1J8CA

Solution structure of the ubiquitin-like domain of hplic-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-like protein hPLIC-2
publication title Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j8cA00
4ANWA 3IG3A 2CS4A 3S2AA 1GG3A 1V86A 2RSUA 1WI0A 3OJ3A 3TBLD 3B08A 2MW5A 3QQ8B 3RD2A 3VH4B 4KVGB 1WE7A 2O6VD 1WRDB 3IBEA 3PGEA 3RYTA 5BO4B 3NZSA 1WGGA 2FCQA 3O65B 3JSVB 4HDOA 4I6NB 1C3TA 1NI2A 1P9DU 5L95C 3HHMA 4I6LB 1G6JA 2XK5B 1XD3B 2GBKA 4MJSA 3VAWA 2IO1B 2MWSB 3VFKA 3L0WB 4G50A 2L3ZA 2VRRB 2JT4B 2ZCBA 5IA7A 4LJPB 3B0AA 1MG8A 4CYEA 4XX5A 2KJ6A 1WX7A 1L2NA 3VTVA 5HKHA 4EUTA 2IO3B 2Z59B 2K8HA 2MSED 3RZFA 4I6PA 3R3MA 4FHKA 5AZHA 3L13A 1UGMA 1E5WA 2ZJDA 4B9KA 2NS5A 2V3SA 2JRHA 3PRZA 2WYQA 3RCZA 3QAQA 1UD7A 2D2QA 2DZJA 4A20A 2HJ8A 4WWNA 1WIAA 2KX3A 2LUEA 1TTNA 1KLVA 5LXIB 3NY5A 4MSMB 2KD0A 2LGXA 2L00B 4HPMB 1JRUA 4FULA 1Q1OA 3K9PB 4BOZB 2JF5A 2G45B 1VD2A 4ANXA 1YIWA 2CR5A 4II3B 4HVBA 2N4FA 1TGZB 2M0XA 3BY4B 3WAPA 4JQWC 1V49A 4AWJA 1EO6A 2GBNA 2W9NA 4K1RB 2GBRA 4GB9A 2NBWB 5D2MB 1OGWA 2KOXA 1TZ1A 2JUOA 1P1AA 1Z2MA 4WJPA 1WGRA 3IFWB 2K6DB 1UBIA 1EF5A 2L7RA 2N9XA 4MGYE 1WXSA 4K7UA 2ZCCA 1TBEA 5CHWA 3H6NA 3R66C 5IAAC 1OTRB 3OJ4B 2KANA 2XBBC 3A9JB 3ZTCA 2MRPA 2N7EA 4IUMB 5CTRC 1IPGA 4IM2A 4W9JA 3KYDD 1E7UA 4GN1A 2IY1B 2BGFA 3A9KA 3HM3A 3PTFC 2GBJA 2XEWA 3PLVA 3QK0A 2LRUA 3ZW3A 3WAOA 4M8MA 4OVVA 3U7DA 3DOWA 3IVFA 2C5LC 2RD0A 1GNUA 3PZDA 4GU2A 3L17A 2HE7A 4E3CA 1RFAA 4AJWA 1WXMA 4W9CA 5D6JB 3TMPB 2L0FA 3ZDMC 4RM9A 4PYZA 3L08A 1E8WA 4BKGA 1T0YA 2BYEA 2G3QB 2KK8A 2DYBA 4IG7B 4RM8A 2L76A 3VDZA 5LXHA 4M0WB 2V4LA 3EFUA 3P2BA 4PYUA 4EZLA 2AEHA 2N1VA 4KZ0A 4GGQA 2JZ3B 4GOCA 3VVWB 2BPSA 3A1QB 4ZYNA 2JPHA 1UZXB 3UIPB 1Y8RC 3T8MA 2LZ6A 2N7DA 2RPQA 4ANVA 2L05A 2KVRA 2BKRB 1OQYA 4BVUC 3JW0X 3PHWB 2GOWA 3PT2B 3PSEB 2DAJA 2K8BA 5AZGA 2AL6A 3UF8A 5FR6A 4AP4C 4KSLC 2D11A 3VUWA 2KC2A 4ANUA 2G4SA 4JGHB 2IZVB 2G4DB 2ZEQA 2KDEB 3KVFB 3C0RB 4W9GA 1QZEA 4G11A 5L83A 2MQJA 4ZRIA 5E6OA 4W9FA 2CHXA 2JRIB 3GOEA 4DHZB 3V6CB 2DZKA 5J18A 1KM7A 4KSKC 3QX1A 1KJTA 4J6IA 2AYOB 1Z5SB 2KWVB 2LVOA 2IO0B 2KLGA 3X23A 3D32A 3A4RA 3N32A 3NS8A 4HDQA 2D07B 4RMAA 4AUQC 4G0NB 4NPNA 3PRPB 5DPRA 2KFKB 3ZLZA 1CMXB 2WX0A 4URKA 2IO2B 2KN5A 2KFJA 2YVCA 4JLCA 3WA0A 2M8SA 5CHVC 1LXDA 1YX5B 2R2OA 5KHQA 1ZKHA 1FXTB 1V2YA 2UWQA 3H7PA 2N9PC 3K9OB 2I1KA 4F7ZA 3HK0A 3ZRCA 5DPTA 4KDIC 3WIMA 2CHWA 3DVGY 4EZKA 3LDZE 3NHEB 2KDFB 1X1MA 3L16A 2IYDB 3PHXB 2C9WB 3PVLA 3JSVA 3APDA 4GDLA 3DVNU 5JHAA 1UELA 2MBBB 4NAWA 4B6WA 2KLCA 2WDTB 2XK5A 2ZVOA 4AOFA 2JVCA 5CX3A 2PEAA 2NCNA 2LVQA 1F9JA 2J0MA 3QIJA 2LRWA 2ZNVC 2KDBA 4IC7B 2KC1A 5LLIA 4PS8A 5G55A 1WR1A 2FAZA 2KWUB 3DDCB 2BWES 2PE9A 1P98A 4KIKA 3AU5A 3UGBB 4GIVA 3H1UA 4F1SA 2R2QA 2LASA 2FIDA 4ASWC 2K6QA 1WX8A 3KUDB 2BF8B 4XC2A 2O6VA 3HM6X 4KV2A 4PS3A 4BBNF 2KJHB 4W9DA 3ZVVA 2FUHB 3V60A 3X0WA 1WYWB 3APCA 1WH3A 3W1SA 4IWPA 4WJNA 2KHWB 3H9DA 3QA8A 5AZFA 1LM8B 1V81A 3AU4A 4CHKA 3QCAA 2FNJB 3QJZA 4BFRA 1E7VA 1YQBA 4HXDA 5C1ZA 1E8YA 3PS6A 1OEYA 2MP2B 2EMSA 5G2NA 4TUUA 5DPWA 3UIOB 1IP9A 4M8NA 3ZNID 4X57B 4MGKE 3CF6E 2OOBB 2KTFA 1I35A 3DBHI 4G3XB 4BBNC 3VH3B 2CU1A 1WM2A 3L54A 1WFYA 3UQAA 2A5UA 3KYCD 3A33B 1V5TA 4HWIB 5C23A 2KTRB 3M63B 4W9LA 3R7QA 4WAAA 2HD5B 4EFOA 2CHZA 2MA9B 3HIZA 3KUCB 4K7WA 1WE6A 1A5RA 4ICVA 4EZJA 3ZUNA 3VUYA 1WMHA 1WZ0A 2NVUI 3VHTC 4EEWA 1C1YB 4TV3A 3U30A 4MH0E 2KMAA 2RGFA 2PJHA 1V80A 1WXAA 4FJZA 2DYMA 3WANA 1RRBA 3ZTDA 3ZNGC 4NNJB 3QHTA 1WJUA 2D10A 3A4SC 3MTNB 3QARA 3UINB 1D3ZA 4IM3A 2LGYA 3A9JA 1M94A 2C7NB 2KJRA 2PPHA 5J17A 5D7GA 1WGHA 2LWPA 3Q3JA 4GXBA 4W9HA 5CHFA 2O2VB 3TJPA 4MGIE 4F8CB 3EHVA 2RR9A 2PE6B 2ZPYA 2L0TA 3MHSD 4FJYA 4IWOA 4DBGA 2NBVB 4A3PA 3VTUA 1WY8A 2NPTA 2OJRA 3ZKJC 3DBRI 2C7HA 2WWZA 4GDKB 3SHQA 1E8XA 2IBIB 1WX9A 3DPDA 4DHZE 3APFA 3ZDTA 2ASQA 2BWFA 2DZMA 2NR2A 4GDLB 4PS7A 4W9EA 2MLBA 1L7YA 4TQ1A 4MEMA 3CMMB 3DCGA 3JVZX 4AJYB 2MBQA 4FLHA 2DZIA 3A1QA 1SE9A 1HE8A 2AWTA 2B3AA 3TCAA 1SIFA 1OEYJ 3PV1A 4LCDE 4MGZE 5KHOA 1ISNA 4LDTB 2Z0DB 4EKUA 2UYZB 1J19A 3R7RA 3VXWA 3DVNV 3DVGX 1UH6A 2DAFA 3VUXA 2LD9A 4MJSB 2M17A 2KWCA 2IY0B 3OAWA 1K8RB 2BYFA 2K8CA 4FA6A 5JHBA 2J0KA 1WJNA 2EKEC 4GSWA 2I1JA 1WF9A 3ZNHB 3ZRFA 2LI5A 1E8ZA 4K81A 4IM0A 3DBSA 3H7PB 1NDDA 4ZRJA 4WWPA 2L8JA 1KOTA 1R4MI 4NQKE 1ZW7A 4JL9A 2LXCA 4MELA 5E6NA 3EECA 2DX5B 1UBQA 5J2RA 5D94A 3AULA 2REXA 4NAWB 1P3QU 1H8CA 3LJ3A 1NBFC 2ZNVB 4DXAB 2BYVE 3V6EB 4DHJB 3WALA 4HPLB 2J7QB 4KZCA 2AL3A 5DPSA 4TQ0A 3I3TB 3M3JA 2KFKA 3B1LX 3PLUA 2KXJA 3PREA 4WJQA 4DDID 3PRMB 4WJOA 4IWQA 3QWZB 2ZZPB 3ZIMA 3RZWC 3PPAA 4W9KA 3RULA 4NQLB 1RLFA 4JIOU 3IHPC 1WGDA 3ONSA 4KIKB 5AEKB 4GMVA 2K39A 2GMIC 3ECIA 4YL8A 2JY6A 3TL5A 3V62A 1J0GA 3CSFA 4NJ6A 3ZNZB 1V6EA 3CSTA 3BINA 3WAMA 2O6VB 1Q0WB 3KW5B 2C60A 3DBLI 2FCSA 5TR5A 3EC8A 4MM3A 2KQSA 4HCPB 2KKCA 4FHJA 4HCNB 4HLEA 1WZ3A 1R4NI 3AXCA 4ICUA 5E6PA 3ALBA 5GMVA 2N1WA 3W1SC 2YLMA 4FJVB 2KNBA 2D3GA 4MDKE 4NJ7A 4TKNA 4DWFA 1S1QB 4NY0A 3N30A 3UQBA 3KUZA 2K25A 1V9JA 1GJZA 1IYFA 3SD5A 5JH5C 4FN2A 2LVPA 1VCBA 2DHZA 1S3SG 2C7MB 2N9EB 2Z0EB 4EOYA 2FCNA 5EDSA 4HJKA 2JZZA 3ENEA 3A9KB 1U4AA 4W9IA 4DDGD 1LQBA 4A3OA 2BKFA 3ZO5B 2KMCA 2FIFA 4E71A 4OVUA 3L10B 3ML9A 4IW0A 1WMHB 3M95A 4WWOA 1WXVA 3V61A 1WGYA 3Q3FA 4ZRKA 4CO7A 2KDIA 4BOSC 3NZUA 1WJ4A 2MP2A 3GZNI 4BKSD 2LGDA 3MJWA 1LFDA 2MBHA 1Q5WB 4N9F4 1WM3A 2KO3A 5JZEB 2LXAA 2GBMA 2FCMA 1PQSA 4XZ4A 2DYOA 4P7IA 1H4RA 4KDLB 2J0JA 2QHOA 3RUIB 1J8CA 2M4NA 1ZGUB 1XT9B 4HK2A 1I42A 3W1YA 1GC6A 4LDTD 4WQOB 1GUAB 2HTHA 2M1MA 3N3KB 3H7SA 3RT3B 1WR6E 2KTRA 2V1YA 2WX1A 2MCNB 1AARA 4E74A 2LJ5A 4II2B 1EUVB 1E90A 2NPTB 5DCNA 4FBJB 2MBEA 3U8ZA 2NBUA 1RAXA 1V5OA 2JXXA 2DENB 4FADA 3JYUA 2KZRA 3VQIA 3NOBA 3VTWA 1P0RA 3KH0A 2KX0A 1SGHA 4B95A 2KQ7A 2ZPNA 2A4ZA 1YX6B 2Y5BB 3AI5A 2JWZA 1BT0A 4K7SA 3T9LA 4BKTA 1YJ1A 2O2VA 1GC7A 1YD8U 3SDLC 1EF1A 3OLMD 4DHJD 3TIXA 3ML8A 4MSQB 1XQQA 4LJOB 4DK5A 4GDKA 4ZDVA 2CKHB 2ZVNA 3M62B 2MBOA 3SU8X 2EMTA 2MX2A 1WJ6A 2K1FA 4BKSA 3DQVA 3QC8B
chains in the Genus database with same CATH superfamily
4ANWA 3ZJTA 1GG3A 1WI0A 3OJ3A 3B08A 3QQ8B 3RFZB 3RD2A 1VR9A 3IBEA 2V3NA 1WGGA 2FCQA 4ZHPA 3MFGA 1NI2A 1P9DU 3HHMA 4I6LB 1G6JA 1SF0A 4LNFA 3VAWA 2TSSA 2R61A 3P4RB 2ZCBA 5IA7A 3EGRA 3B0AA 1SEBD 3CWIA 2KJ6A 1WX7A 1YJJA 5BMGA 2RDGA 2DLBA 4EUTA 4A8XC 1XLQA 4I6PA 2OJWA 5AZHA 3BVMA 3PZ7A 2K5PA 2NS5A 2V3SA 3RCZA 2WYQA 3QAQA 1BMLC 4A20A 1QF6A 2KX3A 1KLVA 3AEGB 2JU6X 4HRSA 2KD0A 3Q8BA 3B9JA 3EFCA 2JF5A 2G45B 1TGZB 2M0XA 1FRDA 4JQWC 1V49A 1EO6A 3GE3C 2NTSA 2GBRA 2NBWB 4S17A 3AE9B 1Z2MA 3IFWB 1L5PA 2L7RA 2WDVB 1XCQL 4K7UA 3H6NA 3R66C 5IAAC 1OTRB 2XBBC 2CU3A 5CTRC 1IPGA 4W9JA 4GN1A 2IY1B 2GBJA 3WAOA 1EWYC 3IVFA 2C5LC 2RD0A 3PZDA 4GU2A 3TMPB 1VDVA 3ZDMC 5BMHA 1B1ZA 4PYZA 1T0YA 1HTOA 2G3QB 5HG2A 3GB1A 5BMIA 3P2BA 1GB4A 4EZLA 4GOCA 2BPSA 1FXAA 2JPHA 3KQ4A 2RPQA 4ANVA 3U52E 1OQYA 3PHWB 3Q8FA 4AP4C 5AZGA 1TYGB 4KSLC 2D11A 2WXMA 2KC2A 2ZW0A 3ZJUA 2G4SA 1VZ6A 1KFYB 2IGDA 3ABVB 1AYFA 3C0RB 3HUIA 3KVFB 3VR9B 4G11A 4RNAA 5E6OA 3Q14C 2JRIB 5J18A 2DZKA 3QX1A 1KJTA 1HZ5A 2IDYA 2KWVB 1VLBA 3V3XA 3X23A 3N32A 2MEKA 4NPNA 2KYWA 1FMAD 1V8CA 3PRPB 1FCLA 