1J8AA

Crystal structure of benzamidine inhibited bovine pancreatic trypsin at 105k to 1.21a resolution from laboratory source with high number of waters modelled
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin as a model for high resolution X-ray diffraction in proteins.
pubmed rcsb
molecule tags Hydrolase
molecule keywords TRYPSINOGEN, CATIONIC
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA02
1XMNB 1GMDG 5A8ZA 1TGTA 1ZSKA 1FPHH 1AGJA 2WV4A 1MUEB 2YOLA 4SGBE 2QXJA 1ZPBA 1G2LA 2Y5GA 1HAOH 4FVDA 1YBWA 1BTZA 4MLFB 4UFFH 3QO6A 4AYYB 1P57B 1BRBE 1DFPA 2UUYA 1L1GA 2HGTH 1AWHB 3QN7A 1QL8A 4AGKA 2HVXA 2ZGJA 1P05A 3FP8E 3DT0H 1BBRK 3GDSA 4O97A 3BTKE 1IAUA 2BY8X 1RXPA 2BXTH 2W3KA 1KXEA 1G37A 1KLJH 3GY2A 2G52A 1YPHC 4X1SU 2H9HA 1CT2E 1GVZA 4AG1A 1G3DA 2D1JA 3A83A 1PPZA 1O3NA 3SV8A 3K65B 1CBWC 2Y6TA 4DURA 1C9PA 1PPFE 2P16A 3F9HA 1NT1A 3EA9A 1Z1JA 1K1LA 1W7XH 2A0QB 1EP5A 3RC5A 1DXPA 1D3PB 1T8LA 2EI6A 2ANMH 1M9UA 1UJ1A 1RTKA 1MD7A 1SLVB 2ZU4A 1GGDC 4XE4A 2FI4E 4NFFA 1BRAA 4BNRA 3QTOH 1ELBA 4ABIA 4FUGA 2GCHF 4Y71A 3U8RH 5EW1H 3MO9A 4U01A 2F9OA 1FAXA 2ZP0H 5IYTA 4WMFA 5T6DA 1GBBA 3RC6A 2C8ZB 1AUJA 2A2XH 2R2MB 3E91A 1VCQA 1CT4E 2XW9A 4HZHA 3LOXA 2GT8A 2FOCA 3SGAE 3E8LA 4B74A 4MDSA 1O2ZA 5FPYA 3ZZDA 2HRVA 2ZCLP 1VCWA 3D49H 1GBEA 1IQFA 1OP0A 5L2ZH 4IBLH 5DJ7A 3MTYA 3GCNA 2VIPA 2AYWA 4RKJB 1PQ5A 2B8OH 3KL6A 4YESB 1O2QA 1DXWA 3RP2A 2NU1E 4AB8A 4UFEH 2BVRH 2VGCC 2ZGHA 2ZHEH 5E8EH 2FXRA 1C2LA 1N8OB 4AFZA 2P93A 2PV9B 3RXVA 3K2UA 5FPSA 1K9OE 1O5DH 2PGQB 2B7DH 2BY6X 1HAVA 3T62A 3RLYH 3TGJE 4CRDA 1LTOA 2SGFE 4WWYA 3UNRA 1BMMH 1YGCH 1RS0A 2B0FA 1SSXA 2RDLA 7GCHG 1UTOA 2H2ZA 1C5UA 2XTTB 5DO4H 2VJ1A 1LKAA 1E36B 1ZTLA 3SNEA 1OWHA 2YNAA 2P3TB 1TLDA 3RU4E 2QN5T 3RXGA 1FJSA 1O2JA 4X0WU 3QUMP 4MPVA 4I8GA 3TNTA 2FP7B 2ALPA 1ZGIA 3BTWE 2BTCE 3T2NA 2TGDA 2LPRA 2GP9B 3B23B 4NWLA 3FZZA 1F92A 2H1UA 2ANYA 4ZKRU 3RXQA 1BITA 3S7KB 2G5VA 1NRQH 3ZZ7A 3K9XB 4OS6A 1DPOA 3VPKA 3M3VA 1NU7B 3TVJB 3TH2H 1RIWC 2Y7ZA 1XKAC 3M35A 4OGXA 1GG6C 4ZXYH 1S81A 3A7XA 3UWJH 3RU4D 2C3SA 1EPTB 3D65E 3P17H 1Y8TA 2XCFA 1G30B 2ZGBH 4B75A 9ESTA 1O33A 5FCRA 1IOEA 1VITG 2QYIA 2SNWA 3BTTE 2ZF0H 4DIIH 1YPHE 2VWNA 2Q6DA 3S0NA 1QQUA 3F68H 1UCYK 2IN2A 1LMWB 1Z1IA 2W3IA 3FZDA 9LPRA 3V3MA 4Y6DA 4ZKOU 2ZU3A 5AHGH 1VITF 5EW2H 2NU4E 3SJKA 1HBTH 7KMEH 3UR6A 4ASHA 5GCHF 2A7CA 1QR3E 3PWBA 4FUFA 2ZNKH 4H6SB 2FODA 2OCVB 2TIOA 3GCTF 4BOHA 1O2MA 1V2UT 3SU5A 1QJ1B 1AUTC 3STIA 1KXFA 5AFYH 3R3GB 2ASUB 4CHAB 1HXFH 3SQHE 1O3EA 3O8RA 4LZ1H 2A5IA 2C90B 4IC5A 3ZZBA 3ZZ6A 3OY6U 2XC0A 2A1DB 3ATKA 2OQ5A 2PTNA 2ZPSA 1SR5C 3H7OA 2GCHG 1W13U 4BANB 1BBRE 3A87A 1P3EA 5T6GA 1GI2A 2Y7XA 2EEKA 1WBGB 3V0XA 1A4WH 1EOJA 4J2YB 1FZZA 2PUXB 1LHGH 1DUAA 1V2KT 2BX4A 3M5OA 1GHZA 2ILNA 2ZTZA 2ZECA 1SGDE 4UE7H 2FOMB 4TWWA 1KSNA 3VB5A 2J34A 4MPWA 1GHAG 1ELFA 4YT7H 2FWWA 3M61U 3SI4H 3ZZ3A 1DT2A 2FOBA 4FXGH 3BF6H 3RXAA 1NY22 2ZZUH 1O37A 1O3BA 1UVSH 2GGVB 1QQ4A 3MFJA 2ZDAH 4ZMAH 2XCNA 3NZIA 4BTUB 3ZYEA 4A5TS 3P8FA 4ISOA 2DE8A 3M5LA 4CR9A 2VH6A 1MTSA 4MNWA 4FUBA 1V2TT 1C2FA 3AW0A 2Z94A 5ABWA 4GLYA 4WXVA 4KTSA 1C1QA 2J94A 4B2CA 3GY4A 1GI8B 4WMDA 4X2YA 2PWXA 1KXAA 2HWLB 2BDYA 2FPZA 3ZZAA 5DP4A 5LH8A 1RFNA 1GHBF 2ZCKP 3NWUA 1UCYE 1O2WA 5JPMH 1XX9A 1GJ8B 1A5HA 1C4U2 4O3TA 4TY6A 1GHVH 2HNTE 1Z71A 3EA7A 1XUJA 2VGCB 3HGPA 3O8DA 1T8OA 1P2IA 1ZJDA 4WH6A 1YPJH 2GVFA 3UTUH 2XWBI 3K6YA 3GY8A 2ZHQH 1O5CB 4ABBA 2BY7X 3T5FH 4F4OC 1ZHRA 1AD8H 1KTSB 4I8JA 2EC9H 1C5VA 1SGRE 2BZ6H 1ANDA 1VGCC 1UVPA 1C1RA 1OP2A 1QRXA 1C5MD 2PKAA 2J92A 4ABHA 2CJIA 4KELA 4MNXA 5GPIB 4OS1A 1GBKA 2H9TH 4I8KA 4XDEA 3RXSA 2V3OH 4H4FA 2BD2A 1P2JA 2H5CA 1OSSA 1YYY1 3GYLB 2SGQE 1LO6A 2XC5A 1JXPA 1AVGH 2WINI 4M7GA 5HYOA 4FUHA 1BTXA 4MQAA 1S0QA 1EJAA 5FX6A 1E37B 1FAKH 1HJ8A 1NS3A 3O8CA 3LC3A 5I46H 2VIOA 2Z3CA 2JETB 5J4QA 1AFQB 3SU2A 2G00A 1UTMA 2ZDNA 3BTME 5G4BA 3PLPA 5EQRA 2A5AA 2YNBA 1O3GA 3VFEA 1TNJA 6LPRA 3RC4A 1GJCB 5CMXH 1CGHA 2J9NA 5A09A 3C27B 1UO6A 3A8BA 2R9PA 4FU7A 1GBHA 1PQ7A 3F9FA 5HM2A 1D3DB 1PFXC 3W95A 4BTTB 2FLRH 1ANEA 4JYTA 1O5GH 2BLVA 1NTPA 1OOKB 4R0IA 1MCVA 1A61H 2G5NA 1QNJA 3M5MA 1W7GH 4X2VA 1SGIB 5JBTA 3EQ0H 5DP7A 1V2NT 1D3TB 1GL1A 3BG8A 5DG6A 1IQMA 3E0NB 5DPAA 1AFQC 4MNVA 3SNDA 4WXIA 4DJZB 1WOFA 1D9IA 1O2GH 1SLWB 1O2UA 1PPEE 1C5OH 3C1KA 3SHAH 2RA0A 1Y5AT 3LIWA 2BQ6B 3SJOA 2GCTC 3QX5H 2ZDMA 3KQCA 4X6OA 1O32A 1IQEA 1FV9A 4KGAA 4U2WA 4E7RG 1C1WH 2HNTC 1T8NA 4O3UA 3ZVEA 2ZPRA 3M3TA 1O3AA 3RXBA 1O36A 1LVOA 1P2QA 3A80A 1GJBB 2FLBH 2FTLE 1HUTH 3VB7A 3MU0A 3RDZA 1K21H 1P01A 3KCGH 1A0LA 2EA3A 1MTWA 4O9VA 1TRYA 2BOKA 2BY9X 5E2PA 4YLUA 1FY1A 4RN6A 1O5BB 4IMZA 2HALA 2W7UA 3GOVB 5FHTA 2BD4A 4ISHH 1TIOA 4K60A 2GMTB 1LVMA 1EKBB 3M7UA 1GJ4H 1NFUA 2QXGA 4B1TA 1ZSJA 3E0PB 2R2WU 1C1OA 2B9LA 4WH8A 3RUOA 5FX5A 1HYLA 3A89A 1H9IE 2DE9A 3SHCH 1BT7A 1K2I1 1QL7A 2WUBA 5EU8A 1BTYA 1BTUA 3VGCC 1T32A 1LVBA 4B2BA 1CSOE 3TK6A 3URCA 2QF3A 4Y8YA 1GHAF 3VEQB 1Y3YA 3MH4A 6CHAC 1ZTJA 4MPUA 3SGBE 2BY5X 1DWBH 5L6NH 1XVOA 1MBQA 3RU4T 3HK3B 1O2YA 4ABFA 4FU9A 4OS4A 3GDVA 3KEEA 3U8OH 1DDJA 