1J8CA

Solution structure of the ubiquitin-like domain of hplic-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics
molecule keywords ubiquitin-like protein hPLIC-2
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j8cA00
4K7UA 3VUWA 4BKTA 1P98A 4GDLA 3SD5A 4OVVA 2LUEA 2R2OA 1J19A 4G3XB 2KDBA 3R7RA 2PPHA 2QHOA 1V5TA 2AL6A 2WWZA 3VUXA 4K7SA 3U8ZA 2KOXA 2ZVNA 2N4FA 3PLVA 3DBLI 2WYQA 2KJ6A 3PTFC 3PHWB 2LVOA 3W1SC 2HE7A 4PYUA 4FADA 2KDIA 3PPAA 4ASWC 3UINB 2LGDA 4JIOU 3S2AA 2GBNA 5D2MB 3V6CB 2N7DA 4EZJA 3PRPB 5LXIB 3PGEA 3M95A 5AZGA 1UBIA 3PV1A 4AUQC 4GXBA 2DZIA 3PRMB 2EKEC 4PS3A 2JZ3B 3MJWA 1P1AA 2Z0EB 4A3OA 2MBHA 3QQ8B 4ZRJA 5J18A 2MA9B 1OEYA 4NJ7A 1WJ6A 4GSWA 1PQSA 3H9DA 3LJ3A 1YX5B 4HDOA 3OJ4B 1EUVB 5CHVC 4ANVA 4EZLA 3ZLZA 1GJZA 2KDEB 4LDTB 1WXVA 4BKSA 2PEAA 4KDIC 3TBLD 2DAJA 4DHZB 3B1LX 4IW0A 4B6WA 3ZIMA 2K6DB 2LI5A 2NCNA 4CO7A 2KX3A 4F1SA 1YIWA 4EZKA 4NJ6A 1C1YB 4MGZE 1E7UA 1HE8A 2XK5A 3V60A 4EKUA 2JRHA 4G11A 2KK8A 4CHKA 3HM6X 3ML8A 4NAWB 5DCNA 3RT3B 4BFRA 2MBEA 2Z0DB 4DK5A 2BWFA 1WR6E 2N9EB 1GC7A 3JVZX 1BT0A 3EC8A 4GMVA 4W9GA 4DXAB 3KUZA 2KVRA 3JSVB 3ZTCA 1GC6A 1VCBA 3P2BA 1MG8A 1WZ3A 3ZO5B 2L0TA 3PSEB 2JY6A 2LASA 4ZDVA 3QAQA 3M63B 1SE9A 2JPHA 2WX1A 5TR5A 3H1UA 2LXCA 1KJTA 2BWES 2FIFA 3HIZA 5E6PA 4IUMB 3KW5B 3ZUNA 4TV3A 2C7HA 3AU4A 3N30A 5IA7A 1IPGA 3QX1A 2KC1A 5IAAC 2G4SA 1GG3A 2MW5A 1WH3A 1WX7A 4MEMA 3NS8A 3CF6E 4MJSB 2CR5A 3MHSD 4F8CB 1WXSA 2IZVB 3L08A 2N9XA 2NVUI 3DBHI 4JGHB 2CKHB 2BGFA 2HJ8A 2KTRB 4LCDE 4IM0A 3ZDMC 4KDLB 2KFJA 5EDSA 3VDZA 1ZW7A 3WA0A 1V80A 2KFKB 3L16A 4YL8A 1RAXA 2K6QA 3A1QB 4W9EA 5D7GA 1I42A 2O2VA 3A9KB 3ONSA 2BF8B 3RZWC 2OJRA 3PVLA 4WJOA 4LJOB 1ZGUB 1UZXB 2D2QA 3X23A 1J8CA 1OQYA 3DCGA 2DZJA 1V81A 3ZNID 1LFDA 1NI2A 2ZCBA 3CMMB 4WWOA 3TCAA 3RULA 4WQOB 3KH0A 3H7PA 1OTRB 1WMHA 2W9NA 1TBEA 2C7NB 3RYTA 4BOSC 3QA8A 3WALA 2MBQA 2LVPA 1H4RA 2XBBC 4EOYA 2NPTB 2I1KA 4AP4C 4ICVA 3VFKA 1L2NA 4XC2A 3APCA 1ZKHA 3ML9A 4WAAA 4B9KA 1SGHA 3QC8B 1WR1A 4IM3A 2LGYA 3T9LA 1YQBA 4B95A 1OGWA 2GMIC 2CU1A 3IHPC 3V6EB 5L95C 4ZRIA 5HKHA 3IG3A 1ISNA 4RM9A 4I6LB 1RLFA 2MP2B 3EECA 3A1QA 5C1ZA 3OLMD 4A20A 2JVCA 4NNJB 3LDZE 2DYOA 3RCZA 2IYDB 3DVGY 3HM3A 2CHZA 1U4AA 4IG7B 5JZEB 5KHQA 3HK0A 3IVFA 2MCNB 2KJRA 4HPMB 4GDLB 2JT4B 4IM2A 3K9PB 3L10B 1X1MA 4GGQA 2HD5B 2CHXA 2RGFA 3R66C 3H7SA 2RD0A 5LLIA 2C5LC 3AI5A 2FCSA 2JZZA 3JYUA 2MRPA 4HWIB 4GU2A 1EF1A 2YLMA 4JQWC 5CX3A 5L83A 1GUAB 2XK5B 1UH6A 4FN2A 2KKCA 1A5RA 2JWZA 4DHZE 1E7VA 2MWSB 1V9JA 1WJNA 4GIVA 3PREA 4P7IA 4PYZA 2D07B 1UELA 2Y5BB 4HCPB 2L05A 2IO0B 4BVUC 1LM8B 4FHJA 2KHWB 1YJ1A 2ZNVB 3DOWA 3DVNV 5AZHA 4FBJB 1Z5SB 1E90A 3QARA 2CHWA 3NZSA 1WJUA 2DX5B 3VQIA 1XD3B 4M0WB 1WX9A 5JH5C 4NAWA 2GBRA 1WZ0A 1Q5WB 2AYOB 2ZEQA 1H8CA 3UIOB 1WE7A 3GZNI 1WFYA 3QCAA 1E8WA 3U7DA 4G50A 1E8ZA 4LDTD 3W1YA 2N7EA 2V3SA 2MX2A 2VRRB 2LRWA 4W9CA 3DVGX 2IO3B 5C23A 2XEWA 2WX0A 5D94A 3ZRCA 4MJSA 2KWVB 4OVUA 3QWZB 2KMAA 3ZNGC 4E74A 2J7QB 2D3GA 3EFUA 3H7PB 3DVNU 3A9JA 3GOEA 4DWFA 2KJHB 4F7ZA 2KTFA 4EFOA 2D11A 2M1MA 1KM7A 3V61A 3ENEA 4JLCA 4MM3A 3ZDTA 4HLEA 4KZ0A 3R7QA 4KSKC 4K81A 2LXAA 2DZKA 2NPTA 4KV2A 1RRBA 4FJZA 4NQLB 1NDDA 4WJNA 3JSVA 3A4RA 3UQAA 3ZNZB 4FJYA 2BYFA 4AJWA 4FA6A 3C0RB 2G4DB 1EO6A 4DDID 1WF9A 2L76A 2C7MB 4E71A 1LXDA 2L00B 3VVWB 2K8CA 3VH4B 1TZ1A 2LZ6A 3VH3B 4M8NA 3UF8A 1TTNA 1WGDA 1V6EA 2MBBB 4MGKE 2RSUA 1YX6B 3M62B 3PHXB 4GDKA 3H6NA 1AARA 2JRIB 4ANXA 2DHZA 1WGHA 3N3KB 2MP2A 4URKA 2ZPYA 1WYWB 2NBWB 1UGMA 1S1QB 1D3ZA 4ZRKA 3WAOA 4EEWA 2G3QB 2KQSA 1C3TA 4RMAA 3SHQA 1QZEA 5G55A 1E5WA 2O6VB 5G2NA 2ZNVC 4KSLC 2FCNA 4MDKE 1XT9B 4GOCA 1R4NI 4K7WA 4MGIE 4DHJB 3VAWA 4HJKA 1VD2A 3BINA 2K39A 3WANA 3KVFB 2MLBA 3W1SA 1P0RA 2KANA 4NY0A 4BBNF 4AWJA 2N9PC 1RFAA 3TL5A 3RZFA 1IP9A 4HXDA 3IBEA 4JL9A 3AULA 3VTVA 4FJVB 2J0KA 3KUDB 3QJZA 5CHFA 2L3ZA 2G45B 2FNJB 2RPQA 2LVQA 2WDTB 4RM8A 3MTNB 5JHBA 3EHVA 2L0FA 2DAFA 2KWUB 2R2QA 2ZVOA 2GBMA 4GDKB 1R4MI 3PT2B 5CHWA 2O2VB 3A9KA 4XZ4A 4ANUA 3APDA 4W9LA 4DBGA 5CTRC 4W9HA 1OEYJ 3B0AA 2JF5A 5KHOA 4EUTA 3DPDA 2C9WB 4BKGA 2PE6B 2PE9A 4HK2A 2DYBA 1TGZB 1Z2MA 2C60A 3TMPB 3ZKJC 4TQ0A 3ZVVA 3L0WB 2D10A 3OJ3A 1V2YA 1V49A 2MQJA 2ZPNA 3PS6A 2BKFA 3DBRI 4W9KA 2J0MA 3UIPB 3NZUA 3VTWA 1WIAA 3SDLC 4J6IA 2M0XA 2KC2A 2ZCCA 2KZRA 1XQQA 4GN1A 1WX8A 3NY5A 3BY4B 4NPNA 2CS4A 2M4NA 3Q3FA 1Y8RC 4FULA 4II3B 1V86A 3A9JB 2KD0A 1LQBA 3KYCD 4TKNA 2KDFB 2V4LA 4FHKA 1JRUA 3N32A 4GB9A 2K1FA 4TQ1A 5BO4B 2EMTA 3DDCB 4M8MA 2KLCA 2Z59B 2BKRB 2KFKA 4PS8A 2FIDA 3ZRFA 1T0YA 4HCNB 1KOTA 2K8HA 3X0WA 5DPWA 2MBOA 1WI0A 1WM2A 5JHAA 1WJ4A 2NBUA 2O6VA 3Q3JA 3KUCB 5DPRA 3TJPA 2FAZA 3NOBA 4MELA 2N1WA 3PRZA 4BKSD 4A3PA 4E3CA 3A33B 3CSFA 3L54A 5LXHA 2ZJDA 3PZDA 1M94A 1G6JA 3L13A 1WXMA 4WJPA 1F9JA 4W9JA 3ZW3A 2KX0A 3V62A 2BYVE 2KQ7A 5E6OA 3T8MA 1SIFA 5AZFA 2GBKA 4HPLB 2AL3A 1J0GA 2J0JA 5J17A 4WWNA 2FCQA 1YD8U 2KXJA 1S3SG 2A5UA 2IO2B 2M17A 2UWQA 4MSMB 1I35A 2GOWA 2IBIB 2PJHA 4HDQA 4ZYNA 3RD2A 1L7YA 1IYFA 2ASQA 2RR9A 5GMVA 4CYEA 4KIKA 4PS7A 3UQBA 2K8BA 1WE6A 3UGBB 3QK0A 3M3JA 2BYEA 2HTHA 2M8SA 3U30A 2LRUA 2NS5A 3SU8X 4I6PA 1WMHB 4LJPB 1EF5A 1WGRA 1NBFC 3AU5A 3OAWA 2IY1B 3VHTC 3VTUA 4AOFA 3APFA 1WRDB 2DYMA 1Q0WB 4IWPA 1Q1OA 3RUIB 1WM3A 3ZTDA 4TUUA 4AJYB 2JUOA 2A4ZA 1E8YA 2ZZPB 2AWTA 1WXAA 2EMSA 4KZCA 2KO3A 2REXA 4FLHA 1V5OA 4G0NB 2IO1B 3QHTA 4MH0E 3ALBA 1WGYA 4KVGB 3A4SC 3VUYA 1P3QU 2L8JA 3VXWA 2LJ5A 3PLUA 5AEKB 1KLVA 3K9OB 4BOZB 3B08A 4HVBA 3I3TB 2BPSA 3CSTA 1CMXB 4W9FA 3D32A 4N9F4 2AEHA 3O65B 5FR6A 3WAMA 3L17A 2KN5A 4W9DA 2JXXA 3HHMA 2NR2A 4IWOA 4MSQB 3KYDD 4ICUA 1WY8A 3IFWB 3AXCA 3ZNHB 4NQKE 4DDGD 5J2RA 4I6NB 2UYZB 1P9DU 2I1JA 4X57B 2O6VD 3R3MA 2KLGA 3WIMA 4K1RB 4MGYE 5DPSA 2FUHB 1E8XA 4DHJD 3QIJA 4XX5A 3WAPA 2DZMA 1GNUA 4ANWA 2DENB 2GBJA 3ECIA 2LD9A 1K8RB 2KWCA 4IWQA 4IC7B 3NHEB 4W9IA 4WWPA 1FXTB 2B3AA 2N1VA 1UD7A 5DPTA 2YVCA 2NBVB 2KTRA 3DQVA 5D6JB 2MSED 3TIXA 4KIKB 2OOBB 2KMCA 2V1YA 4WJQA 4II2B 3JW0X 1WGGA 2L7RA 2LWPA 3DBSA 4BBNC 2IY0B 2FCMA 2K25A 1UBQA 5E6NA 2LGXA 2KNBA
chains in the Genus database with same CATH superfamily
3VUWA 4GDLA 3IT4B 2OHFA 2R2OA 4G3XB 3R7RA 4HKZE 3PTFC 2LVOA 2X38A 3PPAA 1C4CA 3UINB 3PRPB 3M95A 4AUQC 4GXBA 1VZ7A 4TMAB 2JYTA 3PRMB 4KKIA 4PS3A 2I38A 2Z0EB 4P6VF 5J18A 1WJ6A 3H9DA 5CHVC 1EUVB 2XNAC 3N9YC 2AQ1B 3ZLZA 4LDTB 4RH6A 4RCOA 1K52A 1JWUD 2RDGA 1T5XD 3B1LX 4F1SA 3ZIMA 2K6DB 2IPKD 2LI5A 4CO7A 1C1YB 2MH7A 1SXTA 2V3NA 1HZ6A 4CHKA 5DCNA 4IOIE 2Z0DB 4DK5A 4W9GA 1XLPA 2V3PA 3AEAB 1MG8A 1WZ3A 5E6JA 2LASA 3M63B 3H1UA 2FIFA 1DOXA 3KW5B 1BXTA 4RGNA 4RNAA 1IPGA 1GG3A 2WLBA 4MEMA 3RMKC 2J52A 2IZVB 3Q3MC 2KTRB 4KDLB 2KFJA 3AE9B 3DBHB 1SEBD 2ZW1A 4W9EA 4KGTA 1E7PB 1NYQA 2JZPA 2BF8B 2N0SB 1UZXB 2D2QA 1EWYC 2WXPA 3DCGA 1MFWA 5EE0A 1HQRD 1PYWD 3KH0A 5BYSA 3C8YA 3QA8A 3AMZA 1TKGA 2K9XA 2NPTB 1L2NA 4XC2A 2IGHA 4ZRPA 1SGHA 3T9LA 2QMTA 3IHPC 4ZRIA 5HKHA 2MJEA 3IG3A 1FFUA 1R7SA 2H88B 2QILA 4I6LB 3NJTA 4HRSA 3OLMD 4JWSC 2JVCA 2NTTA 2EELA 4LNNA 3RCZA 2IYDB 3DVGY 5KHQA 4LNOA 1D4BA 2KJRA 4HPMB 2JT4B 3NVWA 4YTMB 3H7SA 1TZOA 5LLIA 2C5LC 3AI5A 4GLSC 2WHIA 2MRPA 1SJED 4HWIB 4M0WA 4JQWC 1KFYB 5CX3A 1I4XA 4OHJA 3R2TA 1A5RA 2JWZA 4DHZE 