1J8AA

Crystal structure of benzamidine inhibited bovine pancreatic trypsin at 105k to 1.21a resolution from laboratory source with high number of waters modelled
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN, CATIONIC
publication title Trypsin as a model for high resolution X-ray diffraction in proteins.
pubmed rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA02
1K1JA 3D23A 5F8XA 2WPJS 4Y8XA 5DP9A 3LJJA 3EDXB 1GBFA 2GP9B 2G5VA 1MU6B 1PPGE 5EU8A 1C4U2 1ELTA 2QGRA 1AHTH 1GWAA 1ESTA 1GHBG 3UOPA 2FOCA 3LU9B 2GCTC 1C1OA 4WVPE 2QYIA 2BY6X 5FX5A 5CHAB 1L1JA 3TNTA 3VB4A 3F9FA 4D76A 1V2NT 4AX9H 1XVMA 2D8WA 3GOVB 1G2LA 1N8OB 1UCYK 4Y76A 5DGJA 1MAXA 4LXBH 1GBLA 1NRSH 3VXFH 2M5TA 1OS8A 4A6LA 1EPTA 4IN2A 4WF8A 1SB1H 1ESBA 1SR5C 2A4OA 2HPPH 3QGJA 1P06A 1O5FH 1DLEA 2SGFE 3S69A 4U30A 2FPZA 1IQIA 4R8TB 1GL1A 4OGXA 1ZR0A 5LGOA 1KLTA 1F0SA 1O2WA 2FOBA 1GVZA 4FUJA 4MVNA 1TPSA 3RM2H 1J17T 4INLA 3ZVBA 1LVYA 1E36B 1LTOA 3MNCA 3STIA 1HLTH 1NN6A 3SQHE 3ZZ6A 2VB0A 1O2UA 3VGCC 4YOGA 1BTPA 3A88A 4MPVA 1DS2E 1IQLA 2QY0B 3AAUA 3ZZ7A 3NPSA 3RXLA 2A4QA 1C5LH 4Q2KA 1FAKH 3PV4A 1YPHC 1VITG 4X8VH 2D26C 2QAAA 2ZECA 3ZZ3A 2HNTF 4Z6AH 1GBEA 1MD8A 2GDDA 3KL6A 4UFFH 1AVXA 3M7QA 4ABDA 2QC2A 4ZKSU 3L33A 2BY8X 3LOXA 5LPEA 1VJAU 3O8CA 3URCA 1TNHA 1SLXB 3RXDA 4FUGA 3HGPA 5EPNA 4GAWA 1TGCA 1O3AA 1SQAA 2W3KA 3PB1E 2PR3A 1LVOA 1ETSH 5B6OA 3ITIA 3E1XB 1C1VH 1CGIE 2Z9KA 4TWWA 4F49A 1SOTA 3AW1A 1L1GA 4A1VA 4AFSA 2BZ6H 1QCPA 4NZLA 1A0JA 2BQ7B 1HGTH 1ZPBA 1GHXH 5K0HA 2C3SA 3SU6A 3PLBA 2GD4B 1KTSB 4DT7B 1P2JA 1GCTC 1NRNH 4X6NA 1GI8B 1KY9A 1P12E 3IWMA 1YCPM 2BLOA 1PYTD 5L2ZH 2XWBI 1HFDA 3T29A 1UVTH 3ZVAA 5EODA 4K5ZA 1AFQB 2CJIA 4Y11E 4I31A 2ZDMA 3GDUA 1QURH 1XVOA 2O8TA 4FUHA 3HKIB 1O3JA 2R2WU 3ZZDA 2FS8A 2EI8A 5FX6A 1NU7B 2VIOA 5PTPA 3BTGE 3RM0H 4B74A 2QV1A 3RXAA 4WMFA 2BX3A 2B8OH 2B7DH 4AYVB 1TNJA 3OY5U 3B23B 4QT8C 4X8SH 4CREA 2HWLB 1PPCE 3T25A 2FMJA 1NFWA 2ZCLP 4SGBE 5EXLA 4X6OA 2D2DA 2CN0H 2QF3A 3DHKH 5EW2H 2QN5T 1NT1A 1SFIA 5HM2A 1TRYA 1UTJA 2PKSC 4NIWA 2PTCE 3ZZ8A 1AVGH 1GVKB 1EQ9A 1LQDB 1EZUC 1TGSZ 3ZV8A 3ZVDA 2XW9A 4VGCC 1LPGB 4A1XA 2TGTA 2A2QH 4DG4A 1CA0C 2FESH 1F92A 3VB5A 2FX6A 1UVOA 1EZQA 3SNCA 4Q7XA 3P8NA 3UQVA 3OX7U 2P3UB 2ZPSA 1C5SA 3PMHB 4E06H 4NIVA 2UUJB 3F9EA 3W94A 1FY3A 2ZDKA 5FPTA 3U8OH 2GMTC 1T4VH 3QZQA 1VITH 3A7ZA 1XUHA 1YPKH 1ZZZA 3TGIE 1SMFE 2R3UA 1ETTH 1QFKH 1GBKA 1WCZA 2Q6GA 1PPEE 4KTCA 4AFUA 3BEIB 2A7HA 2A4RA 3BTTE 1QQ4A 1W3CA 2F9PA 1EP6A 2DE9A 2F3CE 4Q80A 4KKDA 1GG6B 4FUIA 3SU5A 4DY7B 1O33A 1ID5H 3GCOA 5ETXA 3SQEE 2XBYA 1C4Y2 2XBXA 1NO9H 3GCTF 1B5GH 1G36A 1C5OH 1DANH 4IS5A 1LVMA 2CHAB 3ELAH 5DP4A 2RA0A 4UFDH 1C2JA 4MNVA 1G3BA 4SGAE 1S0RA 1YPHE 1HNEE 1KYNA 4E7RG 3SNBA 3H7OA 3TH2H 2ODPA 1GI4A 4K3JA 2FYQA 1LPKB 5EPYA 1ZJDA 4WH6A 3ZYEA 1DWEH 1L2EA 1VZQH 1C5XB 3M5LA 2YNBA 1P2MA 1SGEE 2ZGHA 2PFEA 4JMYA 2H9HA 1U6QA 1O3PB 1FN8A 3RXGA 4B2CA 2UWOA 1BRBE 1FIZA 2VGCB 1TBRH 1LKAA 1H8DH 1MKXK 4YT7H 4IMZA 1MTWA 3E0NB 1E38B 1W7XH 1P9SA 2OBOA 1VITF 1IQHA 3BG4B 4JZFH 5BRRE 1E0FD 3BTFE 1WQSA 2QA9E 4XBDA 1JWTA 3P8FA 1ELVA 1GDQA 3P17H 1V2TT 2P8OC 3LGYA 2A1DB 3NWUA 3F9HA 3TNSA 4ISLA 3ZVFA 1BMAA 4RSPA 2GCTB 4ZKOU 4B1TA 1LDTT 1V2UT 4CBNA 4LZ4B 1W2KH 2EC9H 1T8LA 2GKVE 2HRVA 3BTHE 4GCHF 1AUJA 3SJIA 1S0QA 2ZPRA 1TOMH 1ZRBA 1TIOA 1UO6A 1C9PA 2BZAA 4Z0KA 3MH4A 1Z8GA 3PTBA 5IYTA 3TH3H 4F4OC 2ZA5A 3UWIA 2K1QA 2SGPE 4LOYH 4O03A 3QTVH 2BD5A 4Y7BA 3M35A 3ZYDA 1SGNE 4KGAA 3SGBE 5JBTA 3OY6U 1SL3A 3QO6A 3E3TA 4Q7ZA 4K8BA 3RMLH 3ZZ5A 1O3HA 2NU3E 1O2YA 4MNWA 2XCNA 4K2YA 1CT0E 1O3KA 1JXPA 4MNXA 1P3CA 4H42U 3RXIA 4AZ2B 3GYMA 3RXUA 1WTHD 1YPEH 2O8LA 2P95A 1ZSLA 4NA8A 1AVWA 4Y71A 4H4FA 1OWEA 1MTNC 1D3DB 1MTUA 2FLBH 3LPRA 2OINA 1SGCA 4LK4A 1O2NA 3S9CA 1C5VA 3VGCB 5GDSH 2PHBA 1O2PA 1C1UH 4DGJA 3RUOA 4OS6A 3QDZB 1C5NH 3FP7E 1V6DA 4RKJB 1UVUH 2GX4A 2ZDAH 3SNEA 5HYOA 3ZZAA 3MO3A 3PLKA 2VVUA 5L2YH 1P3EA 3MHWU 3Q3YA 2OCVB 2W26A 1L4ZA 4IW4E 3ZVGA 1SGPE 2ZKSA 5EOKA 4GSOA 1O5CB 1O5BB 5L30H 1CQQA 1K1OA 4MDSA 3ATIA 3FVFB 1RD3B 1P57B 1NFXA 2H2ZA 4ABEA 2W7SA 1EOLA 2FP7B 1BTHH 3U1JB 1EB2A 1O3BA 4RKOB 4D9RA 2PSYA 1S82A 1GDNA 5GPIB 4CH8B 1DX5M 2O8UA 3GY3A 1OKXA 1GBDA 2FIRH 5DK1A 2HNTE 1EJNA 5I46H 1IOEA 1DSUA 4JCNA 1ZHPA 1S85A 1GCTB 6GCHF 4WMEA 1RXPA 3BV9B 2R2MB 1AQ7A 4MQAA 4Y8ZA 1VGCC 4DOQA 3A7VA 1F2SE 1C1PA 1TA2A 2CGAA 5I25A 1P2OA 2BOKA 1HAHH 4B2AA 1C5QA 1GJ9B 1QJ7B 5J4SA 1YGCH 1BA8B 1O5DH 1XXDA 1DXWA 3MI4A 1GHAF 5DO4H 2BXUH 1C5TA 1LPZB 3A81A 2VINA 3UUZA 4FVBA 2ZIQH 3RLWH 1B7XB 1FY8E 4RN6A 3KGPA 3T62A 1RS0A 1O2GH 2CXVA 1O3IA 1DY9A 4WY3A 2ALPA 5TCAA 3PWCA 5DP3A 1ELCA 1OX1A 1GJBB 3ATLA 1TMUH 3RU4D 3R0FA 1O2XA 1Z1JA 1SOZA 2ZTZA 3P92A 2ZFFH 4HFPB 1LQEA 3U9AH 2OQUA 4NFEA 5A0CA 2AGIX 3BN9A 3SW2B 2AMQA 2PKSB 2TRMA 2ANKH 2ZTXA 1MAYA 2ZFRH 2VJ1A 1DWBH 1Q31A 4O9VA 4VGCB 1CA0B 1IQNA 1QRZA 2FOHA 2PGQB 1O3FA 3GCHC 1ZPZA 3Q3XA 1BHXF 3EGKH 3MYWA 1EX3A 2ZDLA 1AUTC 3F68H 2BD2A 2BLVA 4HZHA 3VB6A 1TQ0B 1ANDA 2GMTB 2ZG0H 2PW8H 1LMWB 4KP0A 3SV7A 1OPHB 1EAWA 2PTNA 2NU2E 1FIWA 1K21H 5E0HA 1TMBH 1QA0A 4JYVH 