1TBRH 1PPBH 1GDNA 5FCKA 1P04A 1F0SA 3MU1A 4D7GA 2ZDVH 2FZZA 2WYGA 1UK3A 2F9BH 1QL9A 2JKHA 3LJOA 1SBWA 3FVFB 8KME2 1BRCE 5E0JA 4JZ1A 5HXFA 2OBOA 1CA0B 3LGIA 2AMDA 4CRCA 3SJ9A 1C1TA 4I8HA 3MI4A 3Q3YA 1TGNA 1NFXA 4Y0ZE 1AVWA 2QXHA 5PTPA 1KDQA 4D7FA 1F7ZA 4DCDA 4Q7XA 2FTMA 2VNTA 2FM2A 4Q7ZA 1S84A 1GVLA 1MU8B 1F5RA 1MKWH 3DFJA 3ATLA 4TY7A 5E2OA 1NRPH 5DP9A 1GJ5H 2Q1JA 2TRMA 1Z7KA 1OWEA 4ZUHA 3TJOA 1PYTD 1W0YH 4AN7A 3MU5A 5CHAC 1G32B 4WMEA 6GCHG 1BQYA 2BQWB 2R3YA 3T29A 4AGJA 5A0AE 1XUIA 1TWXB 4DY7B 4Z6AH 4DW2U 1C5NH 1GBLA 2C8WB 3DFLA 3E90B 1O2VA 1UHBA 3GY6A 1DE7H 2CF9H 2D2DA 1E38B 1HIAB 1KTTB 1ETRH 2XBVA 1G3BA 2G8TA 3P8GA 1GI6A 2H6MA 1FXYA 2RA3A 1C5QA 1NN6A 2PKAB 4ESTE 1AZ8A 3VXFH 3CS0A 1MZDA 4NG9H 1O2OA 2CF8H 1X7AC 1WSSH 3P92A 4NZLA 1TNIA 1SGTA 2R3UA 1C1PA 1C5YB 1LQEA 1BTWA 1QRZA 1YCPM 1UTNA 1VITH 8LPRA 1LHEH 5F6MA 2Y81A 1THSH 5HMAA 3HKIB 1SGYE 4A92A 1HJAB 3DUXH 3SNBA 2THFB 1J16A 3Q3KA 1HPGA 1K1IA 2A2QH 1QB9A 3FP6E 1O3CA 2ZGXH 3ZZ9A 4ZROA 3SN8A 1TOCB 1ESAA 1A3BH 5CE1A 3OY5U 3RLWH 3RMNH 2AEIH 2BDGA 1AVXA 1XXFA 2ZPQA 3OU0A 3M3SA 3LH1A 1VCPA 1OWKA 4R8TB 4IW4E 2BDBA 1O39A 2NWNA 1C2DA 2V3HH 5FXLA 4NZQA 1WV7H 1XUGA 1YPLH 3F9EA 4NFEA 1DICA 1EZSC 1ESTA 1ZMNA 5GIBA 2TGTA 3ZV8A 4CRBA 2FMJA 3TITA 1WTGH 5DKMA 4K5ZA 1ELGA 2GD4B 4UONA 1QBOA 3O8BA 3U9AH 1JRTA 2RG3A 1GMCF 3I77A 3TPIZ 2CMYA 3IITA 1TX8A 5C67A 2ZDLA 4YOJA 4WVPE 1P0SH 1HFDA 3SUEA 2QC2A 1P10A 4GCHG 3GCHB 3RXHA 2PKSC 3VGCB 1A7SA 4IN1A 1DX5M 1CA8B 1RRKA 4NIWA 2FOFA 1MMJN 1SGFG 4K1SA 2PLXA 3ENSB 1K1NA 1V2LT 1O3MA 3TH4H 1HV7A 1AKSB 3TJVA 2ZFSA 1H9LB 1ZPCA 1PQ8A 3VB6A 2AMPA 4MVNA 2VINA 1AHTH 1C5XB 1SQOA 1OPHB 3LDXH 1IQJA 1UVTH 1G3CA 1TGCA 3OX7U 2HLCA 1IQIA 1TBQH 1NPMA 4Y10E 3KIDU 3E3TA 3ATIA 1S83A 1WQSA 2F9UA 2FX4A 1Z8RA 3RXTA 3CP7A 1DITH 2AFQB 3AAUA 4WJG2 3BEUA 3PO1C 2QCYA 1O0DH 1ELDE 3SBKA 1BJVA 3EGKH 2FYRA 1O5FH 1SFQB 1ZOMA 3A86A 1FY5A 1LQDB 4X8VH 4MTBA 1JMOH 2TPIZ 3A85A 4Q2KA 2HNTF 4JZDH 2BD5A 3P95A 1N6XA 1EASA 2QAAA 1K22H 4LXBH 1EJNA 4KKDA 3U98H 2BHGA 1QCPA 2ZGCA 1D3QB 1V3XA 2GV6A 1C2MA 1C1VH 1TBZH 1S5SA 2AERH 1KIGH 3QGJA 4UD9H 2I6SA 3ZVAA 3S9BA 4CREA 1N8OC 3TGKE 1GMDF 4A7IB 3HK6B 4ABDA 2Q6FA 5E0GA 4YOGA 4ABJA 1SGEE 3PB1E 3S9CA 4D76A 1NRNH 1UMAH 1GJDB 1O3PB 3PTBA 4DT7B 2FOAA 1KY9A 1MCTA 2Z9JA 3LPRA 4Y7AA 4B76A 1CT0E 4Y8ZA 4JYVH 5ETXA 2AH4X 2SGEE 4MNYA 3SZNA 2BMGB 1XVMA 1TGSZ 4X2WA 1MTUA 2VVVA 1TNHA 4JZEH 1ARCA 4RSPA 4HTCH 3M5NA 2BLOA 3A7YA 1L1JA 2BYAX 4OS2A 3ZVFA 3VXEH 2HOBA 2C93B 1NESE 1OX1A 1XKBC 1GBTA 4Y11E 3MNSA 1GCDA 5C1UA 4I33A 1C5ZB 3U1JB 4IGDA 4BAHB 1JRSA 1GWAA 1TNGA 2K1QA 1TNKA 1QA0A 2P3FH 1GPZA 1BB0B 1EPTC 2CV3A 1AN1E 2GV7A 4NIYA 1QBVH 4FUDA 3RXFA 3SUGA 3V13A 1Q31A 2AGIX 4Q80A 1F5KU 1NROH 1T7CA 5EG4A 1IQHA 3SUFA 4Q7YA 2G4TA 1FIWA 3EE0B 1DY8A 1ZHPA 5H4IB 4GAWA 4HFPB 1HAIH 1TGBA 1MD8A 3PMBB 5IDKA 1NZQH 1J17T 2UWOA 3RMLH 1KXCA 1C5SA 5C20A 1ANCA 3ZVCA 1EXFA 1GMHG 3KQBA 1QFKH 1C9TA 3LU9B 4NGAH 1TX6A 4RKOB 3T28A 4X1QU 1C1SA 1JBUH 2WUCA 1B7XB 5A0BA 4GVUA 1B0FA 1O2LA 1MAYA 3AAVA 4NIVA 3TK9A 1SLUB 1LPZB 4H42U 1W3CA 1FPCH 2BQ7B 2ZCHP 1MTNC 4TPIZ 4E05H 1GI9B 3TK5A 1ELTA 2Y82A 3SNCA 2UUKB 2BDHA 5L30H 2W5EA 4OS7A 1GI4A 3SO3A 2G81E 1Z8GA 3UQVA 1J9CH 4Z0KA 1C2GA 2WPKS 1QHRB 2Y5HA 1QTFA 1FIZA 2CHAC 1FNIA 3LGUA 1KXDA 5FPTA 1EB1H 4NCYA 1L0ZA 1DM4B 1EB2A 3BTEE 2HPPH 5L2YH 1JOUB 2ODQA 1ANBA 3R0FA 3LGTA 1OS8A 1P2OA 1SMFE 2IPHA 2Z9GA 3MNCA 2ULLA 4JK5A 2AGGX 1EAXA 3MMGA 3CENA 3SU4A 2F3CE 1MKWK 1ZLRA 3NUMA 1GI7B 5JYIA 1DOJA 1THRH 2D8WA 1V2JT 4ZH8A 2GDDA 3BG4B 5EOKA 2BXUH 1GG6B 1MU6B 5A8YA 5EGMA 4O03A 1IHTH 4BXSA 2CHAB 1GCTB 1QGFA 4THNH 2ANKH 1B5GH 3GDUA 3RXIA 4YM9A 3Q3XA 1UHBB 1J15A 2I6QA 2BZAA 2BD7A 3PROA 3ZVBA 1EX3A 2WPJS 3U69H 1P9SA 2XWAA 1YPKH 1A5GH 2A32A 5CHAB 3NKKA 1GGDB 2PHBA 3PTNA 2A7JA 1Y3UA 3I29A 1O31A 4B73A 2A4QA 1SGCA 1DWEH 4A1VA 3RXUA 2PTCE 2XNIA 1O2RA 1EQ9A 1C2EA 3QTVH 2ZDKA 2Z9KA 5F8TA 4E06H 1MKXK 1HAPH 2SFAA 1P09A 4JZIA 1CGJE 4ZXXH 1C1MA 2ZI2H 1DSTA 1ELVA 3DHKH 3BEIB 1DLKB 1SQTA 5C1YA 2OXSA 4NA8A 3QK1A 4IMQA 1UTQA 5DK1A 1MKXH 1V2QT 1Z6EA 2NU3E 1G36A 2ZO3H 3RM0H 2ANWA 3KNXA 3W94A 1GBAA 1KYNA 2ODYB 5A8XA 1O38A 1SOZA 1TA6A 4XOJA 4DVAU 1HAZB 2Y5FA 1QY6A 2XBYA 5JB8S 2KAIA 2VIVA 4BAMB 1V2RT 2JH6D 1W10U 4X1NU 3Q76A 1DUEA 4AB9A 2ZHDA 3N7OA 1A1RA 3NXPA 2P95A 5DP6A 4ISLA 2PUQH 3TJUA 1O2TA 1OWDA 2BD9A 2GTBA 4H6TA 1KLTA 1U6QA 3A8CA 2AIPA 8GCHF 1BHXB 2FI5E 1OXGA 1HAXB 3BTFE 1EZQA 5EODA 1AMHA 2H9EH 7ESTE 1GHBG 3RXDA 2A31A 2EI7A 4IS5A 1QURH 1EAUA 1HAGE 3UIRA 1GJ9B 1O30A 1O2NA 1FI8A 1FLEE 2J38A 3MH5A 4TYDA 1HCGA 2UUJB 1WAYB 4U32A 3MH7A 1GI3A 1W2KH 2FIRH 1THPB 2O8LA 1A0JA 3PO1B 1XUKA 1K1MA 2VU8E 1SLXB 4WF8A 5GXPA 1GJ6A 2CXVA 5FBEA 2XBWA 3PLKA 2TGAA 1UVOA 3GISB 3BN9A 3UUZA 3QZRA 1O2SA 1ABIH 1TRNA 1TALA 2NU2E 1T4VH 3TU7H 2OD3B 4A6LA 3KHVA 4NIXA 1BHXF 1S6HA 2B5TB 1DWCH 4AFUA 2OC0A 4FUJA 1INCA 4BAOB 3BIUH 3P8NA 1EJMA 2F9PA 1PJPA 4TPYA 2GCTB 3ZZCA 1C4Y2 3NPSA 2P3UB 5C5OA 1BTPA 2PR3A 3FANA 1ID5H 1SGNE 4UFDH 1GI5A 3QWCH 4AFQA 4AYVB 3URDA 1MTVA 2VVUA 3IG6B 2RCEA 4IN2A 5DP3A 5K7RA 1ZR0A 3SV7A 3TH3H 1EOLA 