2MWSB 4MM3B 4BVUC 1LM8B 2BB6A 1QQRA 3LXFA 1E90A 3SFDB 3NZSA 2GBRA 1XLOA 3U7DA 3W1YA 1SB3C 2MX2A 2E6XA 2XEWA 1F52A 2CU3A 3ZNGC 1L4ZB 4K3CA 4NZLB 2WS3B 2QCZA 1GOZA 1FMAD 3U2SC 4HLEA 3ZDTA 4JLCA 1XCTL 4LK0M 3RNGC 4K81A 3CWIA 4FJZA 1NDDA 4RF0A 5AUIA 4WJNA 3KWLA 2SEBD 3UQAA 1ESFA 3C0RB 2G4DB 1EO6A 2GRIA 2YEPF 2L76A 1SIJA 1K50A 1J7CA 2LZ6A 4M8NA 1YX6B 2DLBA 3KLSX 1NI3A 4GDKA 1NEKB 3OWEB 5BYRA 4ANXA 3MJ5A 2ZPYA 1WYWB 4S17A 3WAOA 2G3QB 3NG0A 2KQSA 5FK9C 1IBXB 3GZNB 3SHQA 1QZEA 3BYTB 4KSLC 3FC4A 4XWWA 2RPVA 1XT9B 4GOCA 3Q2AC 1UGJA 4HJKA 2ZW0A 1VD2A 4NAMA 3WANA 2MLBA 5H92C 3TL5A 1FRRA 4ARIA 1VJKA 4JL9A 3Q3NC 3AULA 4M02A 3RFZB 3QJZA 4PT5A 2G45B 1FCCC 2LVQA 1YQ4B 2WDTB 1OFFA 3EHVA 2ZVOA 4GDKB 1AYFA 3APDA 4W9LA 5C2TB 4W9HA 1TGZB 2DYBA 4B0MA 2WGSA 2MQJA 2ZPNA 2BKFA 3DBRI 3NZUA 4AS1A 4A6QA 2M0XA 2KC2A 1XQQA 4US8A 1WX8A 3URYA 2CS4A 5IP4D 3MFGA 2WDVB 4II3B 3A9JB 5HG2A 1ET6A 3NS1A 4ZOHC 1JRUA 1J7BA 4TQ1A 4WAFA 5FR3A 2KWDA 1KRHA 2INCC 2FIDA 4UDUC 3ZXRA 1T0YA 4HCNB 1WXQA 3RN9C 1ZXHA 5JHAA 2KDMA 4QAYA 4NJCA 3V3XA 1MHHE 4R3DA 1M94A 3L13A 3RNAC 1JCKB 2DWQA 2KX0A 2KQ7A 5AZFA 4AQ7A 1J0GA 2J0JA 2FCQA 2IJ0A 2MJ3A 2IO2B 3AE2B 3E56A 2IBIB 2PJHA 2WU5B 1L7YA 4YSZB 3B9JA 5GMVA 4KIKA 4PS7A 2BTEA 2K8BA 1WE6A 3M3JA 2BYEA 2LRUA 3SU8X 3VHTC 3AU5A 3OAWA 2IY1B 3APFA 1WRDB 1Q1OA 1WM3A 2LGSA 3ZTDA 1SBBB 2WQYB 2AWTA 2DNFA 2REXA 1VZ8A 1V5OA 2IO1B 4IKGA 3A4SC 3VUYA 4RGOS 3VXWA 1J7AA 3N1ZC 1QT9A 1KLVA 1HZ5A 1I4HA 1XCQL 1SE3A 2TSSA 3O65B 5FR6A 3L17A 4W9DA 1JW9D 2NR2A 4IWOA 3T3NA 3AXCA 4O1NA 1I4RA 3B2GA 1P9DU 2YEPB 3R3MA 1L4DB 2FUHB 1E8XA 1STEA 4DHJD 4OW0A 5G5GA 5IN7A 3IXSA 2LUMA 4RF1A 2N1VA 4KKJA 2YVCA 2KTRA 2CJOA 2PVOD 1ACCA 2KMCA 2LWPA 2IY0B 3KUZA 4K7UA 4BKTA 2J53A 1UWXA 3SD5A 2LUEA 4D2KA 1J19A 3AB5A 2V0GA 1V5TA 4JPSA 4K7SA 1I7HA 2N4FA 3AECB 2KJ6A 1KF6B 2WXKA 4PYUA 2D3BA 3DBLB 3V6CB 3RI7C 3PGEA 1HA5A 1UBIA 3EGRA 1EWCA 1F2RC 1HEZE 3NUHB 1JQ4A 2WXFA 2DZIA 1P1AA 4A3OA 2MA9B 1OEYA 3AE5B 4NJ7A 4HDOA 3AH7A 3OJ4B 2L52A 1QILA 1WXVA 4KDIC 3TBLD 1CK1A 4DHZB 3I9V1 2N9KA 1TJEA 4NJ6A 1N62A 3V60A 1HE8A 4EKUA 2IGGA 3RT3B 2INPE 3RNBC 4C56C 2BWFA 1WR6E 3EC8A 5EE1A 1GC6A 3AEFB 3BVZA 3ABVB 3SFEB 4KGSA 1KJTA 1WGKA 2C7HA 3AU4A 1WH3A 1T0SC 3NS8A 4MJSB 2CR5A 3TEXA 2NVUI 3DBHI 4JGHB 2CKHB 2HJ8A 2Y3AA 4LCDE 2INDC 2CJNA 1JRPA 3WA0A 1V80A 1V97A 3L16A 1TS4A 1V1OA 1RAXA 1HTOA 2FBWB 3A1QB 4ACFA 5D7GA 1I42A 4YWGG 1YN5A 3ONSA 3PVLA 4WJOA 4LJOB 1B1ZA 1OQYA 3CMMB 1YN3A 4WQOB 1OTRB 3RNFC 2WXRA 2VZKD 2W3SA 2LVPA 2XBBC 2X8XX 3APCA 1ZKHA 3DHHC 4B9KA 3AE6B 3AN1A 2LGYA 1YQBA 2GMIC 1PGAA 4RM9A 1RLFA 3EECA 2WXLA 1VR9A 3LDZE 1FPYA 1SJHD 3NZ3A 3IVFA 2MCNB 4GDLB 1TS5A 3K9PB 1PFDA 3Q8BA 3RNEC 3TEYA 1X1MA 4GGQA 1BMLC 3FILB 4OZCA 2FCSA 1I4GA 3JYUA 3SR6A 1UH6A 2KKCA 5HI1A 1E7VA 4JX1C 1V9JA 1UELA 2Y5BB 2IO0B 3DOWA 1YJ1A 2BQQA 3DVNV 1Z5SB 1GB1A 2CHWA 1WJUA 1XD3B 1WX9A 5JH5C 3TEZA 1WZ0A 1E8WA 2FUG1 4LDTD 2V3SA 2LRWA 5C23A 2WX0A 3N1YC 2KWVB 1MVKA 2KMAA 2OEDA 3W5UB 3GOEA 2HTME 1XO3A 2KJHB 4F7ZA 2KTFA 3DWGC 3V61A 2KT7A 3ENEA 4KZ0A 2LXAA 4NQLB 1CZPA 3A4RA 2M0AA 2ON8A 4AJWA 4FA6A 1T6BX 2C7MB 2W3RA 2L1AA 3VVWB 1JROA 1T3QA 2K8CA 1TZ1A 2V9HA 3ZXVA 2MBBB 1ZDXA 3M62B 1ZP0B 3O13A 4TSSA 2MP2A 4URKA 2JQRB 3BVGA 1FXAA 3GE8C 3T3OA 1S1QB 1D3ZA 1FO4A 4RMAA 5G55A 2JX5A 1HXYD 4MDKE 1NENB 4MGIE 4NY0A 2N9PC 1IP9A 4JE3B 4EE2A 3VTVA 1D5MC 5CHFA 1IGCA 3MTNB 3BK1A 4RGMA 1N63A 2LHEA 2MEKA 5JXVA 2L0FA 2KWUB 2R2QA 4XZ4A 1R4MI 3PT2B 5CHWA 4ANUA 1OEYJ 3DPDA 2C9WB 4BKGA 2PE6B 3P4PB 1C79A 3TMPB 4TQ0A 1V2YA 1P7EA 1PGBA 3PS6A 3VTWA 1WIAA 4J6IA 4XYCA 3BY4B 1UWMA 4S0RA 2V4IB 3KYCD 5I4DA 1FD6A 4WQMA 2EMTA 2KLCA 2QSDA 3NVYA 3AEDB 3VR8B 1WM2A 2O6VA 3Q3JA 4MELA 1ZDVA 4BKSD 4E3CA 4WIPA 3HVDA 3L54A 4N6EB 3PZDA 3V62A 2QDFA 3T8MA 2GBKA 2NMQA 1YD8U 2M17A 4MSMB 4A8XC 2L83A 3I5JC 2ASQA 4JWUC 2RR9A 4CYEA 3UGBB 3QK0A 2M8SA 5GXGB 3U30A 4LJPB 1RWSA 2J42A 2DYMA 1Q0WB 3P4SB 3RUIB 2R61A 4TUUA 2JUOA 1WRIA 2ZZPB 1WXAA 5HFYA 2RMMA 3ALBA 1WGYA 1P3QU 1ENFA 4Q2JA 4HVBA 3I3TB 2BPSA 3CSTA 1CMXB 4W9FA 3D32A 3RPFC 2AEHA 3WAMA 2KN5A 3HHMA 3KYDD 3IFWB 2K3UA 3ZNHB 4I6NB 4X57B 3HUIA 3B2FA 5BYQA 3WIMA 4MGYE 4ZHOA 1TS3A 2DZMA 2DENB 3NHEB 4WWPA 4PK1A 3EUB2 1UD7A 2NBVB 5D6JB 4KIKB 2V1YA 1DOYA 4II2B 1QKZA 2WXIA 4BBNC 2G9HD 2FCMA 1QOBA 1UBQA 2LGXA 1K53A 1P98A 1Q10A 4OVVA 1SE2A 2KDBA 3R2IA 2PPHA 4XWTA 2QHOA 3AEEB 2AL6A 2WWZA 1CQVA 2LGIA 2KOXA 4K3BA 2ZVNA 1C77A 3DBLI 3PHWB 5C3JB 1TY2A 2HE7A 2KDIA 4ASWC 4JIOU 2GBNA 1YJJA 2N7DA 2QJLA 2ACZB 1AWDA 1V8CA 1I4PA 2WXJA 5AZGA 1N61A 3PV1A 5G5HA 2K5PA 3FILA 4P1BC 4ITKA 3ZYYX 2JZ3B 2FE8A 2MBHA 3QQ8B 4ZRJA 3GS2A 4ZRQA 2PLPA 4GSWA 1YX5B 4H2AA 4OZAA 1N60A 3AEBB 2PEAA 2AQ2B 1YN4A 2DAJA 4ARCA 1RFKA 2KX3A 4LNKA 4L2YA 4MGZE 1E7UA 2JWUA 2JRHA 4G11A 2KK8A 4NAWB 1P7FA 2MBEA 3J9CA 2N9EB 3AE8B 1BT0A 3JSVB 3ZTCA 3P2BA 3ZO5B 5IOIA 4N58A 4M00A 2BW2A 2WX1A 2LXCA 2BWES 1FRDA 3HIZA 5E6PA 1XF5L 4YSXB 3ZUNA 4P1CC 4TV3A 3N30A 5IA7A 2KC1A 4YSYB 4HROA 3MHSD 2D5GA 2WXOA 1WXSA 4C80A 2KVZA 1XEEA 4XGAB 2BGFA 4IM0A 3ZDMC 5EDSA 3VDZA 1ZW7A 2LHDA 1NVID 3NVVA 2J4XA 3RZWC 2OJRA 1ZGUB 5BMIA 4WWMA 2DZJA 3P1MA 1V81A 4WWOA 3TCAA 3H7PA 2WXMA 2W9NA 1TBEA 2C7NB 4BOSC 3AE1B 3WALA 2MBQA 1F77A 1DOIA 2I1KA 4AP4C 4ZHPA 3VFKA 3Q8AA 4L1BA 3QC8B 2WXNA 1FFVA 1OGWA 2CU1A 3CIRB 5L95C 1ISNA 1IGDA 1PDXA 2MP2B 1T0RC 2M56B 3KQ4A 1SSNA 2DYOA 2E3TA 3HM3A 2CHZA 4IG7B 3LB8C 3HK0A 5D3DA 3MP9A 4OVZA 1D6EC 2HD5B 2CHXA 3AE4B 1PUTA 2RD0A 1YOVB 4GU2A 2YLMA 2PIAA 5L83A 2JU6X 1GUAB 2XK5B 4FN2A 1TYGB 3W9CB 3PREA 4PYZA 2D07B 2ZNVB 2LEKA 1JWAD 4C00A 5D3IB 3QARA 1C76A 1C4AA 2L32A 2DX5B 3VQIA 1EU4A 1FCLA 2Y5CA 3VR9B 3WCQA 1Q5WB 2ZEQA 1H8CA 1MG4A 1WE7A 2AX5A 3GZNI 3UIOB 1JALA 4MACA 4G50A 5IKCM 1E8ZA 2KYWA 2N7EA 4W9CA 3DVGX 3ZRCA 4MJSA 2PVGC 1FEHA 3QWZB 4E74A 2J7QB 4WURA 4HPPA 3H7PB 3DVNU 4C4VB 4EFOA 2D11A 1KM7A 4MM3A 1YNTE 3R7QA 1L0XB 2NPTA 4MH8A 4KV2A 1UUPA 2BS2B 2BYFA 1WF9A 5BMGA 1YMHE 2WXHA 4E71A 2L00B 3ZJUA 3VH4B 1KLGD 2B76B 3UF8A 5HHDG 1V6EA 2RSUA 3PHXB 1SE4A 1M4VA 3H6NA 1AARA 2JRIB 1WGHA 3MHZA 3N3KB 3NRZA 5EE9A 2HJ1A 2NBWB 4YT0B 2W82A 2O6VB 5G2NA 4J3OD 3BINA 2K39A 1DYQA 3W1SA 4AWJA 4HXDA 2N9LA 2IDYA 1TS2A 3Q3OC 4FJVB 2J0KA 3KUDB 1FIQA 2RPQA 2W54A 4M01A 1MHXA 4RM8A 1TIFA 3UI3A 3BYYB 1RYJA 2DAFA 2GBMA 5CTRC 2JF5A 5KHOA 3IT6B 3L4PA 1Z2MA 3ZVVA 3L0WB 2D10A 3IAS1 1XLNA 4W9KA 2J0MA 1XXGA 3UIPB 2PW9A 1E6EB 3SDLC 2ZCCA 2KZRA 4GN1A 3NY5A 2VH1A 4NPNA 3Q3FA 1N5XA 1DGJA 1LQBA 4TKNA 2KDFB 2V4LA 4FHKA 3DHGC 3N32A 2K1FA 2Z59B 3NVZA 4PS8A 3ZRFA 1KOTA 2K8HA 5DPWA 2MBOA 2NBUA 5DPRA 2JYEA 3KUCB 2MJDA 4REZA 2Q5WD 4A3PA 1TKYA 3A33B 3CSFA 1KH0A 1WXMA 4WJPA 1F9JA 3ZW3A 3Q69A 2D3CA 1OQRA 2D3AA 2AL3A 3ZJVA 5J17A 4WWNA 1I35A 2A5UA 2GOWA 4HDQA 3RD2A 5EE3A 3AM9A 3UQBA 3EA6A 2HTHA 2WU2B 3V05A 1L5PA 4AOFA 2ONQA 2QC8A 1ZE3D 2A4ZA 2EMSA 2KO3A 4G0NB 3QHTA 3HRDD 2GB1A 3Q8FA 2LJ5A 3PLUA 4HJGE 5LNK1 3TUOA 3K9OB 4BOZB 3MC9A 3B08A 2ICIA 1L6UA 1F1HA 4L23A 1FM0D 4MSQB 1WY8A 3P4QB 4BAXA 4DDGD 5J2RA 4BZAA 2UYZB 2I1JA 1HTQA 3N1XC 1E9MA 4XDCA 3H8HA 5DPSA 1FNWA 5TSSA 1MI0A 4XX5A 2QEJC 4A90A 1GNUA 2GBJA 2LD9A 1A70A 4IWQA 4W9IA 1QOGA 2W55A 1FXTB 5DPTA 4BBNF 3TIXA 3DQVA 3X0WA 2VH2A 