3Q76A 1VCPA 2Q1JA 3NK8A 1ANCA 2OP9A 4MTBA 2A45B 1GJ6A 4YZUA 1C5MD 4OGYA 1UTNA 3UTUH 6CHAC 3RXJA 4MPXA 1S81A 3MNBA 3K65B 3TK6A 3UR6A 3UQOA 3Q77A 1FAXA 1W14U 1C1MA 1S84A 2G81E 2Y5HA 2ANYA 4GHTA 3SNAA 3TITA 3BTDE 2WINI 2J95A 1SLWB 1TWXB 3E6PH 1G2MA 4B2BA 3BIUH 4GHQA 3NCLA 1SHYA 1INCA 1QR3E 2JH5D 1OOKB 2G4UA 3A80A 3SNDA 3GCNA 2XC0A 1O34A 2PLXA 2SGAA 1SGFG 3HGNA 1THSH 3KCGH 1EJMA 1O2LA 1WUNH 1F0RA 2QXGA 5GXPA 2AIPA 1C2GA 1F7ZA 2F9UA 2BDIA 2OXSA 2SGQE 3SJKA 3V3MA 1N6XA 4DJZB 4E05H 5HXFA 5ESTE 2ZO3H 2BY7X 1AU8A 1H9IE 4U2WA 4YOJA 2Y7ZA 5A8ZA 2BMGB 1UTKA 4AOQA 4AFZA 3SHCH 3M37A 4DW2U 2BM2A 2UWLA 3L3TA 1Z8IB 1H8IH 4X0WU 1NS3A 1JRSA 1GGDC 1S6HA 2BQ6B 2JETC 1K1LA 4YOIA 2RDLA 3SUDA 1WV7H 1GVLA 4H6SB 3AW0A 2P8OB 4ISIH 2UWPA 1YLCA 4MPUA 1QB9A 1A5IA 2JKHA 2A2XH 4HTCH 1CHGA 1C1TA 2ILNA 1TX6A 3PWBA 2OC7A 3GCTG 1TFXA 1EUFA 1ZLRA 1XX9A 3UOUA 1DUEA 2VIVA 2FLRH 2FOEA 2G8TA 1TNIA 1AFEH 1WOFA 4FUFA 3SN8A 3TIUA 1GI9B 1UVSH 3HPTB 5TCCA 1DITH 5LPRA 1KXFA 3CS0A 5LH8A 3QZRA 3UNQA 3DD2H 3B8JA 4R0IA 2WPIS 2A5AA 4BXSA 2HVXA 3U8RH 1GI3A 1BRCE 2R0KA 4KTSA 2ODQA 1BRUP 1P03A 4XBBA 1HAGE 1HJ9A 4XDEA 3TPIZ 1J14A 1QGFA 2C8YB 3SGQE 3ZZ9A 1V2KT 1MTNB 1YLDA 1BTWA 1TPOA 2Z9LA 4TY6A 1GMDG 1P10A 2ZU5A 4JZEH 4I8LA 4Y6DA 1SC8U 3T28A 4X2VA 3TLOA 1LO6A 1O38A 1GI7B 3P8OA 2ZDVH 2A5IA 1O3EA 4FVDA 5BPEA 1C5ZB 1EATA 1XUGA 2ZHQH 2QIQA 4OS5A 2BOHB 1C1SA 1RTLA 1KXEA 4GCHG 1FY4A 3GY7A 2BHGA 1J16A 2NU0E 7ESTE 1C5RA 1ZPCA 4YT6H 3BTME 3KF2A 1TOCB 2YOLA 5E2PA 1GBCA 3MH6A 3TJOA 3UIRA 1SQOA 1GI2A 2BYAX 2TPIZ 4UD9H 2Q6DA 1H1BA 3RXQA 2BD3A 1TB6H 4JZIA 1GBBA 3S0NA 1CSOE 1XUJA 1O2OA 3MNXA 1CVWH 4CRFA 2EEKA 3A85A 2THFB 1BRAA 1Z6EA 3DFLA 2G4TA 3O8BA 1HCGA 1YP9A 3U98H 4CR5A 3MU4A 1PPHE 1T7CA 1NZQH 1P04A 8GCHG 4Y7AA 2BXTH 3ODFA 4NWLA 2JH6D 1DFPA 2WYJA 2Y7XA 1MU8B 2A7JA 2ZGCA 3T27A 1AD8H 4AN7A 1TPAE 1ELEE 4UFGH 1D3QB 1TQ7B 1MQ6A 1QA7A 4FU8A 2BDAA 3SHAH 3QWCH 2VIDA 1AKSB 1ZMJA 1SGTA 3S7HB 1PYTC 5EQQA 1OWKA 4CH2B 3RXMA 3ENSB 2A32A 3Q00A 3TGKE 1T8NA 4CRAA 1GBTA 3RC5A 3MFJA 1QB1A 1VCWA 1LKBA 1O2KA 1A0HB 1KXAA 2Z3DA 3KQBA 1THPB 1V2OT 2VWLA 4NIYA 4WH8A 5T6GA 2BLWA 1FXYA 2AS9A 1TX8A 1O5GH 1AWFH 1WBGB 1QBNA 1VR1H 4DIHH 1NRPH 1J15A 2DUCA 1ZJKA 4CRDA 4CBOA 2FI5E 3SJ9A 2F91A 1UK2A 3LH3A 5JYIA 1L0ZA 1QTFA 3KQEA 3GY5A 3V13A 1O35A 2W5EA 3V12A 2ZCHP 2BY5X 4BTIB 3HATH 4BANB 3GCHB 3ZZBA 1HDTH 3EAJA 4B73A 7LPRA 1O5EH 3U8TH 6GCHG 2Z9GA 1CA8B 1SVPA 3MTYA 2J92A 2IJOB 1CBWC 3A87A 5E0GA 4GLYA 3KN2A 1V2PT 4XSKU 2SGDE 1D9IA 1XUFA 4D7GA 3K6ZA 2BD9A 1C2DA 1GJ7B 2XYAA 2H5CA 1YBWA 2DE8A 1MD7A 3SV8A 2AH4X 5A2MH 1GHAG 1HB0B 5FXLA 1A7SA 2G51A 2HNTC 5C5OA 1V2LT 1WYKA 3LGWA 2SFAA 2I6SA 6CHAB 1YCPH 4BOHA 5A0BA 1TBZH 1RFNA 1ARCA 1C2HA 2C4FH 3RMNH 4BAKB 2J38A 3IITA 4BTUB 4X2WA 1C4V2 3PMJA 3GY6A 3QK1A 2F9BH 2GCHF 4JYUH 5ABWA 1LHCH 1IQJA 1HIAA 1C5PA 4X1RU 4DVAU 1TPPA 3A8DA 2AGEX 3M5NA 4B76A 1A5GH 3FAOA 1PQAA 4U01A 1LVBA 1CU1A 1B0FA 3C1KA 1ELBA 3M5OA 1BBRH 1NROH 1UTOA 1VCQA 2AERH 2PUQH 1P05A 2OUAA 1EASA 2D1JA 1W13U 1D4PB 1BCUH 2KAIA 3VFEA 4AFQA 2B0FA 2C90B 1Y5UT 5T3HA 1C1WH 3VPKA 1NFYA 1WU1A 4Q7YA 1GMDF 2AEIH 1ORFA 2ZFTA 1YPMH 4HGCA 1ETRH 1SGIB 1OYQA 4FUBA 3SU0A 3GDVA 1G32B 3MH7A 3K9XB 4AG2A 1D6RA 2J34A 3CENA 2FODA 1MZDA 5T6DA 3EQ0H 1GGDB 3T26A 4E7NA 1EAXA 2FI3E 1OWDA 2JETB 2ZF0H 1T8OA 1UHBB 4ESTE 1C5YB 2ASUB 4MNYA 1TX7A 4IMQA 1Y3VA 2C93B 1AKSA 1RTFB 4I8KA 4NWKA 1UVPA 4UFEH 2EA3A 1UTLM 1TBQH 3H7TA 1LHEH 3LJOA 4ZHLU 3A7WA 5A09A 1TGNA 1KSNA 1GHVH 3SU1A 3SV2H 2ULLA 4CHAC 4M7GA 1MMJN 2J94A 3QLPH 2IPHA 2ZU1A 8LPRA 3TJNA 3LGVA 4YO9A 3SORA 1TNLA 1A5HA 1FY5A 5FBIA 2FTMA 8GCHF 1GHZA 4FUEA 3SO3A 4NSYA 2Y80A 5G4BA 2G00A 1BTUA 3SUEA 1BITA 1E34B 3HK3B 5AFZH 4B71A 1GJCB 3SU3A 1F5LA 2HOBA 4A92A 1CT2E 3MMGA 3PO1C 1Z1IA 2GT8A 2H9EH 3MU0A 2VVCA 1MQ5A 1V2WT 1KXCA 1HUTH 2STAE 1KXDA 7KMEH 1CT4E 4NFFA 1WTGH 4ABFA 1QJ6B 2GT7A 2VVVA 1X7AC 3GY4A 5IDKA 1OYTH 5JPMH 2BVXH 1DVAH 1O32A 1OWIA 3UWJH 1GJDB 1HJ8A 3RC6A 1Y3UA 1Y5AT 1AZ8A 1DUAA 2AFQB 1UJ1A 5DKMA 1DOJA 1FZZA 1G3DA 3IG6B 4X8TH 3RU4T 1ZMLA 2O8WA 2Y6TA 3UREA 1Y5BT 4OS7A 1MBMA 5C1XA 1GHWH 5CMXH 4THNH 4D9QA 3A8BA 5AHGH 5C67A 3URDA 4A1TA 1K1NA 1QNJA 4NA9H 2PKAB 4ASHA 2BTCE 2FZZA 2ZFPH 1WQVH 2PSXA 2W3IA 5JBBS 2P16A 1XUIA 2GVFA 4X1NU 2WPHS 2C8XB 1PJPA 1GMCG 2AIQA 1P9UA 1RRKA 2EI6A 3VB7A 1Z71A 2Y82A 5C1UA 1KXBA 1W12U 1E37B 1YPLH 5EQRA 5T6FA 4I32A 1ANBA 1T31A 1JIMA 5A8YA 3EYDA 1MBQA 4Y0ZE 2PV9B 3L6PA 1SQTA 1HAYB 1FNIA 3RXPA 3A7YA 1NFUA 3QTOH 5AF9H 1ZTKA 5GIBA 1SPJA 3AAVA 4K60A 1Z7KA 2VWOA 4H6TA 1Q2WA 5C3NA 1EAUA 4WMDA 3S9AA 2FX4A 2GZ7A 1AGJA 1T8MA 2F9OA 1NU9A 3I29A 1TAWA 1UHBA 2R0LA 2P3FH 2NU1E 1HXFH 5F03A 1UTMA 1GBIA 1TYNA 1YYY1 1XXFA 1A3BH 2SNWA 1QBVH 3F9GA 1QQUA 4NGAH 3LC3A 1MTSA 3PM3A 2UUFB 4AGJA 2J9NA 3KQDA 2FI4E 2ZGBH 1SGYE 1O3DA 1O3MA 1DLKB 1CGHA 5F8ZA 5FPYA 3DT0H 4IC5A 4A5TS 1KLJH 4NIXA 5A8XA 4NA7A 3E90B 1ELAA 1XUKA 3GISB 3RXEA 4IC6A 1SGQE 3SZNA 3OU0A 1HJAC 1CBWB 3LT3A 1Q3XA 2Y5FA 3OYPA 4JK5A 3BF6H 1QHRB 3T5FH 4YTAA 1CHOF 1BTXA 3STJA 2FO9A 2AYWA 3CP7A 5C5NA 2RCEA 1QL9A 5EGMA 2NWNA 1HAVA 2ZI2H 1IQFA 