1J8AA

Crystal structure of benzamidine inhibited bovine pancreatic trypsin at 105k to 1.21a resolution from laboratory source with high number of waters modelled
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin as a model for high resolution X-ray diffraction in proteins.
pubmed rcsb
molecule tags Hydrolase
molecule keywords TRYPSINOGEN, CATIONIC
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j8aA02
4CRBA 5DKMA 2C8YB 1WBGB 2A0QB 1Y3WA 3S9AA 2V3OH 1K1NA 4LK4A 2Q1JA 2JETC 2Y5GA 1FNIA 1FJSA 1QQ4A 1TPPA 1CA8B 1UTQA 3ZVAA 1NM6A 1UCYE 3U69H 2FTLE 4KTUA 2G55A 1A46H 3GY6A 5JPMH 3AVZA 3ZZ9A 1C5YB 2PKSC 5EQRA 5CHAB 1NU9A 2BDHA 1MD8A 2ZHFH 2O8WA 4HZHA 2ZTXA 3SQHE 2V6NA 4ISHH 3RMNH 2FS9A 1UCYH 5A0AE 1OWJA 1ELAA 5K0HA 1GHZA 2AGGX 1SLXB 2C90B 1AGJA 3VB6A 3U8RH 2AMQA 3BF6H 4TYDA 7LPRA 1GL0E 4NWKA 3GYMA 4YESB 4YOJA 1QL8A 1KDQB 2IPHA 2A5AA 4CHAC 1NRPH 3O8CA 1WUNH 1ZOMA 1IHTH 1SOTA 3SHAH 1ZSJA 2ZC9H 1YLCA 1O3LA 2H6MA 1C5SA 2EA3A 9LPRA 1LMWB 4U32A 2A4OA 3T2NA 4X2WA 1HGTH 1M9UA 3O8BA 4MLFB 3UR9A 3PLKA 2FI3E 1C1PA 1CT2E 5ETXA 2R3YA 1DWDH 3SU3A 2GV6A 3Q3XA 4TWWA 2ZGHA 3SU5A 2AGIX 3RXPA 1BJUA 1YC0A 2GCHG 5DP8A 2VVCA 5DP5A 1EPTC 1MH0A 1MBQA 2P93A 4WF8A 2ZFPH 5IDKA 1SGYE 2EEKA 1W12U 2A4QA 1V2TT 3TH4H 1TGBA 1AWHB 3VB7A 3QGNB 4CR5A 3TJVA 1GJCB 5SGAE 4B71A 1V6DA 2HGTH 1MTUA 3NCLA 3GOVB 1EPTA 1ARBA 1Z6EA 4FXGH 4O3TA 1DXPA 5FPTA 3NUMA 4ABHA 1XMNB 3SU2A 2JH0D 1UVOA 1CHOF 2DUCA 1BMLA 2XCNA 3HKIB 1MKWK 1AVWA 2XC0A 4ABEA 2QN5T 4UDWH 1FMGA 1S0QA 4FU7A 4LZ1H 4CH8B 2TGPZ 5AHGH 2FS8A 1QB1A 3GDVA 2HVXA 2QCYA 8GCHF 1GI6A 1QFKH 8LPRA 1F0SA 1BITA 1NRSH 3PWBA 1VR1H 2VNTA 1SGTA 2BD7A 4A7IB 3A7ZA 3M37A 4X6PA 4MPUA 3MI4A 1C2FA 1A0HB 1H4WA 1ANCA 3SV6A 2TBSA 3VXFH 5TCAA 3TVJB 3BTEE 3D23A 2HWLB 2UWLA 3STIA 4AGKA 2R3UA 1RS0A 3BTKE 3URDA 2QIQA 1J15A 4ABGA 1F5RA 2XCFA 1A0LA 3E6PH 1B5GH 2G52A 7GCHG 3UREA 4Y0YE 2GTBA 1PQAA 2OBOA 1QL9A 4ZAEA 2VGCB 1ZLRA 2PKAA 1XKBC 4ISNA 3KNXA 1GBDA 4IW4E 2BTCE 4OS4A 1YPGH 1PPBH 2F83A 4UFEH 1Q31A 4FUEA 1LCYA 4FU8A 4U01A 2ZA5A 1OP2A 1GI4A 1QJ6B 2EI6A 2NU4E 3BN9A 1P9UA 3BIUH 4J2YB 4DIIH 5PTPA 1V2OT 2BVSH 3MU0A 3S9BA 5J4QA 3RXAA 3FZDA 1RTKA 1BMNH 3E1XB 1AFQC 1GMHF 2P8OB 2Y80A 1ACBE 2VIOA 2A4GA 3LOXA 1C1VH 3PYHA 3OTJE 4X8TH 1XKAC 1C1WH 3RXIA 3RXUA 2OXSA 2Z7FE 2Z3EA 1K1JA 4YLQH 5C67A 5FBEA 2SGFE 2XC4A 1O3PB 2Z9GA 3LC5A 1TWXB 4NIWA 1ETTH 8KME2 3RXHA 2A4RA 1YCPH 3LDXH 1Q3XA 1C5RA 1GBEA 1L2EA 6GCHF 4DCDA 1GBHA 5FPSA 1C1NA 1S84A 1BMMH 2PWXA 1V2UT 3TK9A 3ZVCA 1GCTB 3SU0A 1GCTC 1EJNA 1O5DH 3SO3A 1JIRA 1LDTT 1ZRKA 2XC5A 3NXPA 1QR3E 3HGNA 2VH0A 2HRVA 2FOCA 4JYUH 3UTUH 4CREA 2BB4A 4ZHLU 2FZZA 1CGJE 3Q76A 1SQTA 2ZECA 3GY7A 1GDNA 1TMTH 1WV7H 2FOHA 3U98H 3LONA 4F4OC 3LH1A 2P8OC 1L1GA 1SR5C 3RXGA 3TK6A 1DSTA 1SGEE 1TRMA 2QXHA 3L33A 3KQEA 3LH3A 1KXBA 4H6SB 1AIXH 2P59A 3EA9A 4KGAA 3KHVA 1ID5H 1OPHB 1GHAF 2TGAA 4ZUHA 1UTMA 1TGCA 4PROA 4SGBE 1GBTA 5EW1H 1FDPA 3M5OA 5E8EH 6CHAB 5ESTE 4U30A 1EPTB 2ZFQH 3SU1A 4A1VA 2ZFRH 2FYQA 3ZZDA 3MU8A 1V2LT 3C27B 3OSYA 3V3MA 4IBLH 2J95A 1ESBA 1DANH 1H8IH 1TNIA 2FOAA 1FN8A 2BY8X 1J16A 2SGQE 3GCHB 3EAJA 4AFSA 1ELGA 5FAHA 6GCHG 5DP4A 1ZYOA 2I6QA 4A5TS 3UY9A 3MOCA 4NIYA 3ZZ5A 3RXDA 2BX3A 3LKWA 3PROA 4CHAB 1G3CA 2G5VA 1ETRH 3N7OA 3ZZAA 1GGDB 5DGJA 1C2HA 2GMTC 2ZWLH 3EA7A 2DE8A 4J1YA 2HNTE 1HIAB 1CA0B 2J92A 5DO4H 3C1KA 2F9UA 4ZKSU 2PR3A 1GJ6A 1GBKA 2CXVA 4AFZA 2UUKB 2XBVA 4RN6A 2A7CA 2GT7A 3A80A 1D6RA 4ZH8A 2ZTYA 4NWLA 2OCVB 3PTNA 1P57B 1BT7A 1P2NA 1HJ9A 1DSUA 1TB6H 1W7XH 3ZZ7A 5DP9A 3H5CB 4Q7ZA 4DGJA 1V2PT 2BVXH 1W11U 2H9TH 3VGCC 2NU3E 3V13A 4MNXA 1N1LA 3TH3H 1CA0C 1UK2A 2ILNA 1F2SE 2LNCA 1AB9B 1NFYA 2R0LA 1DLEA 1W7GH 5GDSH 1O34A 1SLWB 1IQHA 3F9EA 4B73A 2GV7A 3A88A 1S5SA 3RC5A 2B9LA 2Z6BD 2WPMS 4Z0KA 5TJXA 3UNRA 1OP0A 1UO6A 4JZIA 1A1RA 1AN1E 1C5LH 3BTGE 1YLDA 1DITH 4AYYB 1FY8E 1P2OA 3ZV8A 4CRCA 1BMAA 1FXYA 2A32A 5GCHG 2QXJA 4ZHAA 1UJ1A 2B0FA 2TRMA 2ZKSA 2TPIZ 1P05A 4Q7YA 2STAE 2H2ZA 3MNSA 5E2PA 3SV2H 2VIWA 2ZPRA 2G8TA 4HFPB 1GPZA 1MD7A 4MNVA 3PM3A 4JK5A 1XXDA 1GJ7B 1T8LA 1BRCE 3ZYDA 2BZ6H 1GJDB 2C93B 2HALA 3FAOA 3FVFB 3ZZ4A 3FP6E 1XUGA 1EAXA 1AVGH 4GPGA 2WPJS 3DT0H 1PPFE 3MYWA 1TGSZ 1YP9A 2W7UA 2WV5A 4Y7BA 4MVNA 1W13U 4Q2KA 3SU6A 2BDAA 1S83A 4GVUA 3HKJB 1O3DA 4K5ZA 2GP9B 3TJUA 4YT7H 1QB6A 2FWWA 2Y81A 1AU8A 1TLDA 1D3PB 2PHBA 4U2WA 1B7XB 3TNSA 3A87A 1DX5M 1TPSA 4NSVA 4OS7A 2XWAA 1FQ3A 4BAOB 3U1IB 3W94A 1AO5A 3BTQE 3PTBA 5EQSA 3E0NB 1L4DA 3TPIZ 1QQUA 2ZU1A 3NPSA 4ZKNU 4K69A 1F5KU 4YLUA 5E0JA 2GCHF 3F9HA 1HXFH 5GCHF 2WUBA 1J14A 5H4IB 2G4UA 4E06H 3ZVBA 1CQQA 4NIXA 2SFAA 4BNRA 4AB9A 1EAIA 1A5HA 1QURH 4X0WU 1QRWA 1SVPA 2Y6TA 1O37A 5HGGA 1C5OH 3I77A 2IOTA 1C1UH 1THRH 1EATA 1K28D 2GZ7A 1WQVH 2G51A 4X1RU 1H9HE 1JBUH 1HAVB 2PKSB 2YNAA 2F9NA 2WYJA 1ZMJA 2P94A 4E7NA 1RIWC 1SFIA 5IYTA 4ABIA 1E0FD 4QT8C 1TX7A 2ZCHP 1TNJA 2ASUB 4BTTB 1JWTA 1BHXF 3SHCH 2CMYA 4BAQB 3TGJE 2BY5X 3E16B 1C1SA 3NWUA 1HIAA 1C2IA 1NFXA 1WCZA 4D7FA 3STJA 1GI3A 1AFEH 1K1OA 1ZMNA 1O2OA 3KQCA 4ZROA 3SUFA 3BTWE 4B2AA 1Z8GA 1OKXA 2A45B 1G9IE 4Q7XA 1S6FA 1PPHE 2OD3B 