1J8CA

Solution structure of the ubiquitin-like domain of hplic-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics
molecule keywords ubiquitin-like protein hPLIC-2
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j8cA00
2C7HA 2N9XA 2KX0A 4BVUC 4LCDE 2WDTB 4MGIE 4WJNA 3IVFA 4LJPB 5D94A 2BKRB 4I6LB 3VXWA 3ZDTA 4MJSB 2NBVB 4NPNA 2LRUA 3ZTDA 1J8CA 1EF5A 4F7ZA 4WJOA 3ZKJC 1FXTB 1WX9A 4IWOA 3PVLA 2MBQA 4A20A 1IPGA 1P98A 1P0RA 4JLCA 4DHJB 2L8JA 1ZW7A 2G3QB 2O2VA 4IG7B 3SHQA 3PRMB 1BT0A 2MW5A 2JY6A 3NZUA 4W9HA 3V6EB 1WM3A 5E6PA 2G45B 2KO3A 1NBFC 1WIAA 2L7RA 2MA9B 3HM3A 4EEWA 1P3QU 4MH0E 3D32A 4W9CA 3L54A 4AOFA 2DYOA 3DQVA 1Q5WB 4ZYNA 2CU1A 2R2OA 1CMXB 1WE7A 1WRDB 1GC7A 2KZRA 3S2AA 4HWIB 3ONSA 3APFA 2BYEA 4TQ1A 5C23A 4W9GA 3VAWA 4W9FA 3X23A 2GBJA 1P9DU 2NPTB 2J0JA 3CF6E 1V80A 3QA8A 4XX5A 3RULA 2V3SA 1XQQA 2XBBC 2KLGA 3L16A 4FADA 3W1SC 1V81A 3U30A 3R3MA 1E8ZA 2R2QA 2J7QB 3O65B 3CSTA 1E5WA 1UH6A 2JUOA 4FLHA 4HXDA 4W9JA 2KFKB 3HK0A 4BBNF 2CS4A 2CKHB 2UWQA 3KUCB 2BGFA 2L05A 3ECIA 1WR6E 2PE6B 2JT4B 5AEKB 4MGKE 2MCNB 2IO0B 4B95A 1UBIA 1U4AA 2N9EB 1V5TA 2BWFA 2KC1A 3PLVA 4PS7A 1E8XA 4KDLB 4ANWA 2UYZB 3TJPA 4ANUA 1E8YA 4HCPB 3TL5A 2CHXA 2LJ5A 1G6JA 2BWES 1VCBA 2Z59B 2ZJDA 1WZ0A 2D2QA 4AWJA 3L08A 4KSLC 1KJTA 1C1YB 1RLFA 5AZGA 3KH0A 2ZCBA 3L13A 2L00B 4ANVA 2DZMA 4WWOA 2DZKA 2KJHB 2IO2B 2BF8B 5DPTA 4W9EA 3QK0A 3HHMA 4DDGD 2V4LA 2GBKA 2RPQA 1NI2A 2C7NB 3A1QB 5AZHA 4MGZE 1XD3B 1F9JA 3JSVA 1TGZB 3OAWA 3ZNID 4B9KA 5J17A 5KHQA 1WXVA 2K8CA 4K7WA 2V1YA 2IY1B 2B3AA 4XC2A 3N32A 4FA6A 3R66C 2K1FA 3PREA 4LDTB 3VUXA 2JXXA 2LVQA 3TCAA 5IA7A 3ZNHB 4CHKA 1S3SG 1OEYJ 1LQBA 2ZEQA 2GOWA 3OJ3A 3ZTCA 2M1MA 1WE6A 3U7DA 2KOXA 2KWVB 4URKA 1E8WA 1JRUA 2LGYA 4NY0A 2N1WA 2XK5A 3JVZX 4XZ4A 3EC8A 4IW0A 2L0TA 1E7UA 1Y8RC 5DCNA 2C7MB 1YD8U 5CHVC 4IM3A 3VFKA 4MSMB 2JPHA 4HJKA 4M0WB 2WYQA 3UF8A 4BKSA 4BBNC 3RUIB 2KQSA 1I35A 2KN5A 3NHEB 5TR5A 5G2NA 1WY8A 3DCGA 4RMAA 2FCMA 2JRIB 5CHFA 2KDIA 3L17A 2MQJA 3DVNU 4JL9A 2DYBA 5JHBA 3AU4A 2IO1B 2VRRB 4JQWC 2KKCA 3DPDA 1UGMA 4I6PA 2C5LC 4E3CA 2JWZA 3B0AA 3W1YA 4KSKC 4IUMB 1WX8A 2L0FA 3VTUA 4WQOB 1Z5SB 2RR9A 1J19A 3ML8A 3LDZE 2WX0A 2KX3A 4IC7B 1WXSA 2KDEB 4G0NB 5D7GA 2KNBA 1MG8A 3W1SA 1WGDA 2LZ6A 3A9JA 3WIMA 3A4RA 1LM8B 2A5UA 2JZ3B 3AXCA 4J6IA 1YJ1A 5E6OA 4GGQA 3DVGX 1LFDA 3IFWB 1H8CA 1L7YA 2DENB 4W9DA 2HJ8A 4II3B 2KK8A 2EMSA 2AL6A 3WAPA 2EMTA 3H7SA 2KJRA 2DAFA 2LVOA 2MX2A 4E71A 2EKEC 2L3ZA 3ZNGC 1OEYA 4G50A 4ZRJA 1V49A 3TBLD 2K8BA 3OJ4B 3JW0X 3UQBA 4JIOU 1OTRB 2MBOA 3PS6A 1TBEA 4K1RB 3IG3A 4N9F4 1TTNA 2FCNA 3PZDA 4E74A 4GDLA 2DZJA 3ZRCA 2FIDA 1GUAB 4NJ6A 2N7EA 2M4NA 4FBJB 1E7VA 2O6VB 4IM0A 3L10B 3UIPB 2KXJA 3A9KA 3SU8X 4ZRKA 4KZ0A 3DDCB 2AYOB 1A5RA 2JF5A 4CYEA 3QAQA 2MBHA 4A3PA 5JH5C 3EFUA 4KVGB 3I3TB 1M94A 3H7PB 3B08A 4TUUA 2WX1A 4PS3A 4IWQA 3WA0A 2FAZA 2IY0B 2YLMA 5D6JB 4RM9A 3RZWC 1GNUA 4ZRIA 3JYUA 2IBIB 1WGGA 4DDID 4NQKE 2KANA 1H4RA 2IO3B 2K8HA 1Z2MA 3T9LA 4HK2A 2IZVB 1GG3A 4RM8A 2HD5B 2C9WB 3DBSA 5LXIB 3BY4B 2LI5A 4MJSA 4ZDVA 3HIZA 2CHZA 2RD0A 3VHTC 1RRBA 4M8MA 2K6QA 1WGHA 1YX5B 2ZPNA 2KD0A 4HDOA 3HM6X 3Q3JA 1P1AA 1WF9A 4HPMB 5DPWA 2AL3A 3H9DA 4M8NA 2LUEA 4HVBA 2YVCA 4BKGA 2O6VD 1K8RB 4JGHB 2D3GA 4F1SA 1HE8A 1ZKHA 3M63B 4ICUA 4NAWA 2Z0EB 3MTNB 3QCAA 2KVRA 3ENEA 3WAOA 3KW5B 3K9OB 2K25A 2PE9A 1TZ1A 5CX3A 3UINB 3H1UA 2LRWA 4AJWA 4NAWB 4EKUA 1WH3A 4YL8A 2GBNA 4X57B 1WJ4A 3N3KB 4OVVA 1WR1A 3PGEA 1WZ3A 3ZNZB 4BKSD 2GBRA 3VH4B 3CSFA 3PHXB 3ZO5B 2KJ6A 5AZFA 1LXDA 2KQ7A 2N4FA 3UGBB 3UIOB 3A1QA 3MJWA 1V9JA 4WWNA 2D07B 2PJHA 2LXAA 2K39A 2MRPA 2XK5B 5DPRA 2PPHA 3V60A 4KDIC 1J0GA 1S1QB 3M62B 1UZXB 3QWZB 4FHKA 2M17A 3Q3FA 4II2B 2REXA 3H7PA 1OGWA 2I1KA 4BKTA 4HDQA 5L83A 2C60A 3NS8A 2HTHA 4WJPA 4WWPA 2WWZA 2O2VB 3RZFA 4TQ0A 2NS5A 1WJUA 3V61A 3DBHI 4CO7A 2KMAA 5FR6A 3PHWB 3A9KB 3R7QA 3M95A 4OVUA 3RD2A 1EF1A 1T0YA 4W9IA 4DXAB 3TMPB 2RSUA 4ICVA 4GMVA 3AU5A 2XEWA 3K9PB 1V5OA 1R4NI 5KHOA 2KFJA 1EO6A 3M3JA 2I1JA 2KHWB 2NBWB 2LXCA 2BYVE 5C1ZA 2ZNVB 3VVWB 3V62A 5DPSA 4PYZA 3ZVVA 4KIKA 2J0KA 4FULA 2KWCA 2AWTA 2BYFA 1XT9B 4K7UA 1WI0A 2Z0DB 4MSQB 3RYTA 1WJ6A 3LJ3A 3NOBA 2CR5A 1L2NA 4DWFA 5E6NA 2NVUI 4GIVA 2NCNA 1V2YA 3VTVA 4AP4C 3PSEB 1RAXA 2N1VA 2N9PC 3IHPC 1WGRA 3KYDD 4W9LA 3U8ZA 3VQIA 3JSVB 4GDKA 1KOTA 3PLUA 4GB9A 1AARA 3ALBA 4DHJD 4DK5A 2HE7A 2GBMA 1V6EA 2JZZA 2ZPYA 4NQLB 3TIXA 3KUDB 3A9JB 3DVGY 3QC8B 3QQ8B 4KIKB 1X1MA 1IP9A 1D3ZA 3VUWA 1YX6B 2CHWA 2IYDB 3KVFB 5CTRC 3RT3B 5LXHA 3DBRI 4NJ7A 4B6WA 2W9NA 2A4ZA 5CHWA 2M0XA 2ZCCA 3WANA 2DAJA 4LDTD 3QX1A 1GJZA 4DBGA 1GC6A 2KC2A 3VH3B 4MEMA 1KM7A 1WGYA 4KZCA 1UBQA 3C0RB 4ANXA 2D10A 4BOZB 1V86A 2FNJB 3PRZA 2ZNVC 1C3TA 5IAAC 3QIJA 1E90A 4FJYA 1QZEA 5HKHA 2MWSB 2MBEA 4DHZB 4FN2A 4NNJB 2RGFA 2MBBB 1UELA 2NPTA 4MGYE 2KTFA 2KTRB 3QHTA 3VUYA 4F8CB 5L95C 5BO4B 1WXMA 3SD5A 1Q1OA 5EDSA 1WX7A 2D11A 2OJRA 4FHJA 4EOYA 1OQYA 2KFKA 3NZSA 4WAAA 4HLEA 2M8SA 2MSED 3ML9A 2O6VA 2MP2B 1YQBA 3QARA 2ASQA 4HCNB 3P2BA 4IM2A 4W9KA 2DHZA 4DHZE 5JHAA 4GDKB 1ISNA 1VD2A 2LASA 4MDKE 4GXBA 3N30A 3NY5A 1YIWA 2QHOA 2DX5B 3OLMD 2LD9A 3PV1A 3B1LX 4K81A 1SIFA 1KLVA 4AJYB 3PPAA 4KV2A 5JZEB 4GU2A 5J2RA 4GSWA 2NBUA 3ZDMC 4GOCA 4FJVB 1IYFA 4BFRA 1WMHB 1SGHA 1Q0WB 1WXAA 2L76A 3EECA 3VDZA 3UQAA 5J18A 2KWUB 3KYCD 5D2MB 3RCZA 3ZLZA 3WALA 2MP2A 2GMIC 4AUQC 2FCQA 2G4SA 4PYUA 4WJQA 1WYWB 2FIFA 5LLIA 3A4SC 4LJOB 2BKFA 3L0WB 2PEAA 3DOWA 2LGDA 4G11A 4GN1A 4FJZA 3PTFC 1WJNA 3CMMB 4IWPA 2DYMA 2KTRA 1NDDA 3APCA 2FCSA 3DVNV 3ZUNA 1WM2A 2ZVOA 3APDA 3IBEA 2KLCA 3PRPB 2ZVNA 4P7IA 4EFOA 2KMCA 2LVPA 3PT2B 1WMHA 2FUHB 1PQSA 3GZNI 4G3XB 5G55A 3T8MA 1WFYA 3AULA 4EUTA 2KDFB 4BOSC 2N7DA 1I42A 3V6CB 2LGXA 3SDLC 3GOEA 3H6NA 2ZZPB 4MM3A 2J0MA 3DBLI 2LWPA 1RFAA 2OOBB 1UD7A 2G4DB 2NR2A 2Y5BB 3BINA 2MLBA 2JVCA 3AI5A 3KUZA 3ZW3A 4EZKA 3EHVA 4TV3A 3MHSD 1SE9A 4ASWC 3WAMA 4EZJA 2DZIA 4HPLB 3X0WA 4TKNA 4EZLA 2KDBA 3ZRFA 4MELA 4K7SA 4I6NB 5GMVA 2BPSA 3VTWA 3A33B 3ZIMA 2JRHA 1EUVB 3R7RA 4PS8A 1ZGUB 3QJZA 2AEHA 4A3OA 1R4MI 4GDLB 2K6DB