1HAVB 1FMGA 1ETSH 5HM9A 1AU8A 1O2PA 3LJJA 2BD3A 1GDQA 1BA8B 1TYNA 3A7VA 4VGCB 1O2XA 2D26C 4YLQH 4XFQA 5EXNA 2P8OC 1P2NA 2ZFTA 1O2HA 1HLTH 1OKXA 1EZUC 2FYQA 1TOMH 4GHTA 1AO5A 4J1YA 2UWLA 3SU1A 2UWPA 1P3CA 3EDXB 3BTGE 3IWMA 3LGWA 1FN6A 1KLIH 2STAE 1DVAH 1GBJA 1D4PB 3UFAA 3L6PA 4NA9H 4AOQA 2P8OB 1MZAA 7GCHF 1UCYH 1NFWA 2C8YB 3UREA 2Y80A 2O9QA 4X1RU 3Q77A 1RGQA 4FUIA 4X8SH 1O34A 3H5CB 5HGGA 2J95A 3V12A 2J4IA 1SQAA 1HAHH 4FU8A 2JH0D 3SGQE 2BVXH 3TLOA 4TWYA 3S69A 1C5RA 2GZ9A 1V2MT 3I78A 1C2IA 1JIRA 5ESBA 2OQUA 3D62A 2FESH 1BUIA 1JIMA 1T4UH 1XUHA 4MPXA 1GBFA 2OP9A 4K2YA 1O3JA 4F49A 3SI3H 2ZWLH 4Y8XA 2FS8A 5E0HA 2FDAA 4I8LA 4Y7BA 4GPGA 4U30A 2ZFPH 2NU0E 2A4GA 1LHDH 2VWOA 2ZQ1A 4D8NA 5JBAS 1TQ0B 2Q6GA 3E6PH 1Y3XA 2BVSH 1Q3XA 2BLQA 1B0EA 2BLWA 3NCLA 4ABEA 4FUEA 2BOHB 4NSVA 2P59A 2ZA5A 1O2IA 4UDWH 3BTDE 1EUFA 1N1LA 2XBXA 5T6FA 4UFGH 1OYTH 1Y5BT 1C5PA 1Y5UT 1D6RA 5J4SA 4X8TH 4AX9H 3SJ8A 3H7TA 2WYJA 1GBIA 3MNXA 1PQAA 3ODFA 1TX7A 3M37A 4I32A 1QA7A 4INHA 2Z7FE 3QZQA 4YZUA 3S9AA 1QB1A 2QY0B 1P8VC 2PW8H 2Z6BD 3MHWU 1CQQA 1E0FD 3T26A 3CS7A 1BBRH 1NO9H 2VIQA 2PGBB 1SC8U 1UK4A 5FBIA 3ZYDA 1Q2WA 3MO6A 1ESBA 1Y3VA 4CBNA 1O35A 3LC5A 1FDPA 1ZTKA 1FY8E 5AFZH 4JMYA 3UR9A 5TJXA 4LOYH 4CRGA 2PSYA 4XBBA 4UEHH 4GCHF 1SGPE 2A5KA 1O3IA 1NC6A 5LPRA 3A7TA 1QRWA 2TBSA 1VGCB 2ZTXA 4OS5A 1Y3WA 3BG4C 1TB6H 3TNSA 3A81A 1A2CH 3P70B 1CHGA 3LGVA 3ESTA 1NRSH 3D23A 2GX4A 2Z9IA 5ESTE 4AZ2B 2F83A 4DGJA 5GWZA 1DWDH 1QIXB 2BD8A 3ELAH 2Z9LA 3U1IB 5TCCA 4ZKSU 2FOHA 1BOQA 1GBMA 1LPGB 3MO3A 1V2WT 3QLPH 1F2SE 2VWLA 3ATWA 3UNQA 1G9IE 1SOTA 2O8UA 3DD2H 3SORA 1A46H 1T8MA 1SFIA 2ZFQH 2OINA 1TPAE 3HPTB 2W7SA 3P6ZB 3PWCA 1ZPZA 1LDTT 2ZIQH 1FQ3A 3SQEE 1ZSLA 2QF0A 1GMHF 2A4OA 3V7TA 2EI8A 2VIDA 4JK6A 1DANH 2GT7A 4XBCA 1LVYA 3GICB 2GZ7A 4VGCC 1XUFA 3KF2A 4AORA 1O2KA 2QIQA 3E1XB 3ITIA 3LKWA 5LPEA 3T27A 4DIHH 1WCZA 3PMAB 4ZKNU 3LT3A 1SI5H 1IQLA 1BRUP 3QGNB 1GVKB 4ZHLU 4JZFH 1EPTA 4ABGA 1JWTA 3PLBA 1TFXA 1YC0A 1AKSA 4K3JA 1L1NA 3ZV9A 2BDIA 1GI1A 3KQEA 4JYUH 3GY7A 4B2AA 1SGQE 1O3OA 1SG8B 4XBDA 3VB3A 4LZ4B 1ZGVA 2W26A 1YF4A 2ZTYA 3L3TA 3ZVGA 2QA9E 1HRTH 1HAYB 2GMTC 1YCPH 1NRRH 3BIVH 3L33A 1V2VT 3UWIA 1W11U 3SOSA 4IC6A 1TA2A 4ISIH 5EPYA 2VVCA 4MG3A 1S82A 1SL3A 5BRRE 4K8YA 3MU8A 1DSUA 3RXLA 4X6PA 4CRAA 2WPIS 4I31A 2UUFB 2QV1A 1Z8JB 2J2UA 1E35B 2TGPZ 3BSQA 1AY6H 3LGYA 2QXIA 2ZU2A 2SNVA 3RXRA 3ZZ8A 2ZU1A 3KQDA 4D9QA 2A4RA 3HATH 3GCOA 2LNCA 2ZC9H 4CR5A 3OYPA 5C3NA 1GL0E 1J8AA 4AG2A 1TMUH 4E7NA 4K8BA 2AMQA 4CBOA 1ELEE 1MAXA 1O3LA 3S7HB 2AIQA 1TQ7B 2A7HA 1H9HE 1CGIE 4Y0YE 3GCHC 1O3HA 1S0RA 4X1PU 1DS2E 5SGAE 1RTFB 2VWMA 4CRFA 2CN0H 1MTNB 1F0RA 2GKVE 1GHYH 1F5LA 3A8DA 4OGYA 1KXBA 3HGNA 3LONA 4NSYA 6CHAB 3OSYA 5AF9H 5FAHA 1AZZA 1HXEH 4JCNA 2CGAA 4BXWA 1P2KA 2VH0A 1O3KA 1FY3A 1G2MA 2PFEA 5C2ZA 3RXOA 2OTVA 1TMBH 1C2JA 1RJXB 1YPEH 1CE5A 1CU1A 1ORFA 1YPMH 2O8MA 3BTQE 3A84A 1OWIA 2ZHFH 3ODDA 1BDAA 2GDEH 1KDQB 5EQQA 1O5EH 1CHOG 1GBDA 3KN2A 2OUAA 3Q00A 1O3FA 1S6FA 2FO9A 4Y76A 1OP8A 5BPEA 3RXMA 3ZZ4A 6ESTA 1W0ZU 3RM2H 3TGIE 1XM1A 2IJOB 3AVZA 2R0KA 5JB9S 3ZZ5A 1BJUA 3EAJA 4X6NA 1PYTC 2AGEX 4AFSA 1C5WB 1WUNH 2P94A 1YPGH 2OBQA 1ELCA 1RTLA 1TPPA 3MOCA 3RXEA 5LPFA 1O3DA 3A82A 3RXJA 1TPOA 3B8JA 1V2ST 1LKBA 3UY9A 1YCPK 2BM2A 5JDUB 1PPCE 1MBMA 2F9VA 2GZ8A 1YLCA 5GDSH 1NU9A 1L4ZA 1CO7E 1H8IH 1UTJA 2ZU5A 4YTAA 1F0TA 5C1XA 2STBE 1OYQA 2XXLA 1FN8A 1GHXH 1L2EA 8GCHG 4HGCA 2XYAA 3SU3A 3PM3A 3PMHB 2BB4A 4YT6H 3VB4A 3JZ1B 1GCTC 3GYMA 1ZMJA 1PPGE 1CBWB 3LH3A 3SV2H 5A0CA 1NM6A 3DA9B 1MQ6A 5LGOA 1TRMA 1AIXH 1HIAA 4XSKU 1ZHMA 4A1TA 5F8XA 1IQKA 1BIOA 6GCHF 3MYWA 3UOPA 2V0BA 2ZG0H 3MWIU 4ABAA 1QBNA 3JZ2B 4ZAEA 1H1BA 3RMOH 2FS9A 1TONA 2AS9A 5EQSA 3T25A 1VJ9U 8ESTE 2BDCA 3STJA 1P11E 1LHCH 3BEFB 1MQ5A 1C2KA 2WPMS 1GDUA 1ETTH 1W12U 4WY3A 1Z6JH 3FFGA 1P02A 5DP5A 4PROA 2C4FH 1SB1H 1YP9A 1BMNH 5DP8A 1G3EA 1CVWH 3GY3A 3TIUA 5I25A 1BTHH 2DUCA 2VB0A 1FY4A 3GCTG 4SGAE 2XRCA 1ARBA 3SU6A 2A45B 1EAWA 1LCYA 3QDZB 1H8DH 2V6NA 1TMTH 4QT8C 5C5NA 1EP6A 3MH6A 4GUXA 1A5IA 3RXPA 1F0UA 3KGPA 1K1OA 2H5DA 1QB6A 1YKTA 1A0HB 1OWJA 1ACBE 1L4DA 1IHSH 3BV9B 4HI3A 3AW1A 1P9UA 3M36A 4NA7A 5GCHG 5B6OA 2OC1A 5A2MH 3SW2B 4I7YH 4ZHAA 2ESTE 2ZFRH 5F03A 2FX6A 4CH8B 1C4V2 3M7QA 2VIWA 4YOIA 1HGTH 4KTUA 3SUDA 1N6YA 3P8OA 1K1PA 4CHAC 1WU1A 2O8TA 1SPJA 5K0HA 5EXLA 1VJAU 1P06A 4ISNA 2ODPA 1HNEE 4X8UH 1C5LH 5TCAA 2G51A 4KTCA 1SGFA 2PKSB 4BAQB 3SV6A 3A88A 1ZRBA 4NWKA 1UVUH 1C1UH 3HKJB 1C2HA 1TPSA 2JETC 1P03A 1ABJH 1P12E 1AI8H 4K1TA 3SNAA 3SJIA 1UTPA 3BTHE 3UQOA 1AB9B 1AB9C 1GJ7B 2BX3A 1K28D 4Y79A 4K69A 3WY8A 3ATMA 1AWFH 1H4WA 1ZJKA 1CA0C 2SGPE 4D9RA 4GHQA 4K1EA 2FOEA 1A3EH 1V6DA 1GHWH 1TABE 2JH5D 1O5AB 3UPEA 5AVDA 1FUJA 3E16B 2F9NA 3F1SB 2WPHS 2FEQH 1D6WA 2G55A 3F6UH 2HPQH 3EYDA 1T31A 2R0LA 1TE0A 2Z3EA 3OTJE 2V35A 1LHFH 4BTIB 1RIWB 3FP7E 4GSOA 1C1NA 1S85A 1HJAC 3TJNA 3M7TA 3NK8A 3SU0A 3K6ZA 3PMJA 1J14A 1NFYA 1EATA 1ZZZA 1GBCA 1V2OT 1W8BH 5DGJA 3AASA 1SHYA 1DY9A 4FUCA 1SVPA 1IQNA 1WTHD 4DOQA 4BAKB 1HDTH 4YO9A 3B9FH 3F9GA 1RD3B 2KAIB 1ELAA 4KP0A 4LK4A 1QJ6B 3RMMH 4X6MA 2WPLS 2ZHWH 1AFEH 4B71A 2C8XB 1LPKB 1ZRKA 4ZHMU 1GMCG 2OLGA 2BDAA 2OC8A 3ZVDA 1WYKA 1UK2A 1VZQH 2WV5A 4INKA 1C5TA 1YM0A 2IOTA 3G01A 3A7ZA 2ALVA 2ZQ2A 3A7WA 3PV4A 3MU4A 4X2XA 1V2PT 3UOUA 3FAOA 2M5TA 5EXMA 2QGRA 1AE8H 7LPRA 1TNLA 1P2MA 1DLEA 1FONA 1CHOF 2G4UA 1MH0A 1IQGA 1WQVH 3MNBA 2SGAA 1EAIA 3PYHA 2F91A 2ZEBA 2ZKSA 1PPHE 4DG4A 1HJ9A 1BMAA 2FI3E 5EPNA 5GJ4B 1YLDA 2Z3DA 2PSXA 5F8ZA 1BZXE 1K1JA 5T3HA 2XC4A 1XXDA 2O8WA 4A1XA 3RXKA 3U8TH 1HB0B 1AE5A 1W14U 2ZFFH 2OC7A 1VR1H 5JBCS 4FVBA 3EA8A 1GJAB 1Y59T 1BMLA 1QJ7B 3UNSA 1TAWA 4INLA 1E34B 1GI0A 1SHHB 5JBBS 3A8AA 1EZXC 3GY5A 4CH2B 1AQ7A 2FOGA 1UTLM 1Z8IB 3RXCA 1UTKA 2SGDE 1ZMLA 3SV9A 1BCUH 1ZYOA
