F9JA 4MJ4A 1GVIA 3P0GB 4BYHA 1YEGL 1F90L 2EE2A 2V2XB 2WWKO 3L1OH 3WHE1 4TUJA 4D9RD 1UC6A 4YAQA 4BFIB 1TQBB 5JR1H 4ISVB 3RWIB 2PXYD 2WQRA 1MLBB 4EN3B 1LILA 4IMKA 3D18A 4CMMB 3AROA 1T3FA 1S7WB 5F1KC 3OG4B 4JHAL 4P3DA 1E6JH 5B39G 5F1NA 1XGUB 3B9DA 3MA9L 3QJHB 4I0PD 4YE4L 5DJ8B 3CSGA 4PREA 3NA4A 1MAMH 5E5MA 1WUNT 3PWVA 3ZE1F 3MUJA 3HAEG 5H35B 4RGOH 3S4SB 4GAFB 3PIQB 4FXGB 4ZDHA 3B9KC 3A0OA 2YD4A 4HKZB 4RGNE 4H1LB 4G7VL 3WS3B 2NLJA 1B4JH 2OR7A 4PG9A 2AJZA 4O51B 3EO9H 5EU7E 1HYSD 4ZS6C 4KJYA 1LO2L 5JR1L 1SYVB 2BY2A 2XA3A 3JV6A 1MWAA 5CBEA 2EDYA 4YFLF 1R5IA 2BVEA 3ZSSA 4C4KO 4CNIA 1S7TB 3O9WB 4AG4L 5JPMB 2Y5TA 2J8OA 4D0CA 4MS8D 1LK3L 1AFVH 4FQQA 2H2PC 3FRPA 4DAGL 3EFFA 5ID0A 2IALA 4FFYH 3WUWB 1WWCA 2PO6B 1FGNL 2VABB 5FCSH 3F7YA 4FQJL 4CUCA 3MV8D 3IDUA 1P5UA 1A3LL 2C3VB 5EOTB 3FO1A 2OBGA 2PXYC 2GK2A 3CDYA 5CJOH 4DZBB 4E41D 3KPOA 3VXUB 4K3HA 5F7LB 4IJ3B 4N8VB 4WFHE 4PRAA 2W0FB 2VR5A 1AQDB 5HGBA 3GK8H 4JFYB 5CILH 2ZJSL 4H0GA 2EDKA 1ORSA 2BVYA 4R4BA 1NSNH 2YK1H 2EDQA 2F5AL 4JFEE 1LO2H 1T7VA 2C5DC 2ED7A 5HYIA 1QZ1A 1A6UH 4NYLA 3MACH 1TZHB 2F53D 5JNYA 1TFHA 5E8PA 1JGUH 2VLLA 5IKCA 1NCDL 3ZT5A 4DK6A 3BH9A 4XTRC 5KSBE 5IFJB 2RFXA 1AD0B 5C07A 2GIYA 5FYJH 2B1AH 1I9EA 4L3ED 2BX5A 4ZMAT 1PG7H 1J7VR 1HOCB 2ENYA 1MNUH 4TOYH 5E00A 3X14A 1D6EB 5JORB 2GW5A 5TQ0L 1FN4A 5I6XC 3LQAL 3C6LC 2BNQB 3WNPA 3ZYOA 4PS4H 5E6YA 2V9TA 5T5NG 2EH8H 2OL3A 5L8JB 2ZP0T 1YNTA 3O2DH 3O8XD 5DK0B 5EU5A 3BYYA 4ZO9A 1MLCA 2ADGB 3WL9A 1M1SA 4BFEA 4MJIB 5D7LE 3HE7A 1VFBB 5IIEA 3D87B 4Y19B 5D1ZC 2ARJB 5DD5L 3OJMB 2B0SL 2XPGA 3OKYA 1N5YL 4PRID 5SWZE 3QWOA 4D0BB 1IGJA 1XIWD 4JVWA 2DQIL 3V6ZA 2DMBA 4D9QE 4PJCE 1X5JA 4KK8C 2EE3A 5MENE 3DROB 5FYJL 1WFUA 2JELL 1WV7T 4PIRF 4RBPK 3GBNL 4M43L 4JFOA 4P23A 1LD9B 4WEMB 3LMJL 3U30B 4L1HA 1VKXB 1PDKA 2CDEA 5T5FH 2VAAA 2VWEE 4I9WE 1L4IA 4LPVA 4P9MH 5D72H 1KIQA 2APXA 5IGXL 5IM7A 1KJ3L 4R0LA 3IT8D 4NOBA 1CQYA 2JCCA 3IU4L 4MXWL 3PHQA 3H7BB 5GGVH 1A7RL 5IFAL 1VADB 1UJ3C 2PF6A 1J12A 4LPUA 1CK0H 4EUPG 4OCYL 2P24B 3FB6B 1G0DA 1XGYH 4WV1A 1EAPA 1G9ML 5FHAL 2D31B 5GS1B 5T3XH 4D0BA 5F88A 2XQYK 4NWTH 4OZFG 5F6IB 2XWTB 3UYRH 5BV7C 4DUXA 3QNZA 3EOTH 4QRPD 4U1SB 1BQLL 1ORQB 1RAMA 5F3HB 5C0EB 5ICYA 1G9NL 1NFDE 5CZVL 3KR3H 3S34H 5HPOA 1KPRA 1YQ2A 1RUMH 2VITA 2APWA 3REVA 3TP4A 1W72L 2PYFB 3IDMB 4TSBH 4PJGF 4P9ML 5D72L 1K9TA 1A21A 4OZGF 4JPWL 4KTEL 2FIKA 1CDCA 3I9GL 3VDAA 1JRHI 2JIXD 4XVSL 4Z7WA 1G9MC 4Z76B 3L7EA 1MI5B 3PHOA 3VFUA 4HG4J 3O6LH 1ERNA 3C5ZC 3S5LG 2FR4A 1MJUH 1BZ9B 2NXZC 4NZDA 5L8KB 3MYJA 5DS8B 1Z2KA 3HS0A 3IFPA 1AQKH 1B6UA 1RJYB 3WNNA 1DUZB 1BF8A 3OKLB 4N8PA 1CIDA 3QG6B 2D03L 4UT9H 3MGOB 4OJFH 1PY4A 5IOPB 2AEQH 3BQUC 4PV9B 1KACB 1R3LB 1I9JL 3EW3B 3QUYA 4HXAH 1JZ5A 2QLVB 2LU4A 2VQUA 1FCCA 4WFGE 4JDZB 3L1OL 4QHKJ 2VN4A 5EOTA 1Q9OA 4HC1L 1C7TA 1H5BC 4X98A 4NRZB 3DGGB 4HIIB 5EBWA 3JWOL 1U8LB 3OL2A 2VUYA 4OZHA 1GZQB 4G8GE 3FHAA 1RIHL 2NY0D 5MHSE 1R24A 3VE0B 1TITA 4OIBA 1XF4B 5LJYH 3BRDA 3QHTC 1JWMA 4QWWD 2NY2C 2AJXH 1A7PH 2A83B 3KPRD 5DHYA 3MSPA 3ARDA 5SV3A 2LAAA 1LDSA 2P43B 4XI5C 2C26A 1S7XA 2IFGA 4MNQD 2X9YA 5T3ZE 2APBA 3MLTB 5LQBL 4UT7L 2FNBA 3EZJB 5C0FA 4ZNEE 5DJZA 5FGSA 3INUL 4ODSH 3SJVB 4LAQH 3HI5H 5KSUA 1JGDA 4NQXB 2WBJB 1JP5A 5JO5B 2P8PA 5F8QC 2YN3A 5DQ9A 4DJMA 1KEGL 2GUOA 3KXFD 3MJ7B 4IOFD 3VXRD 5DVKA 5DMKA 5HVFB 1KBGH 5E2TH 1HH9B 1VGEH 5IVXF 1AGBA 4G43A 2GJZB 4P2QE 3WEXB 4JKKA 3V5KB 4M6ML 4UIMB 1A4KA 2E7LA 1SM3L 4QRTB 3NOIA 5A2KH 4FQCH 5D8JH 4BZ2L 1MPAH 2A9NL 3BIBX 1X5HA 5J13B 4PJXA 4HFUL 1IMHC 4L1DA 5E7BA 5IHUH 4FTVE 4X7CC 4OD3L 4K3EL 4ZS7L 4Z7UF 1YEJH 4HWZB 3VFVA 3RUGE 3SY0B 1AH1A 3B5TA 4R2GC 3WO3B 1ZVSA 4Y4HB 4H25B 3P2TA 3C2SA 3KYKH 5CFHA 3Q5YA 4F9LC 2DQCL 2VXUL 4HAFA 1JF1B 5K9OA 3LB6C 4U0QB 4I77H 3LAFA 3U6RB 3QCVH 3ZL4L 5CGMA 4HFWA 3NFNA 1PFCA 1AGFB 1ZT1B 2EZ0D 4UQ3A 2V7HB 1DFBL 3WHE0 2IADA 4G8IB 1U2CA 1IAMA 3S37X 2B1AL 3LEYH 5EZJA 5AWNL 1OQOA 3C60A 1L7IH 1T5WA 1CFNA 5C08D 3UTZB 3GSXB 3L95B 1G0YR 3TZVD 4FQ1H 3QDMA 2CR3A 3MFFA 1I3RB 3ARFD 3DXAA 4S1QL 3KYKL 2R69H 3BEVB 3STBA 3T0AA 1BHGA 2KL6A 5IB2A 1QP1A 3FQXA 2F5BL 4PJCF 4PR5B 5D7SH 4EUPH 1FZMA 3H8NA 2DLHA 1ROWA 1MCNA 4TSCL 4F7EA 4OLXH 1QFPA 4XMLL 1QTYT 4V1DA 4MX7A 1IC4H 2BNQD 3GSNL 3GSVB 5DVLA 1HSBA 4I48B 5KVDH 3ILQD 4HKXA 1N8ZA 5C92A 3B6SA 5JXEA 4K8RC 1H0DA 3FO0H 1SMOA 3QPQD 2CPCA 1C8PA 1XGPB 4KVCL 3WIIL 4U3CA 1RJLA 3KPLA 4PP1C 1MJJA 4H20L 2BNQE 3QIBC 1GGCL 2QQNH 1B2WH 1UWGH 1YMMA 3IXAA 3RZWA 2CDGA 4KRPB 2BC4A 3FFCA 1VEMA 3TO4D 2QQKL 3UTTE 4HWBA 4OIIL 1H3XA 4M7ZC 3GMQB 1EZVX 4R97C 1HSAB 3QEQE 4XNZB 5IBTH 3OWEA 1FFNA 3KPRA 3L95A 1BD2B 2ATPA 4F57L 4YHLH 3SQOL 4I0PB 4AEIL 3W5NA 1XCQB 5HI4C 1MCLA 3MR9A 1K4DA 2QADC 3X17A 4P23D 1TNNA 4TSBL 4M6AA 5CSBA 1QFWL 3BW9A 3NFNB 5JA8B 4OI7A 3LH2L 1S9YA 2BJML 2VH5L 5ABDE 1D9KC 4QRRE 2X42A 4HJJL 1RIVL 2YPLB 5E95B 4X6DA 1JF1A 3ARGC 4Z7OF 5MENB 4KZEH 4YQXH 1QBBA 4PTTA 5C0DA 5BMFL 2X5PA 1LO3L 4KRPD 5I1LB 3S8WA 2QQKH 4YHML 1DVFB 1JHLH 2UVFA 3H9SB 1S7QB 