chains in the Genus database with same CATH superfamily
2H89B 2IDYA 2NTTA 5MPOA 1TZOA 4MJSB 2NBVB 4YT0B 4RF0A 4F7ZA 4WJOA 1FXTB 3PZ7A 1XEEA 2MBQA 1L0XB 2L8JA 1F1HA 1YNTE 2G45B 2L7RA 2MA9B 1P3QU 2D3CA 1JCKB 4PK1A 2J52A 1Q5WB 2KZRA 3NVZA 3ONSA 3APFA 2BYEA 1L0VB 1V80A 1FFUA 3W1SC 1E8ZA 4MM3B 4XDDA 3O65B 1E5WA 4FLHA 2J4XA 1XLNA 1VLBA 4DXGA 2GRIA 2L05A 4RNAA 2PE6B 1ZP0B 2MCNB 2N9EB 3GP7A 1NI3A 2W82A 4C56C 3N1XC 2CHXA 2BWES 2SEBD 2D2QA 3DHIC 1KJTA 3ZXRA 4YXDB 5DPTA 4W9EA 2JYTA 3QK0A 2WNMA 1ESFA 5AZHA 1F9JA 5J17A 4XC2A 4FA6A 1MHHE 4LDTB 3PREA 1TKGA 4C7ZA 2LVQA 3Q69A 4CHKA 1S3SG 3W9CB 3ZTCA 1C77A 5HFYA 3U7DA 2DBYA 2JX5A 2KWVB 2KOXA 1E8WA 1JRUA 2LGYA 4HRSA 2XK5A 1FXIA 3EC8A 4NZLB 3T3OA 1Y8RC 3NS1A 4L23A 1K50A 1YD8U 3VFKA 4MSMB 2JPHA 2X8XX 1L0YB 2KQSA 4MH8A 4OHJA 3NHEB 5G2NA 1SF0A 5CHVC 1FMAD 2VRRB 3AE1B 2JWZA 4KSKC 3EFCA 3LDZE 3W1SA 1KLUD 2KX3A 1WXSA 2KDEB 4A90A 2LZ6A 2BBCA 1LM8B 2M0AA 4D2KA 1YJ1A 3DVGX 1FFVA 1LFDA 4W9DA 1QILA 4KKJA 2AL6A 3WAPA 3Q3MC 3H7SA 2LVOA 4UDUC 1RWSA 2SAKA 2OJWA 2JZPA 3ZYYX 3ZNGC 1OEYA 1C4CA 3TBLD 4JIOU 3PS6A 2MBOA 3TEWA 4JX1C 1FXAA 4N9F4 2FCNA 3P4PB 3AE3B 1GUAB 4IM0A 3AN1A 3SU8X 2XNAC 2WXQA 2AYOB 4M02A 3QAQA 4A3PA 3TSSA 3I3TB 3BYYB 4PS3A 5JXVA 5D6JB 4RM9A 3RZWC 1N5WA 2W3SA 1Z2MA 1XLOA 4HK2A 2JXTA 4RM8A 4YSYB 1PFDA 1N62A 3AM9A 4M8MA 2W3RA 4ZHPA 4H2AA 1WGHA 4B0EA 4HDOA 1STEA 4M8NA 1FNUA 2YVCA 2O6VD 4JGHB 1YJJA 3MTNB 2KVRA 4A55A 3N20C 1TZ1A 4OVZA 5CX3A 4LK0M 1WH3A 4L2YA 1D5ZC 4BKSD 1LXDA 3MJWA 1V9JA 3OG5A 2K39A 2MRPA 2PPHA 3DWMA 5D3DA 2M17A 4II2B 3H7PA 2I1KA 4BKTA 3NS8A 4WJPA 1HQRD 1WJUA 2JQRB 4JE3B 4US8A 5KHOA 3M3JA 2I1JA 2LXCA 3N1ZC 5C1ZA 3URYA 2KWCA 1NENB 4NJCA 1JWSD 3RYTA 1QKZA 2CR5A 2LHEA 5E6NA 1ACCA 2NVUI 1T0SC 3VTVA 4AP4C 2N9PC 2PIAA 3IHPC 4W9LA 5BMGA 2V3NA 1FRDA 1V6EA 4NQLB 3A9JB 4KIKB 1J7AA 5EE3A 1IP9A 1D3ZA 1D4BA 2IYDB 3ZXVA 5CHWA 2M0XA 1ZPSA 2ZCCA 2FUG1 3MC0B 1QOBA 1WGYA 4BOZB 1N63A 4DXFA 3QIJA 4RH6A 4DHZB 1T6BX 4YSZB 2NPTA 2UU7A 5L95C 2KTRB 3QHTA 4REZA 3AMZA 2NTSA 5BO4B 1I4PA 1WX7A 3NJTA 4FHJA 1GOZA 2KFKA 2M8SA 1B1ZA 3MC8A 2ASQA 4M01A 1E0ZA 2DHZA 5JHAA 5GXGB 4KKIA 3NY5A 3P42A 3AE7B 5I4DA 3PPAA 5J2RA 4GU2A 2NBUA 4FJVB 1WMHB 1SGHA 1XCQL 1Q0WB 3Q8BA 3VDZA 4C4VB 4LNNA 2KWUB 2GMIC 1ENFA 1EWYC 2FCQA 4MACA 4PYUA 1V1OA 2BKFA 3DOWA 3PTFC 3IT4B 3ZUNA 3APCA 1V8CA 3I5JC 3IBEA 3PRPB 4EFOA 3NG0A 2WGSA 1XXGA 3NUHB 3FKYA 1I42A 3SDLC 3GOEA 3ZJUA 1RFAA 2Y5BB 3RNEC 2MLBA 1ZE3D 1PGBA 3AI5A 3KUZA 3ZW3A 3EHVA 4TV3A 1SE9A 3WAMA 4EZJA 4HPLB 3KWLA 3X0WA 3ZRFA 2WDVB 1ZXHA 4K7SA 5GMVA 3R8BA 1FCCC 1HTQA 2BPSA 3VTWA 4RF1A 2ZW1A 2JRHA 4PS8A 1ZGUB 3AEBB 2BYTA 2K6DB 4LCDE 3ZJVA 1ZDXA 2WDTB 2E3TA 4MGIE 3IVFA 1IUEA 5D94A 4I6LB 3VXWA 3ZTDA 3MP9A 2JYEA 4Q2JA 1C4AA 4A20A 1P98A 4DHJB 2G3QB 3PRMB 1BT0A 1ZDVA 3AEDB 3NZUA 3P4RB 4W9HA 3V6EB 3MJ5A 5E6PA 1NBFC 1D5MC 4EEWA 2V9HA 4AS1A 3D32A 4W9CA 2TSSA 3L54A 2DYOA 3FAHA 3EUB2 4J3OD 4RGTA 2BB5A 3W5UB 3Q2AC 1CMXB 3E9SA 4TQ1A 4W9GA 3P63A 3CF6E 3QA8A 2JU6X 2V3SA 1YJIA 3L16A 4FADA 3U30A 4YTPB 5FK9C 4W9JA 3MFGA 3AE6B 1RM6C 2LGIA 3KUCB 2L52A 3ECIA 5AEKB 1YN4A 4MGKE 4P1CC 1SEBD 2IO0B 4OW0A 1UBIA 3PLVA 1V5TA 2KC1A 4PS7A 5G5HA 1E8YA 3ZQ4A 2LJ5A 1VCBA 4XGAB 1SJHD 3AE4B 5EE0A 5AZGA 3KH0A 1ET9A 2RDBC 2KT7A 4ANVA 2BF8B 1TT5B 4DDGD 2INCC 1WXQA 2GBKA 3JSVA 1TGZB 1FNVA 2BS2B 3OAWA 1WXVA 1N60A 1I4GA 2V1YA 3R66C 2WXKA 3HVDA 2JXXA 5AUKA 1MHXA 4HJGE 3HRDD 2GOWA 1WE6A 4URKA 1EU4A 3RMKC 3JVZX 4JPSA 2K5PA 4IW0A 4XZ4A 2L0TA 2ICIA 2K22A 2XN9C 3RFZB 3P4SB 4QAYA 4HJKA 4HPPA 4BBNC 3RUIB 3LB8C 5TR5A 4RMAA 2FCMA 3DVNU 2DYBA 2WXGA 4A8XC 1OFFA 2C5LC 3W1YA 1EU3A 4IUMB 1K51A 3VTUA 4WURA 3ABVB 4IKGA 3WIMA 1ZUD2 4WH4A 5E6OA 4AQ7A 3PZ8A 4II3B 4BZAA 3VR9B 3N9YC 2EMTA 1C79A 2MX2A 1VZ7A 3OJ4B 1TS5A 4XWTA 1TBEA 4K1RB 2QILA 1TTNA 2GB1A 3PZDA 4N59A 4E74A 1F77A 2LJIA 4NJ6A 3IAS1 2M4NA 1E7VA 2O6VB 3UIPB 2DNFA 1AN8A 2KXJA 3A9KA 4KZ0A 1KF6B 3DDCB 4O1NA 2N7JA 2IGGA 5JH5C 3RNAC 2PVGC 1M94A 2QJLA 2K0PA 4IWQA 2FAZA 2YLMA 1DOYA 1GNUA 2AQ1B 4DDID 1TS2A 3UI3A 4NQKE 5BYRA 1PGAA 3T9LA 1GG3A 1JQ4A 3DBSA 2C9WB 3RNFC 4JWUC 1WGKA 2LI5A 2KMMA 3DBHB 2ZPNA 2AL3A 1CJEA 1C78A 1MI0A 1J7CA 2LUEA 4HVBA 1K8RB 2D3GA 4C7YA 2QDFA 1HE8A 1T5XD 4ICUA 3ENEA 3WAOA 3KW5B 3K9OB 2H88B 4AJWA 3UINB 3H1UA 2WDQB 4EKUA 1QQRA 2GBNA 4YL8A 1MVKA 1WJ4A 3N3KB 1LO5D 2CU3A 3PGEA 3BYTB 3VRAB 2GBRA 2D5GA 3CSFA 2WXIA 3ZO5B 2KQ7A 2IGDA 4WWNA 2LXAA 5DPRA 2XK5B 3V60A 3BIID 3I57A 4HROA 1S1QB 3M62B 1UZXB 3DBLB 3AEGB 4TMAB 5L83A 2BTEA 2C60A 4WWPA 1V1PA 1Y56A 5BYQA 3TEZA 5FR6A 3AECB 3A9KB 3PHWB 4N6EB 1OQQA 4DXAB 4W9IA 1XO3A 2E6XA 4ICVA 3AU5A 1R4NI 2KHWB 3AEAB 2ZNVB 2RDGA 3V62A 5DPSA 4PYZA 3NVYA 4KIKA 2J0KA 2BB6A 4FULA 1FD6A 2BYFA 4K7UA 3P1MA 1WJ6A 4DWFA 4GIVA 2Q5WD 3C19A 1FEHA 3KYDD 2HTME 4GDKA 3ALBA 4DK5A 3NVVA 2K3UA 1B9RA 1YX6B 2CHWA 3KVFB 2YEPF 4B6WA 1N6ZA 1QT9A 3AH7A 4M00A 3WANA 4LDTD 1Q10A 1GJZA 3VH3B 4MEMA 2KDMA 3C0RB 3RPFC 2D10A 2FNJB 3PRZA 2ZNVC 3BVGA 2WU2B 4FJYA 1AWDA 5EE9A 1UWMA 1WWTA 2KYWA 2MBBB 1UELA 4MGYE 4F8CB 1WXMA 3SD5A 1Q1OA 5EDSA 1QOAA 2D11A 4EOYA 3GE3C 3BWUD 4WAAA 2GLSA 1JROA 2MSED 3ML9A 2O6VA 1SE3A 3P2BA 1E7PB 3GZNB 1UGJA 5BMHA 2R61A 1ISNA 2LASA 3N30A 1YIWA 2DX5B 2LD9A 3PV1A 