1FPHH 3KHVA 1IHSH 1UK4A 3KIDU 4AB8A 1HYLA 1GBAA 3PYHA 1HAXB 1TRMA 4K1SA 1W10U 3T2NA 1Z6JH 1QL7A 1TMTH 3SV9A 1K1MA 3RXHA 1GHYH 4O3TA 2FYRA 4BNRA 1GMHG 4U32A 1C9TA 1S6FA 4BAMB 2J2UA 4X2YA 1O2QA 1NRQH 1ZRKA 4INHA 3SUFA 2CHAC 1YKTA 1UK3A 1ZMNA 1O2SA 1EP5A 2BDBA 2A0QB 1BDAA 1HRTH 2HPQH 3LIWA 2ZQ1A 2WPMS 1V2QT 2ZPQA 1BTYA 3BG8A 3KQCA 3EA9A 4JYTA 3EA7A 2PKAA 2SGEE 2CF8H 2WPKS 2FOFA 2Y5GA 3RXVA 5DP8A 5HGGA 3M3TA 2A5KA 1BJUA 3LDXH 3NUMA 2AGGX 3SJOA 3MH5A 1C1RA 1BOQA 1C2EA 4IGDA 1B0EA 4ZHMU 2QXHA 4AG1A 4MG3A 3AASA 3TU7H 1W0ZU 3BG4C 1ZHMA 2Z6BD 5FPSA 2QCYA 4BAQB 6ESTA 1A46H 2XCFA 4A7IB 1A61H 4BTTB 2RG3A 1IQKA 5EG4A 3TH4H 1GJ8B 1L4DA 1RTKA 2OC1A 2GCHG 3LGUA 1OWHA 5HMAA 3RXCA 3SBKA 2TIOA 2FM2A 1K1PA 5F8TA 1T32A 4CHAB 3EA8A 3LGTA 2XNIA 1BJVA 2ZQ2A 1GJ5H 1K28D 3VXEH 2VWNA 1K9OE 3M61U 1NY22 1K22H 1HAIH 3SGAE 4X1QU 4ZKNU 1MKWH 1BZXE 1IQMA 3ATKA 3QN7A 1GMCF 2ANWA 2GZ8A 3A84A 1UTPA 1QL8A 2ALVA 1WAYB 1FQ3A 1S5SA 1G3EA 5LPFA 1G30B 1XKBC 4I8JA 1ZSKA 1TGTA 5GCHF 1F5RA 5JB8S 1Y3XA 4X6MA 4AGKA 3P6ZB 4LZ1H 3I78A 1SG8B 4X2XA 1FJSA 5FBEA 3PO1B 2ZHFH 1O3CA 3RU4E 4TY7A 1EOJA 1QBOA 2J4IA 1TNGA 1THRH 3TJUA 1MH0A 1ELFA 1P09A 2UUYA 3BEUA 3MU8A 1SLUB 1G37A 1HIAB 1MUEB 4ZH8A 4TWYA 1MKXH 1QRWA 4ZHAA 3KEEA 2V3OH 4XBCA 3SI3H 1O2TA 3UNRA 1BBRE 1O3NA 3UNSA 1AN1E 1C2KA 1H4WA 1G3CA 2G52A 3A83A 1Z8JB 1D6WA 3D62A 1W0YH 1BB0B 3VB3A 1FY1A 2IOTA 1IQEA 5ESBA 1AE5A 3PMAB 2KAIB 1YF4A 3FANA 1YM0A 2F9VA 1L1NA 2O9QA 7GCHG 1H9HE 1C5WB 3M5MA 9ESTA 1LHFH 4DURA 1QJ1B 2ZWLH 3ODDA 1HV7A 2ZFQH 2LNCA 2Z3EA 3ATWA 4TPYA 1SGRE 1NC6A 2VU8E 2ZNKH 5DPAA 1ZGIA 1GJAB 1O2HA 5CE1A 1TE0A 1ZOMA 3PLPA 5AFYH 4Y0YE 1BQYA 1VGCB 1J9CH 3AVZA 3SJ8A 5J4QA 2PUXB 4Y79A 1A0LA 2VH0A 5EW1H 1CO7E 1OXGA 3RLYH 3A8AA 4XE4A 1GI1A 5FAHA 2ZU2A 1C2FA 1JRTA 4K8YA 1MTVA 1MCTA 2WUCA 2XC5A 4WWYA 1YPJH 1JBUH 2BDCA 3G01A 5AVDA 2CV3A 1VJ9U 4UEHH 2Q6FA 2ZTYA 1LHGH 2P93A 4WXIA 1P2KA 1EPTC 1MZAA 1BMMH 1P0SH 3MWIU 1O36A 1BUIA 1EB1H 2H5DA 3RXKA 2XRCA 1AMHA 3FP6E 3TK9A 1GMHF 1EZSC 4IBLH 3UFAA 1HAOH 1ESAA 2BDGA 1F0UA 1P2QA 2QXJA 3RDZA 4X8UH 2H6MA 1BMLA 1EJAA 1G9IE 4CR9A 3U1IB 4Y10E 2BDYA 2FDAA 1KLIH 1EKBB 4D7FA 1S83A 4CRCA 3FP8E 3QX5H 1O3LA 1AO5A 4ZAEA 1OP2A 2VH6A 1O2MA 1F0TA 2VWMA 3QUMP 2XBVA 2V35A 2R9PA 3GICB 1A2CH 1HAZB 2BY9X 4K69A 1O2ZA 3ZV9A 1SGFA 1J8AA 1P02A 2XBWA 2P94A 1HJAB 2WV5A 3LC5A 5A0AE 2WPLS 1UMAH 4AYYB 1RIWC 1DT2A 2ZDNA 1AB9C 1SGDE 1C2LA 2UUKB 1TALA 1GI6A 4ABJA 3TJVA 2Z94A 3A7XA 1ELDE 1V2MT 4UE7H 1BT7A 1UCYE 3VEQB 4ABBA 4YLQH 2AMDA 1K2I1 1GHBF 2OTVA 2JH0D 4ZUHA 2C8WB 2XC4A 3GY8A 3E16B 2PWXA 2ZZUH 3MOCA 4KELA 1UTQA 2ZGJA 4ABIA 1PQ7A 3SOSA 3ZZCA 5C2ZA 2G5NA 4AB9A 2ESTE 2G55A 2OC0A 4YM9A 1Y3YA 2HGTH 4ISOA 5E8EH 1TA6A 1PPBH 1C1NA 2Y81A 4ZMAH 1GJ4H 1MKWK 2PGBB 3FFGA 4FUDA 1NPMA 1NESE 2XWAA 3SV6A 1PQ5A 3UPEA 1GI0A 1LHDH 3ZVEA 4ISHH 4K1TA 1C5UA 1D3PB 4JZ1A 1EXFA 3MU1A 4JZDH 1FMGA 1O30A 3MU5A 2GGVB 4CRBA 3U69H 1BIOA 2I6QA 2ZEBA 1BTZA 2VIPA 3ZZ4A 2TGPZ 3BIVH 5DG6A 1ZHRA 1SFQB 3M7TA 5JBCS 2WUBA 3ESTA 1V3XA 1DXPA 1GBJA 1CHOG 1ABIH 4B75A 3FZDA 3RC4A 4CRGA 3A7TA 4ABHA 5DP6A 2P3TB 1TABE 3SU2A 3BTQE 8ESTE 1O2VA 1DWDH 1DPOA 3A8CA 3DA9B 2TGAA 5DJ7A 1N1LA 1YPGH 1V2RT 3NXPA 4ZROA 3D49H 5CHAC 3RXRA 3RXSA 1GPZA 1TRNA 1ARBA 1ZTLA 3HKJB 1O2RA 2FS9A 5EXNA 4PROA 4ZXXH 1N8OC 4GVUA 7GCHF 4D8NA 1PPFE 4O3UA 1EZXC 3P8GA 1DWCH 2V0BA 1Y3WA 2H1UA 1O31A 4FUCA 2B9LA 2W7UA 1PQ8A 1O39A 2OBQA 3MO6A 1NM6A 3ATMA 2GV6A 9LPRA 3MO9A 1BHXB 2BX4A 4INKA 1HAVB 2OQ5A 5FCRA 1BMNH 1Y59T 4I33A 3S9BA 1WSSH 1EAIA 4J1YA 4O97A 2FWWA 2XXLA 3EE0B 3SUGA 5FHTA 2FXRA 1C1QA 3F1SB 1KDQB 1HAPH 1MCVA 5FCKA 5SGAE 1DICA 1ABJH 3PTNA 4NZQA 4ABGA 2BVSH 3UY9A 1O5AB 4J2YB 1IAUA 3O8RA 4OS1A 1V2JT 4NSVA 5K7RA 3LGIA 3V0XA 1YC0A 4IN1A 1IHTH 3ZVCA 2CMYA 2Z9IA 3H5CB 3M7UA 4GPGA 1XKAC 2FOAA 4DIIH 1AY6H 2A4GA 2ZU4A 3Q3KA 2F9NA 1GI5A 3BSQA 1O3OA 4X1PU 1NTPA 5JB9S 2A31A 3M3SA 3OSYA 2BVRH 2BD8A 3CS7A 2Z9JA 4MPWA 3PROA 1CE5A 1AI8H 1PFXC 1UCYH 3M36A 3P95A 2A7CA 1HBTH 1KTTB 3E0PB 4XOJA 4ZKRU 1H9LB 2O8MA 2NU4E 1FI8A 3NKKA 1AWHB 3E91A 4KTUA 3TK5A 4X6PA 1ANEA 1KIGH 1AE8H 4XFQA 5E0JA 2ZGXH 3SI4H 1AIXH 2ZP0H 3S7KB 2H9TH 1FUJA 4YLUA 4UONA 3RMMH 3DFJA 5EQSA 2HLCA 2LPRA 3NZIA 5GCHG 1QB6A 4DCDA 1SBWA 1XM1A 2TBSA 1AFQC 1HPGA 3D65E 1SSXA 4OS2A 4ABAA 1OP0A 3E8LA 2ZHDA 1ZYOA 4I8GA 1O2JA 2FOGA 3LONA 3MNSA 3LKWA 3KNXA 1V2ST 5HM9A 3A82A 1DE7H 3W95A 2B5TB 3BTWE 1YCPK 1FV9A 4I7YH 1W8BH 3GYLB 2YNAA 3PMBB 1LCYA 1EPTB 1OP8A 1ZTJA 3O8DA 2GTBA 3RXOA 4I8HA 6LPRA 2P59A 3FZZA 1FONA 3SU4A 1O37A 1GDUA 2CF9H 1M9UA 3K6YA 1PPZA 3BTKE 2AMPA 1GBMA 2ZU3A 2R3YA 4FU7A 2RA3A 2V6NA 1FLEE 1C2MA 2GV7A 1BBRK 1OWJA 1SI5H 4HI3A 4JK6A 4NCYA 2FTLE 4NG9H 1N6YA 2QF0A 3BTEE 3QGNB 2IN2A 4FU9A 4AORA 1GL0E 1ZSJA 1T4UH 4ZXYH 5TJXA 1DY8A 3F6UH 2HALA 2STBE 4UDWH 4WXVA 1IQGA 1JOUB 2C8ZB 5GJ4B 2EI7A 3JZ1B 1O3GA 2QXIA 5L6NH 3C27B 4BXWA 1GBHA 5GWZA 1FPCH 1JIRA 2GZ9A 3GY2A 1Z8RA 1E35B 4OS4A 3TVJB 2F83A 3TGJE 1CGJE 4TPIZ 3B9FH 4Y8YA 1SHHB 2ZCKP 4GUXA 1AZZA 1P11E 3WY8A 1D3TB 2ZFSA 1TGBA 3N7OA 5JDUB 4K1EA 2XTTB 1RIWB 4MLFB 1ZGVA 5EXMA 1A1RA 1C2IA 1XMNB 2FEQH 1P01A 1AB9B 1ACBE 1TLDA 4BAOB 1ELGA 2VIQA 2ZHEH 3P70B 1DDJA 1QRXA 3HK6B 3RXFA 2V3HH 3DUXH 1KDQA 4X1SU 1GG6C 1FDPA 1F5KU 2ANMH 2SNVA 2VNTA 1TONA 2VIWA 5E2OA 1QY6A 2OD3B 3A89A 5F6MA 2BD7A 1RJXB 3JZ2B 5DP7A 2BD4A 1W11U 3UR9A 1FN6A 1JMOH 2BB4A 4FXGH 5C1YA 1RGQA 3GDSA 1W7GH 3K2UA 5JBAS 1GCDA 4ISNA 2ZHWH 2ODYB 1QIXB 2TGDA 2WYGA 1O0DH 2ZC9H 3RXTA 5C20A 3I77A 1O2IA 1DSTA 1P2NA 2BDHA 2OLGA 2OC8A 3M3VA 3LH1A 2Z3CA 4TYDA 8KME2 1P2IA 2WV4A 4YESB 4BAHB 1TNKA 1HXEH 1Y8TA 1V2VT 5H4IB 2BLQA 1A4WH 5DP5A 1A3EH 2BQWB 1DM4B 1NRRH 3V7TA 3BEFB 1P8VC 3OTJE 2Z7FE 3RXBA 3R3GB 4WJG2 1K1IA 1OSSA 1SLVB 2FOMB 3RP2A 2VGCC 3RMOH 2GDEH 3A86A
