1J8CA

Solution structure of the ubiquitin-like domain of hplic-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-like protein hPLIC-2
publication title Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j8cA00
4F7ZA 1WZ3A 1QZEA 4G3XB 1LFDA 4HXDA 3A4RA 5CHFA 4GDKB 3HM3A 2C7NB 3ZUNA 4FJZA 2LVOA 2CU1A 2LUEA 4WQOB 2D3GA 4LJOB 1WY8A 2KOXA 3DPDA 3C0RB 3PRPB 2KLGA 2MBHA 4GIVA 4BBNF 3O65B 4N9F4 1HE8A 3ML9A 2AWTA 2J7QB 4E71A 4ANUA 1WM3A 3PPAA 4A20A 2A5UA 2WX1A 3NHEB 4HWIB 5D94A 4DHJB 2GBRA 1P1AA 2HTHA 2K25A 4EKUA 4WAAA 3WANA 1WE6A 4JGHB 2KFKA 2M4NA 5J17A 2Z0DB 4TKNA 3ZNHB 4BVUC 2BGFA 3NY5A 2BPSA 4KZCA 3H7SA 3A9KA 4KZ0A 3ZTCA 3Q3JA 2K6QA 3IG3A 3JYUA 3ZW3A 5HKHA 2O2VB 1WRDB 2BYVE 3RUIB 3ALBA 2K1FA 1NDDA 3A1QA 4WWPA 1WIAA 4CO7A 4GOCA 5JZEB 1YD8U 1WM2A 3ZNID 3DVGX 4K7UA 3DBRI 1ZKHA 4W9IA 2ASQA 2LVPA 5KHOA 2ZCBA 2YLMA 3CSTA 2KNBA 4GN1A 1C3TA 4JIOU 4K81A 2IY0B 2O6VD 2ZZPB 2ZNVC 2N9EB 1OTRB 3DCGA 1ISNA 2BKRB 2KVRA 3KUZA 2DX5B 1R4MI 5JH5C 4GMVA 2CKHB 4M8NA 3VAWA 3R7QA 1OEYJ 4PYUA 3RULA 3UIOB 4K7WA 2MSED 2DAJA 2M1MA 1E8YA 2M8SA 2Y5BB 2ZPYA 2EMTA 3QIJA 4CHKA 1V9JA 3K9OB 4IG7B 4NAWA 2XEWA 1F9JA 2EKEC 3AU4A 1WMHA 2NCNA 3PLUA 2MBBB 3DVNV 1UELA 1D3ZA 2DZMA 3L10B 4MSQB 2DYMA 4MJSB 4ZRJA 3LJ3A 1LXDA 3VTVA 1UBQA 4BBNC 2LRUA 4BKGA 4KIKB 2KJRA 1Q0WB 4W9CA 3PVLA 4KDLB 1KLVA 3X23A 1Z2MA 4ASWC 2MBOA 2MX2A 4FADA 2WYQA 1FXTB 2IY1B 2KD0A 3EC8A 2I1KA 3M63B 3MTNB 4EZKA 5C1ZA 2BF8B 3IFWB 4AJYB 5L95C 3TJPA 2IO3B 4DXAB 2K8BA 1J0GA 2C7HA 4RM9A 3JSVA 3TIXA 1WXSA 1E8XA 2V4LA 3K9PB 4LDTD 3CF6E 1Y8RC 3ZLZA 4JL9A 2L7RA 4B6WA 3VVWB 2KXJA 3TBLD 3ZNGC 4X57B 2CHXA 2CR5A 3AXCA 5CHVC 2JY6A 2BWES 2MP2A 2NBWB 4KIKA 2N4FA 4MGKE 2B3AA 1WJNA 2WDTB 3H9DA 3CSFA 5DPTA 3SU8X 4DHJD 3N32A 1WGHA 2NBUA 3W1SC 4FHJA 4IM0A 2KLCA 2NPTB 2KX0A 1V5OA 1XQQA 2K39A 3KW5B 2A4ZA 4HCPB 4IWOA 3HM6X 2KDEB 3OJ3A 4NJ6A 4EEWA 1J8CA 1OQYA 3V62A 4W9LA 2FAZA 3QHTA 3OJ4B 4FULA 1H4RA 2L00B 3AI5A 4AJWA 1RAXA 4JLCA 3VUYA 4W9FA 4J6IA 1Q5WB 4A3PA 1YX6B 2LVQA 3B08A 1UGMA 3QJZA 4W9EA 3T8MA 4BOSC 4EFOA 2JRHA 3ZKJC 4EZLA 2FCSA 2J0KA 3HHMA 2ZPNA 4XX5A 2FUHB 3ZRCA 3APFA 3WAPA 3NS8A 4EUTA 4ZDVA 3OAWA 1KOTA 3T9LA 1EUVB 2KWUB 3UF8A 3W1YA 3JW0X 4WJOA 3SHQA 3TL5A 2RPQA 3M95A 3RYTA 2M0XA 5AZGA 1WX7A 3NZSA 2KKCA 2MCNB 1I35A 3M62B 2GBMA 2NPTA 4BKSD 1CMXB 4W9KA 1TGZB 3RT3B 4MELA 4AWJA 1TZ1A 4XZ4A 4ICVA 4DDID 1WJUA 4HDQA 3RZFA 4RMAA 2G3QB 3ZNZB 3NZUA 2LGXA 1RFAA 2HJ8A 2D2QA 1RRBA 3PV1A 4P7IA 5AZFA 4PYZA 2NBVB 4I6NB 2N1VA 4GDLB 4GDKA 4II2B 4LCDE 2HE7A 4WWNA 5E6NA 1VCBA 2KQSA 2DENB 2MBQA 5G55A 1A5RA 2PJHA 2UWQA 1S3SG 1UH6A 5DCNA 2DZKA 1UZXB 2ZVOA 4MSMB 4ZRKA 1WGGA 3QC8B 2KTRB 4MDKE 4W9HA 4WJPA 3B0AA 3VTUA 4DK5A 3TMPB 1WJ6A 3GOEA 4FA6A 2JUOA 5FR6A 3IBEA 2LASA 2FIFA 4TUUA 3N3KB 2G45B 1GUAB 2MLBA 3DOWA 2KZRA 4HPLB 2OJRA 4HDOA 1C1YB 2DHZA 4F8CB 4URKA 1V6EA 1WX8A 1K8RB 2D10A 2IO2B 3PT2B 2PE9A 2V1YA 3V6CB 2XK5B 3B1LX 2N7DA 3IHPC 2GOWA 5JHBA 3P2BA 3WIMA 4CYEA 1P9DU 2O2VA 2K8HA 3QQ8B 1I42A 2NS5A 1S1QB 2MWSB 2MRPA 3KYDD 4GGQA 2KC2A 1SGHA 2QHOA 2BWFA 1LQBA 2JWZA 3QAQA 3QARA 3X0WA 3RD2A 2KC1A 3V61A 3KH0A 1H8CA 1LM8B 2KTRA 2KO3A 2DYBA 2BYFA 5J2RA 3UQBA 3H7PB 2MA9B 3ML8A 2FNJB 2IZVB 2KMAA 2FIDA 2ZJDA 1NI2A 5AEKB 4FJYA 3VH3B 5LLIA 1PQSA 4YL8A 2KDIA 4II3B 4IWQA 3EHVA 3W1SA 2MBEA 2IYDB 1UBIA 1V49A 2KANA 3DDCB 4FJVB 4HLEA 4BKSA 3N30A 3MJWA 1IYFA 4IW0A 3L54A 3DBLI 3A4SC 2LWPA 3DBSA 5DPWA 5AZHA 2LRWA 3PSEB 4HJKA 2VRRB 4EZJA 1WGYA 4ZYNA 3NOBA 1SIFA 4KVGB 3WA0A 4ANWA 4IUMB 2LI5A 3PZDA 2LXCA 3M3JA 4PS8A 1MG8A 1WXMA 3ZDMC 4FBJB 4FHKA 2EMSA 5D7GA 2GBNA 2DZIA 4MJSA 5L83A 3KYCD 3VUWA 3HK0A 2KFJA 3VH4B 2L3ZA 2BKFA 2KWCA 5CTRC 4G0NB 2L8JA 4MGYE 3QA8A 1IP9A 3DQVA 2AL3A 3PHWB 4AUQC 2RR9A 2V3SA 4GU2A 5IAAC 2PEAA 4FLHA 4HPMB 4K7SA 3LDZE 1V81A 4G11A 1WF9A 4JQWC 4NQKE 1YQBA 2KMCA 2KX3A 3IVFA 4OVVA 3VXWA 4E3CA 3PLVA 3KUCB 2AL6A 1J19A 2JZ3B 3PHXB 2KHWB 2K8CA 2JRIB 3I3TB 4WJQA 3H1UA 2Z59B 2NR2A 4IM2A 2RD0A 2L76A 4BOZB 1XT9B 1WX9A 2FCQA 4M0WB 2JF5A 3PGEA 1JRUA 3WALA 3TCAA 2J0MA 4TV3A 2LJ5A 3PTFC 2DAFA 4KV2A 3VQIA 3A9JB 2HD5B 2KDFB 3L0WB 4A3OA 4IWPA 1WE7A 2OOBB 3L13A 3ZRFA 4G50A 2RGFA 5D6JB 2JVCA 3CMMB 1WI0A 2CHZA 3A9KB 2REXA 3VFKA 2L0FA 3ECIA 4ZRIA 3RZWC 2N7EA 3PRZA 3QWZB 3A33B 1SE9A 1P3QU 3A1QB 5CHWA 2KTFA 1L7YA 1WJ4A 4E74A 5EDSA 2I1JA 5KHQA 4W9DA 1NBFC 3KVFB 2D11A 2JZZA 3L16A 1WFYA 1WZ0A 1EF1A 2LXAA 1L2NA 1IPGA 3UQAA 3HIZA 3L17A 2PE6B 1OEYA 3DBHI 2R2QA 2DZJA 1OGWA 1V5TA 2MQJA 2D07B 3GZNI 3U8ZA 3VDZA 3A9JA 1WH3A 3S2AA 4HCNB 3V60A 1E8ZA 3R66C 5E6PA 1UD7A 2C7MB 1BT0A 2J0JA 4NNJB 4MEMA 2W9NA 4AOFA 3H6NA 3R3MA 4W9JA 5CX3A 5GMVA 3EECA 1ZGUB 4F1SA 2NVUI 4NAWB 2C9WB 3DVGY 2M17A 1E90A 3QCAA 2G4DB 1WMHB 2R2OA 4W9GA 4DBGA 4FN2A 5LXHA 3WAOA 2N1WA 4MH0E 4WWOA 1ZW7A 2DYOA 2KJHB 1U4AA 4M8MA 3RCZA 3ZIMA 2KWVB 3AU5A 3ENEA 3ZDTA 4GXBA 4PS3A 4RM8A 4MGZE 2CS4A 3PRMB 2JXXA 4IC7B 4KSKC 2PPHA 1V86A 3EFUA 1WXAA 3ONSA 4GDLA 1E7VA 1KM7A 1E5WA 1XD3B 3SDLC 4ANXA 2Z0EB 3ZO5B 2XBBC 4AP4C 4DDGD 2GBKA 4TQ1A 1YJ1A 2CHWA 2BYEA 4DHZE 1Z5SB 2FCMA 1WR6E 1WYWB 3MHSD 2KDBA 2LGDA 4B95A 5DPRA 5E6OA 3AULA 3ZTDA 1GC7A 5IA7A 1GNUA 3Q3FA 2ZCCA 1EF5A 2G4SA 4NQLB 3JSVB 5C23A 1E8WA 1P98A 2JPHA 5BO4B 3BY4B 3BINA 2C5LC 4OVUA 3U7DA 2XK5A 2C60A 2IBIB 2MW5A 3VTWA 5D2MB 1YIWA 3D32A 4KDIC 4NPNA 2MP2B 5J18A 4EOYA 1KJTA 1YX5B 3VUXA 3R7RA 3SD5A 2IO1B 3WAMA 1AARA 3L08A 4B9KA 2YVCA 2KK8A 1Q1OA 1M94A 4ICUA 2O6VB 2K6DB 4NY0A 3UINB 2GMIC 4LJPB 1RLFA 5JHAA 2AYOB 2L05A 3JVZX 2UYZB 2RSUA 2L0TA 4I6PA 3V6EB 1WGDA 1TBEA 2N9PC 2N9XA 1VD2A 3H7PA 4TQ0A 3PS6A 4GB9A 5LXIB 3VHTC 2GBJA 4I6LB 4NJ7A 3PREA 1V80A 1GJZA 2ZEQA 1X1MA 2JT4B 4IM3A 2LZ6A 2ZVNA 4DWFA 4MM3A 4DHZB 5DPSA 4KSLC 3UGBB 3UIPB 1WR1A 3APCA 4MGIE 2LD9A 3KUDB 4PS7A 4BFRA 2KJ6A 3APDA 4K1RB 1E7UA 2AEHA 1WXVA 3OLMD 4BKTA 2KQ7A 2O6VA 1GG3A 2WX0A 4GSWA 2ZNVB 1P0RA 3QX1A 4ANVA 5G2NA 1G6JA 2KFKB 4WJNA 2KN5A 1R4NI 3ZVVA 1WGRA 1V2YA 1GC6A 3DVNU 5TR5A 2IO0B 1EO6A 1TTNA 2WWZA 1T0YA 2FCNA 4HVBA 4HK2A 4XC2A 2LGYA 3QK0A 4LDTB 3U30A
chains in the Genus database with same CATH superfamily
1WSPA 1QZEA 1XXGA 4M01A 3HM3A 2C7NB 3IAM1 2LVOA 1HA5A 2D3GA 1FMAD 2CU3A 1WY8A 4KX6B 2MBHA 5BYQA 2MHJA 1HE8A 3ML9A 1AW7A 2AWTA 4E71A 2VZKD 1Q10A 3PPAA 3HVZA 3I5JC 4USAA 4DHJB 1P1AA 2HTHA 1RFKA 2K25A 4WAAA 2N9KA 3WANA 1PYWD 5J17A 2YEPB 2YEPF 3FILB 3DHHC 2RDHA 3NY5A 4BZAA 1I7HA 3ZTCA 2PMVA 1DYQA 3NUHB 2K6QA 3IG3A 4JX1C 2K1FA 3A1QA 1QOFA 1WM2A 2Q5WD 3ZNID 3DBRI 4YTPB 5KHOA 3CWIA 4HROA 2VH2A 2V3PA 2O6VD 2ZZPB 3DCGA 1ISNA 1R4MB 3DHGC 4GMVA 4M8NA 1OEYJ 2WXGA 1E8YA 1SJED 4WAFA 1JRPA 1V9JA 3K9OB 2H88B 2DYMA 4MJSB 2XN9C 2LEKA 4KIKB 4AS1A 4RCOA 1T6BX 5JXVA 1ET9A 2J53A 4WQMA 3P1MA 3X23A 1Z2MA 4ASWC 4XWTA 2WYQA 2IY1B 4AJYB 5L95C 5BYRA 1AWDA 5FR3A 1FRDA 1WXSA 3CF6E 1N60A 2L7RA 2N7JA 3BYYB 2KXJA 3TBLD 3ZNGC 4X57B 4B6WA 1PGAA 2CHXA 2MP2A 4RGOS 1WGHA 2NBUA 3V05A 2WLBA 3KW5B 4IWOA 1JALA 4EEWA 2WXFA 3V62A 5G5HA 3OJ4B 4ITKA 4C80A 4W9FA 1Q5WB 1TS5A 3V3XA 3B08A 1EWCA 1UGMA 3QJZA 4OW0A 4WH4A 4EZLA 1MFWA 4IOIE 2ZPNA 3AE5B 4ZDVA 1D5ZC 3T9LA 3AE2B 1JCKB 2PVGC 3JW0X 4FXCA 1WX7A 2BS4B 2NPTA 1KLUD 1TGZB 1WJUA 5D3DA 4HJGE 4P1BC 2I2YA 4P7IA 1MVKA 