4IN1A 3P8GA 4GHQA 2BM2A 5FHTA 1IQMA 1MZAA 3M36A 2PV9B 4BTIB 2BVRH 1B0EA 1XVMA 1DE7H 3A8BA 2ANYA 4ABJA 1EOJA 4GCHG 2BY7X 3ZYEA 2BD8A 1TNHA 4DT7B 1O3EA 2H9EH 1TFXA 2OC1A 1O0DH 1GJAB 4WXVA 9ESTA 3HATH 1YBWA 2QY0B 1FONA 4K60A 1MKXK 1ZPZA 4GAWA 1LHDH 3LJJA 1GBCA 2WPIS 2ESTE 2B5TB 4VGCB 1GJ8B 1LVBA 1Y3UA 1AB9C 1ZTLA 2FOEA 2OBQA 1XUKA 2ZTZA 5B6OA 2J9NA 3P92A 3RC6A 3ZVFA 1NESE 5I46H 1F0RA 2WYGA 5JB9S 1GVZA 2RG3A 3SJ9A 1TPOA 1O2NA 2YNBA 3ESTA 1MU8B 1A5IA 1EJMA 3LT3A 3VB5A 2CGAA 1H9LB 4OS6A 2FLBH 2RA3A 1O3HA 2SNVA 3RLYH 5FXLA 4UONA 1VGCC 1HBTH 1TAWA 2J94A 1C5UA 1LQEA 3ENSB 1THPB 3QN7A 1GHAG 3FFGA 1GBJA 3QTOH 4UD9H 3DUXH 4CR9A 1TONA 1GHWH 1MZDA 1O2WA 3Q3KA 4IC5A 5A8ZA 1S0RA 4TWYA 4AX9H 4MNWA 5EODA 2B7DH 1O3OA 3SV7A 4FVBA 1CBWB 2FI4E 5BPEA 1H8DH 3M3TA 2HPPH 2UUFB 1HAZB 5T6DA 1AZ8A 1K2I1 1O2RA 1ABJH 2ZGCA 1IQEA 3AAUA 4KP0A 1WU1A 3I29A 3SBKA 2XXLA 2A7HA 1O2YA 2H5CA 1Z1IA 2OQUA 2AYWA 4NSYA 1O2PA 2WPLS 1TE0A 2VIVA 2VWNA 1BRAA 5C5OA 2IN2A 5JDUB 1ESAA 2GDDA 1BZXE 3KIDU 1LPKB 1E38B 3TNTA 2BLWA 1CHOG 3QZQA 1PPEE 1NRNH 4AG2A 1EOLA 1O2UA 3NK8A 5CHAC 1LTOA 1V3XA 4WH8A 1NROH 2C8XB 4B2CA 2O8MA 1BRUP 2XBWA 3VEQB 2ZDVH 1P11E 2FIRH 5C1YA 4O97A 2ZDNA 2BLOA 4H6TA 4MPXA 2ZHQH 2I6SA 3PO1C 2C3SA 2OLGA 4TY7A 4CRAA 2F3CE 3ITIA 3PLBA 2GKVE 2PKAB 1TOCB 3V0XA 1AE5A 1BTHH 4X2VA 1DXWA 4WH6A 1L1JA 1H9IE 3PMJA 3LGTA 2BD3A 1T8MA 3L3TA 7KMEH 2Z3CA 4Y10E 1P09A 1PQ5A 1O2TA 4D8NA 4JZFH 5C3NA 4UFFH 1IQKA 3CS0A 3T5FH 1ELFA 3P70B 1NS3A 4XFQA 3DFJA 1D3TB 4JZDH 1Z1JA 1HYLA 3QX5H 4Y11E 1AE8H 1UVUH 1U6QA 3ZZ8A 3V7TA 1C4Y2 1C4V2 1ZHMA 2UWPA 3NZIA 5BRRE 3RXRA 1DT2A 1AQ7A 4B75A 1IQLA 2CN0H 2ZZUH 1P10A 1T4VH 1BRBE 4I8LA 1AFQB 2TGTA 5F8XA 1ZTKA 1DPOA 4D76A 1DUEA 1P2KA 1Y8TA 4CBOA 1C5VA 1JIMA 4MDSA 3FP7E 2ZIQH 3P8FA 1QB9A 2GDEH 2QXIA 3I78A 4TPIZ 4ESTE 1A4WH 1S6HA 1IQIA 1D3QB 1P0SH 3IITA 1UHBB 1ZZZA 1G37A 1LHGH 2F91A 1JOUB 2P16A 2P3UB 3QZRA 4NCYA 1PQ7A 3LJOA 1K9OE 2B8OH 3D65E 4Y8XA 2R0KA 4I32A 2BDGA 2V0BA 1P2QA 5FCKA 4WWYA 2AEIH 2BQWB 1O2VA 1O2IA 4B1TA 1BIOA 1T32A 4K1TA 5EPNA 2ZI2H 1KIGH 3A7WA 3ATMA 2ZHEH 3ZVDA 1D3DB 2PLXA 3SW2B 2OC8A 3TJNA 1HFDA 1VITG 1C5NH 1O3CA 3F1SB 3ATKA 5JBCS 5HM2A 3GCTF 2GD4B 2D1JA 4K2YA 1GJBB 1C1MA 2W26A 3A7VA 4Z6AH 3SV8A 2BQ6B 4BOHA 1PQ8A 2ANMH 2DE9A 2PUQH 5G4BA 1CO7E 1XX9A 1GVKB 1EZQA 3DA9B 5CE1A 2BY6X 1EASA 3T62A 1Y5UT 4NA9H 3RXFA 2J34A 5E2OA 2A31A 3TH2H 3LC3A 3M7UA 1VITH 1EXFA 3UQOA 1Y3VA 4UE7H 3A8CA 3BTHE 4K3JA 3T28A 1O35A 2JKHA 3Q00A 2A2XH 3MU4A 1TMUH 2BDIA 1W3CA 4YO9A 3SJOA 1DUAA 1TGNA 3G01A 2XWBI 3A82A 3SORA 5DG6A 1QTFA 3ATWA 3SJKA 1O3FA 1C1TA 2VGCC 5GJ4B 3AAVA 2H1UA 1ARCA 4ZHMU 1LHEH 1OXGA 1TYNA 3BG4C 1KY9A 2SGEE 1TBZH 1C2MA 1X7AC 1Y3YA 1NY22 1HAVA 1G3EA 4AN7A 1HCGA 2QV1A 3ZV9A 4IGDA 1IQGA 3KEEA 3B9FH 3RC4A 4ISIH 2ZCLP 2PFEA 1Z7KA 1LVYA 3P8OA 2ZDLA 4AG1A 2ZPSA 3KF2A 3MH7A 3RXMA 5L2ZH 4R0IA 2WPKS 1FN6A 4IMZA 3D62A 2ODYB 4WJG2 1EZSC 2ALPA 3GCOA 2H5DA 5L30H 4Q80A 1ZHPA 1VGCB 1EQ9A 1MUEB 2FP7B 1MCTA 2FOMB 3OY5U 4KTCA 3OYPA 3R3GB 2VWOA 1OP8A 2WPHS 4FUCA 5AFYH 2BQ7B 1MAXA 1CVWH 3RP2A 2FX4A 1Z8JB 3RMOH 1GHYH 2Z3DA 3LU9B 3UOUA 4K8YA 4O3UA 2Y7XA 1GMCG 4CBNA 1ELDE 5FX5A 4I8GA 1GI5A 1QY6A 1KLTA 1GI1A 4YOGA 4ISOA 1ZJDA 2BY9X 5A09A 5T3HA 3PO1B 4WMEA 1WOFA 3BEUA 4AB8A 2FYRA 2VJ1A 1NRRH 2P3TB 2XTTB 5A2MH 1UTOA 2ZU3A 2OP9A 1CGIE 2QXGA 4JZ1A 1FV9A 1VCWA 2ZU5A 1GHXH 1CHGA 4FUHA 1NT1A 1TGTA 2CV3A 3PWCA 2HNTF 4OGXA 3A81A 3E90B 5DP6A 5FBIA 4AORA 2P3FH 3Q77A 7GCHF 5T6GA 4AFQA 3SI3H 1QGFA 2FI5E 2ZFFH 3GY8A 5FPYA 1BTUA 1KLJH 1KYNA 1O3AA 4I33A 4Y8YA 4IMQA 1RJXB 1E37B 5A8YA 3GISB 4WY3A 2QC2A 4E7RG 3BG4B 4BAKB 2HNTC 1A61H 3OX7U 2Q6GA 1BB0B 4HGCA 1GMCF 1PJPA 1P12E 1RRKA 5GXPA 1TRNA 3ZZBA 2STBE 1KXEA 2BD2A 1F0UA 1QCPA 2AGEX 4ZKRU 1MCVA 5LH8A 4GLYA 1ELBA 1TX6A 1W8BH 1C1QA 1GCDA 2R2MB 1W0ZU 1HB0B 3MO9A 1GJ5H 1P2MA 1TNKA 1O3KA 2BXUH 1GHBG 1TBQH 1TNGA 1OWEA 1QJ7B 1O2ZA 1AY6H 1HXEH 4X8SH 4CRFA 3LGWA 4B2BA 1CE5A 3WY8A 1YF4A 3ZZ6A 1HAXB 2EC9H 4DY7B 5DP3A 4ZXXH 1Z71A 4ABFA 1F7ZA 3EA8A 2TIOA 1KTSB 1QBVH 1BUIA 1TA2A 2W3IA 4I8JA 5F03A 2W5EA 2G00A 2Y7ZA 1ANDA 1LHCH 3UNQA 4CRGA 4DJZB 1HNEE 2FDAA 1MKWH 2W7SA 1INCA 1SQOA 3URCA 1G3DA 2GZ9A 2NU0E 5DP7A 2FX6A 4K1EA 2Y5HA 1AZZA 4FUBA 2CHAC 1L0ZA 1ESTA 2GCTB 1ANEA 3A7TA 4XDEA 4I31A 1N8OC 1DY8A 3E91A 3P95A 1K1MA 4WXIA 3MH4A 1SPJA 1G30B 2XW9A 1XM1A 1LQDB 3GDUA 3M5NA 1BHXB 3B8JA 4AOQA 1C5TA 1GBMA 2ZU2A 3RXLA 1EUFA 1DFPA 3T27A 3FANA 5A0BA 1BTZA 1AHTH 3RXOA 4XE4A 1GVLA 2BDYA 3RU4D 1SGIB 2OINA 1KXFA 4A1XA 1IQJA 2ZEBA 5HXFA 3KQBA 2WV4A 2EI8A 1LKBA 2XRCA 3DD2H 2PTNA 1MTSA 1GBIA 1O3BA 1OX1A 2J4IA 1OWDA 1DDJA 1Z6JH 1O3IA 2H9HA 3CENA 3UUZA 2FM2A 1QA0A 1UHBA 1G2MA 4M7GA 2AFQB 4KTSA 1N8OB 3FP8E 5JBAS 4FUJA 4YM9A 1A7SA 4DG4A 1D6WA 3BEIB 4UEHH 3K2UA 2CHAB 1YKTA 3QGJA 1E35B 1CT4E 1HAYB 1O30A 1G2LA 1GMHG 1UVSH 3E8LA 1YCPM 3E0PB 1FY5A 4FU9A 2C4FH 2Q6FA 2Z9LA 5K7RA 3RXVA 5JBTA 5A0CA 2O8UA 1CGHA 4Y71A 3A7XA 3M61U 2V35A 1V2RT 5AVDA 4AZ2B 3MNBA 3GYLB 1GJ4H 3HK3B 1C9PA 1EP6A 1O5AB 4XBCA 1SB1H 3H7TA 3OY6U 5JB8S 1Z8IB 2ZNKH 3PMAB 2J38A 1YPKH 4NG9H 4Y76A 3P17H 1YCPK 