chains in the Genus database with same CATH superfamily
1XMNB 1GMDG 3EE7A 1TGTA 5A8ZA 3PV2A 1ZSKA 1FPHH 5T1VA 1AGJA 2WV4A 1MUEB 2YOLA 3VG8A 1WXRA 4SGBE 2QXJA 3FKSD 1ZPBA 1G2LA 2Y5GA 1HAOH 4FVDA 1YBWA 1BTZA 4MLFB 4UFFH 3QO6A 4AYYB 1P57B 1BRBE 1DFPA 2UUYA 1L1GA 2HGTH 1AWHB 3QN7A 1QL8A 4AGKA 2HVXA 2ZGJA 1P05A 3FP8E 3DT0H 1BBRK 3GDSA 4O97A 3BTKE 1IAUA 2BY8X 1RXPA 2BXTH 2W3KA 3OFND 1FX0B 1KXEA 1G37A 1KLJH 3GY2A 2G52A 1YPHC 4X1SU 2H9HA 1CT2E 1GVZA 4AG1A 1G3DA 2D1JA 3A83A 1PPZA 1O3NA 3SV8A 4ASUD 3K65B 1CBWC 2Y6TA 4DURA 1C9PA 1PPFE 2P16A 3F9HA 1NT1A 3EA9A 1Z1JA 1K1LA 1W7XH 3KYFA 2A0QB 1EP5A 3RC5A 1DXPA 1D3PB 1T8LA 2EI6A 2ANMH 1M9UA 1UJ1A 1RTKA 1MD7A 1SLVB 2ZU4A 1GGDC 4XE4A 2FI4E 4NFFA 1BRAA 4BNRA 3QTOH 1ELBA 4ABIA 4FUGA 2GCHF 4Y71A 3N7DA 3U8RH 5EW1H 3MO9A 4U01A 3CNRA 2F9OA 1FAXA 2ZP0H 5IYTA 4WMFA 5T6DA 1GBBA 3RC6A 2C8ZB 1AUJA 2A2XH 2R2MB 3E91A 1VCQA 1CT4E 2XW9A 2KX4A 4HZHA 3LOXA 2GT8A 2FOCA 3SGAE 3E8LA 4B74A 4MDSA 1O2ZA 5FPYA 3ZZDA 1H8HD 2HRVA 2ZCLP 1VCWA 3D49H 1GBEA 1IQFA 1OP0A 5L2ZH 4IBLH 5DJ7A 3MTYA 3GCNA 2VIPA 2AYWA 4RKJB 1PQ5A 2B8OH 3KL6A 4YESB 1O2QA 1DXWA 3RP2A 2NU1E 4AB8A 4UFEH 2BVRH 2VGCC 2ZGHA 2ZHEH 4OM9A 5E8EH 2FXRA 1C2LA 1N8OB 4AFZA 2P93A 2PV9B 3RXVA 3K2UA 5FPSA 3PRBA 1K9OE 1O5DH 2PGQB 2B7DH 2BY6X 2J98B 1HAVA 3T62A 3RLYH 3TGJE 4CRDA 1LTOA 2SGFE 4WWYA 3UNRA 1BMMH 1YGCH 1RS0A 2B0FA 1SSXA 5CDFE 2RDLA 7GCHG 1UTOA 2H2ZA 1C5UA 2XTTB 5DO4H 2VJ1A 1LKAA 1E36B 1ZTLA 3SNEA 1OWHA 1UW7A 2YNAA 2P3TB 1TLDA 3RU4E 2EQNA 2QN5T 3MQKC 3RXGA 2JDID 1FJSA 1O2JA 4X0WU 3QUMP 4MPVA 4I8GA 3TNTA 2FP7B 2ALPA 1ZGIA 3BTWE 2BTCE 3T2NA 2TGDA 2LPRA 2GP9B 1K0HA 3B23B 4NWLA 3FZZA 1F92A 2H1UA 2ANYA 4ZKRU 3RXQA 1BITA 3S7KB 2G5VA 1NRQH 3ZZ7A 3K9XB 4OS6A 1DPOA 3VPKA 3M3VA 1NU7B 3TVJB 3TH2H 1RIWC 2Y7ZA 1XKAC 3M35A 5EIYA 4OGXA 1GG6C 4ZXYH 1S81A 3A7XA 3UWJH 3RU4D 2C3SA 1EPTB 3D65E 3P17H 1Y8TA 2XCFA 1G30B 2ZGBH 4B75A 9ESTA 1O33A 5FCRA 1IOEA 1VITG 2QYIA 2SNWA 3BTTE 2ZF0H 4DIIH 1YPHE 2VWNA 2Q6DA 3S0NA 1QQUA 3F68H 1UCYK 2IN2A 1LMWB 1Z1IA 2W3IA 3FZDA 9LPRA 3V3MA 4Y6DA 4ZKOU 2ZU3A 2JIZD 5AHGH 1VITF 3OTPA 5EW2H 2NU4E 3SJKA 1HBTH 7KMEH 3UR6A 4ASHA 5GCHF 2A7CA 1QR3E 3PWBA 4FUFA 2ZNKH 4H6SB 2FODA 2OCVB 2TIOA 3GCTF 4BOHA 1O2MA 1V2UT 3SU5A 1QJ1B 1AUTC 3STIA 1KXFA 5AFYH 3R3GB 2ASUB 4CHAB 1HXFH 3SQHE 1O3EA 3O8RA 4LZ1H 2A5IA 1E79D 2C90B 4IC5A 3ZZBA 3ZZ6A 3OY6U 3F2GA 2XC0A 2A1DB 3ATKA 2OQ5A 2PTNA 2ZPSA 1SR5C 3H7OA 2GCHG 1W13U 5CHBA 4BANB 1BBRE 3A87A 1P3EA 5T6GA 1GI2A 2Y7XA 2EEKA 1WBGB 3V0XA 1A4WH 1EOJA 4J2YB 1FZZA 2PUXB 1W0KD 1LHGH 1DUAA 1V2KT 2BX4A 3M5OA 1GHZA 2ILNA 4XD7D 2V3MA 2ZTZA 2ZECA 2J5UA 1SGDE 4UE7H 2FOMB 4TWWA 1E1QD 1KSNA 3VB5A 2J34A 4MPWA 1GHAG 1ELFA 4YT7H 2FWWA 3M61U 3SI4H 3ZZ3A 5C94A 1DT2A 5F53A 2FOBA 4FXGH 3BF6H 3RXAA 1NY22 2ZZUH 1O37A 1O3BA 1UVSH 2GGVB 1QQ4A 3MFJA 2ZDAH 4ZMAH 2XCNA 3NZIA 4BTUB 3ZYEA 4A5TS 3P8FA 4ISOA 2DE8A 3M5LA 4CR9A 2VH6A 1MTSA 4MNWA 4FUBA 1V2TT 1C2FA 3AW0A 2Z94A 5ABWA 4GLYA 4WXVA 4KTSA 1C1QA 2J94A 4XRNA 4B2CA 3GY4A 1GI8B 4WMDA 4X2YA 2PWXA 1KXAA 2HWLB 2BDYA 2FPZA 3ZZAA 2WHXA 5DP4A 5LH8A 2RFKC 1RFNA 1GHBF 4HG6A 2ZCKP 3NWUA 1UCYE 3FO8D 1O2WA 5JPMH 1XX9A 1GJ8B 1A5HA 1C4U2 4O3TA 2AHME 3FN8A 1GHVH 4TY6A 2HNTE 1Z71A 3EA7A 1XUJA 2VGCB 3HGPA 3O8DA 1T8OA 3PV5A 1P2IA 1ZJDA 4WH6A 1YPJH 2GVFA 3UTUH 2XWBI 3K6YA 3GY8A 2ZHQH 1O5CB 4ABBA 2KCAA 2BY7X 3T5FH 4F4OC 1ZHRA 4Q4LA 1AD8H 1KTSB 4I8JA 2EC9H 1C5VA 1SGRE 2BZ6H 1ANDA 1VGCC 1UVPA 2L74A 1C1RA 1OP2A 1QRXA 1C5MD 2PKAA 2J92A 4ABHA 2CJIA 4KELA 4MNXA 5GPIB 4OS1A 1GBKA 2H9TH 4I8KA 4XDEA 3RXSA 2V3OH 4H4FA 2BD2A 1P2JA 2H5CA 2KFWA 1OSSA 1YYY1 3GYLB 2SGQE 1LO6A 2XC5A 1JXPA 1AVGH 2WINI 4M7GA 5HYOA 4FUHA 1NBME 1BTXA 4MQAA 1S0QA 1EJAA 5FX6A 1E37B 1FAKH 1HJ8A 1NS3A 3O8CA 3LC3A 5I46H 2VIOA 2Z3CA 2JETB 5J4QA 1AFQB 3SU2A 2G00A 1UTMA 2ZDNA 3BTME 3KYGA 5G4BA 3PLPA 5EQRA 2A5AA 2YNBA 1O3GA 3VFEA 1E1RD 1TNJA 3WWBA 3RC4A 6LPRA 1GJCB 5CMXH 1CGHA 2J9NA 5A09A 3C27B 1UO6A 3A8BA 2R9PA 4FU7A 1GBHA 1PQ7A 3F9FA 5HM2A 1D3DB 1PFXC 3W95A 4BTTB 2FLRH 1ANEA 4JYTA 1O5GH 2BLVA 1NTPA 1OOKB 4R0IA 1MCVA 1A61H 2G5NA 1QNJA 3M5MA 1W7GH 4X2VA 1SGIB 5JBTA 4FETA 3EQ0H 5DP7A 1V2NT 1D3TB 1GL1A 3BG8A 5DG6A 1IQMA 3E0NB 5DPAA 1AFQC 4MNVA 3SNDA 4WXIA 3DSOA 1WOFA 4DJZB 1D9IA 1O2GH 1SLWB 1O2UA 1PPEE 1YWUA 1C5OH 3C1KA 3SHAH 2RA0A 1Y5AT 2F4LA 2IJD1 3LIWA 2BQ6B 3SJOA 2GCTC 3QX5H 2ZDMA 3KQCA 4X6OA 1O32A 1IQEA 2KCOA 1FV9A 4KGAA 