2W55A 2INDC 4KV2A 4XYCA 2Z8LA 2AQ2B 3RNGC 1QLBB 1WXAA 2J53A 3W2DA 3KYCD 5D2MB 5BMIA 2KWDA 4GLSC 4WJQA 1WYWB 5LLIA 1WSPA 1XLQA 4ZHOA 3L0WB 2PEAA 2LGDA 4P1BC 4GN1A 3RNBC 1WJNA 4KGSA 1I4XA 4IWPA 2DYMA 2MJ3A 2L32A 1E10A 1DYQA 2RPVA 2BS4B 4G3XB 2FUHB 5G55A 3T8MA 1WFYA 2KACA 3AULA 1V97A 2WXOA 3DHGC 3V6CB 1TS4A 5H8YE 2LGXA 2ZZPB 2J0MA 1JALA 1T3QA 1SJED 2WU5B 1MJDA 2BS3B 4ASWC 2PKOA 1HXYD 4TKNA 4ZRQA 3AEEB 1C4PA 3IAM1 5E6JA 1YN5A 3R7RA 3ZIMA 3QJZA 2AEHA 1R4MI 4GDLB 4YTMB 3VRBB 3TEXA 2C7HA 2N9XA 2KX0A 2V4IB 4WJNA 4LJPB 2FE8A 2WXJA 2BKRB 4NPNA 2LRUA 1P7EA 1EF5A 1P7FA 1JW9D 2VZKD 2AQ3B 3PVLA 1IPGA 4JLCA 2QEJC 1V1PB 1ZW7A 4IG7B 2RDHA 2JY6A 2WXHA 1WM3A 2KO3A 1AW7A 1WIAA 3HM3A 2NMQA 4MH0E 4RGNA 4WQMA 1BMLC 2CU1A 3ZJTA 1SSNA 1EM7A 4LNKA 1WE7A 1WRDB 1GC7A 1TIFA 3DWGC 3S2AA 4HWIB 4BAXA 5C23A 1F2RI 3VAWA 4W9FA 2GBJA 2GI9A 1P9DU 2NPTB 4ITKA 2J0JA 1HEZE 3RULA 1C76A 1XQQA 4C80A 3BVMA 3U4EG 1N61A 3CSTA 2JUOA 4HXDA 2KFKB 2CKHB 2BGFA 4A9AA 2LFIA 4B95A 1M4VA 1U4AA 3RNCC 1KLGD 1E8XA 4KDLB 4M0WA 4ANWA 2UYZB 4HCPB 3I63C 3TL5A 4AWJA 4KSLC 3L13A 2L00B 2L83A 1K52A 2VZKB 2DZMA 4WWOA 2DZKA 2IO2B 4WIPA 3MC9A 3NVWA 1NI2A 3A1QB 3FILA 4FXCA 4MGZE 1VDVA 1XD3B 3ZNID 5KHQA 1YQ4B 3LXFA 2K1FA 3VUXA 2QMTA 5IA7A 1LQBA 3OJ3A 1SE2A 2M1MA 1AYFA 4NY0A 2L1AA 5H92C 1E7UA 5DCNA 4ACFA 1TKEA 1L6UA 4BKSA 3UF8A 2WYQA 4R3DA 5BYSA 5T8IA 3DCGA 2KDIA 3L17A 4JL9A 5JHBA 3AU4A 4JQWC 2KKCA 3DPDA 1UGMA 3KQ4A 3B0AA 2L0FA 2WXFA 4WQOB 1Z5SB 1J19A 2WX0A 3IXSA 3TUOA 4G0NB 1WGDA 1IBXA 3A4RA 1FIQA 1N5XA 3AXCA 4J6IA 3IFWB 1H8CA 1ROEA 2HJ8A 2KK8A 1WRIA 2ACZB 3Q3NC 2V3PA 2IJ0A 3GE8C 5HHDG 4E71A 2KAJA 4G50A 1V49A 3JW0X 4WWMA 2INPE 3UQBA 2BQQA 4RGMA 3NRZA 1RYJA 2J42A 3GB1A 4GDLA 2DZJA 2FIDA 2MHJA 4FBJB 3B2GA 3N1YC 2WXPA 4CYEA 3AE5B 2MBHA 2X38A 1I4HA 2Y5PA 3Q6BA 3H7PB 3WA0A 3EGRA 2IY0B 3JYUA 3AB5A 5FKAC 1JWBD 3R2IA 1H4RA 2IO3B 2K8HA 2V0GA 2HD5B 1PDXA 3BY4B 4ZDVA 3HIZA 2CHZA 2MJDA 3LYYA 1GAQB 2KD0A 3HM6X 1P1AA 1WF9A 4HPMB 4C00A 3BK2A 3H9DA 2WDRB 4US9A 2ZW0A 4P6VF 4BKGA 4F1SA 2Z0EB 3QCAA 4MT5A 2LRWA 4NAWB 2KQ4X 2BVCA 4X57B 1WR1A 1WZ3A 2N4FA 4OZAA 1PYWD 1HZ6A 2INNE 2PJHA 1J0GA 1T0RC 1C9FA 3QWZB 4FHKA 4A6QA 1OQRA 2WWZA 2O2VB 3RZFA 3V61A 3DBHI 3OWEB 4CO7A 4OVUA 3RD2A 1EF1A 1T0YA 3TMPB 4GMVA 3U2SC 3RI7C 2KFJA 1MG4A 4KGTA 2BYVE 3VVWB 3ZVVA 2AWTA 1XT9B 1JWUD 3R2TA 1PGXA 3LJ3A 1VZ8A 1FNWA 2NCNA 3PSEB 2Y3AA 3ETRA 3U8ZA 1KOTA 2CJNA 4DHJD 2I2YA 1QF6A 2QC8A 1TKYA 2HE7A 4N58A 1MPEA 2GBMA 2JZZA 3TIXA 1R7SA 1ZOYB 3QC8B 3FC4A 2G9HD 4EE2A 1IBXB 3VUWA 5CTRC 3FILB 4HEA1 2W9NA 2A4ZA 1R4NB 1RFKA 1KFYB 4DBGA 3U52E 1E6EB 1UBQA 4ANXA 1TS3A 1V86A 1C3TA 5IAAC 1E90A 1QZEA 5HKHA 2MWSB 2MBEA 2B76B 4FN2A 2WXNA 4NNJB 2RGFA 4B0MA 4YTNB 2N9KA 2KTFA 2LGSA 1LGRA 2OJRA 4ZOHC 3KLSX 1FM0D 3QARA 4HCNB 3VR8B 4W9KA 4DHZE 4MDKE 4GXBA 3SFEB 3OLMD 4K81A 1KLVA 4PT5A 3ZDMC 1IYFA 4BFRA 1HA5A 3SR6A 1K53A 2L76A 3EECA 3UQAA 5J18A 1JWMD 2MP2A 4AUQC 2OEDA 1JWAD 1DGJA 4LJOB 3C8YA 4LTUA 1NEKB 3CMMB 3IT6B 2KTRA 2AX5A 1NDDA 3APDA 1WYGA 2ZVNA 4P7IA 1IGCA 3PT2B 1WMHA 2KDFB 1MFWA 3H6NA 2M56B 3DBLI 2OOBB 2VH1A 2G4DB 3BINA 1F2RC 2JVCA 3E56A 2DZIA 2PVOD 4MELA 5IKCM 1HZ5A 3RN9C 3A33B 4A3OA 2QCZA 5EE1A 4BVUC 3ZGZA 1SE4A 3Q3OC 1GB1A 3ZDTA 1KH0A 1J7BA 1J8CA 1TJEA 3ZKJC 3I9V1 1WX9A 4IWOA 2QSDA 1P0RA 2O2VA 3SHQA 2MW5A 2N9LA 1I4QA 1FCLA 5HI1A 4AOFA 3DQVA 4ZYNA 4K3CA 2R2OA 2ON8A 3X23A 5TSSA 4XX5A 1ZXIA 1L6VA 2XBBC 2KLGA 1V81A 1XCTL 3R3MA 2R2QA 2J7QB 5LNK1 2W54A 4HKZE 1UH6A 4XDCA 3HK0A 4BBNF 2CS4A 2UWQA 1SIJA 3HUIA 1WR6E 2JT4B 1NYQA 2FBWB 1SB3C 2BWFA 1D6EC 1E9MA 3WCQA 3TJPA 4ANUA 4ARIA 1G6JA 2Z59B 2ZJDA 1WZ0A 2WQYB 3L08A 4XWWA 1C1YB 1RLFA 3DHHC 4P16A 2ZCBA 2DLBA 4ZYSA 2LEKA 2KJHB 2MJEA 2CJOA 3HHMA 2V4LA 1GB4A 2RPQA 2HDEA 2C7NB 4OZBA 3SFDB 2WP9B 4B9KA 2K8CA 4K7WA 3W5VB 2IY1B 2B3AA 3N32A 4L1BA 3TCAA 3ZNHB 2ZEQA 1VZ6A 1OEYJ 4OZCA 2MEKA 2WHIA 2M19A 2N1WA 4ZRPA 5G5GA 2C7MB 4IM3A 2PW9A 2WXRA 4S0RA 4M0WB 2D3BA 2KN4A 2Y5CA 1I35A 2KN5A 2DWQA 2QIEB 3V05A 1WY8A 5CHFA 3BK1A 2JRIB 2MQJA 5IO9A 2IO1B 4I6PA 4E3CA 1DOIA 2IGHA 1WX8A 1YMHE 4CQNA 1XF5L 4NAMA 2RR9A 3TEYA 3ML8A 3Q8EA 4IC7B 5D7GA 2KNBA 1MG8A 1TY2A 1YOVB 3A9JA 1NVID 2A5UA 2JZ3B 1HTOA 4GGQA 1PUTA 4HKQA 1L7YA 1L4ZB 2DENB 1UUPA 2HJ1A 3DBRB 1CQVA 2EMSA 1VJKA 3Q14C 2KJRA 2DAFA 2EELA 2LMCA 2EKEC 2L3ZA 3Q8AA 4ZRJA 3Q8CA 2K8BA 1OTRB 4RCOA 3IG3A 5AUIA 1TY0A 2LHDA 4LNIA 4RFBA 3ZRCA 2N7EA 3L10B 4ZRKA 3AE2B 4DQOC 3O13A 1A5RA 2JF5A 3EFUA 2EKIA 4KVGB 1FO4A 3B08A 4TUUA 2WX1A 2G1EA 4ZRIA 2IBIB 1WGGA 1I4RA 1BUIC 1CZPA 2KANA 2IZVB 1GPXA 5LXIB 4MJSA 3V3XA 2RD0A 3VHTC 1RRBA 2WLBA 2K6QA 2VH2A 1YX5B 3Q3JA 5DPWA 5HG2A 4JWSC 2ONQA 4ARCA 2JWUA 3M63B 1ZKHA 4NAWA 5C2TB 2K25A 2PE9A 3EA6A 1I7HA 3SEBA 3B9JA 2KVZA 4YWGG 3AEFB 4OVVA 3ZNZB 4RGOS 3VH4B 3PHXB 2KJ6A 5AZFA 3UIOB 3UGBB 3A1QA 2D07B 4KDIC 3B2FA 3CWIA 1UF0A 2PLPA 3Q3FA 2K9XA 4XE0A 2REXA 3BZDB 1OGWA 4HDQA 5C3JB 2HTHA 3NZ3A 4TQ0A 2NS5A 1D5XC 2KMAA 1IGDA 3R7QA 3M95A 3MHZA 1EWCA 2RSUA 1YQ3B 2XEWA 1XLPA 3K9PB 1V5OA 4USAA 1EO6A 2JSVX 2NBWB 1F52A 4WAFA 1WI0A 2Z0DB 4IDIA 4MSQB 3AV8A 4TSSA 3NOBA 3H8HA 3P4QB 1L2NA 1V2YA 3T3NA 1RAXA 2N1VA 1WGRA 2D3AA 3VQIA 3JSVB 4GB9A 1ET6A 1AARA 1KRHA 3PLUA 1L4DB 1T0QC 3KWVA 2RMMA 2ZPYA 1JRPA 3KUDB 3PO0A 1SXTA 3DVGY 3QQ8B 4KX6B 1X1MA 3J9CA 3RT3B 5LXHA 3DBRI 4NJ7A 2BW2A 2PTLA 1TYGB 2MH7A 2WXMA 3GS2A 2DAJA 4LLGM 3QX1A 1GC6A 2KC2A 2OHFA 1KM7A 5IOIA 4KZCA 1L5PA 2BT6A 4S17A 1SBBB 1F0ZA 3VUYA 1YN3A 1DOXA 2IPKD 1KTKA 1OQYA 2PMVA 3NZSA 2I38A 4HLEA 2MP2B 1YQBA 3HVZA 4IM2A 4GDKB 4K3BA 4YSXB 1FRRA 1VD2A 4LNFA 2WXLA 2QHOA 1QOFA 2WS3B 3B1LX 1SIFA 4AJYB 3Q8FA 5JZEB 4GSWA 4GOCA 5IP4D 3RCZA 3ZLZA 3WALA 2G4SA 4C4VA 2FIFA 2LUMA 3A4SC 1NYRA 1R4MB 4G11A 1JMLA 4FJZA 1QOGA 3U7ZA 3CIRB 1BXTA 4KGRA 2YEPB 1UNSA 1A70A 1VRAB 3DVNV 2FCSA 1UWXA 1WM2A 2ZVOA 2KLCA 2KMCA 2LVPA 5FR3A 1PQSA 3GZNI 4EUTA 1FPYA 4BOSC 2N7DA 3BVZA 1VR9A 4MM3A 2LWPA 5IN7A 1UD7A 2NR2A 3AE8B 4EZKA 3MHSD 4EZLA 5D3IB 2KDBA 4IOIE 4I6NB 3AE9B 3L4PA 1EUVB 4LNOA 1CK1A 2N0SB