5C5NA 2OUAA 4LZ4B 2UUJB 2O8LA 1DLKB 1GG6B 2ZU4A 4OS2A 4CH2B 2AIPA 2UUYA 2Y82A 4X1NU 1C2LA 2WINI 1KTTB 4ABBA 3TU7H 1D9IA 1N6XA 1EP5A 3T29A 2GX4A 3U9AH 3RXKA 1HAIH 1ZGIA 1MTVA 2ZGJA 2BOKA 4OGYA 3SU4A 2BLQA 3H7OA 4HI3A 2BHGA 1ETSH 1SG8B 2Z9IA 4IC6A 1TOMH 3K65B 4TPYA 3P8NA 1HAPH 1P3CA 1AUJA 1BTPA 1VJAU 2LPRA 6LPRA 1J17T 1SGCA 1O31A 1OYTH 1C2KA 1QJ1B 3QWCH 4A92A 3RU4E 1SLUB 3PB1E 4XBBA 3KQDA 1BTXA 1MAYA 1SL3A 1UVTH 2PSXA 3M35A 4LXBH 4HTCH 1HJAC 1S82A 1A2CH 3A86A 3K9XB 1C1OA 1P2JA 1C5MD 1EB2A 1WYKA 3F9FA 3ZZCA 2BXTH 2ZFSA 1NO9H 4OS5A 2KAIA 1EB1H 2AH4X 1P02A 3GY5A 2OC7A 1GWAA 4MPVA 1PYTD 5FCRA 3RMLH 3W95A 1UTJA 1O32A 4DIHH 1RFNA 2GVFA 3BV9B 2VINA 1C2JA 3AASA 4XSKU 2QF3A 2D8WA 1GDQA 1UCYK 4H42U 3CP7A 1V2QT 3RUOA 1GDUA 3S7HB 5EW2H 1SOZA 1ZGVA 3TGKE 2HPQH 3T26A 1C5XB 1L1NA 1YPEH 1UTKA 2ZP0H 1TBRH 2ANWA 1C5WB 3LGIA 2F9PA 3MH5A 3V12A 4A6LA 4DVAU 1OWKA 1LPGB 2ALVA 1O36A 1A0JA 4X8VH 2D26C 2PSYA 1TQ7B 1E36B 2XBXA 2AS9A 2ZGBH 4KKDA 1Z8RA 2D2DA 3UQVA 1W2KH 1Y5BT 2FPZA 3SQEE 1ZRBA 3GCHC 4K1SA 3RXQA 5AFZH 2F9VA 2WUCA 3ATIA 1YPMH 2NWNA 2ZCKP 2ZDKA 1RXPA 1GI8B 1K1LA 1TQ0B 3TJOA 1UK4A 2FOFA 2XYAA 3MU5A 1S85A 6ESTA 2FXRA 3F9GA 1F0TA 5EG4A 4H4FA 3A89A 3M5MA 1O5FH 1MQ5A 3MWIU 2FTMA 2JH6D 3F68H 1EAUA 2EI7A 3SGAE 1P9SA 2AIQA 4BTUB 5AF9H 3A83A 1ANBA 2VU8E 1FUJA 2Y5FA 3VXEH 3A7YA 1ZTJA 4Y0ZE 1TNLA 4MTBA 2BZAA 4IS5A 1EKBB 1EX3A 5I25A 1TMBH 6CHAC 3FZZA 2QF0A 3O8DA 3IWMA 5ESBA 4R8TB 1ZR0A 1NRQH 1MTWA 1NU7B 2ZQ1A 1IAUA 5EXMA 1ELEE 2SNWA 3KN2A 2BYAX 1EZXC 3M5LA 5C1XA 1V2WT 4LOYH 4JCNA 1YPJH 3KGPA 2FOBA 2BD5A 1MQ6A 1P06A 1BQYA 1YPHE 1JMOH 3BTDE 1HAOH 2RA0A 1K1PA 3MO3A 1IQFA 3UR6A 4KELA 1P01A 4K8BA 3SUEA 3L6PA 4INLA 2GCTC 1DS2E 3IG6B 4UFGH 1V2KT 3SNEA 1B0FA 4ABAA 1LHFH 5F8ZA 5ABWA 1FPCH 1VZQH 3RM0H 5F8TA 4ZMAH 1FY4A 1TX8A 4BXWA 2BMGB 1O2KA 1XUIA 8GCHG 3QLPH 2CJIA 4FUDA 1O5BB 1XUFA 4YTAA 1Y59T 2SGPE 1KSNA 1XXFA 1FIZA 1QHRB 4NGAH 1P2IA 1ZSLA 2ZFTA 1RD3B 1UTPA 1UK3A 2G4TA 4ISLA 4THNH 1HPGA 1C2DA 4ASHA 3A8DA 1LO6A 4Y7AA 1BBRK 4NA7A 3VFEA 4AFUA 3PLPA 1D4PB 2F9OA 3EGKH 1PPZA 1C9TA 5LGOA 2F9BH 4FUIA 1V2ST 1AI8H 1T8NA 3D49H 1A3BH 3O8RA 4GHTA 1OS8A 3GCTG 1L4ZA 1RGQA 4NFEA 5F6MA 1GI9B 3BIVH 3SJIA 4BAMB 3HPTB 1F5LA 2AMDA 1SSXA 1TALA 2W3KA 3LGUA 3M7QA 1K22H 3AW1A 3RXSA 5FX6A 3RDZA 1O3GA 2AMPA 2SGAA 3KL6A 3EE0B 2HLCA 3MMGA 1V2VT 3RXJA 1O2HA 2BD9A 1RTLA 1ZPCA 3QUMP 2VWMA 2C8ZB 2KAIB 4X6MA 3U1JB 3SUGA 4DOQA 3A8AA 1GBLA 2VH6A 1NTPA 1ZJKA 3ODFA 4VGCC 1YM0A 2O9QA 3RU4T 3NKKA 1BJVA 1GHVH 1SGDE 1T7CA 1O3NA 1TRYA 5GPIB 2FOGA 1DWBH 1TABE 1FY1A 1SGFA 1VCPA 2OTVA 2V3HH 4F49A 1QBNA 1OSSA 5C2ZA 2BX4A 1SQAA 5LPRA 3S69A 1SHHB 4AYVB 1O5CB 1MKXH 3SOSA 1YPHC 1CU1A 1ZHRA 3P6ZB 1KXCA 2C8WB 4X2XA 4NZQA 5EQQA 5GIBA 1UTLM 1O39A 3MO6A 2P95A 1GBFA 1SGQE 1ELVA 2ZHDA 4JYTA 1O2XA 4JYVH 4X8UH 1A5GH 1DWCH 1HLTH 1SMFE 3A85A 1HDTH 4OS1A 1A3EH 4RSPA 1O2QA 3MFJA 2NU1E 1SI5H 2UWOA 1EAWA 2BDBA 4ZXYH 1JRSA 2PTCE 2VIQA 1TPAE 1QRZA 1O2SA 4B76A 2XNIA 2A7JA 1CBWC 1AMHA 1RIWB 3VB4A 1AUTC 1O38A 4MG3A 1ZMLA 1FY3A 3ATLA 2ANKH 1MMJN 4BXSA 3ODDA 4NIVA 3E3TA 3GDSA 4I8HA 3SUDA 3ZVEA 1WSSH 4AGJA 1J8AA 1GI7B 3ZZ3A 1NFUA 3TIUA 1QL7A 1XUHA 4JMYA 3SV9A 1YGCH 1GJ9B 2AERH 2Z94A 1IQNA 1NC6A 2YOLA 1DOJA 4Y79A 3UPEA 2ULLA 2J2UA 2NU2E 1QNJA 1UVPA 1IHSH 2JETB 1O3MA 2ODPA 1VJ9U 1T8OA 2OQ5A 4ZKOU 1W0YH 5GWZA 3BSQA 1EZUC 1HJ8A 3MNCA 3QDZB 1KDQA 2VIPA 4D9QA 5LPEA 4MPWA 4YZUA 5JYIA 2QYIA 2ZPQA 1OYQA 2PUXB 1MBMA 3R0FA 2G81E 5HMAA 4O9VA 1O2GH 3UWJH 1MTNB 2QGRA 5HM9A 5CMXH 1YYY1 1F92A 4ABDA 1J9CH 3LGYA 3U8OH 2IJOB 1G32B 1HJAB 3PMBB 1UTNA 5TCCA 1O2JA 3M3VA 8ESTE 3RXEA 3MHWU 1GI0A 1RTFB 5EXLA 3SGBE 1GHBF 2O8TA 1GBAA 1E34B 2HOBA 2ZG0H 1YPLH 1V2JT 5DJ7A 2JH5D 1QBOA 1MU6B 2PW8H 1KXDA 1FI8A 1OWIA 1LVOA 3Q3YA 1N6YA 4X1SU 1SGNE 4UFDH 3TGIE 1T31A 2FO9A 2FODA 3TLOA 2G5NA 1OWHA 2QA9E 5C1UA 2GT8A 1FZZA 4X1PU 1ELCA 4I8KA 1C5QA 2Q6DA 1BA8B 3UFAA 5DPAA 5EXNA 1UMAH 4GUXA 3U8TH 2ZO3H 4XBDA 4Y8ZA 2VWLA 3EYDA 2Z9KA 1JRTA 2ZHWH 4NFFA 4BANB 4D7GA 1C5PA 1WTGH 2VIDA 3M3SA 3PMHB 1GMDF 1TA6A 1BBRH 1AWFH 1XUJA 3SN8A 3CS7A 3MH6A 3EQ0H 4WMFA 2VVVA 3T25A 4Y6DA 3SGQE 4FUGA 4YOIA 1GGDC 2FESH 1DY9A 3GCNA 5E0GA 1CT0E 1GG6C 5EPYA 1ZPBA 1T4UH 1O3JA 1QIXB 2ZF0H 2BOHB 1PPGE 2VVUA 2GZ8A 3RLWH 3SZNA 1P03A 2Z9JA 3SI4H 2BD4A 4JK6A 1GI2A 2RDLA 4YT6H 1ELTA 1O5GH 2VB0A 1KXAA 1C5ZB 4INHA 1WTHD 4BAHB 1V2NT 1G3BA 3BTFE 1IOEA 1GMDG 2XBYA 2PGBB 5EOKA 3RXTA 1FIWA 1PFXC 3HGPA 4DURA 1FAXA 3TK5A 3ZVGA 2A1DB 4E05H 3F6UH 3GY4A 1C2GA 1ZSKA 2QAAA 3RMMH 4X1QU 4GCHF 2M5TA 4DW2U 3MTYA 1S81A 4RKOB 1FLEE 1TIOA 1AVXA 4FVDA 3S0NA 1JXPA 1DVAH 1CSOE 2THFB 3VPKA 3K6ZA 3QK1A 4A1TA 2ZDAH 1SC8U 3GICB 2R9PA 1HV7A 1AKSA 4CRDA 5E0HA 2PGQB 1QRXA 4INKA 3JZ1B 1MTNC 1P3EA 3MU1A 1NPMA 3TITA 1VCQA 1BTWA 1O5EH 4IN2A 4MNYA 3SNBA 1AD8H 1Q2WA 4X6OA 5L2YH 3UNSA 5L6NH 2CF9H 4WMDA 1LVMA 1WAYB 3UOPA 3GY2A 2ZGXH 2A5IA 1GL1A 5HYOA 1G36A 3LGVA 3QTVH 2SGDE 1XVOA 3B23B 4FUFA 5A8XA 4MQAA 1BBRE 1SBWA 1C2EA 3JZ2B 5J4SA 1W14U 3M7TA 4TY6A 1O2MA 3BTTE 1NN6A 4B74A 1DWEH 5C20A 2ODQA 3VGCB 1SGFG 4JZEH 3SNCA 3VB3A 2BLVA 2TGDA 3AW0A 1EJAA 1PPCE 2BDCA 1WQSA 4XOJA 3ELAH 3BG8A 1C1RA 1THSH 3PV4A 3K6YA 3RXCA 7ESTE 1SGRE 1SHYA 3LPRA 5EU8A 3RXBA 1AKSB 4X2YA 1C4U2 3A84A 1W10U 4NA8A 3DHKH 1HUTH 1P04A 1OOKB 5T6FA 3EDXB 1VITF 3SNAA 1BOQA 4D9RA 1K21H 2RCEA 1SGPE 1ORFA 3SNDA 2GMTB 2FLRH 1PYTC 5JBBS 1HRTH 1LPZB 3GY3A 1SLVB 1NZQH 2ZDMA 3UIRA 1SFQB 3S9CA 4GSOA 1QA7A 1Y3XA 1HAHH 3KCGH 4O03A 4NZLA 3OU0A 3DFLA 3UWIA 3S7KB 1FAKH 2A5KA 3LIWA 2FMJA 4X6NA 1O2LA 1K1IA 1BTYA 1NFWA 2A2QH 1P8VC 3BTME 1DICA 3MNXA 4WVPE 2CF8H 4I7YH 1BDAA 1GBBA 3SJ8A 2K1QA 1ABIH 1V2MT 2FEQH 5DK1A 3HK6B 1O33A 5LPFA 2GGVB 4RKJB 4SGAE 1HAGE 3RM2H 2R2WU 1FPHH 3BEFB 1DM4B 1LKAA 2ZQ2A 5EGMA 1BCUH 3QO6A 2OC0A 1KLIH 1H1BA 1Y5AT