chains in the Genus database with same CATH superfamily
5C0UA 1K1JA 3D23A 5F8XA 2WPJS 4Y8XA 5DP9A 3LJJA 3EDXB 1GBFA 2GP9B 2G5VA 1MU6B 1PPGE 5EU8A 1C4U2 1ELTA 2QGRA 1AHTH 1GWAA 1ESTA 1GHBG 3UOPA 2FOCA 3LU9B 2GCTC 1C1OA 4WVPE 2QYIA 2BY6X 5FX5A 5CHAB 1L1JA 3TNTA 3VB4A 3F9FA 4D76A 5KECA 1V2NT 4AX9H 1XVMA 2D8WA 3GOVB 1G2LA 1N8OB 1UCYK 4Y76A 2PP6A 5DGJA 1MAXA 4LXBH 1GBLA 1NRSH 3VXFH 2M5TA 1OS8A 4A6LA 1EPTA 2JIZD 4IN2A 4WF8A 1SB1H 1ESBA 1SR5C 2A4OA 4P00A 2HPPH 3QGJA 1P06A 1O5FH 1DLEA 2SGFE 3S69A 4U30A 2FPZA 1IQIA 4R8TB 5F53A 1GL1A 4OGXA 1ZR0A 5LGOA 2F4LA 1KLTA 1F0SA 1O2WA 2FOBA 1GVZA 4FUJA 4MVNA 1TPSA 2YMSD 3RM2H 1J17T 3FN8A 4INLA 3ZVBA 1LVYA 1E36B 1LTOA 3MNCA 3STIA 1HLTH 1NN6A 3SQHE 3ZZ6A 2VB0A 1O2UA 3VGCC 4YOGA 1BTPA 3A88A 4MPVA 1DS2E 1NBME 1IQLA 2QY0B 3AAUA 3ZZ7A 2W6JD 2JJ1D 3NPSA 3RXLA 2A4QA 1C5LH 3DSPA 4Q2KA 1FAKH 3PV4A 1YPHC 1VITG 4X8VH 2D26C 2J97A 2QAAA 3H09A 2ZECA 3ZZ3A 2HNTF 4Z6AH 1GBEA 1MD8A 2GDDA 3KL6A 4UFFH 1AVXA 3M7QA 2J98A 4ABDA 2QC2A 4ZKSU 3L33A 2BY8X 3LOXA 5LPEA 1VJAU 3O8CA 3URCA 1TNHA 1SLXB 3RXDA 4FUGA 3HGPA 5EPNA 4GAWA 5C94A 1TGCA 1WXRA 1O3AA 1SQAA 2W3KA 3PB1E 2PR3A 3FOAA 1LVOA 1ETSH 5B6OA 3ITIA 3E1XB 1C1VH 1CGIE 2Z9KA 4TWWA 4F49A 1SOTA 3AW1A 1L1GA 4A1VA 4AFSA 2BZ6H 1QCPA 4NZLA 1A0JA 2BQ7B 1HGTH 1ZPBA 1GHXH 5K0HA 2C3SA 3SU6A 3PLBA 2GD4B 1KTSB 4DT7B 1P2JA 1GCTC 1NRNH 4X6NA 4RI0A 1GI8B 1KY9A 1P12E 3IWMA 1YCPM 2BLOA 1PYTD 5L2ZH 2XWBI 1HFDA 1QZ8A 3T29A 2KX4A 1UVTH 3ZVAA 5EODA 4K5ZA 1AFQB 2CJIA 3DCLA 4Y11E 4I31A 2ZDMA 3GDUA 1QURH 1XVOA 2O8TA 4FUHA 3HKIB 1O3JA 2R2WU 3ZZDA 2FS8A 2EI8A 1VKYA 5FX6A 1NU7B 2VIOA 5PTPA 3BTGE 3RM0H 4B74A 2QV1A 3RXAA 4WMFA 2BX3A 2B8OH 2B7DH 4AYVB 1TNJA 3OY5U 3B23B 4QT8C 4X8SH 4CREA 2W6ID 2HWLB 1PPCE 3T25A 2FMJA 1NFWA 2ZCLP 4SGBE 5EXLA 4X6OA 2D2DA 2CN0H 2QF3A 3DHKH 5EW2H 2QN5T 1NT1A 1SFIA 5HM2A 1TRYA 1UTJA 2PKSC 4NIWA 2PTCE 3ZZ8A 1AVGH 1GVKB 1EQ9A 1LQDB 1EZUC 1TGSZ 3ZV8A 1E79D 3ZVDA 2XW9A 4VGCC 1LPGB 4A1XA 2TGTA 2A2QH 4DG4A 1CA0C 2FESH 1F92A 3VB5A 2FX6A 1UVOA 1EZQA 3SNCA 2QE7D 4Q7XA 3P8NA 3UQVA 3OX7U 2P3UB 2ZPSA 1C5SA 3PMHB 3F0OA 4NIVA 4E06H 2UUJB 3F9EA 3W94A 1FY3A 2ZDKA 5FPTA 3U8OH 2GMTC 1T4VH 3QZQA 1VITH 3F3BA 3A7ZA 1XUHA 1YPKH 1ZZZA 3TGIE 1SMFE 2R3UA 1ETTH 1QFKH 1GBKA 1WCZA 2Q6GA 1PPEE 4KTCA 4AFUA 3BEIB 2A7HA 2A4RA 3BTTE 1QQ4A 1W3CA 2F9PA 1EP6A 2DE9A 2F3CE 4Q80A 4KKDA 1GG6B 4FUIA 3SU5A 4DY7B 1O33A 1ID5H 3GCOA 5ETXA 3SQEE 2XBYA 1C4Y2 2XBXA 1NO9H 3GCTF 1B5GH 1G36A 1C5OH 1DANH 4IS5A 1LVMA 2CHAB 3ELAH 5DP4A 1EFRD 2KM0A 2RA0A 4UFDH 1C2JA 4MNVA 1G3BA 4SGAE 1S0RA 1YPHE 1HNEE 1KYNA 4E7RG 3SNBA 3H7OA 3TH2H 2ODPA 1GI4A 4K3JA 2FYQA 1LPKB 5EPYA 1ZJDA 1BMFD 4WH6A 3ZYEA 1DWEH 1L2EA 1VZQH 3NRLA 1C5XB 3M5LA 2YNBA 1P2MA 1SGEE 2ZGHA 2PFEA 5IK2D 4JMYA 2H9HA 1U6QA 1O3PB 1FN8A 3RXGA 4B2CA 2UWOA 1BRBE 1FIZA 2VGCB 1TBRH 2HLDD 1LKAA 1H8DH 1MKXK 4YT7H 4IMZA 1MTWA 3E0NB 1E38B 3WW7A 1W7XH 1P9SA 2OBOA 1VITF 1IQHA 3BG4B 4JZFH 5BRRE 1E0FD 3BTFE 1WQSA 2QA9E 4XBDA 1JWTA 3P8FA 1ELVA 1GDQA 3P17H 1V2TT 2P8OC 3LGYA 2A1DB 3NWUA 3F9HA 3TNSA 4ISLA 3ZVFA 1BMAA 4RSPA 2GCTB 4ZKOU 4B1TA 1LDTT 1V2UT 4CBNA 4LZ4B 1W2KH 2EC9H 1T8LA 2GKVE 2HRVA 3BTHE 4GCHF 1AUJA 3SJIA 1S0QA 2ZPRA 1TOMH 1ZRBA 1TIOA 1UO6A 1C9PA 2BZAA 3OEED 3MH4A 4Z0KA 1Z8GA 3PTBA 5IYTA 3TH3H 4F4OC 2ZA5A 3UWIA 2K1QA 2SGPE 4LOYH 4O03A 3QTVH 2BD5A 5EJZA 4Y7BA 3M35A 3ZYDA 1SGNE 4KGAA 3SGBE 5JBTA 2WSSD 1SL3A 3OY6U 3QO6A 3E3TA 4Q7ZA 4K8BA 3RMLH 3ZZ5A 1O3HA 2NU3E 1O2YA 4MNWA 2XCNA 4K2YA 1CT0E 1O3KA 1JXPA 4MNXA 1P3CA 4H42U 3RXIA 4AZ2B 3GYMA 3RXUA 1WTHD 1YPEH 2O8LA 2P95A 1ZSLA 4NA8A 2QF4A 1AVWA 4Y71A 3UB0A 4H4FA 3F0PA 1OWEA 1MTNC 1D3DB 1MTUA 2FLBH 3LPRA 2OINA 1SGCA 4LK4A 1O2NA 3S9CA 1C5VA 3VGCB 5GDSH 2PHBA 1O2PA 1C1UH 4DGJA 3RUOA 4OS6A 3QDZB 1C5NH 3FP7E 1V6DA 4RKJB 1UVUH 2GX4A 2ZDAH 3SNEA 2EQNA 5HYOA 3ZZAA 3MO3A 2KCAA 3PLKA 2VVUA 5L2YH 1P3EA 3MHWU 3Q3YA 2OCVB 2W26A 1L4ZA 4IW4E 3ZVGA 1SGPE 4Q63A 2ZKSA 5EOKA 4GSOA 1O5CB 1O5BB 5L30H 1CQQA 1K1OA 4MDSA 3ATIA 3FVFB 1RD3B 1P57B 1NFXA 2H2ZA 4ABEA 2W7SA 1EOLA 2FP7B 1BTHH 3U1JB 1EB2A 1O3BA 4RKOB 4D9RA 2PSYA 1S82A 1GDNA 5GPIB 4CH8B 3DSOA 1DX5M 2O8UA 3GY3A 3MQKC 1OKXA 1GBDA 1S6LA 2FIRH 5DK1A 2HNTE 1EJNA 5I46H 1IOEA 1DSUA 4JCNA 1ZHPA 1S85A 1GCTB 6GCHF 4WMEA 1RXPA 2L74A 2R2MB 1AQ7A 3BV9B 4MQAA 4Y8ZA 1K0HA 2WZQA 1VGCC 4DOQA 3A7VA 1F2SE 1C1PA 1TA2A 2CGAA 5I25A 1P2OA 2BOKA 1HAHH 2XOKD 4B2AA 1C5QA 4HG6A 1GJ9B 1QJ7B 5J4SA 1YGCH 