2N1VA 4GDLB 4WWNA 3AEBB 5E6NA 2KQSA 3BWUD 5G55A 1WGKA 2ZVOA 1R7SA 4WJPA 3Q6BA 4FA6A 2WU2B 2K9XA 3N3KB 4HPLB 2WHIA 1C1YB 4URKA 3V6CB 3PT2B 2V1YA 4IKGA 4YSXB 4AQ7A 4CYEA 1P9DU 3Q14C 4MH8A 3QQ8B 1I42A 4UDUC 1GB4A 4HKZE 1C9FA 3SFEB 3BIID 3RPFC 3QAQA 2KC1A 3IT4B 3KH0A 3V61A 2KO3A 3ABVB 2NMQA 2MA9B 2FNJB 1NI2A 3VH3B 1PQSA 4II3B 1DOYA 1QOGA 1NEKB 1UBIA 3MP9A 3MJWA 3DBLI 3A4SC 4RGTA 2ZW1A 3DBSA 3ZJTA 2LRWA 1XCTL 3NOBA 1SIJA 1TIFA 3ZQ4A 4KVGB 2LI5A 2WXRA 4WURA 2LXCA 5D7GA 4MJSA 5L83A 1UWMA 4MGYE 3QA8A 1IP9A 2AL3A 1YNTE 2RR9A 2V3SA 4JPSA 2BB5A 3VR8B 4M00A 4G11A 1ZDXA 4NQKE 1YQBA 2WXMA 2INNE 3PLVA 1J19A 3PHXB 2GI9A 4LNNA 1IGDA 2K8CA 3KWLA 1DGJA 4WJQA 1T3QA 2Z59B 2NR2A 3IXSA 2FCQA 4M0WB 3WALA 4TV3A 4KV2A 3A9JB 2HD5B 2KDFB 4HEA1 1YJIA 4A3OA 1WE7A 2K0PA 2JVCA 1WI0A 2E3TA 4XDDA 4ZRIA 1HZ5A 5CHWA 3RNEC 4OVZA 5EDSA 5KHQA 1J7AA 3RI7C 2PVOD 1MJDA 1WFYA 1WZ0A 1EF1A 1IPGA 4DXFA 1OEYA 3DBHI 3EA6A 2QIEB 3GZNB 3KWVA 1V5TA 3VDZA 2W55A 1VR9A 1UD7A 3URYA 4MEMA 3AEAB 3R3MA 3AEDB 1ZGUB 1NYQA 2JX5A 1C76A 3DVGY 1FXAA 1E90A 4ACFA 2R2OA 1WMHB 4LNKA 5G5GA 3HUIA 4FN2A 3J9CA 4MH0E 2DYOA 4B0EA 4M8MA 2KWVB 3ENEA 1VZ6A 2GB1A 4RM8A 3GS2A 4IC7B 3AM9A 2PPHA 4GDLA 3ONSA 1WXAA 2VZKB 1XD3B 1KM7A 1E5WA 4ANXA 2Z0EB 4ZRQA 2XBBC 1QOAA 1I4PA 4B95A 1GNUA 2IJ0A 2ZCCA 2G4SA 4NQLB 1P98A 2KN4A 3BINA 2IBIB 1BUIC 4NPNA 4HRSA 1KJTA 1ET6A 1NVID 3Q8FA 3WAMA 3L08A 4B9KA 4ICUA 2O6VB 1D6EC 4NY0A 1KFYB 3UINB 1RYJA 2GMIC 1FCLA 3W9CB 2IGDA 2N9XA 1X1MA 3AEFB 4IM3A 1L0VB 4DWFA 4HPPA 2L1AA 4KSLC 1T0RC 5DPSA 2LD9A 4BFRA 1YN5A 2KJ6A 3APDA 2M19A 4K1RB 1E7UA 5BYSA 2AEHA 3R2TA 3OLMD 4XE0A 4K3CA 2ZNVB 5G2NA 1SEBD 1G6JA 5AUIA 1R4NI 1TJEA 1EO6A 1TTNA 4DXGA 5LNK1 3SFDB 1KLGD 4HK2A 1WWTA 4F7ZA 2WDQB 4WQOB 3PRPB 2J7QB 4M0WA 1WM3A 4A20A 3NHEB 2GBRA 4EKUA 5IKCM 1WE6A 4JGHB 1YQ3B 2KFKA 2Z0DB 4BVUC 2BGFA 3N1ZC 2BPSA 3H7SA 3Q3JA 3ZW3A 3W5VB 3MFGA 2JZPA 3RUIB 1NDDA 2OEDA 3DBRB 1GB1A 4W9IA 1ZKHA 4H2AA 2ASQA 1EU4A 2ZCBA 3CSTA 2KNBA 4GN1A 2IY0B 2ZNVC 2N9EB 2BKRB 2KVRA 2Y3AA 1HTQA 2DX5B 1MHHE 4OZBA 4XWWA 1LGRA 3BK1A 4PYUA 3BYTB 2MSED 2M1MA 2Y5BB 5HG2A 4A8XC 2ZPYA 4CHKA 4DQOC 2CJOA 2XEWA 1F9JA 2VH1A 1WMHA 2NCNA 3ZJUA 3PLUA 3DVNV 1UELA 2DZMA 3IAS1 2MJ3A 3LJ3A 4BKGA 2KJRA 1QKZA 4W9CA 3PVLA 1TS3A 4FADA 3MTNB 3EC8A 1D5MC 1SE2A 4OZAA 1I4GA 2IO3B 3K9PB 1Y8RC 4K3BA 3ZLZA 4JL9A 3VVWB 1ROEA 2QJLA 2CR5A 5D3IB 2D5GA 2BWES 1QT9A 4YTMB 4MGKE 3N9YC 5DPTA 2ON8A 3KLSX 1OFFA 4IM0A 1QILA 3U52E 2L52A 2KAJA 2NPTB 3BK2A 1DOXA 2KX0A 1VRAB 3MC9A 2M56B 4HCPB 3RMKC 3HM6X 3OJ3A 1J8CA 3QHTA 2L00B 3AI5A 1C4CA 2BT6A 1VDVA 3VUYA 1SJHD 4A3PA 3AEGB 4BOSC 3H8HA 3HHMA 5H92C 3ZRCA 2FUHB 3BVGA 3APFA 3KQ4A 4C7YA 1N5WA 1NI3A 3OAWA 3UF8A 4M02A 3AH7A 2KKCA 2MCNB 2GBMA 1CMXB 4W9KA 3RT3B 1TZ1A 4XZ4A 3TUOA 4DDID 4Q2JA 2LGXA 1RFAA 2D2QA 1RRBA 5AZFA 2NBVB 4LCDE 1D4BA 2MBQA 2PJHA 4ZRKA 4MSMB 3P4PB 3QC8B 4W9HA 3DWMA 1WJ6A 2FIFA 4NZLB 2B76B 4F8CB 1V6EA 3ZXRA 2N7DA 3U4EG 3TEWA 5JHBA 5C2TB 3NG0A 4D2KA 1C79A 2QHOA 2BWFA 5FKAC 1JMLA 3TSSA 3X0WA 1LM8B 2KTRA 5J2RA 1TS2A 2KYWA 3W5UB 4R3DA 2KMAA 2ZJDA 4RF1A 1ZUD2 1V49A 2KANA 4HLEA 3N30A 3DBLB 4MM3B 4IW0A 2PTLA 3L54A 2LWPA 1B1ZA 2MJDA 4RGMA 3PSEB 4QAYA 4HJKA 2VRRB 1N5XA 1CQVA 1SIFA 4ANWA 3WA0A 4IUMB 1QF6A 1ENFA 1MG8A 2EMSA 2PW9A 3HK0A 2KFJA 2L3ZA 5BMHA 1XLPA 4G0NB 3PHWB 2WXOA 4AUQC 4GU2A 4FLHA 3LDZE 2FUG1 4LNIA 3AECB 1MI0A 2KMCA 4OVVA 2JZ3B 4KKIA 2IPKD 3I3TB 4BOZB 2E6XA 2JF5A 3PGEA 2J42A 3AV8A 4TSSA 1UGJA 3VQIA 1YMHE 2QDFA 2OOBB 3ZRFA 4G50A 2RGFA 2KVZA 3CMMB 1N61A 2J4XA 3BVZA 3A9KB 3ECIA 5C3JB 3AE1B 1JW9D 1LO5D 1ZXHA 2N7EA 2KTFA 2Y5CA 4IDIA 2D11A 2OJWA 1L2NA 2LHEA 1FFUA 3UQAA 3HIZA 3DBHB 3L17A 2PE6B 1L4ZB 2DZJA 3U8ZA 4P6VF 4PK1A 3V60A 1E8ZA 3R66C 1F0ZA 1BT0A 4NNJB 2W9NA 4KKJA 3DWGC 4W9JA 2LGSA 5GMVA 4KGRA 1E7PB 2NVUI 1HZ6A 4A90A 2LJIA 2M17A 1N62A 1UUPA 1XCQL 1U4AA 2EELA 1CZPA 4GXBA 2CS4A 4REZA 4KSKC 1RWSA 2WDRB 3EFUA 3NRZA 1E7VA 1SBBB 4TQ1A 1L4DB 2L83A 1Z5SB 1WYWB 4ZOHC 2LGDA 5E6OA 1FD6A 1EF5A 2WXHA 3JSVB 3Q8EA 1J7BA 1E8WA 2KWDA 2JPHA 3NS1A 4C4VB 1F2RI 3BY4B 3Q3NC 4JWSC 1ZDVA 2WXNA 4OVUA 3U7DA 2C60A 1K53A 5D2MB 3D32A 1EU3A 1YX5B 3VUXA 3SD5A 3AE8B 2IO1B 3AB5A 4LJPB 3AMZA 1JWMD 1RLFA 3JVZX 1HXYD 1VZ8A 3T3OA 2N9PC 3NVYA 4GB9A 2OHFA 1B9RA 1ZE3D 3VHTC 2GBJA 4NJ7A 2JT4B 4MM3A 2RDBC 1WR1A 3APCA 3GE8C 4MGIE 4PS7A 1IGCA 2K5PA 4ZHOA 2BB6A 2IGGA 2KQ7A 1YN4A 2WX0A 3B2GA 1SE3A 2PLPA 4KGTA 1R4NB 2KFKB 2KN5A 2TSSA 1WGRA 2GLSA 3DVNU 5TR5A 2WWZA 3DHIC 2FCNA 3U30A 5EE0A 1WZ3A 1LFDA 5CHFA 3ZUNA 4FJZA 2QEJC 2CU1A 2KOXA 3C0RB 1ZXIA 2BW2A 4BBNF 4GIVA 1XLQA 4L2YA 4N9F4 3SR6A 3L4PA 3NZ3A 5FK9C 2A5UA 2WX1A 4C00A 5D94A 3E56A 5HI1A 1WXQA 3MJ5A 3ZNHB 4KZCA 1YQ4B 2DBYA 3A9KA 4KZ0A 5IO9A 5HKHA 1WRDB 3ALBA 1WIAA 4P1CC 4GOCA 2WXKA 1F52A 1YD8U 3DVGX 3ZYYX 2LVPA 2YLMA 4JIOU 3I9V1 5IN7A 2D3BA 2INCC 3VAWA 3R7QA 4LK0M 1JWSD 3RULA 4K7WA 1YOVB 2D3AA 2M8SA 1JWAD 3QIJA 4YSZB 1SF0A 1J7CA 4IG7B 3P63A 2WXLA 1D3ZA 2BQQA 3NVVA 4BBNC 1UBQA 1QQRA 3SEBA 2LRUA 5IOIA 1E6EB 1KLVA 4KDLB 2MBOA 3LXFA 1UNSA 1FXTB 2ICIA 2KD0A 2I1KA 2W3RA 2BF8B 2MJEA 2KMMA 3IFWB 2K8BA 1J0GA 4XYCA 2C7HA 3JSVA 3TIXA 2V4LA 1E8XA 4LDTD 1HEZE 4C4VA 4GLSC 1IUEA 2K22A 3AXCA 5CHVC 1MPEA 1T0QC 2JY6A 2N4FA 2B3AA 3E9SA 4RF0A 3H9DA 1K51A 3CSFA 2HDEA 4CQNA 3N32A 4US8A 4FHJA 1XO3A 3Q3OC 1XQQA 2JYEA 1XEEA 2KDEB 2FAZA 1K50A 3BVMA 4AJWA 1T5XD 4JLCA 1YX6B 2LVQA 5AUKA 2FBWB 2AQ1B 2RDGA 3ZKJC 2FCSA 2J0KA 4XX5A 4BAXA 2DLBA 2BS3B 3WAPA 3NS8A 2LGIA 1KOTA 4EE2A 2KWUB 4S17A 2BBCA 4WJOA 3SHQA 3TL5A 3RFZB 3VRAB 2ZW0A 3M95A 1FEHA 2M0XA 5AZGA 3NZSA 1KF6B 3R2IA 1MG4A 3M62B 4PT5A 4BKSD 4AWJA 2G9HD 4HDQA 1Y56A 4RMAA 1ZP0B 1HQRD 2MEKA 3PV1A 3P4QB 4I6NB 1L6VA 4II2B 3P4RB 2HE7A 1VCBA 2DENB 1UH6A 1UZXB 1WGGA 2KTRB 3B0AA 2PKOA 3TMPB 3GOEA 5FR6A 2LASA 1M4VA 1GUAB 2MLBA 3DOWA 3NVWA 2DHZA 1WX8A 2D10A 1K8RB 2IO2B 2PE9A 3ZJVA 2GOWA 3WIMA 4JE3B 4XDCA 1NYRA 1C4PA 2NS5A 1DOIA 2MWSB 2MRPA 2WNMA 3N20C 2KC2A 3RD2A 2HTME 1H8CA 2NTTA 2DYBA 2BYFA 5HHDG 4YWGG 3UQBA 1AYFA 2N9LA 1QOBA 2IZVB 4FJYA 5LLIA 2MBEA 2IYDB 2WP9B 2L32A 4FJVB 1PGBA 1IYFA 2WXPA 5DPWA 5AZHA 4EZJA 1WGYA 4ZYNA 3U7ZA 2RPVA 3PZDA 4PS8A 1I4XA 1AN8A 4FHKA 2GBNA 3VUWA 1UWXA 3VH4B 2BKFA 3HRDD 2L8JA 3DQVA 3MHZA 4HPMB 4K7SA 3OG5A 3NJTA 4L1BA 2V9HA 2KX3A 2SEBD 2X38A 4E3CA 1JWUD 2AL6A 2KHWB 4WIPA 2JRIB 3RN9C 4IM2A 2KT7A 2RD0A 2L76A 1F1HA 1F77A 3N1XC 1JRUA 3TCAA 4ARIA 2J0MA 2QMTA 3VR9B 2LJ5A 2DAFA 3NVZA 4IWPA 2RMMA 1IBXA 2PIAA 2DNFA 2QCZA 1WRIA 3P4SB 2REXA 3VFKA 2L0FA 3RZWC 1FO4A 3PRZA 3A33B 1P3QU 1L7YA 1WJ4A 2I1JA 4WWMA 1NBFC 1TYGB 2JZZA 4RFBA 4ZRPA 1VLBA 5HFYA 1ZPSA 2R2QA 1OGWA 2D07B 3S2AA 4HCNB 5E6PA 3AE4B 2SAKA 4AOFA 3H6NA 1NENB 1SB3C 5CX3A 1C77A 4NAWB 4DBGA 2G4DB 2AX5A 1L5PA 5LXHA 1E9MA 3RNAC 1TKEA 1ZW7A 3ZDTA 3PRMB 2JXXA 3AE6B 1V8CA 2QSDA 3ZO5B 2WGSA 1YJJA 4C56C 4AP4C 4DDGD 2GBKA 1KRHA 3AN1A 2BYEA 4DHZE 3MHSD 1WR6E 2WS3B 2KDBA 5DPRA 3AULA 1GC7A 3B9JA 3CIRB 3HVDA 3RNGC 3AE9B 2C5LC 2MW5A 2QC8A 3Q3MC 2AQ3B 2FE8A 2R61A 3C8YA 1TKYA 5EE9A 2KK8A 1Q1OA 3OWEB 1ZOYB 2K6DB 3FAHA 5JHAA 1CJEA 4LLGM 2AYOB 1N6ZA 4I6PA 3V6EB 4XGAB 1TBEA 4JWUC 5EE3A 1VD2A 3UI3A 3PS6A 1ESFA 3PREA 4J3OD 1GJZA 2ZEQA 2Y5PA 3EUB2 3Q69A 