chains in the Genus database with same CATH topology
2C7HA 2N9XA 2KX0A 4BVUC 4LCDE 2WDTB 4MGIE 4WJNA 3IVFA 4LJPB 5D94A 2BKRB 4I6LB 3VXWA 3ZDTA 4MJSB 2NBVB 4NPNA 2LRUA 3ZTDA 1J8CA 1EF5A 4F7ZA 4WJOA 3ZKJC 1FXTB 1WX9A 4IWOA 3PVLA 2MBQA 4A20A 1IPGA 1P98A 1P0RA 4JLCA 4DHJB 2L8JA 1ZW7A 2G3QB 2O2VA 4IG7B 3SHQA 3PRMB 1BT0A 2MW5A 2JY6A 3NZUA 4W9HA 3V6EB 1WM3A 5E6PA 2G45B 2KO3A 1NBFC 1WIAA 2L7RA 2MA9B 3HM3A 4EEWA 1P3QU 4MH0E 3D32A 4W9CA 3L54A 4AOFA 2DYOA 3DQVA 1Q5WB 4ZYNA 2CU1A 2R2OA 1CMXB 1WE7A 1WRDB 1GC7A 2KZRA 3S2AA 4HWIB 3ONSA 3APFA 2BYEA 4TQ1A 5C23A 4W9GA 3VAWA 4W9FA 3X23A 2GBJA 1P9DU 2NPTB 2J0JA 3CF6E 1V80A 3QA8A 4XX5A 3RULA 2V3SA 1XQQA 2XBBC 2KLGA 3L16A 4FADA 3W1SC 1V81A 3U30A 3R3MA 1E8ZA 2R2QA 2J7QB 3O65B 3CSTA 1E5WA 1UH6A 2JUOA 4FLHA 4HXDA 4W9JA 2KFKB 3HK0A 4BBNF 2CS4A 2CKHB 2UWQA 3KUCB 2BGFA 2L05A 3ECIA 1WR6E 2PE6B 2JT4B 5AEKB 4MGKE 2MCNB 2IO0B 4B95A 1UBIA 1U4AA 2N9EB 1V5TA 2BWFA 2KC1A 3PLVA 4PS7A 1E8XA 4KDLB 4ANWA 2UYZB 3TJPA 4ANUA 1E8YA 4HCPB 3TL5A 2CHXA 2LJ5A 1G6JA 2BWES 1VCBA 2Z59B 2ZJDA 1WZ0A 2D2QA 4AWJA 3L08A 4KSLC 1KJTA 1C1YB 1RLFA 5AZGA 3KH0A 2ZCBA 3L13A 2L00B 4ANVA 2DZMA 4WWOA 2DZKA 2KJHB 2IO2B 2BF8B 5DPTA 4W9EA 3QK0A 3HHMA 4DDGD 2V4LA 2GBKA 2RPQA 1NI2A 2C7NB 3A1QB 5AZHA 4MGZE 1XD3B 1F9JA 3JSVA 1TGZB 3OAWA 3ZNID 4B9KA 5J17A 5KHQA 1WXVA 2K8CA 4K7WA 2V1YA 2IY1B 2B3AA 4XC2A 3N32A 4FA6A 3R66C 2K1FA 3PREA 4LDTB 3VUXA 2JXXA 2LVQA 3TCAA 5IA7A 3ZNHB 4CHKA 1S3SG 1OEYJ 1LQBA 2ZEQA 2GOWA 3OJ3A 3ZTCA 2M1MA 1WE6A 3U7DA 2KOXA 2KWVB 4URKA 1E8WA 1JRUA 2LGYA 4NY0A 2N1WA 2XK5A 3JVZX 4XZ4A 3EC8A 4IW0A 2L0TA 1E7UA 1Y8RC 5DCNA 2C7MB 1YD8U 5CHVC 4IM3A 3VFKA 4MSMB 2JPHA 4HJKA 4M0WB 2WYQA 3UF8A 4BKSA 4BBNC 3RUIB 2KQSA 1I35A 2KN5A 3NHEB 5TR5A 5G2NA 1WY8A 3DCGA 4RMAA 2FCMA 2JRIB 5CHFA 2KDIA 3L17A 2MQJA 3DVNU 4JL9A 2DYBA 5JHBA 3AU4A 2IO1B 2VRRB 4JQWC 2KKCA 3DPDA 1UGMA 4I6PA 2C5LC 4E3CA 2JWZA 3B0AA 3W1YA 4KSKC 4IUMB 1WX8A 2L0FA 3VTUA 4WQOB 1Z5SB 2RR9A 1J19A 3ML8A 3LDZE 2WX0A 2KX3A 4IC7B 1WXSA 2KDEB 4G0NB 5D7GA 2KNBA 1MG8A 3W1SA 1WGDA 2LZ6A 3A9JA 3WIMA 3A4RA 1LM8B 2A5UA 2JZ3B 3AXCA 4J6IA 1YJ1A 5E6OA 4GGQA 3DVGX 1LFDA 3IFWB 1H8CA 1L7YA 2DENB 4W9DA 2HJ8A 4II3B 2KK8A 2EMSA 2AL6A 3WAPA 2EMTA 3H7SA 2KJRA 2DAFA 2LVOA 2MX2A 4E71A 2EKEC 2L3ZA 3ZNGC 1OEYA 4G50A 4ZRJA 1V49A 3TBLD 2K8BA 3OJ4B 3JW0X 3UQBA 4JIOU 1OTRB 2MBOA 3PS6A 1TBEA 4K1RB 3IG3A 4N9F4 1TTNA 2FCNA 3PZDA 4E74A 4GDLA 2DZJA 3ZRCA 2FIDA 1GUAB 4NJ6A 2N7EA 2M4NA 4FBJB 1E7VA 2O6VB 4IM0A 3L10B 3UIPB 2KXJA 3A9KA 3SU8X 4ZRKA 4KZ0A 3DDCB 2AYOB 1A5RA 2JF5A 4CYEA 3QAQA 2MBHA 4A3PA 5JH5C 3EFUA 4KVGB 3I3TB 1M94A 3H7PB 3B08A 4TUUA 2WX1A 4PS3A 4IWQA 3WA0A 2FAZA 2IY0B 2YLMA 5D6JB 4RM9A 3RZWC 1GNUA 4ZRIA 3JYUA 2IBIB 1WGGA 4DDID 4NQKE 2KANA 1H4RA 2IO3B 2K8HA 1Z2MA 3T9LA 4HK2A 2IZVB 1GG3A 4RM8A 2HD5B 2C9WB 3DBSA 5LXIB 3BY4B 2LI5A 4MJSA 4ZDVA 3HIZA 2CHZA 2RD0A 3VHTC 1RRBA 4M8MA 2K6QA 1WGHA 1YX5B 2ZPNA 2KD0A 4HDOA 3HM6X 3Q3JA 1P1AA 1WF9A 4HPMB 5DPWA 2AL3A 3H9DA 4M8NA 2LUEA 4HVBA 2YVCA 4BKGA 2O6VD 1K8RB 4JGHB 2D3GA 4F1SA 1HE8A 1ZKHA 3M63B 4ICUA 4NAWA 2Z0EB 3MTNB 3QCAA 2KVRA 3ENEA 3WAOA 3KW5B 3K9OB 2K25A 2PE9A 1TZ1A 5CX3A 3UINB 3H1UA 2LRWA 4AJWA 4NAWB 4EKUA 1WH3A 4YL8A 2GBNA 4X57B 1WJ4A 3N3KB 4OVVA 1WR1A 3PGEA 1WZ3A 3ZNZB 4BKSD 2GBRA 3VH4B 3CSFA 3PHXB 3ZO5B 2KJ6A 5AZFA 1LXDA 2KQ7A 2N4FA 3UGBB 3UIOB 3A1QA 3MJWA 1V9JA 4WWNA 2D07B 2PJHA 2LXAA 2K39A 2MRPA 2XK5B 5DPRA 2PPHA 3V60A 4KDIC 1J0GA 1S1QB 3M62B 1UZXB 3QWZB 4FHKA 2M17A 3Q3FA 4II2B 2REXA 3H7PA 1OGWA 2I1KA 4BKTA 4HDQA 5L83A 2C60A 3NS8A 2HTHA 4WJPA 4WWPA 2WWZA 2O2VB 3RZFA 4TQ0A 2NS5A 1WJUA 3V61A 3DBHI 4CO7A 2KMAA 5FR6A 3PHWB 3A9KB 3R7QA 3M95A 4OVUA 3RD2A 1EF1A 1T0YA 4W9IA 4DXAB 3TMPB 2RSUA 4ICVA 4GMVA 3AU5A 2XEWA 3K9PB 1V5OA 1R4NI 5KHOA 2KFJA 1EO6A 3M3JA 2I1JA 2KHWB 2NBWB 2LXCA 2BYVE 5C1ZA 2ZNVB 3VVWB 3V62A 5DPSA 4PYZA 3ZVVA 4KIKA 2J0KA 4FULA 2KWCA 2AWTA 2BYFA 1XT9B 4K7UA 1WI0A 2Z0DB 4MSQB 3RYTA 1WJ6A 3LJ3A 3NOBA 2CR5A 1L2NA 4DWFA 5E6NA 2NVUI 4GIVA 2NCNA 1V2YA 3VTVA 4AP4C 3PSEB 1RAXA 2N1VA 2N9PC 3IHPC 1WGRA 3KYDD 4W9LA 3U8ZA 3VQIA 3JSVB 4GDKA 1KOTA 3PLUA 4GB9A 1AARA 3ALBA 4DHJD 4DK5A 2HE7A 2GBMA 1V6EA 2JZZA 2ZPYA 4NQLB 3TIXA 3KUDB 3A9JB 3DVGY 3QC8B 3QQ8B 4KIKB 1X1MA 1IP9A 1D3ZA 3VUWA 1YX6B 2CHWA 2IYDB 3KVFB 5CTRC 3RT3B 5LXHA 3DBRI 4NJ7A 4B6WA 2W9NA 2A4ZA 5CHWA 2M0XA 2ZCCA 3WANA 2DAJA 4LDTD 3QX1A 1GJZA 4DBGA 1GC6A 2KC2A 3VH3B 4MEMA 1KM7A 1WGYA 4KZCA 1UBQA 3C0RB 4ANXA 2D10A 4BOZB 1V86A 2FNJB 3PRZA 2ZNVC 1C3TA 5IAAC 3QIJA 1E90A 4FJYA 1QZEA 5HKHA 2MWSB 2MBEA 4DHZB 4FN2A 4NNJB 2RGFA 2MBBB 1UELA 2NPTA 4MGYE 2KTFA 2KTRB 3QHTA 3VUYA 4F8CB 5L95C 5BO4B 1WXMA 3SD5A 1Q1OA 5EDSA 1WX7A 2D11A 2OJRA 4FHJA 4EOYA 1OQYA 2KFKA 3NZSA 4WAAA 4HLEA 2M8SA 2MSED 3ML9A 2O6VA 2MP2B 1YQBA 3QARA 2ASQA 4HCNB 3P2BA 4IM2A 4W9KA 2DHZA 4DHZE 5JHAA 4GDKB 1ISNA 1VD2A 2LASA 4MDKE 4GXBA 3N30A 3NY5A 1YIWA 2QHOA 2DX5B 3OLMD 2LD9A 3PV1A 3B1LX 4K81A 1SIFA 1KLVA 4AJYB 3PPAA 4KV2A 5JZEB 4GU2A 5J2RA 4GSWA 2NBUA 3ZDMC 4GOCA 4FJVB 1IYFA 4BFRA 1WMHB 1SGHA 1Q0WB 1WXAA 2L76A 3EECA 3VDZA 3UQAA 5J18A 2KWUB 3KYCD 5D2MB 3RCZA 3ZLZA 3WALA 2MP2A 2GMIC 4AUQC 2FCQA 2G4SA 4PYUA 4WJQA 1WYWB 2FIFA 5LLIA 3A4SC 4LJOB 2BKFA 3L0WB 2PEAA 3DOWA 2LGDA 4G11A 