chains in the Genus database with same CATH superfamily
4CRBA 5DKMA 2C8YB 1WBGB 2A0QB 1Y3WA 3S9AA 2V3OH 1K1NA 4LK4A 2Q1JA 2JETC 1OHHD 2Y5GA 1FNIA 1FJSA 1QQ4A 1TPPA 1CA8B 1UTQA 3ZVAA 1NM6A 1UCYE 3U69H 2FTLE 4KTUA 2G55A 1A46H 3GY6A 5JPMH 3AVZA 3ZZ9A 1C5YB 2PKSC 5EQRA 5CHAB 1NU9A 2BDHA 1MD8A 2ZHFH 2O8WA 4HZHA 2ZTXA 3SQHE 4RT0A 2V6NA 4ISHH 3RMNH 2FS9A 1UCYH 5A0AE 1OWJA 1ELAA 5K0HA 1GHZA 2AGGX 1SLXB 2C90B 1AGJA 3VB6A 3U8RH 2AMQA 3BF6H 4TYDA 1COWD 7LPRA 2VBCA 1QZ8A 1GL0E 4NWKA 3GYMA 4YESB 4YOJA 1QL8A 1KDQB 2IPHA 2A5AA 4CHAC 1NRPH 3O8CA 1WUNH 1ZOMA 1IHTH 1SOTA 3SHAH 1ZSJA 2ZC9H 1YLCA 1O3LA 2H6MA 1C5SA 2EA3A 4FETA 9LPRA 1LMWB 4U32A 2A4OA 3T2NA 5B6LA 4X2WA 1HGTH 1M9UA 3O8BA 4MLFB 3UR9A 3PLKA 2FI3E 1C1PA 1CT2E 5ETXA 2R3YA 1DWDH 3SU3A 2GV6A 3Q3XA 4TWWA 2ZGHA 3SU5A 2AGIX 3RXPA 1BJUA 1YC0A 2GCHG 5DP8A 2VVCA 5DP5A 1EPTC 1MH0A 1MBQA 2P93A 4WF8A 2ZFPH 5IDKA 1SGYE 2EEKA 1W12U 2A4QA 1V2TT 3TH4H 1TGBA 1AWHB 3VB7A 3QGNB 4CR5A 3TJVA 1GJCB 5SGAE 4B71A 1V6DA 2HGTH 1MTUA 3NCLA 3DSPA 3GOVB 1EPTA 1ARBA 1Z6EA 4FXGH 4O3TA 1DXPA 2XOKD 5FPTA 3NUMA 4ABHA 1XMNB 3SU2A 2JH0D 1UVOA 1CHOF 2DUCA 1BMLA 2XCNA 3HKIB 1MKWK 1AVWA 2XC0A 4ABEA 2QN5T 4UDWH 1FMGA 1S0QA 4FU7A 4LZ1H 4CH8B 2TGPZ 5AHGH 2FS8A 1QB1A 3GDVA 2HVXA 2QCYA 8GCHF 1GI6A 1QFKH 2QE7D 8LPRA 1F0SA 1BITA 1NRSH 3PWBA 1VR1H 3OAAD 2VNTA 1SGTA 1SQRA 2BD7A 3A7ZA 4A7IB 3M37A 4X6PA 4MPUA 3MI4A 1C2FA 1A0HB 3OE7D 5C17A 1H4WA 1ANCA 3SV6A 2RFKC 2TBSA 3VXFH 2WHXA 5TCAA 3TVJB 3BTEE 3D23A 2HWLB 2UWLA 3STIA 4AGKA 2R3UA 1RS0A 3BTKE 3URDA 2QIQA 1J15A 4ABGA 1F5RA 2XCFA 1A0LA 3E6PH 1B5GH 2G52A 7GCHG 3UREA 4Y0YE 2GTBA 1PQAA 2OBOA 1QL9A 4ZAEA 2VGCB 1ZLRA 2PKAA 1XKBC 4ISNA 3KNXA 1GBDA 4IW4E 2BTCE 4OS4A 1YPGH 1PPBH 2F83A 4UFEH 1Q31A 4FUEA 1LCYA 4FU8A 4U01A 2ZA5A 4I86A 1OP2A 1GI4A 3W1EA 1QJ6B 2EI6A 2NU4E 3BN9A 1P9UA 3BIUH 4J2YB 4DIIH 5PTPA 1V2OT 2BVSH 3MU0A 3S9BA 5J4QA 3RXAA 3FZDA 1RTKA 1BMNH 3E1XB 1AFQC 1GMHF 2P8OB 2Y80A 1ACBE 2VIOA 2A4GA 3LOXA 1C1VH 3PYHA 3OTJE 4X8TH 1XKAC 1C1WH 3RXIA 3RXUA 2OXSA 2Z7FE 2Z3EA 1K1JA 4YLQH 5C67A 5FBEA 2SGFE 2XC4A 1O3PB 2Z9GA 3LC5A 1TWXB 4NIWA 1ETTH 8KME2 3RXHA 2A4RA 1YCPH 3LDXH 1Q3XA 1C5RA 1GBEA 1L2EA 2KCYA 6GCHF 4DCDA 1GBHA 5FPSA 1C1NA 1S84A 1BMMH 1KMHB 1V2UT 2PWXA 3TK9A 3ZVCA 1GCTB 3SU0A 5CHBA 1GCTC 1EJNA 1O5DH 3SO3A 1JIRA 1LDTT 4P00A 1ZRKA 2XC5A 3NXPA 1QR3E 5HIYA 3HGNA 2VH0A 2HRVA 2FOCA 4JYUH 3UTUH 4CREA 2BB4A 4ZHLU 2FZZA 1CGJE 3Q76A 1SQTA 2ZECA 3GY7A 1GDNA 1TMTH 1WV7H 2FOHA 3U98H 3LONA 4F4OC 3LH1A 2P8OC 1L1GA 1SR5C 3RXGA 3TK6A 1DSTA 1SGEE 1TRMA 2QXHA 3L33A 3KQEA 3LH3A 1KXBA 4H6SB 1AIXH 2P59A 3EA9A 4KGAA 3KHVA 1ID5H 1OPHB 1GHAF 2TGAA 3GS9A 4ZUHA 1UTMA 1TGCA 4PROA 4SGBE 1GBTA 5EW1H 1FDPA 3M5OA 5E8EH 6CHAB 3FN8A 5ESTE 4U30A 1EPTB 2ZFQH 3SU1A 4A1VA 2ZFRH 2FYQA 3ZZDA 3MU8A 1V2LT 3C27B 3OSYA 3V3MA 4IBLH 2J95A 1ESBA 1DANH 1H8IH 1TNIA 2FOAA 1FN8A 2BY8X 1J16A 2SGQE 3F2GA 3GCHB 3EAJA 4AFSA 1ELGA 5FAHA 6GCHG 5DP4A 1ZYOA 2I6QA 4A5TS 3N99A 3MOCA 3UY9A 4NIYA 3ZZ5A 3RXDA 2BX3A 3LKWA 3PROA 1W0JD 4CHAB 4M9FA 1G3CA 2G5VA 1ETRH 3N7OA 3ZZAA 1GGDB 5DGJA 1C2HA 2GMTC 3PV2A 5FL7D 2ZWLH 3EA7A 2DE8A 4J1YA 2HNTE 1HIAB 1CA0B 2J92A 5DO4H 3C1KA 2F9UA 4ZKSU 2PR3A 1GJ6A 1GBKA 2CXVA 4AFZA 2UUKB 2XBVA 4RN6A 2A7CA 2GT7A 3A80A 1D6RA 4ZH8A 2ZTYA 4NWLA 2OCVB 3PTNA 1P57B 2F4LA 1BT7A 1P2NA 1HJ9A 1DSUA 1TB6H 1W7XH 3ZZ7A 3F0OA 5DP9A 3H5CB 4Q7ZA 3FKSD 4DGJA 1V2PT 2BVXH 1W11U 2H9TH 3VGCC 2NU3E 3V13A 4MNXA 1N1LA 3U28C 3TH3H 1CA0C 1UK2A 2ILNA 1F2SE 2LNCA 1AB9B 1NFYA 2R0LA 1DLEA 1W7GH 5GDSH 2EQNA 1O34A 1SLWB 1IQHA 3F9EA 4B73A 2GV7A 3A88A 1S5SA 3RC5A 2B9LA 2Z6BD 2WPMS 4Z0KA 5TJXA 3UNRA 5F53A 1OP0A 1UO6A 4JZIA 1A1RA 1AN1E 1C5LH 2RDEA 3BTGE 1YLDA 1DITH 4AYYB 1FY8E 1P2OA 3ZV8A 4CRCA 1BMAA 1FXYA 2A32A 5GCHG 2QXJA 4ZHAA 4B6FA 1UJ1A 2B0FA 2TRMA 2ZKSA 2TPIZ 1P05A 4Q7YA 2STAE 2H2ZA 3MNSA 1VKYA 5E2PA 3SV2H 2VIWA 2ZPRA 2G8TA 4HFPB 1GPZA 1MD7A 4MNVA 3PM3A 4JK5A 1XXDA 1GJ7B 1T8LA 1BRCE 1MABB 3ZYDA 2BZ6H 1GJDB 2C93B 2HALA 3FAOA 3FVFB 3ZZ4A 4RI0A 3FP6E 1XUGA 1EAXA 1AVGH 4GPGA 2WPJS 3DT0H 1PPFE 3MYWA 1TGSZ 1YP9A 2W7UA 2WV5A 4Y7BA 4MVNA 1W13U 4Q2KA 3SU6A 2BDAA 1S83A 4GVUA 3HKJB 1O3DA 4K5ZA 2GP9B 3TJUA 4YT7H 1QB6A 2FWWA 2Y81A 1AU8A 1TLDA 1D3PB 2PHBA 4U2WA 1B7XB 3TNSA 3A87A 1DX5M 1TPSA 4NSVA 4OS7A 2XWAA 1FQ3A 4BAOB 3U1IB 3W94A 1AO5A 3BTQE 4Q63A 3PTBA 5EQSA 3E0NB 1L4DA 3TPIZ 1QQUA 2ZU1A 3NPSA 4ZKNU 4K69A 1F5KU 5KGOA 