3AE3B 3UGBB 3UIPB 2WXJA 3GP7A 3KUDB 2LHDA 4HKQA 1WXVA 4OHJA 1BMLC 3MC8A 4BKTA 1E10A 4P16A 1GG3A 1P0RA 2W3SA 5T8IA 2JQRB 4WJNA 3EFCA 1V2YA 2IO0B 1F2RC 1T0YA 3RNBC 1N63A 4XC2A 4LDTB 4A9AA 4G3XB 4HXDA 3A4RA 1TKGA 4GDKB 3P42A 2LUEA 4ARCA 4YSYB 4LJOB 3DPDA 2BS2B 2KLGA 4B0MA 1FXIA 3O65B 4LTUA 4ANUA 2AQ2B 4HWIB 2JWUA 2V3NA 1PUTA 3RNCC 2M4NA 3PZ8A 3ETRA 4TKNA 1SE4A 1ACCA 1P7FA 2BVCA 1WYGA 1KH0A 3JYUA 2O2VB 2BYVE 2EKIA 4MT5A 4WWPA 4CO7A 2IGHA 5JZEB 1TY0A 4K7UA 1L0XB 4L23A 3TEZA 2KQ4X 1C3TA 4K81A 1GAQB 1OTRB 2JXTA 1FPYA 3KUZA 1R4MI 3Q2AC 5JH5C 2CKHB 3UIOB 2CJNA 2DAJA 3FILA 2DWQA 5EE1A 2EMTA 4NAWA 3TEYA 2EKEC 3AU4A 3PO0A 5MPOA 2MBBB 4NJCA 4ZYSA 3L10B 4MSQB 5H8YE 4ZRJA 1TY2A 3B2FA 3VTVA 1LXDA 1PFDA 4RNAA 1Q0WB 2HJ1A 4O1NA 2MX2A 3TEXA 2INDC 4EZKA 3M63B 5C1ZA 3TJPA 4DXAB 2LMCA 4RM9A 3O13A 1STEA 3W2DA 1EM7A 2NBWB 4KIKA 5E6JA 2IDYA 2WU5B 1WJNA 2WDTB 3ZGZA 3SU8X 4DHJD 2X8XX 3W1SC 2KLCA 1V5OA 2K39A 2A4ZA 4NJ6A 1OQYA 4W9LA 1XLNA 4FULA 1H4RA 2N0SB 1RAXA 4J6IA 2D3CA 1SXTA 2V0GA 4W9EA 3T8MA 4EFOA 2JRHA 1PGXA 4N6EB 4EUTA 4TMAB 1VJKA 1EUVB 3LYYA 3W1YA 1TT5B 1FNUA 2RPQA 3RYTA 1SSNA 1OQRA 1I35A 3Q8AA 1V1PB 2W54A 1VZ7A 4MELA 4ICVA 3MC0B 3RZFA 3EGRA 2G3QB 3ZNZB 3NZUA 2HJ8A 4PYZA 1C4AA 4GDKA 1A5RA 2UWQA 1S3SG 1JWBD 5DCNA 1TS4A 2DZKA 2WXQA 4C7ZA 4MDKE 2BTEA 3VTUA 4DK5A 4YXDB 2JUOA 2KDMA 3IBEA 4TUUA 2G45B 1BXTA 2XNAC 2KZRA 2OJRA 3LB8C 4HDOA 2XK5B 3B1LX 3IHPC 1EWYC 1I4RA 3P2BA 1FIQA 2O2VA 2JYTA 2K8HA 2V4IB 1S1QB 3KYDD 4GGQA 2INPE 1SGHA 1P7EA 1LQBA 2JWZA 3QARA 2JSVX 4US9A 3C19A 3H7PB 3ML8A 2FIDA 5AEKB 1GOZA 4YL8A 2ACZB 2KDIA 4IWQA 5BMIA 3EHVA 3W1SA 3DDCB 2G1EA 4BKSA 3BZDB 1L0YB 3PZ7A 4LNOA 1JQ4A 3N1YC 3ZXVA 3M3JA 3ZDMC 1WXMA 4FBJB 2I38A 1CK1A 2DZIA 1RM6C 3KYCD 2LUMA 1TZOA 2KWCA 5CTRC 1HTOA 1L6UA 2QILA 5IAAC 1JROA 2PEAA 3R8BA 1IBXB 1V81A 3FKYA 1WF9A 4JQWC 3IVFA 2NTSA 3VXWA 3I63C 3KUCB 4OZCA 1I4QA 1V97A 3AEEB 3H1UA 1FCCC 1XT9B 1WX9A 3GE3C 1FM0D 3PTFC 3RNFC 1YN3A 3L0WB 3L13A 5D6JB 3Q8CA 1FNVA 5GXGB 4RGNA 2CHZA 1D5XC 2MH7A 5BMGA 3QWZB 1SE9A 1KTKA 2ONQA 3A1QB 4E74A 4KGSA 4W9DA 3KVFB 1V1OA 3L16A 1K52A 2K3UA 1E0ZA 1FFVA 2LXAA 3I57A 1T0SC 4NAMA 4MACA 2MQJA 3GZNI 2WXIA 3A9JA 3WCQA 1WH3A 3AE7B 2C7MB 2H89B 2J0JA 2M0AA 3EECA 4N59A 4F1SA 4RH6A 1V1PA 2C9WB 3QCAA 4W9GA 3WAOA 2N1WA 4WWOA 1FRRA 2KJHB 3ZIMA 1UF0A 3RCZA 3AU5A 2JU6X 4PS3A 4MGZE 2J52A 1V86A 4S0RA 2WDVB 3SDLC 1YJ1A 2CHWA 2FCMA 4YTNB 4ZHPA 1GPXA 3ZTDA 5IA7A 3Q3FA 3IT6B 5C23A 5BO4B 1A70A 2XK5A 3VTWA 1YIWA 3Q8BA 4KDIC 2MP2B 5J18A 4EOYA 2KACA 3R7RA 1FNWA 1AARA 2UU7A 2YVCA 1M94A 3T3NA 3VRBB 2L05A 2UYZB 4LNFA 2RSUA 2L0TA 1WGDA 3H7PA 4TQ0A 2LFIA 5LXIB 4I6LB 5IP4D 1XF5L 1V80A 2Z8LA 1OQQA 2LZ6A 2ZVNA 3FC4A 1PDXA 4DHZB 5I4DA 3U2SC 4YT0B 5TSSA 2BYTA 1C78A 1MHXA 2GRIA 2W82A 1QLBB 1I4HA 2O6VA 4GSWA 4N58A 3QX1A 4ANVA 4A6QA 1XLOA 3ZVVA 3GB1A 1GC6A 2WQYB 4HVBA 2LGYA 3QK0A 4A55A
chains in the Genus database with same CATH topology
4F7ZA 1WZ3A 1QZEA 4G3XB 1LFDA 4HXDA 3A4RA 5CHFA 4GDKB 3HM3A 2C7NB 3ZUNA 4FJZA 2LVOA 2CU1A 2LUEA 4WQOB 2D3GA 4LJOB 1WY8A 2KOXA 3DPDA 3C0RB 3PRPB 2KLGA 2MBHA 4GIVA 4BBNF 3O65B 4N9F4 1HE8A 3ML9A 2AWTA 2J7QB 4E71A 4ANUA 1WM3A 3PPAA 4A20A 2A5UA 2WX1A 3NHEB 4HWIB 5D94A 4DHJB 2GBRA 1P1AA 2HTHA 2K25A 4EKUA 4WAAA 3WANA 1WE6A 4JGHB 2KFKA 2M4NA 5J17A 2Z0DB 4TKNA 3ZNHB 4BVUC 2BGFA 3NY5A 2BPSA 4KZCA 3H7SA 3A9KA 4KZ0A 3ZTCA 3Q3JA 2K6QA 3IG3A 3JYUA 3ZW3A 5HKHA 2O2VB 1WRDB 2BYVE 3RUIB 3ALBA 2K1FA 1NDDA 3A1QA 4WWPA 1WIAA 4CO7A 4GOCA 5JZEB 1YD8U 1WM2A 3ZNID 3DVGX 4K7UA 3DBRI 1ZKHA 4W9IA 2ASQA 2LVPA 5KHOA 2ZCBA 2YLMA 3CSTA 2KNBA 4GN1A 1C3TA 4JIOU 4K81A 2IY0B 2O6VD 2ZZPB 2ZNVC 2N9EB 1OTRB 3DCGA 1ISNA 2BKRB 2KVRA 3KUZA 2DX5B 1R4MI 5JH5C 4GMVA 2CKHB 4M8NA 3VAWA 3R7QA 1OEYJ 4PYUA 3RULA 3UIOB 4K7WA 2MSED 2DAJA 2M1MA 1E8YA 2M8SA 2Y5BB 2ZPYA 2EMTA 3QIJA 4CHKA 1V9JA 3K9OB 4IG7B 4NAWA 2XEWA 1F9JA 2EKEC 3AU4A 1WMHA 2NCNA 3PLUA 2MBBB 3DVNV 1UELA 1D3ZA 2DZMA 3L10B 4MSQB 2DYMA 4MJSB 4ZRJA 3LJ3A 1LXDA 3VTVA 1UBQA 4BBNC 2LRUA 4BKGA 4KIKB 2KJRA 1Q0WB 4W9CA 3PVLA 4KDLB 1KLVA 3X23A 1Z2MA 4ASWC 2MBOA 2MX2A 4FADA 2WYQA 1FXTB 2IY1B 2KD0A 3EC8A 2I1KA 3M63B 3MTNB 4EZKA 5C1ZA 2BF8B 3IFWB 4AJYB 5L95C 3TJPA 2IO3B 4DXAB 2K8BA 1J0GA 2C7HA 4RM9A 3JSVA 3TIXA 1WXSA 1E8XA 2V4LA 3K9PB 4LDTD 3CF6E 1Y8RC 3ZLZA 4JL9A 2L7RA 4B6WA 3VVWB 2KXJA 3TBLD 3ZNGC 4X57B 2CHXA 2CR5A 3AXCA 5CHVC 2JY6A 2BWES 2MP2A 2NBWB 4KIKA 2N4FA 4MGKE 2B3AA 1WJNA 2WDTB 3H9DA 3CSFA 5DPTA 3SU8X 4DHJD 3N32A 1WGHA 2NBUA 3W1SC 4FHJA 4IM0A 2KLCA 2NPTB 2KX0A 1V5OA 1XQQA 2K39A 3KW5B 2A4ZA 4HCPB 4IWOA 3HM6X 2KDEB 3OJ3A 4NJ6A 4EEWA 1J8CA 1OQYA 3V62A 4W9LA 2FAZA 3QHTA 3OJ4B 4FULA 1H4RA 2L00B 3AI5A 4AJWA 1RAXA 4JLCA 3VUYA 4W9FA 4J6IA 1Q5WB 4A3PA 1YX6B 2LVQA 3B08A 1UGMA 3QJZA 4W9EA 3T8MA 4BOSC 4EFOA 2JRHA 3ZKJC 4EZLA 2FCSA 2J0KA 3HHMA 2ZPNA 4XX5A 2FUHB 3ZRCA 3APFA 3WAPA 3NS8A 4EUTA 4ZDVA 3OAWA 1KOTA 3T9LA 1EUVB 2KWUB 3UF8A 3W1YA 3JW0X 4WJOA 3SHQA 3TL5A 2RPQA 3M95A 3RYTA 2M0XA 5AZGA 1WX7A 3NZSA 2KKCA 2MCNB 1I35A 3M62B 2GBMA 2NPTA 4BKSD 1CMXB 4W9KA 1TGZB 3RT3B 4MELA 4AWJA 1TZ1A 4XZ4A 4ICVA 4DDID 1WJUA 4HDQA 3RZFA 4RMAA 2G3QB 3ZNZB 3NZUA 2LGXA 1RFAA 2HJ8A 2D2QA 1RRBA 3PV1A 4P7IA 5AZFA 4PYZA 2NBVB 4I6NB 2N1VA 4GDLB 4GDKA 4II2B 4LCDE 2HE7A 4WWNA 5E6NA 1VCBA 2KQSA 2DENB 2MBQA 5G55A 1A5RA 2PJHA 2UWQA 1S3SG 1UH6A 5DCNA 2DZKA 1UZXB 2ZVOA 4MSMB 4ZRKA 1WGGA 3QC8B 2KTRB 4MDKE 4W9HA 4WJPA 3B0AA 3VTUA 4DK5A 3TMPB 1WJ6A 3GOEA 4FA6A 2JUOA 5FR6A 3IBEA 2LASA 2FIFA 4TUUA 3N3KB 2G45B 1GUAB 2MLBA 3DOWA 2KZRA 4HPLB 2OJRA 4HDOA 1C1YB 2DHZA 4F8CB 4URKA 1V6EA 1WX8A 1K8RB 2D10A 2IO2B 3PT2B 2PE9A 2V1YA 3V6CB 2XK5B 3B1LX 2N7DA 3IHPC 2GOWA 5JHBA 3P2BA 3WIMA 4CYEA 1P9DU 2O2VA 2K8HA 3QQ8B 1I42A 2NS5A 1S1QB 2MWSB 2MRPA 3KYDD 4GGQA 2KC2A 1SGHA 2QHOA 2BWFA 1LQBA 2JWZA 3QAQA 3QARA 3X0WA 3RD2A 2KC1A 3V61A 3KH0A 1H8CA 1LM8B 2KTRA 2KO3A 2DYBA 2BYFA 5J2RA 3UQBA 3H7PB 2MA9B 3ML8A 2FNJB 2IZVB 2KMAA 2FIDA 2ZJDA 1NI2A 5AEKB 4FJYA 3VH3B 5LLIA 1PQSA 4YL8A 2KDIA 4II3B 4IWQA 3EHVA 3W1SA 2MBEA 2IYDB 1UBIA 1V49A 2KANA 3DDCB 4FJVB 4HLEA 4BKSA 3N30A 3MJWA 1IYFA 4IW0A 3L54A 3DBLI 3A4SC 2LWPA 3DBSA 5DPWA 5AZHA 2LRWA 3PSEB 4HJKA 2VRRB 4EZJA 1WGYA 4ZYNA 3NOBA 1SIFA 4KVGB 3WA0A 4ANWA 4IUMB 2LI5A 3PZDA 2LXCA 3M3JA 4PS8A 1MG8A 1WXMA 3ZDMC 4FBJB 4FHKA 2EMSA 5D7GA 2GBNA 2DZIA 4MJSA 5L83A 3KYCD 3VUWA 3HK0A 2KFJA 3VH4B 2L3ZA 2BKFA 2KWCA 5CTRC 4G0NB 2L8JA 4MGYE 3QA8A 1IP9A 3DQVA 2AL3A 3PHWB 4AUQC 2RR9A 2V3SA 4GU2A 5IAAC 2PEAA 4FLHA 4HPMB 4K7SA 3LDZE 1V81A 4G11A 1WF9A 4JQWC 4NQKE 1YQBA 2KMCA 2KX3A 3IVFA 4OVVA 3VXWA 4E3CA 3PLVA 3KUCB 2AL6A 1J19A 2JZ3B 3PHXB 2KHWB 2K8CA 2JRIB 3I3TB 4WJQA 3H1UA 2Z59B 2NR2A 4IM2A 2RD0A 2L76A 4BOZB 1XT9B 1WX9A 2FCQA 4M0WB 2JF5A 3PGEA 1JRUA 3WALA 3TCAA 2J0MA 4TV3A 2LJ5A 3PTFC 2DAFA 4KV2A 3VQIA 3A9JB 2HD5B 2KDFB 3L0WB 4A3OA 4IWPA 1WE7A 2OOBB 3L13A 3ZRFA 4G50A 2RGFA 5D6JB 2JVCA 3CMMB 1WI0A 2CHZA 3A9KB 2REXA 3VFKA 2L0FA 3ECIA 4ZRIA 3RZWC 2N7EA 3PRZA 3QWZB 3A33B 1SE9A 1P3QU 3A1QB 5CHWA 2KTFA 1L7YA 1WJ4A 4E74A 5EDSA 2I1JA 5KHQA 4W9DA 1NBFC 3KVFB 2D11A 2JZZA 3L16A 1WFYA 1WZ0A 1EF1A 2LXAA 1L2NA 1IPGA 3UQAA 3HIZA 3L17A 2PE6B 1OEYA 3DBHI 2R2QA 2DZJA 1OGWA 