4U2WA 4E7RG 1C1WH 2HNTC 1T8NA 4O3UA 3ZVEA 2ZPRA 3M3TA 1O3AA 3RXBA 1O36A 1LVOA 1P2QA 3A80A 1GJBB 2FLBH 5KEDA 2FTLE 1HUTH 3VB7A 3MU0A 3RDZA 1K21H 1P01A 3KCGH 1A0LA 2EA3A 1MTWA 4O9VA 1TRYA 2BOKA 2BY9X 5E2PA 4YLUA 1FY1A 4RN6A 3UAIC 1O5BB 4IMZA 2HALA 2W7UA 3GOVB 5FHTA 2BD4A 4ISHH 2F43B 1TIOA 4K60A 2GMTB 1LVMA 1EKBB 3M7UA 1GJ4H 1NFUA 2QXGA 4B1TA 1ZSJA 3E0PB 2R2WU 5GNDA 1C1OA 2B9LA 4WH8A 3RUOA 5FX5A 1HYLA 3A89A 1H9IE 2DE9A 3SHCH 1BT7A 1K2I1 1QL7A 2WUBA 5EU8A 1BTYA 3AK5A 1BTUA 3VGCC 1T32A 1LVBA 4B2BA 1CSOE 3TK6A 3URCA 2QF3A 4Y8YA 1GHAF 3VEQB 1Y3YA 3MH4A 6CHAC 1ZTJA 4MPUA 3SGBE 2BY5X 1DWBH 5L6NH 1XVOA 1MBQA 3RU4T 3HK3B 1O2YA 4ABFA 4FU9A 4OS4A 3GDVA 3KEEA 4RT0A 3U8OH 1DDJA 1TBRH 1PPBH 1GDNA 5FCKA 1P04A 1F0SA 3MU1A 4D7GA 2ZDVH 2FZZA 2KCYA 2YMSC 2WYGA 1UK3A 2F9BH 1QL9A 5FL7D 2JKHA 3LJOA 1SBWA 3FVFB 8KME2 1BRCE 5E0JA 4JZ1A 5HXFA 2EY4C 1CA0B 2OBOA 2AMDA 3LGIA 4CRCA 3SJ9A 1C1TA 4I8HA 3MI4A 3Q3YA 1TGNA 1NFXA 4Y0ZE 1AVWA 2QXHA 5PTPA 1KDQA 4D7FA 1F7ZA 4DCDA 4Q7XA 2FTMA 2PP6A 2VNTA 2FM2A 4Q7ZA 1S84A 1GVLA 1MU8B 1F5RA 1MKWH 3ZIAD 3DFJA 3ATLA 4TY7A 5E2OA 1NRPH 5DP9A 1GJ5H 2Q1JA 2TRMA 2XOKD 1Z7KA 1OWEA 4ZUHA 3TJOA 4M9FA 1PYTD 1W0YH 4AN7A 3SZEA 3MU5A 5CHAC 1G32B 4WMEA 6GCHG 1BQYA 1S6LA 2BQWB 2R3YA 3T29A 4AGJA 1XUIA 5A0AE 1TWXB 4DY7B 4Z6AH 4DW2U 1C5NH 1GBLA 2C8WB 3DFLA 3E90B 1O2VA 1UHBA 4AC9A 3GY6A 1DE7H 2CF9H 2D2DA 1E38B 1HIAB 1KTTB 1ETRH 2XBVA 1G3BA 2RDEA 2G8TA 3P8GA 1GI6A 2H6MA 1FXYA 2RA3A 1C5QA 1NN6A 2PKAB 2LP6A 4ESTE 1AZ8A 3VXFH 3CS0A 1MZDA 4NG9H 1O2OA 2CF8H 1X7AC 1WSSH 3P92A 5C17A 4NZLA 1TNIA 1SGTA 2R3UA 1C1PA 1C5YB 3U28C 1LQEA 1BTWA 1QRZA 1YCPM 1UTNA 1VITH 8LPRA 1LHEH 5F6MA 2Y81A 1THSH 5HMAA 3HKIB 1SGYE 4A92A 1HJAB 3DUXH 3SNBA 2THFB 1J16A 3DSPA 3Q3KA 2WV9A 5EJLA 1HPGA 1K1IA 2A2QH 1QB9A 3FP6E 1O3CA 2QE7D 2CK3D 2ZGXH 2KM0A 3ZZ9A 4ZROA 3SN8A 1TOCB 1ESAA 1A3BH 5CE1A 3OY5U 3F2FA 3RLWH 3RMNH 2AEIH 2BDGA 4Z1MD 1AVXA 1XXFA 2ZPQA 3OU0A 3M3SA 3LH1A 1VCPA 1OWKA 4R8TB 4IW4E 2BDBA 1O39A 2NWNA 1C2DA 2V3HH 5FXLA 4NZQA 1WV7H 1XUGA 1YPLH 3F9EA 4NFEA 1DICA 1EZSC 1ESTA 1ZMNA 5GIBA 2TGTA 3ZV8A 4CRBA 2FMJA 3TITA 1WTGH 5DKMA 4K5ZA 1ELGA 2GD4B 4UONA 1QBOA 3O8BA 3U9AH 1JRTA 2RG3A 1GMCF 3I77A 2XNDD 3TPIZ 2CMYA 3IITA 1TX8A 5C67A 2ZDLA 4YOJA 4WVPE 1P0SH 1HFDA 3SUEA 2QC2A 1P10A 4GCHG 3GCHB 3RXHA 2PKSC 3VGCB 1A7SA 4DT4A 4IN1A 1DX5M 1CA8B 1RRKA 4NIWA 2FOFA 1MMJN 1SGFG 4K1SA 2PLXA 3ENSB 1K1NA 3PRDA 1V2LT 1O3MA 3TH4H 1HV7A 1AKSB 3TJVA 2ZFSA 1H9LB 1ZPCA 1PQ8A 3VB6A 2AMPA 4MVNA 2VINA 1AHTH 1C5XB 1SQOA 1OPHB 3LDXH 1IQJA 1UVTH 1G3CA 1TGCA 3OX7U 2HLCA 1IQIA 1TBQH 1NPMA 4Y10E 3KIDU 3E3TA 3ATIA 1S83A 1WQSA 2F9UA 2FX4A 2GJGA 1Z8RA 3RXTA 3CP7A 1DITH 2AFQB 3AAUA 4WJG2 3BEUA 3PO1C 2QCYA 1O0DH 1ELDE 3SBKA 1BJVA 3EGKH 2FYRA 1O5FH 1SFQB 1ZOMA 3A86A 1FY5A 1LQDB 4X8VH 4MTBA 1JMOH 2TPIZ 3A85A 4Q2KA 2HNTF 4JZDH 2BD5A 3P95A 1N6XA 3OEHD 1EASA 2QAAA 3F3BA 1K22H 2J97A 4LXBH 1EJNA 4KKDA 3U98H 2BHGA 1QCPA 2ZGCA 1D3QB 1V3XA 2GV6A 1C2MA 2K8IA 1C1VH 1TBZH 1S5SA 5B6LA 2AERH 1KIGH 3QGJA 4UD9H 2I6SA 3ZVAA 3S9BA 4CREA 1N8OC 3TGKE 1GMDF 4A7IB 3HK6B 4ABDA 2Q6FA 5E0GA 4YOGA 4ABJA 1SGEE 3PB1E 3S9CA 4D76A 1NRNH 1UMAH 1GJDB 1O3PB 3PTBA 4DT7B 2FOAA 1KY9A 1MCTA 2Z9JA 3LPRA 4Y7AA 4B76A 1CT0E 4Y8ZA 4B6EA 4JYVH 5ETXA 2AH4X 2SGEE 4MNYA 5HIZA 3SZNA 2BMGB 4ZCNA 1XVMA 1TGSZ 4X2WA 1MTUA 3W1EA 2VVVA 1TNHA 4JZEH 1ARCA 4RSPA 4HTCH 3M5NA 2BLOA 3A7YA 4ACBA 1L1JA 2BYAX 4OS2A 3ZVFA 3VXEH 2HOBA 2C93B 1NESE 1OX1A 2IPQX 1XKBC 1GBTA 4Y11E 3MNSA 1GCDA 5C1UA 4I33A 1C5ZB 3U1JB 4IGDA 4BAHB 1JRSA 1GWAA 1TNGA 2K1QA 4F55A 1TNKA 1QA0A 2P3FH 1GPZA 1BB0B 1EPTC 2CV3A 1AN1E 2GV7A 4NIYA 3WWFA 1QBVH 4FUDA 3RXFA 3SUGA 3V13A 1Q31A 2AGIX 4Q80A 1F5KU 1NROH 1T7CA 3N7EA 1IQHA 5EG4A 3SUFA 4Q7YA 2G4TA 1FIWA 3EE0B 1DY8A 1ZHPA 5H4IB 4GAWA 4HFPB 1HAIH 1TGBA 1MD8A 3PMBB 5IDKA 1NZQH 1J17T 2UWOA 3RMLH 1KXCA 1C5SA 5C20A 1ANCA 3ZVCA 3OEED 1EXFA 1GMHG 3KQBA 1QFKH 3OAAD 1C9TA 3LU9B 4NGAH 1TX6A 4RKOB 3T28A 4X1QU 1C1SA 1JBUH 2WUCA 1B7XB 1EFRD 5A0BA 4GVUA 1B0FA 1O2LA 1MAYA 3AAVA 4NIVA 3TK9A 1SLUB 1LPZB 4H42U 1W3CA 1FPCH 2BQ7B 2ZCHP 1MTNC 4TPIZ 4E05H 1GI9B 3TK5A 1ELTA 2Y82A 3SNCA 2UUKB 2BDHA 5L30H 2W5EA 4OS7A 1GI4A 3SO3A 2G81E 2M2AA 1Z8GA 3UQVA 1J9CH 4Z0KA 1C2GA 2WPKS 1QHRB 2Y5HA 1QTFA 1FIZA 2CHAC 1FNIA 3LGUA 2KR7A 1KXDA 5FPTA 1EB1H 4NCYA 1L0ZA 1DM4B 1EB2A 3BTEE 2KCPA 2HPPH 5L2YH 1JOUB 2ODQA 1ANBA 3R0FA 3LGTA 1OS8A 1P2OA 1SMFE 2YMSB 2IPHA 2Z9GA 3MNCA 2ULLA 4JK5A 5KECA 2AGGX 1EAXA 3MMGA 3CENA 3SU4A 2F3CE 1MKWK 1ZLRA 3NUMA 1GI7B 5JYIA 1DOJA 1THRH 2D8WA 1V2JT 4ZH8A 2GDDA 3BG4B 5EOKA 2BXUH 1GG6B 1MU6B 5A8YA 2WPDD 4O03A 1IHTH 5EGMA 4BXSA 2CHAB 1GCTB 1QGFA 4THNH 2ANKH 1B5GH 3GDUA 3RXIA 4YM9A 3Q3XA 1UHBB 1J15A 2I6QA 2BZAA 2BD7A 3PROA 3ZVBA 1EX3A 2WPJS 3U69H 1P9SA 2XWAA 1YPKH 1A5GH 3F0PA 2A32A 5CHAB 3NKKA 1GGDB 2PHBA 3PTNA 2A7JA 2OK5A 1Y3UA 3I29A 1O31A 1KMHB 2A4QA 4B73A 1SGCA 1DWEH 4A1VA 3RXUA 2PTCE 2XNIA 3UB0A 1O2RA 1EQ9A 1C2EA 3QTVH 2ZDKA 2Z9KA 5F8TA 4E06H 1MKXK 1HAPH 2SFAA 1P09A 4JZIA 1CGJE 4ZXXH 1C1MA 2ZI2H 1DSTA 1ELVA 3DHKH 3BEIB 1DLKB 5C0UA 1SQTA 5C1YA 2OXSA 4NA8A 