2XKNA 5E2UH 3TYGL 5GGRB 2UYLA 3UYPA 5GGQH 35C8H 2J8UF 2D7QA 4ZFZB 3MJGX 1YMME 1LP9E 1KJMA 2VE6B 5ISZA 1MCSA 2BCKA 1OTUD 2GITA 1H3PL 4EDXA 4ODTL 1ZGLA 1OHQA 3TZVC 1E4KA 4W6XB 2VERN 3GGWB 3FOLA 4QXTB 2H45A 3RZCB 1WITA 1HH6B 3MJ8B 4ESKA 2GFBB 3JTTA 1CLOL 4XP9L 5A1AA 5L2KA 3P4MA 2IANA 3HE6C 2YPVH 3C9NB 4GXUM 4LCCC 4JKPL 2PW2B 1JGDB 5FYJD 3KXFE 1FDLH 1B88A 5FUCE 1G7MB 4KI1A 2CKBL 4B7LA 4HUKB 2MKLC 3STZA 2SEBA 1ZT4A 1QPXA 1FZKB 1OP5K 5JUEL 4ZOAA 3H9HB 3SKOA 3LVEA 4PJBE 3O11B 2IQ9L 5T3ZD 2HJKA 4JN2B 1MI5E 1MQKH 3WN5C 3WIHL 3GSQB 5IF0A 4MJ6B 4LP5A 1CLCA 1UACH 2RR3A 1UWXK 4P4RA 4Q6IB 1PLGH 1I9IL 5DF0A 5HDBF 3VFSA 1SQ2N 1T22A 4KTDH 1FBIL 1WVZA 4EQ3A 1T7WA 4LKXA 3A6CH 1MCPL 1IEBA 2QEJA 4EEEA 3SE4C 4OZFH 4BELD 1FV1A 3VFVB 1IGCL 4M7KL 3V4PH 5JIIA 4PYGA 4GXVH 4QTIL 2YPVL 3EGSB 2EDFA 3SOBH 4MCYB 2GAZA 1AJ7H 3RY6A 4J8RA 1NC4D 1LEGA 1MVUA 3RIAF 5E4IA 4JCMA 3VFMA 2AV7B 4N0UA 3DOSA 3ZE0E 4PJFE 4FFVC 2W60B 1UYWL 3LDBB 4JFFD 4WO4A 2BFVH 4G6AC 4Z5RB 1VEPA 4P2OC 5BO1H 4G3YH 3FL7A 5C0ND 2X4PA 4H26B 1PGRB 4JPKL 5D71L 4PJ9B 4CN1A 3WFCL 4NO3A 1AD9B 3ILPB 3O8XA 3TN0D 2HVJA 4NN7B 3AXLA 1BVKA 1JNHB 3V4PL 3OKOA 2NY4B 4HLZH 5HY9B 2E7MA 1H3VA 3FFDB 4UNVA 4NC1C 3RGVA 4ZOBA 2DBJA 2EDJA 2J12B 1C16A 4M61B 1Z5LA 2DICA 2YXMA 4ZD3H 1LEKB 3AB0C 4I18B 1ZHLB 3EYFB 5EG6C 4D0DB 3UZVB 3JVGA 2BNRA 1JI1A 3HKFA 4JREB 3FHQA 4YXLH 3PV6A 4DKEH 2BNRB 2X7LB 1ES0B 4L4JA 2NTSP 4N0UE 5D5MB 3DVGB 1WBYA 3SKUD 1RZJC 2P7TB 3GBMH 4E42A 1HZHH 3LN5A 4V1DE 3DRTB 3LZFH 4QRSB 4WWKA 1MUJB 1MFAH 4NKIH 4ORZC 3WJLC 4OUUB 3IFLH 1EZVY 2ENSA 4U0RB 1G7JB 4PJ5A 3SQBA 4KAQH 4NWTL 4I2XA 3QXVA 3QDJB 2V17L 4POZD 4F7MB 4JZNA 5FYKE 1FJ1A 1C5DB 3VXQB 1ZS8A 1IFHH 4HK0B 3OKOB 3HS0B 2XNAB 3NPSB 4IRSA 3VH8A 2LU3A 4G5ZL 2ZUYA 1YYMH 4GBXB 1AHWC 3BUTA 4HV8B 4HEPG 5JW4Q 1NJ9B 3FO2A 3RTQC 4XPTH 5LBSL 3P9WB 4TVPE 2HN7A 2F8OA 2BHZA 1QFHA 2QQNL 2FIKB 2ZWLT 1XT5A 4K07A 1CYGA 3QIWA 3D39E 3V6OC 1XH3B 1LE5B 1T2QL 1DLFH 3VWKD 1Z3GH 5I16A 4MA8L 3WE6B 2RHEA 1JNJA 4L4TB 3GSWB 2FX8L 1FO0H 4IDLA 4J6RH 4DQOL 3DVGA 1NANI 2XWTA 2W07A 1C12A 3ALXA 4LIQH 3VG9C 3IDJB 4KFZC 1MHHA 4QRSA 5KSBF 2ZZUT 2P7TA 1N59B 3PDOB 3H3KA 3VU2A 3CFIC 4JHZA 2Z93A 2WZPD 2XV6B 4RX4A 3VGHA 3TC9A 1INEH 1CE6A 4MVBD 4BK5A 4BQBA 4D8PA 3TA3C 1ODAA 5ACZA 2H41A 5JQ6H 4JKMA 3CLFH 1Y18A 5GISL 4PJHE 3U0PA 3LKNB 3MRPA 3L3DA 1W72A 3RVTC 3MV7D 4KMQA 4DN4L 1A9EA 4JFED 2FEDD 1JWUA 4IBLT 4HH9B 3LKSB 5JW4M 1AD9A 1NMAH 4P9HH 3O6FC 5MEOA 2AK1H 4WFHD 3OZ9L 4AG4H 2DRUA 3MCG1 4Z5RA 2UUDK 1H3PH 1J1XH 2ZCHH 1HH6A 3MJ8A 5I1IH 3CUPA 1Q1JH 3K0WA 3E8UL 4NQTA 4PJ9A 4LHJB 4M62H 1MHEB 3LPWA 2VZOA 4X0KA 2Z91B 3HE7C 4RA0C 4WWID 4ACPA 3S88L 5ISZB 3RWGB 5C6WH 4XP4L 3DO7A 1RUAH 1MJ8L 4NCDA 3SJVE 4CW1A 3BIKB 5AZ2L 4ZFZA 5D7JD 3HG1B 1RY7B 5HGDA 2CKBH 3G6AB 3EDFA 3FCTB 1IGYB 1A1MB 2AI0H 5KSAC 4OI9A 3DLQR 3QISA 5K59F 1TQCB 5KOMC 1P5VA 1UM5H 2MPAH 1Q0XL 3MQIA 3UC0L 4AY0A 4GW5A 4LCUB 4K3EH 5A3ID 4HS3B 5BVJA 5JW4N 3WV0A 1MRCH 2ZG1A 4PRBB 1RZGA 1UZ6F 2ICWJ 4QRUA 5BZDB 3H9HA 5E9DB 3NFPB 4OAWA 3UPCA 3SDCB 3D3VE 3LRGA 2B39A 3L5XH 4CMMA 4RGMB 3GSQA 3WLWD 1ZHKB 4PB9L 4X5XA 2IH3B 2J5LB 1RIUH 4BUHA 2E9BA 5EH1A 5EPMB 5B38B 1C1EH 3O2DL 5C0GB 3RFZC 1TJHH 2NYYD 2FATL 3HRZA 4XVTH 1TJIL 3UDWA 3O3AB 5IROA 1TTGA 1CGYA 3IGAB 4O02L 4CU6A 3VMPA 3QUZA 1G7MA 4R3SB 2CLRA 5FUOH 3FOLB 3OJ2C 4RDQG 1UYWH 3L7FA 5L88H 2YXFA 1KYOK 3ULUH 2YD5A 4PD4J 4WW2B 2C9AA 4KKCD 4LASL 4LPYA 3FAXA 4LSVL 5IR1B 2Z31D 3MLRH 2YUVA 4R6UA 5C3LD 1C5BH 2EE6A 2XT1B 4KJYB 2Q1EA 5D7JC 4PJ7E 1DQJA 3O3BA 4S1QH 3U2SB 1K5NB 1T0NB 2X05A 3U82B 1MIMH 1FFPB 2X9XA 4PG9B 4CVXB 1ZEAL 4HBCL 3W2DH 4X99A 4Y1AB 5LAXA 1EHNA 4J8RB 4OGYH 4ZDHB 3OR6A 4X80L 5MEQB 5HGGS 1RVFH 1IGTA 5HBBA 3QRGL 1LQSR 3D39B 3GSNH 2J4WH 3W11C 5BVPH 5HHPA 5BJTB 3BZDA 4ZUSB 1XGUA 4JANB 4LSUH 3T0ED 1EHXA 2ADFL 1MREH 3MUZ1 4P3DB 2XN9E 3ORJA 4WU5A 1S7WA 3O2WL 3KPMB 1J87A 4JVPA 1YEEL 3DPBA 4GQPH 3GHBL 3ARQA 4S10A 4UT6L 5TDOA 3O11A 4UTAL 4M1GH 2VDLL 4WUUD 5EBMB 5FA4A 4MNGE 1EIBA 3V5DA 4KUZL 3VXUD 3IDNA 2Y36L 4OBRA 3UBXI 2YRLA 5IP4A 4BSVA 3LZFL 3ULSA 2MFNA 4KTEH 1FNEA 4O2EB 2VLJA 4RAHA 3MTRA 3AU1B 5J12B 2VAJA 3KPQB 4LLMA 4F15C 5E1AA 3OV6A 2CH8A 3GHEH 2WBWB 5BVPL 1DBAL 4YHZL 32C2B 3RX7A 3UTQB 3AAZA 3SDAC 3FB5B 4ZTOH 4U1HB 2APTA 4QXUH 1AE6L 3MNZB 3SGKC 4HKJA 5JMRA 1AGDB 1FYHB 2H8PA 2XTJB 3D39A 3GKWL 5GIRA 4HJJH 3ZDYF 3QJFA 5CEZE 4LGRB 3IU3A 1ZA3B 4XGZB 3KLSA 1U92B 2NY4D 4LSTL 3VGAB 4P99A 3VCLA 5MEND 4XVJL 2HRPH 4MA8H 1N8ZB 3KPNB 5HHOB 1CE6B 3O81A 1YDPB 1I1FB 5CD5D 2WUCH 4WDIA 2AEPH 3OJVC 3QUXC 4XX1G 3KHQA 3LSOB 2DDQH 2VXTH 5H37G 3MFFB 4E41B 1YNKH 1BZQK 3TWCL 5DJYA 1LK2B 1NC2B 5ENWA 3C6LA 5B8CC 4FFWD 1AFVL 4MCZA 5C0RL 5E8OA 4Y2OA 5I66A 2VLJE 2Q76A 4XP1H 1K4DB 4PPTA 3MR9B 4NZRH 5AZEH 5KS9A 2QSCL 2OJZH 4C83A 3R1GH 4UQ2A 3JSSA 2BSTB 4MQXC 5D4QA 2X10A 1AGCA 4QOKE 1QQDA 2W9DH 3FRPG 4I3RH 4PLJC 3C2AH 4R8WH 5B21A 1A6PA 1RZ7H 5IB4B 4WU5B 3WFZA 3X3GL 1DP0A 2R15A 5LWYH 1NMCC 3G5ZB 5ICZA 2N7BA 2KUTA 2JJVA 5FO7A 