1BA8B 1O5DH 1XXDA 1DXWA 3MI4A 1GHAF 5DO4H 2BXUH 1C5TA 1LPZB 3A81A 2VINA 3UUZA 4FVBA 2ZIQH 3RLWH 1B7XB 1FY8E 4RN6A 3KGPA 3T62A 1RS0A 1O2GH 2CXVA 5HKKD 1O3IA 1DY9A 4WY3A 2ALPA 5TCAA 3PWCA 3AK5A 5DP3A 1ELCA 1OX1A 1GJBB 3ATLA 1TMUH 3RU4D 3R0FA 1O2XA 1Z1JA 1SOZA 2ZTZA 3P92A 2ZFFH 3FKSD 4HFPB 1LQEA 3U9AH 2OQUA 4NFEA 5A0CA 2AGIX 3BN9A 3SW2B 2AMQA 2PKSB 2TRMA 2ANKH 2ZTXA 1MAYA 1NBMD 2ZFRH 2VJ1A 1DWBH 2V3MA 1Q31A 4O9VA 4VGCB 2HVYB 1CA0B 1IQNA 1QRZA 2FOHA 2PGQB 1O3FA 3GCHC 1ZPZA 3Q3XA 1BHXF 3EGKH 3MYWA 1EX3A 2ZDLA 1AUTC 3F68H 4I86A 2BD2A 2BLVA 4HZHA 3VB6A 1TQ0B 1ANDA 2GMTB 2ZG0H 2PW8H 1LMWB 4KP0A 3SV7A 1OPHB 1EAWA 2PTNA 2NU2E 1FIWA 1K21H 5E0HA 1TMBH 1QA0A 4JYVH 3Q76A 1VCPA 2XNDD 2Q1JA 3NK8A 1ANCA 2OP9A 4MTBA 2A45B 1GJ6A 4YZUA 1C5MD 4OGYA 1UTNA 3UTUH 6CHAC 3RXJA 4MPXA 1S81A 3MNBA 3K65B 3TK6A 3UR6A 3UQOA 3Q77A 1FAXA 1W14U 1C1MA 1S84A 2G81E 2Y5HA 2ANYA 4GHTA 3SNAA 3TITA 3BTDE 2WINI 2J95A 1SLWB 1TWXB 3E6PH 1G2MA 4B2BA 3BIUH 4GHQA 3NCLA 1SHYA 1INCA 1QR3E 2JH5D 5CHBA 1OOKB 2G4UA 3A80A 3SNDA 3GCNA 2XC0A 1O34A 2PLXA 2SGAA 1SGFG 3HGNA 1THSH 3KCGH 1EJMA 1O2LA 1WUNH 1F0RA 4P02A 2QXGA 5GXPA 2AIPA 1C2GA 1F7ZA 2F9UA 2BDIA 2OXSA 2SGQE 3SJKA 3V3MA 1N6XA 4DJZB 4E05H 5HXFA 5ESTE 2ZO3H 2BY7X 1AU8A 5GNDA 1H9IE 4U2WA 4YOJA 2Y7ZA 5A8ZA 2BMGB 1UTKA 4AOQA 4AFZA 3SHCH 3M37A 4DW2U 2BM2A 2UWLA 3L3TA 1Z8IB 1H8IH 2AHME 4X0WU 1NS3A 1JRSA 1GGDC 1S6HA 2BQ6B 2JETC 1K1LA 4YOIA 2RDLA 3SUDA 1WV7H 1GVLA 4H6SB 3AW0A 2P8OB 4ISIH 2UWPA 1YLCA 4MPUA 1QB9A 1A5IA 2JKHA 2A2XH 4HTCH 1CHGA 1C1TA 2ILNA 1TX6A 3PWBA 2KR7A 2OC7A 3GCTG 1TFXA 1EUFA 1ZLRA 1H8ED 1XX9A 3UOUA 2L6OA 1DUEA 2VIVA 2FLRH 2FOEA 2G8TA 1TNIA 1AFEH 1WOFA 4FUFA 3SN8A 3TIUA 1GI9B 1UVSH 3HPTB 5TCCA 1DITH 3KYGA 2IPQX 5LPRA 1KXFA 3CS0A 5LH8A 3QZRA 3UNQA 3DD2H 3B8JA 4R0IA 2WPIS 2A5AA 4BXSA 2HVXA 3U8RH 1GI3A 1BRCE 2R0KA 4KTSA 2ODQA 1BRUP 1P03A 4XBBA 1HAGE 1HJ9A 4XDEA 3TPIZ 1J14A 1QGFA 2C8YB 3SGQE 3ZZ9A 1V2KT 4FOUC 1MTNB 1YLDA 1BTWA 1TPOA 2Z9LA 4TY6A 1GMDG 1P10A 2ZU5A 4JZEH 4I8LA 4Y6DA 1SC8U 3T28A 4X2VA 3TLOA 1LO6A 1O38A 1GI7B 3P8OA 2ZDVH 2A5IA 1O3EA 4FVDA 5BPEA 1C5ZB 1EATA 1XUGA 2ZHQH 2QIQA 4OS5A 2BOHB 1C1SA 1RTLA 1KXEA 4GCHG 1FY4A 3GY7A 2BHGA 1J16A 2NU0E 7ESTE 1C5RA 1ZPCA 4YT6H 3BTME 3KF2A 1TOCB 2YOLA 5DN6D 5E2PA 1GBCA 4ACBA 3MH6A 3TJOA 3UIRA 1SQOA 1GI2A 2BYAX 2TPIZ 4UD9H 2Q6DA 1H1BA 3RXQA 2BD3A 1TB6H 2WPDD 2WV9A 4JZIA 1GBBA 3S0NA 1CSOE 1XUJA 1O2OA 3MNXA 1CVWH 4CRFA 2EEKA 3A85A 2THFB 1BRAA 1Z6EA 3DFLA 2G4TA 3O8BA 1HCGA 1YP9A 3U98H 4CR5A 3MU4A 1PPHE 1T7CA 3KQ5A 1NZQH 1P04A 8GCHG 4Y7AA 2BXTH 3ODFA 4NWLA 2JH6D 1DFPA 2WYJA 2Y7XA 1MU8B 2A7JA 2ZGCA 3T27A 1AD8H 4AN7A 1TPAE 1ELEE 4UFGH 1D3QB 1TQ7B 3F2FA 1MQ6A 1QA7A 4FU8A 2BDAA 3SHAH 3QWCH 2VIDA 1AKSB 1ZMJA 1SGTA 3S7HB 1PYTC 5EQQA 1OWKA 4CH2B 3RXMA 3ENSB 2A32A 3Q00A 3TGKE 3N7EA 1T8NA 4CRAA 1GBTA 3RC5A 3MFJA 1QB1A 1VCWA 1LKBA 1O2KA 1A0HB 1KXAA 2Z3DA 3KQBA 1THPB 1V2OT 2VWLA 4NIYA 4WH8A 5T6GA 2BLWA 1FXYA 2AS9A 1TX8A 1O5GH 1AWFH 1WBGB 1QBNA 1VR1H 4DIHH 1NRPH 1J15A 2DUCA 1ZJKA 2IJD1 4CRDA 4CBOA 2FI5E 3SJ9A 2F91A 1UK2A 3LH3A 5JYIA 1L0ZA 1QTFA 3DSGA 3KQEA 3GY5A 3V13A 1O35A 2W5EA 3V12A 2ZCHP 2BY5X 4BTIB 3HATH 2K8IA 4BANB 3GCHB 3ZZBA 4ZCNA 1HDTH 3EAJA 4B73A 7LPRA 1O5EH 3U8TH 6GCHG 2Z9GA 1CA8B 1SVPA 3MTYA 2J92A 4F48B 2IJOB 1CBWC 3A87A 5E0GA 4GLYA 3KN2A 1V2PT 4XSKU 1KMHB 2SGDE 1D9IA 1XUFA 4D7GA 3K6ZA 2BD9A 1C2DA 1GJ7B 5CDFE 2XYAA 2H5CA 3GS9A 1YBWA 2DE8A 1MD7A 3SV8A 2AH4X 5A2MH 5HIZA 1GHAG 1HB0B 5FXLA 1A7SA 2G51A 2HNTC 5C5OA 1V2LT 1WYKA 3LGWA 2SFAA 2I6SA 6CHAB 1YCPH 4BOHA 5A0BA 1TBZH 1RFNA 1ARCA 1C2HA 2C4FH 3RMNH 4BAKB 2J38A 3IITA 4BTUB 4X2WA 1C4V2 3PMJA 3GY6A 3QK1A 2F9BH 2GCHF 4JYUH 5ABWA 1LHCH 1IQJA 1HIAA 1C5PA 4X1RU 4DVAU 1TPPA 3A8DA 2AGEX 3M5NA 4B76A 1A5GH 3FAOA 1PQAA 4U01A 1LVBA 1CU1A 1B0FA 3C1KA 1ELBA 3M5OA 1BBRH 1NROH 1UTOA 1VCQA 2AERH 2PUQH 2RFKC 1P05A 2OUAA 1EASA 2D1JA 1W13U 1D4PB 1BCUH 2KAIA 3VFEA 4XRNA 4AFQA 2B0FA 2C90B 1Y5UT 5T3HA 3OAAD 1C1WH 3VPKA 1NFYA 1WU1A 4Q7YA 1GMDF 2AEIH 1ORFA 2ZFTA 1YPMH 4HGCA 1ETRH 1SGIB 1OYQA 4FUBA 3SU0A 3GDVA 1G32B 3MH7A 3K9XB 4AG2A 1D6RA 2J34A 3CENA 2FODA 1MZDA 5T6DA 3EQ0H 1GGDB 3T26A 4E7NA 1EAXA 2FI3E 1OWDA 2JETB 2ZF0H 1T8OA 1UHBB 4ESTE 1C5YB 2ASUB 4MNYA 1TX7A 4IMQA 4TSFD 1Y3VA 2C93B 1AKSA 1RTFB 4I8KA 4NWKA 1UVPA 4UFEH 2EA3A 1UTLM 1TBQH 3H7TA 1LHEH 4YXWD 3LJOA 5EJ1A 4ZHLU 3A7WA 5A09A 1TGNA 1KSNA 1GHVH 3SU1A 3SV2H 2ULLA 4CHAC 4M7GA 1MMJN 2J94A 3QLPH 2IPHA 2ZU1A 8LPRA 3TJNA 3LGVA 4YO9A 3SORA 1TNLA 1A5HA 1SKYE 1FY5A 5FBIA 2FTMA 8GCHF 1GHZA 4FUEA 3SO3A 4NSYA 2Y80A 5G4BA 2G00A 1BTUA 3SUEA 5T1VA 1BITA 1E34B 3HK3B 5AFZH 4B71A 1GJCB 3SU3A 1F5LA 2HOBA 4A92A 1CT2E 3MMGA 3PO1C 1Z1IA 2GT8A 2H9EH 3MU0A 2VVCA 1MQ5A 1V2WT 2OK5A 1KXCA 1HUTH 2STAE 1KXDA 7KMEH 1CT4E 4NFFA 1WTGH 4ABFA 1QJ6B 2GT7A 2VVVA 1X7AC 3GY4A 5IDKA 1OYTH 5JPMH 2BVXH 1DVAH 1O32A 1OWIA 3UWJH 1GJDB 1HJ8A 3RC6A 1Y3UA 1Y5AT 1AZ8A 1DUAA 2AFQB 1UJ1A 5DKMA 1DOJA 2CK3D 1FZZA 1G3DA 3IG6B 4X8TH 3RU4T 1ZMLA 2O8WA 2Y6TA 3UREA 1Y5BT 4OS7A 1MBMA 5C1XA 1GHWH 5CMXH 4THNH 4D9QA 1H8HD 3A8BA 5AHGH 5C67A 3URDA 