1I4PA 5DPRA 2DWQA 3RNBC 2IO2B 1C76A 2YVCA 4JLCA 2K22A 2RMMA 5CHVC 3OG5A 1FXTB 1V2YA 3WIMA 3DVGY 2WLBA 4EZKA 3LDZE 4KGRA 1X1MA 2IGHA 1TS4A 1F2RI 2V4IB 3TEXA 1UELA 2MBBB 4LNKA 4MM3B 2KLCA 2XK5A 4P1BC 2JVCA 5CX3A 2NCNA 2LRWA 2KC1A 1PFDA 1L4DB 2KWUB 4B0MA 3P63A 3U2SC 2K6QA 3KUDB 5AUIA 2BF8B 4KGTA 1N62A 4W9DA 3N1YC 3H9DA 1V81A 3QCAA 1TKYA 1YQBA 3PS6A 2PKOA 4WQMA 1EWCA 1YN4A 2EMSA 1QOGA 4UDUC 4TUUA 5DPWA 4M8NA 4HROA 1P7FA 3CF6E 3L54A 2INCC 4R3DA 3A33B 2KTRB 2HD5B 4NZLB 2BS4B 4K7WA 1A5RA 2BVCA 2OHFA 1WZ0A 4TV3A 4MH0E 4LK0M 1IGCA 2PJHA 1TS2A 2FBWB 2BS2B 2L83A 4NNJB 1WJUA 2D10A 1D3ZA 2LGYA 3Q69A 2PPHA 5D7GA 4W9HA 5CHFA 3I63C 3W2DA 1TIFA 1FFUA 2PE6B 1YN3A 3VTUA 2OJRA 2WWZA 4GDKB 2WDRB 2IBIB 4RGTA 1WX9A 2JYEA 3APFA 2NR2A 2DBYA 2MLBA 3RNFC 3DCGA 3JVZX 4AJYB 3AN1A 2DZIA 2AQ1B 1HE8A 2LHDA 1SB3C 4LDTB 2Z0DB 2D3AA 3R7RA 1J19A 2SEBD 2WXLA 4O1NA 2D5GA 4MJSB 2KWCA 2L1AA 3OAWA 1K8RB 2BYFA 4J3OD 4FA6A 4FXCA 1DOIA 2I1JA 1WF9A 4JWSC 3ZRFA 3DBSA 2L8JA 1T6BX 3MHZA 2WNMA 4JL9A 2LJIA 5T8IA 1WRIA 5J2RA 1P3QU 1WGKA 3GZNB 4HJGE 4QAYA 4Q2JA 2BYVE 3DWMA 1UWXA 4DHJB 3WALA 4KZCA 1PYWD 3ETRA 5DPSA 3M3JA 4DDID 2KXJA 1GPXA 1XXGA 4IWQA 1MFWA 5D3DA 3RZWC 4OZAA 3V62A 4WURA 4YL8A 1ZP0B 3BINA 3CSTA 3BIID 3MJ5A 2WS3B 2GI9A 3ZGZA 5TR5A 2D3BA 4FHJA 2L32A 4XDDA 4ICUA 5E6PA 3AE4B 2N1WA 4TKNA 3GS2A 3UQBA 3KUZA 1GJZA 3FILA 1S3SG 2FCNA 1I4GA 5EDSA 2JZZA 1LQBA 2I2YA 4RF0A 2PLPA 2KMCA 2WXPA 1SJHD 4WAFA 1WXVA 1WGYA 5FK9C 4ZRKA 2MJEA 2MP2A 1ROEA 3GZNI 1LFDA 2KO3A 2LXAA 3I5JC 1PQSA 4YWGG 1J8CA 4A6QA 2X38A 3W1YA 1GC6A 4WQOB 1TT5B 3RT3B 3H7SA 5FKAC 4MH8A 2LJ5A 1E90A 5DCNA 4P16A 2MBEA 3TSSA 3JYUA 4BZAA 3AEFB 3NOBA 3VTWA 4LNIA 5TSSA 1TS3A 2KX0A 1SGHA 2ZPNA 2JWZA 1UF0A 4IOIE 3T9LA 3Q8CA 3SDLC 3OLMD 1FNWA 2WP9B 2WHIA 3ML8A 1JROA 4MSQB 4LJOB 5IO9A 3NZ3A 2MBOA 3QC8B 4GDLA 4CQNA 1KTKA 3S2AA 1V86A 2RSUA 3TBLD 5GXGB 4KVGB 3AECB 3VH4B 4A9AA 2PVGC 1ZUD2 4HPPA 1JRPA 4YT0B 3Q6BA 3VFKA 2VRRB 4RF1A 1MG8A 2I38A 2W3SA 1L2NA 3E56A 1QOBA 3VTVA 2IO3B 1FXIA 1JQ4A 3RZFA 3W5VB 5G5HA 2YEPB 3L13A 1XO3A 1E5WA 3PRZA 1Y56A 2N9LA 2E6XA 4GLSC 3LB8C 1ZDXA 1UWMA 4MSMB 2MH7A 2LGXA 2L00B 1Q1OA 3K9PB 4KKIA 5BYRA 4ANXA 3LXFA 4HVBA 3BY4B 3WAPA 4AWJA 2GBNA 4GB9A 3AE8B 1OGWA 3SFEB 2KOXA 4YTPB 2W82A 3KLSX 2V0GA 2N9XA 1V1PB 2BTEA 1DGJA 4PK1A 1NEKB 2WXGA 3OJ4B 3IXSA 2MRPA 5MPOA 4IM2A 1E7UA 3BYTB 1IBXB 2BGFA 3A9KA 1XCTL 2G1EA 1GNUA 3L17A 2JSVX 3IT6B 1WXMA 4W9CA 3L08A 1E8WA 1P7EA 2DYBA 2KK8A 3VDZA 5HHDG 4N58A 2V4LA 3EFUA 2Y3AA 3UIPB 3R8BA 2IGGA 1SE3A 2L05A 2KVRA 4BVUC 2WXKA 1FIQA 2GOWA 3PT2B 3PSEB 1WYGA 2K8BA 2AL6A 3VUWA 2EKIA 4OZCA 2INNE 2GLSA 1PGXA 1FNVA 2M0AA 1QZEA 2CHXA 4DHZB 2JWUA 3V6CB 1KM7A 4KSKC 2AYOB 5C2TB 2KLGA 3D32A 4HDQA 3NS8A 2D07B 5I4DA 2KFKB 3DBHB 2KN5A 1LXDA 2R2OA 1ZKHA 1SE2A 2N9PC 4F7ZA 3TEZA 1FNUA 5DPTA 3BZDB 1JW9D 2C9WB 3MP9A 3JSVA 5JHAA 1EU4A 4B6WA 2WDTB 4AOFA 2PEAA 4S0RA 2J0MA 3QIJA 1GAQB 1E10A 5JXVA 4XDCA 4K3CA 2FAZA 3DDCB 2PE9A 3SR6A 1P98A 1QKZA 4KIKA 4RGMA 4F1SA 5G5GA 5LNK1 2FIDA 4ASWC 1ENFA 2FUHB 3X0WA 3APCA 1ET6A 4WJNA 3QA8A 5AZFA 3AU4A 2FNJB 4HXDA 2JYTA 4KKJA 4RFBA 2MJ3A 5D3IB 3UIOB 4YSYB 3ZNID 4MGKE 2KTFA 4MT5A 3DBHI 3VH3B 3AE2B 1WM2A 2A5UA 4L1BA 3AV8A 5C23A 3I9V1 2W3RA 4W9LA 4WAAA 2IJ0A 4ICVA 4EZJA 4D2KA 4C7YA 3U30A 3E9SA 1R4MB 2KMAA 1V80A 1WXAA 2GRIA 4YXDB 3ZTDA 3NJTA 1I4XA 3A4SC 3UINB 4IM3A 4XYCA 3A9JA 5FR3A 2C7NB 1CK1A 2KJRA 5IP4D 5J17A 2BB5A 2RR9A 3VRAB 2L0TA 4DBGA 2NBVB 4M01A 2V3PA 3ZKJC 2C7HA 3SHQA 1M4VA 2DZMA 4PS7A 1F0ZA 3DBLB 4TQ1A 3A1QA 1MHHE 2J4XA 1SE9A 1XEEA 2AWTA 4US8A 1SIFA 3PV1A 2PVOD 4EKUA 2UYZB 2HDEA 1NI3A 2D3CA 3VUXA 2LD9A 2IY0B 1VZ7A 2KMMA 1FM0D 2J0KA 3ZNHB 2LI5A 1NDDA 1R4MI 4NQKE 1ZW7A 1ZXHA 5EE3A 4MELA 5E6NA 1L0YB 5D94A 3AE5B 2WU5B 3AULA 4DXAB 2XNAC 3B2FA 1TKGA 4HPLB 2KWDA 4TQ0A 2BW2A 3I3TB 5IKCM 4WJOA 2QEJC 3QWZB 3PPAA 2WQYB 3IHPC 1WGDA 3ONSA 4KIKB 2PW9A 2GMIC 3NG0A 1J0GA 3CSFA 4NJ6A 1C79A 1SBBB 4RH6A 3DBLI 1T0RC 1DOYA 2FCSA 1R7SA 3DHHC 1JCKB 2J52A 1WZ3A 1C4CA 1UGJA 5AUKA 1I7HA 4FJVB 2D3GA 4M02A 1PGAA 4NJ7A 1S1QB 2K25A 3SD5A 1A70A 1K50A 1VCBA 2DHZA 2C7MB 4XGAB 2Z0EB 3IT4B 4HJKA 3ENEA 1N5WA 1U4AA 2FUG1 4W9IA 2WU2B 2INPE 1OQQA 3U4EG 2FIFA 4E71A 5BYSA 3L10B 1STEA 4IW0A 3M95A 3V61A 3AMZA 1FPYA 3Q3FA 2M56B 1MVKA 3NZUA 1YNTE 1HEZE 1D5MC 1MHXA 4N9F4 1WM3A 3RMKC 5JZEB 2FCMA 4TSSA 4P7IA 1H4RA 1QOFA 2J0JA 1ZGUB 1RFKA 2HTHA 2M1MA 4L2YA 4C4VA 2ZW1A 2MCNB 1AARA 4E74A 1MJDA 3U8ZA 2KQ4X 4WH4A 2WXFA 1E6EB 1C9FA 2N7JA 1TKEA 4M0WA 4B95A 4USAA 3ZQ4A 1K51A 2O2VA 1EF1A 1NVID 2W54A 5EE9A 1YJIA 1WSPA 2WXJA 5H92C 2E3TA 2OEDA 4ZDVA 2WXHA 5H8YE 2EMTA 2MX2A 1WJ6A 2K1FA 3AE7B 3DQVA 2LEKA 2J42A 3BVZA 2CS4A 2Z8LA 1MI0A 1WRDB 3PGEA 3RYTA 5BO4B 2KT7A 4I6NB 2DNFA 1QILA 1C3TA 3Q3OC 1KH0A 4L23A 5L95C 2XK5B 2IO1B 2MWSB 1OQRA 4DQOC 1FRRA 3L0WB 2RPVA 2JT4B 4LJPB 1OFFA 3LYYA 4ITKA 2ON8A 5HKHA 2AQ3B 2K8HA 1IUEA 2JQRB 1UGMA 4B9KA 3Q8AA 2JRHA 1UD7A 2DZJA 2BT6A 1WIAA 2WXQA 1TTNA 5LXIB 4WWMA 3NY5A 2L52A 3AEBB 3RN9C 4HPMB 3P4SB 3AB5A 1PUTA 4FULA 4LNOA 4REZA 1C78A 1VD2A 1YIWA 4II3B 3NVVA 2N4FA 4K1RB 5D2MB 2KAJA 1TZ1A 2JUOA 1LGRA 2K6DB 4OZBA 1UBIA 1EF5A 4MGYE 3IAM1 1L6UA 1WXSA 2QJLA 1EM7A 1TBEA 3ZTCA 2N7EA 1SE4A 1XLNA 3FKYA 2LGSA 3PTFC 2UU7A 3NUHB 3ZW3A 3PLVA 2HJ1A 2LRUA 4OVVA 3AEEB 2QILA 4E3CA 1L4ZB 5D6JB 3BYYB 4RM9A 4OVZA 4BKGA 2BYEA 4IG7B 4LTUA 2L76A 5LXHA 1N6ZA 2WXRA 4M0WB 4PYUA 3HVDA 1ZOYB 2JZ3B 1L6VA 3AE3B 1I4QA 1Y8RC 4ZRQA 3T8MA 3AEAB 2KACA 2VH1A 3JW0X 2ONQA 3UF8A 5FR6A 1HTQA 1DYQA 2H89B 3P42A 1AN8A 2IZVB 2G4DB 2ZEQA 1Q10A 2KDEB 3N9YC 4W9GA 2MQJA 4B0EA 4YTNB 1KRHA 1QLBB 1TJEA 4J6IA 1Z5SB 2LVOA 2IO0B 2LFIA 4RMAA 4AUQC 4G0NB 2W55A 2WGSA 3ZLZA 1CMXB 4URKA 2KFJA 3WA0A 1XLPA 1TY2A 2RDHA 1K52A 5KHQA 2WXOA 3H7PA 3K9OB 2I1KA 1JWUD 3HK0A 3ZRCA 4KDIC 3N1XC 2KDFB 1V97A 3L16A 3PHXB 3PVLA 2CJOA 3B2GA 4ZHOA 1ZPSA 4NAWA 2PIAA 3MC0B 2ZVOA 2GB1A 3FC4A 2LVQA 1F9JA 4ZRPA 2ZNVC 5G55A 1WR1A 4P6VF 3FILB 4JE3B 3AU5A 3DWGC 3H1UA 5HI1A 1WX8A 1SXTA 3EA6A 2LHEA 3HM6X 4KV2A 4BBNF 3V60A 1WYWB 3W1SA 4IWPA 1LM8B 5HFYA 3QJZA 4BFRA 5C1ZA 3N1ZC 1E8YA 2MP2B 3ZXVA 2BS3B 3RNGC 1IP9A 1ET9A 1D5ZC 4X57B 4NAMA 4DXGA 2OOBB 1BXTA 4BBNC 4YTMB 2CU1A 3DHIC 1HXYD 2J53A 1WFYA 1D5XC 2FE8A 3NVZA 2CHZA 3HIZA 3KUCB 1WE6A 3ZUNA 3VHTC 4EEWA 4P1CC 4H2AA 3J9CA 1RRBA 1WXQA 3IAS1 4TMAB 2VH2A 1WGHA 4GXBA 4KX6B 1D4BA 1TZOA 3TJPA 4MGIE 1VJKA 4F8CB 2NTTA 3EHVA 1C4AA 1PGBA 3MHSD 4IWOA 3AE6B 1TY0A 1N61A 2BQQA 2NPTA 1E8XA 1JWAD 3RNAC 3ZDTA 4K3BA 4GDLB 4W9EA 1FEHA 1T0QC 4MEMA 3CMMB 2MBQA 4FLHA 1R4NB 1KLUD 1C77A 1JALA 2B3AA 3NVYA 3TCAA 4LCDE 1OEYJ 4MGZE 3VXWA 5IN7A 3VRBB 3NS1A 3DVGX 1TS5A 1YOVB 4MACA 2EKEC 3I57A 4HKQA 1B9RA 4K81A 3H7PB 4XWTA 4ZRJA 4PT5A 4WWPA 1KOTA 1YQ4B 1JMLA 2LXCA 1YMHE 2Y5PA 4NAWB 1NBFC 3V6EB 2LMCA 2J7QB 2AL3A 1HQRD 3B1LX 3PREA 1YQ3B 1DOXA 3ZIMA 4W9KA 3GE8C 1RLFA 4JIOU 4LLGM 4NQLB 1J7CA 3Q3NC 3TL5A 3ECIA 2JY6A 1CQVA 1V6EA 3WAMA 2WXNA 3V05A 4ARIA 2C60A 4C7ZA 3EC8A 4MM3A 2KQSA 4HCPB 4HCNB 4HLEA 1R4NI 5GMVA 4C00A 3W1SC 3Q3MC 4ZOHC 3N30A 1V9JA 1FD6A 4HKZE 5JH5C 3FAHA 4EOYA 1SSNA 3A9KB 2JZPA 2BKFA 4OVUA 1FCCC 3ML9A 4WWOA 3ZJVA 3OWEB 2PTLA 2G9HD 1WJ4A 1I4HA 1QQRA 1Q5WB 1UNSA 2PMVA 