4YLUA 5E0JA 2GCHF 3F9HA 1HXFH 5GCHF 2WUBA 1J14A 5H4IB 3WWFA 2G4UA 4E06H 3ZVBA 2WZQA 1CQQA 2YMSB 4NIXA 2SFAA 4BNRA 4AB9A 1EAIA 1A5HA 1QURH 4X0WU 1QRWA 1SVPA 2Y6TA 1O37A 5HGGA 1C5OH 3I77A 5DSFA 3WW7A 2IOTA 1C1UH 1THRH 1EATA 1K28D 2GZ7A 1WQVH 1YLNA 2G51A 4X1RU 1H9HE 1E79D 1JBUH 3N7EA 1HAVB 2PKSB 2YNAA 2F9NA 2WYJA 1ZMJA 2P94A 4E7NA 1RIWC 1SFIA 5IYTA 4ABIA 1E0FD 4QT8C 1TX7A 2ZCHP 1TNJA 2ASUB 4BTTB 2KR7A 1JWTA 1BHXF 3SHCH 2CMYA 4BAQB 3TGJE 2BY5X 3E16B 1C1SA 3NWUA 1HIAA 1C2IA 1NFXA 3N7DA 1WCZA 4D7FA 3STJA 1GI3A 1AFEH 1K1OA 1ZMNA 1O2OA 3KQCA 4ZROA 3SUFA 3BTWE 4B2AA 1Z8GA 1OKXA 2A45B 2KZ4A 1G9IE 4Q7XA 1S6FA 1PPHE 2OD3B 4IN1A 3P8GA 4GHQA 2BM2A 5FHTA 1IQMA 1MZAA 2QF5A 3M36A 2PV9B 4BTIB 2BVRH 1B0EA 1XVMA 1DE7H 3A8BA 2ANYA 4ABJA 1EOJA 4GCHG 2BY7X 3ZYEA 2BD8A 1TNHA 4DT7B 1O3EA 2H9EH 3SZEA 1TFXA 2OC1A 1O0DH 1GJAB 4WXVA 9ESTA 3HATH 1YBWA 2QY0B 1FONA 4K60A 1MKXK 1ZPZA 4GAWA 1LHDH 3LJJA 1GBCA 2WPIS 3KQ5A 2ESTE 2JJ1D 2B5TB 4VGCB 1GJ8B 1LVBA 1Y3UA 1AB9C 1ZTLA 2FOEA 2OBQA 1XUKA 2ZTZA 3UAIC 5B6OA 2J9NA 3P92A 3RC6A 3ZVFA 1NESE 5I46H 1F0RA 2WYGA 5JB9S 1GVZA 2RG3A 2WV9A 3SJ9A 1TPOA 1O2NA 2YNBA 3ESTA 1MU8B 1A5IA 1EJMA 3LT3A 3VB5A 2EY4C 2CGAA 1H9LB 4OS6A 2FLBH 2RA3A 2CK3D 1O3HA 2SNVA 2W6ID 3RLYH 5FXLA 4UONA 1VGCC 1HBTH 1TAWA 2J94A 1C5UA 1LQEA 3ENSB 1THPB 3QN7A 1GHAG 3FFGA 1GBJA 3QTOH 2KM0A 4UD9H 3DUXH 4CR9A 1TONA 1GHWH 1MZDA 1O2WA 3Q3KA 4IC5A 5A8ZA 1S0RA 4TWYA 4AX9H 4MNWA 5EODA 2B7DH 1O3OA 3SV7A 4FVBA 1CBWB 2FI4E 5BPEA 1H8DH 3M3TA 2HPPH 2UUFB 1HAZB 5T6DA 1AZ8A 1K2I1 1O2RA 1ABJH 2ZGCA 1IQEA 3AAUA 4KP0A 1WU1A 3I29A 3SBKA 2XXLA 2A7HA 1O2YA 2H5CA 1Z1IA 2OQUA 3UB0A 2AYWA 4NSYA 1O2PA 2WPLS 1TE0A 2VIVA 2VWNA 1BRAA 5C5OA 2IN2A 5JDUB 1ESAA 2GDDA 1BZXE 3KIDU 1LPKB 1E38B 2K8IA 3TNTA 2BLWA 1CHOG 3QZQA 1PPEE 1NRNH 4AG2A 1EOLA 2KCAA 1O2UA 3NK8A 5CHAC 1LTOA 1V3XA 4WH8A 1NROH 2C8XB 4B2CA 2O8MA 1BRUP 3OEHD 2XBWA 3VEQB 2ZDVH 1P11E 2FIRH 5C1YA 4O97A 2ZDNA 2BLOA 4H6TA 4MPXA 2ZHQH 2I6SA 3PO1C 2C3SA 2OLGA 4TY7A 4CRAA 2F3CE 3ITIA 3PLBA 2GKVE 2PKAB 1TOCB 3V0XA 1AE5A 1BTHH 4X2VA 1DXWA 4WH6A 1L1JA 1H9IE 3PMJA 3LGTA 2BD3A 1T8MA 3L3TA 7KMEH 2Z3CA 4Y10E 1P09A 1PQ5A 1O2TA 4D8NA 4JZFH 5C3NA 4UFFH 1IQKA 3CS0A 3T5FH 1ELFA 3P70B 1NS3A 4XFQA 3DFJA 1D3TB 4JZDH 1Z1JA 1HYLA 3QX5H 4Y11E 1AE8H 1UVUH 1U6QA 3ZZ8A 3V7TA 1C4Y2 1C4V2 1ZHMA 2UWPA 3NZIA 5BRRE 3RXRA 1DT2A 1AQ7A 4B75A 1IQLA 5HKKD 2CN0H 2ZZUH 1P10A 1T4VH 1BRBE 2W6JD 4I8LA 1AFQB 2TGTA 5F8XA 1ZTKA 1DPOA 4D76A 1DUEA 1P2KA 1Y8TA 4CBOA 1C5VA 1JIMA 4MDSA 3FP7E 4AC9A 2ZIQH 3P8FA 1QB9A 2GDEH 2QXIA 3I78A 4OM9A 4TPIZ 4ESTE 2HVYB 1A4WH 1S6HA 1IQIA 1D3QB 1P0SH 3IITA 1UHBB 1ZZZA 1G37A 1LHGH 2F91A 1JOUB 2P16A 2P3UB 3QZRA 4NCYA 1PQ7A 3LJOA 1K9OE 5KECA 2B8OH 2IPQX 3D65E 4Y8XA 2R0KA 4I32A 2BDGA 2V0BA 1P2QA 5FCKA 4WWYA 2AEIH 2BQWB 1O2VA 1O2IA 4B1TA 1BIOA 1T32A 4K1TA 5EPNA 2ZI2H 1KIGH 3A7WA 3ATMA 2ZHEH 3ZVDA 1D3DB 2PLXA 3OFND 3SW2B 2OC8A 3TJNA 1HFDA 1VITG 1C5NH 2V3MA 2KX4A 1O3CA 3F1SB 3ATKA 5JBCS 5HM2A 3GCTF 2GD4B 2D1JA 4K2YA 1GJBB 1C1MA 5EJLA 2W26A 3A7VA 4Z6AH 3SV8A 2BQ6B 4BOHA 1PQ8A 2ANMH 2DE9A 2PUQH 5G4BA 1CO7E 1XX9A 1GVKB 1EZQA 3DA9B 5CE1A 2BY6X 1EASA 3T62A 1Y5UT 4NA9H 3RXFA 2J34A 5E2OA 2A31A 4HG6A 3TH2H 3LC3A 3M7UA 1VITH 1EXFA 3UQOA 1Y3VA 4UE7H 3A8CA 3BTHE 4K3JA 3T28A 1O35A 2JKHA 3Q00A 2A2XH 3MU4A 1TMUH 2BDIA 1W3CA 4YO9A 3SJOA 1DUAA 1TGNA 3KYGA 3G01A 2JIZD 2XWBI 3A82A 3EE7A 3SORA 2J98B 5DG6A 1QTFA 3ATWA 3SJKA 1O3FA 1C1TA 2VGCC 5C0TA 5GJ4B 3AAVA 2H1UA 1ARCA 4ZHMU 1LHEH 1OXGA 1TYNA 3BG4C 1KY9A 3PV5A 2AHME 2SGEE 1TBZH 1C2MA 1X7AC 1Y3YA 1NY22 1HAVA 1G3EA 4AN7A 1HCGA 2QV1A 3ZV9A 4IGDA 1IQGA 3KEEA 2QF4A 3B9FH 3RC4A 1UW7A 4ISIH 2ZCLP 2PFEA 1Z7KA 1LVYA 3P8OA 2ZDLA 4AG1A 2ZPSA 3KF2A 3MH7A 3RXMA 5L2ZH 4R0IA 2WPKS 1FN6A 4IMZA 3D62A 5T1VA 2ODYB 4WJG2 1EZSC 2ALPA 3GCOA 2H5DA 5L30H 4Q80A 1ZHPA 1VGCB 1EQ9A 1MUEB 2FP7B 1MCTA 2FOMB 3OY5U 4FOUC 4KTCA 3OYPA 3R3GB 2VWOA 1OP8A 2WPHS 2PP6A 4FUCA 5AFYH 2BQ7B 1MAXA 1CVWH 3RP2A 2FX4A 1Z8JB 3RMOH 1GHYH 2Z3DA 3LU9B 3UOUA 4K8YA 4O3UA 2Y7XA 1GMCG 4CBNA 1ELDE 5FX5A 4I8GA 1GI5A 2V7QD 1QY6A 1KLTA 1GI1A 4YOGA 4ISOA 1ZJDA 2BY9X 5A09A 5T3HA 3PO1B 4WMEA 1WOFA 3BEUA 4AB8A 2FYRA 2VJ1A 1NRRH 2P3TB 2XTTB 5A2MH 1UTOA 2ZU3A 2GJGA 2OP9A 1CGIE 2QXGA 4JZ1A 1FV9A 2JDID 1VCWA 2ZU5A 1GHXH 1CHGA 3WWBA 4F48B 4FUHA 1NT1A 1TGTA 2CV3A 3F2HA 3PWCA 2HNTF 4DT4A 4OGXA 3A81A 3E90B 5DP6A 5FBIA 4AORA 2P3FH 3Q77A 7GCHF 5T6GA 4AFQA 3SI3H 1QGFA 2FI5E 2ZFFH 3GY8A 5FPYA 1BTUA 1KLJH 1KYNA 1O3AA 4I33A 4Y8YA 4IMQA 1RJXB 1E37B 5A8YA 3GISB 4WY3A 2QC2A 4E7RG 5KEDA 3BG4B 4BAKB 5CDFE 2HNTC 1A61H 3OX7U 2Q6GA 1BB0B 4HGCA 5EIYA 1GMCF 1PJPA 1P12E 1RRKA 5GXPA 1TRNA 3ZZBA 2STBE 1KXEA 2BD2A 3F0PA 1F0UA 1QCPA 2AGEX 4ZKRU 1MCVA 5LH8A 4GLYA 1ELBA 1TX6A 1W8BH 1C1QA 1GCDA 2R2MB 1W0ZU 1HB0B 3MO9A 1GJ5H 1P2MA 1TNKA 1O3KA 2BXUH 1GHBG 1TBQH 1TNGA 1OWEA 1QJ7B 1O2ZA 1AY6H 1HXEH 4X8SH 4CRFA 3LGWA 4B2BA 1CE5A 3WY8A 1YF4A 3ZZ6A 1HAXB 2EC9H 4DY7B 5DP3A 4ZXXH 1Z71A 4ABFA 1F7ZA 3EA8A 2TIOA 1KTSB 1QBVH 1BUIA 1TA2A 2W3IA 4I8JA 5F03A 2W5EA 2G00A 2Y7ZA 1ANDA 1LHCH 3UNQA 4CRGA 4DJZB 1HNEE 