1V5TA 2MQJA 2D07B 3GZNI 3U8ZA 3VDZA 3A9JA 1WH3A 3S2AA 4HCNB 3V60A 1E8ZA 3R66C 5E6PA 1UD7A 2C7MB 1BT0A 2J0JA 4NNJB 4MEMA 2W9NA 4AOFA 3H6NA 3R3MA 4W9JA 5CX3A 5GMVA 3EECA 1ZGUB 4F1SA 2NVUI 4NAWB 2C9WB 3DVGY 2M17A 1E90A 3QCAA 2G4DB 1WMHB 2R2OA 4W9GA 4DBGA 4FN2A 5LXHA 3WAOA 2N1WA 4MH0E 4WWOA 1ZW7A 2DYOA 2KJHB 1U4AA 4M8MA 3RCZA 3ZIMA 2KWVB 3AU5A 3ENEA 3ZDTA 4GXBA 4PS3A 4RM8A 4MGZE 2CS4A 3PRMB 2JXXA 4IC7B 4KSKC 2PPHA 1V86A 3EFUA 1WXAA 3ONSA 4GDLA 1E7VA 1KM7A 1E5WA 1XD3B 3SDLC 4ANXA 2Z0EB 3ZO5B 2XBBC 4AP4C 4DDGD 2GBKA 4TQ1A 1YJ1A 2CHWA 2BYEA 4DHZE 1Z5SB 2FCMA 1WR6E 1WYWB 3MHSD 2KDBA 2LGDA 4B95A 5DPRA 5E6OA 3AULA 3ZTDA 1GC7A 5IA7A 1GNUA 3Q3FA 2ZCCA 1EF5A 2G4SA 4NQLB 3JSVB 5C23A 1E8WA 1P98A 2JPHA 5BO4B 3BY4B 3BINA 2C5LC 4OVUA 3U7DA 2XK5A 2C60A 2IBIB 2MW5A 3VTWA 5D2MB 1YIWA 3D32A 4KDIC 4NPNA 2MP2B 5J18A 4EOYA 1KJTA 1YX5B 3VUXA 3R7RA 3SD5A 2IO1B 3WAMA 1AARA 3L08A 4B9KA 2YVCA 2KK8A 1Q1OA 1M94A 4ICUA 2O6VB 2K6DB 4NY0A 3UINB 2GMIC 4LJPB 1RLFA 5JHAA 2AYOB 2L05A 3JVZX 2UYZB 2RSUA 2L0TA 4I6PA 3V6EB 1WGDA 1TBEA 2N9PC 2N9XA 1VD2A 3H7PA 4TQ0A 3PS6A 4GB9A 5LXIB 3VHTC 2GBJA 4I6LB 4NJ7A 3PREA 1V80A 1GJZA 2ZEQA 1X1MA 2JT4B 4IM3A 2LZ6A 2ZVNA 4DWFA 4MM3A 4DHZB 5DPSA 4KSLC 3UGBB 3UIPB 1WR1A 3APCA 4MGIE 2LD9A 3KUDB 4PS7A 4BFRA 2KJ6A 3APDA 4K1RB 1E7UA 2AEHA 1WXVA 3OLMD 4BKTA 2KQ7A 2O6VA 1GG3A 2WX0A 4GSWA 2ZNVB 1P0RA 3QX1A 4ANVA 5G2NA 1G6JA 2KFKB 4WJNA 2KN5A 1R4NI 3ZVVA 1WGRA 1V2YA 1GC6A 3DVNU 5TR5A 2IO0B 1EO6A 1TTNA 2WWZA 1T0YA 2FCNA 4HVBA 4HK2A 4XC2A 2LGYA 3QK0A 4LDTB 3U30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  1WZ3 A;  1QZE A;  4G3X B;  1LFD A;  4HXD A;  3A4R A;  5CHF A;  4GDK B;  3HM3 A;  2C7N B;  3ZUN A;  4FJZ A;  2LVO A;  2CU1 A;  2LUE A;  4WQO B;  2D3G A;  4LJO B;  1WY8 A;  2KOX A;  3DPD A;  3C0R B;  3PRP B;  2KLG A;  2MBH A;  4GIV A;  4BBN F;  3O65 B;  4N9F 4;  1HE8 A;  3ML9 A;  2AWT A;  2J7Q B;  4E71 A;  4ANU A;  1WM3 A;  3PPA A;  4A20 A;  2A5U A;  2WX1 A;  3NHE B;  4HWI B;  5D94 A;  4DHJ B;  2GBR A;  1P1A A;  2HTH A;  2K25 A;  4EKU A;  4WAA A;  3WAN A;  1WE6 A;  4JGH B;  2KFK A;  2M4N A;  5J17 A;  2Z0D B;  4TKN A;  3ZNH B;  4BVU C;  2BGF A;  3NY5 A;  2BPS A;  4KZC A;  3H7S A;  3A9K A;  4KZ0 A;  3ZTC A;  3Q3J A;  2K6Q A;  3IG3 A;  3JYU A;  3ZW3 A;  5HKH A;  2O2V B;  1WRD B;  2BYV E;  3RUI B;  3ALB A;  2K1F A;  1NDD A;  3A1Q A;  4WWP A;  1WIA A;  4CO7 A;  4GOC A;  5JZE B;  1YD8 U;  1WM2 A;  3ZNI D;  3DVG X;  4K7U A;  3DBR I;  1ZKH A;  4W9I A;  2ASQ A;  2LVP A;  5KHO A;  2ZCB A;  2YLM A;  3CST A;  2KNB A;  4GN1 A;  1C3T A;  4JIO U;  4K81 A;  2IY0 B;  2O6V D;  2ZZP B;  2ZNV C;  2N9E B;  1OTR B;  3DCG A;  1ISN A;  2BKR B;  2KVR A;  3KUZ A;  2DX5 B;  1R4M I;  5JH5 C;  4GMV A;  2CKH B;  4M8N A;  3VAW A;  3R7Q A;  1OEY J;  4PYU A;  3RUL A;  3UIO B;  4K7W A;  2MSE D;  2DAJ A;  2M1M A;  1E8Y A;  2M8S A;  2Y5B B;  2ZPY A;  2EMT A;  3QIJ A;  4CHK A;  1V9J A;  3K9O B;  4IG7 B;  4NAW A;  2XEW A;  1F9J A;  2EKE C;  3AU4 A;  1WMH A;  2NCN A;  3PLU A;  2MBB B;  3DVN V;  1UEL A;  1D3Z A;  2DZM A;  3L10 B;  4MSQ B;  2DYM A;  4MJS B;  4ZRJ A;  3LJ3 A;  1LXD A;  3VTV A;  1UBQ A;  4BBN C;  2LRU A;  4BKG A;  4KIK B;  2KJR A;  1Q0W B;  4W9C A;  3PVL A;  4KDL B;  1KLV A;  3X23 A;  1Z2M A;  4ASW C;  2MBO A;  2MX2 A;  4FAD A;  2WYQ A;  1FXT B;  2IY1 B;  2KD0 A;  3EC8 A;  2I1K A;  3M63 B;  3MTN B;  4EZK A;  5C1Z A;  2BF8 B;  3IFW B;  4AJY B;  5L95 C;  3TJP A;  2IO3 B;  4DXA B;  2K8B A;  1J0G A;  2C7H A;  4RM9 A;  3JSV A;  3TIX A;  1WXS A;  1E8X A;  2V4L A;  3K9P B;  4LDT D;  3CF6 E;  1Y8R C;  3ZLZ A;  4JL9 A;  2L7R A;  4B6W A;  3VVW B;  2KXJ A;  3TBL D;  3ZNG C;  4X57 B;  2CHX A;  2CR5 A;  3AXC A;  5CHV C;  2JY6 A;  2BWE S;  2MP2 A;  2NBW B;  4KIK A;  2N4F A;  4MGK E;  2B3A A;  1WJN A;  2WDT B;  3H9D A;  3CSF A;  5DPT A;  3SU8 X;  4DHJ D;  3N32 A;  1WGH A;  2NBU A;  3W1S C;  4FHJ A;  4IM0 A;  2KLC A;  2NPT B;  2KX0 A;  1V5O A;  1XQQ A;  2K39 A;  3KW5 B;  2A4Z A;  4HCP B;  4IWO A;  3HM6 X;  2KDE B;  3OJ3 A;  4NJ6 A;  4EEW A;  1J8C A;  1OQY A;  3V62 A;  4W9L A;  2FAZ A;  3QHT A;  3OJ4 B;  4FUL A;  1H4R A;  2L00 B;  3AI5 A;  4AJW A;  1RAX A;  4JLC A;  3VUY A;  4W9F A;  4J6I A;  1Q5W B;  4A3P A;  1YX6 B;  2LVQ A;  3B08 A;  1UGM A;  3QJZ A;  4W9E A;  3T8M A;  4BOS C;  4EFO A;  2JRH A;  3ZKJ C;  4EZL A;  2FCS A;  2J0K A;  3HHM A;  2ZPN A;  4XX5 A;  2FUH B;  3ZRC A;  3APF A;  3WAP A;  3NS8 A;  4EUT A;  4ZDV A;  3OAW A;  1KOT A;  3T9L A;  1EUV B;  2KWU B;  3UF8 A;  3W1Y A;  3JW0 X;  4WJO A;  3SHQ A;  3TL5 A;  2RPQ A;  3M95 A;  3RYT A;  2M0X A;  5AZG A;  1WX7 A;  3NZS A;  2KKC A;  2MCN B;  1I35 A;  3M62 B;  2GBM A;  2NPT A;  4BKS D;  1CMX B;  4W9K A;  1TGZ B;  3RT3 B;  4MEL A;  4AWJ A;  1TZ1 A;  4XZ4 A;  4ICV A;  4DDI D;  1WJU A;  4HDQ A;  3RZF A;  4RMA A;  2G3Q B;  3ZNZ B;  3NZU A;  2LGX A;  1RFA A;  2HJ8 A;  2D2Q A;  1RRB A;  3PV1 A;  4P7I A;  5AZF A;  4PYZ A;  2NBV B;  4I6N B;  2N1V A;  4GDL B;  4GDK A;  4II2 B;  4LCD E;  2HE7 A;  4WWN A;  5E6N A;  1VCB A;  2KQS A;  2DEN B;  2MBQ A;  5G55 A;  1A5R A;  2PJH A;  2UWQ A;  1S3S G;  1UH6 A;  5DCN A;  2DZK A;  1UZX B;  2ZVO A;  4MSM B;  4ZRK A;  1WGG A;  3QC8 B;  2KTR B;  4MDK E;  4W9H A;  4WJP A;  3B0A A;  3VTU A;  4DK5 A;  3TMP B;  1WJ6 A;  3GOE A;  4FA6 A;  2JUO A;  5FR6 A;  3IBE A;  2LAS A;  2FIF A;  4TUU A;  3N3K B;  2G45 B;  1GUA B;  2MLB A;  3DOW A;  2KZR A;  4HPL B;  2OJR A;  4HDO A;  1C1Y B;  2DHZ A;  4F8C B;  4URK A;  1V6E A;  1WX8 A;  1K8R B;  2D10 A;  2IO2 B;  3PT2 B;  2PE9 A;  2V1Y A;  3V6C B;  2XK5 B;  3B1L X;  2N7D A;  3IHP C;  2GOW A;  5JHB A;  3P2B A;  3WIM A;  4CYE A;  1P9D U;  2O2V A;  2K8H A;  3QQ8 B;  1I42 A;  2NS5 A;  1S1Q B;  2MWS B;  2MRP A;  3KYD D;  4GGQ A;  2KC2 A;  1SGH A;  2QHO A;  2BWF A;  1LQB A;  2JWZ A;  3QAQ A;  3QAR A;  3X0W A;  3RD2 A;  2KC1 A;  3V61 A;  3KH0 A;  1H8C A;  1LM8 B;  2KTR A;  2KO3 A;  2DYB A;  2BYF A;  5J2R A;  3UQB A;  3H7P B;  2MA9 B;  3ML8 A;  2FNJ B;  2IZV B;  2KMA A;  2FID A;  2ZJD A;  1NI2 A;  5AEK B;  4FJY A;  3VH3 B;  5LLI A;  1PQS A;  4YL8 A;  2KDI A;  4II3 B;  4IWQ A;  3EHV A;  3W1S A;  2MBE A;  2IYD B;  1UBI A;  1V49 A;  2KAN A;  3DDC B;  4FJV B;  4HLE A;  4BKS A;  3N30 A;  3MJW A;  1IYF A;  4IW0 A;  3L54 A;  3DBL I;  3A4S C;  2LWP A;  3DBS A;  5DPW A;  5AZH A;  2LRW A;  3PSE B;  4HJK A;  2VRR B;  4EZJ A;  1WGY A;  4ZYN A;  3NOB A;  1SIF A;  4KVG B;  3WA0 A;  4ANW A;  4IUM B;  2LI5 A;  3PZD A;  2LXC A;  3M3J A;  4PS8 A;  1MG8 A;  1WXM A;  3ZDM C;  4FBJ B;  4FHK A;  2EMS A;  5D7G A;  2GBN A;  2DZI A;  4MJS A;  5L83 A;  3KYC D;  3VUW A;  3HK0 A;  2KFJ A;  3VH4 B;  2L3Z A;  2BKF A;  2KWC A;  5CTR C;  4G0N B;  2L8J A;  4MGY E;  3QA8 A;  1IP9 A;  3DQV A;  2AL3 A;  3PHW B;  4AUQ C;  2RR9 A;  2V3S A;  4GU2 A;  5IAA C;  2PEA A;  4FLH A;  4HPM B;  4K7S A;  3LDZ E;  1V81 A;  4G11 A;  1WF9 A;  4JQW C;  4NQK E;  1YQB A;  2KMC A;  2KX3 A;  3IVF A;  4OVV A;  3VXW A;  4E3C A;  3PLV A;  3KUC B;  2AL6 A;  1J19 A;  2JZ3 B;  3PHX B;  2KHW B;  2K8C A;  2JRI B;  3I3T B;  4WJQ A;  3H1U A;  2Z59 