3QK1A 4IMQA 1UTQA 5DK1A 1MKXH 1V2QT 1Z6EA 2NU3E 1G36A 2ZO3H 3RM0H 2ANWA 3KNXA 3W94A 1GBAA 1KYNA 2ODYB 5A8XA 1O38A 1SOZA 1TA6A 4XOJA 4DVAU 4TSFD 1HAZB 2Y5FA 1QY6A 2XBYA 5JB8S 2KAIA 2VIVA 4BAMB 1V2RT 2JH6D 1W10U 4X1NU 3Q76A 1DUEA 4AB9A 2ZHDA 3N7OA 1A1RA 3NXPA 1W0JD 2P95A 5DP6A 4ISLA 2PUQH 3TJUA 1O2TA 1OWDA 2BD9A 2GTBA 4H6TA 1KLTA 1U6QA 3A8CA 2AIPA 8GCHF 1BHXB 2FI5E 1OXGA 1HAXB 3BTFE 1EZQA 5EODA 1AMHA 2H9EH 7ESTE 1GHBG 3RXDA 2A31A 2EI7A 4IS5A 1QURH 4F48B 1EAUA 1HAGE 3UIRA 1GJ9B 1O30A 1O2NA 1FI8A 1FLEE 2J38A 3MH5A 4TYDA 1HCGA 2UUJB 1WAYB 4U32A 3MH7A 1GI3A 1W2KH 2FIRH 4I86A 1THPB 2O8LA 1A0JA 3PO1B 1XUKA 1K1MA 2VU8E 1SLXB 4WF8A 5GXPA 1GJ6A 2CXVA 5FBEA 4RI0A 2XBWA 3PLKA 2TGAA 1UVOA 3GISB 3BN9A 3UUZA 3QZRA 1O2SA 1ABIH 1TRNA 1TALA 2NU2E 2V7QD 1T4VH 2W6JD 3TU7H 2OD3B 4A6LA 3KHVA 5IK2D 4NIXA 1BHXF 1S6HA 2B5TB 1DWCH 4AFUA 2OC0A 4FUJA 3N99A 1INCA 4BAOB 3BIUH 3P8NA 1EJMA 2F9PA 1PJPA 4TPYA 2GCTB 3ZZCA 1C4Y2 3NPSA 2P3UB 5C5OA 1BTPA 2PR3A 3FANA 1ID5H 1SGNE 4UFDH 1GI5A 3QWCH 4AFQA 4AYVB 3URDA 5DSFA 1MTVA 2VVUA 3IG6B 2RCEA 4IN2A 5DP3A 5K7RA 1ZR0A 3SV7A 3TH3H 1EOLA 2K0QA 1HAVB 2HVYB 1FMGA 1ETSH 5HM9A 1AU8A 1O2PA 2L6OA 1BMFD 3LJJA 2BD3A 1GDQA 1BA8B 1TYNA 3A7VA 4VGCB 1O2XA 2D26C 4YLQH 2VBCA 4XFQA 5EXNA 2P8OC 1P2NA 2ZFTA 1O2HA 1HLTH 1OKXA 1EZUC 2FYQA 1TOMH 4GHTA 1AO5A 4J1YA 2UWLA 3SU1A 2UWPA 1P3CA 3EDXB 3BTGE 3IWMA 3LGWA 1FN6A 1KLIH 2LELA 2STAE 1DVAH 2WZQA 1GBJA 1D4PB 3UFAA 3L6PA 4NA9H 4AOQA 2P8OB 1MZAA 7GCHF 1UCYH 1NFWA 2C8YB 3UREA 2Y80A 2O9QA 4X1RU 3Q77A 1RGQA 4FUIA 4X8SH 1O34A 3H5CB 3KQ5A 5HGGA 2J95A 3V12A 2J4IA 1SQAA 1HAHH 4FU8A 2JH0D 3SGQE 2BVXH 3TLOA 4TWYA 3S69A 1C5RA 2GZ9A 1V2MT 3WW7A 5C0TA 3I78A 1C2IA 1JIRA 5ESBA 2OQUA 3D62A 2FESH 1SKYE 1BUIA 1JIMA 1T4UH 1XUHA 4MPXA 1GBFA 2OP9A 4K2YA 1O3JA 4F49A 3SI3H 2ZWLH 4Y8XA 2FS8A 5E0HA 2FDAA 4I8LA 4Y7BA 4GPGA 4U30A 2ZFPH 2NU0E 2A4GA 1LHDH 2VWOA 5KGOA 2ZQ1A 4D8NA 5JBAS 1TQ0B 2Q6GA 3E6PH 1Y3XA 2BVSH 1Q3XA 2BLQA 1B0EA 2BLWA 3NCLA 4ABEA 4FUEA 2BOHB 4NSVA 2P59A 2ZA5A 1O2IA 4UDWH 3BTDE 1EUFA 1N1LA 2XBXA 5T6FA 4UFGH 1OYTH 1Y5BT 1C5PA 1WDIA 1Y5UT 1D6RA 5J4SA 4X8TH 4AX9H 3SJ8A 3H7TA 2WYJA 1GBIA 3MNXA 1PQAA 3ODFA 1TX7A 3M37A 4I32A 1QA7A 4INHA 2Z7FE 3QZQA 4YZUA 3S9AA 1QB1A 2QY0B 1P8VC 2KZ4A 2PW8H 2Z6BD 3MHWU 1CQQA 1E0FD 3T26A 3CS7A 1BBRH 1NO9H 2VIQA 2PGBB 1SC8U 1UK4A 3SYJA 3F0OA 5FBIA 3ZYDA 1Q2WA 3MO6A 1ESBA 1Y3VA 4CBNA 1O35A 3LC5A 1FDPA 1ZTKA 1FY8E 5AFZH 4JMYA 3UR9A 5TJXA 4LOYH 4CRGA 2PSYA 4XBBA 4UEHH 4GCHF 1SGPE 2A5KA 1O3IA 1NC6A 5LPRA 3A7TA 1QRWA 2TBSA 1VGCB 2ZTXA 4OS5A 1Y3WA 3BG4C 1TB6H 3TNSA 3A81A 1A2CH 3P70B 1CHGA 3LGVA 3ESTA 1NRSH 3D23A 2GX4A 2Z9IA 5ESTE 4AZ2B 2F83A 4DGJA 5GWZA 1DWDH 1QIXB 2BD8A 3ELAH 2Z9LA 3U1IB 5TCCA 4ZKSU 2FOHA 1BOQA 1GBMA 1LPGB 3MO3A 1V2WT 3QLPH 1F2SE 2VWLA 3ATWA 3FOAA 3UNQA 1G9IE 1SOTA 2O8UA 3DD2H 3SORA 2WSSD 1A46H 1T8MA 1SFIA 2ZFQH 2OINA 1TPAE 3HPTB 2W7SA 3P6ZB 3PWCA 1ZPZA 1LDTT 2ZIQH 1FQ3A 3SQEE 3H09A 1ZSLA 2QF0A 1GMHF 2A4OA 3V7TA 2EI8A 2VIDA 1YY3A 4FOUC 4JK6A 1DANH 2GT7A 4XBCA 1LVYA 3GICB 2GZ7A 4VGCC 1XUFA 3KF2A 4AORA 1O2KA 2QIQA 3E1XB 3ITIA 3LKWA 5LPEA 3T27A 4DIHH 1WCZA 3PMAB 4ZKNU 3LT3A 1SI5H 1IQLA 1BRUP 3QGNB 1GVKB 4ZHLU 4JZFH 1EPTA 4ABGA 1JWTA 3PLBA 1TFXA 1YC0A 1AKSA 4K3JA 1L1NA 3ZV9A 2BDIA 1GI1A 3KQEA 4JYUH 3GY7A 4B2AA 1SGQE 1O3OA 1SG8B 4XBDA 3VB3A 4LZ4B 1ZGVA 2W26A 1YF4A 2ZTYA 3L3TA 3ZVGA 2QA9E 1HRTH 1HAYB 2GMTC 1YCPH 1NRRH 3BIVH 3L33A 1VKYA 1V2VT 3UWIA 1W11U 3SOSA 4IC6A 1TA2A 4ISIH 5EPYA 2VVCA 4MG3A 1S82A 2JJ1D 1SL3A 5BRRE 4K8YA 3MU8A 1DSUA 5EJ1A 3RXLA 4X6PA 4CRAA 2WPIS 4I31A 2UUFB 2QV1A 1Z8JB 2J2UA 1E35B 2TGPZ 3BSQA 1AY6H 3LGYA 2QXIA 1OHHD 2ZU2A 2SNVA 3RXRA 3ZZ8A 2ZU1A 3KQDA 4D9QA 2A4RA 3HATH 3GCOA 2LNCA 2ZC9H 4CR5A 3OYPA 5C3NA 1GL0E 1J8AA 4AG2A 1TMUH 4E7NA 4K8BA 2AMQA 4CBOA 1ELEE 1MAXA 1O3LA 3S7HB 2AIQA 1TQ7B 3GS9A 2A7HA 1H9HE 1CGIE 4Y0YE 3GCHC 1O3HA 1S0RA 4X1PU 1DS2E 5SGAE 1RTFB 2VWMA 4CRFA 1COWD 2CN0H 1MTNB 1NBMD 1F0RA 2GKVE 1GHYH 1F5LA 3A8DA 4OGYA 1KXBA 3HGNA 3LONA 4NSYA 6CHAB 3OSYA 5AF9H 5FAHA 1AZZA 1HXEH 4JCNA 2CGAA 4BXWA 1P2KA 1O3KA 2VH0A 1FY3A 1G2MA 2PFEA 5C2ZA 3RXOA 2OTVA 1TMBH 1C2JA 1RJXB 1YPEH 1CE5A 1CU1A 1ORFA 1YPMH 2O8MA 3BTQE 3A84A 1OWIA 2ZHFH 3ODDA 1BDAA 2GDEH 1KDQB 5EQQA 1O5EH 1CHOG 1GBDA 3KN2A 2OUAA 3Q00A 1O3FA 1S6FA 2FO9A 4Y76A 1OP8A 5BPEA 3RXMA 3ZZ4A 6ESTA 1W0ZU 3RM2H 3TGIE 1XM1A 2IJOB 3AVZA 2R0KA 5JB9S 3ZZ5A 1BJUA 3EAJA 4X6NA 1PYTC 2AGEX 4AFSA 1C5WB 1WUNH 2P94A 1YPGH 2OBQA 1ELCA 1RTLA 1TPPA 3MOCA 3RXEA 5LPFA 3NRLA 1O3DA 3A82A 3RXJA 1TPOA 3B8JA 1V2ST 1LKBA 3UY9A 1YCPK 2BM2A 4TT3D 1PPCE 1MBMA 5JDUB 2F9VA 2GZ8A 1YLCA 5GDSH 1NU9A 1L4ZA 1CO7E 1H8IH 1UTJA 2ZU5A 4YTAA 1F0TA 5C1XA 2STBE 1OYQA 2XXLA 1FN8A 1GHXH 1L2EA 8GCHG 4HGCA 2XYAA 3SU3A 3PM3A 3PMHB 3F2HA 2BB4A 4YT6H 3VB4A 3JZ1B 1GCTC 3GYMA 1ZMJA 1PPGE 1CBWB 3LH3A 3SV2H 1SQRA 1NM6A 4RT1A 5A0CA 3DA9B 1MQ6A 5LGOA 1TRMA 1AIXH 1HIAA 4XSKU 1ZHMA 4A1TA 5F8XA 1IQKA 1BIOA 6GCHF 3MYWA 3UOPA 2V0BA 2ZG0H 3MWIU 4ABAA 1QBNA 3JZ2B 4ZAEA 1H1BA 3RMOH 2QF4A 2FS9A 1TONA 2AS9A 5EQSA 3T25A 1VJ9U 8ESTE 2BDCA 3STJA 1P11E 