1FNAA 2GSGB 1SYSA 1OF2A 2V7NB 3OMZA 1YY9D 1QSED 4ZS6D 2HFGL 3QXDB 3HMWH 4HAGA 1NCBL 4I2XB 1KTDA 3NCMA 5DEZA 3UAJD 1H0DB 5KANI 3CNKA 2HT2C 2ICWI 4GMTH 1MCPH 1A4JB 4OD3H 3MLXL 2I25N 3I50L 3NZHH 1KPUA 4S1SL 2MNUA 2Q3ZA 3M1BA 3MLVH 4QCIA 5TPWL 4CU8A 2GT9A 3KLHC 1RJYA 5F93C 2FLBT 3ARZA 4S0TD 3CFJB 4MA7H 3VWJA 1BD2D 4JRYA 5L7XH 1NEZG 1S7RB 2ZUUA 3PP4L 4P2CG 5L6YH 1IAIM 3DVIA 1T21A 1G7PB 4QOKA 4QYOB 3HRZB 1T1WA 5HYQA 3BXNB 4XMKH 4F9PC 5HYSB 5C0GA 1WAAE 4NCC1 1J88A 1NCCH 3E3QE 4Y2DB 3SDXA 1U3ZA 1FGNH 1E28B 3BD4A 1ZHKA 2VSDA 2ATKA 2FX7L 4ELMA 4QOKB 3O4LB 4JVUA 1ULVA 4H88L 4B53A 1T1ZB 3I75B 3NTCL 4NRYB 3H42H 4HW6A 3UROR 3HCVA 4FA8A 2R2HA 4F7TB 1GZPB 3SE9L 5D7SL 1RZ8A 2BSED 2E9IA 4Y5XC 2QSVA 4K7PX 1FLTX 4PJDA 4GG6A 1OW0C 5DLML 5FO9A 2NY0C 2N1KA 5HI3C 1FP5A 3VRIB 3PQYD 4AH2B 4HWZA 5FYLL 2QADD 3QUYB 5CCKL 1F6AB 3VDBA 2UWEE 4PJEE 5M94B 1KTDB 2DM2A 3HMXA 4CW1B 3R06B 3MGOA 3MV01 3ARGA 1PG7L 4HIHA 3GJFK 4UDTB 2H1PH 4U1NB 5CIPB 3GSWA 1MNUL 4TOYL 1F02I 3L3KB 4YHOH 4PJ8B 5DT1L 1IGIL 1QYGH 4LGPB 1NGWB 4XCYB 1FL5A 4K94L 3ULUF 4G43B 5SX4H 4L8SC 4S1RL 3BISA 4UV7L 5ECJE 3T2PA 4NC1E 1BGXL 4RA3A 1KXTB 4YK4C 2WBJA 5GHWL 1OAUH 1T80A 5SWSB 3SKOB 2R8SL 4HIXH 4IRSB 3FQUA 1FIEA 1DN0B 4OF7A 1EHLH 4OKVB 1JWSB 4A2MA 5I17A 3SO5A 1UZ6E 2AEQL 2IF7A 5JIHA 3IRPX 4MCZB 4FP8L 1TDQA 3N1QC 4Z18A 1OTTC 4XP6H 4U1MA 2E6PA 3JTTB 2VZ3A 1F4AA 4D8PB 4LRNH 2Z31C 2DYPB 1NAMB 3MV7A 4XVUC 3Q5TA 5GXBB 3BPNC 4EVNB 4QXTA 2NR6C 5ICYB 1MJ7H 1E6OL 3MGTA 3VD9A 4DQOH 1UCTA 4EI5B 4KZEL 3PWPD 4M7JL 4NRZA 4X98B 4CL7A 5IKCB 3FTGA 3P3YA 4QRPB 3OAYH 3DX7B 1RUPH 4OCYH 4YHIA 5DJ0B 1D9KA 4HDIA 3O3DA 3V4UL 1Q9WA 4R96A 1REIA 3TYGH 1YMHB 2VAAB 5EORH 2H8PB 4KJPC 1WT5A 1BEYL 2BZDA 1OQXA 3GFUA 3UTSB 2NY5H 1JPGA 1NAKL 1AXTL 4XBGB 1OAKH 4AENA 4EIGB 3OHXA 1ZE3C 4K9EH 1FYTB 5I1EH 3NMEA 5JOEA 1KJVB 3J7HA 5F1IB 1B0RA 1U36A 3L6FA 4P59L 5FKPB 1JNHA 4FXLA 4N9GA 4DFHA 3HC4L 5JW4R 4GBXA 4P2RE 3WL9B 5EZLB 1N6QL 1DQML 2ZOKA 1OCWL 3VFUB 3FJTA 3W82A 1NBYA 2RBLA 2YMXH 4H26A 2DBLH 3C6SA 4I4WA 4LVNB 2OR8A 4P9HC 1NKRA 3BSZH 3LCYA 3BEWB 5E2TL 1JYVA 3GJEA 3V0AC 4TNWK 4PRIB 5ESAB 4C54A 4JG0H 1T4KA 5IT2L 1YC8A 5TDOB 2EYSA 4ZAKD 5F7YC 1LEIB 1MY5A 5D8JL 2CIIA 3BIAX 3AY4A 3VFMB 4Y5VC 4NJ9L 2IBZY 1K4CA 2Y25A 2YRZA 3TVMD 5D5MA 1ORQA 4X5WB 1YEJL 1FC1A 1D6EA 1JNLH 4EUPB 1R3JB 3GO1H 2G60L 4JR9L 3DHMA 3A6CL 3CK0L 3EYFA 1ZHLA 3O41B 5MEQA 5J1SC 5F1NB 5L2JA 5FGCB 4TUKH 3UCRA 1YJDC 2RFXB 4AT6B 1P4LA 2YD9A 2OZ4A 1YC7A 3BH9B 1BWWA 4ETQB 5JLZA 1KCKA 3JWOH 1HSBB 1OSPL 2VIRB 4W81A 3FOMA 2XYCA 1S78D 4YDJA 1FE8H 2FD6L 2WWKT 1F4XH 1ZLVK 3CVHB 4CRPA 1FCGA 2CDEB 3JTSB 4LLWA 4XWOD 5F7KC 1H3WM 2YUWA 1L7IL 5CHNB 5DJCA 4Y5VB 2HVJB 5CP3H 4PR5A 2GCYA 1HILB 4OLWH 3U4EB 4XZUB 2XKSA 5F71A 5LQBH 1P7QB 4QHMB 5TDNB 3OJDB 5CILL 3VGDA 5T1MB 4HGKC 5DGQA 12E8H 2Y5EA 4Y19A 3QDGB 1XR8A 2F5AH 1OP3H 4Z8FH 4LVNC 3JWDL 5KJRL 1X4XA 1MIEH 4ZUUA 3IJSB 3DI2B 1T1XB 5E94A 1NCDH 4X8XA 1OSPH 4EDXB 1OY3B 3GIZL 3D2UD 1NDGA 4XT1C 2IADB 4G8IA 5CUSL 1F4XL 3IETA 3BKCL 1NCCL 1KJMB 4HS8L 4KMLB 4NUGL 2JJSC 3GI8H 2Z8VC 2VLME 3C5SA 2DB8A 5JHDA 1I7RB 3QJHA 4ZS7H 2CDFA 1MCQA 4KQ4L 3ZHDA 2F53B 2AKRB 3JWOC 1HQRB 1NLBL 4H25A 3RIFF 3MO1B 1OP9A 2AXFA 1XGRB 3ALPA 3I6GB 4HUVB 4G8GB 3JVGC 3M17B 3QQ9C 2FIRT 4PJHF 4NRXA 3BW9B 3EUUA 5C0IA 3GSRA 1QHOA 2IQAB 4WJ5B 4WO4D 4EI5C 1TIUA 1JTPA 3T0BA 2Z91A 3LN9A 2P5WE 2EDRA 1D7FA 3BPNB 1I8IA 3D18B 5C0CA 1XF3A 3WEXA 2Z31B 2HVKB 4Z7VA 2W91A 4U6HA 1HH9A 5BOPA 3T65A 1ZANL 1MFEL 3THML 2KKQA 3OAZH 4H1LH 5KZCD 3QSKB 1CGUA 4WHYH 3KYOA 1Q72L 5T1DL 4JJHA 2GJ6A 5TQ2H 5JXAL 4OQ1A 4Q97A 1IGFH 4MHHG 4CJ0A 5GQBA 1RJCA 4IRSC 1M71A 4GSDL 2VQ1B 4WW1B 1ZGLB 4DGVL 5C7XH 5I18H 1A7RH 1MCWW 3OB8A 4GOSA 1MCIA 4YK4B 3DSFL 1QKZH 3ZKSD 1QO3A 1RUKL 3GHEL 3CH8A 1CK0L 1TZGH 1LO3H 4X4YB 1QSFA 1GPOH 2HT3D 3WXWH 4P5KB 4OLXL 4ZTOL 5T3XL 1A1OB 3Q3GA 4L8SB 1AP2B 3DV4B 4EBQH 4PJXF 4DGYL 1S7QA 2XKNB 3H9SA 3VI3F 5JTWA 1XF4A 4N9OB 3SE8H 1WCQA 3LKQB 2YPLE 1NBZB 1SY6A 4PJ8C 4MNQB 3MROB 4OZGE 5FECA 5IG7A 4EXPX 2I07B 3RWHB 3VXPB 1F5WA 3GKWH 2VUOA 1JTOA 4ZFOA 5DJAA 4K3JH 2B8OT 3BP7A 1HKFA 3IKCA 1PYWB 1UXSB 2I60H 3QUYC 4LLVA 4MLSA 5EC1B 2NY0B 5DVMA 4KU1A 4F7PB 5L2KD 2V2WA 4H0HB 4PJEB 4Y5XB 1EAJA 2B20A 2MQCA 5BW7A 4KK9C 1SJEA 2R39A 4YR6B 3TT3H 3DJ9A 3K8KA 4JRWA 1MF2H 4XBEH 2YD7A 1U3HA 3OKDA 2CRZA 3U4BL 3CGTA 3MOQA 2FGZA 1KB5L 5EZJB 4X9IA 3HFML 2Q86A 3J8F7 4PJEF 4HHAA 2GI7A 1VPOH 3ZTNH 1NAKH 5FKAB 2BXZA 1WCBA 4HJGA 5HJ3B 2VLMD 1JMZA 1OAQL 1ZA6B 4AEIH 3EOAB 3MXWH 3MRKB 2XNAA 1FLRL 1GIGH 3EDJA 4HFWB 2FBJH 2CO6B 4U1KB 1SY6L 4YUEH 4Y2DC 4OLZH 1KT2A 3C2AL 3BP6B 1VGKA 5BXFA 2Z8RA 3QFJA 5CEZH 2QR0B 3LH2H 4HWBL 2AS5M 1WFNA 1BX2A 4BSWA 3REVB 4LPWA 4GAYA 5B4MC 3P77A 1YEHL 2OTWB 3NN8A 4FQXD 2GJJA 5LXGH 3IDXL 3MLUH 2VSCA 3DX6A 4XCNB 4DVRL 5C0EA 4HT1L 4YHMH 4LKCA 2C7UB 2A6IA 2WUBL 5FF6B 4OLVL 3HMWL 5HHMD 2ESVE 4PJXB 1W0WB 4M1DH 4FQJH 3CDGB 4I2XE 2GKIA 4GG8B 4WUUB 2ZUSA 2X6MA 5LGHL 3VFRB 1DR9A 1A5FL 5HHNB 1I7TB 