4A1TA 1K1NA 1QNJA 4NA9H 2PKAB 4ASHA 2BTCE 2FZZA 2ZFPH 1WQVH 2PSXA 2W3IA 5JBBS 2P16A 1XUIA 2GVFA 4M9FA 4X1NU 2WPHS 2C8XB 1PJPA 1GMCG 2AIQA 1P9UA 1RRKA 3OEHD 2EI6A 3VB7A 1Z71A 2Y82A 5C1UA 1KXBA 1W12U 1E37B 1YPLH 2JJ2D 5EQRA 5T6FA 4I32A 1ANBA 1T31A 1JIMA 5A8YA 3EYDA 2LP6A 1MBQA 4Y0ZE 2PV9B 2J5UA 3L6PA 1SQTA 1HAYB 1FNIA 3RXPA 3A7YA 1NFUA 3QTOH 5AF9H 1ZTKA 5GIBA 1SPJA 3AAVA 4K60A 1Z7KA 3FO8D 2VWOA 4H6TA 1Q2WA 5C3NA 1EAUA 4WMDA 3S9AA 2FX4A 2GZ7A 1AGJA 1T8MA 2F9OA 3CNRA 1NU9A 3I29A 1TAWA 1UHBA 2R0LA 2NU1E 2P3FH 1HXFH 5F03A 1UTMA 1GBIA 1TYNA 1YYY1 1XXFA 1A3BH 2SNWA 1QBVH 1OHHD 3F9GA 1QQUA 4NGAH 3LC3A 1MTSA 3PM3A 2UUFB 4AGJA 2J9NA 3KQDA 2FI4E 2ZGBH 1SGYE 1O3DA 1O3MA 1DLKB 1CGHA 5F8ZA 5FPYA 3DT0H 4IC5A 4A5TS 1KLJH 4NIXA 5A8XA 4NA7A 3E90B 1ELAA 1XUKA 3GISB 3RXEA 4IC6A 1SGQE 3SZNA 3OU0A 1HJAC 1CBWB 3LT3A 1Q3XA 2Y5FA 3OYPA 1MABB 4JK5A 3BF6H 1QHRB 4B6FA 3T5FH 4YTAA 1CHOF 1BTXA 3STJA 2FO9A 3WWFA 2AYWA 3CP7A 5C5NA 2RCEA 1YLNA 2K0QA 1QL9A 5EGMA 2NWNA 1HAVA 2ZI2H 1IQFA 1FPHH 3KHVA 1IHSH 1UK4A 3KIDU 4AB8A 1HYLA 1GBAA 3PYHA 1HAXB 1TRMA 4K1SA 1W10U 3T2NA 1Z6JH 1QL7A 1TMTH 3SV9A 1K1MA 2KCYA 3RXHA 1GHYH 4O3TA 2FYRA 3OFND 4BNRA 1GMHG 4U32A 1C9TA 1W0JD 1S6FA 2GJGA 4BAMB 2KFWA 2J2UA 4X2YA 1O2QA 1NRQH 1ZRKA 4INHA 3SUFA 2CHAC 1YKTA 1UK3A 1ZMNA 1O2SA 1EP5A 2BDBA 2A0QB 1BDAA 1HRTH 2HPQH 3LIWA 2ZQ1A 2WPMS 1V2QT 2ZPQA 1BTYA 3BG8A 3KQCA 3EA9A 4JYTA 3EA7A 2PKAA 2SGEE 2CF8H 2WPKS 2FOFA 2Y5GA 3RXVA 5DP8A 5HGGA 3M3TA 2A5KA 3PRBA 1BJUA 3LDXH 3NUMA 2AGGX 3SJOA 3N7DA 3MH5A 1C1RA 1BOQA 1C2EA 4IGDA 1B0EA 4ZHMU 2QXHA 4AG1A 4MG3A 3AASA 3TU7H 1W0ZU 3BG4C 1ZHMA 2Z6BD 5FPSA 2QCYA 1SQRA 4BAQB 6ESTA 1A46H 2XCFA 4A7IB 1A61H 4BTTB 2RG3A 1IQKA 5EG4A 3TH4H 1GJ8B 1L4DA 1COWD 1RTKA 2OC1A 2GCHG 3LGUA 1UW7A 1OWHA 5HMAA 3RXCA 3SBKA 2TIOA 2FM2A 1K1PA 5F8TA 1T32A 4CHAB 3EA8A 3LGTA 2XNIA 1BJVA 2ZQ2A 1GJ5H 1K28D 3VXEH 2VWNA 1FX0B 1K9OE 3M61U 1NY22 1K22H 1HAIH 3SGAE 4X1QU 4ZKNU 1MKWH 1BZXE 1IQMA 3ATKA 3QN7A 1GMCF 2ANWA 2GZ8A 3A84A 1UTPA 1QL8A 2ALVA 1WAYB 1FQ3A 1S5SA 1G3EA 5LPFA 1G30B 1XKBC 4I8JA 4AC9A 1ZSKA 2LELA 1TGTA 5GCHF 1F5RA 5JB8S 1Y3XA 4X6MA 4AGKA 3P6ZB 4LZ1H 3I78A 2YMSC 1SG8B 4X2XA 1FJSA 5FBEA 3PO1B 2ZHFH 1O3CA 3RU4E 4TY7A 1EOJA 1QBOA 2J4IA 1TNGA 3WWBA 3EE7A 1THRH 3TJUA 1MH0A 1ELFA 1P09A 2UUYA 3BEUA 3MU8A 1SLUB 1G37A 4XD7D 1HIAB 1MUEB 4ZH8A 4TWYA 1MKXH 1QRWA 3F2GA 4ZHAA 3KEEA 2V3OH 4XBCA 3SI3H 1O2TA 4ASUD 3UNRA 1BBRE 1O3NA 3UNSA 1AN1E 1C2KA 1H4WA 5B6LA 1G3CA 2G52A 3A83A 1Z8JB 1D6WA 3D62A 1W0YH 1BB0B 3VB3A 1FY1A 2IOTA 1IQEA 5ESBA 1AE5A 3PMAB 2KAIB 1YF4A 3FANA 1YM0A 2F9VA 1L1NA 4B6EA 2O9QA 7GCHG 1H9HE 1C5WB 2V7QD 3M5MA 9ESTA 1LHFH 4DURA 1QJ1B 2ZWLH 3ODDA 1E1QD 3W1EA 1HV7A 2ZFQH 2LNCA 2Z3EA 3ATWA 4TPYA 1SGRE 1NC6A 2VU8E 2ZNKH 5DPAA 1ZGIA 1GJAB 1O2HA 5CE1A 1TE0A 1ZOMA 3OTPA 3PLPA 5AFYH 4Y0YE 4DT4A 1BQYA 1VGCB 1J9CH 3AVZA 3SJ8A 5J4QA 2PUXB 4Y79A 1A0LA 2VH0A 5EW1H 1CO7E 1OXGA 3RLYH 3A8AA 4XE4A 1GI1A 5FAHA 2ZU2A 1C2FA 1JRTA 4K8YA 1MTVA 1MCTA 2WUCA 2XC5A 4WWYA 1YPJH 1JBUH 2BDCA 3G01A 5AVDA 2CV3A 1VJ9U 4UEHH 2Q6FA 2ZTYA 1LHGH 2P93A 4WXIA 1P2KA 1EPTC 1MZAA 1BMMH 1P0SH 3OE7D 3MWIU 1O36A 1BUIA 1EB1H 2H5DA 3RXKA 2XRCA 1AMHA 3FP6E 3TK9A 1GMHF 1EZSC 4IBLH 3UFAA 1HAOH 1ESAA 2BDGA 1F0UA 1P2QA 2QXJA 3RDZA 4X8UH 2H6MA 1BMLA 1EJAA 1G9IE 4FETA 4CR9A 3U1IB 4Y10E 2BDYA 2FDAA 1KLIH 1EKBB 4D7FA 1S83A 4CRCA 3FP8E 3QX5H 1O3LA 1AO5A 4ZAEA 1OP2A 2VH6A 1O2MA 1F0TA 2VWMA 3QUMP 2XBVA 2V35A 2R9PA 3GICB 1A2CH 1HAZB 2BY9X 4K69A 1O2ZA 3ZV9A 1SGFA 1J8AA 1P02A 2KCOA 2XBWA 4F55A 2P94A 1HJAB 2WV5A 3LC5A 5A0AE 2WPLS 3PV5A 1UMAH 4AYYB 1RIWC 1DT2A 2ZDNA 1AB9C 1SGDE 1C2LA 2UUKB 1TALA 1GI6A 4ABJA 3TJVA 2Z94A 3A7XA 1ELDE 1V2MT 4UE7H 1BT7A 1UCYE 3VEQB 4ABBA 4YLQH 2AMDA 1K2I1 1GHBF 2OTVA 2JH0D 4ZUHA 2C8WB 2XC4A 3GY8A 3E16B 2PWXA 2ZZUH 3MOCA 4KELA 1UTQA 2ZGJA 4ABIA 4TT3D 1PQ7A 3SOSA 3ZZCA 5C2ZA 2G5NA 4AB9A 2ESTE 2G55A 1W0KD 2OC0A 4YM9A 1Y3YA 2HGTH 4ISOA 1WDIA 5E8EH 1TA6A 1PPBH 1C1NA 2Y81A 4ZMAH 1GJ4H 1MKWK 2PGBB 3FFGA 2KZ4A 4FUDA 1NPMA 1NESE 2XWAA 3SV6A 1PQ5A 3UPEA 1GI0A 1LHDH 3ZVEA 4ISHH 4K1TA 1C5UA 1D3PB 4JZ1A 1EXFA 3MU1A 4JZDH 1FMGA 1O30A 3MU5A 2GGVB 4CRBA 3U69H 1BIOA 2I6QA 2ZEBA 1BTZA 2VIPA 3ZZ4A 2TGPZ 3BIVH 5DG6A 1ZHRA 1SFQB 3M7TA 5JBCS 2WUBA 3ESTA 3UAIC 1V3XA 1DXPA 1GBJA 1CHOG 1ABIH 4B75A 3FZDA 3RC4A 4CRGA 3A7TA 4ABHA 5DP6A 4RT1A 4OM9A 2P3TB 1TABE 3SU2A 3BTQE 8ESTE 1O2VA 1DWDH 1DPOA 3A8CA 3DA9B 2TGAA 5DJ7A 1N1LA 1YPGH 1V2RT 3NXPA 5EIYA 4ZROA 3D49H 5CHAC 3RXRA 5KEDA 3RXSA 1GPZA 1TRNA 1ARBA 1ZTLA 3HKJB 1O2RA 2FS9A 5EXNA 4PROA 4ZXXH 1N8OC 5HIYA 4GVUA 7GCHF 5EJLA 4D8NA 1PPFE 4O3UA 1EZXC 3P8GA 1DWCH 2V0BA 1Y3WA 2H1UA 1O31A 4FUCA 2B9LA 2W7UA 1PQ8A 1O39A 2OBQA 3MO6A 1NM6A 3ATMA 2GV6A 9LPRA 3MO9A 1BHXB 2BX4A 4INKA 1HAVB 2OQ5A 5FCRA 1BMNH 1Y59T 4I33A 3PV2A 3S9BA 1WSSH 1EAIA 4J1YA 4O97A 2FWWA 3SZEA 2XXLA 3EE0B 3SUGA 4RT0A 5FHTA 2FXRA 1C1QA 3F1SB 1KDQB 1HAPH 3ZIAD 2YMSB 5KGOA 1MCVA 5FCKA 5SGAE 1DICA 1ABJH 3PTNA 4NZQA 4ABGA 2BVSH 3UY9A 1O5AB 4J2YB 1IAUA 3O8RA 4OS1A 1V2JT 4NSVA 5K7RA 3LGIA 3V0XA 1YC0A 4IN1A 5C0TA 1IHTH 