4WJQA 3JW0X 1WGGA 3DBSA 2KACA 5E6NA 2KNBA 1IBXA 3Q6BA 1NYRA 2I2YA 1OQQA 3W2DA 3AE7B 3VUXA 1IUEA 3U8ZA 3PLVA 2KQ4X 2WYQA 3W1SC 4IDIA 4FADA 3TSSA 1VDVA 2LGDA 1PGXA 3S2AA 3SEBA 5D2MB 4B0EA 3Q8EA 4EZJA 2WXQA 4P16A 5LXIB 5T8IA 1C9FA 2EKEC 3MJWA 1KTKA 2HDEA 1PQSA 4CQNA 3LJ3A 1QLBB 1FXIA 2BB5A 4ANVA 4EZLA 1GB4A 1GJZA 2KDEB 2LFIA 4HKQA 4BKSA 2N7JA 2AQ3B 3U7ZA 4B6WA 4IW0A 2NCNA 1KLUD 1YIWA 4EZKA 2MHJA 4N59A 2DBYA 2XK5A 2BS3B 3HM6X 3ML8A 3P4RB 4BFRA 3ZQ4A 3I57A 1N5WA 1AN8A 4LNFA 3JVZX 4GMVA 1GC7A 4DXAB 2KVRA 1VCBA 3FAHA 4XDDA 3BWUD 2JSVX 2L0TA 3PSEB 2K22A 2JY6A 4ZDVA 3QAQA 1SE9A 2JPHA 5TR5A 4A55A 1C4PA 5MPOA 4IUMB 5BMHA 3QX1A 5IAAC 2G4SA 1JWBD 1ZUD2 2MW5A 2KMMA 1WX7A 1E10A 3CF6E 5AUKA 4F8CB 3L08A 2N9XA 3E9SA 2JXTA 2KFKB 4YL8A 3PZ7A 2K6QA 4C7YA 1UF0A 1ZPSA 2O2VA 3A9KB 5FKAC 3Q8CA 3X23A 1J8CA 2WP9B 1B9RA 3ZNID 1LFDA 1NI2A 2ZCBA 3ZJTA 3RULA 1I4QA 1FNVA 2WNMA 1ZXIA 2IGDA 1WMHA 3RYTA 1WWTA 4WH4A 2QIEB 2LMCA 2EKIA 3PO0A 1H4RA 4EOYA 4ICVA 3ML9A 4WAAA 2BYTA 1WR1A 4IM3A 3ZGZA 4ZYSA 4B95A 1AW7A 3V6EB 2Z8LA 3A1QA 5C1ZA 4A20A 3I63C 4NNJB 4MT5A 1U4AA 5JZEB 4YTPB 2NTSA 4IM2A 3L10B 4DXGA 3P63A 2RGFA 3R66C 1LO5D 3FKYA 3AV8A 2BVCA 2JZZA 1EF1A 1UNSA 3BIID 1CJEA 1MJDA 2INNE 4RGTA 1WJNA 4GIVA 3U4EG 4P7IA 5H8YE 1TY0A 1D5ZC 3BZDB 2L05A 4HCPB 2PKOA 3C19A 2KHWB 4FHJA 5AZHA 4USAA 4FBJB 4M0WB 3ETRA 4NAWA 3HVZA 2AYOB 1WFYA 3QCAA 1N6ZA 2GI9A 1SF0A 2VRRB 2PTLA 2IO3B 1ROEA 5D94A 3GE3C 4OVUA 1YQ3B 1TKEA 2D3GA 4HEA1 3EFUA 3A9JA 4DWFA 2BBCA 2M1MA 1QOAA 4KSKC 2DZKA 1RRBA 1WYGA 3TEWA 3JSVA 3ZNZB 4FJYA 3MC0B 4DDID 3R8BA 1LXDA 3VRAB 2KAJA 2WDRB 4OZBA 3VH3B 1TTNA 1WGDA 3GB1A 4MGKE 3DWMA 1L0VB 3VRBB 2WDQB 1FNUA 1ET9A 2DHZA 1GAQB 4YXDB 1UGMA 1Y56A 4ZRKA 4EEWA 4US9A 1C3TA 2GLSA 1E5WA 3AEGB 2ZNVC 1MPEA 1L0YB 2FCNA 1VLBA 1R4NI 4KGRA 4K7WA 4DHJB 2M19A 3VAWA 3KVFB 1P0RA 2KANA 1RFAA 3RZFA 1ZOYB 3IBEA 3IAM1 2L3ZA 1QOFA 3MC8A 3GP7A 2FNJB 1JMLA 5JHBA 2H89B 3P42A 2O2VB 3A9KA 4DBGA 4EUTA 3B0AA 3KWVA 2KN4A 2PE9A 4HK2A 2C60A 3U52E 3ZKJC 3OJ3A 1V49A 1D5XC 1VZ6A 3DBRB 2K0PA 4A9AA 3DHIC 2M4NA 3BK2A 1Y8RC 3PZ8A 4FULA 2Y5PA 1V86A 2KD0A 4LLGM 4GB9A 5BO4B 1C78A 3DDCB 4M8MA 2BKRB 2XN9C 2KFKA 3BVMA 1RM6C 1WI0A 1WJ4A 1VRAB 3TJPA 2FAZA 3Q14C 1JWSD 3NOBA 2UU7A 2N1WA 2LJIA 3PRZA 5LXHA 1EU3A 2ZJDA 1G6JA 4W9JA 3OG5A 4C4VA 3RNCC 2BYVE 4FXCA 5E6OA 1SIFA 2RDBC 4HPLB 1F2RI 2KXJA 1S3SG 2UWQA 2WXGA 1R4MB 4ZYNA 1IYFA 1F0ZA 4KX6B 4DQOC 1GPXA 1LGRA 1V1PA 2OJWA 2NS5A 2BS4B 2BT6A 4I6PA 1WMHB 1EF5A 1WGRA 1NBFC 1V1PB 3VTUA 3N20C 4IWPA 1L6VA 4AJYB 1K51A 1E8YA 1E0ZA 1QF6A 2VZKB 4KZCA 1JWMD 4FLHA 4MH0E 4KVGB 4XE0A 2PMVA 2L8JA 5AEKB 4C7ZA 1TT5B 4DXFA 4RFBA 4N9F4 4LTUA 2JXXA 1YJIA 4ICUA 2G1EA 4NQKE 3EFCA 1R4NB 2RDHA 2SAKA 3AE3B 2O6VD 2KLGA 4K1RB 3QIJA 3W5VB 3WAPA 4ANWA 1T0QC 1EM7A 3ECIA 1K8RB 2KWCA 4IC7B 2B3AA 1XLQA 2MSED 1WSPA 2OOBB 4YTNB 1BUIC 2L7RA 2K25A 3LYYA 5IO9A 4LNIA
chains in the Genus database with same CATH topology
4K7UA 3VUWA 4BKTA 1P98A 4GDLA 3SD5A 4OVVA 2LUEA 2R2OA 1J19A 4G3XB 2KDBA 3R7RA 2PPHA 2QHOA 1V5TA 2AL6A 2WWZA 3VUXA 4K7SA 3U8ZA 2KOXA 2ZVNA 2N4FA 3PLVA 3DBLI 2WYQA 2KJ6A 3PTFC 3PHWB 2LVOA 3W1SC 2HE7A 4PYUA 4FADA 2KDIA 3PPAA 4ASWC 3UINB 2LGDA 4JIOU 3S2AA 2GBNA 5D2MB 3V6CB 2N7DA 4EZJA 3PRPB 5LXIB 3PGEA 3M95A 5AZGA 1UBIA 3PV1A 4AUQC 4GXBA 2DZIA 3PRMB 2EKEC 4PS3A 2JZ3B 3MJWA 1P1AA 2Z0EB 4A3OA 2MBHA 3QQ8B 4ZRJA 5J18A 2MA9B 1OEYA 4NJ7A 1WJ6A 4GSWA 1PQSA 3H9DA 3LJ3A 1YX5B 4HDOA 3OJ4B 1EUVB 5CHVC 4ANVA 4EZLA 3ZLZA 1GJZA 2KDEB 4LDTB 1WXVA 4BKSA 2PEAA 4KDIC 3TBLD 2DAJA 4DHZB 3B1LX 4IW0A 4B6WA 3ZIMA 2K6DB 2LI5A 2NCNA 4CO7A 2KX3A 4F1SA 1YIWA 4EZKA 4NJ6A 1C1YB 4MGZE 1E7UA 1HE8A 2XK5A 3V60A 4EKUA 2JRHA 4G11A 2KK8A 4CHKA 3HM6X 3ML8A 4NAWB 5DCNA 3RT3B 4BFRA 2MBEA 2Z0DB 4DK5A 2BWFA 1WR6E 2N9EB 1GC7A 3JVZX 1BT0A 3EC8A 4GMVA 4W9GA 4DXAB 3KUZA 2KVRA 3JSVB 3ZTCA 1GC6A 1VCBA 3P2BA 1MG8A 1WZ3A 3ZO5B 2L0TA 3PSEB 2JY6A 2LASA 4ZDVA 3QAQA 3M63B 1SE9A 2JPHA 2WX1A 5TR5A 3H1UA 2LXCA 1KJTA 2BWES 2FIFA 3HIZA 5E6PA 4IUMB 3KW5B 3ZUNA 4TV3A 2C7HA 3AU4A 3N30A 5IA7A 1IPGA 3QX1A 2KC1A 5IAAC 2G4SA 1GG3A 2MW5A 1WH3A 1WX7A 4MEMA 3NS8A 3CF6E 4MJSB 2CR5A 3MHSD 4F8CB 1WXSA 2IZVB 3L08A 2N9XA 2NVUI 3DBHI 4JGHB 2CKHB 2BGFA 2HJ8A 2KTRB 4LCDE 4IM0A 3ZDMC 4KDLB 2KFJA 5EDSA 3VDZA 1ZW7A 3WA0A 1V80A 2KFKB 3L16A 4YL8A 1RAXA 2K6QA 3A1QB 4W9EA 5D7GA 1I42A 2O2VA 3A9KB 3ONSA 2BF8B 3RZWC 2OJRA 3PVLA 4WJOA 4LJOB 1ZGUB 1UZXB 2D2QA 3X23A 1J8CA 1OQYA 3DCGA 2DZJA 1V81A 3ZNID 1LFDA 1NI2A 2ZCBA 3CMMB 4WWOA 3TCAA 3RULA 4WQOB 3KH0A 3H7PA 1OTRB 1WMHA 2W9NA 1TBEA 2C7NB 3RYTA 4BOSC 3QA8A 3WALA 2MBQA 2LVPA 1H4RA 2XBBC 4EOYA 2NPTB 2I1KA 4AP4C 4ICVA 3VFKA 1L2NA 4XC2A 3APCA 1ZKHA 3ML9A 4WAAA 4B9KA 1SGHA 3QC8B 1WR1A 4IM3A 2LGYA 3T9LA 1YQBA 4B95A 1OGWA 2GMIC 2CU1A 3IHPC 3V6EB 5L95C 4ZRIA 5HKHA 3IG3A 1ISNA 4RM9A 4I6LB 1RLFA 2MP2B 3EECA 3A1QA 5C1ZA 3OLMD 4A20A 2JVCA 4NNJB 3LDZE 2DYOA 3RCZA 2IYDB 3DVGY 3HM3A 2CHZA 1U4AA 4IG7B 5JZEB 5KHQA 3HK0A 3IVFA 2MCNB 2KJRA 4HPMB 4GDLB 2JT4B 4IM2A 3K9PB 3L10B 1X1MA 4GGQA 2HD5B 2CHXA 2RGFA 3R66C 3H7SA 2RD0A 5LLIA 2C5LC 3AI5A 2FCSA 2JZZA 3JYUA 2MRPA 4HWIB 4GU2A 1EF1A 2YLMA 4JQWC 5CX3A 5L83A 1GUAB 2XK5B 1UH6A 4FN2A 2KKCA 1A5RA 2JWZA 4DHZE 1E7VA 2MWSB 1V9JA 1WJNA 4GIVA 3PREA 4P7IA 4PYZA 2D07B 1UELA 2Y5BB 4HCPB 2L05A 2IO0B 4BVUC 1LM8B 4FHJA 2KHWB 1YJ1A 2ZNVB 3DOWA 3DVNV 5AZHA 4FBJB 1Z5SB 1E90A 3QARA 2CHWA 3NZSA 1WJUA 2DX5B 3VQIA 1XD3B 4M0WB 1WX9A 5JH5C 4NAWA 2GBRA 1WZ0A 1Q5WB 2AYOB 2ZEQA 1H8CA 3UIOB 1WE7A 3GZNI 1WFYA 3QCAA 1E8WA 3U7DA 4G50A 1E8ZA 4LDTD 3W1YA 2N7EA 2V3SA 2MX2A 2VRRB 2LRWA 4W9CA 3DVGX 2IO3B 5C23A 2XEWA 2WX0A 5D94A 3ZRCA 4MJSA 2KWVB 4OVUA 3QWZB 2KMAA 3ZNGC 4E74A 2J7QB 2D3GA 3EFUA 3H7PB 3DVNU 3A9JA 3GOEA 4DWFA 2KJHB 4F7ZA 2KTFA 4EFOA 2D11A 2M1MA 1KM7A 3V61A 3ENEA 4JLCA 4MM3A 3ZDTA 4HLEA 4KZ0A 3R7QA 4KSKC 4K81A 2LXAA 2DZKA 2NPTA 4KV2A 1RRBA 4FJZA 4NQLB 1NDDA 4WJNA 3JSVA 3A4RA 3UQAA 3ZNZB 4FJYA 2BYFA 4AJWA 4FA6A 3C0RB 2G4DB 1EO6A 4DDID 1WF9A 2L76A 2C7MB 4E71A 1LXDA 2L00B 3VVWB 2K8CA 3VH4B 1TZ1A 2LZ6A 3VH3B 4M8NA 3UF8A 1TTNA 1WGDA 1V6EA 2MBBB 4MGKE 2RSUA 1YX6B 3M62B 3PHXB 4GDKA 3H6NA 1AARA 2JRIB 4ANXA 2DHZA 1WGHA 3N3KB 2MP2A 4URKA 2ZPYA 1WYWB 2NBWB 1UGMA 1S1QB 1D3ZA 4ZRKA 3WAOA 4EEWA 2G3QB 2KQSA 1C3TA 4RMAA 3SHQA 1QZEA 5G55A 1E5WA 2O6VB 5G2NA 2ZNVC 4KSLC 2FCNA 4MDKE 1XT9B 4GOCA 1R4NI 4K7WA 4MGIE 4DHJB 3VAWA 4HJKA 1VD2A 3BINA 2K39A 3WANA 3KVFB 2MLBA 3W1SA 1P0RA 2KANA 4NY0A 4BBNF 4AWJA 2N9PC 1RFAA 3TL5A 3RZFA 1IP9A 4HXDA 3IBEA 4JL9A 3AULA 3VTVA 4FJVB 2J0KA 3KUDB 3QJZA 5CHFA 2L3ZA 2G45B 2FNJB 2RPQA 2LVQA 2WDTB 4RM8A 3MTNB 5JHBA 3EHVA 2L0FA 2DAFA 2KWUB 2R2QA 2ZVOA 2GBMA 4GDKB 1R4MI 3PT2B 5CHWA 2O2VB 3A9KA 4XZ4A 4ANUA 3APDA 4W9LA 4DBGA 5CTRC 4W9HA 1OEYJ 3B0AA 2JF5A 5KHOA 4EUTA 3DPDA 2C9WB 4BKGA 2PE6B 2PE9A 4HK2A 2DYBA 1TGZB 1Z2MA 2C60A 3TMPB 3ZKJC 4TQ0A 3ZVVA 3L0WB 2D10A 3OJ3A 1V2YA 1V49A 2MQJA 2ZPNA 3PS6A 2BKFA 3DBRI 4W9KA 2J0MA 3UIPB 3NZUA 3VTWA 1WIAA 3SDLC 4J6IA 2M0XA 2KC2A 2ZCCA 2KZRA 1XQQA 4GN1A 1WX8A 3NY5A 3BY4B 4NPNA 2CS4A 2M4NA 3Q3FA 1Y8RC 4FULA 4II3B 1V86A 3A9JB 2KD0A 1LQBA 3KYCD 4TKNA 2KDFB 2V4LA 4FHKA 1JRUA 3N32A 4GB9A 2K1FA 4TQ1A 5BO4B 2EMTA 