B;  2NR2 A;  4IM2 A;  2RD0 A;  2L76 A;  4BOZ B;  1XT9 B;  1WX9 A;  2FCQ A;  4M0W B;  2JF5 A;  3PGE A;  1JRU A;  3WAL A;  3TCA A;  2J0M A;  4TV3 A;  2LJ5 A;  3PTF C;  2DAF A;  4KV2 A;  3VQI A;  3A9J B;  2HD5 B;  2KDF B;  3L0W B;  4A3O A;  4IWP A;  1WE7 A;  2OOB B;  3L13 A;  3ZRF A;  4G50 A;  2RGF A;  5D6J B;  2JVC A;  3CMM B;  1WI0 A;  2CHZ A;  3A9K B;  2REX A;  3VFK A;  2L0F A;  3ECI A;  4ZRI A;  3RZW C;  2N7E A;  3PRZ A;  3QWZ B;  3A33 B;  1SE9 A;  1P3Q U;  3A1Q B;  5CHW A;  2KTF A;  1L7Y A;  1WJ4 A;  4E74 A;  5EDS A;  2I1J A;  5KHQ A;  4W9D A;  1NBF C;  3KVF B;  2D11 A;  2JZZ A;  3L16 A;  1WFY A;  1WZ0 A;  1EF1 A;  2LXA A;  1L2N A;  1IPG A;  3UQA A;  3HIZ A;  3L17 A;  2PE6 B;  1OEY A;  3DBH I;  2R2Q A;  2DZJ A;  1OGW A;  1V5T A;  2MQJ A;  2D07 B;  3GZN I;  3U8Z A;  3VDZ A;  3A9J A;  1WH3 A;  3S2A A;  4HCN B;  3V60 A;  1E8Z A;  3R66 C;  5E6P A;  1UD7 A;  2C7M B;  1BT0 A;  2J0J A;  4NNJ B;  4MEM A;  2W9N A;  4AOF A;  3H6N A;  3R3M A;  4W9J A;  5CX3 A;  5GMV A;  3EEC A;  1ZGU B;  4F1S A;  2NVU I;  4NAW B;  2C9W B;  3DVG Y;  2M17 A;  1E90 A;  3QCA A;  2G4D B;  1WMH B;  2R2O A;  4W9G A;  4DBG A;  4FN2 A;  5LXH A;  3WAO A;  2N1W A;  4MH0 E;  4WWO A;  1ZW7 A;  2DYO A;  2KJH B;  1U4A A;  4M8M A;  3RCZ A;  3ZIM A;  2KWV B;  3AU5 A;  3ENE A;  3ZDT A;  4GXB A;  4PS3 A;  4RM8 A;  4MGZ E;  2CS4 A;  3PRM B;  2JXX A;  4IC7 B;  4KSK C;  2PPH A;  1V86 A;  3EFU A;  1WXA A;  3ONS A;  4GDL A;  1E7V A;  1KM7 A;  1E5W A;  1XD3 B;  3SDL C;  4ANX A;  2Z0E B;  3ZO5 B;  2XBB C;  4AP4 C;  4DDG D;  2GBK A;  4TQ1 A;  1YJ1 A;  2CHW A;  2BYE A;  4DHZ E;  1Z5S B;  2FCM A;  1WR6 E;  1WYW B;  3MHS D;  2KDB A;  2LGD A;  4B95 A;  5DPR A;  5E6O A;  3AUL A;  3ZTD A;  1GC7 A;  5IA7 A;  1GNU A;  3Q3F A;  2ZCC A;  1EF5 A;  2G4S A;  4NQL B;  3JSV B;  5C23 A;  1E8W A;  1P98 A;  2JPH A;  5BO4 B;  3BY4 B;  3BIN A;  2C5L C;  4OVU A;  3U7D A;  2XK5 A;  2C60 A;  2IBI B;  2MW5 A;  3VTW A;  5D2M B;  1YIW A;  3D32 A;  4KDI C;  4NPN A;  2MP2 B;  5J18 A;  4EOY A;  1KJT A;  1YX5 B;  3VUX A;  3R7R A;  3SD5 A;  2IO1 B;  3WAM A;  1AAR A;  3L08 A;  4B9K A;  2YVC A;  2KK8 A;  1Q1O A;  1M94 A;  4ICU A;  2O6V B;  2K6D B;  4NY0 A;  3UIN B;  2GMI C;  4LJP B;  1RLF A;  5JHA A;  2AYO B;  2L05 A;  3JVZ X;  2UYZ B;  2RSU A;  2L0T A;  4I6P A;  3V6E B;  1WGD A;  1TBE A;  2N9P C;  2N9X A;  1VD2 A;  3H7P A;  4TQ0 A;  3PS6 A;  4GB9 A;  5LXI B;  3VHT C;  2GBJ A;  4I6L B;  4NJ7 A;  3PRE A;  1V80 A;  1GJZ A;  2ZEQ A;  1X1M A;  2JT4 B;  4IM3 A;  2LZ6 A;  2ZVN A;  4DWF A;  4MM3 A;  4DHZ B;  5DPS A;  4KSL C;  3UGB B;  3UIP B;  1WR1 A;  3APC A;  4MGI E;  2LD9 A;  3KUD B;  4PS7 A;  4BFR A;  2KJ6 A;  3APD A;  4K1R B;  1E7U A;  2AEH A;  1WXV A;  3OLM D;  4BKT A;  2KQ7 A;  2O6V A;  1GG3 A;  2WX0 A;  4GSW A;  2ZNV B;  1P0R A;  3QX1 A;  4ANV A;  5G2N A;  1G6J A;  2KFK B;  4WJN A;  2KN5 A;  1R4N I;  3ZVV A;  1WGR A;  1V2Y A;  1GC6 A;  3DVN U;  5TR5 A;  2IO0 B;  1EO6 A;  1TTN A;  2WWZ A;  1T0Y A;  2FCN A;  4HVB A;  4HK2 A;  4XC2 A;  2LGY A;  3QK0 A;  4LDT B;  3U30 A; 
#chains in the Genus database with same CATH topology
 1WSP A;  1QZE A;  1XXG A;  4M01 A;  3HM3 A;  2C7N B;  3IAM 1;  2LVO A;  1HA5 A;  2D3G A;  1FMA D;  2CU3 A;  1WY8 A;  4KX6 B;  2MBH A;  5BYQ A;  2MHJ A;  1HE8 A;  3ML9 A;  1AW7 A;  2AWT A;  4E71 A;  2VZK D;  1Q10 A;  3PPA A;  3HVZ A;  3I5J C;  4USA A;  4DHJ B;  1P1A A;  2HTH A;  1RFK A;  2K25 A;  4WAA A;  2N9K A;  3WAN A;  1PYW D;  5J17 A;  2YEP B;  2YEP F;  3FIL B;  3DHH C;  2RDH A;  3NY5 A;  4BZA A;  1I7H A;  3ZTC A;  2PMV A;  1DYQ A;  3NUH B;  2K6Q A;  3IG3 A;  4JX1 C;  2K1F A;  3A1Q A;  1QOF A;  1WM2 A;  2Q5W D;  3ZNI D;  3DBR I;  4YTP B;  5KHO A;  3CWI A;  4HRO A;  2VH2 A;  2V3P A;  2O6V D;  2ZZP B;  3DCG A;  1ISN A;  1R4M B;  3DHG C;  4GMV A;  4M8N A;  1OEY J;  2WXG A;  1E8Y A;  1SJE D;  4WAF A;  1JRP A;  1V9J A;  3K9O B;  2H88 B;  2DYM A;  4MJS B;  2XN9 C;  2LEK A;  4KIK B;  4AS1 A;  4RCO A;  1T6B X;  5JXV A;  1ET9 A;  2J53 A;  4WQM A;  3P1M A;  3X23 A;  1Z2M A;  4ASW C;  4XWT A;  2WYQ A;  2IY1 B;  4AJY B;  5L95 C;  5BYR A;  1AWD A;  5FR3 A;  1FRD A;  1WXS A;  3CF6 E;  1N60 A;  2L7R A;  2N7J A;  3BYY B;  2KXJ A;  3TBL D;  3ZNG C;  4X57 B;  4B6W A;  1PGA A;  2CHX A;  2MP2 A;  4RGO S;  1WGH A;  2NBU A;  3V05 A;  2WLB A;  3KW5 B;  4IWO A;  1JAL A;  4EEW A;  2WXF A;  3V62 A;  5G5H A;  3OJ4 B;  4ITK A;  4C80 A;  4W9F A;  1Q5W B;  1TS5 A;  3V3X A;  3B08 A;  1EWC A;  1UGM A;  3QJZ A;  4OW0 A;  4WH4 A;  4EZL A;  1MFW A;  4IOI E;  2ZPN A;  3AE5 B;  4ZDV A;  1D5Z C;  3T9L A;  3AE2 B;  1JCK B;  2PVG C;  3JW0 X;  4FXC A;  1WX7 A;  2BS4 B;  2NPT A;  1KLU D;  1TGZ B;  1WJU A;  5D3D A;  4HJG E;  4P1B C;  2I2Y A;  4P7I A;  1MVK A;  2N1V A;  4GDL B;  4WWN A;  3AEB B;  5E6N A;  2KQS A;  3BWU D;  5G55 A;  1WGK A;  2ZVO A;  1R7S A;  4WJP A;  3Q6B A;  4FA6 A;  2WU2 B;  2K9X A;  3N3K B;  4HPL B;  2WHI A;  1C1Y B;  4URK A;  3V6C B;  3PT2 B;  2V1Y A;  4IKG A;  4YSX B;  4AQ7 A;  4CYE A;  1P9D U;  3Q14 C;  4MH8 A;  3QQ8 B;  1I42 A;  4UDU C;  1GB4 A;  4HKZ E;  1C9F A;  3SFE B;  3BII D;  3RPF C;  3QAQ A;  2KC1 A;  3IT4 B;  3KH0 A;  3V61 A;  2KO3 A;  3ABV B;  2NMQ A;  2MA9 B;  2FNJ B;  1NI2 A;  3VH3 B;  1PQS A;  4II3 B;  1DOY A;  1QOG A;  1NEK B;  1UBI A;  3MP9 A;  3MJW A;  3DBL I;  3A4S C;  4RGT A;  2ZW1 A;  3DBS A;  3ZJT A;  2LRW A;  1XCT L;  3NOB A;  1SIJ A;  1TIF A;  3ZQ4 A;  4KVG B;  2LI5 A;  2WXR A;  4WUR A;  2LXC A;  5D7G A;  4MJS A;  5L83 A;  1UWM A;  4MGY E;  3QA8 A;  1IP9 A;  2AL3 A;  1YNT E;  2RR9 A;  2V3S A;  4JPS A;  2BB5 A;  3VR8 B;  4M00 A;  4G11 A;  1ZDX A;  4NQK E;  1YQB A;  2WXM A;  2INN E;  3PLV A;  1J19 A;  3PHX B;  2GI9 A;  4LNN A;  1IGD A;  2K8C A;  3KWL A;  1DGJ A;  4WJQ A;  1T3Q A;  2Z59 B;  2NR2 A;  3IXS A;  2FCQ A;  4M0W B;  3WAL A;  4TV3 A;  4KV2 A;  3A9J B;  2HD5 B;  2KDF B;  4HEA 1;  1YJI A;  4A3O A;  1WE7 A;  2K0P A;  2JVC A;  1WI0 A;  2E3T A;  4XDD A;  4ZRI A;  1HZ5 A;  5CHW A;  3RNE C;  4OVZ A;  5EDS A;  5KHQ A;  1J7A A;  3RI7 C;  2PVO D;  1MJD A;  1WFY A;  1WZ0 A;  1EF1 A;  1IPG A;  4DXF A;  1OEY A;  3DBH I;  3EA6 A;  2QIE B;  3GZN B;  3KWV A;  1V5T A;  3VDZ A;  2W55 A;  1VR9 A;  1UD7 A;  3URY A;  4MEM A;  3AEA B;  3R3M A;  3AED B;  1ZGU B;  1NYQ A;  2JX5 A;  1C76 A;  3DVG Y;  1FXA A;  1E90 A;  4ACF A;  2R2O A;  1WMH B;  4LNK A;  5G5G A;  3HUI A;  4FN2 A;  3J9C A;  4MH0 E;  2DYO A;  4B0E A;  4M8M A;  2KWV B;  3ENE A;  1VZ6 A;  2GB1 A;  4RM8 A;  3GS2 A;  4IC7 B;  3AM9 A;  2PPH A;  4GDL A;  3ONS A;  1WXA A;  2VZK B;  1XD3 B;  1KM7 A;  1E5W A;  4ANX A;  2Z0E B;  4ZRQ A;  2XBB C;  1QOA A;  1I4P A;  4B95 A;  1GNU A;  2IJ0 A;  2ZCC A;  2G4S A;  4NQL B;  1P98 A;  2KN4 A;  3BIN A;  2IBI B;  1BUI C;  4NPN A;  4HRS A;  1KJT A;  1ET6 A;  1NVI D;  3Q8F A;  3WAM A;  3L08 A;  4B9K A;  4ICU A;  2O6V B;  1D6E C;  4NY0 A;  1KFY B;  3UIN B;  1RYJ A;  2GMI C;  1FCL A;  3W9C B;  2IGD A;  2N9X A;  1X1M A;  3AEF B;  4IM3 A;  1L0V B;  4DWF A;  4HPP A;  2L1A A;  4KSL C;  1T0R C;  5DPS A;  2LD9 A;  4BFR A;  1YN5 A;  