4GN1A 4FJZA 3PTFC 1WJNA 3CMMB 4IWPA 2DYMA 2KTRA 1NDDA 3APCA 2FCSA 3DVNV 3ZUNA 1WM2A 2ZVOA 3APDA 3IBEA 2KLCA 3PRPB 2ZVNA 4P7IA 4EFOA 2KMCA 2LVPA 3PT2B 1WMHA 2FUHB 1PQSA 3GZNI 4G3XB 5G55A 3T8MA 1WFYA 3AULA 4EUTA 2KDFB 4BOSC 2N7DA 1I42A 3V6CB 2LGXA 3SDLC 3GOEA 3H6NA 2ZZPB 4MM3A 2J0MA 3DBLI 2LWPA 1RFAA 2OOBB 1UD7A 2G4DB 2NR2A 2Y5BB 3BINA 2MLBA 2JVCA 3AI5A 3KUZA 3ZW3A 4EZKA 3EHVA 4TV3A 3MHSD 1SE9A 4ASWC 3WAMA 4EZJA 2DZIA 4HPLB 3X0WA 4TKNA 4EZLA 2KDBA 3ZRFA 4MELA 4K7SA 4I6NB 5GMVA 2BPSA 3VTWA 3A33B 3ZIMA 2JRHA 1EUVB 3R7RA 4PS8A 1ZGUB 3QJZA 2AEHA 4A3OA 1R4MI 4GDLB 2K6DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7H A;  2N9X A;  2KX0 A;  4BVU C;  4LCD E;  2WDT B;  4MGI E;  4WJN A;  3IVF A;  4LJP B;  5D94 A;  2BKR B;  4I6L B;  3VXW A;  3ZDT A;  4MJS B;  2NBV B;  4NPN A;  2LRU A;  3ZTD A;  1J8C A;  1EF5 A;  4F7Z A;  4WJO A;  3ZKJ C;  1FXT B;  1WX9 A;  4IWO A;  3PVL A;  2MBQ A;  4A20 A;  1IPG A;  1P98 A;  1P0R A;  4JLC A;  4DHJ B;  2L8J A;  1ZW7 A;  2G3Q B;  2O2V A;  4IG7 B;  3SHQ A;  3PRM B;  1BT0 A;  2MW5 A;  2JY6 A;  3NZU A;  4W9H A;  3V6E B;  1WM3 A;  5E6P A;  2G45 B;  2KO3 A;  1NBF C;  1WIA A;  2L7R A;  2MA9 B;  3HM3 A;  4EEW A;  1P3Q U;  4MH0 E;  3D32 A;  4W9C A;  3L54 A;  4AOF A;  2DYO A;  3DQV A;  1Q5W B;  4ZYN A;  2CU1 A;  2R2O A;  1CMX B;  1WE7 A;  1WRD B;  1GC7 A;  2KZR A;  3S2A A;  4HWI B;  3ONS A;  3APF A;  2BYE A;  4TQ1 A;  5C23 A;  4W9G A;  3VAW A;  4W9F A;  3X23 A;  2GBJ A;  1P9D U;  2NPT B;  2J0J A;  3CF6 E;  1V80 A;  3QA8 A;  4XX5 A;  3RUL A;  2V3S A;  1XQQ A;  2XBB C;  2KLG A;  3L16 A;  4FAD A;  3W1S C;  1V81 A;  3U30 A;  3R3M A;  1E8Z A;  2R2Q A;  2J7Q B;  3O65 B;  3CST A;  1E5W A;  1UH6 A;  2JUO A;  4FLH A;  4HXD A;  4W9J A;  2KFK B;  3HK0 A;  4BBN F;  2CS4 A;  2CKH B;  2UWQ A;  3KUC B;  2BGF A;  2L05 A;  3ECI A;  1WR6 E;  2PE6 B;  2JT4 B;  5AEK B;  4MGK E;  2MCN B;  2IO0 B;  4B95 A;  1UBI A;  1U4A A;  2N9E B;  1V5T A;  2BWF A;  2KC1 A;  3PLV A;  4PS7 A;  1E8X A;  4KDL B;  4ANW A;  2UYZ B;  3TJP A;  4ANU A;  1E8Y A;  4HCP B;  3TL5 A;  2CHX A;  2LJ5 A;  1G6J A;  2BWE S;  1VCB A;  2Z59 B;  2ZJD A;  1WZ0 A;  2D2Q A;  4AWJ A;  3L08 A;  4KSL C;  1KJT A;  1C1Y B;  1RLF A;  5AZG A;  3KH0 A;  2ZCB A;  3L13 A;  2L00 B;  4ANV A;  2DZM A;  4WWO A;  2DZK A;  2KJH B;  2IO2 B;  2BF8 B;  5DPT A;  4W9E A;  3QK0 A;  3HHM A;  4DDG D;  2V4L A;  2GBK A;  2RPQ A;  1NI2 A;  2C7N B;  3A1Q B;  5AZH A;  4MGZ E;  1XD3 B;  1F9J A;  3JSV A;  1TGZ B;  3OAW A;  3ZNI D;  4B9K A;  5J17 A;  5KHQ A;  1WXV A;  2K8C A;  4K7W A;  2V1Y A;  2IY1 B;  2B3A A;  4XC2 A;  3N32 A;  4FA6 A;  3R66 C;  2K1F A;  3PRE A;  4LDT B;  3VUX A;  2JXX A;  2LVQ A;  3TCA A;  5IA7 A;  3ZNH B;  4CHK A;  1S3S G;  1OEY J;  1LQB A;  2ZEQ A;  2GOW A;  3OJ3 A;  3ZTC A;  2M1M A;  1WE6 A;  3U7D A;  2KOX A;  2KWV B;  4URK A;  1E8W A;  1JRU A;  2LGY A;  4NY0 A;  2N1W A;  2XK5 A;  3JVZ X;  4XZ4 A;  3EC8 A;  4IW0 A;  2L0T A;  1E7U A;  1Y8R C;  5DCN A;  2C7M B;  1YD8 U;  5CHV C;  4IM3 A;  3VFK A;  4MSM B;  2JPH A;  4HJK A;  4M0W B;  2WYQ A;  3UF8 A;  4BKS A;  4BBN C;  3RUI B;  2KQS A;  1I35 A;  2KN5 A;  3NHE B;  5TR5 A;  5G2N A;  1WY8 A;  3DCG A;  4RMA A;  2FCM A;  2JRI B;  5CHF A;  2KDI A;  3L17 A;  2MQJ A;  3DVN U;  4JL9 A;  2DYB A;  5JHB A;  3AU4 A;  2IO1 B;  2VRR B;  4JQW C;  2KKC A;  3DPD A;  1UGM A;  4I6P A;  2C5L C;  4E3C A;  2JWZ A;  3B0A A;  3W1Y A;  4KSK C;  4IUM B;  1WX8 A;  2L0F A;  3VTU A;  4WQO B;  1Z5S B;  2RR9 A;  1J19 A;  3ML8 A;  3LDZ E;  2WX0 A;  2KX3 A;  4IC7 B;  1WXS A;  2KDE B;  4G0N B;  5D7G A;  2KNB A;  1MG8 A;  3W1S A;  1WGD A;  2LZ6 A;  3A9J A;  3WIM A;  3A4R A;  1LM8 B;  2A5U A;  2JZ3 B;  3AXC A;  4J6I A;  1YJ1 A;  5E6O A;  4GGQ A;  3DVG X;  1LFD A;  3IFW B;  1H8C A;  1L7Y A;  2DEN B;  4W9D A;  2HJ8 A;  4II3 B;  2KK8 A;  2EMS A;  2AL6 A;  3WAP A;  2EMT A;  3H7S A;  2KJR A;  2DAF A;  2LVO A;  2MX2 A;  4E71 A;  2EKE C;  2L3Z A;  3ZNG C;  1OEY A;  4G50 A;  4ZRJ A;  1V49 A;  3TBL D;  2K8B A;  3OJ4 B;  3JW0 X;  3UQB A;  4JIO U;  1OTR B;  2MBO A;  3PS6 A;  1TBE A;  4K1R B;  3IG3 A;  4N9F 4;  1TTN A;  2FCN A;  3PZD A;  4E74 A;  4GDL A;  2DZJ A;  3ZRC A;  2FID A;  1GUA B;  4NJ6 A;  2N7E A;  2M4N A;  4FBJ B;  1E7V A;  2O6V B;  4IM0 A;  3L10 B;  3UIP B;  2KXJ A;  3A9K A;  3SU8 X;  4ZRK A;  4KZ0 A;  3DDC B;  2AYO B;  1A5R A;  2JF5 A;  4CYE A;  3QAQ A;  2MBH A;  4A3P A;  5JH5 C;  3EFU A;  4KVG B;  3I3T B;  1M94 A;  3H7P B;  3B08 A;  4TUU A;  2WX1 A;  4PS3 A;  4IWQ A;  3WA0 A;  2FAZ A;  2IY0 B;  2YLM A;  5D6J B;  4RM9 A;  3RZW C;  1GNU A;  4ZRI A;  3JYU A;  2IBI B;  1WGG A;  4DDI D;  4NQK E;  2KAN A;  1H4R A;  2IO3 B;  2K8H A;  1Z2M A;  3T9L A;  4HK2 A;  2IZV B;  1GG3 A;  4RM8 A;  2HD5 B;  2C9W B;  3DBS A;  5LXI B;  3BY4 B;  2LI5 A;  4MJS A;  4ZDV A;  3HIZ A;  2CHZ A;  2RD0 A;  3VHT C;  1RRB A;  4M8M A;  2K6Q A;  1WGH A;  1YX5 B;  2ZPN A;  2KD0 A;  4HDO A;  3HM6 X;  3Q3J A;  1P1A A;  1WF9 A;  4HPM B;  5DPW A;  2AL3 A;  3H9D A;  4M8N A;  2LUE A;  4HVB A;  2YVC A;  4BKG A;  2O6V D;  1K8R B;  4JGH B;  2D3G A;  4F1S A;  1HE8 A;  1ZKH A;  3M63 B;  4ICU A;  4NAW A;  2Z0E B;  3MTN B;  3QCA A;  2KVR A;  3ENE A;  3WAO A;  3KW5 B;  3K9O B;  2K25 A;  2PE9 A;  1TZ1 A;  5CX3 A;  3UIN B;  3H1U A;  2LRW A;  4AJW A;  4NAW B;  4EKU A;  1WH3 A;  4YL8 A;  2GBN A;  4X57 B;  1WJ4 A;  3N3K B;  4OVV A;  1WR1 A;  3PGE A;  1WZ3 A;  3ZNZ B;  4BKS D;  2GBR A;  3VH4 B;  3CSF A;  3PHX B;  3ZO5 B;  2KJ6 A;  5AZF A;  1LXD A;  2KQ7 A;  2N4F A;  3UGB B;  3UIO B;  3A1Q A;  3MJW