1SY6H 3ECBA 5AD0A 5T33L 4DVBA 1MH5B 3C87A 5C08E 3QDMB 4J3XA 3GO1L 4NQVA 4S0SD 3FFDA 3HI5L 1JUFA 5KSBB 2LFGA 3IDIA 2R0KH 4M6NH 4OD2A 3MV11 4Y0GA 1KUMA 2E9JA 5E8DH 4LRIA 3CJJA 4KXZI 1KPVA 3VW3L 5IJVB 3HR5B 1I9RL 1NMCB 3NCJL 2MKWA 4Z78B 1VFOA 3DRQA 1C1EL 4TNWF 5H94A 4QRRD 2XXMB 3MV9D 4X6CE 3UP1A 1CZ8L 4HK3J 4CKVX 2HFEB 3NZ8B 4X9FA 4O02H 2XZQL 4N1EA 5F9DC 5K9OB 3C5JA 4MDJB 3LS5L 3ARUA 2A73B 4K8RL 2QQQA 1CBVH 3KJ6H 2EEAA 2R1XB 2EIEA 1W0VB 4B50A 3DBXB 5IROC 5TQ0H 2NX5D 5FM5O 5LKNA 1UB6A 1AY1H 3BZFA 4I1NB 5B8CB 1HXYA 3BWAB 3HNVH 1WIOA 1PZ5B 1Q9OB 4G6AD 1J8HD 2I24N 1UEYA 3DX8B 4GAGL 2NX5A 3F58L 5JQHC 1BWMA 4MXVF 1HZHL 5E8EA 1S5HB 3QUXB 4BFBD 5DUPL 1K6QH 5B22A 4GKSA 2Q6WB 5F96L 3RRQA 4O5LH 4M03A 3B8YA 3QWRD 3C60D 5IFJA 4NHUB 3GSNB 1UENA 3VGAC 4P5TA 3WLBB 3D39D 4WI6A 3C8KA 3S35X 1KELH 5E56A 4U6XB 5HHOE 2XTJC 5IHZB 1YEEH 1S9XA 2ADJB 4HPYL 4Z0BL 4S2SB 2HH0L 2WIIA 2DI9A 3BOVA 4OF0A 3DMMD 3PHOB 4F3FB 4KKLD 1U93A 3TBVA 1TVBB 2YZ1A 2KZWA 3KPRE 3SDAB 4Q7DA 1A7QL 3I6LE 2J6EH 2GSIB 3PWPE 4LDOB 3GB7B 4YFEA 5F70A 2BXYA 2G2RA 3BWUC 3M45A 1CT8A 4F15B 1S7SA 3N9GH 1K6QL 5J12C 3KGRA 1R24B 3VE0A 3ARDD 1OB1B 3MJ9L 3VGBA 1U8LA 1QHPA 4MJID 4X5LA 4DN3H 3PE9A 1OAYL 3VXMB 1UM6L 1NC2D 1KELL 3MOBH 3LHPL 5TE7H 5IB5A 8FABB 5I8EA 4DK3A 2FWOA 1W72H 2JJTA 4I0KA 4Z7QE 4XB7A 3ARBA 1F4YL 1CU4L 1TVBA 4GSDH 1HIML 4QRRB 3T0EA 2ZSVA 4KQ3H 4PTUB 4Q0XL 5JQ6L 2FZ3A 4ODWB 3WS3A 4RCAA 2B7DT 3SPVA 2ILLA 3AS3A 5C0DB 1RZFH 1JF6A 2XWBA 3CPLB 2W92A 5IHZA 1H15B 3MZGB 1A7NL 5FYKU 3HAEH 3V4UH 3MA9H 4PREB 1P1ZB 4WCYL 1U8KA 2OSLB 3HNTL 4Y2DD 3BKML 4FQLL 3U7AA 2FYYB 3MLYH 4AYFA 4WEBL 4MNHA 1T1YA 2D7MA 3UTTB 4FTVD 1I4FB 4EN3A 5D7JB 1ITBB 1MLBA 1HDMA 3AFLA 4PRHE 5GS0L 2ZPKH 4NGHL 5E8EB 1PD6A 5I1IL 1T7ZA 4FQXA 4EDWH 2FECI 1JN6B 1RZIB 1SVZA 3Q0HA 5IBUG 3VFWA 4WW2C 5C07D 1L9NA 4I3SH 2X70B 2PYFA 5AZEL 5KVEH 4XCEA 4HC1H 1LDPL 4FTVB 4XP5H 1UA6H 3C8DA 3Q6GH 1Q38A 2FO4B 2X4UB 1Y0LB 4YGVA 2RAMA 2DLGA 4X7TA 5AZ2H 3UBXB 1LEIA 2IGFH 4KHXL 4LDEB 5HI5C 3C8HA 3VFWB 1RIHH 1UKQA 3S36L 3O9WD 4BZYA 2J5LC 3ROLB 5ERWA 1H8SA 4JDTL 2AJXL 1HHJA 4RGMC 1EERB 4M4RA 5EFIA 4NJAL 1ZA6A 4S11A 4AIOA 5C9JB 4YLQT 1VADA 1BLNB 3SDCC 4OZGB 1RU9H 4HKXB 5JIPA 5CJ8A 5EIIB 3UMTA 5CWSB 2UWEF 2DI8A 5TFSH 1KJVA 3BAEL 3GSVA 3RP1A 3RY5A 1KCUH 1BJ1J 4PP2B 4MX7B 1A3RL 1I8LA 1EEUA 1HQ4A 4OCNC 1QRKA 4NZJA 4R4BB 1TQCC 5I2IA 4JM2F 3KWWB 1YEHH 4F7EB 2ZG3A 5DQJA 2H2PD 3HPJA 3EFDL 2ZNXA 4QRRA 4R26H 2C3GA 4PJIE 3SE4A 4FNLL 4U2ZA 5KSAB 1X6LA 4X6DE 4JRXA 3SHSA 1MCBA 3EYSL 4X7SL 4DCQA 3V6ZB 2R56H 4NP4H 3X13B 3IVKB 4HXBL 5INCA 3CZJA 4Z7UE 1T04A 3ISWA 5C0BB 4FQCL 2HLFD 3B2VL 3MJ9A 3OKNA 4Y8AA 4JFDD 4LAJH 5JOFB 2EXWD 3RUGB 3HE7B 4HFUH 5D1ZD 2XQYG 3GMLB 1NC4B 2VL4A 3SKJH 4MXQC 4PJGA 1S9VB 5LGHH 3LKQA 3BE1H 4LEOA 5IQ9B 3MNWA 4PGZA 4JFQA 1MEXL 2YWZA 4KUCF 2L0DA 3QPXH 5J1AA 43CAB 2MQ3A 1QLEH 2DQFB 2R0ZL 1QO3B 4M6NL 4L3EE 3T0VA 3EHBD 4TYUA 5M95B 3O6FB 2H6PA 3G5XA 3EDEA 1WZ1L 4LLUB 5DD5H 1DQLL 2Y6SC 1AJ7L 5A2JH 1WCBB 5JHDD 1SVCP 4G42A 1O7SA 2J4WL 1PW3A 1FVEA 2F53E 3BESR 4QY8B 1BOGB 1XIWA 2QKIA 4LLQA 1JIBA 2AK4A 4K3DL 3TA3B 1NFKA 4ERSH 3T4YB 4BUGA 2BFVL 1ADQA 2VKXA 3CCHA 1U8OA 3BN9C 4GXUN 4OTXH 1F13A 3K81A 4TRPH 4JFPB 3QBTB 4U1IA 1G7QA 5ILTH 4QRPE 1S5HA 3QUXA 4LLAA 4X7FC 4LLVB 1IE5A 2P5WD 3VG9B 1R5VA 4ODBD 4XNXL 4BFIA 3TA3A 1YNLH 2BNUA 4LQ1A 2Y36H 3NCBB 5F9JB 3CFKB 4XPAH 3BZFB 4KKAD 4M8QA 1OP5H 3U46B 1KFAL 4G42B 5IG7B 4Z7UB 1N5AB 2Y5TB 1A6VH 3BO8B 5FHBH 1CDUA 2FATH 5DJZB 1ED3A 4G9FA 4ZUWB 3T4AA 3LB6D 1VB9A 5DZLA 4E5XA 4IOIB 1FQ9C 2H6PB 4I9WD 2NXZD 2Y7QA 4K3DH 1SYVA 2BVPB 4IDJL 1P6AB 5SX5H 2DIAA 3RTQB 5TQ2L 3T2QA 5JXAH 1JGLL 1FPTL 5EO0B 4LSVH 4M5YL 4POYA 1AHWB 4GBXC 3V0VB 3T4AB 1KPVB 1D6VH 4KKLC 1S9VA 3NPSC 5EZOL 3MRRA 5SWZD 1HWGB 2RCSH 2NZIA 1I3GH 4NQVB 4N0RA 1QRNE 5IMOA 1T1WB 1J1PL 3B2UC 4U0RC 1EO5A 4PJ5D 3T3PE 4UUJB 4RWYL 2DQIH 4P57A 2OM5A 4NKMA 4N0FB 4RWHA 2COQA 2UZYB 4KK8D 5C0CB 5SWZA 1Y6KR 1OAZH 4XXDA 2BRRL 1FH5H 3UJIL 4LL9A 2Q8BL 4A6YB 1CGVA 4XPGL 4NQCA 2DWDB 3PL6D 3ROOB 4JREC 1BQHG 3FT3A 3DV6B 3ROOA 3M17A 2G75B 4YDJB 4I18C 1CU4H 2JK5B 3AB0B 2DIBA 2YKLH 3OSKA 3QDAA 4XXDB 3PABB 1ZHNA 4OFYA 2DD8L 4OZFA 1B4JL 4O58H 1NUGA 1I7RA 2X41A 3BDYH 4PGCA 5I1KH 2VXVL 3BQUD 5KW9L 1A7OL 3A6BL 3MX0A 1N6QH 4J6RL 5C0AD 4YDVB 3FZUC 1DQQA 4G6ML 4QT5A 2NY4C 1WC7B 3TN0A 2IWGA 5ICZB 3QEHA 3PGCB 3BKYL 4NN7C 4WFFE 2VDOH 2XG4A 4XAKE 4LLUA 5JA9A 1X4ZA 4PJ9C 4YGAB 1GIGL 3S36X 3BP4B 1NCBH 3U7YH 2DLTA 1DSFL 2FCBA 4P2OB 5EDXA 1SJEB 3QDJD 2D9QB 4JCLA 3LDBC 4GW1A 4CADA 4HZAA 1Q0YH 4C58B 1CDBA 2WV3A 4Q9RL 2V2WB 3HZYA 4OCLC 5EA0L 2ZOKB 1S7VB 3TEUA 5BV7L 4JFDA 3VXME 5I66B 3GK8L 1O5DT 4R90H 4JR9H 1TNMA 1MCCA 3S36H 2X4TA 4ZYKA 3IF1A 5FOBB 1QG3A 4OF6A 3BP5B 3PXJA 4ZSOA 5FECB 4XC3H 5IJKC 5CWSA 2WBJD 2VC2H 1DVFD 4O4YH 4R9HA 2NNAA 4C55A 4AT6A 5K9KB 3VCLB 3QNYA 4KXZH 4Q6IC 4D94A 4PP2A 4WNQB 5DUBB 2BY3A 5KG9B 4Y4FA 4MNQE 3WN5B 2EDWA 2YC1A 2YR3A 1BFVL 1KLGB 3HUJA 4U1JA 4K55A 4HQQH 1FNGA 1ACYL 