3DDCB 4M8MA 2KLCA 2Z59B 2BKRB 2KFKA 4PS8A 2FIDA 3ZRFA 1T0YA 4HCNB 1KOTA 2K8HA 3X0WA 5DPWA 2MBOA 1WI0A 1WM2A 5JHAA 1WJ4A 2NBUA 2O6VA 3Q3JA 3KUCB 5DPRA 3TJPA 2FAZA 3NOBA 4MELA 2N1WA 3PRZA 4BKSD 4A3PA 4E3CA 3A33B 3CSFA 3L54A 5LXHA 2ZJDA 3PZDA 1M94A 1G6JA 3L13A 1WXMA 4WJPA 1F9JA 4W9JA 3ZW3A 2KX0A 3V62A 2BYVE 2KQ7A 5E6OA 3T8MA 1SIFA 5AZFA 2GBKA 4HPLB 2AL3A 1J0GA 2J0JA 5J17A 4WWNA 2FCQA 1YD8U 2KXJA 1S3SG 2A5UA 2IO2B 2M17A 2UWQA 4MSMB 1I35A 2GOWA 2IBIB 2PJHA 4HDQA 4ZYNA 3RD2A 1L7YA 1IYFA 2ASQA 2RR9A 5GMVA 4CYEA 4KIKA 4PS7A 3UQBA 2K8BA 1WE6A 3UGBB 3QK0A 3M3JA 2BYEA 2HTHA 2M8SA 3U30A 2LRUA 2NS5A 3SU8X 4I6PA 1WMHB 4LJPB 1EF5A 1WGRA 1NBFC 3AU5A 3OAWA 2IY1B 3VHTC 3VTUA 4AOFA 3APFA 1WRDB 2DYMA 1Q0WB 4IWPA 1Q1OA 3RUIB 1WM3A 3ZTDA 4TUUA 4AJYB 2JUOA 2A4ZA 1E8YA 2ZZPB 2AWTA 1WXAA 2EMSA 4KZCA 2KO3A 2REXA 4FLHA 1V5OA 4G0NB 2IO1B 3QHTA 4MH0E 3ALBA 1WGYA 4KVGB 3A4SC 3VUYA 1P3QU 2L8JA 3VXWA 2LJ5A 3PLUA 5AEKB 1KLVA 3K9OB 4BOZB 3B08A 4HVBA 3I3TB 2BPSA 3CSTA 1CMXB 4W9FA 3D32A 4N9F4 2AEHA 3O65B 5FR6A 3WAMA 3L17A 2KN5A 4W9DA 2JXXA 3HHMA 2NR2A 4IWOA 4MSQB 3KYDD 4ICUA 1WY8A 3IFWB 3AXCA 3ZNHB 4NQKE 4DDGD 5J2RA 4I6NB 2UYZB 1P9DU 2I1JA 4X57B 2O6VD 3R3MA 2KLGA 3WIMA 4K1RB 4MGYE 5DPSA 2FUHB 1E8XA 4DHJD 3QIJA 4XX5A 3WAPA 2DZMA 1GNUA 4ANWA 2DENB 2GBJA 3ECIA 2LD9A 1K8RB 2KWCA 4IWQA 4IC7B 3NHEB 4W9IA 4WWPA 1FXTB 2B3AA 2N1VA 1UD7A 5DPTA 2YVCA 2NBVB 2KTRA 3DQVA 5D6JB 2MSED 3TIXA 4KIKB 2OOBB 2KMCA 2V1YA 4WJQA 4II2B 3JW0X 1WGGA 2L7RA 2LWPA 3DBSA 4BBNC 2IY0B 2FCMA 2K25A 1UBQA 5E6NA 2LGXA 2KNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7U A;  3VUW A;  4BKT A;  1P98 A;  4GDL A;  3SD5 A;  4OVV A;  2LUE A;  2R2O A;  1J19 A;  4G3X B;  2KDB A;  3R7R A;  2PPH A;  2QHO A;  1V5T A;  2AL6 A;  2WWZ A;  3VUX A;  4K7S A;  3U8Z A;  2KOX A;  2ZVN A;  2N4F A;  3PLV A;  3DBL I;  2WYQ A;  2KJ6 A;  3PTF C;  3PHW B;  2LVO A;  3W1S C;  2HE7 A;  4PYU A;  4FAD A;  2KDI A;  3PPA A;  4ASW C;  3UIN B;  2LGD A;  4JIO U;  3S2A A;  2GBN A;  5D2M B;  3V6C B;  2N7D A;  4EZJ A;  3PRP B;  5LXI B;  3PGE A;  3M95 A;  5AZG A;  1UBI A;  3PV1 A;  4AUQ C;  4GXB A;  2DZI A;  3PRM B;  2EKE C;  4PS3 A;  2JZ3 B;  3MJW A;  1P1A A;  2Z0E B;  4A3O A;  2MBH A;  3QQ8 B;  4ZRJ A;  5J18 A;  2MA9 B;  1OEY A;  4NJ7 A;  1WJ6 A;  4GSW A;  1PQS A;  3H9D A;  3LJ3 A;  1YX5 B;  4HDO A;  3OJ4 B;  1EUV B;  5CHV C;  4ANV A;  4EZL A;  3ZLZ A;  1GJZ A;  2KDE B;  4LDT B;  1WXV A;  4BKS A;  2PEA A;  4KDI C;  3TBL D;  2DAJ A;  4DHZ B;  3B1L X;  4IW0 A;  4B6W A;  3ZIM A;  2K6D B;  2LI5 A;  2NCN A;  4CO7 A;  2KX3 A;  4F1S A;  1YIW A;  4EZK A;  4NJ6 A;  1C1Y B;  4MGZ E;  1E7U A;  1HE8 A;  2XK5 A;  3V60 A;  4EKU A;  2JRH A;  4G11 A;  2KK8 A;  4CHK A;  3HM6 X;  3ML8 A;  4NAW B;  5DCN A;  3RT3 B;  4BFR A;  2MBE A;  2Z0D B;  4DK5 A;  2BWF A;  1WR6 E;  2N9E B;  1GC7 A;  3JVZ X;  1BT0 A;  3EC8 A;  4GMV A;  4W9G A;  4DXA B;  3KUZ A;  2KVR A;  3JSV B;  3ZTC A;  1GC6 A;  1VCB A;  3P2B A;  1MG8 A;  1WZ3 A;  3ZO5 B;  2L0T A;  3PSE B;  2JY6 A;  2LAS A;  4ZDV A;  3QAQ A;  3M63 B;  1SE9 A;  2JPH A;  2WX1 A;  5TR5 A;  3H1U A;  2LXC A;  1KJT A;  2BWE S;  2FIF A;  3HIZ A;  5E6P A;  4IUM B;  3KW5 B;  3ZUN A;  4TV3 A;  2C7H A;  3AU4 A;  3N30 A;  5IA7 A;  1IPG A;  3QX1 A;  2KC1 A;  5IAA C;  2G4S A;  1GG3 A;  2MW5 A;  1WH3 A;  1WX7 A;  4MEM A;  3NS8 A;  3CF6 E;  4MJS B;  2CR5 A;  3MHS D;  4F8C B;  1WXS A;  2IZV B;  3L08 A;  2N9X A;  2NVU I;  3DBH I;  4JGH B;  2CKH B;  2BGF A;  2HJ8 A;  2KTR B;  4LCD E;  4IM0 A;  3ZDM C;  4KDL B;  2KFJ A;  5EDS A;  3VDZ A;  1ZW7 A;  3WA0 A;  1V80 A;  2KFK B;  3L16 A;  4YL8 A;  1RAX A;  2K6Q A;  3A1Q B;  4W9E A;  5D7G A;  1I42 A;  2O2V A;  3A9K B;  3ONS A;  2BF8 B;  3RZW C;  2OJR A;  3PVL A;  4WJO A;  4LJO B;  1ZGU B;  1UZX B;  2D2Q A;  3X23 A;  1J8C A;  1OQY A;  3DCG A;  2DZJ A;  1V81 A;  3ZNI D;  1LFD A;  1NI2 A;  2ZCB A;  3CMM B;  4WWO A;  3TCA A;  3RUL A;  4WQO B;  3KH0 A;  3H7P A;  1OTR B;  1WMH A;  2W9N A;  1TBE A;  2C7N B;  3RYT A;  4BOS C;  3QA8 A;  3WAL A;  2MBQ A;  2LVP A;  1H4R A;  2XBB C;  4EOY A;  2NPT B;  2I1K A;  4AP4 C;  4ICV A;  3VFK A;  1L2N A;  4XC2 A;  3APC A;  1ZKH A;  3ML9 A;  4WAA A;  4B9K A;  1SGH A;  3QC8 B;  1WR1 A;  4IM3 A;  2LGY A;  3T9L A;  1YQB A;  4B95 A;  1OGW A;  2GMI C;  2CU1 A;  3IHP C;  3V6E B;  5L95 C;  4ZRI A;  5HKH A;  3IG3 A;  1ISN A;  4RM9 A;  4I6L B;  1RLF A;  2MP2 B;  3EEC A;  3A1Q A;  5C1Z A;  3OLM D;  4A20 A;  2JVC A;  4NNJ B;  3LDZ E;  2DYO A;  3RCZ A;  2IYD B;  3DVG Y;  3HM3 A;  2CHZ A;  1U4A A;  4IG7 B;  5JZE B;  5KHQ A;  3HK0 A;  3IVF A;  2MCN B;  2KJR A;  4HPM B;  4GDL B;  2JT4 B;  4IM2 A;  3K9P B;  3L10 B;  1X1M A;  4GGQ A;  2HD5 B;  2CHX A;  2RGF A;  3R66 C;  3H7S A;  2RD0 A;  5LLI A;  2C5L C;  3AI5 A;  2FCS A;  2JZZ A;  3JYU A;  2MRP A;  4HWI B;  4GU2 A;  1EF1 A;  2YLM A;  4JQW C;  5CX3 A;  5L83 A;  1GUA B;  2XK5 B;  1UH6 A;  4FN2 A;  2KKC A;  1A5R A;  2JWZ A;  4DHZ E;  1E7V A;  2MWS B;  1V9J A;  1WJN A;  4GIV A;  3PRE A;  4P7I A;  4PYZ A;  2D07 B;  1UEL A;  2Y5B B;  4HCP B;  2L05 A;  2IO0 B;  4BVU C;  1LM8 B;  4FHJ A;  2KHW B;  1YJ1 A;  2ZNV B;  3DOW A;  3DVN V;  5AZH A;  4FBJ B;  1Z5S B;  1E90 A;  3QAR A;  2CHW A;  3NZS A;  1WJU A;  2DX5 B;  3VQI A;  1XD3 B;  4M0W B;  1WX9 A;  5JH5 C;  4NAW A;  2GBR A;  1WZ0 A;  1Q5W B;  2AYO B;  2ZEQ A;  1H8C A;  3UIO B;  1WE7 A;  3GZN I;  1WFY A;  3QCA A;  1E8W A;  3U7D A;  4G50 A;  1E8Z A;  4LDT D;  3W1Y A;  2N7E A;  2V3S A;  2MX2 A;  2VRR B;  2LRW A;  4W9C A;  3DVG X;  2IO3 B;  5C23 A;  2XEW A;  2WX0 A;  5D94 A;  3ZRC A;  4MJS A;  2KWV B;  4OVU A;  3QWZ B;  2KMA A;  3ZNG C;  4E74 A;  2J7Q B;  2D3G A;  3EFU A;  3H7P B;  3DVN U;  3A9J A;  3GOE A;  4DWF A;  2KJH B;  4F7Z A;  2KTF A;  4EFO A;  2D11 A;  2M1M A;  1KM7 A;  3V61 A;  3ENE A;  4JLC A;  4MM3 A;  3ZDT A;  4HLE A;  4KZ0 A;  3R7Q A;  4KSK C;  4K81 A;  2LXA A;  2DZK A;  2NPT A;  4KV2 A;  1RRB A;  4FJZ A;  4NQL B;  1NDD A;  4WJN A;  3JSV A;  3A4R A;  3UQA A;  3ZNZ B;  4FJY A;  2BYF A;  4AJW A;  4FA6 A;  3C0R B;  2G4D B;  1EO6 A;  4DDI D;  1WF9 A;  2L76 A;  2C7M B;  4E71 A;  1LXD A;  2L00 B;  3VVW B;  2K8C A;  3VH4 B;  1TZ1 A;  2LZ6 A;  3VH3 B;  4M8N A;  3UF8 A;  1TTN A;  1WGD A;  1V6E A;  2MBB B;  4MGK E;  2RSU A;  1YX6 B;  3M62 B;  3PHX B;  4GDK A;  3H6N A;  1AAR A;  2JRI B;  4ANX A;  2DHZ A;  1WGH A;  3N3K B;  2MP2 A;  4URK A;  2ZPY A;  1WYW B;  2NBW B;  1UGM A;  1S1Q B;  1D3Z A;  4ZRK A;  3WAO A;  4EEW A;  2G3Q B;  2KQS A;  1C3T A;  4RMA A;  3SHQ A;  1QZE A;  5G55 A;  1E5W A;  2O6V B;  5G2N A;  2ZNV C;  4KSL C;  2FCN A;  4MDK E;  1XT9 B;  4GOC A;  1R4N I;  4K7W A;  4MGI E;  4DHJ B;  3VAW A;  4HJK A;  1VD2 A;  3BIN A;  2K39 A;  3WAN A;  3KVF B;  2MLB A;  3W1S A;  1P0R A;  2KAN A;  4NY0 A;  4BBN F;  4AWJ A;  2N9P C;  1RFA A;  3TL5 A;  3RZF A;  1IP9 A;  4HXD A;  3IBE A;  4JL9 A;  3AUL A;  3VTV A;  4FJV B;  2J0K A;  3KUD B;  3QJZ A;  5CHF A;  2L3Z A;  2G45 B;  2FNJ B;  2RPQ A;  2LVQ A;  2WDT B;  4RM8 A;  3MTN B;  5JHB A;  3EHV A;  2L0F A;  2DAF A;  2KWU B;  2R2Q A;  2ZVO A;  2GBM A;  4GDK B;  