4WIPA 2GBMA 2QMTA 4XZ4A 2DYOA 2JX5A 2QHOA 1AWDA 1RYJA 2M4NA 1I42A 4DXFA 3N3KB 2K0PA 2KTRA 1F1HA 1CZPA 4II2B 1EUVB 1LO5D 1RM6C 2NPTB 1ACCA 2NBUA 4RGOS 1V5OA 2JXXA 2DENB 4FADA 2VZKD 1E9MA 2X8XX 3MC8A 1P0RA 3KH0A 2A4ZA 3AI5A 1ZXIA 1F2RC 3H8HA 4K7SA 4BKTA 1KLGD 1GC7A 2XN9C 1T3QA 5EE1A 4GDKA 2CKHB 2ZVNA 2AX5A 4BKSA 3IG3A 3Q8EA 2MW5A 1WE7A 2O6VD 1FFVA 4XWWA 3NZSA 3O65B 3JSVB 4HDOA 2AQ2B 1XD3B 2GBKA 4MJSA 1V1OA 2N9KA 4G50A 2L3ZA 3CIRB 4IDIA 1PDXA 4A90A 4CYEA 4XX5A 1NENB 5E6JA 2BB6A 3SEBA 1YN5A 2Z59B 4EE2A 2MSED 3R3MA 4FHKA 1EU3A 2ZJDA 1AW7A 3P4QB 2D2QA 3P4PB 2B76B 2HJ8A 4LNNA 3RI7C 4WWNA 2LUEA 1T5XD 3URYA 1JRUA 4KGSA 1SJED 4BOZB 2QSDA 2CR5A 1E7PB 1WWTA 2W9NA 1C4PA 1P1AA 4WJPA 2QC8A 1WGRA 4XE0A 2ZCCA 5CHWA 3BVGA 2KANA 3A9JB 1GOZA 4IUMB 3KYDD 3HM3A 4RCOA 2XEWA 3QK0A 4M8MA 3U7DA 1JWMD 3DOWA 1ZE3D 2HE7A 1RFAA 3PZ8A 3EUB2 4AJWA 1VZ8A 2L0FA 1ZDVA 4NJCA 2K9XA 4RM8A 1K53A 2Y5CA 1MG4A 2AEHA 2N1VA 4KZ0A 3SFDB 4GGQA 4ZYSA 3VVWB 1L0VB 3A1QB 4ZYNA 1UZXB 4YSXB 4OW0A 2LZ6A 2N7DA 2KN4A 2BKRB 2SAKA 2DAJA 3VR8B 4ANUA 4JGHB 4JX1C 2BYTA 5L83A 4ZRIA 1ESFA 4W9FA 1GB1A 3GOEA 1JWBD 3UI3A 1N60A 3A4RA 1N5XA 4M00A 1I4RA 2MJDA 2WX0A 2JXTA 2M8SA 1YX5B 1XLOA 2UWQA 2CHWA 3Q2AC 3NHEB 3AE1B 2IYDB 3APDA 3DVNU 2IPKD 3C19A 2M19A 1NYQA 2ACZB 5LLIA 3TEYA 1T0SC 2KDBA 4IC7B 1L0XB 4PS8A 3BK2A 2BWES 3UGBB 4GIVA 2R2QA 2LASA 3L4PA 3O13A 3WCQA 1J7BA 3DBRB 4XC2A 2O6VA 4PS3A 2KJHB 3ZVVA 1WH3A 2KHWB 3HVZA 4CHKA 1E7VA 3R2IA 1OEYA 5G2NA 2V9HA 1I35A 4G3XB 5BYQA 3BK1A 2WXIA 3NVWA 2ICIA 3UQAA 3KYCD 1HZ6A 1V5TA 4HWIB 4C4VB 3M63B 3R7QA 3DHGC 4EFOA 2MA9B 3VUYA 1WMHA 2LUMA 2NVUI 2WDQB 1C1YB 1V1PA 2MHJA 2RGFA 4FJZA 2DYMA 3WANA 3ZNGC 3QHTA 3MTNB 3QARA 1M94A 3W9CB 3Q3JA 2LWPA 3RPFC 1IBXA 3ZXRA 2O2VB 3NRZA 4HEA1 2ZPYA 4FJYA 4A3PA 1WY8A 3DBRI 4ACFA 1VRAB 4YSZB 3BWUD 3P1MA 3DPDA 4DHZE 2ASQA 2BWFA 1L7YA 4BAXA 3T3NA 3W5UB 4AQ7A 2INDC 2QCZA 5KHOA 1ISNA 2EELA 1N63A 3DVNV 1UH6A 2DAFA 2M17A 2K8CA 5JHBA 1WJNA 4GSWA 2KDMA 1E8ZA 4JWUC 2H88B 4IM0A 4RGNA 2VZKB 4A55A 1CJEA 4ARCA 3EECA 1BUIC 1D6EC 2DX5B 1UBQA 2NMQA 2REXA 1H8CA 3LJ3A 2ZNVB 1SIJA 3KWLA 3U7ZA 1KF6B 4WJQA 2KFKA 3PLUA 3MC9A 4OHJA 3PRMB 3R2TA 2YEPF 3N20C 2ZZPB 4N6EB 1F77A 3AH7A 3RULA 5AEKB 1FO4A 4GMVA 2K39A 3TUOA 3ZNZB 2O6VB 1Q0WB 3KW5B 3PO0A 2BBCA 2N0SB 2KKCA 3AXCA 3ALBA 1RWSA 2HTME 2YLMA 2QIEB 2KNBA 4MDKE 4DWFA 1QOAA 3GP7A 4NY0A 2RDBC 1IYFA 4FN2A 1F52A 2LVPA 1UUPA 2N9EB 1QT9A 4JPSA 2CJNA 3RNCC 4DDGD 4A3OA 4AS1A 3ZO5B 1WMHB 4CO7A 2KDIA 1XF5L 4BOSC 4C80A 4BKSD 5C3JB 2LGDA 3MJWA 5EE0A 2MBHA 3TEWA 1HA5A 4IKGA 1J7AA 1E0ZA 4KDLB 3RUIB 4HK2A 1XT9B 3C8YA 4LDTD 1GUAB 4N59A 1WR6E 1NYRA 2V1YA 2WX1A 3ZYYX 1IGDA 4FBJB 3AM9A 2K3UA 1RAXA 2KZRA 3VQIA 2QDFA 5IOIA 3HRDD 2KQ7A 2Y5BB 1YX6B 2LGIA 3RNEC 1JWSD 1BT0A 1YJ1A 1YD8U 3AEDB 4DHJD 3TIXA 1MPEA 3KWVA 1XQQA 2Q5WD 4DK5A 2KVZA 3M62B 4US9A 3SU8X 3T3OA 4C56C
chains in the Genus database with same CATH topology
4ANWA 3IG3A 2CS4A 3S2AA 1GG3A 1V86A 2RSUA 1WI0A 3OJ3A 3TBLD 3B08A 2MW5A 3QQ8B 3RD2A 3VH4B 4KVGB 1WE7A 2O6VD 1WRDB 3IBEA 3PGEA 3RYTA 5BO4B 3NZSA 1WGGA 2FCQA 3O65B 3JSVB 4HDOA 4I6NB 1C3TA 1NI2A 1P9DU 5L95C 3HHMA 4I6LB 1G6JA 2XK5B 1XD3B 2GBKA 4MJSA 3VAWA 2IO1B 2MWSB 3VFKA 3L0WB 4G50A 2L3ZA 2VRRB 2JT4B 2ZCBA 5IA7A 4LJPB 3B0AA 1MG8A 4CYEA 4XX5A 2KJ6A 1WX7A 1L2NA 3VTVA 5HKHA 4EUTA 2IO3B 2Z59B 2K8HA 2MSED 3RZFA 4I6PA 3R3MA 4FHKA 5AZHA 3L13A 1UGMA 1E5WA 2ZJDA 4B9KA 2NS5A 2V3SA 2JRHA 3PRZA 2WYQA 3RCZA 3QAQA 1UD7A 2D2QA 2DZJA 4A20A 2HJ8A 4WWNA 1WIAA 2KX3A 2LUEA 1TTNA 1KLVA 5LXIB 3NY5A 4MSMB 2KD0A 2LGXA 2L00B 4HPMB 1JRUA 4FULA 1Q1OA 3K9PB 4BOZB 2JF5A 2G45B 1VD2A 4ANXA 1YIWA 2CR5A 4II3B 4HVBA 2N4FA 1TGZB 2M0XA 3BY4B 3WAPA 4JQWC 1V49A 4AWJA 1EO6A 2GBNA 2W9NA 4K1RB 2GBRA 4GB9A 2NBWB 5D2MB 1OGWA 2KOXA 1TZ1A 2JUOA 1P1AA 1Z2MA 4WJPA 1WGRA 3IFWB 2K6DB 1UBIA 1EF5A 2L7RA 2N9XA 4MGYE 1WXSA 4K7UA 2ZCCA 1TBEA 5CHWA 3H6NA 3R66C 5IAAC 1OTRB 3OJ4B 2KANA 2XBBC 3A9JB 3ZTCA 2MRPA 2N7EA 4IUMB 5CTRC 1IPGA 4IM2A 4W9JA 3KYDD 1E7UA 4GN1A 2IY1B 2BGFA 3A9KA 3HM3A 3PTFC 2GBJA 2XEWA 3PLVA 3QK0A 2LRUA 3ZW3A 3WAOA 4M8MA 4OVVA 3U7DA 3DOWA 3IVFA 2C5LC 2RD0A 1GNUA 3PZDA 4GU2A 3L17A 2HE7A 4E3CA 1RFAA 4AJWA 1WXMA 4W9CA 5D6JB 3TMPB 2L0FA 3ZDMC 4RM9A 4PYZA 3L08A 1E8WA 4BKGA 1T0YA 2BYEA 2G3QB 2KK8A 2DYBA 4IG7B 4RM8A 2L76A 3VDZA 5LXHA 4M0WB 2V4LA 3EFUA 3P2BA 4PYUA 4EZLA 2AEHA 2N1VA 4KZ0A 4GGQA 2JZ3B 4GOCA 3VVWB 2BPSA 3A1QB 4ZYNA 2JPHA 1UZXB 3UIPB 1Y8RC 3T8MA 2LZ6A 2N7DA 2RPQA 4ANVA 2L05A 2KVRA 2BKRB 1OQYA 4BVUC 3JW0X 3PHWB 2GOWA 3PT2B 3PSEB 2DAJA 2K8BA 5AZGA 2AL6A 3UF8A 5FR6A 4AP4C 4KSLC 2D11A 3VUWA 2KC2A 4ANUA 2G4SA 4JGHB 2IZVB 2G4DB 2ZEQA 2KDEB 3KVFB 3C0RB 4W9GA 1QZEA 4G11A 5L83A 2MQJA 4ZRIA 5E6OA 4W9FA 2CHXA 2JRIB 3GOEA 4DHZB 3V6CB 2DZKA 5J18A 1KM7A 4KSKC 3QX1A 1KJTA 4J6IA 2AYOB 1Z5SB 2KWVB 2LVOA 2IO0B 2KLGA 3X23A 3D32A 3A4RA 3N32A 3NS8A 4HDQA 2D07B 4RMAA 4AUQC 4G0NB 4NPNA 3PRPB 5DPRA 2KFKB 3ZLZA 1CMXB 2WX0A 4URKA 2IO2B 2KN5A 2KFJA 2YVCA 4JLCA 3WA0A 2M8SA 5CHVC 1LXDA 1YX5B 2R2OA 5KHQA 1ZKHA 1FXTB 1V2YA 2UWQA 3H7PA 2N9PC 3K9OB 2I1KA 4F7ZA 3HK0A 3ZRCA 5DPTA 4KDIC 3WIMA 2CHWA 3DVGY 4EZKA 3LDZE 3NHEB 2KDFB 1X1MA 3L16A 2IYDB 3PHXB 2C9WB 3PVLA 3JSVA 3APDA 4GDLA 3DVNU 5JHAA 1UELA 2MBBB 4NAWA 4B6WA 2KLCA 2WDTB 2XK5A 2ZVOA 4AOFA 2JVCA 5CX3A 2PEAA 2NCNA 2LVQA 1F9JA 2J0MA 3QIJA 2LRWA 2ZNVC 2KDBA 4IC7B 2KC1A 5LLIA 4PS8A 5G55A 1WR1A 2FAZA 2KWUB 3DDCB 2BWES 2PE9A 1P98A 4KIKA 3AU5A 3UGBB 4GIVA 3H1UA 4F1SA 2R2QA 2LASA 2FIDA 4ASWC 2K6QA 1WX8A 3KUDB 2BF8B 4XC2A 2O6VA 3HM6X 4KV2A 4PS3A 4BBNF 2KJHB 4W9DA 3ZVVA 2FUHB 3V60A 3X0WA 1WYWB 3APCA 1WH3A 3W1SA 4IWPA 4WJNA 2KHWB 3H9DA 3QA8A 5AZFA 1LM8B 1V81A 3AU4A 4CHKA 3QCAA 2FNJB 3QJZA 4BFRA 1E7VA 1YQBA 4HXDA 5C1ZA 1E8YA 3PS6A 1OEYA 2MP2B 2EMSA 5G2NA 4TUUA 5DPWA 3UIOB 1IP9A 4M8NA 3ZNID 4X57B 4MGKE 3CF6E 2OOBB 2KTFA 1I35A 3DBHI 4G3XB 4BBNC 3VH3B 2CU1A 1WM2A 3L54A 1WFYA 3UQAA 2A5UA 3KYCD 3A33B 1V5TA 4HWIB 5C23A 2KTRB 3M63B 4W9LA 3R7QA 4WAAA 2HD5B 4EFOA 2CHZA 2MA9B 3HIZA 3KUCB 4K7WA 1WE6A 1A5RA 4ICVA 4EZJA 3ZUNA 3VUYA 1WMHA 1WZ0A 2NVUI 3VHTC 4EEWA 1C1YB 4TV3A 3U30A 4MH0E 2KMAA 2RGFA 2PJHA 1V80A 1WXAA 4FJZA 2DYMA 3WANA 1RRBA 3ZTDA 3ZNGC 4NNJB 3QHTA 1WJUA 2D10A 3A4SC 3MTNB 3QARA 3UINB 1D3ZA 4IM3A 2LGYA 3A9JA 1M94A 2C7NB 2KJRA 2PPHA 5J17A 5D7GA 1WGHA 2LWPA 3Q3JA 4GXBA 4W9HA 5CHFA 2O2VB 3TJPA 4MGIE 4F8CB 3EHVA 2RR9A 2PE6B 2ZPYA 2L0TA 3MHSD 4FJYA 4IWOA 4DBGA 2NBVB 4A3PA 3VTUA 1WY8A 2NPTA 2OJRA 3ZKJC 3DBRI 2C7HA 2WWZA 4GDKB 3SHQA 1E8XA 2IBIB 1WX9A 3DPDA 4DHZE 3APFA 3ZDTA 2ASQA 2BWFA 2DZMA 2NR2A 4GDLB 4PS7A 4W9EA 2MLBA 1L7YA 4TQ1A 4MEMA 3CMMB 3DCGA 3JVZX 4AJYB 2MBQA 4FLHA 2DZIA 3A1QA 1SE9A 1HE8A 2AWTA 2B3AA 3TCAA 1SIFA 1OEYJ 3PV1A 4LCDE 4MGZE 5KHOA 1ISNA 4LDTB 2Z0DB 4EKUA 2UYZB 1J19A 3R7RA 3VXWA 3DVNV 3DVGX 1UH6A 2DAFA 3VUXA 2LD9A 4MJSB 2M17A 2KWCA 2IY0B 3OAWA 1K8RB 2BYFA 2K8CA 4FA6A 5JHBA 2J0KA 1WJNA 2EKEC 4GSWA 2I1JA 1WF9A 3ZNHB 3ZRFA 2LI5A 1E8ZA 4K81A 4IM0A 3DBSA 3H7PB 1NDDA 4ZRJA 4WWPA 2L8JA 1KOTA 1R4MI 4NQKE 1ZW7A 4JL9A 2LXCA 4MELA 5E6NA 3EECA 2DX5B 1UBQA 5J2RA 5D94A 3AULA 2REXA 4NAWB 1P3QU 1H8CA 3LJ3A 1NBFC 2ZNVB 4DXAB 2BYVE 3V6EB 4DHJB 3WALA 4HPLB 