1LHCH 3BEFB 1MQ5A 1C2KA 2WPMS 1GDUA 1ETTH 1W12U 4WY3A 3DSGA 1Z6JH 3FFGA 1P02A 5DP5A 4PROA 2C4FH 1SB1H 1YP9A 1BMNH 5DP8A 1G3EA 2W6ID 1CVWH 3GY3A 3TIUA 5I25A 1BTHH 2DUCA 2VB0A 1FY4A 3GCTG 4SGAE 2XRCA 1ARBA 2J98A 3SU6A 2A45B 1EAWA 1LCYA 3QDZB 1H8DH 2V6NA 1TMTH 4QT8C 5C5NA 1EP6A 3MH6A 4GUXA 1A5IA 3RXPA 1F0UA 3KGPA 1K1OA 2H5DA 1QB6A 1YKTA 1A0HB 1OWJA 1ACBE 1L4DA 1IHSH 2QF5A 3BV9B 4HI3A 3AW1A 1P9UA 3M36A 4NA7A 5GCHG 5B6OA 2OC1A 5A2MH 3SW2B 4I7YH 4ZHAA 2ESTE 2JJ2D 2ZFRH 5F03A 4ACAA 2FX6A 4CH8B 5HKKD 1C4V2 3M7QA 2VIWA 4YOIA 1HGTH 4KTUA 3SUDA 1N6YA 3P8OA 1K1PA 4CHAC 1WU1A 2O8TA 1SPJA 5K0HA 5EXLA 1VJAU 1P06A 4ISNA 2ODPA 1HNEE 4X8UH 1C5LH 5TCAA 2G51A 4KTCA 1SGFA 2PKSB 4BAQB 3SV6A 3A88A 1ZRBA 4NWKA 1UVUH 1C1UH 3HKJB 1C2HA 1TPSA 2JETC 1P03A 1ABJH 1P12E 1AI8H 4K1TA 3SNAA 3SJIA 1UTPA 3BTHE 1YLNA 3UQOA 1AB9B 1AB9C 1GJ7B 2BX3A 1K28D 4Y79A 4K69A 3WY8A 3ATMA 1AWFH 1H4WA 1ZJKA 1CA0C 2SGPE 4D9RA 4GHQA 4K1EA 2FOEA 1A3EH 1V6DA 1GHWH 1TABE 2JH5D 1O5AB 3UPEA 5AVDA 1FUJA 3E16B 2F9NA 3F1SB 2WPHS 2FEQH 1D6WA 2G55A 3F6UH 2HPQH 3EYDA 1T31A 2R0LA 1TE0A 2Z3EA 3OTJE 2V35A 1LHFH 4BTIB 1RIWB 3FP7E 4GSOA 1C1NA 1S85A 1HJAC 3TJNA 5EJZA 3M7TA 3NK8A 3SU0A 3K6ZA 3PMJA 1J14A 2HLDD 1NFYA 1EATA 1ZZZA 1GBCA 1V2OT 1W8BH 5DGJA 3AASA 1SHYA 1DY9A 4FUCA 1SVPA 1IQNA 1WTHD 4DOQA 4BAKB 1HDTH 4YO9A 3B9FH 3F9GA 5DN6D 1RD3B 2KAIB 1ELAA 4KP0A 4LK4A 1QJ6B 3RMMH 4X6MA 4Q63A 2WPLS 2ZHWH 4YXWD 1AFEH 4B71A 2C8XB 1LPKB 1ZRKA 4ZHMU 1GMCG 2OLGA 2BDAA 2OC8A 3ZVDA 1WYKA 1UK2A 1VZQH 2WV5A 4INKA 1C5TA 1YM0A 2IOTA 3G01A 3A7ZA 2ALVA 2ZQ2A 3A7WA 3PV4A 3MU4A 4X2XA 1V2PT 3UOUA 3FAOA 2M5TA 5EXMA 2QGRA 1AE8H 7LPRA 1TNLA 1P2MA 5HIYA 1DLEA 1FONA 1QZ8A 1CHOF 2G4UA 1MH0A 1IQGA 1WQVH 2YMSD 2SGAA 3MNBA 1EAIA 3PYHA 2F91A 2ZEBA 2ZKSA 1PPHE 4DG4A 1HJ9A 1BMAA 2FI3E 5EPNA 1MABB 5GJ4B 3OE7D 1YLDA 2Z3DA 2PSXA 5F8ZA 1BZXE 1K1JA 5T3HA 2XC4A 1XXDA 2O8WA 4A1XA 3RXKA 3U8TH 1HB0B 1AE5A 1H8ED 1W14U 2ZFFH 2OC7A 1VR1H 5JBCS 4FVBA 3EA8A 1GJAB 1Y59T 1BMLA 4B6FA 1QJ7B 3UNSA 1TAWA 4INLA 1E34B 4P02A 1GI0A 1SHHB 5JBBS 3A8AA 1EZXC 3GY5A 4P00A 4CH2B 1AQ7A 2FOGA 1UTLM 1Z8IB 3DCLA 3RXCA 1UTKA 2SGDE 1ZMLA 3SV9A 1BCUH 1ZYOA
chains in the Genus database with same CATH topology
1XMNB 1GMDG 5A8ZA 1TGTA 1ZSKA 1FPHH 1AGJA 2WV4A 1MUEB 2YOLA 4SGBE 2QXJA 1ZPBA 1G2LA 2Y5GA 1HAOH 4FVDA 1YBWA 1BTZA 4MLFB 4UFFH 3QO6A 4AYYB 1P57B 1BRBE 1DFPA 2UUYA 1L1GA 2HGTH 1AWHB 3QN7A 1QL8A 4AGKA 2HVXA 2ZGJA 1P05A 3FP8E 3DT0H 1BBRK 3GDSA 4O97A 3BTKE 1IAUA 2BY8X 1RXPA 2BXTH 2W3KA 1KXEA 1G37A 1KLJH 3GY2A 2G52A 1YPHC 4X1SU 2H9HA 1CT2E 1GVZA 4AG1A 1G3DA 2D1JA 3A83A 1PPZA 1O3NA 3SV8A 3K65B 1CBWC 2Y6TA 4DURA 1C9PA 1PPFE 2P16A 3F9HA 1NT1A 3EA9A 1Z1JA 1K1LA 1W7XH 2A0QB 1EP5A 3RC5A 1DXPA 1D3PB 1T8LA 2EI6A 2ANMH 1M9UA 1UJ1A 1RTKA 1MD7A 1SLVB 2ZU4A 1GGDC 4XE4A 2FI4E 4NFFA 1BRAA 4BNRA 3QTOH 1ELBA 4ABIA 4FUGA 2GCHF 4Y71A 3U8RH 5EW1H 3MO9A 4U01A 2F9OA 1FAXA 2ZP0H 5IYTA 4WMFA 5T6DA 1GBBA 3RC6A 2C8ZB 1AUJA 2A2XH 2R2MB 3E91A 1VCQA 1CT4E 2XW9A 4HZHA 3LOXA 2GT8A 2FOCA 3SGAE 3E8LA 4B74A 4MDSA 1O2ZA 5FPYA 3ZZDA 2HRVA 2ZCLP 1VCWA 3D49H 1GBEA 1IQFA 1OP0A 5L2ZH 4IBLH 5DJ7A 3MTYA 3GCNA 2VIPA 2AYWA 4RKJB 1PQ5A 2B8OH 3KL6A 4YESB 1O2QA 1DXWA 3RP2A 2NU1E 4AB8A 4UFEH 2BVRH 2VGCC 2ZGHA 2ZHEH 5E8EH 2FXRA 1C2LA 1N8OB 4AFZA 2P93A 2PV9B 3RXVA 3K2UA 5FPSA 1K9OE 1O5DH 2PGQB 2B7DH 2BY6X 1HAVA 3T62A 3RLYH 3TGJE 4CRDA 1LTOA 2SGFE 4WWYA 3UNRA 1BMMH 1YGCH 1RS0A 2B0FA 1SSXA 2RDLA 7GCHG 1UTOA 2H2ZA 1C5UA 2XTTB 5DO4H 2VJ1A 1LKAA 1E36B 1ZTLA 3SNEA 1OWHA 2YNAA 2P3TB 1TLDA 3RU4E 2QN5T 3RXGA 1FJSA 1O2JA 4X0WU 3QUMP 4MPVA 4I8GA 3TNTA 2FP7B 2ALPA 1ZGIA 3BTWE 2BTCE 3T2NA 2TGDA 2LPRA 2GP9B 3B23B 4NWLA 3FZZA 1F92A 2H1UA 2ANYA 4ZKRU 3RXQA 1BITA 3S7KB 2G5VA 1NRQH 3ZZ7A 3K9XB 4OS6A 1DPOA 3VPKA 3M3VA 1NU7B 3TVJB 3TH2H 1RIWC 2Y7ZA 1XKAC 3M35A 4OGXA 1GG6C 4ZXYH 1S81A 3A7XA 3UWJH 3RU4D 2C3SA 1EPTB 3D65E 3P17H 1Y8TA 2XCFA 1G30B 2ZGBH 4B75A 9ESTA 1O33A 5FCRA 1IOEA 1VITG 2QYIA 2SNWA 3BTTE 2ZF0H 4DIIH 1YPHE 2VWNA 2Q6DA 3S0NA 1QQUA 3F68H 1UCYK 2IN2A 1LMWB 1Z1IA 2W3IA 3FZDA 9LPRA 3V3MA 4Y6DA 4ZKOU 2ZU3A 5AHGH 1VITF 5EW2H 2NU4E 3SJKA 1HBTH 7KMEH 3UR6A 4ASHA 5GCHF 2A7CA 1QR3E 3PWBA 4FUFA 2ZNKH 4H6SB 2FODA 2OCVB 2TIOA 3GCTF 4BOHA 1O2MA 1V2UT 3SU5A 1QJ1B 1AUTC 3STIA 1KXFA 5AFYH 3R3GB 2ASUB 4CHAB 1HXFH 3SQHE 1O3EA 3O8RA 4LZ1H 2A5IA 2C90B 4IC5A 3ZZBA 3ZZ6A 3OY6U 2XC0A 2A1DB 3ATKA 2OQ5A 2PTNA 2ZPSA 1SR5C 3H7OA 2GCHG 1W13U 4BANB 1BBRE 3A87A 1P3EA 5T6GA 1GI2A 2Y7XA 2EEKA 1WBGB 3V0XA 1A4WH 1EOJA 4J2YB 1FZZA 2PUXB 1LHGH 1DUAA 1V2KT 2BX4A 3M5OA 1GHZA 2ILNA 2ZTZA 2ZECA 1SGDE 4UE7H 2FOMB 4TWWA 1KSNA 3VB5A 2J34A 4MPWA 1GHAG 1ELFA 4YT7H 2FWWA 3M61U 3SI4H 3ZZ3A 1DT2A 2FOBA 4FXGH 3BF6H 3RXAA 1NY22 2ZZUH 1O37A 1O3BA 1UVSH 2GGVB 1QQ4A 3MFJA 2ZDAH 4ZMAH 2XCNA 3NZIA 4BTUB 3ZYEA 4A5TS 3P8FA 4ISOA 2DE8A 3M5LA 4CR9A 2VH6A 1MTSA 4MNWA 4FUBA 1V2TT 1C2FA 3AW0A 2Z94A 5ABWA 4GLYA 4WXVA 4KTSA 1C1QA 2J94A 4B2CA 3GY4A 1GI8B 4WMDA 4X2YA 2PWXA 1KXAA 2HWLB 2BDYA 2FPZA 3ZZAA 5DP4A 5LH8A 1RFNA 1GHBF 2ZCKP 3NWUA 1UCYE 1O2WA 5JPMH 1XX9A 1GJ8B 1A5HA 1C4U2 