1R4M I;  3PT2 B;  5CHW A;  2O2V B;  3A9K A;  4XZ4 A;  4ANU A;  3APD A;  4W9L A;  4DBG A;  5CTR C;  4W9H A;  1OEY J;  3B0A A;  2JF5 A;  5KHO A;  4EUT A;  3DPD A;  2C9W B;  4BKG A;  2PE6 B;  2PE9 A;  4HK2 A;  2DYB A;  1TGZ B;  1Z2M A;  2C60 A;  3TMP B;  3ZKJ C;  4TQ0 A;  3ZVV A;  3L0W B;  2D10 A;  3OJ3 A;  1V2Y A;  1V49 A;  2MQJ A;  2ZPN A;  3PS6 A;  2BKF A;  3DBR I;  4W9K A;  2J0M A;  3UIP B;  3NZU A;  3VTW A;  1WIA A;  3SDL C;  4J6I A;  2M0X A;  2KC2 A;  2ZCC A;  2KZR A;  1XQQ A;  4GN1 A;  1WX8 A;  3NY5 A;  3BY4 B;  4NPN A;  2CS4 A;  2M4N A;  3Q3F A;  1Y8R C;  4FUL A;  4II3 B;  1V86 A;  3A9J B;  2KD0 A;  1LQB A;  3KYC D;  4TKN A;  2KDF B;  2V4L A;  4FHK A;  1JRU A;  3N32 A;  4GB9 A;  2K1F A;  4TQ1 A;  5BO4 B;  2EMT A;  3DDC B;  4M8M A;  2KLC A;  2Z59 B;  2BKR B;  2KFK A;  4PS8 A;  2FID A;  3ZRF A;  1T0Y A;  4HCN B;  1KOT A;  2K8H A;  3X0W A;  5DPW A;  2MBO A;  1WI0 A;  1WM2 A;  5JHA A;  1WJ4 A;  2NBU A;  2O6V A;  3Q3J A;  3KUC B;  5DPR A;  3TJP A;  2FAZ A;  3NOB A;  4MEL A;  2N1W A;  3PRZ A;  4BKS D;  4A3P A;  4E3C A;  3A33 B;  3CSF A;  3L54 A;  5LXH A;  2ZJD A;  3PZD A;  1M94 A;  1G6J A;  3L13 A;  1WXM A;  4WJP A;  1F9J A;  4W9J A;  3ZW3 A;  2KX0 A;  3V62 A;  2BYV E;  2KQ7 A;  5E6O A;  3T8M A;  1SIF A;  5AZF A;  2GBK A;  4HPL B;  2AL3 A;  1J0G A;  2J0J A;  5J17 A;  4WWN A;  2FCQ A;  1YD8 U;  2KXJ A;  1S3S G;  2A5U A;  2IO2 B;  2M17 A;  2UWQ A;  4MSM B;  1I35 A;  2GOW A;  2IBI B;  2PJH A;  4HDQ A;  4ZYN A;  3RD2 A;  1L7Y A;  1IYF A;  2ASQ A;  2RR9 A;  5GMV A;  4CYE A;  4KIK A;  4PS7 A;  3UQB A;  2K8B A;  1WE6 A;  3UGB B;  3QK0 A;  3M3J A;  2BYE A;  2HTH A;  2M8S A;  3U30 A;  2LRU A;  2NS5 A;  3SU8 X;  4I6P A;  1WMH B;  4LJP B;  1EF5 A;  1WGR A;  1NBF C;  3AU5 A;  3OAW A;  2IY1 B;  3VHT C;  3VTU A;  4AOF A;  3APF A;  1WRD B;  2DYM A;  1Q0W B;  4IWP A;  1Q1O A;  3RUI B;  1WM3 A;  3ZTD A;  4TUU A;  4AJY B;  2JUO A;  2A4Z A;  1E8Y A;  2ZZP B;  2AWT A;  1WXA A;  2EMS A;  4KZC A;  2KO3 A;  2REX A;  4FLH A;  1V5O A;  4G0N B;  2IO1 B;  3QHT A;  4MH0 E;  3ALB A;  1WGY A;  4KVG B;  3A4S C;  3VUY A;  1P3Q U;  2L8J A;  3VXW A;  2LJ5 A;  3PLU A;  5AEK B;  1KLV A;  3K9O B;  4BOZ B;  3B08 A;  4HVB A;  3I3T B;  2BPS A;  3CST A;  1CMX B;  4W9F A;  3D32 A;  4N9F 4;  2AEH A;  3O65 B;  5FR6 A;  3WAM A;  3L17 A;  2KN5 A;  4W9D A;  2JXX A;  3HHM A;  2NR2 A;  4IWO A;  4MSQ B;  3KYD D;  4ICU A;  1WY8 A;  3IFW B;  3AXC A;  3ZNH B;  4NQK E;  4DDG D;  5J2R A;  4I6N B;  2UYZ B;  1P9D U;  2I1J A;  4X57 B;  2O6V D;  3R3M A;  2KLG A;  3WIM A;  4K1R B;  4MGY E;  5DPS A;  2FUH B;  1E8X A;  4DHJ D;  3QIJ A;  4XX5 A;  3WAP A;  2DZM A;  1GNU A;  4ANW A;  2DEN B;  2GBJ A;  3ECI A;  2LD9 A;  1K8R B;  2KWC A;  4IWQ A;  4IC7 B;  3NHE B;  4W9I A;  4WWP A;  1FXT B;  2B3A A;  2N1V A;  1UD7 A;  5DPT A;  2YVC A;  2NBV B;  2KTR A;  3DQV A;  5D6J B;  2MSE D;  3TIX A;  4KIK B;  2OOB B;  2KMC A;  2V1Y A;  4WJQ A;  4II2 B;  3JW0 X;  1WGG A;  2L7R A;  2LWP A;  3DBS A;  4BBN C;  2IY0 B;  2FCM A;  2K25 A;  1UBQ A;  5E6N A;  2LGX A;  2KNB A; 
#chains in the Genus database with same CATH topology
 3VUW A;  4GDL A;  3IT4 B;  2OHF A;  2R2O A;  4G3X B;  3R7R A;  4HKZ E;  3PTF C;  2LVO A;  2X38 A;  3PPA A;  1C4C A;  3UIN B;  3PRP B;  3M95 A;  4AUQ C;  4GXB A;  1VZ7 A;  4TMA B;  2JYT A;  3PRM B;  4KKI A;  4PS3 A;  2I38 A;  2Z0E B;  4P6V F;  5J18 A;  1WJ6 A;  3H9D A;  5CHV C;  1EUV B;  2XNA C;  3N9Y C;  2AQ1 B;  3ZLZ A;  4LDT B;  4RH6 A;  4RCO A;  1K52 A;  1JWU D;  2RDG A;  1T5X D;  3B1L X;  4F1S A;  3ZIM A;  2K6D B;  2IPK D;  2LI5 A;  4CO7 A;  1C1Y B;  2MH7 A;  1SXT A;  2V3N A;  1HZ6 A;  4CHK A;  5DCN A;  4IOI E;  2Z0D B;  4DK5 A;  4W9G A;  1XLP A;  2V3P A;  3AEA B;  1MG8 A;  1WZ3 A;  5E6J A;  2LAS A;  3M63 B;  3H1U A;  2FIF A;  1DOX A;  3KW5 B;  1BXT A;  4RGN A;  4RNA A;  1IPG A;  1GG3 A;  2WLB A;  4MEM A;  3RMK C;  2J52 A;  2IZV B;  3Q3M C;  2KTR B;  4KDL B;  2KFJ A;  3AE9 B;  3DBH B;  1SEB D;  2ZW1 A;  4W9E A;  4KGT A;  1E7P B;  1NYQ A;  2JZP A;  2BF8 B;  2N0S B;  1UZX B;  2D2Q A;  1EWY C;  2WXP A;  3DCG A;  1MFW A;  5EE0 A;  1HQR D;  1PYW D;  3KH0 A;  5BYS A;  3C8Y A;  3QA8 A;  3AMZ A;  1TKG A;  2K9X A;  2NPT B;  1L2N A;  4XC2 A;  2IGH A;  4ZRP A;  1SGH A;  3T9L A;  2QMT A;  3IHP C;  4ZRI A;  5HKH A;  2MJE A;  3IG3 A;  1FFU A;  1R7S A;  2H88 B;  2QIL A;  4I6L B;  3NJT A;  4HRS A;  3OLM D;  4JWS C;  2JVC A;  2NTT A;  2EEL A;  4LNN A;  3RCZ A;  2IYD B;  3DVG Y;  5KHQ A;  4LNO A;  1D4B A;  2KJR A;  4HPM B;  2JT4 B;  3NVW A;  4YTM B;  3H7S A;  1TZO A;  5LLI A;  2C5L C;  3AI5 A;  4GLS C;  2WHI A;  2MRP A;  1SJE D;  4HWI B;  4M0W A;  4JQW C;  1KFY B;  5CX3 A;  1I4X A;  4OHJ A;  3R2T A;  1A5R A;  2JWZ A;  4DHZ E;  2MWS B;  4MM3 B;  4BVU C;  1LM8 B;  2BB6 A;  1QQR A;  3LXF A;  1E90 A;  3SFD B;  3NZS A;  2GBR A;  1XLO A;  3U7D A;  3W1Y A;  1SB3 C;  2MX2 A;  2E6X A;  2XEW A;  1F52 A;  2CU3 A;  3ZNG C;  1L4Z B;  4K3C A;  4NZL B;  2WS3 B;  2QCZ A;  1GOZ A;  1FMA D;  3U2S C;  4HLE A;  3ZDT A;  4JLC A;  1XCT L;  4LK0 M;  3RNG C;  4K81 A;  3CWI A;  4FJZ A;  1NDD A;  4RF0 A;  5AUI A;  4WJN A;  3KWL A;  2SEB D;  3UQA A;  1ESF A;  3C0R B;  2G4D B;  1EO6 A;  2GRI A;  2YEP F;  2L76 A;  1SIJ A;  1K50 A;  1J7C A;  2LZ6 A;  4M8N A;  1YX6 B;  2DLB A;  3KLS X;  1NI3 A;  4GDK A;  1NEK B;  3OWE B;  5BYR A;  4ANX A;  3MJ5 A;  2ZPY A;  1WYW B;  4S17 A;  3WAO A;  2G3Q B;  3NG0 A;  2KQS A;  5FK9 C;  1IBX B;  3GZN B;  3SHQ A;  1QZE A;  3BYT B;  4KSL C;  3FC4 A;  4XWW A;  2RPV A;  1XT9 B;  4GOC A;  3Q2A C;  1UGJ A;  4HJK A;  2ZW0 A;  1VD2 A;  4NAM A;  3WAN A;  2MLB A;  5H92 C;  3TL5 A;  1FRR A;  4ARI A;  1VJK A;  4JL9 A;  3Q3N C;  3AUL A;  4M02 A;  3RFZ B;  3QJZ A;  4PT5 A;  2G45 B;  1FCC C;  2LVQ A;  1YQ4 B;  2WDT B;  1OFF A;  3EHV A;  2ZVO A;  4GDK B;  1AYF A;  3APD A;  4W9L A;  5C2T B;  4W9H A;  1TGZ B;  2DYB A;  4B0M A;  2WGS A;  2MQJ A;  2ZPN A;  2BKF A;  3DBR I;  3NZU A;  4AS1 A;  4A6Q A;  2M0X A;  2KC2 A;  1XQQ A;  4US8 A;  1WX8 A;  3URY A;  2CS4 A;  5IP4 D;  3MFG A;  2WDV B;  4II3 B;  3A9J B;  5HG2 A;  1ET6 A;  3NS1 A;  4ZOH C;  1JRU A;  1J7B A;  4TQ1 A;  4WAF A;  5FR3 A;  2KWD A;  1KRH A;  2INC C;  2FID A;  4UDU C;  3ZXR A;  1T0Y A;  4HCN B;  1WXQ A;  3RN9 C;  1ZXH A;  5JHA A;  2KDM A;  4QAY A;  4NJC A;  3V3X A;  1MHH E;  4R3D A;  1M94 A;  3L13 A;  3RNA C;  1JCK B;  2DWQ A;  2KX0 A;  2KQ7 A;  5AZF A;  4AQ7 A;  1J0G A;  2J0J A;  2FCQ A;  2IJ0 A;  2MJ3 A;  2IO2 B;  3AE2 B;  3E56 A;  2IBI B;  2PJH A;  2WU5 B;  1L7Y A;  4YSZ B;  3B9J A;  5GMV A;  4KIK A;  4PS7 A;  2BTE A;  2K8B A;  1WE6 A;  3M3J A;  2BYE A;  2LRU A;  3SU8 X;  3VHT C;  3AU5 A;  3OAW A;  2IY1 B;  3APF A;  1WRD B;  1Q1O A;  1WM3 A;  2LGS A;  3ZTD A;  1SBB B;  2WQY B;  2AWT A;  2DNF A;  2REX A;  1VZ8 A;  1V5O A;  2IO1 B;  4IKG A;  3A4S C;  3VUY A;  4RGO S;  3VXW A;  1J7A A;  3N1Z C;  1QT9 A;  1KLV A;  1HZ5 A;  1I4H A;  1XCQ L;  1SE3 A;  2TSS A;  3O65 B;  5FR6 A;  3L17 A;  4W9D A;  1JW9 D;  2NR2 A;  4IWO A;  3T3N A;  3AXC A;  4O1N A;  1I4R A;  3B2G A;  1P9D U;  