1DDHB 4YZFF 2P5EB 2Z35A 2AQ3A 1OGAD 3NACH 3NCJH 4XVUD 3WJJA 2CIKA 4X7SH 1JBJA 2FO4A 1XFPA 3VXMD 3G5XB 1BZ7A 2ZKHH 1J86A 4LCCB 3OX8B 3LEYL 7FABL 4O2FB 3QB7C 5E08H 3HE6B 4JM4L 5HDBE 1FN4B 4J3WA 1RZIA 4JB9H 1N4XH 1FRGH 2AV1B 3BEWA 5D7IB 4O2EA 4Z7VF 1FNEB 3PGFL 2DF3A 4G6JL 3RZCC 5HSFA 1KB5B 3FQUB 1AY1L 2JCCE 4UT7H 2AQ2A 4HWEL 3TZVB 5FA4B 3Q6FB 3QQ4B 5JOFA 4LCWB 5HYJD 2HRLA 1MHCA 3U0WH 1IT9L 4K9EC 1PKQA 1MRFH 2YUZA 4WI7A 1KYOJ 5SX4I 3VJ6B 1BFVH 1HDMB 5EO1A 4L8DA 4S1SH 5ESQA 1S9KC 1QVOA 4DCQB 4NHUA 2ESVB 3CFBB 1NEUA 1FIGL 2CDFB 1DVFC 1R5WB 2OSLA 3I84A 1TJHL 4GRWE 3HPJB 1P4BL 2VDMH 1KTLB 2NQCA 4IRJA 5D7KD 3D0LA 1UFUA 1MPAL 1M7IA 4P2QA 4R4FH 3ARGB 4GBXD 1ZLUH 3VFTB 1H15A 3CSYB 1D9KB 2ZCKL 1PZUB 1IGMH 4L8BB 2VQTA 3QA3A 3TBYB 3ULVF 5TE4L 5B39B 2JKXA 3L3OB 3KPSB 3PJSB 4Z7WE 3CLEL 2QADB 4R7NA 2EXWC 2F8XC 3B3IB 4GG6B 4HKBB 4I0PC 1KGCD 2FWOB 2VR9A 4GKOA 5ERWB 4XP6L 1CWVA 4NC2B 3F7QA 3QI9A 2OR9H 1MELA 3ZYJA 3HCVB 1ZHBB 4R97B 3HB3D 4I8DA 4XNZC 4OGYL 1FVCB 1MFAL 1IC5L 4NKIL 4M7ZB 4HS6A 4X6BA 4PJ7B 3RHWK 3PGDA 2X4NA 4FN0A 4OM1H 4F3FA 3DYPA 4KRPC 5DJDB 1PX3A 1BM3L 3MLZL 3QIBB 2B2XH 3GB7A 4FQ2L 1RZJH 3RHWF 4U6XA 4FFZH 1RMFH 1I3UA 3FT2B 5FYLH 2AJYL 4JO1H 3BX7C 2OZ4L 3TJEH 25C8L 2X1XR 5BZDA 3ZYIA 3MNVB 2EKSB 4IHOB 4K3JL 1SBSH 3EOBA 5EU6B 1J5OL 3VI4F 1IGIH 2WM0A 4L8DB 4BQ6A 4QCIB 4D9QD 4YDKH 3DX8A 4L29A 1CICD 3F7VA 3R8BB 4V1DD 5DJ6B 5EULV 5CS7A 5C8JB 4WCYH 4M48H 1IC4L 2J2ZA 4JLRB 4OLEA 2ZNWA 5FYLD 4JEGB 3QEQA 1UB6B 5AAMA 3FCTA 2DQUL 2HKFL 1U8HA 5IT2H 2W9LA 1R3KA 3MLZH 4XPGH 5KAQF 1T20A 1V3LA 4PB0L 3HZKA 1AKJA 2AJYH 3OAZK 5GGSA 3DO7B 3UPAA 3TYFB 1EVTC 3RU8L 2AJUL 5EOQL 1AXSB 2R2BA 4H20H 2FHCA 1U8IB 3ZE2F 2ITCB 1CLOH 1FLRH 3DX9B 4XP9H 4YNYA 1MWAL 4O58L 3N85H 3BUYA 2MCPH 3PG2A 4NKOA 2VXVH 3RKDD 4LMQE 1E28A 2VZ1A 4LBEA 2NW2B 5D7KE 5EWIH 4OZIE 1U41A 4BH7A 2GK0A 3B43A 2BSTA 3EO1B 5ID1A 2VXTL 4X6CA 3UJTH 3TBVB 5GRUH 1UQSA 3VFNB 4J2XA 5IW1B 4YXHL 4JFXB 1OARL 4H5SB 4MAUH 3GSUA 1T21B 1ZWIA 1NUDA 4W6YB 3VFRA 3WIHH 4Y4HC 2WUBH 1DUYB 4R2GB 5GS2D 1W72B 3HE6D 3MOAH 4JM2D 3WNMA 3NIFF 4M4PA 5HYJE 3L3GB 2V5RA 1KCUL 4BH8A 1I1YB 4MAYA 4M62L 1AO7B 5EOQH 1U6AH 1RK1B 3MV8B 3GSNA 1RIVH 3RIAK 2LVEA 5J13C 3FT4A 3CX2A 4GW4A 3LRSA 2FH6A 1V7MH 5LGJA 4WUUA 3MUGB 3BPCA 5I8CB 3WXVH 3TFKC 1AR1D 5DSCA 3TV3L 5E70A 1ZOXA 2AV1A 4XWGH 3KXFA 1OCWH 3VWJD 4PRPD 1FHGA 1QSFB 1LO5A 3QFJB 4DKFH 4BQCA 1FZJA 4LCIL 5D7IF 1WZLA 3HN3A 2WBJC 5CEZD 2HFGH 4X8JA 3NN8B 1I85A 2VYRE 3O3EB 3PGCA 3EYVB 4B0MM 1CLZH 3D2UB 1FO0A 3LPGA 1RULH 3D0VA 4ONGH 3P0VH 3S6CA 4QXWA 3I50H 5MERA 1DQTA 2M26A 3MRKA 2NY2B 5E5UB 5DYOA 2WP3T 3MUY1 3S98A 4C83B 1QBLL 4NKDB 1I8IB 1IM9D 3ULSB 1OW0A 4LCYB 3FO9A 1ZTXH 1A3QA 4NUJB 4GAGH 4F7PA 1XZ0A 1C5DA 2P5ED 4MWFB 3VXQA 1N0XH 5E8OB 4YR6A 3DO3A 1JUFB 5KSBA 1H5BB 1FFQA 4NQCB 1E4XI 5HDOA 3X11B 3TNNB 3V6FB 4MAYD 1GRWA 2YEZB 4XH2B 4WDIB 5F7WC 1PEWA 1PLGL 3T3MF 3U36A 4HCRA 3HMXH 3ULVD 1FGVH 5HDQH 4NFBA 3CDGA 5JHDB 1NFIA 1FG2B 2ORBH 3I3BA 4ONGL 4HUMB 4U3HA 3BP7B 1TETL 3BQUB 3T0EE 3TCXA 4U6VH 1N3NA 2R0WL 4XGZA 2R9HC 1MY7A 5F7NC 3NCYS 2JF1A 3IFOA 2X09A 5BRZA 3H42L 2QV2A 2V2TA 2B4CH 2NXZB 2NTFA 3C5ZB 3RX5A 1QSFD 3AS0A 3IAGC 4MJ2A 4FS0A 4MB5A 3D3VB 3G6JA 4EIZC 3SDXB 2DJUA 4JKLA 4X4YA 1VGKB 5BXFB 4N0YL 4PRNB 5H8DA 2BSSA 4WGVB 2K1MA 2D9CA 1D5BB 1XF2A 4HUWB 3PWNB 4LSRH 1UKSA 4OZHE 2VQ1A 2FB4L 5EU3B 5AYUL 3QDGD 5IBLD 3LKOB 3FN0H 4KMTH 2OX5A 2GJ6B 4MJIE 4Y5VA 2XI9A 1G84A 4NQDD 5KN5B 2CLZA 5IGXH 3QEQD 1F00I 4LK4A 5BV7B 1NLBH 4RAUA 5F6IC 2FSEB 1EFXB 4B41A 4U6HB 3RBSA 3UTTD 4MXQD 5GS1C 3WFHA 3BKJH 4N0UB 4WGWB 1HHIB 4EJ1C 4PJ5E 3X12A 5FB8A 5DC0A 1UJ3B 4NKMB 4PJIF 3HZVB 4K7FB 5I1AB 5FHAH 5GHWH 4UIKH 4L4VD 1IKFH 5DK2B 3CH1A 5EO9B 3G04A 1I8MB 4AMKL 4UINH 5JDSB 2Y06H 3H7LA 2GYSA 5EIVA 4URTB 1Q9LA 2R0LL 1XF5B 3EOTL 3ZE0F 1DBJH 3HUJF 3U30C 1HQRA 1N2RA 4OB5H 1K4CB 4X7EC 1PSKL 1INDL 1WEJH 1YN7B 4G8FA 3EYQD 4LQFH 4HJ0D 2R4SL 5C0CD 3VXSA 2CXGA 3O6FA 1DQJB 3U2SA 1FL3B 5BQ7A 1TVHB 3HTLX 1LDPH 4XP5L 2OJEB 4YDKL 5IMKB 3IFLL 3HE7D 4PRIA 5D1ZB 5ESAA 4APQD 1N7ML 2CK0L 4IOIA 4UV4H 1RUKH 5FIEA 5TDNA 4NNYB 4NNPL 3KS0J 4R3SA 2J8UB 5C6PB 2DTMH 3GMLA 5DMYA 4DWHA 1J8KA 3U7YL 1BEYH 3C6LB 4XP1L 1CXFA 5I6XB 2MOVA 1G7HA 3ES6A 1T83A 3JTSA 4RGOL 3MMEB 4FMFA 3T65B 3STLA 2XTJD 4PLNC 4MHHI 2Z31A 2WIMA 1HILA 2IH1A 1EEYB 5DD1H 5TFSL 4RMQA 2HG5B 4PJHA 3WD5H 1Q94A 1FYTE 4JFEB 2JLLA 2CQVA 2VE6A 3I3EA 3GSRB 1Q9WB 5EWIL 4PJDF 4PY7A 5C0IB 1U9KA 4QTIH 3V2AR 1IEHA 3FOMB 3ARVA 2DMKA 5DHVH 3MO1A 1WT5C 3P4NA 5E6IA 1LE9B 3QUMA 2CO7B 3SDDA 1J05A 4HIJA 4ODUB 3VD7A 4IJ3C 4GMTL 1KCVH 4KV5E 5E8NA 2X2YA 5HGDB 2PXYB 3FQNA 1HK6A 4Y4FD 1A3LH 1CBVL 5DRXA 3MXWL 1YECH 4ZNEA 2PO6C 5ADOL 4XMPL 5ANME 3G9VA 2ARJQ 4KK9D 3C6SB 3INUH 4JQIL 4OCMC 4NQEA 5C08B 4WU7A 1IBGH 3RWCB 4Q9BA 5BOZG 5I1HL 4HWBH 3O9WC 5TH2A 4XCEB 1QFWI 5GGTA 3FAWA 2PTTA 3SGEH 2EYSB 2VOTA 4ZQKB 3UX9B 1NMAL 4P9HL 1NFDB 2FEEL 1P2CA 3U1SH 5L88L 1FNHA 2XFXA 5D7JA 4NO0B 3ZDXE 1NGZA 2OQJA 4JPIA 1NBYB 