2J7QB 4KZCA 2AL3A 5DPSA 4TQ0A 3I3TB 3M3JA 2KFKA 3B1LX 3PLUA 2KXJA 3PREA 4WJQA 4DDID 3PRMB 4WJOA 4IWQA 3QWZB 2ZZPB 3ZIMA 3RZWC 3PPAA 4W9KA 3RULA 4NQLB 1RLFA 4JIOU 3IHPC 1WGDA 3ONSA 4KIKB 5AEKB 4GMVA 2K39A 2GMIC 3ECIA 4YL8A 2JY6A 3TL5A 3V62A 1J0GA 3CSFA 4NJ6A 3ZNZB 1V6EA 3CSTA 3BINA 3WAMA 2O6VB 1Q0WB 3KW5B 2C60A 3DBLI 2FCSA 5TR5A 3EC8A 4MM3A 2KQSA 4HCPB 2KKCA 4FHJA 4HCNB 4HLEA 1WZ3A 1R4NI 3AXCA 4ICUA 5E6PA 3ALBA 5GMVA 2N1WA 3W1SC 2YLMA 4FJVB 2KNBA 2D3GA 4MDKE 4NJ7A 4TKNA 4DWFA 1S1QB 4NY0A 3N30A 3UQBA 3KUZA 2K25A 1V9JA 1GJZA 1IYFA 3SD5A 5JH5C 4FN2A 2LVPA 1VCBA 2DHZA 1S3SG 2C7MB 2N9EB 2Z0EB 4EOYA 2FCNA 5EDSA 4HJKA 2JZZA 3ENEA 3A9KB 1U4AA 4W9IA 4DDGD 1LQBA 4A3OA 2BKFA 3ZO5B 2KMCA 2FIFA 4E71A 4OVUA 3L10B 3ML9A 4IW0A 1WMHB 3M95A 4WWOA 1WXVA 3V61A 1WGYA 3Q3FA 4ZRKA 4CO7A 2KDIA 4BOSC 3NZUA 1WJ4A 2MP2A 3GZNI 4BKSD 2LGDA 3MJWA 1LFDA 2MBHA 1Q5WB 4N9F4 1WM3A 2KO3A 5JZEB 2LXAA 2GBMA 2FCMA 1PQSA 4XZ4A 2DYOA 4P7IA 1H4RA 4KDLB 2J0JA 2QHOA 3RUIB 1J8CA 2M4NA 1ZGUB 1XT9B 4HK2A 1I42A 3W1YA 1GC6A 4LDTD 4WQOB 1GUAB 2HTHA 2M1MA 3N3KB 3H7SA 3RT3B 1WR6E 2KTRA 2V1YA 2WX1A 2MCNB 1AARA 4E74A 2LJ5A 4II2B 1EUVB 1E90A 2NPTB 5DCNA 4FBJB 2MBEA 3U8ZA 2NBUA 1RAXA 1V5OA 2JXXA 2DENB 4FADA 3JYUA 2KZRA 3VQIA 3NOBA 3VTWA 1P0RA 3KH0A 2KX0A 1SGHA 4B95A 2KQ7A 2ZPNA 2A4ZA 1YX6B 2Y5BB 3AI5A 2JWZA 1BT0A 4K7SA 3T9LA 4BKTA 1YJ1A 2O2VA 1GC7A 1YD8U 3SDLC 1EF1A 3OLMD 4DHJD 3TIXA 3ML8A 4MSQB 1XQQA 4LJOB 4DK5A 4GDKA 4ZDVA 2CKHB 2ZVNA 3M62B 2MBOA 3SU8X 2EMTA 2MX2A 1WJ6A 2K1FA 4BKSA 3DQVA 3QC8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANW A;  3IG3 A;  2CS4 A;  3S2A A;  1GG3 A;  1V86 A;  2RSU A;  1WI0 A;  3OJ3 A;  3TBL D;  3B08 A;  2MW5 A;  3QQ8 B;  3RD2 A;  3VH4 B;  4KVG B;  1WE7 A;  2O6V D;  1WRD B;  3IBE A;  3PGE A;  3RYT A;  5BO4 B;  3NZS A;  1WGG A;  2FCQ A;  3O65 B;  3JSV B;  4HDO A;  4I6N B;  1C3T A;  1NI2 A;  1P9D U;  5L95 C;  3HHM A;  4I6L B;  1G6J A;  2XK5 B;  1XD3 B;  2GBK A;  4MJS A;  3VAW A;  2IO1 B;  2MWS B;  3VFK A;  3L0W B;  4G50 A;  2L3Z A;  2VRR B;  2JT4 B;  2ZCB A;  5IA7 A;  4LJP B;  3B0A A;  1MG8 A;  4CYE A;  4XX5 A;  2KJ6 A;  1WX7 A;  1L2N A;  3VTV A;  5HKH A;  4EUT A;  2IO3 B;  2Z59 B;  2K8H A;  2MSE D;  3RZF A;  4I6P A;  3R3M A;  4FHK A;  5AZH A;  3L13 A;  1UGM A;  1E5W A;  2ZJD A;  4B9K A;  2NS5 A;  2V3S A;  2JRH A;  3PRZ A;  2WYQ A;  3RCZ A;  3QAQ A;  1UD7 A;  2D2Q A;  2DZJ A;  4A20 A;  2HJ8 A;  4WWN A;  1WIA A;  2KX3 A;  2LUE A;  1TTN A;  1KLV A;  5LXI B;  3NY5 A;  4MSM B;  2KD0 A;  2LGX A;  2L00 B;  4HPM B;  1JRU A;  4FUL A;  1Q1O A;  3K9P B;  4BOZ B;  2JF5 A;  2G45 B;  1VD2 A;  4ANX A;  1YIW A;  2CR5 A;  4II3 B;  4HVB A;  2N4F A;  1TGZ B;  2M0X A;  3BY4 B;  3WAP A;  4JQW C;  1V49 A;  4AWJ A;  1EO6 A;  2GBN A;  2W9N A;  4K1R B;  2GBR A;  4GB9 A;  2NBW B;  5D2M B;  1OGW A;  2KOX A;  1TZ1 A;  2JUO A;  1P1A A;  1Z2M A;  4WJP A;  1WGR A;  3IFW B;  2K6D B;  1UBI A;  1EF5 A;  2L7R A;  2N9X A;  4MGY E;  1WXS A;  4K7U A;  2ZCC A;  1TBE A;  5CHW A;  3H6N A;  3R66 C;  5IAA C;  1OTR B;  3OJ4 B;  2KAN A;  2XBB C;  3A9J B;  3ZTC A;  2MRP A;  2N7E A;  4IUM B;  5CTR C;  1IPG A;  4IM2 A;  4W9J A;  3KYD D;  1E7U A;  4GN1 A;  2IY1 B;  2BGF A;  3A9K A;  3HM3 A;  3PTF C;  2GBJ A;  2XEW A;  3PLV A;  3QK0 A;  2LRU A;  3ZW3 A;  3WAO A;  4M8M A;  4OVV A;  3U7D A;  3DOW A;  3IVF A;  2C5L C;  2RD0 A;  1GNU A;  3PZD A;  4GU2 A;  3L17 A;  2HE7 A;  4E3C A;  1RFA A;  4AJW A;  1WXM A;  4W9C A;  5D6J B;  3TMP B;  2L0F A;  3ZDM C;  4RM9 A;  4PYZ A;  3L08 A;  1E8W A;  4BKG A;  1T0Y A;  2BYE A;  2G3Q B;  2KK8 A;  2DYB A;  4IG7 B;  4RM8 A;  2L76 A;  3VDZ A;  5LXH A;  4M0W B;  2V4L A;  3EFU A;  3P2B A;  4PYU A;  4EZL A;  2AEH A;  2N1V A;  4KZ0 A;  4GGQ A;  2JZ3 B;  4GOC A;  3VVW B;  2BPS A;  3A1Q B;  4ZYN A;  2JPH A;  1UZX B;  3UIP B;  1Y8R C;  3T8M A;  2LZ6 A;  2N7D A;  2RPQ A;  4ANV A;  2L05 A;  2KVR A;  2BKR B;  1OQY A;  4BVU C;  3JW0 X;  3PHW B;  2GOW A;  3PT2 B;  3PSE B;  2DAJ A;  2K8B A;  5AZG A;  2AL6 A;  3UF8 A;  5FR6 A;  4AP4 C;  4KSL C;  2D11 A;  3VUW A;  2KC2 A;  4ANU A;  2G4S A;  4JGH B;  2IZV B;  2G4D B;  2ZEQ A;  2KDE B;  3KVF B;  3C0R B;  4W9G A;  1QZE A;  4G11 A;  5L83 A;  2MQJ A;  4ZRI A;  5E6O A;  4W9F A;  2CHX A;  2JRI B;  3GOE A;  4DHZ B;  3V6C B;  2DZK A;  5J18 A;  1KM7 A;  4KSK C;  3QX1 A;  1KJT A;  4J6I A;  2AYO B;  1Z5S B;  2KWV B;  2LVO A;  2IO0 B;  2KLG A;  3X23 A;  3D32 A;  3A4R A;  3N32 A;  3NS8 A;  4HDQ A;  2D07 B;  4RMA A;  4AUQ C;  4G0N B;  4NPN A;  3PRP B;  5DPR A;  2KFK B;  3ZLZ A;  1CMX B;  2WX0 A;  4URK A;  2IO2 B;  2KN5 A;  2KFJ A;  2YVC A;  4JLC A;  3WA0 A;  2M8S A;  5CHV C;  1LXD A;  1YX5 B;  2R2O A;  5KHQ A;  1ZKH A;  1FXT B;  1V2Y A;  2UWQ A;  3H7P A;  2N9P C;  3K9O B;  2I1K A;  4F7Z A;  3HK0 A;  3ZRC A;  5DPT A;  4KDI C;  3WIM A;  2CHW A;  3DVG Y;  4EZK A;  3LDZ E;  3NHE B;  2KDF B;  1X1M A;  3L16 A;  2IYD B;  3PHX B;  2C9W B;  3PVL A;  3JSV A;  3APD A;  4GDL A;  3DVN U;  5JHA A;  1UEL A;  2MBB B;  4NAW A;  4B6W A;  2KLC A;  2WDT B;  2XK5 A;  2ZVO A;  4AOF A;  2JVC A;  5CX3 A;  2PEA A;  2NCN A;  2LVQ A;  1F9J A;  2J0M A;  3QIJ A;  2LRW A;  2ZNV C;  2KDB A;  4IC7 B;  2KC1 A;  5LLI A;  4PS8 A;  5G55 A;  1WR1 A;  2FAZ A;  2KWU B;  3DDC B;  2BWE S;  2PE9 A;  1P98 A;  4KIK A;  3AU5 A;  3UGB B;  4GIV A;  3H1U A;  4F1S A;  2R2Q A;  2LAS A;  2FID A;  4ASW C;  2K6Q A;  1WX8 A;  3KUD B;  2BF8 B;  4XC2 A;  2O6V A;  3HM6 X;  4KV2 A;  4PS3 A;  4BBN F;  2KJH B;  4W9D A;  3ZVV A;  2FUH B;  3V60 A;  3X0W A;  1WYW B;  3APC A;  1WH3 A;  3W1S A;  4IWP A;  4WJN A;  2KHW B;  3H9D A;  3QA8 A;  5AZF A;  1LM8 B;  1V81 A;  3AU4 A;  4CHK A;  3QCA A;  2FNJ B;  3QJZ A;  4BFR A;  1E7V A;  1YQB A;  4HXD A;  5C1Z A;  1E8Y A;  3PS6 A;  1OEY A;  2MP2 B;  2EMS A;  5G2N A;  4TUU A;  5DPW A;  3UIO B;  1IP9 A;  4M8N A;  3ZNI D;  4X57 B;  4MGK E;  3CF6 E;  2OOB B;  2KTF A;  1I35 A;  3DBH I;  4G3X B;  4BBN C;  3VH3 B;  2CU1 A;  1WM2 A;  3L54 A;  1WFY A;  3UQA A;  2A5U A;  3KYC D;  3A33 B;  1V5T A;  4HWI B;  5C23 A;  2KTR B;  3M63 B;  4W9L A;  3R7Q A;  4WAA A;  2HD5 B;  4EFO A;  2CHZ A;  2MA9 B;  3HIZ A;  3KUC B;  4K7W A;  1WE6 A;  1A5R A;  4ICV A;  4EZJ A;  3ZUN A;  3VUY A;  1WMH A;  1WZ0 A;  2NVU I;  3VHT C;  4EEW A;  1C1Y B;  4TV3 A;  3U30 A;  4MH0 E;  2KMA A;  2RGF A;  2PJH A;  1V80 A;  1WXA A;  4FJZ A;  2DYM A;  3WAN A;  1RRB A;  3ZTD A;  3ZNG C;  4NNJ B;  3QHT A;  1WJU A;  2D10 A;  3A4S C;  3MTN B;  3QAR A;  3UIN B;  1D3Z A;  4IM3 A;  2LGY A;  3A9J A;  1M94 A;  2C7N B;  2KJR A;  2PPH A;  5J17 A;  5D7G A;  1WGH A;  2LWP A;  3Q3J A;  4GXB A;  4W9H A;  5CHF A;  2O2V B;  3TJP A;  4MGI E;  4F8C B;  3EHV A;  2RR9 A;  2PE6 B;  2ZPY A;  2L0T A;  3MHS D;  4FJY A;  4IWO A;  4DBG A;  2NBV B;  4A3P A;  3VTU A;  1WY8 A;  2NPT A;  2OJR A;  3ZKJ C;  3DBR I;  2C7H A;  2WWZ A;  4GDK B;  3SHQ A;  1E8X A;  2IBI B;  1WX9 A;  3DPD A;  4DHZ E;  3APF A;  3ZDT A;  2ASQ A;  2BWF A;  2DZM A;  2NR2 A;  4GDL B;  4PS7 A;  4W9E A;  2MLB A;  1L7Y A;  4TQ1 A;  4MEM A;  3CMM B;  3DCG A;  3JVZ X;  4AJY B;  2MBQ A;  4FLH