A;  1V9J A;  4WWN A;  2D07 B;  2PJH A;  2LXA A;  2K39 A;  2MRP A;  2XK5 B;  5DPR A;  2PPH A;  3V60 A;  4KDI C;  1J0G A;  1S1Q B;  3M62 B;  1UZX B;  3QWZ B;  4FHK A;  2M17 A;  3Q3F A;  4II2 B;  2REX A;  3H7P A;  1OGW A;  2I1K A;  4BKT A;  4HDQ A;  5L83 A;  2C60 A;  3NS8 A;  2HTH A;  4WJP A;  4WWP A;  2WWZ A;  2O2V B;  3RZF A;  4TQ0 A;  2NS5 A;  1WJU A;  3V61 A;  3DBH I;  4CO7 A;  2KMA A;  5FR6 A;  3PHW B;  3A9K B;  3R7Q A;  3M95 A;  4OVU A;  3RD2 A;  1EF1 A;  1T0Y A;  4W9I A;  4DXA B;  3TMP B;  2RSU A;  4ICV A;  4GMV A;  3AU5 A;  2XEW A;  3K9P B;  1V5O A;  1R4N I;  5KHO A;  2KFJ A;  1EO6 A;  3M3J A;  2I1J A;  2KHW B;  2NBW B;  2LXC A;  2BYV E;  5C1Z A;  2ZNV B;  3VVW B;  3V62 A;  5DPS A;  4PYZ A;  3ZVV A;  4KIK A;  2J0K A;  4FUL A;  2KWC A;  2AWT A;  2BYF A;  1XT9 B;  4K7U A;  1WI0 A;  2Z0D B;  4MSQ B;  3RYT A;  1WJ6 A;  3LJ3 A;  3NOB A;  2CR5 A;  1L2N A;  4DWF A;  5E6N A;  2NVU I;  4GIV A;  2NCN A;  1V2Y A;  3VTV A;  4AP4 C;  3PSE B;  1RAX A;  2N1V A;  2N9P C;  3IHP C;  1WGR A;  3KYD D;  4W9L A;  3U8Z A;  3VQI A;  3JSV B;  4GDK A;  1KOT A;  3PLU A;  4GB9 A;  1AAR A;  3ALB A;  4DHJ D;  4DK5 A;  2HE7 A;  2GBM A;  1V6E A;  2JZZ A;  2ZPY A;  4NQL B;  3TIX A;  3KUD B;  3A9J B;  3DVG Y;  3QC8 B;  3QQ8 B;  4KIK B;  1X1M A;  1IP9 A;  1D3Z A;  3VUW A;  1YX6 B;  2CHW A;  2IYD B;  3KVF B;  5CTR C;  3RT3 B;  5LXH A;  3DBR I;  4NJ7 A;  4B6W A;  2W9N A;  2A4Z A;  5CHW A;  2M0X A;  2ZCC A;  3WAN A;  2DAJ A;  4LDT D;  3QX1 A;  1GJZ A;  4DBG A;  1GC6 A;  2KC2 A;  3VH3 B;  4MEM A;  1KM7 A;  1WGY A;  4KZC A;  1UBQ A;  3C0R B;  4ANX A;  2D10 A;  4BOZ B;  1V86 A;  2FNJ B;  3PRZ A;  2ZNV C;  1C3T A;  5IAA C;  3QIJ A;  1E90 A;  4FJY A;  1QZE A;  5HKH A;  2MWS B;  2MBE A;  4DHZ B;  4FN2 A;  4NNJ B;  2RGF A;  2MBB B;  1UEL A;  2NPT A;  4MGY E;  2KTF A;  2KTR B;  3QHT A;  3VUY A;  4F8C B;  5L95 C;  5BO4 B;  1WXM A;  3SD5 A;  1Q1O A;  5EDS A;  1WX7 A;  2D11 A;  2OJR A;  4FHJ A;  4EOY A;  1OQY A;  2KFK A;  3NZS A;  4WAA A;  4HLE A;  2M8S A;  2MSE D;  3ML9 A;  2O6V A;  2MP2 B;  1YQB A;  3QAR A;  2ASQ A;  4HCN B;  3P2B A;  4IM2 A;  4W9K A;  2DHZ A;  4DHZ E;  5JHA A;  4GDK B;  1ISN A;  1VD2 A;  2LAS A;  4MDK E;  4GXB A;  3N30 A;  3NY5 A;  1YIW A;  2QHO A;  2DX5 B;  3OLM D;  2LD9 A;  3PV1 A;  3B1L X;  4K81 A;  1SIF A;  1KLV A;  4AJY B;  3PPA A;  4KV2 A;  5JZE B;  4GU2 A;  5J2R A;  4GSW A;  2NBU A;  3ZDM C;  4GOC A;  4FJV B;  1IYF A;  4BFR A;  1WMH B;  1SGH A;  1Q0W B;  1WXA A;  2L76 A;  3EEC A;  3VDZ A;  3UQA A;  5J18 A;  2KWU B;  3KYC D;  5D2M B;  3RCZ A;  3ZLZ A;  3WAL A;  2MP2 A;  2GMI C;  4AUQ C;  2FCQ A;  2G4S A;  4PYU A;  4WJQ A;  1WYW B;  2FIF A;  5LLI A;  3A4S C;  4LJO B;  2BKF A;  3L0W B;  2PEA A;  3DOW A;  2LGD A;  4G11 A;  4GN1 A;  4FJZ A;  3PTF C;  1WJN A;  3CMM B;  4IWP A;  2DYM A;  2KTR A;  1NDD A;  3APC A;  2FCS A;  3DVN V;  3ZUN A;  1WM2 A;  2ZVO A;  3APD A;  3IBE A;  2KLC A;  3PRP B;  2ZVN A;  4P7I A;  4EFO A;  2KMC A;  2LVP A;  3PT2 B;  1WMH A;  2FUH B;  1PQS A;  3GZN I;  4G3X B;  5G55 A;  3T8M A;  1WFY A;  3AUL A;  4EUT A;  2KDF B;  4BOS C;  2N7D A;  1I42 A;  3V6C B;  2LGX A;  3SDL C;  3GOE A;  3H6N A;  2ZZP B;  4MM3 A;  2J0M A;  3DBL I;  2LWP A;  1RFA A;  2OOB B;  1UD7 A;  2G4D B;  2NR2 A;  2Y5B B;  3BIN A;  2MLB A;  2JVC A;  3AI5 A;  3KUZ A;  3ZW3 A;  4EZK A;  3EHV A;  4TV3 A;  3MHS D;  1SE9 A;  4ASW C;  3WAM A;  4EZJ A;  2DZI A;  4HPL B;  3X0W A;  4TKN A;  4EZL A;  2KDB A;  3ZRF A;  4MEL A;  4K7S A;  4I6N B;  5GMV A;  2BPS A;  3VTW A;  3A33 B;  3ZIM A;  2JRH A;  1EUV B;  3R7R A;  4PS8 A;  1ZGU B;  3QJZ A;  2AEH A;  4A3O A;  1R4M I;  4GDL B;  2K6D B; 
#chains in the Genus database with same CATH topology
 2H89 B;  2IDY A;  2NTT A;  5MPO A;  1TZO A;  4MJS B;  2NBV B;  4YT0 B;  4RF0 A;  4F7Z A;  4WJO A;  1FXT B;  3PZ7 A;  1XEE A;  2MBQ A;  1L0X B;  2L8J A;  1F1H A;  1YNT E;  2G45 B;  2L7R A;  2MA9 B;  1P3Q U;  2D3C A;  1JCK B;  4PK1 A;  2J52 A;  1Q5W B;  2KZR A;  3NVZ A;  3ONS A;  3APF A;  2BYE A;  1L0V B;  1V80 A;  1FFU A;  3W1S C;  1E8Z A;  4MM3 B;  4XDD A;  3O65 B;  1E5W A;  4FLH A;  2J4X A;  1XLN A;  1VLB A;  4DXG A;  2GRI A;  2L05 A;  4RNA A;  2PE6 B;  1ZP0 B;  2MCN B;  2N9E B;  3GP7 A;  1NI3 A;  2W82 A;  4C56 C;  3N1X C;  2CHX A;  2BWE S;  2SEB D;  2D2Q A;  3DHI C;  1KJT A;  3ZXR A;  4YXD B;  5DPT A;  4W9E A;  2JYT A;  3QK0 A;  2WNM A;  1ESF A;  5AZH A;  1F9J A;  5J17 A;  4XC2 A;  4FA6 A;  1MHH E;  4LDT B;  3PRE A;  1TKG A;  4C7Z A;  2LVQ A;  3Q69 A;  4CHK A;  1S3S G;  3W9C B;  3ZTC A;  1C77 A;  5HFY A;  3U7D A;  2DBY A;  2JX5 A;  2KWV B;  2KOX A;  1E8W A;  1JRU A;  2LGY A;  4HRS A;  2XK5 A;  1FXI A;  3EC8 A;  4NZL B;  3T3O A;  1Y8R C;  3NS1 A;  4L23 A;  1K50 A;  1YD8 U;  3VFK A;  4MSM B;  2JPH A;  2X8X X;  1L0Y B;  2KQS A;  4MH8 A;  4OHJ A;  3NHE B;  5G2N A;  1SF0 A;  5CHV C;  1FMA D;  2VRR B;  3AE1 B;  2JWZ A;  4KSK C;  3EFC A;  3LDZ E;  3W1S A;  1KLU D;  2KX3 A;  1WXS A;  2KDE B;  4A90 A;  2LZ6 A;  2BBC A;  1LM8 B;  2M0A A;  4D2K A;  1YJ1 A;  3DVG X;  1FFV A;  1LFD A;  4W9D A;  1QIL A;  4KKJ A;  2AL6 A;  3WAP A;  3Q3M C;  3H7S A;  2LVO A;  4UDU C;  1RWS A;  2SAK A;  2OJW A;  2JZP A;  3ZYY X;  3ZNG C;  1OEY A;  1C4C A;  3TBL D;  4JIO U;  3PS6 A;  2MBO A;  3TEW A;  4JX1 C;  1FXA A;  4N9F 4;  2FCN A;  3P4P B;  3AE3 B;  1GUA B;  4IM0 A;  3AN1 A;  3SU8 X;  2XNA C;  2WXQ A;  2AYO B;  4M02 A;  3QAQ A;  4A3P A;  3TSS A;  3I3T B;  3BYY B;  4PS3 A;  5JXV A;  5D6J B;  4RM9 A;  3RZW C;  1N5W A;  2W3S A;  1Z2M A;  1XLO