2DQDL 4X4XB 3D85D 3IAQA 4HH8A 3T3PF 2C3XA 1FYTA 2AJ3A 2LQRA 1S7UA 3L3HA 2JB5L 2VDRH 5DJ2B 3B9KB 4PUBL 3QO0A 2FX7H 1IAKA 5EUKA 5AYQA 1YECL 1YMHA 4LIQE 3MRPB 5DXWA 1F58L 3S88H 4HPYH 4Z0BH 3TIEA 5ADPL 1U8QB 1AXIB 3OR6B 2XWBB 1IILE 1MI5D 1QBML 2VXSH 1QEWB 4Y1AA 1RVFL 1CD1A 3RPIA 3W0WE 2R0KL 4NM4H 2UWEB 4BZ1L 5LGJB 3LOWA 5IMLB 5MEPA 3H3PL 3PDOA 4EN3C 2I9TA 2A38A 3QEUA 4PBVC 4XPAL 4TSAL 1DZBA 4OF3A 4EI6A 3U1SL 1UWEL 1TQBC 5E2WL 1A6ZA 1C12B 4UNTA 1I1YA 3TFKD 3VXSD 5IVNA 5TE4H 5FHBL 1RURL 3RGVD 1BF2A 4NRYA 3I75A 3NIFE 2AGJH 3FQXB 3MRFB 3Q1SH 1RZKL 2JB5H 4HGMA 2EYRA 1UM4L 3HMXL 2AJVH 4ZO7A 3RAJH 2P49B 5GGUA 3LMJH 5IW1A 1A6AA 3FRUA 1CT8B 2ZSWB 4PB9H 4X6FA 5DFTA 5LBSH 2NY3C 1U91A 1CFNB 2VDKL 1IC5H 4NQSB 4MXWH 1JWSA 1BVKB 4OFDA 3UYOD 2A6KB 3VD4A 2VLKA 5CINL 2HLAB 3CFJA 1UWEH 4N0YH 4FQ2H 1WFOA 1FJ1B 4Y1AE 3KLAA 4NQDA 3QUML 2ZG2A 4JPVH 3QIWD 4LSRL 4YBQD 1FNFA 3MRDB 3V0WL 2VZVA 4FQIL 3MRJB 2P5WB 1FSKC 5HI3D 4WWKB 2X9WA 4KMTL 1ZVSB 5GS0H 1EUTA 4HPOH 2AVGA 3JUZA 2IAND 3SY0A 4UDTA 5CIPA 5DQDL 4P2OD 1DQDL 5DD6A 1MFDL 2NX5B 4BKLB 5KVEL 2X4RB 1J0JA 3RNKA 3MRDA 3DX7A 2EEBA 4YHIB 4PV8A 3UJJH 4MJ5B 3VXNA 3BGFB 4LSQL 3D9AL 5GRWA 3M8OH 3GKZA 1QNZH 3TVMA 1W8NA 5F9OL 4LSSL 4RFNC 1CFQB 4O2CB 3D85B 5C0AB 1YQVL 4PGDA 3BGMA 3MPCA 1IKFL 4Y16B 1L7TL 4TVPH 3HC3L 5IBTL 1CF8H 4JGMA 1J10A 3AS1A 1TCMA 3FT2A 2BHYA 3SQOH 4GJTB 5C0CE 4CAGA 3SJVA 3NIDE 3DRQB 3MOBL 4APQA 5C09B 1XMWA 1T89A 1X6NA 1A1NB 2O26U 3S96A 3W9DB 1KLUA 1J9CT 2ADJA 1S7XB 3MRNA 4Z9KB 3KLDA 4RISH 3U0PB 3G08A 5LWYL 4JZJC 4LNRB 3EFDH 4Y5YC 4QHUB 2MCG1 4FNLH 4FOMA 1G7PA 4QYOA 4MGXA 2MSPA 4NNPH 3HNSH 4LFHG 5E2UL 1CGSL 4JRYB 4S1DC 4AQOA 4TUOB 4YO0B 2DM7A 3DUHA 43C9A 5B3JE 5IHLB 1J8HE 1IVLA 4KPHL 5ISZE 5GS3A 1MOEA 3S35L 2FO1A 2FDBP 1ZA3A 3IU3B 4XNQA 4XTRD 4BKLA 3BVNB 1YY8B 5FM4A 1OF2B 1V7ML 3O6FD 2A6DB 1BFOA 1P7KB 4HIEB 2X4OB 3MNZA 5C0BE 5FO9B 5HVWA 3IXTB 4I3SL 4X4ZA 3CK0H 5I1LA 3BJ91 1AIFA 4Y16D 3MJ6A 2CSPA 1QVOB 4XPHH 1NGXB 4P46A 1DUZA 1EK3A 2DDQL 1RIUL 5FDWB 2O5XL 2IGFL 1L0XA 2K9UA 1NJ9A 3FO2B 5GGSY 3KPQA 4F58L 4HMEA 4YE4H 1SM3H 1HKLH 3S96B 3W9DA 4UNUA 1DBBL 4LMQI 5JUEH 5D2LE 4APQB 3TO2B 4U33A 1II4E 5IB4A 3LD8C 2PCPA 3QR2A 3MLPA 2VLRE 1NBVL 3T0XA 4LPTA 5I1JL 1AGCB 1NQBA 4E9LA 2DQJH 5ENWB 3HE6A 1G7JA 2DN7A 3ZT7A 1A5FH 3D5OF 4NQEE 1LNUB 3TLRA 3QZWB 4K23L 4E42B 5J9PA 4IEFB 3CDFA 5EC1A 1MRDH 3QXUA 1MIML 5F3HA 1GAFH 4TTGA 3QH3A 4JZOB 1PAMA 3JWDH 3KPNA 5DR5L 5KJRH 1CXLA 3R0NA 5DJYB 2Q7YA 4Y4KB 3RDTB 1YUHA 1RHHA 4MQ7A 5A2FA 5F88B 5J4MA 4KJWD 5TF0A 3EYSH 1TCRA 5CCKH 1P4BH 2VB5A 2VDML 4CJ1A 4HXBH 4OGAD 3BKCH 4JAMA 3UAJC 5DC4B 3B2VH 5F6HI 4R4FL 1P4IH 3H2WA 1DN2A 2EDEA 2I27N 1T0MB 2ORBL 5EN2A 2QR0A 5I1JH 1U8QA 4NBYB 5C0JB 1TCRB 3OPZH 3MLVL 4ZPVA 4F37F 1UB5A 3R4DA 5T1KA 5D7LA 4FRWA 3WFCH 5L0QC 1QLRB 5IWLC 5GJTH 5A16B 2R0ZH 3DROA 4JFDB 4AM0B 1GAFL 3GMNA 3BDXA 4NPYB 2A0LD 4XMLH 1YEKL 5I15L 3KYOB 3QZWA 4H8WC 4ONFL 2IEPA 4AEFA 2FHBA 1NFDA 5FCUH 4WO4B 1H3TA 1X5KA 2XG5A 3WSQH 3MV9A 2ADGA 1JYXA 5L2KE 4UZGA 1U8MA 5KAQG 3GMQA 1UM4H 4NPYA 2GTWB 2F74A 4WY7L 2BNRE 4QF1A 1MCRA 3SDCA 4PJAB 2GEEA 3H9ZA 4PRPA 5F7EH 1KB9K 4WJ5A 4QRUB 5TDPB 1VFMA 5D7LB 5J8OA 4ZXBD 5HHPB 1CG9A 1TJGH 5IV2B 5DJAB 1KLFA 1EFXD 1C5CL 3QUKB 5I1DB 4OV5B 5AUMA 5EN2B 1BECA 4OZFB 1T0MA 1JZ8A 5E6IB 1ZLSH 3K2UL 4HIEA 2A6DA 4LLDA 2AEPL 4G6MH 3HC0A 1G7LB 1EFXA 3WSQL 2FSEA 1AXTH 3TWCH 4YHLL 3CFCH 2ED9A 4V1DB 4QHLB 5J57B 5I1CL 3HG1D 4CVXA 1WEJL 4ZAKC 5LVEA 3BPOB 2DQTL 4PRAB 5ITBL 4NZRL 2AJ3B 3LKRA 2HWZL 4F2MB 3RU8H 1NGZB 1F42A 2VH5H 1KN2L 4P2QD 2I26N 2R1YA 4HUWA 4GG6F 5GGVL 5IFAH 4IRJD 1C7SA 2R1YB 1AI1L 2BSSB 3VI3E 2FJHA 1BGXH 5DMGD 3OGOE 3VXRE 3BSZL 4NWUL 2HVKA 2VLJB 5K9QI 4D0CB 1N6VA 4PP1D 8CGTA 2GCYB 5HVHB 1P7HL 1CDJA 1I7ZA 2HJFA 4HZLB 1KB5H 2VNCA 4H0IA 2R9HD 2LU7A 3O0RL 3W0WD 4PRBA 5IMKA 5ACLA 1K3ZA 4GRLC 4JO3L 3MLWH 3T1WA 4WFEE 5K9JH 4NN5B 2Y7QB 3KR3L 4QXGH 3QP3A 3QDMD 1X44A 5DMJB 5E8NB 4Z7OE 1YN7A 4G8FB 4U49A 1CICA 3VGFA 4XNYH 5MP6H 3O6KL 4FXGA 3O41A 4UAOB 1G9NC 2OL3L 3DNKA 3QAZC 4ODVL 4XCCH 1ACYH 1KBGL 4M7JH 1RFDL 3QUYD 5CJBA 1FDLL 3W9EB 5DJ8A 3PWUB 2HJFB 1Q8MA 1ND0B 1K5NA 2N7AA 4DKFL 3CCHB 3OAUH 5E5RB 2CIIB 4KHTH 2AK1L 5HYFA 3MRHA 1C08B 2ATPB 1YEFL 4KC3B 4P2YA 3TBSA 2L7JA 1MQKL 4L9DA 3D69B 5C6TL 5JHLL 1BOGA 1ZK9A 4XMPH 2HLAA 4O00A 2HTLD 3L7FB 1CDIA 4EZMA 3H6JA 1CLZL 3O4LD 4IIQC 4UB0L 1I85C 4YH6A 3QQ3B 3IS1X 1NCWL 3S37H 1A9EB 2H9GA 1U3YA 2RQ8A 4W6WB 1RFDH 4NZUH 3EDKA 1FIGH 5MEOB 5DRZB 1Y18B 4TN9A 4X83A 1JPGB 1DBBH 1KPRB 4V2BA 5DWUL 2BHUA 4G6FD 4GS7B 2EC9U 3GI8L 3RGHA 4Y16A 3ARFB 3SBWC 2C3WA 2VC2L 4B5EA 3WCYA 1Z9OA 1X5YA 3WFDL 1MHHB 2DQJL 5EU4A 5ADPH 4G6FB 1SJXA 1T04B 5ETUA 5C0NC 3RL1A 5GSVB 3G04B 3ILQC 1I8MA 5GS0C 1UG9A 4CMHC 4UB0H 4KKBD 4JRXB 2BY0A 1VERA 4M3JA 4YHOL 3DXAB 4M61A 4TUKL 3S9DB 1NGPL 3IDJA 4NM8H 1HQ4B 5FO8B 3AREA 2Y6SD 3QCTL 3NCEB 3MCLH 2D0FA 3QG6A 5E7FA 3K80A 1D5ZB 2V5MA 1WZKA 1KULA 1HHKB 1F3DJ 3TBWA 1BM3H 1KTKE 5FUOL 2G5RA 5DURD 1HCVA 