A;  2DZI A;  3A1Q A;  1SE9 A;  1HE8 A;  2AWT A;  2B3A A;  3TCA A;  1SIF A;  1OEY J;  3PV1 A;  4LCD E;  4MGZ E;  5KHO A;  1ISN A;  4LDT B;  2Z0D B;  4EKU A;  2UYZ B;  1J19 A;  3R7R A;  3VXW A;  3DVN V;  3DVG X;  1UH6 A;  2DAF A;  3VUX A;  2LD9 A;  4MJS B;  2M17 A;  2KWC A;  2IY0 B;  3OAW A;  1K8R B;  2BYF A;  2K8C A;  4FA6 A;  5JHB A;  2J0K A;  1WJN A;  2EKE C;  4GSW A;  2I1J A;  1WF9 A;  3ZNH B;  3ZRF A;  2LI5 A;  1E8Z A;  4K81 A;  4IM0 A;  3DBS A;  3H7P B;  1NDD A;  4ZRJ A;  4WWP A;  2L8J A;  1KOT A;  1R4M I;  4NQK E;  1ZW7 A;  4JL9 A;  2LXC A;  4MEL A;  5E6N A;  3EEC A;  2DX5 B;  1UBQ A;  5J2R A;  5D94 A;  3AUL A;  2REX A;  4NAW B;  1P3Q U;  1H8C A;  3LJ3 A;  1NBF C;  2ZNV B;  4DXA B;  2BYV E;  3V6E B;  4DHJ B;  3WAL A;  4HPL B;  2J7Q B;  4KZC A;  2AL3 A;  5DPS A;  4TQ0 A;  3I3T B;  3M3J A;  2KFK A;  3B1L X;  3PLU A;  2KXJ A;  3PRE A;  4WJQ A;  4DDI D;  3PRM B;  4WJO A;  4IWQ A;  3QWZ B;  2ZZP B;  3ZIM A;  3RZW C;  3PPA A;  4W9K A;  3RUL A;  4NQL B;  1RLF A;  4JIO U;  3IHP C;  1WGD A;  3ONS A;  4KIK B;  5AEK B;  4GMV A;  2K39 A;  2GMI C;  3ECI A;  4YL8 A;  2JY6 A;  3TL5 A;  3V62 A;  1J0G A;  3CSF A;  4NJ6 A;  3ZNZ B;  1V6E A;  3CST A;  3BIN A;  3WAM A;  2O6V B;  1Q0W B;  3KW5 B;  2C60 A;  3DBL I;  2FCS A;  5TR5 A;  3EC8 A;  4MM3 A;  2KQS A;  4HCP B;  2KKC A;  4FHJ A;  4HCN B;  4HLE A;  1WZ3 A;  1R4N I;  3AXC A;  4ICU A;  5E6P A;  3ALB A;  5GMV A;  2N1W A;  3W1S C;  2YLM A;  4FJV B;  2KNB A;  2D3G A;  4MDK E;  4NJ7 A;  4TKN A;  4DWF A;  1S1Q B;  4NY0 A;  3N30 A;  3UQB A;  3KUZ A;  2K25 A;  1V9J A;  1GJZ A;  1IYF A;  3SD5 A;  5JH5 C;  4FN2 A;  2LVP A;  1VCB A;  2DHZ A;  1S3S G;  2C7M B;  2N9E B;  2Z0E B;  4EOY A;  2FCN A;  5EDS A;  4HJK A;  2JZZ A;  3ENE A;  3A9K B;  1U4A A;  4W9I A;  4DDG D;  1LQB A;  4A3O A;  2BKF A;  3ZO5 B;  2KMC A;  2FIF A;  4E71 A;  4OVU A;  3L10 B;  3ML9 A;  4IW0 A;  1WMH B;  3M95 A;  4WWO A;  1WXV A;  3V61 A;  1WGY A;  3Q3F A;  4ZRK A;  4CO7 A;  2KDI A;  4BOS C;  3NZU A;  1WJ4 A;  2MP2 A;  3GZN I;  4BKS D;  2LGD A;  3MJW A;  1LFD A;  2MBH A;  1Q5W B;  4N9F 4;  1WM3 A;  2KO3 A;  5JZE B;  2LXA A;  2GBM A;  2FCM A;  1PQS A;  4XZ4 A;  2DYO A;  4P7I A;  1H4R A;  4KDL B;  2J0J A;  2QHO A;  3RUI B;  1J8C A;  2M4N A;  1ZGU B;  1XT9 B;  4HK2 A;  1I42 A;  3W1Y A;  1GC6 A;  4LDT D;  4WQO B;  1GUA B;  2HTH A;  2M1M A;  3N3K B;  3H7S A;  3RT3 B;  1WR6 E;  2KTR A;  2V1Y A;  2WX1 A;  2MCN B;  1AAR A;  4E74 A;  2LJ5 A;  4II2 B;  1EUV B;  1E90 A;  2NPT B;  5DCN A;  4FBJ B;  2MBE A;  3U8Z A;  2NBU A;  1RAX A;  1V5O A;  2JXX A;  2DEN B;  4FAD A;  3JYU A;  2KZR A;  3VQI A;  3NOB A;  3VTW A;  1P0R A;  3KH0 A;  2KX0 A;  1SGH A;  4B95 A;  2KQ7 A;  2ZPN A;  2A4Z A;  1YX6 B;  2Y5B B;  3AI5 A;  2JWZ A;  1BT0 A;  4K7S A;  3T9L A;  4BKT A;  1YJ1 A;  2O2V A;  1GC7 A;  1YD8 U;  3SDL C;  1EF1 A;  3OLM D;  4DHJ D;  3TIX A;  3ML8 A;  4MSQ B;  1XQQ A;  4LJO B;  4DK5 A;  4GDK A;  4ZDV A;  2CKH B;  2ZVN A;  3M62 B;  2MBO A;  3SU8 X;  2EMT A;  2MX2 A;  1WJ6 A;  2K1F A;  4BKS A;  3DQV A;  3QC8 B; 
#chains in the Genus database with same CATH topology
 4ANW A;  3ZJT A;  1GG3 A;  1WI0 A;  3OJ3 A;  3B08 A;  3QQ8 B;  3RFZ B;  3RD2 A;  1VR9 A;  3IBE A;  2V3N A;  1WGG A;  2FCQ A;  4ZHP A;  3MFG A;  1NI2 A;  1P9D U;  3HHM A;  4I6L B;  1G6J A;  1SF0 A;  4LNF A;  3VAW A;  2TSS A;  2R61 A;  3P4R B;  2ZCB A;  5IA7 A;  3EGR A;  3B0A A;  1SEB D;  3CWI A;  2KJ6 A;  1WX7 A;  1YJJ A;  5BMG A;  2RDG A;  2DLB A;  4EUT A;  4A8X C;  1XLQ A;  4I6P A;  2OJW A;  5AZH A;  3BVM A;  3PZ7 A;  2K5P A;  2NS5 A;  2V3S A;  3RCZ A;  2WYQ A;  3QAQ A;  1BML C;  4A20 A;  1QF6 A;  2KX3 A;  1KLV A;  3AEG B;  2JU6 X;  4HRS A;  2KD0 A;  3Q8B A;  3B9J A;  3EFC A;  2JF5 A;  2G45 B;  1TGZ B;  2M0X A;  1FRD A;  4JQW C;  1V49 A;  1EO6 A;  3GE3 C;  2NTS A;  2GBR A;  2NBW B;  4S17 A;  3AE9 B;  1Z2M A;  3IFW B;  1L5P A;  2L7R A;  2WDV B;  1XCQ L;  4K7U A;  3H6N A;  3R66 C;  5IAA C;  1OTR B;  2XBB C;  2CU3 A;  5CTR C;  1IPG A;  4W9J A;  4GN1 A;  2IY1 B;  2GBJ A;  3WAO A;  1EWY C;  3IVF A;  2C5L C;  2RD0 A;  3PZD A;  4GU2 A;  3TMP B;  1VDV A;  3ZDM C;  5BMH A;  1B1Z A;  4PYZ A;  1T0Y A;  1HTO A;  2G3Q B;  5HG2 A;  3GB1 A;  5BMI A;  3P2B A;  1GB4 A;  4EZL A;  4GOC A;  2BPS A;  1FXA A;  2JPH A;  3KQ4 A;  2RPQ A;  4ANV A;  3U52 E;  1OQY A;  3PHW B;  3Q8F A;  4AP4 C;  5AZG A;  1TYG B;  4KSL C;  2D11 A;  2WXM A;  2KC2 A;  2ZW0 A;  3ZJU A;  2G4S A;  1VZ6 A;  1KFY B;  2IGD A;  3ABV B;  1AYF A;  3C0R B;  3HUI A;  3KVF B;  3VR9 B;  4G11 A;  4RNA A;  5E6O A;  3Q14 C;  2JRI B;  5J18 A;  2DZK A;  3QX1 A;  1KJT A;  1HZ5 A;  2IDY A;  2KWV B;  1VLB A;  3V3X A;  3X23 A;  3N32 A;  2MEK A;  4NPN A;  2KYW A;  1FMA D;  1V8C A;  3PRP B;  1FCL A;  1I4P A;  5DPR A;  2DWQ A;  3RNB C;  2IO2 B;  1C76 A;  2YVC A;  4JLC A;  2K22 A;  2RMM A;  5CHV C;  3OG5 A;  1FXT B;  1V2Y A;  3WIM A;  3DVG Y;  2WLB A;  4EZK A;  3LDZ E;  4KGR A;  1X1M A;  2IGH A;  1TS4 A;  1F2R I;  2V4I B;  3TEX A;  1UEL A;  2MBB B;  4LNK A;  4MM3 B;  2KLC A;  2XK5 A;  4P1B C;  2JVC A;  5CX3 A;  2NCN A;  2LRW A;  2KC1 A;  1PFD A;  1L4D B;  2KWU B;  4B0M A;  3P63 A;  3U2S C;  2K6Q A;  3KUD B;  5AUI A;  2BF8 B;  4KGT A;  1N62 A;  4W9D A;  3N1Y C;  3H9D A;  1V81 A;  3QCA A;  1TKY A;  1YQB A;  3PS6 A;  2PKO A;  4WQM A;  1EWC A;  1YN4 A;  2EMS A;  1QOG A;  4UDU C;  4TUU A;  5DPW A;  4M8N A;  4HRO A;  1P7F A;  3CF6 E;  3L54 A;  2INC C;  4R3D A;  3A33 B;  2KTR B;  2HD5 B;  4NZL B;  2BS4 B;  4K7W A;  1A5R A;  2BVC A;  2OHF A;  1WZ0 A;  4TV3 A;  4MH0 E;  4LK0 M;  1IGC A;  2PJH A;  1TS2 A;  2FBW B;  2BS2 B;  2L83 A;  4NNJ B;  1WJU A;  2D10 A;  1D3Z A;  2LGY A;  3Q69 A;  2PPH A;  5D7G A;  4W9H A;  5CHF A;  3I63 C;  3W2D A;  1TIF A;  1FFU A;  2PE6 B;  1YN3 A;  3VTU A;  2OJR A;  2WWZ A;  4GDK B;  2WDR B;  2IBI B;  4RGT A;  1WX9 A;  2JYE A;  3APF A;  2NR2 A;  2DBY A;  2MLB A;  3RNF C;  3DCG A;  3JVZ X;  4AJY B;  3AN1 A;  2DZI A;  2AQ1 B;  1HE8 A;  2LHD A;  1SB3 C;  4LDT B;  2Z0D B;  2D3A A;  3R7R A;  1J19 A;  2SEB D;  2WXL A;  4O1N A;  2D5G A;  4MJS B;  2KWC A;  2L1A A;  3OAW A;  1K8R B;  2BYF A;  4J3O D;  4FA6 A;  4FXC A;  1DOI A;  2I1J A;  1WF9 A;  4JWS C;  3ZRF A;  3DBS A;  2L8J A;  1T6B X;  3MHZ A;  2WNM A;  4JL9 A;  2LJI A;  5T8I A;  1WRI A;  5J2R A;  1P3Q U;  1WGK A;  3GZN B;  4HJG E;  4QAY A;  4Q2J A;  2BYV E;  3DWM A;  1UWX A;  4DHJ B;  3WAL A;  4KZC A;  1PYW D;  3ETR A;  5DPS A;  3M3J A;  4DDI D;  2KXJ A;  1GPX A;  1XXG A;  4IWQ A;  1MFW A;  5D3D A;  3RZW C;  4OZA A;  3V62 A;  4WUR A;  4YL8 A;  1ZP0 B;  3BIN A;  3CST A;  3BII D;  3MJ5 A;  2WS3 B;  2GI9 A;  3ZGZ A;  5TR5 A;  2D3B A;  4FHJ A;  2L32 A;  4XDD A;  4ICU A;  5E6P A;  3AE4 B;  2N1W A;  4TKN A;  3GS2 A;  3UQB A;  3KUZ A;  1GJZ A;  3FIL A;  1S3S G;  2FCN A;  1I4G A;  5EDS A;  2JZZ A;  1LQB A;  2I2Y A;  4RF0 A;  2PLP A;  2KMC A;  2WXP A;  1SJH D;  4WAF A;  1WXV A;  1WGY A;  5FK9 C;  4ZRK A;  2MJE A;  2MP2 A;  1ROE A;  3GZN I;  1LFD A;  2KO3 A;  2LXA A;  3I5J C;  1PQS A;  4YWG G;  1J8C A;  4A6Q A;  2X38 A;  3W1Y