3ZVCA 2CMYA 2Z9IA 3H5CB 3M7UA 4GPGA 1XKAC 2FOAA 4DIIH 1AY6H 2A4GA 2ZU4A 3Q3KA 2F9NA 1GI5A 3BSQA 1O3OA 4X1PU 1NTPA 5JB9S 2A31A 3M3SA 3OSYA 2BVRH 2BD8A 3CS7A 2Z9JA 4MPWA 3U28C 2VBCA 3PROA 1CE5A 1AI8H 1PFXC 1UCYH 3M36A 3P95A 2A7CA 4ACAA 1HBTH 1KTTB 3E0PB 4XOJA 4ZKRU 1H9LB 2O8MA 2NU4E 1FI8A 3NKKA 1AWHB 3E91A 4KTUA 3TK5A 4X6PA 1ANEA 1KIGH 1AE8H 4XFQA 5E0JA 2ZGXH 3SI4H 1AIXH 2ZP0H 3S7KB 2H9TH 5FL7D 1FUJA 3VG8A 4YLUA 4UONA 3RMMH 3DFJA 5EQSA 2HLCA 2LPRA 3NZIA 5GCHG 1QB6A 4DCDA 1SBWA 1XM1A 2TBSA 1AFQC 1HPGA 2M2AA 1SSXA 3D65E 4OS2A 4ABAA 1OP0A 3E8LA 2ZHDA 1ZYOA 4I8GA 2F43B 1O2JA 2KCPA 2FOGA 3LONA 3MNSA 3LKWA 3KNXA 1V2ST 5HM9A 3PRDA 3A82A 1DE7H 3W95A 2B5TB 3BTWE 1YCPK 1FV9A 4I7YH 1W8BH 3GYLB 2YNAA 3PMBB 4Z1MD 1LCYA 1EPTB 1OP8A 1ZTJA 3O8DA 2GTBA 3RXOA 4I8HA 6LPRA 2P59A 3FZZA 1FONA 5DSFA 3SU4A 1O37A 1GDUA 2CF9H 1M9UA 3K6YA 1PPZA 3BTKE 2AMPA 1GBMA 3KYFA 2ZU3A 2R3YA 4FU7A 2RA3A 2V6NA 1FLEE 1C2MA 2GV7A 1YY3A 1BBRK 1OWJA 1SI5H 4HI3A 4JK6A 4NCYA 2FTLE 4NG9H 1N6YA 2QF0A 3BTEE 3QGNB 2IN2A 1YWUA 4FU9A 4AORA 1GL0E 1ZSJA 1T4UH 4ZXYH 5TJXA 1DY8A 3F6UH 2HALA 2STBE 4UDWH 4WXVA 1IQGA 1JOUB 2C8ZB 5GJ4B 2EI7A 3JZ1B 1O3GA 2QXIA 5L6NH 3C27B 4BXWA 1GBHA 5GWZA 1FPCH 1JIRA 2GZ9A 3GY2A 1E1RD 1Z8RA 1E35B 4OS4A 3TVJB 2F83A 3TGJE 1CGJE 4TPIZ 3B9FH 4Y8YA 1SHHB 2ZCKP 4GUXA 2WHXA 1AZZA 1P11E 3WY8A 1D3TB 2ZFSA 1TGBA 3N7OA 5JDUB 4K1EA 2XTTB 1RIWB 4MLFB 1ZGVA 5EXMA 1A1RA 1C2IA 1XMNB 2FEQH 2J98B 1P01A 4Q4LA 1AB9B 1ACBE 1TLDA 4BAOB 1ELGA 2VIQA 2ZHEH 3P70B 1DDJA 1QRXA 3HK6B 3RXFA 2V3HH 3DUXH 1KDQA 4X1SU 1GG6C 1FDPA 1F5KU 2ANMH 2SNVA 2VNTA 1TONA 2QF5A 2VIWA 5E2OA 1QY6A 2OD3B 3A89A 5F6MA 2BD7A 1RJXB 3JZ2B 3N99A 5DP7A 2BD4A 1W11U 3UR9A 1FN6A 1JMOH 2BB4A 4FXGH 5C1YA 1RGQA 3GDSA 1W7GH 3K2UA 5JBAS 1GCDA 4ISNA 2ZHWH 2ODYB 5C17A 1QIXB 2TGDA 2WYGA 1O0DH 2RDEA 2ZC9H 3RXTA 5C20A 3F2HA 3I77A 1O2IA 1DSTA 1P2NA 2JDID 2BDHA 3SYJA 2OLGA 2EY4C 2OC8A 3M3VA 3LH1A 2Z3CA 4TYDA 8KME2 1P2IA 2WV4A 4YESB 4BAHB 1TNKA 1HXEH 1Y8TA 1V2VT 5H4IB 2BLQA 1A4WH 5DP5A 1A3EH 2BQWB 1DM4B 1NRRH 3V7TA 3BEFB 1P8VC 3OTJE 2Z7FE 3RXBA 3R3GB 4WJG2 1K1IA 1OSSA 1SLVB 2FOMB 3RP2A 2VGCC 3RMOH 2GDEH 3A86A
chains in the Genus database with same CATH topology
1K1JA 3D23A 5F8XA 2WPJS 4Y8XA 5DP9A 3LJJA 3EDXB 1GBFA 2GP9B 2G5VA 1MU6B 1PPGE 5EU8A 1C4U2 1ELTA 2QGRA 1AHTH 1GWAA 1ESTA 1GHBG 3UOPA 2FOCA 3LU9B 2GCTC 1C1OA 4WVPE 2QYIA 2BY6X 5FX5A 5CHAB 1L1JA 3TNTA 3VB4A 3F9FA 4D76A 1V2NT 4AX9H 1XVMA 2D8WA 3GOVB 1G2LA 1N8OB 1UCYK 4Y76A 5DGJA 1MAXA 4LXBH 1GBLA 1NRSH 3VXFH 2M5TA 1OS8A 4A6LA 1EPTA 4IN2A 4WF8A 1SB1H 1ESBA 1SR5C 2A4OA 2HPPH 3QGJA 1P06A 1O5FH 1DLEA 2SGFE 3S69A 4U30A 2FPZA 1IQIA 4R8TB 1GL1A 4OGXA 1ZR0A 5LGOA 1KLTA 1F0SA 1O2WA 2FOBA 1GVZA 4FUJA 4MVNA 1TPSA 3RM2H 1J17T 4INLA 3ZVBA 1LVYA 1E36B 1LTOA 3MNCA 3STIA 1HLTH 1NN6A 3SQHE 3ZZ6A 2VB0A 1O2UA 3VGCC 4YOGA 1BTPA 3A88A 4MPVA 1DS2E 1IQLA 2QY0B 3AAUA 3ZZ7A 3NPSA 3RXLA 2A4QA 1C5LH 4Q2KA 1FAKH 3PV4A 1YPHC 1VITG 4X8VH 2D26C 2QAAA 2ZECA 3ZZ3A 2HNTF 4Z6AH 1GBEA 1MD8A 2GDDA 3KL6A 4UFFH 1AVXA 3M7QA 4ABDA 2QC2A 4ZKSU 3L33A 2BY8X 3LOXA 5LPEA 1VJAU 3O8CA 3URCA 1TNHA 1SLXB 3RXDA 4FUGA 3HGPA 5EPNA 4GAWA 1TGCA 1O3AA 1SQAA 2W3KA 3PB1E 2PR3A 1LVOA 1ETSH 5B6OA 3ITIA 3E1XB 1C1VH 1CGIE 2Z9KA 4TWWA 4F49A 1SOTA 3AW1A 1L1GA 4A1VA 4AFSA 2BZ6H 1QCPA 4NZLA 1A0JA 2BQ7B 1HGTH 1ZPBA 1GHXH 5K0HA 2C3SA 3SU6A 3PLBA 2GD4B 1KTSB 4DT7B 1P2JA 1GCTC 1NRNH 4X6NA 1GI8B 1KY9A 1P12E 3IWMA 1YCPM 2BLOA 1PYTD 5L2ZH 2XWBI 1HFDA 3T29A 1UVTH 3ZVAA 5EODA 4K5ZA 1AFQB 2CJIA 4Y11E 4I31A 2ZDMA 3GDUA 1QURH 1XVOA 2O8TA 4FUHA 3HKIB 1O3JA 2R2WU 3ZZDA 2FS8A 2EI8A 5FX6A 1NU7B 2VIOA 5PTPA 3BTGE 3RM0H 4B74A 2QV1A 3RXAA 4WMFA 2BX3A 2B8OH 2B7DH 4AYVB 1TNJA 3OY5U 3B23B 4QT8C 4X8SH 4CREA 2HWLB 1PPCE 3T25A 2FMJA 1NFWA 2ZCLP 4SGBE 5EXLA 4X6OA 2D2DA 2CN0H 2QF3A 3DHKH 5EW2H 2QN5T 1NT1A 1SFIA 5HM2A 1TRYA 1UTJA 2PKSC 4NIWA 2PTCE 3ZZ8A 1AVGH 1GVKB 1EQ9A 1LQDB 1EZUC 1TGSZ 3ZV8A 3ZVDA 2XW9A 4VGCC 1LPGB 4A1XA 2TGTA 2A2QH 4DG4A 1CA0C 2FESH 1F92A 3VB5A 2FX6A 1UVOA 1EZQA 3SNCA 4Q7XA 3P8NA 3UQVA 3OX7U 2P3UB 2ZPSA 1C5SA 3PMHB 4E06H 4NIVA 2UUJB 3F9EA 3W94A 1FY3A 2ZDKA 5FPTA 3U8OH 2GMTC 1T4VH 3QZQA 1VITH 3A7ZA 1XUHA 1YPKH 1ZZZA 3TGIE 1SMFE 2R3UA 1ETTH 1QFKH 1GBKA 1WCZA 2Q6GA 1PPEE 4KTCA 4AFUA 3BEIB 2A7HA 2A4RA 3BTTE 1QQ4A 1W3CA 2F9PA 1EP6A 2DE9A 2F3CE 4Q80A 4KKDA 1GG6B 4FUIA 3SU5A 4DY7B 1O33A 1ID5H 3GCOA 5ETXA 3SQEE 2XBYA 1C4Y2 2XBXA 1NO9H 3GCTF 1B5GH 1G36A 1C5OH 1DANH 4IS5A 1LVMA 2CHAB 3ELAH 5DP4A 2RA0A 4UFDH 1C2JA 4MNVA 1G3BA 4SGAE 1S0RA 1YPHE 1HNEE 1KYNA 4E7RG 3SNBA 3H7OA 3TH2H 2ODPA 1GI4A 4K3JA 2FYQA 1LPKB 5EPYA 1ZJDA 4WH6A 3ZYEA 1DWEH 1L2EA 1VZQH 1C5XB 3M5LA 2YNBA 1P2MA 1SGEE 2ZGHA 2PFEA 4JMYA 2H9HA 1U6QA 1O3PB 1FN8A 3RXGA 4B2CA 2UWOA 1BRBE 1FIZA 2VGCB 1TBRH 1LKAA 1H8DH 1MKXK 4YT7H 4IMZA 1MTWA 3E0NB 1E38B 1W7XH 1P9SA 2OBOA 1VITF 1IQHA 3BG4B 4JZFH 5BRRE 1E0FD 3BTFE 1WQSA 2QA9E 4XBDA 1JWTA 3P8FA 1ELVA 1GDQA 3P17H 1V2TT 2P8OC 3LGYA 2A1DB 3NWUA 3F9HA 3TNSA 4ISLA 3ZVFA 1BMAA 4RSPA 2GCTB 4ZKOU 4B1TA 1LDTT 1V2UT 4CBNA 4LZ4B 1W2KH 2EC9H 1T8LA 2GKVE 