2FDAA 1MKWH 2W7SA 1INCA 1SQOA 3URCA 1G3DA 4RT1A 2GZ9A 2NU0E 5DP7A 2FX6A 4K1EA 2Y5HA 1AZZA 4FUBA 2CHAC 1L0ZA 1ESTA 2GCTB 1ANEA 3A7TA 4XDEA 4I31A 1N8OC 1DY8A 3OTPA 3E91A 3P95A 1K1MA 4WXIA 3MH4A 1SPJA 1G30B 2XW9A 1XM1A 1LQDB 3GDUA 3M5NA 1BHXB 3H09A 3FOAA 3B8JA 4AOQA 1C5TA 1GBMA 2ZU2A 3RXLA 1EUFA 1DFPA 3T27A 3FANA 5A0BA 1BTZA 1AHTH 3RXOA 4XE4A 1W0KD 1GVLA 2BDYA 3RU4D 1SGIB 2OINA 1KXFA 4A1XA 1IQJA 2ZEBA 5HXFA 3KQBA 2WV4A 2EI8A 1LKBA 2XRCA 3DD2H 2PTNA 1MTSA 1GBIA 1O3BA 1OX1A 2J4IA 1OWDA 1DDJA 1Z6JH 1O3IA 2H9HA 3CENA 3UUZA 2FM2A 1QA0A 1UHBA 1G2MA 4M7GA 2AFQB 4KTSA 1N8OB 3FP8E 5JBAS 4FUJA 4YM9A 1A7SA 1EFRD 4B6EA 4DG4A 1D6WA 3BEIB 4UEHH 3K2UA 2CHAB 1YKTA 3QGJA 1E35B 1CT4E 1HAYB 5GNDA 1O30A 1G2LA 2F43B 1GMHG 1UVSH 1FX0B 3E8LA 1YCPM 3E0PB 5C94A 1FY5A 4FU9A 2C4FH 2Q6FA 2Z9LA 5K7RA 3RXVA 5JBTA 3F2FA 5A0CA 2O8UA 1CGHA 4Y71A 3A7XA 3M61U 2V35A 1V2RT 5AVDA 4AZ2B 3MNBA 3GYLB 1GJ4H 3HK3B 1C9PA 1EP6A 1O5AB 4XBCA 1SB1H 3H7TA 3OY6U 5JB8S 1Z8IB 3DSOA 2ZNKH 3PMAB 1H8ED 2J38A 1YPKH 4NG9H 4Y76A 3P17H 1YCPK 5C5NA 2OUAA 4LZ4B 2UUJB 2O8LA 1DLKB 1GG6B 2ZU4A 4OS2A 4CH2B 2AIPA 2UUYA 2Y82A 4X1NU 1C2LA 2WINI 1KTTB 1S6LA 4ABBA 3TU7H 1D9IA 1N6XA 1EP5A 3T29A 2GX4A 3U9AH 2K0QA 3RXKA 1HAIH 1ZGIA 1MTVA 2ZGJA 2BOKA 2L74A 4OGYA 3SU4A 2BLQA 3H7OA 4HI3A 2BHGA 1ETSH 1SG8B 2Z9IA 3OEED 4IC6A 1TOMH 3K65B 4TPYA 3P8NA 1HAPH 1P3CA 1AUJA 1BTPA 1VJAU 2LPRA 6LPRA 1J17T 1SGCA 1O31A 1OYTH 1C2KA 1QJ1B 3QWCH 4F55A 4A92A 3RU4E 1SLUB 3PB1E 3FO8D 4XBBA 3KQDA 1BTXA 1MAYA 2WSSD 1SL3A 1UVTH 2PSXA 3M35A 4LXBH 4HTCH 5IK2D 1HJAC 1S82A 1A2CH 3A86A 3K9XB 1C1OA 1P2JA 3VG8A 1C5MD 1EB2A 1WYKA 3F9FA 3ZZCA 2BXTH 2ZFSA 1NO9H 4OS5A 2KAIA 1EB1H 2AH4X 1P02A 3GY5A 2OC7A 1GWAA 4MPVA 1PYTD 5FCRA 3RMLH 3W95A 1UTJA 1O32A 4DIHH 1RFNA 2GVFA 3BV9B 2VINA 1C2JA 3AASA 4XSKU 2QF3A 2D8WA 1GDQA 1UCYK 4H42U 3CP7A 1V2QT 3RUOA 1GDUA 3S7HB 5EW2H 1SOZA 1YWUA 1ZGVA 3TGKE 2HPQH 3T26A 1C5XB 1L1NA 1YPEH 1UTKA 2ZP0H 1TBRH 2ANWA 1C5WB 3LGIA 2F9PA 3MH5A 3V12A 4A6LA 4DVAU 1OWKA 1LPGB 2ALVA 1O36A 1A0JA 4X8VH 2D26C 2PSYA 2LELA 1TQ7B 1E36B 2XBXA 2AS9A 2ZGBH 4KKDA 1Z8RA 2D2DA 3UQVA 1W2KH 1Y5BT 2FPZA 3SQEE 1ZRBA 3GCHC 4K1SA 3RXQA 5AFZH 3NRLA 2F9VA 2WUCA 3ATIA 3PRDA 2XNDD 1YPMH 2NWNA 2ZCKP 2ZDKA 1RXPA 2J5UA 1GI8B 1K1LA 1TQ0B 3TJOA 1UK4A 2FOFA 2XYAA 3MU5A 1S85A 1SKYE 6ESTA 2FXRA 3F9GA 1F0TA 5EG4A 4H4FA 3A89A 3M5MA 1O5FH 1MQ5A 3MWIU 2FTMA 2JH6D 3F68H 1EAUA 2EI7A 3SGAE 1P9SA 2AIQA 4BTUB 5AF9H 3A83A 1ANBA 2VU8E 1FUJA 2Y5FA 3VXEH 3A7YA 1ZTJA 4Y0ZE 1TNLA 4MTBA 2BZAA 4IS5A 1EKBB 1EX3A 5I25A 1TMBH 6CHAC 3FZZA 2QF0A 3O8DA 3IWMA 5ESBA 3CNRA 4R8TB 1ZR0A 1NRQH 1MTWA 1NU7B 2ZQ1A 1IAUA 3MQKC 5EXMA 1ELEE 2SNWA 3KN2A 2BYAX 1EZXC 3M5LA 5C1XA 4YXWD 1V2WT 4LOYH 4JCNA 1YPJH 3KGPA 2FOBA 2BD5A 1MQ6A 1P06A 1BQYA 1YPHE 1JMOH 3BTDE 1HAOH 2RA0A 1K1PA 3MO3A 1IQFA 3UR6A 4KELA 3ZIAD 1P01A 4K8BA 5HIZA 3SUEA 3L6PA 4INLA 2GCTC 1DS2E 2J98A 3IG6B 4UFGH 1V2KT 3SNEA 1B0FA 4ABAA 1LHFH 4P02A 5F8ZA 4ACBA 5ABWA 1FPCH 2YMSD 1VZQH 3RM0H 5F8TA 4ZMAH 4ASUD 1FY4A 1TX8A 4BXWA 2BMGB 1O2KA 1XUIA 8GCHG 3QLPH 2CJIA 4FUDA 3AK5A 1O5BB 1XUFA 4YTAA 1Y59T 2SGPE 1KSNA 1XXFA 1FIZA 1QHRB 4NGAH 1NBMD 1P2IA 1ZSLA 2ZFTA 1RD3B 1UTPA 1UK3A 2G4TA 4ISLA 4THNH 1HPGA 1C2DA 4ASHA 3A8DA 1LO6A 4Y7AA 1BBRK 4NA7A 3VFEA 2HLDD 4AFUA 3PLPA 1D4PB 2F9OA 3EGKH 1PPZA 1C9TA 5LGOA 2F9BH 4FUIA 1V2ST 1AI8H 1T8NA 3D49H 1A3BH 3O8RA 4GHTA 1OS8A 3GCTG 1L4ZA 1RGQA 4NFEA 5F6MA 1GI9B 3BIVH 3SJIA 4BAMB 3HPTB 1F5LA 2AMDA 1SSXA 1TALA 2W3KA 3LGUA 3M7QA 1K22H 3AW1A 3RXSA 5FX6A 3RDZA 1O3GA 2AMPA 2SGAA 3KL6A 3EE0B 2HLCA 3MMGA 1V2VT 3RXJA 1O2HA 2BD9A 1RTLA 1ZPCA 3QUMP 2VWMA 2C8ZB 2KAIB 4X6MA 3U1JB 3SUGA 4DOQA 3A8AA 1GBLA 2VH6A 1NTPA 1ZJKA 3ODFA 4VGCC 1YM0A 2O9QA 3RU4T 3NKKA 1BJVA 1GHVH 1SGDE 1T7CA 1O3NA 1TRYA 5GPIB 2FOGA 1DWBH 1TABE 1FY1A 1SGFA 1VCPA 2OTVA 2V3HH 4F49A 2KCPA 1QBNA 1OSSA 5C2ZA 2BX4A 1SQAA 5LPRA 3S69A 1SHHB 4AYVB 1O5CB 1MKXH 3SOSA 1YPHC 1CU1A 1ZHRA 3P6ZB 1KXCA 2C8WB 4X2XA 4NZQA 5EQQA 5GIBA 1UTLM 1O39A 3MO6A 2P95A 1GBFA 1SGQE 1ELVA 2ZHDA 4JYTA 1O2XA 4JYVH 4X8UH 1A5GH 1E1RD 1DWCH 1HLTH 1SMFE 3A85A 1HDTH 4OS1A 1A3EH 4RSPA 1O2QA 3MFJA 2NU1E 1SI5H 2UWOA 1EAWA 2IJD1 2BDBA 4ZXYH 2KCOA 1JRSA 2PTCE 2VIQA 1TPAE 1QRZA 1O2SA 4B76A 2XNIA 2A7JA 1CBWC 1AMHA 1RIWB 3VB4A 1AUTC 1O38A 4MG3A 1ZMLA 1FY3A 3ATLA 2ANKH 1MMJN 4BXSA 3ODDA 4NIVA 3E3TA 3GDSA 4I8HA 3SUDA 3ZVEA 5DN6D 1WSSH 4AGJA 1J8AA 1GI7B 3ZZ3A 1NFUA 3DCLA 3TIUA 1QL7A 1XUHA 4JMYA 3SV9A 1YGCH 1GJ9B 2AERH 2Z94A 1IQNA 1NC6A 4ZCNA 2YOLA 1DOJA 4Y79A 3SYJA 3UPEA 2ULLA 2J2UA 2NU2E 1QNJA 2OK5A 3F3BA 1UVPA 2YMSC 1IHSH 2JETB 1O3MA 2ODPA 1VJ9U 1T8OA 2OQ5A 4ZKOU 1W0YH 5GWZA 3BSQA 1EZUC 1HJ8A 3MNCA 3QDZB 1KDQA 2VIPA 4D9QA 5LPEA 4MPWA 1WXRA 4YZUA 5JYIA 2QYIA 2ZPQA 1OYQA 2PUXB 1MBMA 3R0FA 2G81E 5HMAA 4O9VA 1O2GH 3UWJH 1MTNB 2QGRA 5HM9A 5CMXH 1YYY1 1F92A 4ABDA 1J9CH 3LGYA 3U8OH 2IJOB 1G32B 1HJAB 3PMBB 1UTNA 1YY3A 5TCCA 1O2JA 3M3VA 8ESTE 3RXEA 3MHWU 1GI0A 1NBME 1RTFB 5EXLA 3SGBE 1GHBF 2M2AA 3DSGA 2O8TA 1GBAA 1E34B 2HOBA 2ZG0H 1YPLH 4Z1MD 1V2JT 5DJ7A 2JH5D 1QBOA 1MU6B 2PW8H 1KXDA 1FI8A 1OWIA 