2KJ6 A;  3APD A;  2M19 A;  4K1R B;  1E7U A;  5BYS A;  2AEH A;  3R2T A;  3OLM D;  4XE0 A;  4K3C A;  2ZNV B;  5G2N A;  1SEB D;  1G6J A;  5AUI A;  1R4N I;  1TJE A;  1EO6 A;  1TTN A;  4DXG A;  5LNK 1;  3SFD B;  1KLG D;  4HK2 A;  1WWT A;  4F7Z A;  2WDQ B;  4WQO B;  3PRP B;  2J7Q B;  4M0W A;  1WM3 A;  4A20 A;  3NHE B;  2GBR A;  4EKU A;  5IKC M;  1WE6 A;  4JGH B;  1YQ3 B;  2KFK A;  2Z0D B;  4BVU C;  2BGF A;  3N1Z C;  2BPS A;  3H7S A;  3Q3J A;  3ZW3 A;  3W5V B;  3MFG A;  2JZP A;  3RUI B;  1NDD A;  2OED A;  3DBR B;  1GB1 A;  4W9I A;  1ZKH A;  4H2A A;  2ASQ A;  1EU4 A;  2ZCB A;  3CST A;  2KNB A;  4GN1 A;  2IY0 B;  2ZNV C;  2N9E B;  2BKR B;  2KVR A;  2Y3A A;  1HTQ A;  2DX5 B;  1MHH E;  4OZB A;  4XWW A;  1LGR A;  3BK1 A;  4PYU A;  3BYT B;  2MSE D;  2M1M A;  2Y5B B;  5HG2 A;  4A8X C;  2ZPY A;  4CHK A;  4DQO C;  2CJO A;  2XEW A;  1F9J A;  2VH1 A;  1WMH A;  2NCN A;  3ZJU A;  3PLU A;  3DVN V;  1UEL A;  2DZM A;  3IAS 1;  2MJ3 A;  3LJ3 A;  4BKG A;  2KJR A;  1QKZ A;  4W9C A;  3PVL A;  1TS3 A;  4FAD A;  3MTN B;  3EC8 A;  1D5M C;  1SE2 A;  4OZA A;  1I4G A;  2IO3 B;  3K9P B;  1Y8R C;  4K3B A;  3ZLZ A;  4JL9 A;  3VVW B;  1ROE A;  2QJL A;  2CR5 A;  5D3I B;  2D5G A;  2BWE S;  1QT9 A;  4YTM B;  4MGK E;  3N9Y C;  5DPT A;  2ON8 A;  3KLS X;  1OFF A;  4IM0 A;  1QIL A;  3U52 E;  2L52 A;  2KAJ A;  2NPT B;  3BK2 A;  1DOX A;  2KX0 A;  1VRA B;  3MC9 A;  2M56 B;  4HCP B;  3RMK C;  3HM6 X;  3OJ3 A;  1J8C A;  3QHT A;  2L00 B;  3AI5 A;  1C4C A;  2BT6 A;  1VDV A;  3VUY A;  1SJH D;  4A3P A;  3AEG B;  4BOS C;  3H8H A;  3HHM A;  5H92 C;  3ZRC A;  2FUH B;  3BVG A;  3APF A;  3KQ4 A;  4C7Y A;  1N5W A;  1NI3 A;  3OAW A;  3UF8 A;  4M02 A;  3AH7 A;  2KKC A;  2MCN B;  2GBM A;  1CMX B;  4W9K A;  3RT3 B;  1TZ1 A;  4XZ4 A;  3TUO A;  4DDI D;  4Q2J A;  2LGX A;  1RFA A;  2D2Q A;  1RRB A;  5AZF A;  2NBV B;  4LCD E;  1D4B A;  2MBQ A;  2PJH A;  4ZRK A;  4MSM B;  3P4P B;  3QC8 B;  4W9H A;  3DWM A;  1WJ6 A;  2FIF A;  4NZL B;  2B76 B;  4F8C B;  1V6E A;  3ZXR A;  2N7D A;  3U4E G;  3TEW A;  5JHB A;  5C2T B;  3NG0 A;  4D2K A;  1C79 A;  2QHO A;  2BWF A;  5FKA C;  1JML A;  3TSS A;  3X0W A;  1LM8 B;  2KTR A;  5J2R A;  1TS2 A;  2KYW A;  3W5U B;  4R3D A;  2KMA A;  2ZJD A;  4RF1 A;  1ZUD 2;  1V49 A;  2KAN A;  4HLE A;  3N30 A;  3DBL B;  4MM3 B;  4IW0 A;  2PTL A;  3L54 A;  2LWP A;  1B1Z A;  2MJD A;  4RGM A;  3PSE B;  4QAY A;  4HJK A;  2VRR B;  1N5X A;  1CQV A;  1SIF A;  4ANW A;  3WA0 A;  4IUM B;  1QF6 A;  1ENF A;  1MG8 A;  2EMS A;  2PW9 A;  3HK0 A;  2KFJ A;  2L3Z A;  5BMH A;  1XLP A;  4G0N B;  3PHW B;  2WXO A;  4AUQ C;  4GU2 A;  4FLH A;  3LDZ E;  2FUG 1;  4LNI A;  3AEC B;  1MI0 A;  2KMC A;  4OVV A;  2JZ3 B;  4KKI A;  2IPK D;  3I3T B;  4BOZ B;  2E6X A;  2JF5 A;  3PGE A;  2J42 A;  3AV8 A;  4TSS A;  1UGJ A;  3VQI A;  1YMH E;  2QDF A;  2OOB B;  3ZRF A;  4G50 A;  2RGF A;  2KVZ A;  3CMM B;  1N61 A;  2J4X A;  3BVZ A;  3A9K B;  3ECI A;  5C3J B;  3AE1 B;  1JW9 D;  1LO5 D;  1ZXH A;  2N7E A;  2KTF A;  2Y5C A;  4IDI A;  2D11 A;  2OJW A;  1L2N A;  2LHE A;  1FFU A;  3UQA A;  3HIZ A;  3DBH B;  3L17 A;  2PE6 B;  1L4Z B;  2DZJ A;  3U8Z A;  4P6V F;  4PK1 A;  3V60 A;  1E8Z A;  3R66 C;  1F0Z A;  1BT0 A;  4NNJ B;  2W9N A;  4KKJ A;  3DWG C;  4W9J A;  2LGS A;  5GMV A;  4KGR A;  1E7P B;  2NVU I;  1HZ6 A;  4A90 A;  2LJI A;  2M17 A;  1N62 A;  1UUP A;  1XCQ L;  1U4A A;  2EEL A;  1CZP A;  4GXB A;  2CS4 A;  4REZ A;  4KSK C;  1RWS A;  2WDR B;  3EFU A;  3NRZ A;  1E7V A;  1SBB B;  4TQ1 A;  1L4D B;  2L83 A;  1Z5S B;  1WYW B;  4ZOH C;  2LGD A;  5E6O A;  1FD6 A;  1EF5 A;  2WXH A;  3JSV B;  3Q8E A;  1J7B A;  1E8W A;  2KWD A;  2JPH A;  3NS1 A;  4C4V B;  1F2R I;  3BY4 B;  3Q3N C;  4JWS C;  1ZDV A;  2WXN A;  4OVU A;  3U7D A;  2C60 A;  1K53 A;  5D2M B;  3D32 A;  1EU3 A;  1YX5 B;  3VUX A;  3SD5 A;  3AE8 B;  2IO1 B;  3AB5 A;  4LJP B;  3AMZ A;  1JWM D;  1RLF A;  3JVZ X;  1HXY D;  1VZ8 A;  3T3O A;  2N9P C;  3NVY A;  4GB9 A;  2OHF A;  1B9R A;  1ZE3 D;  3VHT C;  2GBJ A;  4NJ7 A;  2JT4 B;  4MM3 A;  2RDB C;  1WR1 A;  3APC A;  3GE8 C;  4MGI E;  4PS7 A;  1IGC A;  2K5P A;  4ZHO A;  2BB6 A;  2IGG A;  2KQ7 A;  1YN4 A;  2WX0 A;  3B2G A;  1SE3 A;  2PLP A;  4KGT A;  1R4N B;  2KFK B;  2KN5 A;  2TSS A;  1WGR A;  2GLS A;  3DVN U;  5TR5 A;  2WWZ A;  3DHI C;  2FCN A;  3U30 A;  5EE0 A;  1WZ3 A;  1LFD A;  5CHF A;  3ZUN A;  4FJZ A;  2QEJ C;  2CU1 A;  2KOX A;  3C0R B;  1ZXI A;  2BW2 A;  4BBN F;  4GIV A;  1XLQ A;  4L2Y A;  4N9F 4;  3SR6 A;  3L4P A;  3NZ3 A;  5FK9 C;  2A5U A;  2WX1 A;  4C00 A;  5D94 A;  3E56 A;  5HI1 A;  1WXQ A;  3MJ5 A;  3ZNH B;  4KZC A;  1YQ4 B;  2DBY A;  3A9K A;  4KZ0 A;  5IO9 A;  5HKH A;  1WRD B;  3ALB A;  1WIA A;  4P1C C;  4GOC A;  2WXK A;  1F52 A;  1YD8 U;  3DVG X;  3ZYY X;  2LVP A;  2YLM A;  4JIO U;  3I9V 1;  5IN7 A;  2D3B A;  2INC C;  3VAW A;  3R7Q A;  4LK0 M;  1JWS D;  3RUL A;  4K7W A;  1YOV B;  2D3A A;  2M8S A;  1JWA D;  3QIJ A;  4YSZ B;  1SF0 A;  1J7C A;  4IG7 B;  3P63 A;  2WXL A;  1D3Z A;  2BQQ A;  3NVV A;  4BBN C;  1UBQ A;  1QQR A;  3SEB A;  2LRU A;  5IOI A;  1E6E B;  1KLV A;  4KDL B;  2MBO A;  3LXF A;  1UNS A;  1FXT B;  2ICI A;  2KD0 A;  2I1K A;  2W3R A;  2BF8 B;  2MJE A;  2KMM A;  3IFW B;  2K8B A;  1J0G A;  4XYC A;  2C7H A;  3JSV A;  3TIX A;  2V4L A;  1E8X A;  4LDT D;  1HEZ E;  4C4V A;  4GLS C;  1IUE A;  2K22 A;  3AXC A;  5CHV C;  1MPE A;  1T0Q C;  2JY6 A;  2N4F A;  2B3A A;  3E9S A;  4RF0 A;  3H9D A;  1K51 A;  3CSF A;  2HDE A;  4CQN A;  3N32 A;  4US8 A;  4FHJ A;  1XO3 A;  3Q3O C;  1XQQ A;  2JYE A;  1XEE A;  2KDE B;  2FAZ A;  1K50 A;  3BVM A;  4AJW A;  1T5X D;  4JLC A;  1YX6 B;  2LVQ A;  5AUK A;  2FBW B;  2AQ1 B;  2RDG A;  3ZKJ C;  2FCS A;  2J0K A;  4XX5 A;  4BAX A;  2DLB A;  2BS3 B;  3WAP A;  3NS8 A;  2LGI A;  1KOT A;  4EE2 A;  2KWU B;  4S17 A;  2BBC A;  4WJO A;  3SHQ A;  3TL5 A;  3RFZ B;  3VRA B;  2ZW0 A;  3M95 A;  1FEH A;  2M0X A;  5AZG A;  3NZS A;  1KF6 B;  3R2I A;  1MG4 A;  3M62 B;  4PT5 A;  4BKS D;  4AWJ A;  2G9H D;  4HDQ A;  1Y56 A;  4RMA A;  1ZP0 B;  1HQR D;  2MEK A;  3PV1 A;  3P4Q B;  4I6N B;  1L6V A;  4II2 B;  3P4R B;  2HE7 A;  1VCB A;  2DEN B;  1UH6 A;  1UZX B;  1WGG A;  2KTR B;  3B0A A;  2PKO A;  3TMP B;  3GOE A;  5FR6 A;  2LAS A;  1M4V A;  1GUA B;  2MLB A;  3DOW A;  3NVW A;  2DHZ A;  1WX8 A;  2D10 A;  1K8R B;  2IO2 B;  2PE9 A;  3ZJV A;  2GOW A;  3WIM A;  4JE3 B;  4XDC A;  1NYR A;  1C4P A;  2NS5 A;  1DOI A;  2MWS B;  2MRP A;  2WNM A;  3N20 C;  2KC2 A;  3RD2 A;  2HTM E;  1H8C A;  2NTT A;  2DYB A;  2BYF A;  5HHD G;  4YWG G;  3UQB A;  1AYF A;  2N9L A;  1QOB A;  2IZV B;  4FJY A;  5LLI A;  2MBE A;  2IYD B;  2WP9 B;  2L32 A;  4FJV B;  1PGB A;  1IYF A;  2WXP A;  5DPW A;  5AZH A;  4EZJ A;  1WGY A;  4ZYN A;  3U7Z A;  2RPV A;  3PZD A;  4PS8 A;  1I4X A;  1AN8 A;  4FHK A;  2GBN A;  3VUW A;  1UWX A;  3VH4 B;  2BKF A;  3HRD D;  2L8J A;  3DQV A;  3MHZ A;  4HPM B;  4K7S A;  3OG5 A;  3NJT A;  4L1B A;  2V9H A;  2KX3 A;  2SEB D;  2X38 A;  4E3C A;  1JWU D;  2AL6 A;  2KHW B;  4WIP A;  2JRI B;  3RN9 C;  4IM2 A;  2KT7 A;  2RD0 A;  2L76 A;  1F1H A;  1F77 A;  