A;  1GC6 A;  4WQO B;  1TT5 B;  3RT3 B;  3H7S A;  5FKA C;  4MH8 A;  2LJ5 A;  1E90 A;  5DCN A;  4P16 A;  2MBE A;  3TSS A;  3JYU A;  4BZA A;  3AEF B;  3NOB A;  3VTW A;  4LNI A;  5TSS A;  1TS3 A;  2KX0 A;  1SGH A;  2ZPN A;  2JWZ A;  1UF0 A;  4IOI E;  3T9L A;  3Q8C A;  3SDL C;  3OLM D;  1FNW A;  2WP9 B;  2WHI A;  3ML8 A;  1JRO A;  4MSQ B;  4LJO B;  5IO9 A;  3NZ3 A;  2MBO A;  3QC8 B;  4GDL A;  4CQN A;  1KTK A;  3S2A A;  1V86 A;  2RSU A;  3TBL D;  5GXG B;  4KVG B;  3AEC B;  3VH4 B;  4A9A A;  2PVG C;  1ZUD 2;  4HPP A;  1JRP A;  4YT0 B;  3Q6B A;  3VFK A;  2VRR B;  4RF1 A;  1MG8 A;  2I38 A;  2W3S A;  1L2N A;  3E56 A;  1QOB A;  3VTV A;  2IO3 B;  1FXI A;  1JQ4 A;  3RZF A;  3W5V B;  5G5H A;  2YEP B;  3L13 A;  1XO3 A;  1E5W A;  3PRZ A;  1Y56 A;  2N9L A;  2E6X A;  4GLS C;  3LB8 C;  1ZDX A;  1UWM A;  4MSM B;  2MH7 A;  2LGX A;  2L00 B;  1Q1O A;  3K9P B;  4KKI A;  5BYR A;  4ANX A;  3LXF A;  4HVB A;  3BY4 B;  3WAP A;  4AWJ A;  2GBN A;  4GB9 A;  3AE8 B;  1OGW A;  3SFE B;  2KOX A;  4YTP B;  2W82 A;  3KLS X;  2V0G A;  2N9X A;  1V1P B;  2BTE A;  1DGJ A;  4PK1 A;  1NEK B;  2WXG A;  3OJ4 B;  3IXS A;  2MRP A;  5MPO A;  4IM2 A;  1E7U A;  3BYT B;  1IBX B;  2BGF A;  3A9K A;  1XCT L;  2G1E A;  1GNU A;  3L17 A;  2JSV X;  3IT6 B;  1WXM A;  4W9C A;  3L08 A;  1E8W A;  1P7E A;  2DYB A;  2KK8 A;  3VDZ A;  5HHD G;  4N58 A;  2V4L A;  3EFU A;  2Y3A A;  3UIP B;  3R8B A;  2IGG A;  1SE3 A;  2L05 A;  2KVR A;  4BVU C;  2WXK A;  1FIQ A;  2GOW A;  3PT2 B;  3PSE B;  1WYG A;  2K8B A;  2AL6 A;  3VUW A;  2EKI A;  4OZC A;  2INN E;  2GLS A;  1PGX A;  1FNV A;  2M0A A;  1QZE A;  2CHX A;  4DHZ B;  2JWU A;  3V6C B;  1KM7 A;  4KSK C;  2AYO B;  5C2T B;  2KLG A;  3D32 A;  4HDQ A;  3NS8 A;  2D07 B;  5I4D A;  2KFK B;  3DBH B;  2KN5 A;  1LXD A;  2R2O A;  1ZKH A;  1SE2 A;  2N9P C;  4F7Z A;  3TEZ A;  1FNU A;  5DPT A;  3BZD B;  1JW9 D;  2C9W B;  3MP9 A;  3JSV A;  5JHA A;  1EU4 A;  4B6W A;  2WDT B;  4AOF A;  2PEA A;  4S0R A;  2J0M A;  3QIJ A;  1GAQ B;  1E10 A;  5JXV A;  4XDC A;  4K3C A;  2FAZ A;  3DDC B;  2PE9 A;  3SR6 A;  1P98 A;  1QKZ A;  4KIK A;  4RGM A;  4F1S A;  5G5G A;  5LNK 1;  2FID A;  4ASW C;  1ENF A;  2FUH B;  3X0W A;  3APC A;  1ET6 A;  4WJN A;  3QA8 A;  5AZF A;  3AU4 A;  2FNJ B;  4HXD A;  2JYT A;  4KKJ A;  4RFB A;  2MJ3 A;  5D3I B;  3UIO B;  4YSY B;  3ZNI D;  4MGK E;  2KTF A;  4MT5 A;  3DBH I;  3VH3 B;  3AE2 B;  1WM2 A;  2A5U A;  4L1B A;  3AV8 A;  5C23 A;  3I9V 1;  2W3R A;  4W9L A;  4WAA A;  2IJ0 A;  4ICV A;  4EZJ A;  4D2K A;  4C7Y A;  3U30 A;  3E9S A;  1R4M B;  2KMA A;  1V80 A;  1WXA A;  2GRI A;  4YXD B;  3ZTD A;  3NJT A;  1I4X A;  3A4S C;  3UIN B;  4IM3 A;  4XYC A;  3A9J A;  5FR3 A;  2C7N B;  1CK1 A;  2KJR A;  5IP4 D;  5J17 A;  2BB5 A;  2RR9 A;  3VRA B;  2L0T A;  4DBG A;  2NBV B;  4M01 A;  2V3P A;  3ZKJ C;  2C7H A;  3SHQ A;  1M4V A;  2DZM A;  4PS7 A;  1F0Z A;  3DBL B;  4TQ1 A;  3A1Q A;  1MHH E;  2J4X A;  1SE9 A;  1XEE A;  2AWT A;  4US8 A;  1SIF A;  3PV1 A;  2PVO D;  4EKU A;  2UYZ B;  2HDE A;  1NI3 A;  2D3C A;  3VUX A;  2LD9 A;  2IY0 B;  1VZ7 A;  2KMM A;  1FM0 D;  2J0K A;  3ZNH B;  2LI5 A;  1NDD A;  1R4M I;  4NQK E;  1ZW7 A;  1ZXH A;  5EE3 A;  4MEL A;  5E6N A;  1L0Y B;  5D94 A;  3AE5 B;  2WU5 B;  3AUL A;  4DXA B;  2XNA C;  3B2F A;  1TKG A;  4HPL B;  2KWD A;  4TQ0 A;  2BW2 A;  3I3T B;  5IKC M;  4WJO A;  2QEJ C;  3QWZ B;  3PPA A;  2WQY B;  3IHP C;  1WGD A;  3ONS A;  4KIK B;  2PW9 A;  2GMI C;  3NG0 A;  1J0G A;  3CSF A;  4NJ6 A;  1C79 A;  1SBB B;  4RH6 A;  3DBL I;  1T0R C;  1DOY A;  2FCS A;  1R7S A;  3DHH C;  1JCK B;  2J52 A;  1WZ3 A;  1C4C A;  1UGJ A;  5AUK A;  1I7H A;  4FJV B;  2D3G A;  4M02 A;  1PGA A;  4NJ7 A;  1S1Q B;  2K25 A;  3SD5 A;  1A70 A;  1K50 A;  1VCB A;  2DHZ A;  2C7M B;  4XGA B;  2Z0E B;  3IT4 B;  4HJK A;  3ENE A;  1N5W A;  1U4A A;  2FUG 1;  4W9I A;  2WU2 B;  2INP E;  1OQQ A;  3U4E G;  2FIF A;  4E71 A;  5BYS A;  3L10 B;  1STE A;  4IW0 A;  3M95 A;  3V61 A;  3AMZ A;  1FPY A;  3Q3F A;  2M56 B;  1MVK A;  3NZU A;  1YNT E;  1HEZ E;  1D5M C;  1MHX A;  4N9F 4;  1WM3 A;  3RMK C;  5JZE B;  2FCM A;  4TSS A;  4P7I A;  1H4R A;  1QOF A;  2J0J A;  1ZGU B;  1RFK A;  2HTH A;  2M1M A;  4L2Y A;  4C4V A;  2ZW1 A;  2MCN B;  1AAR A;  4E74 A;  1MJD A;  3U8Z A;  2KQ4 X;  4WH4 A;  2WXF A;  1E6E B;  1C9F A;  2N7J A;  1TKE A;  4M0W A;  4B95 A;  4USA A;  3ZQ4 A;  1K51 A;  2O2V A;  1EF1 A;  1NVI D;  2W54 A;  5EE9 A;  1YJI A;  1WSP A;  2WXJ A;  5H92 C;  2E3T A;  2OED A;  4ZDV A;  2WXH A;  5H8Y E;  2EMT A;  2MX2 A;  1WJ6 A;  2K1F A;  3AE7 B;  3DQV A;  2LEK A;  2J42 A;  3BVZ A;  2CS4 A;  2Z8L A;  1MI0 A;  1WRD B;  3PGE A;  3RYT A;  5BO4 B;  2KT7 A;  4I6N B;  2DNF A;  1QIL A;  1C3T A;  3Q3O C;  1KH0 A;  4L23 A;  5L95 C;  2XK5 B;  2IO1 B;  2MWS B;  1OQR A;  4DQO C;  1FRR A;  3L0W B;  2RPV A;  2JT4 B;  4LJP B;  1OFF A;  3LYY A;  4ITK A;  2ON8 A;  5HKH A;  2AQ3 B;  2K8H A;  1IUE A;  2JQR B;  1UGM A;  4B9K A;  3Q8A A;  2JRH A;  1UD7 A;  2DZJ A;  2BT6 A;  1WIA A;  2WXQ A;  1TTN A;  5LXI B;  4WWM A;  3NY5 A;  2L52 A;  3AEB B;  3RN9 C;  4HPM B;  3P4S B;  3AB5 A;  1PUT A;  4FUL A;  4LNO A;  4REZ A;  1C78 A;  1VD2 A;  1YIW A;  4II3 B;  3NVV A;  2N4F A;  4K1R B;  5D2M B;  2KAJ A;  1TZ1 A;  2JUO A;  1LGR A;  2K6D B;  4OZB A;  1UBI A;  1EF5 A;  4MGY E;  3IAM 1;  1L6U A;  1WXS A;  2QJL A;  1EM7 A;  1TBE A;  3ZTC A;  2N7E A;  1SE4 A;  1XLN A;  3FKY A;  2LGS A;  3PTF C;  2UU7 A;  3NUH B;  3ZW3 A;  3PLV A;  2HJ1 A;  2LRU A;  4OVV A;  3AEE B;  2QIL A;  4E3C A;  1L4Z B;  5D6J B;  3BYY B;  4RM9 A;  4OVZ A;  4BKG A;  2BYE A;  4IG7 B;  4LTU A;  2L76 A;  5LXH A;  1N6Z A;  2WXR A;  4M0W B;  4PYU A;  3HVD A;  1ZOY B;  2JZ3 B;  1L6V A;  3AE3 B;  1I4Q A;  1Y8R C;  4ZRQ A;  3T8M A;  3AEA B;  2KAC A;  2VH1 A;  3JW0 X;  2ONQ A;  3UF8 A;  5FR6 A;  1HTQ A;  1DYQ A;  2H89 B;  3P42 A;  1AN8 A;  2IZV B;  2G4D B;  2ZEQ A;  1Q10 A;  2KDE B;  3N9Y C;  4W9G A;  2MQJ A;  4B0E A;  4YTN B;  1KRH A;  1QLB B;  1TJE A;  4J6I A;  1Z5S B;  2LVO A;  2IO0 B;  2LFI A;  4RMA A;  4AUQ C;  4G0N B;  2W55 A;  2WGS A;  3ZLZ A;  1CMX B;  4URK A;  2KFJ A;  3WA0 A;  1XLP A;  1TY2 A;  2RDH A;  1K52 A;  5KHQ A;  2WXO A;  3H7P A;  3K9O B;  2I1K A;  1JWU D;  3HK0 A;  3ZRC A;  4KDI C;  3N1X C;  2KDF B;  1V97 A;  3L16 A;  3PHX B;  3PVL A;  2CJO A;  3B2G A;  4ZHO A;  1ZPS A;  4NAW A;  2PIA A;  3MC0 B;  2ZVO A;  2GB1 A;  3FC4 A;  2LVQ A;  1F9J A;  4ZRP A;  2ZNV C;  5G55 A;  1WR1 A;  4P6V F;  3FIL B;  4JE3 B;  3AU5 A;  3DWG C;  3H1U A;  5HI1 A;  1WX8 A;  1SXT A;  3EA6 A;  2LHE A;  3HM6 X;  4KV2 A;  4BBN F;  3V60 A;  1WYW B;  3W1S A;  4IWP A;  1LM8 B;  5HFY A;  3QJZ A;  4BFR A;  5C1Z A;  3N1Z C;  1E8Y A;  2MP2 B;  3ZXV A;  2BS3 B;  3RNG C;  1IP9 A;  1ET9 A;  1D5Z C;  4X57 B;  4NAM A;  4DXG A;  2OOB B;  1BXT A;  4BBN C;  4YTM B;  2CU1 A;  3DHI C;  1HXY D;  2J53 A;  1WFY A;  1D5X C;  2FE8 A;  3NVZ A;  2CHZ A;  3HIZ A;  3KUC B;  1WE6 A;  3ZUN A;  3VHT C;  4EEW A;  4P1C C;  4H2A A;  3J9C A;  1RRB A;  1WXQ A;  3IAS 1;  4TMA B;  2VH2 A;  1WGH A;  4GXB A;  4KX6 B;  1D4B A;  1TZO A;  3TJP