1LVOA 3Q3YA 1N6YA 4X1SU 1SGNE 4UFDH 3TGIE 1T31A 2FO9A 2FODA 3TLOA 2G5NA 1OWHA 2QA9E 5C1UA 2GT8A 1FZZA 4X1PU 1ELCA 4I8KA 1C5QA 2Q6DA 1BA8B 3UFAA 5DPAA 5EXNA 1UMAH 4GUXA 3U8TH 2ZO3H 4TSFD 4Q4LA 4XBDA 4Y8ZA 2VWLA 3EYDA 2Z9KA 1JRTA 2ZHWH 4NFFA 4BANB 4D7GA 1C5PA 1WTGH 2VIDA 3M3SA 3PMHB 1GMDF 1TA6A 1BBRH 1AWFH 1XUJA 3SN8A 3CS7A 3MH6A 3EQ0H 4WMFA 2VVVA 3T25A 4Y6DA 3SGQE 4FUGA 4YOIA 1GGDC 2FESH 1DY9A 3GCNA 5E0GA 1CT0E 1GG6C 5EPYA 1ZPBA 1T4UH 1O3JA 1QIXB 2ZF0H 2BOHB 1PPGE 2VVUA 2LP6A 2GZ8A 1E1QD 3RLWH 3SZNA 1P03A 5EJZA 2Z9JA 3SI4H 2BD4A 4JK6A 1GI2A 2RDLA 4YT6H 1ELTA 1O5GH 2VB0A 1KXAA 1C5ZB 4INHA 1WTHD 4BAHB 1V2NT 1G3BA 3BTFE 1IOEA 1GMDG 2XBYA 2PGBB 5EOKA 3RXTA 1FIWA 1PFXC 3HGPA 4DURA 1FAXA 3TK5A 3ZVGA 2A1DB 4E05H 3F6UH 3GY4A 3PRBA 1C2GA 1ZSKA 1WDIA 2QAAA 3RMMH 4X1QU 4GCHF 2M5TA 4DW2U 3MTYA 1S81A 4RKOB 1FLEE 1TIOA 1AVXA 4XRNA 4FVDA 5EJ1A 3S0NA 1JXPA 1DVAH 1CSOE 2THFB 3VPKA 3K6ZA 3KYFA 4ACAA 3QK1A 4A1TA 2ZDAH 1SC8U 3GICB 2R9PA 1HV7A 1AKSA 2L6OA 4CRDA 5E0HA 2PGQB 2WPDD 1QRXA 4INKA 3JZ1B 1MTNC 1P3EA 3MU1A 1NPMA 3TITA 1VCQA 1BTWA 1O5EH 4IN2A 4MNYA 3SNBA 1AD8H 1Q2WA 4X6OA 5L2YH 3UNSA 2JJ2D 5L6NH 2CF9H 4WMDA 1LVMA 1WAYB 3UOPA 3GY2A 2ZGXH 2A5IA 1GL1A 5HYOA 1G36A 3LGVA 3QTVH 2SGDE 1XVOA 3B23B 4FUFA 5A8XA 4MQAA 1BBRE 1SBWA 1C2EA 3JZ2B 5J4SA 1W14U 3M7TA 4TY6A 1O2MA 3BTTE 1NN6A 4B74A 1DWEH 5C20A 2ODQA 3VGCB 1SGFG 4JZEH 3SNCA 3VB3A 2BLVA 2TGDA 3AW0A 1EJAA 1PPCE 4TT3D 2BDCA 1WQSA 4XOJA 3ELAH 3BG8A 1C1RA 1THSH 3PV4A 3K6YA 3RXCA 7ESTE 1SGRE 1SHYA 2KFWA 1H8HD 3LPRA 5EU8A 3RXBA 1AKSB 4X2YA 1C4U2 3A84A 1W10U 4NA8A 3DHKH 1HUTH 1P04A 1OOKB 5T6FA 3EDXB 1VITF 3SNAA 1BOQA 4D9RA 1K21H 2RCEA 1SGPE 1ORFA 3SNDA 2GMTB 2FLRH 1PYTC 5JBBS 1HRTH 1LPZB 3GY3A 1SLVB 1NZQH 2ZDMA 3UIRA 1SFQB 3S9CA 4GSOA 1QA7A 1Y3XA 1HAHH 3KCGH 4O03A 1BMFD 4NZLA 3OU0A 3DFLA 3UWIA 3S7KB 5C0UA 1FAKH 2A5KA 3LIWA 2FMJA 2J97A 4X6NA 1O2LA 1K1IA 1BTYA 1NFWA 2A2QH 1P8VC 3BTME 1DICA 3MNXA 4WVPE 2CF8H 4I7YH 1BDAA 1GBBA 3SJ8A 2K1QA 1ABIH 1V2MT 2FEQH 5DK1A 3HK6B 1O33A 5LPFA 1K0HA 2GGVB 4RKJB 4SGAE 1HAGE 3RM2H 2R2WU 1FPHH 3BEFB 1DM4B 1LKAA 2ZQ2A 5EGMA 1BCUH 4XD7D 3QO6A 2OC0A 1KLIH 1H1BA 1Y5AT
chains in the Genus database with same CATH topology
4CRBA 5DKMA 2C8YB 1WBGB 2A0QB 1Y3WA 3S9AA 2V3OH 1K1NA 4LK4A 2Q1JA 2JETC 2Y5GA 1FNIA 1FJSA 1QQ4A 1TPPA 1CA8B 1UTQA 3ZVAA 1NM6A 1UCYE 3U69H 2FTLE 4KTUA 2G55A 1A46H 3GY6A 5JPMH 3AVZA 3ZZ9A 1C5YB 2PKSC 5EQRA 5CHAB 1NU9A 2BDHA 1MD8A 2ZHFH 2O8WA 4HZHA 2ZTXA 3SQHE 2V6NA 4ISHH 3RMNH 2FS9A 1UCYH 5A0AE 1OWJA 1ELAA 5K0HA 1GHZA 2AGGX 1SLXB 2C90B 1AGJA 3VB6A 3U8RH 2AMQA 3BF6H 4TYDA 7LPRA 1GL0E 4NWKA 3GYMA 4YESB 4YOJA 1QL8A 1KDQB 2IPHA 2A5AA 4CHAC 1NRPH 3O8CA 1WUNH 1ZOMA 1IHTH 1SOTA 3SHAH 1ZSJA 2ZC9H 1YLCA 1O3LA 2H6MA 1C5SA 2EA3A 9LPRA 1LMWB 4U32A 2A4OA 3T2NA 4X2WA 1HGTH 1M9UA 3O8BA 4MLFB 3UR9A 3PLKA 2FI3E 1C1PA 1CT2E 5ETXA 2R3YA 1DWDH 3SU3A 2GV6A 3Q3XA 4TWWA 2ZGHA 3SU5A 2AGIX 3RXPA 1BJUA 1YC0A 2GCHG 5DP8A 2VVCA 5DP5A 1EPTC 1MH0A 1MBQA 2P93A 4WF8A 2ZFPH 5IDKA 1SGYE 2EEKA 1W12U 2A4QA 1V2TT 3TH4H 1TGBA 1AWHB 3VB7A 3QGNB 4CR5A 3TJVA 1GJCB 5SGAE 4B71A 1V6DA 2HGTH 1MTUA 3NCLA 3GOVB 1EPTA 1ARBA 1Z6EA 4FXGH 4O3TA 1DXPA 5FPTA 3NUMA 4ABHA 1XMNB 3SU2A 2JH0D 1UVOA 1CHOF 2DUCA 1BMLA 2XCNA 3HKIB 1MKWK 1AVWA 2XC0A 4ABEA 2QN5T 4UDWH 1FMGA 1S0QA 4FU7A 4LZ1H 4CH8B 2TGPZ 5AHGH 2FS8A 1QB1A 3GDVA 2HVXA 2QCYA 8GCHF 1GI6A 1QFKH 8LPRA 1F0SA 1BITA 1NRSH 3PWBA 1VR1H 2VNTA 1SGTA 2BD7A 4A7IB 3A7ZA 3M37A 4X6PA 4MPUA 3MI4A 1C2FA 1A0HB 1H4WA 1ANCA 3SV6A 2TBSA 3VXFH 5TCAA 3TVJB 3BTEE 3D23A 2HWLB 2UWLA 3STIA 4AGKA 2R3UA 1RS0A 3BTKE 3URDA 2QIQA 1J15A 4ABGA 1F5RA 2XCFA 1A0LA 3E6PH 1B5GH 2G52A 7GCHG 3UREA 4Y0YE 2GTBA 1PQAA 2OBOA 1QL9A 4ZAEA 2VGCB 1ZLRA 2PKAA 1XKBC 4ISNA 3KNXA 1GBDA 4IW4E 2BTCE 4OS4A 1YPGH 1PPBH 2F83A 4UFEH 1Q31A 4FUEA 1LCYA 4FU8A 4U01A 2ZA5A 1OP2A 1GI4A 1QJ6B 2EI6A 2NU4E 3BN9A 1P9UA 3BIUH 4J2YB 4DIIH 5PTPA 1V2OT 2BVSH 3MU0A 3S9BA 5J4QA 3RXAA 3FZDA 1RTKA 1BMNH 3E1XB 1AFQC 1GMHF 2P8OB 2Y80A 1ACBE 2VIOA 2A4GA 3LOXA 1C1VH 3PYHA 3OTJE 4X8TH 1XKAC 1C1WH 3RXIA 3RXUA 2OXSA 2Z7FE 2Z3EA 1K1JA 4YLQH 5C67A 5FBEA 2SGFE 2XC4A 1O3PB 2Z9GA 3LC5A 1TWXB 4NIWA 1ETTH 8KME2 3RXHA 2A4RA 1YCPH 3LDXH 1Q3XA 1C5RA 1GBEA 1L2EA 6GCHF 4DCDA 1GBHA 5FPSA 1C1NA 1S84A 1BMMH 2PWXA 1V2UT 3TK9A 3ZVCA 1GCTB 3SU0A 1GCTC 1EJNA 1O5DH 3SO3A 1JIRA 1LDTT 1ZRKA 2XC5A 3NXPA 1QR3E 3HGNA 2VH0A 2HRVA 2FOCA 4JYUH 3UTUH 4CREA 2BB4A 4ZHLU 2FZZA 1CGJE 3Q76A 1SQTA 2ZECA 3GY7A 1GDNA 1TMTH 1WV7H 2FOHA 3U98H 3LONA 4F4OC 3LH1A 2P8OC 1L1GA 1SR5C 3RXGA 3TK6A 1DSTA 1SGEE 1TRMA 2QXHA 3L33A 3KQEA 3LH3A 1KXBA 4H6SB 1AIXH 2P59A 3EA9A 4KGAA 3KHVA 1ID5H 1OPHB 1GHAF 2TGAA 4ZUHA 1UTMA 1TGCA 4PROA 4SGBE 1GBTA 5EW1H 1FDPA 3M5OA 5E8EH 6CHAB 5ESTE 4U30A 1EPTB 2ZFQH 3SU1A 4A1VA 2ZFRH 2FYQA 3ZZDA 3MU8A 1V2LT 3C27B 3OSYA 3V3MA 4IBLH 2J95A 1ESBA 1DANH 1H8IH 1TNIA 2FOAA 1FN8A 2BY8X 1J16A 2SGQE 3GCHB 3EAJA 4AFSA 1ELGA 5FAHA 6GCHG 5DP4A 1ZYOA 2I6QA 4A5TS 3UY9A 3MOCA 4NIYA 3ZZ5A 3RXDA 2BX3A 3LKWA 3PROA 4CHAB 1G3CA 2G5VA 1ETRH 3N7OA 3ZZAA 1GGDB 5DGJA 1C2HA 2GMTC 