1IQWL 1BZ9A 4HUNB 4GUPB 2VL5A 2X1PA 3QDME 5SWSA 3CUPB 3FO0L 1MCOH 5FDYA 3ULUC 2GQHA 4RGND 3LQAH 4HK3N 4Z7WB 1PBYA 3D69A 2EDNA 1ZXQA 1OGAA 4JO4H 5E2VL 2BY1A 4HV8A 3MBEB 4I13B 1IT9H 4XHJD 1T89C 5CGYC 4PG2C 4HH9A 2EIZB 4OCRL 3BH8A 1Y0LA 1NGPH 5GGUB 3U7WH 5GZNC 4WI3A 3VRLE 1BIIA 4JZJA 2V17H 4HLJA 4M48L 1A22B 3NFSL 1LO5B 3QUMH 3WS6C 1LGVA 3HR6A 3KDMB 3V0WH 3KXFB 4FQXB 1RUPL 3LV3A 2F15A 3GBNH 4LSUL 1WGOA 3ESVF 3H0TB 3MA7B 3N1FC 3HG1E 5MEPB 3A67H 1RQ5A 4LHUD 1NL0H 1HHHA 3VXOA 4BQ8A 3CLEH 4Q6IA 1CD1B 4QO1A 2VLLB 1JYWA 1IKNA 2CRMA 4JE4B 3V7MA 4WUKL 3VWKC 1BBDH 1I3GL 4RAVA 1QACA 4HZLA 3S3JA 5ACMA 5I17B 4PGEB 2C3HA 3O4OB 4XBEL 4PJ9D 1FO0L 4TNVF 1QSFE 1K8IA 4H8WH 5FUCC 5B4MD 2GTZA 4ZNCD 5GJSH 3TM6A 4X4XA 1N0LA 4M7LH 5I0DA 3MMEA 2HN7B 5IVZA 1NEZB 1VACA 2W59A 4YPGB 3BXNA 5HYSA 5L2KB 3SDXF 4EQ2A 2Q8BH 1V8HA 3BI9X 1R6VA 2BNRD 4ZQKA 1QLFA 1QBAA 3BUYB 4X4ME 4HKBA 3LKRB 4LGSB 1FL5B 4ZODA 4N0CD 4O2CA 3O6MH 3GGWA 2HWZH 3VH8B 5JPMA 4PJ8A 1EX0A 2GJ6E 3TJEL 3HI1B 3W81A 3MBXH 2BVOA 1GYAA 4PV8B 3QRFM 3PQYE 1BBDL 3AREB 1Q9KB 1Z9SA 3SDAA 2E8ZA 2ZUTA 5DJXB 1JRHL 3REWA 2K7QA 4XWGL 2VN7A 2EZ0C 1QRNA 2N4IA 1GHFL 2R1WB 4LHUB 3MRJA 3MRGB 3BKYH 4LCIH 3RKDC 1RI8A 4PJIB 5IMMA 3C8KB 4LNRA 1A14H 2V5TA 5IV2A 4ZTPL 3QXWA 4JN2A 4YXKH 1T6WA 1MHCB 2ID5A 4M1CD 1T03L 4WRLA 2OP4L 1LO0H 1Q1JL 3OXRB 2DQEH 1LP9F 4K7PL 5I73C 1T22B 3N50A 3VFSB 3R1GL 1HHIA 3AUVA 1UEMA 1XCQA 4N8VA 4NQSA 1T6VN 3RWIA 4ISVA 4JG1H 4XPFH 1RPQA 4OI8A 1MVFA 3C9NA 4ALAH 5IB1B 3ULUE 1IBGL 4RFOH 2R56L 4LCCA 1JPST 1WF5A 1B9ZA 1BD2E 4QWWC 3JUYA 2A1WH 4RQQA 3HFMH 3CVIH 4MNGA 1A6TA 4KH2A 4GT7A 1R3IH 5EU3A 2AQ1A 3QDJE 5F9WC 1ZHBA 2A73A 4PJAE 2DQDH 4QNPF 2GT9B 4G9FD 3SCMB 4D9LL 5CBEB 1MWAB 4MDIA 4YXKL 4E41A 1GSMA 5HHXL 1A2YA 4LLYA 2IPTH 4OGZA 2D31A 4KJQC 1EV2E 1I3VA 2P47B 3UO1H 1I1CA 1U6AL 1VA9A 1X3DA 4LP4A 1NMBH 2AV7A 3L3OA 3NZHL 2GITB 2IPKB 5TGBA 5DR5H 2P5WA 2HTKD 4N1HB 5CLTA 5AUMB 5EZIL 3PIQA 4ZSOB 3F7VB 3IFOB 5GRYA 4X6DB 4U2YA 4Z7VE 1CXIA 1UJTA 4PJFA 3D0LB 3QQ9D 1YEDA 5CSZB 2R2EB 1FV1B 4W68A 5CJ5A 4LVHC 5I1GL 3EOBB 2WLZA 1UH4A 5C0BD 4A6YH 1GOHA 3L3HB 1U8JB 2AK4D 1CICB 5JPNA 5JXEC 1LMKA 1K8DB 32C2A 3MLRL 4TRPL 1S9YB 1ZANH 4GQ9L 5ISZD 2FL5B 3PDGA 3I2CH 3MRMB 1NPUA 1LP9A 1BBJB 3TVMC 3VWJC 4UBDD 3TO2A 1IGCH 15C8H 4M7KH 2X4NB 3GMOA 4KI5E 5BZWB 4AM0A 3L5WA 3SOBL 2CLVB 2PW2A 2V7HA 1IC7L 4P5MA 4KAQL 1QRND 2FEDC 3I3DA 1VFAA 2PXYA 3FQNB 3ZE1E 3M07A 5D70H 1FO0B 4U1GB 1JE6A 4UIKL 4F2MA 2ADFH 1PVHA 3SDDB 2UWEA 4JANA 1FFOB 2XKUA 3P4NB 3PABA 5F89B 5KVFL 4I48A 1KLGA 3HUJB 4PJ8D 5ALCH 5JOPE 4G3YL 5D2LB 4EKXA 2R29H 3QHZL 4PFEA 2E7HA 5EZOH 5KG9A 3VFTA 4U3XA 2R69L 2W0KA 4YDIH 1G6RA 2I5YL 4WFED 4GLRI 5HYEA 4Y4KA 2Q7YB 3RDTA 1MFDH 2E7CA 2HG5A 1KTLA 2C1OA 5D1XB 3BPCB 5I8CA 1NLDH 5F89A 1NAML 5SWZB 2VISB 4X9BA 4IRZH 1I7UA 1U95B 1QFUL 1CTNA 2XZAL 4XH2A 4D3CL 3FFCD 3VMNA 3FKUS 4WI4A 5F9OH 1CG9B 1OAZL 4J4PC 3CZFB 3P9LB 4C56D 3W39A 2HT4D 4BSJA 1PQZA 6CGTA 1L7TH 2F19H 1X5ZA 1XGTA 1HI6B 3DVNB 4ZD3L 2HMIC 5DURB 4TVPL 2Z8SA 4XCFH 5ITBH 1RUQH 2FX9H 2IAMC 1KLUB 4QF1B 4MMZC 2OXHA 3GMPA 1KGCE 3O9WA 4BM7A 4JFXA 2IBZX 3GBLA 4PJCA 2QHRL 2YPKB 3CLFL 4J1UB 4O2FA 5I1KL 2FH8A 5A43C 4DN4H 4TULL 2E27H 2AJZB 3N9GL 4IRZL 1F3JB 3BO8A 4CN6A 4OAWB 1M7DA 1OAXL 1M05B 2BOCA 4D3CH 2FHFA 2WQ8A 3DX9A 4YNYB 4JM2C 4YJZL 2CDGB 3MJ9H 3W0WA 4M8QB 4Y19E 1UB5B 1EXUB 5T1KB 2WSKA 3O4LE 4GW5B 4W4OC 1MAKA 3EBAA 5JDSA 4Y4FB 2D7NA 4G5ZH 2BVUA 3RGVC 1B4RA 4KKCC 1AC6A 3GIVB 5LAXB 1KCVL 1LVEA 3RVTD 3SGDH 5FGBA 3O6ML 4XNUH 5T1LD 2EE9A 2BJMH 3CVHL 1A4KB 4JAMB 2YD6A 4GW4B 5ADOH 1RUAL 4YHNA 3T2OA 1JGEA 2V9RA 4MD5B 1IQDB 5IOPA 3LEXA 5EBGA 1PG7X 4M93C 4DKAA 1TXKA 2M8XA 5AEAA 5A40E 3U9PH 2FX8H 1FVEB 4BFGA 1G6RH 2WP3O 3V79C 4XPHL 3V8OA 3T1FA 2IAMD 3W11D 4RMVA 1KTRL 1GGIL 1AGBB 4I0CC 3B83A 3CU1A 5E99H 3MLYL 1QPPA 5C0FB 3C5SB 1OARH 1HEZB 4HSQA 5ESVA 1D5BA 5FUZH 2DL2A 2ZPKL 4NGHH 1KSRA 2HT2D 3IETB 1TVHA 1T2XA 5D1QB 4ZOEA 4PUBH 1A6AB 2VDNH 4G9DA 4CDHA 1I1AC 4KDWA 5D93B 1SJVA 1ZAGA 2OYPA 2DYPD 1CFQA 1DQQB 2XY1A 1FVCA 1QBMH 4CBPA 3ARDB 2R2BB 4FZ8H 4HIIA 4ALAL 3WD5L 5FDWA 4HS3A 2X1QA 3DTXB 5JW3L 2CGRH 4PJIA 5A3IC 4BZ1H 4JRXE 1GJIA 3AM8A 4JDTH 2ZOLB 3MZTA 4TSAH 4OBSA 5IMLA 1CVRA 5DI8A 2CMRL 1T66C 3BVNA 2EDOA 4ZXBB 2Y9RT 3FQTA 4FG6C 2ZCHL 2HKHH 4UBDC 5DJ6A 1NCNA 4YZFE 4U7MA 5DMIH 3WNOA 3BFOA 3H3BC 2CLZB 2ERJC 5F7MC 3IKKA 4OKDA 5DS8A 3ZO0A 5B38G 4OZGA 3W2DL 4JO2H 2VLKB 2FGWH 1MJ8H 3MFGB 3C6LD 5F6HJ 3NTCH 1N6UA 4XAKD 4I3GA 3NCYP 5SWQB 5DDHA 4GMSL 1DEEB 2DMCA 3QNXB 2RIKA 3MXVH 5D1XD 1P2CB 3G5VA 1OM3H 3F8UB 4KDVA 2YD3A 3MRNB 3Q6FA 1BQUA 2BOBA 4PGBB 3KLHD 4YGVB 3EO0B 4R7DA 4LARH 2PTUA 2XTJE 1YEIH 5EO0A 3V52H 3SGJA 3SKNB 2JB6B 4QHNB 3LKNA 2JTDA 4JO4L 3RVWC 5TE7L 1BJ8A 4CVZB 1JGVL 3NABH 2RCSL 1I4FA 1KG0B 3VXOB 1HHHB 3MLSL 4U6VL 4LEOB 1QYGL 4OIAA 3EJJX 3BGMB 1WZ1H 2B1HL 2X4SA 1ZT7A 2C1PA 5IEHB 1U8KB 3QNZB 2JCCB 3L6FB 4HG4K 3VXNB 2VZSA 3MXVL 1CS6A 1J1OH 1TJIH 1UCBH 3TJHD 1ZGLP 2BNUB 3WN5A 5KTEH 3ESUF 