A;  4MGI E;  1VJK A;  4F8C B;  2NTT A;  3EHV A;  1C4A A;  1PGB A;  3MHS D;  4IWO A;  3AE6 B;  1TY0 A;  1N61 A;  2BQQ A;  2NPT A;  1E8X A;  1JWA D;  3RNA C;  3ZDT A;  4K3B A;  4GDL B;  4W9E A;  1FEH A;  1T0Q C;  4MEM A;  3CMM B;  2MBQ A;  4FLH A;  1R4N B;  1KLU D;  1C77 A;  1JAL A;  2B3A A;  3NVY A;  3TCA A;  4LCD E;  1OEY J;  4MGZ E;  3VXW A;  5IN7 A;  3VRB B;  3NS1 A;  3DVG X;  1TS5 A;  1YOV B;  4MAC A;  2EKE C;  3I57 A;  4HKQ A;  1B9R A;  4K81 A;  3H7P B;  4XWT A;  4ZRJ A;  4PT5 A;  4WWP A;  1KOT A;  1YQ4 B;  1JML A;  2LXC A;  1YMH E;  2Y5P A;  4NAW B;  1NBF C;  3V6E B;  2LMC A;  2J7Q B;  2AL3 A;  1HQR D;  3B1L X;  3PRE A;  1YQ3 B;  1DOX A;  3ZIM A;  4W9K A;  3GE8 C;  1RLF A;  4JIO U;  4LLG M;  4NQL B;  1J7C A;  3Q3N C;  3TL5 A;  3ECI A;  2JY6 A;  1CQV A;  1V6E A;  3WAM A;  2WXN A;  3V05 A;  4ARI A;  2C60 A;  4C7Z A;  3EC8 A;  4MM3 A;  2KQS A;  4HCP B;  4HCN B;  4HLE A;  1R4N I;  5GMV A;  4C00 A;  3W1S C;  3Q3M C;  4ZOH C;  3N30 A;  1V9J A;  1FD6 A;  4HKZ E;  5JH5 C;  3FAH A;  4EOY A;  1SSN A;  3A9K B;  2JZP A;  2BKF A;  4OVU A;  1FCC C;  3ML9 A;  4WWO A;  3ZJV A;  3OWE B;  2PTL A;  2G9H D;  1WJ4 A;  1I4H A;  1QQR A;  1Q5W B;  1UNS A;  2PMV A;  4WIP A;  2GBM A;  2QMT A;  4XZ4 A;  2DYO A;  2JX5 A;  2QHO A;  1AWD A;  1RYJ A;  2M4N A;  1I42 A;  4DXF A;  3N3K B;  2K0P A;  2KTR A;  1F1H A;  1CZP A;  4II2 B;  1EUV B;  1LO5 D;  1RM6 C;  2NPT B;  1ACC A;  2NBU A;  4RGO S;  1V5O A;  2JXX A;  2DEN B;  4FAD A;  2VZK D;  1E9M A;  2X8X X;  3MC8 A;  1P0R A;  3KH0 A;  2A4Z A;  3AI5 A;  1ZXI A;  1F2R C;  3H8H A;  4K7S A;  4BKT A;  1KLG D;  1GC7 A;  2XN9 C;  1T3Q A;  5EE1 A;  4GDK A;  2CKH B;  2ZVN A;  2AX5 A;  4BKS A;  3IG3 A;  3Q8E A;  2MW5 A;  1WE7 A;  2O6V D;  1FFV A;  4XWW A;  3NZS A;  3O65 B;  3JSV B;  4HDO A;  2AQ2 B;  1XD3 B;  2GBK A;  4MJS A;  1V1O A;  2N9K A;  4G50 A;  2L3Z A;  3CIR B;  4IDI A;  1PDX A;  4A90 A;  4CYE A;  4XX5 A;  1NEN B;  5E6J A;  2BB6 A;  3SEB A;  1YN5 A;  2Z59 B;  4EE2 A;  2MSE D;  3R3M A;  4FHK A;  1EU3 A;  2ZJD A;  1AW7 A;  3P4Q B;  2D2Q A;  3P4P B;  2B76 B;  2HJ8 A;  4LNN A;  3RI7 C;  4WWN A;  2LUE A;  1T5X D;  3URY A;  1JRU A;  4KGS A;  1SJE D;  4BOZ B;  2QSD A;  2CR5 A;  1E7P B;  1WWT A;  2W9N A;  1C4P A;  1P1A A;  4WJP A;  2QC8 A;  1WGR A;  4XE0 A;  2ZCC A;  5CHW A;  3BVG A;  2KAN A;  3A9J B;  1GOZ A;  4IUM B;  3KYD D;  3HM3 A;  4RCO A;  2XEW A;  3QK0 A;  4M8M A;  3U7D A;  1JWM D;  3DOW A;  1ZE3 D;  2HE7 A;  1RFA A;  3PZ8 A;  3EUB 2;  4AJW A;  1VZ8 A;  2L0F A;  1ZDV A;  4NJC A;  2K9X A;  4RM8 A;  1K53 A;  2Y5C A;  1MG4 A;  2AEH A;  2N1V A;  4KZ0 A;  3SFD B;  4GGQ A;  4ZYS A;  3VVW B;  1L0V B;  3A1Q B;  4ZYN A;  1UZX B;  4YSX B;  4OW0 A;  2LZ6 A;  2N7D A;  2KN4 A;  2BKR B;  2SAK A;  2DAJ A;  3VR8 B;  4ANU A;  4JGH B;  4JX1 C;  2BYT A;  5L83 A;  4ZRI A;  1ESF A;  4W9F A;  1GB1 A;  3GOE A;  1JWB D;  3UI3 A;  1N60 A;  3A4R A;  1N5X A;  4M00 A;  1I4R A;  2MJD A;  2WX0 A;  2JXT A;  2M8S A;  1YX5 B;  1XLO A;  2UWQ A;  2CHW A;  3Q2A C;  3NHE B;  3AE1 B;  2IYD B;  3APD A;  3DVN U;  2IPK D;  3C19 A;  2M19 A;  1NYQ A;  2ACZ B;  5LLI A;  3TEY A;  1T0S C;  2KDB A;  4IC7 B;  1L0X B;  4PS8 A;  3BK2 A;  2BWE S;  3UGB B;  4GIV A;  2R2Q A;  2LAS A;  3L4P A;  3O13 A;  3WCQ A;  1J7B A;  3DBR B;  4XC2 A;  2O6V A;  4PS3 A;  2KJH B;  3ZVV A;  1WH3 A;  2KHW B;  3HVZ A;  4CHK A;  1E7V A;  3R2I A;  1OEY A;  5G2N A;  2V9H A;  1I35 A;  4G3X B;  5BYQ A;  3BK1 A;  2WXI A;  3NVW A;  2ICI A;  3UQA A;  3KYC D;  1HZ6 A;  1V5T A;  4HWI B;  4C4V B;  3M63 B;  3R7Q A;  3DHG C;  4EFO A;  2MA9 B;  3VUY A;  1WMH A;  2LUM A;  2NVU I;  2WDQ B;  1C1Y B;  1V1P A;  2MHJ A;  2RGF A;  4FJZ A;  2DYM A;  3WAN A;  3ZNG C;  3QHT A;  3MTN B;  3QAR A;  1M94 A;  3W9C B;  3Q3J A;  2LWP A;  3RPF C;  1IBX A;  3ZXR A;  2O2V B;  3NRZ A;  4HEA 1;  2ZPY A;  4FJY A;  4A3P A;  1WY8 A;  3DBR I;  4ACF A;  1VRA B;  4YSZ B;  3BWU D;  3P1M A;  3DPD A;  4DHZ E;  2ASQ A;  2BWF A;  1L7Y A;  4BAX A;  3T3N A;  3W5U B;  4AQ7 A;  2IND C;  2QCZ A;  5KHO A;  1ISN A;  2EEL A;  1N63 A;  3DVN V;  1UH6 A;  2DAF A;  2M17 A;  2K8C A;  5JHB A;  1WJN A;  4GSW A;  2KDM A;  1E8Z A;  4JWU C;  2H88 B;  4IM0 A;  4RGN A;  2VZK B;  4A55 A;  1CJE A;  4ARC A;  3EEC A;  1BUI C;  1D6E C;  2DX5 B;  1UBQ A;  2NMQ A;  2REX A;  1H8C A;  3LJ3 A;  2ZNV B;  1SIJ A;  3KWL A;  3U7Z A;  1KF6 B;  4WJQ A;  2KFK A;  3PLU A;  3MC9 A;  4OHJ A;  3PRM B;  3R2T A;  2YEP F;  3N20 C;  2ZZP B;  4N6E B;  1F77 A;  3AH7 A;  3RUL A;  5AEK B;  1FO4 A;  4GMV A;  2K39 A;  3TUO A;  3ZNZ B;  2O6V B;  1Q0W B;  3KW5 B;  3PO0 A;  2BBC A;  2N0S B;  2KKC A;  3AXC A;  3ALB A;  1RWS A;  2HTM E;  2YLM A;  2QIE B;  2KNB A;  4MDK E;  4DWF A;  1QOA A;  3GP7 A;  4NY0 A;  2RDB C;  1IYF A;  4FN2 A;  1F52 A;  2LVP A;  1UUP A;  2N9E B;  1QT9 A;  4JPS A;  2CJN A;  3RNC C;  4DDG D;  4A3O A;  4AS1 A;  3ZO5 B;  1WMH B;  4CO7 A;  2KDI A;  1XF5 L;  4BOS C;  4C80 A;  4BKS D;  5C3J B;  2LGD A;  3MJW A;  5EE0 A;  2MBH A;  3TEW A;  1HA5 A;  4IKG A;  1J7A A;  1E0Z A;  4KDL B;  3RUI B;  4HK2 A;  1XT9 B;  3C8Y A;  4LDT D;  1GUA B;  4N59 A;  1WR6 E;  1NYR A;  2V1Y A;  2WX1 A;  3ZYY X;  1IGD A;  4FBJ B;  3AM9 A;  2K3U A;  1RAX A;  2KZR A;  3VQI A;  2QDF A;  5IOI A;  3HRD D;  2KQ7 A;  2Y5B B;  1YX6 B;  2LGI A;  3RNE C;  1JWS D;  1BT0 A;  1YJ1 A;  1YD8 U;  3AED B;  4DHJ D;  3TIX A;  1MPE A;  3KWV A;  1XQQ A;  2Q5W D;  4DK5 A;  2KVZ A;  3M62 B;  4US9 A;  3SU8 X;  3T3O A;  4C56 C; 
#chains in the Genus database with same CATH homology
 4ANW A;  3IG3 A;  2CS4 A;  3S2A A;  1GG3 A;  1V86 A;  2RSU A;  1WI0 A;  3OJ3 A;  3TBL D;  3B08 A;  2MW5 A;  3QQ8 B;  3RD2 A;  3VH4 B;  4KVG B;  1WE7 A;  2O6V D;  1WRD B;  3IBE A;  3PGE A;  3RYT A;  5BO4 B;  3NZS A;  1WGG A;  2FCQ A;  3O65 B;  3JSV B;  4HDO A;  4I6N B;  1C3T A;  1NI2 A;  1P9D U;  5L95 C;  3HHM A;  4I6L B;  1G6J A;  2XK5 B;  1XD3 B;  2GBK A;  4MJS A;  3VAW A;  2IO1 B;  2MWS B;  3VFK A;  3L0W B;  4G50 A;  2L3Z A;  2VRR B;  2JT4 B;  2ZCB A;  5IA7 A;  4LJP B;  3B0A A;  1MG8 A;  4CYE A;  4XX5 A;  2KJ6 A;  1WX7 A;  1L2N A;  3VTV A;  5HKH A;  4EUT A;  2IO3 B;  2Z59 B;  2K8H A;  2MSE D;  3RZF A;  4I6P A;  3R3M A;  4FHK A;  5AZH A;  3L13 A;  1UGM A;  1E5W A;  2ZJD A;  4B9K A;  2NS5 A;  2V3S A;  2JRH A;  3PRZ A;  2WYQ A;  3RCZ A;  3QAQ A;  1UD7 A;  2D2Q A;  2DZJ A;  4A20 A;  2HJ8 A;  4WWN A;  1WIA A;  2KX3 A;  2LUE A;  1TTN A;  1KLV A;  5LXI B;  3NY5 A;  4MSM B;  2KD0 A;  2LGX A;  2L00 B;  4HPM B;  1JRU A;  4FUL A;  1Q1O A;  3K9P B;  4BOZ B;  2JF5 A;  2G45 B;  1VD2 A;  4ANX A;  1YIW A;  2CR5 A;  4II3 B;  4HVB A;  2N4F A;  1TGZ B;  2M0X A;  3BY4 B;  3WAP A;  4JQW C;  1V49 A;  4AWJ A;  1EO6 A;  2GBN A;  2W9N A;  4K1R B;  2GBR A;  4GB9 A;  2NBW B;  5D2M B;  1OGW A;  2KOX A;  1TZ1 A;  2JUO A;  1P1A A;  1Z2M A;  4WJP A;  1WGR A;  3IFW B;  2K6D B;  1UBI A;  1EF5 A;  2L7R A;  2N9X A;  4MGY E;  1WXS A;  4K7U A;  2ZCC A;  1TBE A;  5CHW A;  3H6N A;  3R66 C;  5IAA C;  1OTR B;  3OJ4 B;  2KAN A;  2XBB C;  3A9J B;  3ZTC A;  2MRP A;  2N7E A;  4IUM B;  5CTR