4O3TA 4TY6A 1GHVH 2HNTE 1Z71A 3EA7A 1XUJA 2VGCB 3HGPA 3O8DA 1T8OA 1P2IA 1ZJDA 4WH6A 1YPJH 2GVFA 3UTUH 2XWBI 3K6YA 3GY8A 2ZHQH 1O5CB 4ABBA 2BY7X 3T5FH 4F4OC 1ZHRA 1AD8H 1KTSB 4I8JA 2EC9H 1C5VA 1SGRE 2BZ6H 1ANDA 1VGCC 1UVPA 1C1RA 1OP2A 1QRXA 1C5MD 2PKAA 2J92A 4ABHA 2CJIA 4KELA 4MNXA 5GPIB 4OS1A 1GBKA 2H9TH 4I8KA 4XDEA 3RXSA 2V3OH 4H4FA 2BD2A 1P2JA 2H5CA 1OSSA 1YYY1 3GYLB 2SGQE 1LO6A 2XC5A 1JXPA 1AVGH 2WINI 4M7GA 5HYOA 4FUHA 1BTXA 4MQAA 1S0QA 1EJAA 5FX6A 1E37B 1FAKH 1HJ8A 1NS3A 3O8CA 3LC3A 5I46H 2VIOA 2Z3CA 2JETB 5J4QA 1AFQB 3SU2A 2G00A 1UTMA 2ZDNA 3BTME 5G4BA 3PLPA 5EQRA 2A5AA 2YNBA 1O3GA 3VFEA 1TNJA 6LPRA 3RC4A 1GJCB 5CMXH 1CGHA 2J9NA 5A09A 3C27B 1UO6A 3A8BA 2R9PA 4FU7A 1GBHA 1PQ7A 3F9FA 5HM2A 1D3DB 1PFXC 3W95A 4BTTB 2FLRH 1ANEA 4JYTA 1O5GH 2BLVA 1NTPA 1OOKB 4R0IA 1MCVA 1A61H 2G5NA 1QNJA 3M5MA 1W7GH 4X2VA 1SGIB 5JBTA 3EQ0H 5DP7A 1V2NT 1D3TB 1GL1A 3BG8A 5DG6A 1IQMA 3E0NB 5DPAA 1AFQC 4MNVA 3SNDA 4WXIA 4DJZB 1WOFA 1D9IA 1O2GH 1SLWB 1O2UA 1PPEE 1C5OH 3C1KA 3SHAH 2RA0A 1Y5AT 3LIWA 2BQ6B 3SJOA 2GCTC 3QX5H 2ZDMA 3KQCA 4X6OA 1O32A 1IQEA 1FV9A 4KGAA 4U2WA 4E7RG 1C1WH 2HNTC 1T8NA 4O3UA 3ZVEA 2ZPRA 3M3TA 1O3AA 3RXBA 1O36A 1LVOA 1P2QA 3A80A 1GJBB 2FLBH 2FTLE 1HUTH 3VB7A 3MU0A 3RDZA 1K21H 1P01A 3KCGH 1A0LA 2EA3A 1MTWA 4O9VA 1TRYA 2BOKA 2BY9X 5E2PA 4YLUA 1FY1A 4RN6A 1O5BB 4IMZA 2HALA 2W7UA 3GOVB 5FHTA 2BD4A 4ISHH 1TIOA 4K60A 2GMTB 1LVMA 1EKBB 3M7UA 1GJ4H 1NFUA 2QXGA 4B1TA 1ZSJA 3E0PB 2R2WU 1C1OA 2B9LA 4WH8A 3RUOA 5FX5A 1HYLA 3A89A 1H9IE 2DE9A 3SHCH 1BT7A 1K2I1 1QL7A 2WUBA 5EU8A 1BTYA 1BTUA 3VGCC 1T32A 1LVBA 4B2BA 1CSOE 3TK6A 3URCA 2QF3A 4Y8YA 1GHAF 3VEQB 1Y3YA 3MH4A 6CHAC 1ZTJA 4MPUA 3SGBE 2BY5X 1DWBH 5L6NH 1XVOA 1MBQA 3RU4T 3HK3B 1O2YA 4ABFA 4FU9A 4OS4A 3GDVA 3KEEA 3U8OH 1DDJA 1TBRH 1PPBH 1GDNA 5FCKA 1P04A 1F0SA 3MU1A 4D7GA 2ZDVH 2FZZA 2WYGA 1UK3A 2F9BH 1QL9A 2JKHA 3LJOA 1SBWA 3FVFB 8KME2 1BRCE 5E0JA 4JZ1A 5HXFA 2OBOA 1CA0B 3LGIA 2AMDA 4CRCA 3SJ9A 1C1TA 4I8HA 3MI4A 3Q3YA 1TGNA 1NFXA 4Y0ZE 1AVWA 2QXHA 5PTPA 1KDQA 4D7FA 1F7ZA 4DCDA 4Q7XA 2FTMA 2VNTA 2FM2A 4Q7ZA 1S84A 1GVLA 1MU8B 1F5RA 1MKWH 3DFJA 3ATLA 4TY7A 5E2OA 1NRPH 5DP9A 1GJ5H 2Q1JA 2TRMA 1Z7KA 1OWEA 4ZUHA 3TJOA 1PYTD 1W0YH 4AN7A 3MU5A 5CHAC 1G32B 4WMEA 6GCHG 1BQYA 2BQWB 2R3YA 3T29A 4AGJA 5A0AE 1XUIA 1TWXB 4DY7B 4Z6AH 4DW2U 1C5NH 1GBLA 2C8WB 3DFLA 3E90B 1O2VA 1UHBA 3GY6A 1DE7H 2CF9H 2D2DA 1E38B 1HIAB 1KTTB 1ETRH 2XBVA 1G3BA 2G8TA 3P8GA 1GI6A 2H6MA 1FXYA 2RA3A 1C5QA 1NN6A 2PKAB 4ESTE 1AZ8A 3VXFH 3CS0A 1MZDA 4NG9H 1O2OA 2CF8H 1X7AC 1WSSH 3P92A 4NZLA 1TNIA 1SGTA 2R3UA 1C1PA 1C5YB 1LQEA 1BTWA 1QRZA 1YCPM 1UTNA 1VITH 8LPRA 1LHEH 5F6MA 2Y81A 1THSH 5HMAA 3HKIB 1SGYE 4A92A 1HJAB 3DUXH 3SNBA 2THFB 1J16A 3Q3KA 1HPGA 1K1IA 2A2QH 1QB9A 3FP6E 1O3CA 2ZGXH 3ZZ9A 4ZROA 3SN8A 1TOCB 1ESAA 1A3BH 5CE1A 3OY5U 3RLWH 3RMNH 2AEIH 2BDGA 1AVXA 1XXFA 2ZPQA 3OU0A 3M3SA 3LH1A 1VCPA 1OWKA 4R8TB 4IW4E 2BDBA 1O39A 2NWNA 1C2DA 2V3HH 5FXLA 4NZQA 1WV7H 1XUGA 1YPLH 3F9EA 4NFEA 1DICA 1EZSC 1ESTA 1ZMNA 5GIBA 2TGTA 3ZV8A 4CRBA 2FMJA 3TITA 1WTGH 5DKMA 4K5ZA 1ELGA 2GD4B 4UONA 1QBOA 3O8BA 3U9AH 1JRTA 2RG3A 1GMCF 3I77A 3TPIZ 2CMYA 3IITA 1TX8A 5C67A 2ZDLA 4YOJA 4WVPE 1P0SH 1HFDA 3SUEA 2QC2A 1P10A 4GCHG 3GCHB 3RXHA 2PKSC 3VGCB 1A7SA 4IN1A 1DX5M 1CA8B 1RRKA 4NIWA 2FOFA 1MMJN 1SGFG 4K1SA 2PLXA 3ENSB 1K1NA 1V2LT 1O3MA 3TH4H 1HV7A 1AKSB 3TJVA 2ZFSA 1H9LB 1ZPCA 1PQ8A 3VB6A 2AMPA 4MVNA 2VINA 1AHTH 1C5XB 1SQOA 1OPHB 3LDXH 1IQJA 1UVTH 1G3CA 1TGCA 3OX7U 2HLCA 1IQIA 1TBQH 1NPMA 4Y10E 3KIDU 3E3TA 3ATIA 1S83A 1WQSA 2F9UA 2FX4A 1Z8RA 3RXTA 3CP7A 1DITH 2AFQB 3AAUA 4WJG2 3BEUA 3PO1C 2QCYA 1O0DH 1ELDE 3SBKA 1BJVA 3EGKH 2FYRA 1O5FH 1SFQB 1ZOMA 3A86A 1FY5A 1LQDB 4X8VH 4MTBA 1JMOH 2TPIZ 3A85A 4Q2KA 2HNTF 4JZDH 2BD5A 3P95A 1N6XA 1EASA 2QAAA 1K22H 4LXBH 1EJNA 4KKDA 3U98H 2BHGA 1QCPA 2ZGCA 1D3QB 1V3XA 2GV6A 1C2MA 1C1VH 1TBZH 1S5SA 2AERH 1KIGH 3QGJA 4UD9H 2I6SA 3ZVAA 3S9BA 4CREA 1N8OC 3TGKE 1GMDF 4A7IB 3HK6B 4ABDA 2Q6FA 5E0GA 4YOGA 4ABJA 1SGEE 3PB1E 3S9CA 4D76A 1NRNH 1UMAH 1GJDB 1O3PB 3PTBA 4DT7B 2FOAA 1KY9A 1MCTA 2Z9JA 3LPRA 4Y7AA 4B76A 1CT0E 4Y8ZA 4JYVH 5ETXA 2AH4X 2SGEE 4MNYA 3SZNA 2BMGB 1XVMA 1TGSZ 4X2WA 1MTUA 2VVVA 1TNHA 4JZEH 1ARCA 4RSPA 4HTCH 3M5NA 2BLOA 3A7YA 1L1JA 2BYAX 4OS2A 3ZVFA 3VXEH 2HOBA 2C93B 1NESE 1OX1A 1XKBC 1GBTA 4Y11E 3MNSA 1GCDA 5C1UA 4I33A 1C5ZB 3U1JB 4IGDA 4BAHB 1JRSA 1GWAA 1TNGA 2K1QA 1TNKA 1QA0A 2P3FH 1GPZA 1BB0B 1EPTC 2CV3A 1AN1E 2GV7A 4NIYA 1QBVH 4FUDA 3RXFA 3SUGA 3V13A 1Q31A 2AGIX 4Q80A 1F5KU 1NROH 1T7CA 5EG4A 1IQHA 3SUFA 4Q7YA 2G4TA 1FIWA 3EE0B 1DY8A 1ZHPA 5H4IB 4GAWA 4HFPB 1HAIH 1TGBA 1MD8A 3PMBB 5IDKA 1NZQH 1J17T 2UWOA 3RMLH 1KXCA 1C5SA 5C20A 1ANCA 3ZVCA 1EXFA 1GMHG 3KQBA 1QFKH 1C9TA 3LU9B 4NGAH 1TX6A 4RKOB 3T28A 4X1QU 1C1SA 1JBUH 2WUCA 1B7XB 5A0BA 4GVUA 1B0FA 1O2LA 1MAYA 3AAVA 4NIVA 3TK9A 1SLUB 1LPZB 4H42U 1W3CA 1FPCH 2BQ7B 2ZCHP 1MTNC 4TPIZ 4E05H 1GI9B 3TK5A 1ELTA 2Y82A 3SNCA 2UUKB 2BDHA 5L30H 2W5EA 4OS7A 1GI4A 3SO3A 2G81E 1Z8GA 3UQVA 1J9CH 4Z0KA 1C2GA 2WPKS 1QHRB 2Y5HA 1QTFA 1FIZA 2CHAC 1FNIA 3LGUA 1KXDA 5FPTA 1EB1H