3N1X C;  1JRU A;  3TCA A;  4ARI A;  2J0M A;  2QMT A;  3VR9 B;  2LJ5 A;  2DAF A;  3NVZ A;  4IWP A;  2RMM A;  1IBX A;  2PIA A;  2DNF A;  2QCZ A;  1WRI A;  3P4S B;  2REX A;  3VFK A;  2L0F A;  3RZW C;  1FO4 A;  3PRZ A;  3A33 B;  1P3Q U;  1L7Y A;  1WJ4 A;  2I1J A;  4WWM A;  1NBF C;  1TYG B;  2JZZ A;  4RFB A;  4ZRP A;  1VLB A;  5HFY A;  1ZPS A;  2R2Q A;  1OGW A;  2D07 B;  3S2A A;  4HCN B;  5E6P A;  3AE4 B;  2SAK A;  4AOF A;  3H6N A;  1NEN B;  1SB3 C;  5CX3 A;  1C77 A;  4NAW B;  4DBG A;  2G4D B;  2AX5 A;  1L5P A;  5LXH A;  1E9M A;  3RNA C;  1TKE A;  1ZW7 A;  3ZDT A;  3PRM B;  2JXX A;  3AE6 B;  1V8C A;  2QSD A;  3ZO5 B;  2WGS A;  1YJJ A;  4C56 C;  4AP4 C;  4DDG D;  2GBK A;  1KRH A;  3AN1 A;  2BYE A;  4DHZ E;  3MHS D;  1WR6 E;  2WS3 B;  2KDB A;  5DPR A;  3AUL A;  1GC7 A;  3B9J A;  3CIR B;  3HVD A;  3RNG C;  3AE9 B;  2C5L C;  2MW5 A;  2QC8 A;  3Q3M C;  2AQ3 B;  2FE8 A;  2R61 A;  3C8Y A;  1TKY A;  5EE9 A;  2KK8 A;  1Q1O A;  3OWE B;  1ZOY B;  2K6D B;  3FAH A;  5JHA A;  1CJE A;  4LLG M;  2AYO B;  1N6Z A;  4I6P A;  3V6E B;  4XGA B;  1TBE A;  4JWU C;  5EE3 A;  1VD2 A;  3UI3 A;  3PS6 A;  1ESF A;  3PRE A;  4J3O D;  1GJZ A;  2ZEQ A;  2Y5P A;  3EUB 2;  3Q69 A;  3AE3 B;  3UGB B;  3UIP B;  2WXJ A;  3GP7 A;  3KUD B;  2LHD A;  4HKQ A;  1WXV A;  4OHJ A;  1BML C;  3MC8 A;  4BKT A;  1E10 A;  4P16 A;  1GG3 A;  1P0R A;  2W3S A;  5T8I A;  2JQR B;  4WJN A;  3EFC A;  1V2Y A;  2IO0 B;  1F2R C;  1T0Y A;  3RNB C;  1N63 A;  4XC2 A;  4LDT B;  4A9A A;  4G3X B;  4HXD A;  3A4R A;  1TKG A;  4GDK B;  3P42 A;  2LUE A;  4ARC A;  4YSY B;  4LJO B;  3DPD A;  2BS2 B;  2KLG A;  4B0M A;  1FXI A;  3O65 B;  4LTU A;  4ANU A;  2AQ2 B;  4HWI B;  2JWU A;  2V3N A;  1PUT A;  3RNC C;  2M4N A;  3PZ8 A;  3ETR A;  4TKN A;  1SE4 A;  1ACC A;  1P7F A;  2BVC A;  1WYG A;  1KH0 A;  3JYU A;  2O2V B;  2BYV E;  2EKI A;  4MT5 A;  4WWP A;  4CO7 A;  2IGH A;  5JZE B;  1TY0 A;  4K7U A;  1L0X B;  4L23 A;  3TEZ A;  2KQ4 X;  1C3T A;  4K81 A;  1GAQ B;  1OTR B;  2JXT A;  1FPY A;  3KUZ A;  1R4M I;  3Q2A C;  5JH5 C;  2CKH B;  3UIO B;  2CJN A;  2DAJ A;  3FIL A;  2DWQ A;  5EE1 A;  2EMT A;  4NAW A;  3TEY A;  2EKE C;  3AU4 A;  3PO0 A;  5MPO A;  2MBB B;  4NJC A;  4ZYS A;  3L10 B;  4MSQ B;  5H8Y E;  4ZRJ A;  1TY2 A;  3B2F A;  3VTV A;  1LXD A;  1PFD A;  4RNA A;  1Q0W B;  2HJ1 A;  4O1N A;  2MX2 A;  3TEX A;  2IND C;  4EZK A;  3M63 B;  5C1Z A;  3TJP A;  4DXA B;  2LMC A;  4RM9 A;  3O13 A;  1STE A;  3W2D A;  1EM7 A;  2NBW B;  4KIK A;  5E6J A;  2IDY A;  2WU5 B;  1WJN A;  2WDT B;  3ZGZ A;  3SU8 X;  4DHJ D;  2X8X X;  3W1S C;  2KLC A;  1V5O A;  2K39 A;  2A4Z A;  4NJ6 A;  1OQY A;  4W9L A;  1XLN A;  4FUL A;  1H4R A;  2N0S B;  1RAX A;  4J6I A;  2D3C A;  1SXT A;  2V0G A;  4W9E A;  3T8M A;  4EFO A;  2JRH A;  1PGX A;  4N6E B;  4EUT A;  4TMA B;  1VJK A;  1EUV B;  3LYY A;  3W1Y A;  1TT5 B;  1FNU A;  2RPQ A;  3RYT A;  1SSN A;  1OQR A;  1I35 A;  3Q8A A;  1V1P B;  2W54 A;  1VZ7 A;  4MEL A;  4ICV A;  3MC0 B;  3RZF A;  3EGR A;  2G3Q B;  3ZNZ B;  3NZU A;  2HJ8 A;  4PYZ A;  1C4A A;  4GDK A;  1A5R A;  2UWQ A;  1S3S G;  1JWB D;  5DCN A;  1TS4 A;  2DZK A;  2WXQ A;  4C7Z A;  4MDK E;  2BTE A;  3VTU A;  4DK5 A;  4YXD B;  2JUO A;  2KDM A;  3IBE A;  4TUU A;  2G45 B;  1BXT A;  2XNA C;  2KZR A;  2OJR A;  3LB8 C;  4HDO A;  2XK5 B;  3B1L X;  3IHP C;  1EWY C;  1I4R A;  3P2B A;  1FIQ A;  2O2V A;  2JYT A;  2K8H A;  2V4I B;  1S1Q B;  3KYD D;  4GGQ A;  2INP E;  1SGH A;  1P7E A;  1LQB A;  2JWZ A;  3QAR A;  2JSV X;  4US9 A;  3C19 A;  3H7P B;  3ML8 A;  2FID A;  5AEK B;  1GOZ A;  4YL8 A;  2ACZ B;  2KDI A;  4IWQ A;  5BMI A;  3EHV A;  3W1S A;  3DDC B;  2G1E A;  4BKS A;  3BZD B;  1L0Y B;  3PZ7 A;  4LNO A;  1JQ4 A;  3N1Y C;  3ZXV A;  3M3J A;  3ZDM C;  1WXM A;  4FBJ B;  2I38 A;  1CK1 A;  2DZI A;  1RM6 C;  3KYC D;  2LUM A;  1TZO A;  2KWC A;  5CTR C;  1HTO A;  1L6U A;  2QIL A;  5IAA C;  1JRO A;  2PEA A;  3R8B A;  1IBX B;  1V81 A;  3FKY A;  1WF9 A;  4JQW C;  3IVF A;  2NTS A;  3VXW A;  3I63 C;  3KUC B;  4OZC A;  1I4Q A;  1V97 A;  3AEE B;  3H1U A;  1FCC C;  1XT9 B;  1WX9 A;  3GE3 C;  1FM0 D;  3PTF C;  3RNF C;  1YN3 A;  3L0W B;  3L13 A;  5D6J B;  3Q8C A;  1FNV A;  5GXG B;  4RGN A;  2CHZ A;  1D5X C;  2MH7 A;  5BMG A;  3QWZ B;  1SE9 A;  1KTK A;  2ONQ A;  3A1Q B;  4E74 A;  4KGS A;  4W9D A;  3KVF B;  1V1O A;  3L16 A;  1K52 A;  2K3U A;  1E0Z A;  1FFV A;  2LXA A;  3I57 A;  1T0S C;  4NAM A;  4MAC A;  2MQJ A;  3GZN I;  2WXI A;  3A9J A;  3WCQ A;  1WH3 A;  3AE7 B;  2C7M B;  2H89 B;  2J0J A;  2M0A A;  3EEC A;  4N59 A;  4F1S A;  4RH6 A;  1V1P A;  2C9W B;  3QCA A;  4W9G A;  3WAO A;  2N1W A;  4WWO A;  1FRR A;  2KJH B;  3ZIM A;  1UF0 A;  3RCZ A;  3AU5 A;  2JU6 X;  4PS3 A;  4MGZ E;  2J52 A;  1V86 A;  4S0R A;  2WDV B;  3SDL C;  1YJ1 A;  2CHW A;  2FCM A;  4YTN B;  4ZHP A;  1GPX A;  3ZTD A;  5IA7 A;  3Q3F A;  3IT6 B;  5C23 A;  5BO4 B;  1A70 A;  2XK5 A;  3VTW A;  1YIW A;  3Q8B A;  4KDI C;  2MP2 B;  5J18 A;  4EOY A;  2KAC A;  3R7R A;  1FNW A;  1AAR A;  2UU7 A;  2YVC A;  1M94 A;  3T3N A;  3VRB B;  2L05 A;  2UYZ B;  4LNF A;  2RSU A;  2L0T A;  1WGD A;  3H7P A;  4TQ0 A;  2LFI A;  5LXI B;  4I6L B;  5IP4 D;  1XF5 L;  1V80 A;  2Z8L A;  1OQQ A;  2LZ6 A;  2ZVN A;  3FC4 A;  1PDX A;  4DHZ B;  5I4D A;  3U2S C;  4YT0 B;  5TSS A;  2BYT A;  1C78 A;  1MHX A;  2GRI A;  2W82 A;  1QLB B;  1I4H A;  2O6V A;  4GSW A;  4N58 A;  3QX1 A;  4ANV A;  4A6Q A;  1XLO A;  3ZVV A;  3GB1 A;  1GC6 A;  2WQY B;  4HVB A;  2LGY A;  3QK0 A;  4A55 A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  1WZ3 A;  1QZE A;  4G3X B;  1LFD A;  4HXD A;  3A4R A;  5CHF A;  4GDK B;  3HM3 A;  2C7N B;  3ZUN A;  4FJZ A;  2LVO A;  2CU1 A;  2LUE A;  4WQO B;  2D3G A;  4LJO B;  1WY8 A;  2KOX A;  3DPD A;  3C0R B;  3PRP B;  2KLG A;  2MBH A;  4GIV A;  4BBN F;  3O65 B;  4N9F 4;  1HE8 A;  3ML9 A;  2AWT A;  2J7Q B;  4E71 A;  4ANU A;  1WM3 A;  3PPA A;  4A20 A;  2A5U A;  2WX1 A;  3NHE B;  4HWI B;  5D94 A;  4DHJ B;  2GBR A;  1P1A A;  2HTH A;  2K25 A;  4EKU A;  4WAA A;  3WAN A;  1WE6 A;  4JGH B;  2KFK A;  2M4N A;  5J17 A;  2Z0D B;  4TKN A;  3ZNH B;  4BVU C;  2BGF A;  3NY5 A;  2BPS A;  4KZC A;  3H7S A;  3A9K A;  4KZ0 A;  3ZTC A;  3Q3J A;  2K6Q A;  3IG3 A;  3JYU A;  3ZW3 A;  5HKH A;  2O2V B;  1WRD B;  2BYV E;  3RUI B;  3ALB A;  2K1F A;  1NDD A;  3A1Q A;  4WWP A;  1WIA A;  4CO7 A;  4GOC A;  5JZE B;  1YD8 U;  1WM2 A;  3ZNI D;  3DVG X;  4K7U A;  3DBR I;  1ZKH A;  4W9I A;  2ASQ A;  2LVP A;  5KHO A;  2ZCB A;  2YLM A;  3CST A;  2KNB A;  4GN1 A;  1C3T A;  4JIO U;  4K81 A;  2IY0 B;  2O6V D;  2ZZP B;  2ZNV C;  2N9E B;  1OTR B;  3DCG A;  1ISN A;  2BKR B;  2KVR A;  3KUZ A;  2DX5 B;  1R4M I;  5JH5 C;  4GMV A;  2CKH B;  4M8N A;  3VAW A;  3R7Q A;  1OEY J;  4PYU A;  3RUL A;  3UIO B;  4K7W A;  2MSE D;  2DAJ A;  2M1M A;  1E8Y A;  2M8S A;  2Y5B B;  2ZPY A;  2EMT A;  3QIJ A;  4CHK A;  1V9J A;  3K9O B;  4IG7 B;  4NAW A;  2XEW A;  1F9J A;  2EKE C;  3AU4 A;  1WMH A;  2NCN A;  3PLU A;  2MBB B;  3DVN V;  1UEL A;  1D3Z A;  2DZM A;  3L10 B;  4MSQ B;  2DYM A;  4MJS B;  4ZRJ A;  3LJ3 A;  1LXD A;  