A;  4HK2 A;  2JXT A;  4RM8 A;  4YSY B;  1PFD A;  1N62 A;  3AM9 A;  4M8M A;  2W3R A;  4ZHP A;  4H2A A;  1WGH A;  4B0E A;  4HDO A;  1STE A;  4M8N A;  1FNU A;  2YVC A;  2O6V D;  4JGH B;  1YJJ A;  3MTN B;  2KVR A;  4A55 A;  3N20 C;  1TZ1 A;  4OVZ A;  5CX3 A;  4LK0 M;  1WH3 A;  4L2Y A;  1D5Z C;  4BKS D;  1LXD A;  3MJW A;  1V9J A;  3OG5 A;  2K39 A;  2MRP A;  2PPH A;  3DWM A;  5D3D A;  2M17 A;  4II2 B;  3H7P A;  2I1K A;  4BKT A;  3NS8 A;  4WJP A;  1HQR D;  1WJU A;  2JQR B;  4JE3 B;  4US8 A;  5KHO A;  3M3J A;  2I1J A;  2LXC A;  3N1Z C;  5C1Z A;  3URY A;  2KWC A;  1NEN B;  4NJC A;  1JWS D;  3RYT A;  1QKZ A;  2CR5 A;  2LHE A;  5E6N A;  1ACC A;  2NVU I;  1T0S C;  3VTV A;  4AP4 C;  2N9P C;  2PIA A;  3IHP C;  4W9L A;  5BMG A;  2V3N A;  1FRD A;  1V6E A;  4NQL B;  3A9J B;  4KIK B;  1J7A A;  5EE3 A;  1IP9 A;  1D3Z A;  1D4B A;  2IYD B;  3ZXV A;  5CHW A;  2M0X A;  1ZPS A;  2ZCC A;  2FUG 1;  3MC0 B;  1QOB A;  1WGY A;  4BOZ B;  1N63 A;  4DXF A;  3QIJ A;  4RH6 A;  4DHZ B;  1T6B X;  4YSZ B;  2NPT A;  2UU7 A;  5L95 C;  2KTR B;  3QHT A;  4REZ A;  3AMZ A;  2NTS A;  5BO4 B;  1I4P A;  1WX7 A;  3NJT A;  4FHJ A;  1GOZ A;  2KFK A;  2M8S A;  1B1Z A;  3MC8 A;  2ASQ A;  4M01 A;  1E0Z A;  2DHZ A;  5JHA A;  5GXG B;  4KKI A;  3NY5 A;  3P42 A;  3AE7 B;  5I4D A;  3PPA A;  5J2R A;  4GU2 A;  2NBU A;  4FJV B;  1WMH B;  1SGH A;  1XCQ L;  1Q0W B;  3Q8B A;  3VDZ A;  4C4V B;  4LNN A;  2KWU B;  2GMI C;  1ENF A;  1EWY C;  2FCQ A;  4MAC A;  4PYU A;  1V1O A;  2BKF A;  3DOW A;  3PTF C;  3IT4 B;  3ZUN A;  3APC A;  1V8C A;  3I5J C;  3IBE A;  3PRP B;  4EFO A;  3NG0 A;  2WGS A;  1XXG A;  3NUH B;  3FKY A;  1I42 A;  3SDL C;  3GOE A;  3ZJU A;  1RFA A;  2Y5B B;  3RNE C;  2MLB A;  1ZE3 D;  1PGB A;  3AI5 A;  3KUZ A;  3ZW3 A;  3EHV A;  4TV3 A;  1SE9 A;  3WAM A;  4EZJ A;  4HPL B;  3KWL A;  3X0W A;  3ZRF A;  2WDV B;  1ZXH A;  4K7S A;  5GMV A;  3R8B A;  1FCC C;  1HTQ A;  2BPS A;  3VTW A;  4RF1 A;  2ZW1 A;  2JRH A;  4PS8 A;  1ZGU B;  3AEB B;  2BYT A;  2K6D B;  4LCD E;  3ZJV A;  1ZDX A;  2WDT B;  2E3T A;  4MGI E;  3IVF A;  1IUE A;  5D94 A;  4I6L B;  3VXW A;  3ZTD A;  3MP9 A;  2JYE A;  4Q2J A;  1C4A A;  4A20 A;  1P98 A;  4DHJ B;  2G3Q B;  3PRM B;  1BT0 A;  1ZDV A;  3AED B;  3NZU A;  3P4R B;  4W9H A;  3V6E B;  3MJ5 A;  5E6P A;  1NBF C;  1D5M C;  4EEW A;  2V9H A;  4AS1 A;  3D32 A;  4W9C A;  2TSS A;  3L54 A;  2DYO A;  3FAH A;  3EUB 2;  4J3O D;  4RGT A;  2BB5 A;  3W5U B;  3Q2A C;  1CMX B;  3E9S A;  4TQ1 A;  4W9G A;  3P63 A;  3CF6 E;  3QA8 A;  2JU6 X;  2V3S A;  1YJI A;  3L16 A;  4FAD A;  3U30 A;  4YTP B;  5FK9 C;  4W9J A;  3MFG A;  3AE6 B;  1RM6 C;  2LGI A;  3KUC B;  2L52 A;  3ECI A;  5AEK B;  1YN4 A;  4MGK E;  4P1C C;  1SEB D;  2IO0 B;  4OW0 A;  1UBI A;  3PLV A;  1V5T A;  2KC1 A;  4PS7 A;  5G5H A;  1E8Y A;  3ZQ4 A;  2LJ5 A;  1VCB A;  4XGA B;  1SJH D;  3AE4 B;  5EE0 A;  5AZG A;  3KH0 A;  1ET9 A;  2RDB C;  2KT7 A;  4ANV A;  2BF8 B;  1TT5 B;  4DDG D;  2INC C;  1WXQ A;  2GBK A;  3JSV A;  1TGZ B;  1FNV A;  2BS2 B;  3OAW A;  1WXV A;  1N60 A;  1I4G A;  2V1Y A;  3R66 C;  2WXK A;  3HVD A;  2JXX A;  5AUK A;  1MHX A;  4HJG E;  3HRD D;  2GOW A;  1WE6 A;  4URK A;  1EU4 A;  3RMK C;  3JVZ X;  4JPS A;  2K5P A;  4IW0 A;  4XZ4 A;  2L0T A;  2ICI A;  2K22 A;  2XN9 C;  3RFZ B;  3P4S B;  4QAY A;  4HJK A;  4HPP A;  4BBN C;  3RUI B;  3LB8 C;  5TR5 A;  4RMA A;  2FCM A;  3DVN U;  2DYB A;  2WXG A;  4A8X C;  1OFF A;  2C5L C;  3W1Y A;  1EU3 A;  4IUM B;  1K51 A;  3VTU A;  4WUR A;  3ABV B;  4IKG A;  3WIM A;  1ZUD 2;  4WH4 A;  5E6O A;  4AQ7 A;  3PZ8 A;  4II3 B;  4BZA A;  3VR9 B;  3N9Y C;  2EMT A;  1C79 A;  2MX2 A;  1VZ7 A;  3OJ4 B;  1TS5 A;  4XWT A;  1TBE A;  4K1R B;  2QIL A;  1TTN A;  2GB1 A;  3PZD A;  4N59 A;  4E74 A;  1F77 A;  2LJI A;  4NJ6 A;  3IAS 1;  2M4N A;  1E7V A;  2O6V B;  3UIP B;  2DNF A;  1AN8 A;  2KXJ A;  3A9K A;  4KZ0 A;  1KF6 B;  3DDC B;  4O1N A;  2N7J A;  2IGG A;  5JH5 C;  3RNA C;  2PVG C;  1M94 A;  2QJL A;  2K0P A;  4IWQ A;  2FAZ A;  2YLM A;  1DOY A;  1GNU A;  2AQ1 B;  4DDI D;  1TS2 A;  3UI3 A;  4NQK E;  5BYR A;  1PGA A;  3T9L A;  1GG3 A;  1JQ4 A;  3DBS A;  2C9W B;  3RNF C;  4JWU C;  1WGK A;  2LI5 A;  2KMM A;  3DBH B;  2ZPN A;  2AL3 A;  1CJE A;  1C78 A;  1MI0 A;  1J7C A;  2LUE A;  4HVB A;  1K8R B;  2D3G A;  4C7Y A;  2QDF A;  1HE8 A;  1T5X D;  4ICU A;  3ENE A;  3WAO A;  3KW5 B;  3K9O B;  2H88 B;  4AJW A;  3UIN B;  3H1U A;  2WDQ B;  4EKU A;  1QQR A;  2GBN A;  4YL8 A;  1MVK A;  1WJ4 A;  3N3K B;  1LO5 D;  2CU3 A;  3PGE A;  3BYT B;  3VRA B;  2GBR A;  2D5G A;  3CSF A;  2WXI A;  3ZO5 B;  2KQ7 A;  2IGD A;  4WWN A;  2LXA A;  5DPR A;  2XK5 B;  3V60 A;  3BII D;  3I57 A;  4HRO A;  1S1Q B;  3M62 B;  1UZX B;  3DBL B;  3AEG B;  4TMA B;  5L83 A;  2BTE A;  2C60 A;  4WWP A;  1V1P A;  1Y56 A;  5BYQ A;  3TEZ A;  5FR6 A;  3AEC B;  3A9K B;  3PHW B;  4N6E B;  1OQQ A;  4DXA B;  4W9I A;  1XO3 A;  2E6X A;  4ICV A;  3AU5 A;  1R4N I;  2KHW B;  3AEA B;  2ZNV B;  2RDG A;  3V62 A;  5DPS A;  4PYZ A;  3NVY A;  4KIK A;  2J0K A;  2BB6 A;  4FUL A;  1FD6 A;  2BYF A;  4K7U A;  3P1M A;  1WJ6 A;  4DWF A;  4GIV A;  2Q5W D;  3C19 A;  1FEH A;  3KYD D;  2HTM E;  4GDK A;  3ALB A;  4DK5 A;  3NVV A;  2K3U A;  1B9R A;  1YX6 B;  2CHW A;  3KVF B;  2YEP F;  4B6W A;  1N6Z A;  1QT9 A;  3AH7 A;  4M00 A;  3WAN A;  4LDT D;  1Q10 A;  1GJZ A;  3VH3 B;  4MEM A;  2KDM A;  3C0R B;  3RPF C;  2D10 A;  2FNJ B;  3PRZ A;  2ZNV C;  3BVG A;  2WU2 B;  4FJY A;  1AWD A;  5EE9 A;  1UWM A;  1WWT A;  2KYW A;  2MBB B;  1UEL A;  4MGY E;  4F8C B;  1WXM A;  3SD5 A;  