2YEP B;  3R3M A;  1L4D B;  2FUH B;  1E8X A;  1STE A;  4DHJ D;  4OW0 A;  5G5G A;  5IN7 A;  3IXS A;  2LUM A;  4RF1 A;  2N1V A;  4KKJ A;  2YVC A;  2KTR A;  2CJO A;  2PVO D;  1ACC A;  2KMC A;  2LWP A;  2IY0 B;  3KUZ A;  4K7U A;  4BKT A;  2J53 A;  1UWX A;  3SD5 A;  2LUE A;  4D2K A;  1J19 A;  3AB5 A;  2V0G A;  1V5T A;  4JPS A;  4K7S A;  1I7H A;  2N4F A;  3AEC B;  2KJ6 A;  1KF6 B;  2WXK A;  4PYU A;  2D3B A;  3DBL B;  3V6C B;  3RI7 C;  3PGE A;  1HA5 A;  1UBI A;  3EGR A;  1EWC A;  1F2R C;  1HEZ E;  3NUH B;  1JQ4 A;  2WXF A;  2DZI A;  1P1A A;  4A3O A;  2MA9 B;  1OEY A;  3AE5 B;  4NJ7 A;  4HDO A;  3AH7 A;  3OJ4 B;  2L52 A;  1QIL A;  1WXV A;  4KDI C;  3TBL D;  1CK1 A;  4DHZ B;  3I9V 1;  2N9K A;  1TJE A;  4NJ6 A;  1N62 A;  3V60 A;  1HE8 A;  4EKU A;  2IGG A;  3RT3 B;  2INP E;  3RNB C;  4C56 C;  2BWF A;  1WR6 E;  3EC8 A;  5EE1 A;  1GC6 A;  3AEF B;  3BVZ A;  3ABV B;  3SFE B;  4KGS A;  1KJT A;  1WGK A;  2C7H A;  3AU4 A;  1WH3 A;  1T0S C;  3NS8 A;  4MJS B;  2CR5 A;  3TEX A;  2NVU I;  3DBH I;  4JGH B;  2CKH B;  2HJ8 A;  2Y3A A;  4LCD E;  2IND C;  2CJN A;  1JRP A;  3WA0 A;  1V80 A;  1V97 A;  3L16 A;  1TS4 A;  1V1O A;  1RAX A;  1HTO A;  2FBW B;  3A1Q B;  4ACF A;  5D7G A;  1I42 A;  4YWG G;  1YN5 A;  3ONS A;  3PVL A;  4WJO A;  4LJO B;  1B1Z A;  1OQY A;  3CMM B;  1YN3 A;  4WQO B;  1OTR B;  3RNF C;  2WXR A;  2VZK D;  2W3S A;  2LVP A;  2XBB C;  2X8X X;  3APC A;  1ZKH A;  3DHH C;  4B9K A;  3AE6 B;  3AN1 A;  2LGY A;  1YQB A;  2GMI C;  1PGA A;  4RM9 A;  1RLF A;  3EEC A;  2WXL A;  1VR9 A;  3LDZ E;  1FPY A;  1SJH D;  3NZ3 A;  3IVF A;  2MCN B;  4GDL B;  1TS5 A;  3K9P B;  1PFD A;  3Q8B A;  3RNE C;  3TEY A;  1X1M A;  4GGQ A;  1BML C;  3FIL B;  4OZC A;  2FCS A;  1I4G A;  3JYU A;  3SR6 A;  1UH6 A;  2KKC A;  5HI1 A;  1E7V A;  4JX1 C;  1V9J A;  1UEL A;  2Y5B B;  2IO0 B;  3DOW A;  1YJ1 A;  2BQQ A;  3DVN V;  1Z5S B;  1GB1 A;  2CHW A;  1WJU A;  1XD3 B;  1WX9 A;  5JH5 C;  3TEZ A;  1WZ0 A;  1E8W A;  2FUG 1;  4LDT D;  2V3S A;  2LRW A;  5C23 A;  2WX0 A;  3N1Y C;  2KWV B;  1MVK A;  2KMA A;  2OED A;  3W5U B;  3GOE A;  2HTM E;  1XO3 A;  2KJH B;  4F7Z A;  2KTF A;  3DWG C;  3V61 A;  2KT7 A;  3ENE A;  4KZ0 A;  2LXA A;  4NQL B;  1CZP A;  3A4R A;  2M0A A;  2ON8 A;  4AJW A;  4FA6 A;  1T6B X;  2C7M B;  2W3R A;  2L1A A;  3VVW B;  1JRO A;  1T3Q A;  2K8C A;  1TZ1 A;  2V9H A;  3ZXV A;  2MBB B;  1ZDX A;  3M62 B;  1ZP0 B;  3O13 A;  4TSS A;  2MP2 A;  4URK A;  2JQR B;  3BVG A;  1FXA A;  3GE8 C;  3T3O A;  1S1Q B;  1D3Z A;  1FO4 A;  4RMA A;  5G55 A;  2JX5 A;  1HXY D;  4MDK E;  1NEN B;  4MGI E;  4NY0 A;  2N9P C;  1IP9 A;  4JE3 B;  4EE2 A;  3VTV A;  1D5M C;  5CHF A;  1IGC A;  3MTN B;  3BK1 A;  4RGM A;  1N63 A;  2LHE A;  2MEK A;  5JXV A;  2L0F A;  2KWU B;  2R2Q A;  4XZ4 A;  1R4M I;  3PT2 B;  5CHW A;  4ANU A;  1OEY J;  3DPD A;  2C9W B;  4BKG A;  2PE6 B;  3P4P B;  1C79 A;  3TMP B;  4TQ0 A;  1V2Y A;  1P7E A;  1PGB A;  3PS6 A;  3VTW A;  1WIA A;  4J6I A;  4XYC A;  3BY4 B;  1UWM A;  4S0R A;  2V4I B;  3KYC D;  5I4D A;  1FD6 A;  4WQM A;  2EMT A;  2KLC A;  2QSD A;  3NVY A;  3AED B;  3VR8 B;  1WM2 A;  2O6V A;  3Q3J A;  4MEL A;  1ZDV A;  4BKS D;  4E3C A;  4WIP A;  3HVD A;  3L54 A;  4N6E B;  3PZD A;  3V62 A;  2QDF A;  3T8M A;  2GBK A;  2NMQ A;  1YD8 U;  2M17 A;  4MSM B;  4A8X C;  2L83 A;  3I5J C;  2ASQ A;  4JWU C;  2RR9 A;  4CYE A;  3UGB B;  3QK0 A;  2M8S A;  5GXG B;  3U30 A;  4LJP B;  1RWS A;  2J42 A;  2DYM A;  1Q0W B;  3P4S B;  3RUI B;  2R61 A;  4TUU A;  2JUO A;  1WRI A;  2ZZP B;  1WXA A;  5HFY A;  2RMM A;  3ALB A;  1WGY A;  1P3Q U;  1ENF A;  4Q2J A;  4HVB A;  3I3T B;  2BPS A;  3CST A;  1CMX B;  4W9F A;  3D32 A;  3RPF C;  2AEH A;  3WAM A;  2KN5 A;  3HHM A;  3KYD D;  3IFW B;  2K3U A;  3ZNH B;  4I6N B;  4X57 B;  3HUI A;  3B2F A;  5BYQ A;  3WIM A;  4MGY E;  4ZHO A;  1TS3 A;  2DZM A;  2DEN B;  3NHE B;  4WWP A;  4PK1 A;  3EUB 2;  1UD7 A;  2NBV B;  5D6J B;  4KIK B;  2V1Y A;  1DOY A;  4II2 B;  1QKZ A;  2WXI A;  4BBN C;  2G9H D;  2FCM A;  1QOB A;  1UBQ A;  2LGX A;  1K53 A;  1P98 A;  1Q10 A;  4OVV A;  1SE2 A;  2KDB A;  3R2I A;  2PPH A;  4XWT A;  2QHO A;  3AEE B;  2AL6 A;  2WWZ A;  1CQV A;  2LGI A;  2KOX A;  4K3B A;  2ZVN A;  1C77 A;  3DBL I;  3PHW B;  5C3J B;  1TY2 A;  2HE7 A;  2KDI A;  4ASW C;  4JIO U;  2GBN A;  1YJJ A;  2N7D A;  2QJL A;  2ACZ B;  1AWD A;  1V8C A;  1I4P A;  2WXJ A;  5AZG A;  1N61 A;  3PV1 A;  5G5H A;  2K5P A;  3FIL A;  4P1B C;  4ITK A;  3ZYY X;  2JZ3 B;  2FE8 A;  2MBH A;  3QQ8 B;  4ZRJ A;  3GS2 A;  4ZRQ A;  2PLP A;  4GSW A;  1YX5 B;  4H2A A;  4OZA A;  1N60 A;  3AEB B;  2PEA A;  2AQ2 B;  1YN4 A;  2DAJ A;  4ARC A;  1RFK A;  2KX3 A;  4LNK A;  4L2Y A;  4MGZ E;  1E7U A;  2JWU A;  2JRH A;  4G11 A;  2KK8 A;  4NAW B;  1P7F A;  2MBE A;  3J9C A;  2N9E B;  3AE8 B;  1BT0 A;  3JSV B;  3ZTC A;  3P2B A;  3ZO5 B;  5IOI A;  4N58 A;  4M00 A;  2BW2 A;  2WX1 A;  2LXC A;  2BWE S;  1FRD A;  3HIZ A;  5E6P A;  1XF5 L;  4YSX B;  3ZUN A;  4P1C C;  4TV3 A;  3N30 A;  5IA7 A;  2KC1 A;  4YSY B;  4HRO A;  3MHS D;  2D5G A;  2WXO A;  1WXS A;  4C80 A;  2KVZ A;  1XEE A;  4XGA B;  2BGF A;  4IM0 A;  3ZDM C;  5EDS A;  3VDZ A;  1ZW7 A;  2LHD A;  1NVI D;  3NVV A;  2J4X A;  3RZW C;  2OJR A;  1ZGU B;  5BMI A;  4WWM A;  2DZJ A;  3P1M A;  1V81 A;  4WWO A;  3TCA A;  3H7P A;  2WXM A;  2W9N A;  1TBE A;  2C7N B;  4BOS C;  3AE1 B;  3WAL A;  2MBQ A;  1F77 A;  1DOI A;  2I1K A;  4AP4 C;  4ZHP A;  3VFK A;  3Q8A A;  4L1B A;  3QC8 B;  2WXN A;  1FFV A;  1OGW A;  2CU1 A;  3CIR B;  5L95 C;  1ISN A;  1IGD A;  1PDX A;  2MP2 B;  1T0R C;  2M56 B;  3KQ4 A;  1SSN A;  2DYO A;  2E3T A;  3HM3 A;  2CHZ A;  4IG7 B;  3LB8 C;  3HK0 A;  5D3D A;  3MP9 A;  4OVZ A;  1D6E C;  2HD5 B;  2CHX A;  3AE4 B;  1PUT A;  2RD0 A;  1YOV B;  4GU2 A;  2YLM A;  2PIA A;  5L83 A;  2JU6 X;  1GUA B;  2XK5 B;  4FN2 A;  1TYG B;  3W9C B;  3PRE A;  4PYZ A;  2D07 B;  2ZNV B;  2LEK A;  1JWA D;  4C00 A;  5D3I B;  3QAR A;  1C76 A;  1C4A A;  2L32 A;  2DX5 B;  3VQI A;  1EU4 A;  1FCL A;  2Y5C A;  3VR9 B;  3WCQ A;  1Q5W B;  2ZEQ A;  1H8C A;  1MG4 A;  1WE7 A;  2AX5 A;  3GZN I;  3UIO B;  1JAL A;  4MAC A;  4G50 A;  5IKC M;  1E8Z A;  2KYW A;  2N7E A;  4W9C A;  3DVG X;  3ZRC A;  4MJS A;  2PVG C;  1FEH A;  3QWZ B;  4E74 A;  2J7Q B;  4WUR A;  4HPP A;  3H7P B;  3DVN U;  4C4V B;  4EFO A;  2D11 A;  1KM7 A;  4MM3 A;  1YNT E;  3R7Q A;  1L0X B;  2NPT A;  4MH8 A;  4KV2 A;  1UUP A;  2BS2 B;  2BYF A;  1WF9 A;  5BMG A;  1YMH E;  2WXH A;  4E71 A;  2L00 B;  3ZJU A;  3VH4 B;  1KLG D;  2B76 B;  3UF8 A;  5HHD G;  1V6E A;  2RSU A;  3PHX B;  1SE4 A;  1M4V A;  3H6N A;  1AAR A;  2JRI B;  1WGH A;  3MHZ A;  3N3K B;  3NRZ A;  5EE9 A;  2HJ1 A;  2NBW B;  4YT0 B;  2W82 A;  2O6V B;  5G2N A;  4J3O D;  3BIN A;  2K39 A;  1DYQ A;  3W1S A;  4AWJ A;  4HXD A;  2N9L A;  2IDY A;  1TS2 A;  3Q3O C;  4FJV B;  2J0K A;  3KUD B;  1FIQ A;  2RPQ A;  2W54 A;  4M01 A;  1MHX A;  4RM8 A;  1TIF A;  3UI3 A;  3BYY B;  1RYJ A;  2DAF A;  2GBM A;  5CTR C;  2JF5 A;  5KHO A;  3IT6 B;  3L4P A;  1Z2M A;  3ZVV A;  3L0W B;  2D10 A;  3IAS 1;  1XLN A;  4W9K A;  2J0M A;  1XXG A;  3UIP