2HRVA 3BTHE 4GCHF 1AUJA 3SJIA 1S0QA 2ZPRA 1TOMH 1ZRBA 1TIOA 1UO6A 1C9PA 2BZAA 4Z0KA 3MH4A 1Z8GA 3PTBA 5IYTA 3TH3H 4F4OC 2ZA5A 3UWIA 2K1QA 2SGPE 4LOYH 4O03A 3QTVH 2BD5A 4Y7BA 3M35A 3ZYDA 1SGNE 4KGAA 3SGBE 5JBTA 3OY6U 1SL3A 3QO6A 3E3TA 4Q7ZA 4K8BA 3RMLH 3ZZ5A 1O3HA 2NU3E 1O2YA 4MNWA 2XCNA 4K2YA 1CT0E 1O3KA 1JXPA 4MNXA 1P3CA 4H42U 3RXIA 4AZ2B 3GYMA 3RXUA 1WTHD 1YPEH 2O8LA 2P95A 1ZSLA 4NA8A 1AVWA 4Y71A 4H4FA 1OWEA 1MTNC 1D3DB 1MTUA 2FLBH 3LPRA 2OINA 1SGCA 4LK4A 1O2NA 3S9CA 1C5VA 3VGCB 5GDSH 2PHBA 1O2PA 1C1UH 4DGJA 3RUOA 4OS6A 3QDZB 1C5NH 3FP7E 1V6DA 4RKJB 1UVUH 2GX4A 2ZDAH 3SNEA 5HYOA 3ZZAA 3MO3A 3PLKA 2VVUA 5L2YH 1P3EA 3MHWU 3Q3YA 2OCVB 2W26A 1L4ZA 4IW4E 3ZVGA 1SGPE 2ZKSA 5EOKA 4GSOA 1O5CB 1O5BB 5L30H 1CQQA 1K1OA 4MDSA 3ATIA 3FVFB 1RD3B 1P57B 1NFXA 2H2ZA 4ABEA 2W7SA 1EOLA 2FP7B 1BTHH 3U1JB 1EB2A 1O3BA 4RKOB 4D9RA 2PSYA 1S82A 1GDNA 5GPIB 4CH8B 1DX5M 2O8UA 3GY3A 1OKXA 1GBDA 2FIRH 5DK1A 2HNTE 1EJNA 5I46H 1IOEA 1DSUA 4JCNA 1ZHPA 1S85A 1GCTB 6GCHF 4WMEA 1RXPA 3BV9B 2R2MB 1AQ7A 4MQAA 4Y8ZA 1VGCC 4DOQA 3A7VA 1F2SE 1C1PA 1TA2A 2CGAA 5I25A 1P2OA 2BOKA 1HAHH 4B2AA 1C5QA 1GJ9B 1QJ7B 5J4SA 1YGCH 1BA8B 1O5DH 1XXDA 1DXWA 3MI4A 1GHAF 5DO4H 2BXUH 1C5TA 1LPZB 3A81A 2VINA 3UUZA 4FVBA 2ZIQH 3RLWH 1B7XB 1FY8E 4RN6A 3KGPA 3T62A 1RS0A 1O2GH 2CXVA 1O3IA 1DY9A 4WY3A 2ALPA 5TCAA 3PWCA 5DP3A 1ELCA 1OX1A 1GJBB 3ATLA 1TMUH 3RU4D 3R0FA 1O2XA 1Z1JA 1SOZA 2ZTZA 3P92A 2ZFFH 4HFPB 1LQEA 3U9AH 2OQUA 4NFEA 5A0CA 2AGIX 3BN9A 3SW2B 2AMQA 2PKSB 2TRMA 2ANKH 2ZTXA 1MAYA 2ZFRH 2VJ1A 1DWBH 1Q31A 4O9VA 4VGCB 1CA0B 1IQNA 1QRZA 2FOHA 2PGQB 1O3FA 3GCHC 1ZPZA 3Q3XA 1BHXF 3EGKH 3MYWA 1EX3A 2ZDLA 1AUTC 3F68H 2BD2A 2BLVA 4HZHA 3VB6A 1TQ0B 1ANDA 2GMTB 2ZG0H 2PW8H 1LMWB 4KP0A 3SV7A 1OPHB 1EAWA 2PTNA 2NU2E 1FIWA 1K21H 5E0HA 1TMBH 1QA0A 4JYVH 3Q76A 1VCPA 2Q1JA 3NK8A 1ANCA 2OP9A 4MTBA 2A45B 1GJ6A 4YZUA 1C5MD 4OGYA 1UTNA 3UTUH 6CHAC 3RXJA 4MPXA 1S81A 3MNBA 3K65B 3TK6A 3UR6A 3UQOA 3Q77A 1FAXA 1W14U 1C1MA 1S84A 2G81E 2Y5HA 2ANYA 4GHTA 3SNAA 3TITA 3BTDE 2WINI 2J95A 1SLWB 1TWXB 3E6PH 1G2MA 4B2BA 3BIUH 4GHQA 3NCLA 1SHYA 1INCA 1QR3E 2JH5D 1OOKB 2G4UA 3A80A 3SNDA 3GCNA 2XC0A 1O34A 2PLXA 2SGAA 1SGFG 3HGNA 1THSH 3KCGH 1EJMA 1O2LA 1WUNH 1F0RA 2QXGA 5GXPA 2AIPA 1C2GA 1F7ZA 2F9UA 2BDIA 2OXSA 2SGQE 3SJKA 3V3MA 1N6XA 4DJZB 4E05H 5HXFA 5ESTE 2ZO3H 2BY7X 1AU8A 1H9IE 4U2WA 4YOJA 2Y7ZA 5A8ZA 2BMGB 1UTKA 4AOQA 4AFZA 3SHCH 3M37A 4DW2U 2BM2A 2UWLA 3L3TA 1Z8IB 1H8IH 4X0WU 1NS3A 1JRSA 1GGDC 1S6HA 2BQ6B 2JETC 1K1LA 4YOIA 2RDLA 3SUDA 1WV7H 1GVLA 4H6SB 3AW0A 2P8OB 4ISIH 2UWPA 1YLCA 4MPUA 1QB9A 1A5IA 2JKHA 2A2XH 4HTCH 1CHGA 1C1TA 2ILNA 1TX6A 3PWBA 2OC7A 3GCTG 1TFXA 1EUFA 1ZLRA 1XX9A 3UOUA 1DUEA 2VIVA 2FLRH 2FOEA 2G8TA 1TNIA 1AFEH 1WOFA 4FUFA 3SN8A 3TIUA 1GI9B 1UVSH 3HPTB 5TCCA 1DITH 5LPRA 1KXFA 3CS0A 5LH8A 3QZRA 3UNQA 3DD2H 3B8JA 4R0IA 2WPIS 2A5AA 4BXSA 2HVXA 3U8RH 1GI3A 1BRCE 2R0KA 4KTSA 2ODQA 1BRUP 1P03A 4XBBA 1HAGE 1HJ9A 4XDEA 3TPIZ 1J14A 1QGFA 2C8YB 3SGQE 3ZZ9A 1V2KT 1MTNB 1YLDA 1BTWA 1TPOA 2Z9LA 4TY6A 1GMDG 1P10A 2ZU5A 4JZEH 4I8LA 4Y6DA 1SC8U 3T28A 4X2VA 3TLOA 1LO6A 1O38A 1GI7B 3P8OA 2ZDVH 2A5IA 1O3EA 4FVDA 5BPEA 1C5ZB 1EATA 1XUGA 2ZHQH 2QIQA 4OS5A 2BOHB 1C1SA 1RTLA 1KXEA 4GCHG 1FY4A 3GY7A 2BHGA 1J16A 2NU0E 7ESTE 1C5RA 1ZPCA 4YT6H 3BTME 3KF2A 1TOCB 2YOLA 5E2PA 1GBCA 3MH6A 3TJOA 3UIRA 1SQOA 1GI2A 2BYAX 2TPIZ 4UD9H 2Q6DA 1H1BA 3RXQA 2BD3A 1TB6H 4JZIA 1GBBA 3S0NA 1CSOE 1XUJA 1O2OA 3MNXA 1CVWH 4CRFA 2EEKA 3A85A 2THFB 1BRAA 1Z6EA 3DFLA 2G4TA 3O8BA 1HCGA 1YP9A 3U98H 4CR5A 3MU4A 1PPHE 1T7CA 1NZQH 1P04A 8GCHG 4Y7AA 2BXTH 3ODFA 4NWLA 2JH6D 1DFPA 2WYJA 2Y7XA 1MU8B 2A7JA 2ZGCA 3T27A 1AD8H 4AN7A 1TPAE 1ELEE 4UFGH 1D3QB 1TQ7B 1MQ6A 1QA7A 4FU8A 2BDAA 3SHAH 3QWCH 2VIDA 1AKSB 1ZMJA 1SGTA 3S7HB 1PYTC 5EQQA 1OWKA 4CH2B 3RXMA 3ENSB 2A32A 3Q00A 3TGKE 1T8NA 4CRAA 1GBTA 3RC5A 3MFJA 1QB1A 1VCWA 1LKBA 1O2KA 1A0HB 1KXAA 2Z3DA 3KQBA 1THPB 1V2OT 2VWLA 4NIYA 4WH8A 5T6GA 2BLWA 1FXYA 2AS9A 1TX8A 1O5GH 1AWFH 1WBGB 1QBNA 1VR1H 4DIHH 1NRPH 1J15A 2DUCA 1ZJKA 4CRDA 4CBOA 2FI5E 3SJ9A 2F91A 1UK2A 3LH3A 5JYIA 1L0ZA 1QTFA 3KQEA 3GY5A 3V13A 1O35A 2W5EA 3V12A 2ZCHP 2BY5X 4BTIB 3HATH 4BANB 3GCHB 3ZZBA 1HDTH 3EAJA 4B73A 7LPRA 1O5EH 3U8TH 6GCHG 2Z9GA 1CA8B 1SVPA 3MTYA 2J92A 2IJOB 1CBWC 3A87A 5E0GA 4GLYA 3KN2A 1V2PT 4XSKU 2SGDE 1D9IA 1XUFA 4D7GA 3K6ZA 2BD9A 1C2DA 1GJ7B 2XYAA 2H5CA 1YBWA 2DE8A 1MD7A 3SV8A 2AH4X 5A2MH 1GHAG 1HB0B 5FXLA 1A7SA 2G51A 2HNTC 5C5OA 1V2LT 1WYKA 3LGWA 2SFAA 2I6SA 6CHAB 1YCPH 4BOHA 5A0BA 1TBZH 1RFNA 1ARCA 1C2HA 2C4FH 3RMNH 4BAKB 2J38A 3IITA 4BTUB 4X2WA 1C4V2 3PMJA 3GY6A 3QK1A 2F9BH 2GCHF 4JYUH 5ABWA 1LHCH 1IQJA 1HIAA 1C5PA 4X1RU 4DVAU 1TPPA 3A8DA 2AGEX 3M5NA 4B76A 1A5GH 3FAOA 1PQAA 4U01A 1LVBA 1CU1A 1B0FA 3C1KA 1ELBA 3M5OA 1BBRH 1NROH 1UTOA 1VCQA 2AERH 2PUQH 1P05A 2OUAA 1EASA 2D1JA 1W13U 1D4PB 1BCUH 2KAIA 3VFEA 4AFQA 2B0FA 2C90B 1Y5UT 5T3HA 1C1WH 3VPKA 1NFYA 1WU1A 4Q7YA 1GMDF 2AEIH 1ORFA 2ZFTA 1YPMH 4HGCA 1ETRH 1SGIB 1OYQA 4FUBA 3SU0A 3GDVA 1G32B 3MH7A 3K9XB 4AG2A 1D6RA 2J34A 3CENA 2FODA 1MZDA 5T6DA 3EQ0H 1GGDB 3T26A