2ZWLH 3EA7A 2DE8A 4J1YA 2HNTE 1HIAB 1CA0B 2J92A 5DO4H 3C1KA 2F9UA 4ZKSU 2PR3A 1GJ6A 1GBKA 2CXVA 4AFZA 2UUKB 2XBVA 4RN6A 2A7CA 2GT7A 3A80A 1D6RA 4ZH8A 2ZTYA 4NWLA 2OCVB 3PTNA 1P57B 1BT7A 1P2NA 1HJ9A 1DSUA 1TB6H 1W7XH 3ZZ7A 5DP9A 3H5CB 4Q7ZA 4DGJA 1V2PT 2BVXH 1W11U 2H9TH 3VGCC 2NU3E 3V13A 4MNXA 1N1LA 3TH3H 1CA0C 1UK2A 2ILNA 1F2SE 2LNCA 1AB9B 1NFYA 2R0LA 1DLEA 1W7GH 5GDSH 1O34A 1SLWB 1IQHA 3F9EA 4B73A 2GV7A 3A88A 1S5SA 3RC5A 2B9LA 2Z6BD 2WPMS 4Z0KA 5TJXA 3UNRA 1OP0A 1UO6A 4JZIA 1A1RA 1AN1E 1C5LH 3BTGE 1YLDA 1DITH 4AYYB 1FY8E 1P2OA 3ZV8A 4CRCA 1BMAA 1FXYA 2A32A 5GCHG 2QXJA 4ZHAA 1UJ1A 2B0FA 2TRMA 2ZKSA 2TPIZ 1P05A 4Q7YA 2STAE 2H2ZA 3MNSA 5E2PA 3SV2H 2VIWA 2ZPRA 2G8TA 4HFPB 1GPZA 1MD7A 4MNVA 3PM3A 4JK5A 1XXDA 1GJ7B 1T8LA 1BRCE 3ZYDA 2BZ6H 1GJDB 2C93B 2HALA 3FAOA 3FVFB 3ZZ4A 3FP6E 1XUGA 1EAXA 1AVGH 4GPGA 2WPJS 3DT0H 1PPFE 3MYWA 1TGSZ 1YP9A 2W7UA 2WV5A 4Y7BA 4MVNA 1W13U 4Q2KA 3SU6A 2BDAA 1S83A 4GVUA 3HKJB 1O3DA 4K5ZA 2GP9B 3TJUA 4YT7H 1QB6A 2FWWA 2Y81A 1AU8A 1TLDA 1D3PB 2PHBA 4U2WA 1B7XB 3TNSA 3A87A 1DX5M 1TPSA 4NSVA 4OS7A 2XWAA 1FQ3A 4BAOB 3U1IB 3W94A 1AO5A 3BTQE 3PTBA 5EQSA 3E0NB 1L4DA 3TPIZ 1QQUA 2ZU1A 3NPSA 4ZKNU 4K69A 1F5KU 4YLUA 5E0JA 2GCHF 3F9HA 1HXFH 5GCHF 2WUBA 1J14A 5H4IB 2G4UA 4E06H 3ZVBA 1CQQA 4NIXA 2SFAA 4BNRA 4AB9A 1EAIA 1A5HA 1QURH 4X0WU 1QRWA 1SVPA 2Y6TA 1O37A 5HGGA 1C5OH 3I77A 2IOTA 1C1UH 1THRH 1EATA 1K28D 2GZ7A 1WQVH 2G51A 4X1RU 1H9HE 1JBUH 1HAVB 2PKSB 2YNAA 2F9NA 2WYJA 1ZMJA 2P94A 4E7NA 1RIWC 1SFIA 5IYTA 4ABIA 1E0FD 4QT8C 1TX7A 2ZCHP 1TNJA 2ASUB 4BTTB 1JWTA 1BHXF 3SHCH 2CMYA 4BAQB 3TGJE 2BY5X 3E16B 1C1SA 3NWUA 1HIAA 1C2IA 1NFXA 1WCZA 4D7FA 3STJA 1GI3A 1AFEH 1K1OA 1ZMNA 1O2OA 3KQCA 4ZROA 3SUFA 3BTWE 4B2AA 1Z8GA 1OKXA 2A45B 1G9IE 4Q7XA 1S6FA 1PPHE 2OD3B 4IN1A 3P8GA 4GHQA 2BM2A 5FHTA 1IQMA 1MZAA 3M36A 2PV9B 4BTIB 2BVRH 1B0EA 1XVMA 1DE7H 3A8BA 2ANYA 4ABJA 1EOJA 4GCHG 2BY7X 3ZYEA 2BD8A 1TNHA 4DT7B 1O3EA 2H9EH 1TFXA 2OC1A 1O0DH 1GJAB 4WXVA 9ESTA 3HATH 1YBWA 2QY0B 1FONA 4K60A 1MKXK 1ZPZA 4GAWA 1LHDH 3LJJA 1GBCA 2WPIS 2ESTE 2B5TB 4VGCB 1GJ8B 1LVBA 1Y3UA 1AB9C 1ZTLA 2FOEA 2OBQA 1XUKA 2ZTZA 5B6OA 2J9NA 3P92A 3RC6A 3ZVFA 1NESE 5I46H 1F0RA 2WYGA 5JB9S 1GVZA 2RG3A 3SJ9A 1TPOA 1O2NA 2YNBA 3ESTA 1MU8B 1A5IA 1EJMA 3LT3A 3VB5A 2CGAA 1H9LB 4OS6A 2FLBH 2RA3A 1O3HA 2SNVA 3RLYH 5FXLA 4UONA 1VGCC 1HBTH 1TAWA 2J94A 1C5UA 1LQEA 3ENSB 1THPB 3QN7A 1GHAG 3FFGA 1GBJA 3QTOH 4UD9H 3DUXH 4CR9A 1TONA 1GHWH 1MZDA 1O2WA 3Q3KA 4IC5A 5A8ZA 1S0RA 4TWYA 4AX9H 4MNWA 5EODA 2B7DH 1O3OA 3SV7A 4FVBA 1CBWB 2FI4E 5BPEA 1H8DH 3M3TA 2HPPH 2UUFB 1HAZB 5T6DA 1AZ8A 1K2I1 1O2RA 1ABJH 2ZGCA 1IQEA 3AAUA 4KP0A 1WU1A 3I29A 3SBKA 2XXLA 2A7HA 1O2YA 2H5CA 1Z1IA 2OQUA 2AYWA 4NSYA 1O2PA 2WPLS 1TE0A 2VIVA 2VWNA 1BRAA 5C5OA 2IN2A 5JDUB 1ESAA 2GDDA 1BZXE 3KIDU 1LPKB 1E38B 3TNTA 2BLWA 1CHOG 3QZQA 1PPEE 1NRNH 4AG2A 1EOLA 1O2UA 3NK8A 5CHAC 1LTOA 1V3XA 4WH8A 1NROH 2C8XB 4B2CA 2O8MA 1BRUP 2XBWA 3VEQB 2ZDVH 1P11E 2FIRH 5C1YA 4O97A 2ZDNA 2BLOA 4H6TA 4MPXA 2ZHQH 2I6SA 3PO1C 2C3SA 2OLGA 4TY7A 4CRAA 2F3CE 3ITIA 3PLBA 2GKVE 2PKAB 1TOCB 3V0XA 1AE5A 1BTHH 4X2VA 1DXWA 4WH6A 1L1JA 1H9IE 3PMJA 3LGTA 2BD3A 1T8MA 3L3TA 7KMEH 2Z3CA 4Y10E 1P09A 1PQ5A 1O2TA 4D8NA 4JZFH 5C3NA 4UFFH 1IQKA 3CS0A 3T5FH 1ELFA 3P70B 1NS3A 4XFQA 3DFJA 1D3TB 4JZDH 1Z1JA 1HYLA 3QX5H 4Y11E 1AE8H 1UVUH 1U6QA 3ZZ8A 3V7TA 1C4Y2 1C4V2 1ZHMA 2UWPA 3NZIA 5BRRE 3RXRA 1DT2A 1AQ7A 4B75A 1IQLA 2CN0H 2ZZUH 1P10A 1T4VH 1BRBE 4I8LA 1AFQB 2TGTA 5F8XA 1ZTKA 1DPOA 4D76A 1DUEA 1P2KA 1Y8TA 4CBOA 1C5VA 1JIMA 4MDSA 3FP7E 2ZIQH 3P8FA 1QB9A 2GDEH 2QXIA 3I78A 4TPIZ 4ESTE 1A4WH 1S6HA 1IQIA 1D3QB 1P0SH 3IITA 1UHBB 1ZZZA 1G37A 1LHGH 2F91A 1JOUB 2P16A 2P3UB 3QZRA 4NCYA 1PQ7A 3LJOA 1K9OE 2B8OH 3D65E 4Y8XA 2R0KA 4I32A 2BDGA 2V0BA 1P2QA 5FCKA 4WWYA 2AEIH 2BQWB 1O2VA 1O2IA 4B1TA 1BIOA 1T32A 4K1TA 5EPNA 2ZI2H 1KIGH 3A7WA 3ATMA 2ZHEH 3ZVDA 1D3DB 2PLXA 3SW2B 2OC8A 3TJNA 1HFDA 1VITG 1C5NH 1O3CA 3F1SB 3ATKA 5JBCS 5HM2A 3GCTF 2GD4B 2D1JA 4K2YA 1GJBB 1C1MA 2W26A 3A7VA 4Z6AH 3SV8A 2BQ6B 4BOHA 1PQ8A 2ANMH 2DE9A 2PUQH 5G4BA 1CO7E 1XX9A 1GVKB 1EZQA 3DA9B 5CE1A 2BY6X 1EASA 3T62A 1Y5UT 4NA9H 3RXFA 2J34A 5E2OA 2A31A 3TH2H 3LC3A 3M7UA 1VITH 1EXFA 3UQOA 1Y3VA 4UE7H 3A8CA 3BTHE 4K3JA 3T28A 1O35A 2JKHA 3Q00A 2A2XH 3MU4A 1TMUH 2BDIA 1W3CA 4YO9A 3SJOA 1DUAA 1TGNA 3G01A 2XWBI 3A82A 3SORA 5DG6A 1QTFA 3ATWA 3SJKA 1O3FA 1C1TA 2VGCC 5GJ4B 3AAVA 2H1UA 1ARCA 4ZHMU 1LHEH 1OXGA 1TYNA 3BG4C 1KY9A 2SGEE 1TBZH 1C2MA 1X7AC 1Y3YA 1NY22 1HAVA 1G3EA 4AN7A 1HCGA 2QV1A 3ZV9A 4IGDA 1IQGA 3KEEA 3B9FH 3RC4A 4ISIH 2ZCLP 2PFEA 1Z7KA 1LVYA 3P8OA 2ZDLA 4AG1A 2ZPSA 3KF2A 3MH7A 3RXMA 5L2ZH 4R0IA 2WPKS 1FN6A 4IMZA 3D62A 2ODYB 4WJG2 1EZSC 2ALPA 3GCOA 2H5DA 5L30H 4Q80A 1ZHPA 1VGCB 1EQ9A 1MUEB 2FP7B 1MCTA 2FOMB 3OY5U 4KTCA 3OYPA 3R3GB 2VWOA 1OP8A 2WPHS 4FUCA 5AFYH 2BQ7B 1MAXA 1CVWH 3RP2A 2FX4A 1Z8JB 3RMOH 1GHYH 2Z3DA 3LU9B 3UOUA 4K8YA 4O3UA 2Y7XA 1GMCG 4CBNA 1ELDE 5FX5A 4I8GA 1GI5A 1QY6A 1KLTA 1GI1A 4YOGA 4ISOA 1ZJDA 2BY9X 5A09A 5T3HA 3PO1B 4WMEA 1WOFA 3BEUA 4AB8A 2FYRA 2VJ1A 1NRRH 2P3TB 2XTTB 5A2MH