B;  2PW9 A;  1E6E B;  3SDL C;  2ZCC A;  2KZR A;  4GN1 A;  3NY5 A;  2VH1 A;  4NPN A;  3Q3F A;  1N5X A;  1DGJ A;  1LQB A;  4TKN A;  2KDF B;  2V4L A;  4FHK A;  3DHG C;  3N32 A;  2K1F A;  2Z59 B;  3NVZ A;  4PS8 A;  3ZRF A;  1KOT A;  2K8H A;  5DPW A;  2MBO A;  2NBU A;  5DPR A;  2JYE A;  3KUC B;  2MJD A;  4REZ A;  2Q5W D;  4A3P A;  1TKY A;  3A33 B;  3CSF A;  1KH0 A;  1WXM A;  4WJP A;  1F9J A;  3ZW3 A;  3Q69 A;  2D3C A;  1OQR A;  2D3A A;  2AL3 A;  3ZJV A;  5J17 A;  4WWN A;  1I35 A;  2A5U A;  2GOW A;  4HDQ A;  3RD2 A;  5EE3 A;  3AM9 A;  3UQB A;  3EA6 A;  2HTH A;  2WU2 B;  3V05 A;  1L5P A;  4AOF A;  2ONQ A;  2QC8 A;  1ZE3 D;  2A4Z A;  2EMS A;  2KO3 A;  4G0N B;  3QHT A;  3HRD D;  2GB1 A;  3Q8F A;  2LJ5 A;  3PLU A;  4HJG E;  5LNK 1;  3TUO A;  3K9O B;  4BOZ B;  3MC9 A;  3B08 A;  2ICI A;  1L6U A;  1F1H A;  4L23 A;  1FM0 D;  4MSQ B;  1WY8 A;  3P4Q B;  4BAX A;  4DDG D;  5J2R A;  4BZA A;  2UYZ B;  2I1J A;  1HTQ A;  3N1X C;  1E9M A;  4XDC A;  3H8H A;  5DPS A;  1FNW A;  5TSS A;  1MI0 A;  4XX5 A;  2QEJ C;  4A90 A;  1GNU A;  2GBJ A;  2LD9 A;  1A70 A;  4IWQ A;  4W9I A;  1QOG A;  2W55 A;  1FXT B;  5DPT A;  4BBN F;  3TIX A;  3DQV A;  3X0W A;  2VH2 A;  4WJQ A;  3JW0 X;  1WGG A;  3DBS A;  2KAC A;  5E6N A;  2KNB A;  1IBX A;  3Q6B A;  1NYR A;  2I2Y A;  1OQQ A;  3W2D A;  3AE7 B;  3VUX A;  1IUE A;  3U8Z A;  3PLV A;  2KQ4 X;  2WYQ A;  3W1S C;  4IDI A;  4FAD A;  3TSS A;  1VDV A;  2LGD A;  1PGX A;  3S2A A;  3SEB A;  5D2M B;  4B0E A;  3Q8E A;  4EZJ A;  2WXQ A;  4P16 A;  5LXI B;  5T8I A;  1C9F A;  2EKE C;  3MJW A;  1KTK A;  2HDE A;  1PQS A;  4CQN A;  3LJ3 A;  1QLB B;  1FXI A;  2BB5 A;  4ANV A;  4EZL A;  1GB4 A;  1GJZ A;  2KDE B;  2LFI A;  4HKQ A;  4BKS A;  2N7J A;  2AQ3 B;  3U7Z A;  4B6W A;  4IW0 A;  2NCN A;  1KLU D;  1YIW A;  4EZK A;  2MHJ A;  4N59 A;  2DBY A;  2XK5 A;  2BS3 B;  3HM6 X;  3ML8 A;  3P4R B;  4BFR A;  3ZQ4 A;  3I57 A;  1N5W A;  1AN8 A;  4LNF A;  3JVZ X;  4GMV A;  1GC7 A;  4DXA B;  2KVR A;  1VCB A;  3FAH A;  4XDD A;  3BWU D;  2JSV X;  2L0T A;  3PSE B;  2K22 A;  2JY6 A;  4ZDV A;  3QAQ A;  1SE9 A;  2JPH A;  5TR5 A;  4A55 A;  1C4P A;  5MPO A;  4IUM B;  5BMH A;  3QX1 A;  5IAA C;  2G4S A;  1JWB D;  1ZUD 2;  2MW5 A;  2KMM A;  1WX7 A;  1E10 A;  3CF6 E;  5AUK A;  4F8C B;  3L08 A;  2N9X A;  3E9S A;  2JXT A;  2KFK B;  4YL8 A;  3PZ7 A;  2K6Q A;  4C7Y A;  1UF0 A;  1ZPS A;  2O2V A;  3A9K B;  5FKA C;  3Q8C A;  3X23 A;  1J8C A;  2WP9 B;  1B9R A;  3ZNI D;  1LFD A;  1NI2 A;  2ZCB A;  3ZJT A;  3RUL A;  1I4Q A;  1FNV A;  2WNM A;  1ZXI A;  2IGD A;  1WMH A;  3RYT A;  1WWT A;  4WH4 A;  2QIE B;  2LMC A;  2EKI A;  3PO0 A;  1H4R A;  4EOY A;  4ICV A;  3ML9 A;  4WAA A;  2BYT A;  1WR1 A;  4IM3 A;  3ZGZ A;  4ZYS A;  4B95 A;  1AW7 A;  3V6E B;  2Z8L A;  3A1Q A;  5C1Z A;  4A20 A;  3I63 C;  4NNJ B;  4MT5 A;  1U4A A;  5JZE B;  4YTP B;  2NTS A;  4IM2 A;  3L10 B;  4DXG A;  3P63 A;  2RGF A;  3R66 C;  1LO5 D;  3FKY A;  3AV8 A;  2BVC A;  2JZZ A;  1EF1 A;  1UNS A;  3BII D;  1CJE A;  1MJD A;  2INN E;  4RGT A;  1WJN A;  4GIV A;  3U4E G;  4P7I A;  5H8Y E;  1TY0 A;  1D5Z C;  3BZD B;  2L05 A;  4HCP B;  2PKO A;  3C19 A;  2KHW B;  4FHJ A;  5AZH A;  4USA A;  4FBJ B;  4M0W B;  3ETR A;  4NAW A;  3HVZ A;  2AYO B;  1WFY A;  3QCA A;  1N6Z A;  2GI9 A;  1SF0 A;  2VRR B;  2PTL A;  2IO3 B;  1ROE A;  5D94 A;  3GE3 C;  4OVU A;  1YQ3 B;  1TKE A;  2D3G A;  4HEA 1;  3EFU A;  3A9J A;  4DWF A;  2BBC A;  2M1M A;  1QOA A;  4KSK C;  2DZK A;  1RRB A;  1WYG A;  3TEW A;  3JSV A;  3ZNZ B;  4FJY A;  3MC0 B;  4DDI D;  3R8B A;  1LXD A;  3VRA B;  2KAJ A;  2WDR B;  4OZB A;  3VH3 B;  1TTN A;  1WGD A;  3GB1 A;  4MGK E;  3DWM A;  1L0V B;  3VRB B;  2WDQ B;  1FNU A;  1ET9 A;  2DHZ A;  1GAQ B;  4YXD B;  1UGM A;  1Y56 A;  4ZRK A;  4EEW A;  4US9 A;  1C3T A;  2GLS A;  1E5W A;  3AEG B;  2ZNV C;  1MPE A;  1L0Y B;  2FCN A;  1VLB A;  1R4N I;  4KGR A;  4K7W A;  4DHJ B;  2M19 A;  3VAW A;  3KVF B;  1P0R A;  2KAN A;  1RFA A;  3RZF A;  1ZOY B;  3IBE A;  3IAM 1;  2L3Z A;  1QOF A;  3MC8 A;  3GP7 A;  2FNJ B;  1JML A;  5JHB A;  2H89 B;  3P42 A;  2O2V B;  3A9K A;  4DBG A;  4EUT A;  3B0A A;  3KWV A;  2KN4 A;  2PE9 A;  4HK2 A;  2C60 A;  3U52 E;  3ZKJ C;  3OJ3 A;  1V49 A;  1D5X C;  1VZ6 A;  3DBR B;  2K0P A;  4A9A A;  3DHI C;  2M4N A;  3BK2 A;  1Y8R C;  3PZ8 A;  4FUL A;  2Y5P A;  1V86 A;  2KD0 A;  4LLG M;  4GB9 A;  5BO4 B;  1C78 A;  3DDC B;  4M8M A;  2BKR B;  2XN9 C;  2KFK A;  3BVM A;  1RM6 C;  1WI0 A;  1WJ4 A;  1VRA B;  3TJP A;  2FAZ A;  3Q14 C;  1JWS D;  3NOB A;  2UU7 A;  2N1W A;  2LJI A;  3PRZ A;  5LXH A;  1EU3 A;  2ZJD A;  1G6J A;  4W9J A;  3OG5 A;  4C4V A;  3RNC C;  2BYV E;  4FXC A;  5E6O A;  1SIF A;  2RDB C;  4HPL B;  1F2R I;  2KXJ A;  1S3S G;  2UWQ A;  2WXG A;  1R4M B;  4ZYN A;  1IYF A;  1F0Z A;  4KX6 B;  4DQO C;  1GPX A;  1LGR A;  1V1P A;  2OJW A;  2NS5 A;  2BS4 B;  2BT6 A;  4I6P A;  1WMH B;  1EF5 A;  1WGR A;  1NBF C;  1V1P B;  3VTU A;  3N20 C;  4IWP A;  1L6V A;  4AJY B;  1K51 A;  1E8Y A;  1E0Z A;  1QF6 A;  2VZK B;  4KZC A;  1JWM D;  4FLH A;  4MH0 E;  4KVG B;  4XE0 A;  2PMV A;  2L8J A;  5AEK B;  4C7Z A;  1TT5 B;  4DXF A;  4RFB A;  4N9F 4;  4LTU A;  2JXX A;  1YJI A;  4ICU A;  2G1E A;  4NQK E;  3EFC A;  1R4N B;  2RDH A;  2SAK A;  3AE3 B;  2O6V D;  2KLG A;  4K1R B;  3QIJ A;  3W5V B;  3WAP A;  4ANW A;  1T0Q C;  1EM7 A;  3ECI A;  1K8R B;  2KWC A;  4IC7 B;  2B3A A;  1XLQ A;  2MSE D;  1WSP A;  2OOB B;  4YTN B;  1BUI C;  2L7R A;  2K25 A;  3LYY A;  5IO9 A;  4LNI A; 
#chains in the Genus database with same CATH homology
 4K7U A;  3VUW A;  4BKT A;  1P98 A;  4GDL A;  3SD5 A;  4OVV A;  2LUE A;  2R2O A;  1J19 A;  4G3X B;  2KDB A;  3R7R A;  2PPH A;  2QHO A;  1V5T A;  2AL6 A;  2WWZ A;  3VUX A;  4K7S A;  3U8Z A;  2KOX A;  2ZVN A;  2N4F A;  3PLV A;  3DBL I;  2WYQ A;  2KJ6 A;  3PTF C;  3PHW B;  2LVO A;  3W1S C;  2HE7 A;  4PYU A;  4FAD A;  2KDI A;  3PPA A;  4ASW C;  3UIN B;  2LGD A;  4JIO U;  3S2A A;  2GBN A;  5D2M B;  3V6C B;  2N7D A;  4EZJ A;  3PRP B;  5LXI B;  3PGE A;  3M95 A;  5AZG A;  1UBI A;  3PV1 A;  4AUQ C;  4GXB A;  2DZI A;  3PRM B;  2EKE C;  4PS3 A;  2JZ3 B;  3MJW A;  1P1A A;  2Z0E B;  4A3O A;  2MBH A;  3QQ8 B;  4ZRJ A;  5J18 A;  2MA9 B;  1OEY A;  4NJ7 A;  1WJ6 A;  4GSW A;  1PQS A;  3H9D A;  3LJ3 A;  1YX5 B;  4HDO A;  3OJ4 B;  1EUV B;  5CHV C;  4ANV A;  4EZL A;  3ZLZ A;  1GJZ A;  2KDE B;  4LDT B;  1WXV A;  4BKS A;  2PEA A;  4KDI C;  3TBL D;  2DAJ A;  4DHZ B;  3B1L X;  4IW0 A;  4B6W A;  3ZIM A;  2K6D B;  2LI5 A;  2NCN A;  4CO7 A;  2KX3 A;  4F1S A;  1YIW A;  4EZK A;  4NJ6 A;  1C1Y B;  4MGZ E;  1E7U A;  1HE8 A;  2XK5 A;  3V60 A;  4EKU A;  2JRH A;  4G11 A;  2KK8 A;  4CHK A;  3HM6 X;  3ML8 A;  4NAW B;  5DCN A;  3RT3 B;  4BFR A;  2MBE A;  2Z0D B;  4DK5 A;  2BWF A;  1WR6 E;  2N9E B;  1GC7 A;  3JVZ X;  1BT0 A;  3EC8 A;  4GMV A;  4W9G A;  4DXA B;  3KUZ A;  2KVR A;  3JSV B;  3ZTC A;  1GC6 A;  1VCB A;  3P2B A;  1MG8 A;  1WZ3 A;  3ZO5 B;  2L0T A;  3PSE B;  2JY6 A;  2LAS A;  4ZDV A;  3QAQ A;  3M63 B;  1SE9 A;  2JPH A;  2WX1 A;  5TR5 A;  3H1U A;  2LXC A;  1KJT A;  2BWE S;  2FIF