C;  1IPG A;  4IM2 A;  4W9J A;  3KYD D;  1E7U A;  4GN1 A;  2IY1 B;  2BGF A;  3A9K A;  3HM3 A;  3PTF C;  2GBJ A;  2XEW A;  3PLV A;  3QK0 A;  2LRU A;  3ZW3 A;  3WAO A;  4M8M A;  4OVV A;  3U7D A;  3DOW A;  3IVF A;  2C5L C;  2RD0 A;  1GNU A;  3PZD A;  4GU2 A;  3L17 A;  2HE7 A;  4E3C A;  1RFA A;  4AJW A;  1WXM A;  4W9C A;  5D6J B;  3TMP B;  2L0F A;  3ZDM C;  4RM9 A;  4PYZ A;  3L08 A;  1E8W A;  4BKG A;  1T0Y A;  2BYE A;  2G3Q B;  2KK8 A;  2DYB A;  4IG7 B;  4RM8 A;  2L76 A;  3VDZ A;  5LXH A;  4M0W B;  2V4L A;  3EFU A;  3P2B A;  4PYU A;  4EZL A;  2AEH A;  2N1V A;  4KZ0 A;  4GGQ A;  2JZ3 B;  4GOC A;  3VVW B;  2BPS A;  3A1Q B;  4ZYN A;  2JPH A;  1UZX B;  3UIP B;  1Y8R C;  3T8M A;  2LZ6 A;  2N7D A;  2RPQ A;  4ANV A;  2L05 A;  2KVR A;  2BKR B;  1OQY A;  4BVU C;  3JW0 X;  3PHW B;  2GOW A;  3PT2 B;  3PSE B;  2DAJ A;  2K8B A;  5AZG A;  2AL6 A;  3UF8 A;  5FR6 A;  4AP4 C;  4KSL C;  2D11 A;  3VUW A;  2KC2 A;  4ANU A;  2G4S A;  4JGH B;  2IZV B;  2G4D B;  2ZEQ A;  2KDE B;  3KVF B;  3C0R B;  4W9G A;  1QZE A;  4G11 A;  5L83 A;  2MQJ A;  4ZRI A;  5E6O A;  4W9F A;  2CHX A;  2JRI B;  3GOE A;  4DHZ B;  3V6C B;  2DZK A;  5J18 A;  1KM7 A;  4KSK C;  3QX1 A;  1KJT A;  4J6I A;  2AYO B;  1Z5S B;  2KWV B;  2LVO A;  2IO0 B;  2KLG A;  3X23 A;  3D32 A;  3A4R A;  3N32 A;  3NS8 A;  4HDQ A;  2D07 B;  4RMA A;  4AUQ C;  4G0N B;  4NPN A;  3PRP B;  5DPR A;  2KFK B;  3ZLZ A;  1CMX B;  2WX0 A;  4URK A;  2IO2 B;  2KN5 A;  2KFJ A;  2YVC A;  4JLC A;  3WA0 A;  2M8S A;  5CHV C;  1LXD A;  1YX5 B;  2R2O A;  5KHQ A;  1ZKH A;  1FXT B;  1V2Y A;  2UWQ A;  3H7P A;  2N9P C;  3K9O B;  2I1K A;  4F7Z A;  3HK0 A;  3ZRC A;  5DPT A;  4KDI C;  3WIM A;  2CHW A;  3DVG Y;  4EZK A;  3LDZ E;  3NHE B;  2KDF B;  1X1M A;  3L16 A;  2IYD B;  3PHX B;  2C9W B;  3PVL A;  3JSV A;  3APD A;  4GDL A;  3DVN U;  5JHA A;  1UEL A;  2MBB B;  4NAW A;  4B6W A;  2KLC A;  2WDT B;  2XK5 A;  2ZVO A;  4AOF A;  2JVC A;  5CX3 A;  2PEA A;  2NCN A;  2LVQ A;  1F9J A;  2J0M A;  3QIJ A;  2LRW A;  2ZNV C;  2KDB A;  4IC7 B;  2KC1 A;  5LLI A;  4PS8 A;  5G55 A;  1WR1 A;  2FAZ A;  2KWU B;  3DDC B;  2BWE S;  2PE9 A;  1P98 A;  4KIK A;  3AU5 A;  3UGB B;  4GIV A;  3H1U A;  4F1S A;  2R2Q A;  2LAS A;  2FID A;  4ASW C;  2K6Q A;  1WX8 A;  3KUD B;  2BF8 B;  4XC2 A;  2O6V A;  3HM6 X;  4KV2 A;  4PS3 A;  4BBN F;  2KJH B;  4W9D A;  3ZVV A;  2FUH B;  3V60 A;  3X0W A;  1WYW B;  3APC A;  1WH3 A;  3W1S A;  4IWP A;  4WJN A;  2KHW B;  3H9D A;  3QA8 A;  5AZF A;  1LM8 B;  1V81 A;  3AU4 A;  4CHK A;  3QCA A;  2FNJ B;  3QJZ A;  4BFR A;  1E7V A;  1YQB A;  4HXD A;  5C1Z A;  1E8Y A;  3PS6 A;  1OEY A;  2MP2 B;  2EMS A;  5G2N A;  4TUU A;  5DPW A;  3UIO B;  1IP9 A;  4M8N A;  3ZNI D;  4X57 B;  4MGK E;  3CF6 E;  2OOB B;  2KTF A;  1I35 A;  3DBH I;  4G3X B;  4BBN C;  3VH3 B;  2CU1 A;  1WM2 A;  3L54 A;  1WFY A;  3UQA A;  2A5U A;  3KYC D;  3A33 B;  1V5T A;  4HWI B;  5C23 A;  2KTR B;  3M63 B;  4W9L A;  3R7Q A;  4WAA A;  2HD5 B;  4EFO A;  2CHZ A;  2MA9 B;  3HIZ A;  3KUC B;  4K7W A;  1WE6 A;  1A5R A;  4ICV A;  4EZJ A;  3ZUN A;  3VUY A;  1WMH A;  1WZ0 A;  2NVU I;  3VHT C;  4EEW A;  1C1Y B;  4TV3 A;  3U30 A;  4MH0 E;  2KMA A;  2RGF A;  2PJH A;  1V80 A;  1WXA A;  4FJZ A;  2DYM A;  3WAN A;  1RRB A;  3ZTD A;  3ZNG C;  4NNJ B;  3QHT A;  1WJU A;  2D10 A;  3A4S C;  3MTN B;  3QAR A;  3UIN B;  1D3Z A;  4IM3 A;  2LGY A;  3A9J A;  1M94 A;  2C7N B;  2KJR A;  2PPH A;  5J17 A;  5D7G A;  1WGH A;  2LWP A;  3Q3J A;  4GXB A;  4W9H A;  5CHF A;  2O2V B;  3TJP A;  4MGI E;  4F8C B;  3EHV A;  2RR9 A;  2PE6 B;  2ZPY A;  2L0T A;  3MHS D;  4FJY A;  4IWO A;  4DBG A;  2NBV B;  4A3P A;  3VTU A;  1WY8 A;  2NPT A;  2OJR A;  3ZKJ C;  3DBR I;  2C7H A;  2WWZ A;  4GDK B;  3SHQ A;  1E8X A;  2IBI B;  1WX9 A;  3DPD A;  4DHZ E;  3APF A;  3ZDT A;  2ASQ A;  2BWF A;  2DZM A;  2NR2 A;  4GDL B;  4PS7 A;  4W9E A;  2MLB A;  1L7Y A;  4TQ1 A;  4MEM A;  3CMM B;  3DCG A;  3JVZ X;  4AJY B;  2MBQ A;  4FLH A;  2DZI A;  3A1Q A;  1SE9 A;  1HE8 A;  2AWT A;  2B3A A;  3TCA A;  1SIF A;  1OEY J;  3PV1 A;  4LCD E;  4MGZ E;  5KHO A;  1ISN A;  4LDT B;  2Z0D B;  4EKU A;  2UYZ B;  1J19 A;  3R7R A;  3VXW A;  3DVN V;  3DVG X;  1UH6 A;  2DAF A;  3VUX A;  2LD9 A;  4MJS B;  2M17 A;  2KWC A;  2IY0 B;  3OAW A;  1K8R B;  2BYF A;  2K8C A;  4FA6 A;  5JHB A;  2J0K A;  1WJN A;  2EKE C;  4GSW A;  2I1J A;  1WF9 A;  3ZNH B;  3ZRF A;  2LI5 A;  1E8Z A;  4K81 A;  4IM0 A;  3DBS A;  3H7P B;  1NDD A;  4ZRJ A;  4WWP A;  2L8J A;  1KOT A;  1R4M I;  4NQK E;  1ZW7 A;  4JL9 A;  2LXC A;  4MEL A;  5E6N A;  3EEC A;  2DX5 B;  1UBQ A;  5J2R A;  5D94 A;  3AUL A;  2REX A;  4NAW B;  1P3Q U;  1H8C A;  3LJ3 A;  1NBF C;  2ZNV B;  4DXA B;  2BYV E;  3V6E B;  4DHJ B;  3WAL A;  4HPL B;  2J7Q B;  4KZC A;  2AL3 A;  5DPS A;  4TQ0 A;  3I3T B;  3M3J A;  2KFK A;  3B1L X;  3PLU A;  2KXJ A;  3PRE A;  4WJQ A;  4DDI D;  3PRM B;  4WJO A;  4IWQ A;  3QWZ B;  2ZZP B;  3ZIM A;  3RZW C;  3PPA A;  4W9K A;  3RUL A;  4NQL B;  1RLF A;  4JIO U;  3IHP C;  1WGD A;  3ONS A;  4KIK B;  5AEK B;  4GMV A;  2K39 A;  2GMI C;  3ECI A;  4YL8 A;  2JY6 A;  3TL5 A;  3V62 A;  1J0G A;  3CSF A;  4NJ6 A;  3ZNZ B;  1V6E A;  3CST A;  3BIN A;  3WAM A;  2O6V B;  1Q0W B;  3KW5 B;  2C60 A;  3DBL I;  2FCS A;  5TR5 A;  3EC8 A;  4MM3 A;  2KQS A;  4HCP B;  2KKC A;  4FHJ A;  4HCN B;  4HLE A;  1WZ3 A;  1R4N I;  3AXC A;  4ICU A;  5E6P A;  3ALB A;  5GMV A;  2N1W A;  3W1S C;  2YLM A;  4FJV B;  2KNB A;  2D3G A;  4MDK E;  4NJ7 A;  4TKN A;  4DWF A;  1S1Q B;  4NY0 A;  3N30 A;  3UQB A;  3KUZ A;  2K25 A;  1V9J A;  1GJZ A;  1IYF A;  3SD5 A;  5JH5 C;  4FN2 A;  2LVP A;  1VCB A;  2DHZ A;  1S3S G;  2C7M B;  2N9E B;  2Z0E B;  4EOY A;  2FCN A;  5EDS A;  4HJK A;  2JZZ A;  3ENE A;  3A9K B;  1U4A A;  4W9I A;  4DDG D;  1LQB A;  4A3O A;  2BKF A;  3ZO5 B;  2KMC A;  2FIF A;  4E71 A;  4OVU A;  3L10 B;  3ML9 A;  4IW0 A;  1WMH B;  3M95 A;  4WWO A;  1WXV A;  3V61 A;  1WGY A;  3Q3F A;  4ZRK A;  4CO7 A;  2KDI A;  4BOS C;  3NZU A;  1WJ4 A;  2MP2 A;  3GZN I;  4BKS D;  2LGD A;  3MJW A;  1LFD A;  2MBH A;  1Q5W B;  4N9F 4;  1WM3 A;  2KO3 A;  5JZE B;  2LXA A;  2GBM A;  2FCM A;  1PQS A;  4XZ4 A;  2DYO A;  4P7I A;  1H4R A;  4KDL B;  2J0J A;  2QHO A;  3RUI B;  1J8C A;  2M4N A;  1ZGU B;  1XT9 B;  4HK2 A;  1I42 A;  3W1Y A;  1GC6 A;  4LDT D;  4WQO B;  1GUA B;  2HTH A;  2M1M A;  3N3K B;  3H7S A;  3RT3 B;  1WR6 E;  2KTR A;  2V1Y A;  2WX1 A;  2MCN B;  1AAR A;  4E74 A;  2LJ5 A;  4II2 B;  1EUV B;  1E90 A;  2NPT B;  5DCN A;  4FBJ B;  2MBE A;  3U8Z A;  2NBU A;  1RAX A;  1V5O A;  2JXX A;  2DEN B;  4FAD A;  3JYU A;  2KZR A;  3VQI A;  3NOB A;  3VTW A;  1P0R A;  3KH0 A;  2KX0 A;  1SGH A;  4B95 A;  2KQ7 A;  2ZPN A;  2A4Z A;  1YX6 B;  2Y5B B;  3AI5 A;  2JWZ A;  1BT0 A;  4K7S A;  3T9L A;  4BKT A;  1YJ1 A;  2O2V A;  1GC7 A;  1YD8 U;  3SDL C;  1EF1 A;  3OLM D;  4DHJ D;  3TIX A;  3ML8 A;  4MSQ B;  1XQQ A;  4LJO B;  4DK5 A;  4GDK A;  4ZDV A;  2CKH B;  2ZVN A;  3M62 B;  2MBO A;  3SU8 X;  2EMT A;  2MX2 A;  1WJ6 A;  2K1F A;  4BKS A;  3DQV A;  3QC8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...