2P8LA 5I19H 2D7PA 2P24A 4YX2H 4P2QB 2B5IB 2B2XL 1XZ0B 3ETBF 4MWFA 3U83A 3KS0H 3A67L 1ZWIB 3FB8B 2FZ3B 3ZKQD 1CF8L 4JO1L 4LASH 2FJFA 3VFNA 3FB8A 3FONA 5BS0B 2AGJL 4OUOA 2FB4H 1LE5A 4P46D 1WQVT 4R0LB 5CZVH 2P1YA 2ESVA 5I8EB 2NY1D 5IESH 2C3VA 3EJYC 4QRPA 3IJHA 4HGWB 1G7HB 4NOFA 3B9VA 4WTZG 4DW2H 1EBAA 2PW1B 1F90H 1LD9A 3EFFB 5ID0B 4G7YH 2EYTB 3O8XB 3ILPA 4DGVH 5C7XL 2XZAH 3WNLA 1YNTB 4WI2A 1KCLA 3GI9H 1OLZA 5INDB 5GGSB 2G2RB 3NGBB 5IIEB 3B9AA 1T83C 2OJEA 5FO8A 5F3BB 2VXQL 4FQHB 5DRXB 2DTSA 3B5GA 1CFSA 4L9LB 3QDGE 4JPVL 5FFLA 3O0RH 4JFQB 2J8HA 4PGBA 2Y07L 1Q0YL 1RU9L 4TTDC 1KIRA 5C8JA 4HD9A 5I1EL 4QXGL 4WHDA 1INDH 1JN6A 4TVSa 4GRMB 3PV6B 4M3KB 5FV2A 3BGAA 4MAYB 3I6KA 1DLHB 3O6KH 5F7DA 4K71B 3VFGH 4P5TB 2AJSL 4WV1B 4XX1E 3UJJL 4MQSB 2BVTA 2E5EA 4PJBA 1ZHNB 3MRIA 4GKSB 1YJDL 5JHDE 1KNOB 4N8CL 3BPLB 3VXTB 3Q48A 3DHJA 4KDTA 5CJQH 3DUUB 3K7UA 3FT3B 4YAQB 4JQXA 3SO3B 1T03H 1P7QD 1WTLA 4LHUG 3RY6C 4BQ9A 1INEL 1VESA 1ZVYA 5IUSA 4KZDH 2DAVA 3QQ3A 1MAJA 4Q2ZB 3F7RA 5IB3B 2J6EA 2NY6B 4Q9CA 1U8IA 3C60C 2I9LA 3QFJE 1O7VA 2H32H 2C4FT 1GXEA 1KIUA 3QI9B 4K23H 2R23A 4WEUD 5CEZL 5TPWH 3F6LA 2YK1L 4JFDE 3VXMA 1WZMA 4OCXL 4UOW1 1U2HA 4QGTA 3VXSE 3F5WA 1MRDL 4P2OA 1R3KB 4ODHL 3UBXA 4M6OL 1NCAL 4PRDA 2P44B 3SE3A 1UKTA 3RVVC 3DMMC 2BMKA 3ARXA 3EO0A 1LEGB 3H9SD 3RWFA 3QA3B 4ZSOE 3TBYA 2PYEB 3PGFH 1N26A 4J23A 1N2RB 4EOWL 1TLKA 1J11A 3IDIB 2J3SA 4YDVA 4JFHE 4OF8A 3QG7L 3MRLA 2H26A 4NDMB 1OVZA 3P0VL 2OJZL 1DVFA 3A6OA 5DK2A 3WUWG 3EJYD 4OTXL 1KN4H 2AAVA 5D96B 4FQPA 1UJ3A 5T3XE 2A77H 4MD4A 4OZIB 1X5XA 3TH4T 5E2JA 1MQ8A 1WWAX 2BK8A 1JHTA 1RZ7L 4JRYE 2NR6D 3WS6A 4GG6E 1JGEB 5AAWA 4LKCB 1R5VB 2YA1A 4RAUB 4J7RA 2V2XA 4JFEA 1FZKA 5DLMH 3SDAD 5FYJE 2FRGP 1AQDA 5HGBB 3GSOA 3VFPB 1X5GA 1Q0XH 3T0EB 4F58H 3HI6H 1TPXB 5D7IA 3RWDA 5LG1A 2PNDA 5DYOB 1MRCL 4LSPH 1ETZB 8FABA 4NUGH 2FJHB 2D0HA 3QG7H 3VMOA 5ITFA 1FGVL 5HDQL 3RBGA 3JZ7A 4YFLI 4KI5C 3LQZA 1OD7A 5D2NC 1WAAF 4Y1AD 4KQ4H 4JO2L 2XQBH 4FZEH 2ZCLH 4G9DB 4OFPA 5F97E 5A2IH 2ZJSH 5B39A 4GMSH 4L4TE 1MJJB 5ANMA 4ZO6A 2DLEA 5EU6E 4Q58C 4JJ5B 3PP4H 4AJ0A 5L6YL 4TSCH 5D9SA 3ZYZA 4P2RB 4JB9L 3BQUA 3QO1B 5F44A 4PJEA 4LLDB 3F12B 4ZUWA 1R5WA 4P23C 4M8VA 1JJUA 1HE7A 1N64H 4PLOB 1NC4A 5DTFA 3Q1SL 3S4SA 3DVNA 1XGTB 5AYUH 3UJIH 3RWJA 1JCKA 3CFKA 4ZYKB 3PL6A 1ZSDA 2EIDA 4RMUA 1XF5A 1Q9LB 5DZNA 4ZPTB 3L5HA 3LEXB 4P0DA 4N5UA 2W0PA 5FGBC 4PLJD 1HHGB 5GGVY 2W65A 4HWNA 4IRSD 1OWRM 3QIUD 1WIUA 1HN1A 1E4KC 2HFFB 3GUTA 3QIBD 3H9YA 5DQJB 3BKJL 1BQHA 4X6CB 5D9SB 1U92A 3P73A 5DRWB 5KW9H 5BS0E 4X6DF 4MZ2A 3UTZA 4OIIH 3I02B 5KZCB 5I15H 1PG7W 1BFSA 2VDPH 1B3JA 1CVSC 1L0YA 3N1PC 1PKOA 3L9RA 4ONHA 1JNNH 3VD5A 4L5FL 1YYLH 5CZXC 2AJUH 3TN0B 1QLRA 3OQ3B 4OM0H 1YMMB 1K2DB 2Q7NA 3AAZB 1AXSA 1JL8A 2OTPA 2QL1A 1VFAB 4TPRL 5CEYA 1KCSH 1RK0B 1DQDH 2HFEA 4DOHB 5LCVH 5C0JA 5D6CB 1HWHB 1R3HA 3EOAA 3HB3C 4G7YL 4P5MB 3ZTJG 2XRAH 3P30L 2OL3H 5DFVD 4S1RH 1DQMH 2Q86B 1D5XB 1UVQA 3ZKMD 5F7UA 3I02A 5HDLA 2Z8WC 1MCHA 4LCWE 4PY8J 3QIUA 2FL5A 1XR9B 4PLKC 4YBLC 3NCFB 2J7LA 2HA1A 3MRQB 3LIZL 1ZSDB 3OBAA 1GCFA 5EUOF 3P9MA 3L3GA 3TJHC 1A7PL 1PX4A 1XGRA 2AXFB 3QH3B 1T1YB 4JZOA 1JNNL 4RNRA 1W0YT 1HYSC 3U36B 3CVHH 1S78C 2W65B 5GPRA 2VISA 3ZHLA 4UU9B 1MCKA 2MTPA 4PJDE 3MCKB 2ICWB 4RGNC 2AK4E 5IMOB 3MRQA 1V3JA 2H26B 5HD8D 2Z9TA 4XVJH 2WAHA 4P46C 4ORGA 2LTQB 4ZUTA 3UTPD 3I9GH 1NCWH 4X99B 5HTSA 1FVDB 4NKDA 4POUB 5IW6B 4X9GA 1CGTA 4CVUA 4UQ3B 3S3PA 1U42A 3HNSL 5CJQL 4M6MH 3OTTA 1WWWX 4Y88A 2A83A 3TYFA 5ANMB 5T1MA 5FGRA 1NGXA 4KVNH 1JVKA 1R3IL 4PG2A 3MLWL 1D9KD 2EH7H 3RWDB 3B3IA 3WFDH 4OZHB 3IGAA 1BFOB 1P7KA 5DHXB 3OKKA 1MWAH 1HCFX 4HWEH 5T33H 2JK5A 2ICEB 1A9BB 4JQIH 3MRMA 4HCRL 1D5MA 2UZIH 2NY5C 1U58B 5IB1A 3CVHA 3IDYB 2W9EL 2ESVD 4ELKB 2IH3A 2B4CC 5DSCB 4CVWA 3CMOH 1KNOA 1G7QB 1B0GA 5J11B 1DL7L 1NGYA 1U93B 4R26L 2O5XH 3UJTL 3DUSB 4OZIA 1P4LB 3JWNC 1CXEA 4JRXD 3V5KA 4YXHH 5L8LB 5E9DA 5EOCL 1ADQL 3JWDC 2P46B 1F45A 2LE9A 1MSPA 5AWNH 5EO1B 4C59B 2DLFL 4RFEA 3KPSE 3PL6B 2XICA 1NBVH 4KTYA 5DD0L 4NBXB 5EOCJ 3TH2T 1CGXA 2PYEA 2V9QA 3EDDA 4MXVE 1WK0A 2A77L 4G8EB 1VDGA 3L3JA 3VFOB 4L4VE 1AP2A 4Z76A 3PGDB 3MRLB 1HXMA 1AO7D 1QLEL 2GK0B 5E6ID 2F5BH 2W9EH 5DHYB 5L7XL 1BOYA 4OCWH 4CU7A 1LHZA 2MHAB 1F97A 4G8GD 4ONOA 4PRPE 5MHSD 4NZUL 4X0KB 5E2WH 4KJWC 5SWSD 1LO4H 3NAAL 4PGDB 6FABH 3T0WA 1RURH 2ITCA 2NZ9D 3L5JA 5I74C 1RZKH 3E2HC 5JDJA 2YC1B 4OGXL 4L8BA 5E03A 5INCB 4P3WA 5F1IA 4P4KD 5IHUL 3NZ8A 1P7QA 3FZUD 4QHMA 3ARED 1H3GA 3QHFH 4IRJB 4Y8DC 5EC2A 2R29L 3QHZH 5ILTL 4PS4L 5IJVA 1EA9C 3TH3T 3KWWA 4PJBB 4JLRA 4XNXH 4NSKA 2RJMA 1SBSL 2DJ4A 1NANH 2VZTA 4QTHA 3WO4B 5I19L 3I6KB 1XIWB 2QKIB 4LLQB 3WHXA 3IFPB 3QCVL 1IM9B 3ZL4H 3RVUD 3WFEL 4H8WL 5HHNA 3P4LA 2PN5A 2WBKA 4Q9QL 1BAFH 1NCUA 2R1WA 3ARWA 1DBJL 3HZYB 1L6XA 4LFHD 1NAMA 1R3JA 2NPLX 4PJAF 4WY7H 5FYKH 2XPGB 4QNPE 2H1PL 1BFTA 5T5FL 2W1NA 1MCOL 5DEGA 5SV4A 4FQ1L 4MJIA 2YA0A 4DEPC 3PHSA 3TT1H 3RWFB 4NBZB 3DX6B 3E1F1 5F9AC 5I9QC 1HYRC 1KEML 3O3UN 1OGT