A;  3HIZ A;  5E6P A;  4IUM B;  3KW5 B;  3ZUN A;  4TV3 A;  2C7H A;  3AU4 A;  3N30 A;  5IA7 A;  1IPG A;  3QX1 A;  2KC1 A;  5IAA C;  2G4S A;  1GG3 A;  2MW5 A;  1WH3 A;  1WX7 A;  4MEM A;  3NS8 A;  3CF6 E;  4MJS B;  2CR5 A;  3MHS D;  4F8C B;  1WXS A;  2IZV B;  3L08 A;  2N9X A;  2NVU I;  3DBH I;  4JGH B;  2CKH B;  2BGF A;  2HJ8 A;  2KTR B;  4LCD E;  4IM0 A;  3ZDM C;  4KDL B;  2KFJ A;  5EDS A;  3VDZ A;  1ZW7 A;  3WA0 A;  1V80 A;  2KFK B;  3L16 A;  4YL8 A;  1RAX A;  2K6Q A;  3A1Q B;  4W9E A;  5D7G A;  1I42 A;  2O2V A;  3A9K B;  3ONS A;  2BF8 B;  3RZW C;  2OJR A;  3PVL A;  4WJO A;  4LJO B;  1ZGU B;  1UZX B;  2D2Q A;  3X23 A;  1J8C A;  1OQY A;  3DCG A;  2DZJ A;  1V81 A;  3ZNI D;  1LFD A;  1NI2 A;  2ZCB A;  3CMM B;  4WWO A;  3TCA A;  3RUL A;  4WQO B;  3KH0 A;  3H7P A;  1OTR B;  1WMH A;  2W9N A;  1TBE A;  2C7N B;  3RYT A;  4BOS C;  3QA8 A;  3WAL A;  2MBQ A;  2LVP A;  1H4R A;  2XBB C;  4EOY A;  2NPT B;  2I1K A;  4AP4 C;  4ICV A;  3VFK A;  1L2N A;  4XC2 A;  3APC A;  1ZKH A;  3ML9 A;  4WAA A;  4B9K A;  1SGH A;  3QC8 B;  1WR1 A;  4IM3 A;  2LGY A;  3T9L A;  1YQB A;  4B95 A;  1OGW A;  2GMI C;  2CU1 A;  3IHP C;  3V6E B;  5L95 C;  4ZRI A;  5HKH A;  3IG3 A;  1ISN A;  4RM9 A;  4I6L B;  1RLF A;  2MP2 B;  3EEC A;  3A1Q A;  5C1Z A;  3OLM D;  4A20 A;  2JVC A;  4NNJ B;  3LDZ E;  2DYO A;  3RCZ A;  2IYD B;  3DVG Y;  3HM3 A;  2CHZ A;  1U4A A;  4IG7 B;  5JZE B;  5KHQ A;  3HK0 A;  3IVF A;  2MCN B;  2KJR A;  4HPM B;  4GDL B;  2JT4 B;  4IM2 A;  3K9P B;  3L10 B;  1X1M A;  4GGQ A;  2HD5 B;  2CHX A;  2RGF A;  3R66 C;  3H7S A;  2RD0 A;  5LLI A;  2C5L C;  3AI5 A;  2FCS A;  2JZZ A;  3JYU A;  2MRP A;  4HWI B;  4GU2 A;  1EF1 A;  2YLM A;  4JQW C;  5CX3 A;  5L83 A;  1GUA B;  2XK5 B;  1UH6 A;  4FN2 A;  2KKC A;  1A5R A;  2JWZ A;  4DHZ E;  1E7V A;  2MWS B;  1V9J A;  1WJN A;  4GIV A;  3PRE A;  4P7I A;  4PYZ A;  2D07 B;  1UEL A;  2Y5B B;  4HCP B;  2L05 A;  2IO0 B;  4BVU C;  1LM8 B;  4FHJ A;  2KHW B;  1YJ1 A;  2ZNV B;  3DOW A;  3DVN V;  5AZH A;  4FBJ B;  1Z5S B;  1E90 A;  3QAR A;  2CHW A;  3NZS A;  1WJU A;  2DX5 B;  3VQI A;  1XD3 B;  4M0W B;  1WX9 A;  5JH5 C;  4NAW A;  2GBR A;  1WZ0 A;  1Q5W B;  2AYO B;  2ZEQ A;  1H8C A;  3UIO B;  1WE7 A;  3GZN I;  1WFY A;  3QCA A;  1E8W A;  3U7D A;  4G50 A;  1E8Z A;  4LDT D;  3W1Y A;  2N7E A;  2V3S A;  2MX2 A;  2VRR B;  2LRW A;  4W9C A;  3DVG X;  2IO3 B;  5C23 A;  2XEW A;  2WX0 A;  5D94 A;  3ZRC A;  4MJS A;  2KWV B;  4OVU A;  3QWZ B;  2KMA A;  3ZNG C;  4E74 A;  2J7Q B;  2D3G A;  3EFU A;  3H7P B;  3DVN U;  3A9J A;  3GOE A;  4DWF A;  2KJH B;  4F7Z A;  2KTF A;  4EFO A;  2D11 A;  2M1M A;  1KM7 A;  3V61 A;  3ENE A;  4JLC A;  4MM3 A;  3ZDT A;  4HLE A;  4KZ0 A;  3R7Q A;  4KSK C;  4K81 A;  2LXA A;  2DZK A;  2NPT A;  4KV2 A;  1RRB A;  4FJZ A;  4NQL B;  1NDD A;  4WJN A;  3JSV A;  3A4R A;  3UQA A;  3ZNZ B;  4FJY A;  2BYF A;  4AJW A;  4FA6 A;  3C0R B;  2G4D B;  1EO6 A;  4DDI D;  1WF9 A;  2L76 A;  2C7M B;  4E71 A;  1LXD A;  2L00 B;  3VVW B;  2K8C A;  3VH4 B;  1TZ1 A;  2LZ6 A;  3VH3 B;  4M8N A;  3UF8 A;  1TTN A;  1WGD A;  1V6E A;  2MBB B;  4MGK E;  2RSU A;  1YX6 B;  3M62 B;  3PHX B;  4GDK A;  3H6N A;  1AAR A;  2JRI B;  4ANX A;  2DHZ A;  1WGH A;  3N3K B;  2MP2 A;  4URK A;  2ZPY A;  1WYW B;  2NBW B;  1UGM A;  1S1Q B;  1D3Z A;  4ZRK A;  3WAO A;  4EEW A;  2G3Q B;  2KQS A;  1C3T A;  4RMA A;  3SHQ A;  1QZE A;  5G55 A;  1E5W A;  2O6V B;  5G2N A;  2ZNV C;  4KSL C;  2FCN A;  4MDK E;  1XT9 B;  4GOC A;  1R4N I;  4K7W A;  4MGI E;  4DHJ B;  3VAW A;  4HJK A;  1VD2 A;  3BIN A;  2K39 A;  3WAN A;  3KVF B;  2MLB A;  3W1S A;  1P0R A;  2KAN A;  4NY0 A;  4BBN F;  4AWJ A;  2N9P C;  1RFA A;  3TL5 A;  3RZF A;  1IP9 A;  4HXD A;  3IBE A;  4JL9 A;  3AUL A;  3VTV A;  4FJV B;  2J0K A;  3KUD B;  3QJZ A;  5CHF A;  2L3Z A;  2G45 B;  2FNJ B;  2RPQ A;  2LVQ A;  2WDT B;  4RM8 A;  3MTN B;  5JHB A;  3EHV A;  2L0F A;  2DAF A;  2KWU B;  2R2Q A;  2ZVO A;  2GBM A;  4GDK B;  1R4M I;  3PT2 B;  5CHW A;  2O2V B;  3A9K A;  4XZ4 A;  4ANU A;  3APD A;  4W9L A;  4DBG A;  5CTR C;  4W9H A;  1OEY J;  3B0A A;  2JF5 A;  5KHO A;  4EUT A;  3DPD A;  2C9W B;  4BKG A;  2PE6 B;  2PE9 A;  4HK2 A;  2DYB A;  1TGZ B;  1Z2M A;  2C60 A;  3TMP B;  3ZKJ C;  4TQ0 A;  3ZVV A;  3L0W B;  2D10 A;  3OJ3 A;  1V2Y A;  1V49 A;  2MQJ A;  2ZPN A;  3PS6 A;  2BKF A;  3DBR I;  4W9K A;  2J0M A;  3UIP B;  3NZU A;  3VTW A;  1WIA A;  3SDL C;  4J6I A;  2M0X A;  2KC2 A;  2ZCC A;  2KZR A;  1XQQ A;  4GN1 A;  1WX8 A;  3NY5 A;  3BY4 B;  4NPN A;  2CS4 A;  2M4N A;  3Q3F A;  1Y8R C;  4FUL A;  4II3 B;  1V86 A;  3A9J B;  2KD0 A;  1LQB A;  3KYC D;  4TKN A;  2KDF B;  2V4L A;  4FHK A;  1JRU A;  3N32 A;  4GB9 A;  2K1F A;  4TQ1 A;  5BO4 B;  2EMT A;  3DDC B;  4M8M A;  2KLC A;  2Z59 B;  2BKR B;  2KFK A;  4PS8 A;  2FID A;  3ZRF A;  1T0Y A;  4HCN B;  1KOT A;  2K8H A;  3X0W A;  5DPW A;  2MBO A;  1WI0 A;  1WM2 A;  5JHA A;  1WJ4 A;  2NBU A;  2O6V A;  3Q3J A;  3KUC B;  5DPR A;  3TJP A;  2FAZ A;  3NOB A;  4MEL A;  2N1W A;  3PRZ A;  4BKS D;  4A3P A;  4E3C A;  3A33 B;  3CSF A;  3L54 A;  5LXH A;  2ZJD A;  3PZD A;  1M94 A;  1G6J A;  3L13 A;  1WXM A;  4WJP A;  1F9J A;  4W9J A;  3ZW3 A;  2KX0 A;  3V62 A;  2BYV E;  2KQ7 A;  5E6O A;  3T8M A;  1SIF A;  5AZF A;  2GBK A;  4HPL B;  2AL3 A;  1J0G A;  2J0J A;  5J17 A;  4WWN A;  2FCQ A;  1YD8 U;  2KXJ A;  1S3S G;  2A5U A;  2IO2 B;  2M17 A;  2UWQ A;  4MSM B;  1I35 A;  2GOW A;  2IBI B;  2PJH A;  4HDQ A;  4ZYN A;  3RD2 A;  1L7Y A;  1IYF A;  2ASQ A;  2RR9 A;  5GMV A;  4CYE A;  4KIK A;  4PS7 A;  3UQB A;  2K8B A;  1WE6 A;  3UGB B;  3QK0 A;  3M3J A;  2BYE A;  2HTH A;  2M8S A;  3U30 A;  2LRU A;  2NS5 A;  3SU8 X;  4I6P A;  1WMH B;  4LJP B;  1EF5 A;  1WGR A;  1NBF C;  3AU5 A;  3OAW A;  2IY1 B;  3VHT C;  3VTU A;  4AOF A;  3APF A;  1WRD B;  2DYM A;  1Q0W B;  4IWP A;  1Q1O A;  3RUI B;  1WM3 A;  3ZTD A;  4TUU A;  4AJY B;  2JUO A;  2A4Z A;  1E8Y A;  2ZZP B;  2AWT A;  1WXA A;  2EMS A;  4KZC A;  2KO3 A;  2REX A;  4FLH A;  1V5O A;  4G0N B;  2IO1 B;  3QHT A;  4MH0 E;  3ALB A;  1WGY A;  4KVG B;  3A4S C;  3VUY A;  1P3Q U;  2L8J A;  3VXW A;  2LJ5 A;  3PLU A;  5AEK B;  1KLV A;  3K9O B;  4BOZ B;  3B08 A;  4HVB A;  3I3T B;  2BPS A;  3CST A;  1CMX B;  4W9F A;  3D32 A;  4N9F 4;  2AEH A;  3O65 B;  5FR6 A;  3WAM A;  3L17 A;  2KN5 A;  4W9D A;  2JXX A;  3HHM A;  2NR2 A;  4IWO A;  4MSQ B;  3KYD D;  4ICU A;  1WY8 A;  3IFW B;  3AXC A;  3ZNH B;  4NQK E;  4DDG D;  5J2R A;  4I6N B;  2UYZ B;  1P9D U;  2I1J A;  4X57 B;  2O6V D;  3R3M A;  2KLG A;  3WIM A;  4K1R B;  4MGY E;  5DPS A;  2FUH B;  1E8X A;  4DHJ D;  3QIJ A;  4XX5 A;  3WAP A;  2DZM A;  1GNU A;  4ANW A;  2DEN B;  2GBJ A;  3ECI A;  2LD9 A;  1K8R B;  2KWC A;  4IWQ A;  4IC7 B;  3NHE B;  4W9I A;  4WWP A;  1FXT B;  2B3A A;  2N1V A;  1UD7 A;  5DPT A;  2YVC A;  2NBV B;  2KTR A;  3DQV A;  5D6J B;  2MSE D;  3TIX A;  4KIK B;  2OOB B;  2KMC A;  2V1Y A;  4WJQ A;  4II2 B;  3JW0 X;  1WGG A;  2L7R A;  2LWP A;  3DBS A;  4BBN C;  2IY0 B;  2FCM A;  2K25 A;  1UBQ A;  5E6N A;  2LGX A;  2KNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...