3VTV A;  1UBQ A;  4BBN C;  2LRU A;  4BKG A;  4KIK B;  2KJR A;  1Q0W B;  4W9C A;  3PVL A;  4KDL B;  1KLV A;  3X23 A;  1Z2M A;  4ASW C;  2MBO A;  2MX2 A;  4FAD A;  2WYQ A;  1FXT B;  2IY1 B;  2KD0 A;  3EC8 A;  2I1K A;  3M63 B;  3MTN B;  4EZK A;  5C1Z A;  2BF8 B;  3IFW B;  4AJY B;  5L95 C;  3TJP A;  2IO3 B;  4DXA B;  2K8B A;  1J0G A;  2C7H A;  4RM9 A;  3JSV A;  3TIX A;  1WXS A;  1E8X A;  2V4L A;  3K9P B;  4LDT D;  3CF6 E;  1Y8R C;  3ZLZ A;  4JL9 A;  2L7R A;  4B6W A;  3VVW B;  2KXJ A;  3TBL D;  3ZNG C;  4X57 B;  2CHX A;  2CR5 A;  3AXC A;  5CHV C;  2JY6 A;  2BWE S;  2MP2 A;  2NBW B;  4KIK A;  2N4F A;  4MGK E;  2B3A A;  1WJN A;  2WDT B;  3H9D A;  3CSF A;  5DPT A;  3SU8 X;  4DHJ D;  3N32 A;  1WGH A;  2NBU A;  3W1S C;  4FHJ A;  4IM0 A;  2KLC A;  2NPT B;  2KX0 A;  1V5O A;  1XQQ A;  2K39 A;  3KW5 B;  2A4Z A;  4HCP B;  4IWO A;  3HM6 X;  2KDE B;  3OJ3 A;  4NJ6 A;  4EEW A;  1J8C A;  1OQY A;  3V62 A;  4W9L A;  2FAZ A;  3QHT A;  3OJ4 B;  4FUL A;  1H4R A;  2L00 B;  3AI5 A;  4AJW A;  1RAX A;  4JLC A;  3VUY A;  4W9F A;  4J6I A;  1Q5W B;  4A3P A;  1YX6 B;  2LVQ A;  3B08 A;  1UGM A;  3QJZ A;  4W9E A;  3T8M A;  4BOS C;  4EFO A;  2JRH A;  3ZKJ C;  4EZL A;  2FCS A;  2J0K A;  3HHM A;  2ZPN A;  4XX5 A;  2FUH B;  3ZRC A;  3APF A;  3WAP A;  3NS8 A;  4EUT A;  4ZDV A;  3OAW A;  1KOT A;  3T9L A;  1EUV B;  2KWU B;  3UF8 A;  3W1Y A;  3JW0 X;  4WJO A;  3SHQ A;  3TL5 A;  2RPQ A;  3M95 A;  3RYT A;  2M0X A;  5AZG A;  1WX7 A;  3NZS A;  2KKC A;  2MCN B;  1I35 A;  3M62 B;  2GBM A;  2NPT A;  4BKS D;  1CMX B;  4W9K A;  1TGZ B;  3RT3 B;  4MEL A;  4AWJ A;  1TZ1 A;  4XZ4 A;  4ICV A;  4DDI D;  1WJU A;  4HDQ A;  3RZF A;  4RMA A;  2G3Q B;  3ZNZ B;  3NZU A;  2LGX A;  1RFA A;  2HJ8 A;  2D2Q A;  1RRB A;  3PV1 A;  4P7I A;  5AZF A;  4PYZ A;  2NBV B;  4I6N B;  2N1V A;  4GDL B;  4GDK A;  4II2 B;  4LCD E;  2HE7 A;  4WWN A;  5E6N A;  1VCB A;  2KQS A;  2DEN B;  2MBQ A;  5G55 A;  1A5R A;  2PJH A;  2UWQ A;  1S3S G;  1UH6 A;  5DCN A;  2DZK A;  1UZX B;  2ZVO A;  4MSM B;  4ZRK A;  1WGG A;  3QC8 B;  2KTR B;  4MDK E;  4W9H A;  4WJP A;  3B0A A;  3VTU A;  4DK5 A;  3TMP B;  1WJ6 A;  3GOE A;  4FA6 A;  2JUO A;  5FR6 A;  3IBE A;  2LAS A;  2FIF A;  4TUU A;  3N3K B;  2G45 B;  1GUA B;  2MLB A;  3DOW A;  2KZR A;  4HPL B;  2OJR A;  4HDO A;  1C1Y B;  2DHZ A;  4F8C B;  4URK A;  1V6E A;  1WX8 A;  1K8R B;  2D10 A;  2IO2 B;  3PT2 B;  2PE9 A;  2V1Y A;  3V6C B;  2XK5 B;  3B1L X;  2N7D A;  3IHP C;  2GOW A;  5JHB A;  3P2B A;  3WIM A;  4CYE A;  1P9D U;  2O2V A;  2K8H A;  3QQ8 B;  1I42 A;  2NS5 A;  1S1Q B;  2MWS B;  2MRP A;  3KYD D;  4GGQ A;  2KC2 A;  1SGH A;  2QHO A;  2BWF A;  1LQB A;  2JWZ A;  3QAQ A;  3QAR A;  3X0W A;  3RD2 A;  2KC1 A;  3V61 A;  3KH0 A;  1H8C A;  1LM8 B;  2KTR A;  2KO3 A;  2DYB A;  2BYF A;  5J2R A;  3UQB A;  3H7P B;  2MA9 B;  3ML8 A;  2FNJ B;  2IZV B;  2KMA A;  2FID A;  2ZJD A;  1NI2 A;  5AEK B;  4FJY A;  3VH3 B;  5LLI A;  1PQS A;  4YL8 A;  2KDI A;  4II3 B;  4IWQ A;  3EHV A;  3W1S A;  2MBE A;  2IYD B;  1UBI A;  1V49 A;  2KAN A;  3DDC B;  4FJV B;  4HLE A;  4BKS A;  3N30 A;  3MJW A;  1IYF A;  4IW0 A;  3L54 A;  3DBL I;  3A4S C;  2LWP A;  3DBS A;  5DPW A;  5AZH A;  2LRW A;  3PSE B;  4HJK A;  2VRR B;  4EZJ A;  1WGY A;  4ZYN A;  3NOB A;  1SIF A;  4KVG B;  3WA0 A;  4ANW A;  4IUM B;  2LI5 A;  3PZD A;  2LXC A;  3M3J A;  4PS8 A;  1MG8 A;  1WXM A;  3ZDM C;  4FBJ B;  4FHK A;  2EMS A;  5D7G A;  2GBN A;  2DZI A;  4MJS A;  5L83 A;  3KYC D;  3VUW A;  3HK0 A;  2KFJ A;  3VH4 B;  2L3Z A;  2BKF A;  2KWC A;  5CTR C;  4G0N B;  2L8J A;  4MGY E;  3QA8 A;  1IP9 A;  3DQV A;  2AL3 A;  3PHW B;  4AUQ C;  2RR9 A;  2V3S A;  4GU2 A;  5IAA C;  2PEA A;  4FLH A;  4HPM B;  4K7S A;  3LDZ E;  1V81 A;  4G11 A;  1WF9 A;  4JQW C;  4NQK E;  1YQB A;  2KMC A;  2KX3 A;  3IVF A;  4OVV A;  3VXW A;  4E3C A;  3PLV A;  3KUC B;  2AL6 A;  1J19 A;  2JZ3 B;  3PHX B;  2KHW B;  2K8C A;  2JRI B;  3I3T B;  4WJQ A;  3H1U A;  2Z59 B;  2NR2 A;  4IM2 A;  2RD0 A;  2L76 A;  4BOZ B;  1XT9 B;  1WX9 A;  2FCQ A;  4M0W B;  2JF5 A;  3PGE A;  1JRU A;  3WAL A;  3TCA A;  2J0M A;  4TV3 A;  2LJ5 A;  3PTF C;  2DAF A;  4KV2 A;  3VQI A;  3A9J B;  2HD5 B;  2KDF B;  3L0W B;  4A3O A;  4IWP A;  1WE7 A;  2OOB B;  3L13 A;  3ZRF A;  4G50 A;  2RGF A;  5D6J B;  2JVC A;  3CMM B;  1WI0 A;  2CHZ A;  3A9K B;  2REX A;  3VFK A;  2L0F A;  3ECI A;  4ZRI A;  3RZW C;  2N7E A;  3PRZ A;  3QWZ B;  3A33 B;  1SE9 A;  1P3Q U;  3A1Q B;  5CHW A;  2KTF A;  1L7Y A;  1WJ4 A;  4E74 A;  5EDS A;  2I1J A;  5KHQ A;  4W9D A;  1NBF C;  3KVF B;  2D11 A;  2JZZ A;  3L16 A;  1WFY A;  1WZ0 A;  1EF1 A;  2LXA A;  1L2N A;  1IPG A;  3UQA A;  3HIZ A;  3L17 A;  2PE6 B;  1OEY A;  3DBH I;  2R2Q A;  2DZJ A;  1OGW A;  1V5T A;  2MQJ A;  2D07 B;  3GZN I;  3U8Z A;  3VDZ A;  3A9J A;  1WH3 A;  3S2A A;  4HCN B;  3V60 A;  1E8Z A;  3R66 C;  5E6P A;  1UD7 A;  2C7M B;  1BT0 A;  2J0J A;  4NNJ B;  4MEM A;  2W9N A;  4AOF A;  3H6N A;  3R3M A;  4W9J A;  5CX3 A;  5GMV A;  3EEC A;  1ZGU B;  4F1S A;  2NVU I;  4NAW B;  2C9W B;  3DVG Y;  2M17 A;  1E90 A;  3QCA A;  2G4D B;  1WMH B;  2R2O A;  4W9G A;  4DBG A;  4FN2 A;  5LXH A;  3WAO A;  2N1W A;  4MH0 E;  4WWO A;  1ZW7 A;  2DYO A;  2KJH B;  1U4A A;  4M8M A;  3RCZ A;  3ZIM A;  2KWV B;  3AU5 A;  3ENE A;  3ZDT A;  4GXB A;  4PS3 A;  4RM8 A;  4MGZ E;  2CS4 A;  3PRM B;  2JXX A;  4IC7 B;  4KSK C;  2PPH A;  1V86 A;  3EFU A;  1WXA A;  3ONS A;  4GDL A;  1E7V A;  1KM7 A;  1E5W A;  1XD3 B;  3SDL C;  4ANX A;  2Z0E B;  3ZO5 B;  2XBB C;  4AP4 C;  4DDG D;  2GBK A;  4TQ1 A;  1YJ1 A;  2CHW A;  2BYE A;  4DHZ E;  1Z5S B;  2FCM A;  1WR6 E;  1WYW B;  3MHS D;  2KDB A;  2LGD A;  4B95 A;  5DPR A;  5E6O A;  3AUL A;  3ZTD A;  1GC7 A;  5IA7 A;  1GNU A;  3Q3F A;  2ZCC A;  1EF5 A;  2G4S A;  4NQL B;  3JSV B;  5C23 A;  1E8W A;  1P98 A;  2JPH A;  5BO4 B;  3BY4 B;  3BIN A;  2C5L C;  4OVU A;  3U7D A;  2XK5 A;  2C60 A;  2IBI B;  2MW5 A;  3VTW A;  5D2M B;  1YIW A;  3D32 A;  4KDI C;  4NPN A;  2MP2 B;  5J18 A;  4EOY A;  1KJT A;  1YX5 B;  3VUX A;  3R7R A;  3SD5 A;  2IO1 B;  3WAM A;  1AAR A;  3L08 A;  4B9K A;  2YVC A;  2KK8 A;  1Q1O A;  1M94 A;  4ICU A;  2O6V B;  2K6D B;  4NY0 A;  3UIN B;  2GMI C;  4LJP B;  1RLF A;  5JHA A;  2AYO B;  2L05 A;  3JVZ X;  2UYZ B;  2RSU A;  2L0T A;  4I6P A;  3V6E B;  1WGD A;  1TBE A;  2N9P C;  2N9X A;  1VD2 A;  3H7P A;  4TQ0 A;  3PS6 A;  4GB9 A;  5LXI B;  3VHT C;  2GBJ A;  4I6L B;  4NJ7 A;  3PRE A;  1V80 A;  1GJZ A;  2ZEQ A;  1X1M A;  2JT4 B;  4IM3 A;  2LZ6 A;  2ZVN A;  4DWF A;  4MM3 A;  4DHZ B;  5DPS A;  4KSL C;  3UGB B;  3UIP B;  1WR1 A;  3APC A;  4MGI E;  2LD9 A;  3KUD B;  4PS7 A;  4BFR A;  2KJ6 A;  3APD A;  4K1R B;  1E7U A;  2AEH A;  1WXV A;  3OLM D;  4BKT A;  2KQ7 A;  2O6V A;  1GG3 A;  2WX0 A;  4GSW A;  2ZNV B;  1P0R A;  3QX1 A;  4ANV A;  5G2N A;  1G6J A;  2KFK B;  4WJN A;  2KN5 A;  1R4N I;  3ZVV A;  1WGR A;  1V2Y A;  1GC6 A;  3DVN U;  5TR5 A;  2IO0 B;  1EO6 A;  1TTN A;  2WWZ A;  1T0Y A;  2FCN A;  4HVB A;  4HK2 A;  4XC2 A;  2LGY A;  3QK0 A;  4LDT B;  3U30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...