1Q1O A;  5EDS A;  1QOA A;  2D11 A;  4EOY A;  3GE3 C;  3BWU D;  4WAA A;  2GLS A;  1JRO A;  2MSE D;  3ML9 A;  2O6V A;  1SE3 A;  3P2B A;  1E7P B;  3GZN B;  1UGJ A;  5BMH A;  2R61 A;  1ISN A;  2LAS A;  3N30 A;  1YIW A;  2DX5 B;  2LD9 A;  3PV1 A;  2W55 A;  2IND C;  4KV2 A;  4XYC A;  2Z8L A;  2AQ2 B;  3RNG C;  1QLB B;  1WXA A;  2J53 A;  3W2D A;  3KYC D;  5D2M B;  5BMI A;  2KWD A;  4GLS C;  4WJQ A;  1WYW B;  5LLI A;  1WSP A;  1XLQ A;  4ZHO A;  3L0W B;  2PEA A;  2LGD A;  4P1B C;  4GN1 A;  3RNB C;  1WJN A;  4KGS A;  1I4X A;  4IWP A;  2DYM A;  2MJ3 A;  2L32 A;  1E10 A;  1DYQ A;  2RPV A;  2BS4 B;  4G3X B;  2FUH B;  5G55 A;  3T8M A;  1WFY A;  2KAC A;  3AUL A;  1V97 A;  2WXO A;  3DHG C;  3V6C B;  1TS4 A;  5H8Y E;  2LGX A;  2ZZP B;  2J0M A;  1JAL A;  1T3Q A;  1SJE D;  2WU5 B;  1MJD A;  2BS3 B;  4ASW C;  2PKO A;  1HXY D;  4TKN A;  4ZRQ A;  3AEE B;  1C4P A;  3IAM 1;  5E6J A;  1YN5 A;  3R7R A;  3ZIM A;  3QJZ A;  2AEH A;  1R4M I;  4GDL B;  4YTM B;  3VRB B;  3TEX A;  2C7H A;  2N9X A;  2KX0 A;  2V4I B;  4WJN A;  4LJP B;  2FE8 A;  2WXJ A;  2BKR B;  4NPN A;  2LRU A;  1P7E A;  1EF5 A;  1P7F A;  1JW9 D;  2VZK D;  2AQ3 B;  3PVL A;  1IPG A;  4JLC A;  2QEJ C;  1V1P B;  1ZW7 A;  4IG7 B;  2RDH A;  2JY6 A;  2WXH A;  1WM3 A;  2KO3 A;  1AW7 A;  1WIA A;  3HM3 A;  2NMQ A;  4MH0 E;  4RGN A;  4WQM A;  1BML C;  2CU1 A;  3ZJT A;  1SSN A;  1EM7 A;  4LNK A;  1WE7 A;  1WRD B;  1GC7 A;  1TIF A;  3DWG C;  3S2A A;  4HWI B;  4BAX A;  5C23 A;  1F2R I;  3VAW A;  4W9F A;  2GBJ A;  2GI9 A;  1P9D U;  2NPT B;  4ITK A;  2J0J A;  1HEZ E;  3RUL A;  1C76 A;  1XQQ A;  4C80 A;  3BVM A;  3U4E G;  1N61 A;  3CST A;  2JUO A;  4HXD A;  2KFK B;  2CKH B;  2BGF A;  4A9A A;  2LFI A;  4B95 A;  1M4V A;  1U4A A;  3RNC C;  1KLG D;  1E8X A;  4KDL B;  4M0W A;  4ANW A;  2UYZ B;  4HCP B;  3I63 C;  3TL5 A;  4AWJ A;  4KSL C;  3L13 A;  2L00 B;  2L83 A;  1K52 A;  2VZK B;  2DZM A;  4WWO A;  2DZK A;  2IO2 B;  4WIP A;  3MC9 A;  3NVW A;  1NI2 A;  3A1Q B;  3FIL A;  4FXC A;  4MGZ E;  1VDV A;  1XD3 B;  3ZNI D;  5KHQ A;  1YQ4 B;  3LXF A;  2K1F A;  3VUX A;  2QMT A;  5IA7 A;  1LQB A;  3OJ3 A;  1SE2 A;  2M1M A;  1AYF A;  4NY0 A;  2L1A A;  5H92 C;  1E7U A;  5DCN A;  4ACF A;  1TKE A;  1L6U A;  4BKS A;  3UF8 A;  2WYQ A;  4R3D A;  5BYS A;  5T8I A;  3DCG A;  2KDI A;  3L17 A;  4JL9 A;  5JHB A;  3AU4 A;  4JQW C;  2KKC A;  3DPD A;  1UGM A;  3KQ4 A;  3B0A A;  2L0F A;  2WXF A;  4WQO B;  1Z5S B;  1J19 A;  2WX0 A;  3IXS A;  3TUO A;  4G0N B;  1WGD A;  1IBX A;  3A4R A;  1FIQ A;  1N5X A;  3AXC A;  4J6I A;  3IFW B;  1H8C A;  1ROE A;  2HJ8 A;  2KK8 A;  1WRI A;  2ACZ B;  3Q3N C;  2V3P A;  2IJ0 A;  3GE8 C;  5HHD G;  4E71 A;  2KAJ A;  4G50 A;  1V49 A;  3JW0 X;  4WWM A;  2INP E;  3UQB A;  2BQQ A;  4RGM A;  3NRZ A;  1RYJ A;  2J42 A;  3GB1 A;  4GDL A;  2DZJ A;  2FID A;  2MHJ A;  4FBJ B;  3B2G A;  3N1Y C;  2WXP A;  4CYE A;  3AE5 B;  2MBH A;  2X38 A;  1I4H A;  2Y5P A;  3Q6B A;  3H7P B;  3WA0 A;  3EGR A;  2IY0 B;  3JYU A;  3AB5 A;  5FKA C;  1JWB D;  3R2I A;  1H4R A;  2IO3 B;  2K8H A;  2V0G A;  2HD5 B;  1PDX A;  3BY4 B;  4ZDV A;  3HIZ A;  2CHZ A;  2MJD A;  3LYY A;  1GAQ B;  2KD0 A;  3HM6 X;  1P1A A;  1WF9 A;  4HPM B;  4C00 A;  3BK2 A;  3H9D A;  2WDR B;  4US9 A;  2ZW0 A;  4P6V F;  4BKG A;  4F1S A;  2Z0E B;  3QCA A;  4MT5 A;  2LRW A;  4NAW B;  2KQ4 X;  2BVC A;  4X57 B;  1WR1 A;  1WZ3 A;  2N4F A;  4OZA A;  1PYW D;  1HZ6 A;  2INN E;  2PJH A;  1J0G A;  1T0R C;  1C9F A;  3QWZ B;  4FHK A;  4A6Q A;  1OQR A;  2WWZ A;  2O2V B;  3RZF A;  3V61 A;  3DBH I;  3OWE B;  4CO7 A;  4OVU A;  3RD2 A;  1EF1 A;  1T0Y A;  3TMP B;  4GMV A;  3U2S C;  3RI7 C;  2KFJ A;  1MG4 A;  4KGT A;  2BYV E;  3VVW B;  3ZVV A;  2AWT A;  1XT9 B;  1JWU D;  3R2T A;  1PGX A;  3LJ3 A;  1VZ8 A;  1FNW A;  2NCN A;  3PSE B;  2Y3A A;  3ETR A;  3U8Z A;  1KOT A;  2CJN A;  4DHJ D;  2I2Y A;  1QF6 A;  2QC8 A;  1TKY A;  2HE7 A;  4N58 A;  1MPE A;  2GBM A;  2JZZ A;  3TIX A;  1R7S A;  1ZOY B;  3QC8 B;  3FC4 A;  2G9H D;  4EE2 A;  1IBX B;  3VUW A;  5CTR C;  3FIL B;  4HEA 1;  2W9N A;  2A4Z A;  1R4N B;  1RFK A;  1KFY B;  4DBG A;  3U52 E;  1E6E B;  1UBQ A;  4ANX A;  1TS3 A;  1V86 A;  1C3T A;  5IAA C;  1E90 A;  1QZE A;  5HKH A;  2MWS B;  2MBE A;  2B76 B;  4FN2 A;  2WXN A;  4NNJ B;  2RGF A;  4B0M A;  4YTN B;  2N9K A;  2KTF A;  2LGS A;  1LGR A;  2OJR A;  4ZOH C;  3KLS X;  1FM0 D;  3QAR A;  4HCN B;  3VR8 B;  4W9K A;  4DHZ E;  4MDK E;  4GXB A;  3SFE B;  3OLM D;  4K81 A;  1KLV A;  4PT5 A;  3ZDM C;  1IYF A;  4BFR A;  1HA5 A;  3SR6 A;  1K53 A;  2L76 A;  3EEC A;  3UQA A;  5J18 A;  1JWM D;  2MP2 A;  4AUQ C;  2OED A;  1JWA D;  1DGJ A;  4LJO B;  3C8Y A;  4LTU A;  1NEK B;  3CMM B;  3IT6 B;  2KTR A;  2AX5 A;  1NDD A;  3APD A;  1WYG A;  2ZVN A;  4P7I A;  1IGC A;  3PT2 B;  1WMH A;  2KDF B;  1MFW A;  3H6N A;  2M56 B;  3DBL I;  2OOB B;  2VH1 A;  2G4D B;  3BIN A;  1F2R C;  2JVC A;  3E56 A;  2DZI A;  2PVO D;  4MEL A;  5IKC M;  1HZ5 A;  3RN9 C;  3A33 B;  4A3O A;  2QCZ A;  5EE1 A;  4BVU C;  3ZGZ A;  1SE4 A;  3Q3O C;  1GB1 A;  3ZDT A;  1KH0 A;  1J7B A;  1J8C A;  1TJE A;  3ZKJ C;  3I9V 1;  1WX9 A;  4IWO A;  2QSD A;  1P0R A;  2O2V A;  3SHQ A;  2MW5 A;  2N9L A;  1I4Q A;  1FCL A;  5HI1 A;  4AOF A;  3DQV A;  4ZYN A;  4K3C A;  2R2O A;  2ON8 A;  3X23 A;  5TSS A;  4XX5 A;  1ZXI A;  1L6V A;  2XBB C;  2KLG A;  1V81 A;  1XCT L;  3R3M A;  2R2Q A;  2J7Q B;  5LNK 1;  2W54 A;  4HKZ E;  1UH6 A;  4XDC A;  3HK0 A;  4BBN F;  2CS4 A;  2UWQ A;  1SIJ A;  3HUI A;  1WR6 E;  2JT4 B;  1NYQ A;  2FBW B;  1SB3 C;  2BWF A;  1D6E C;  1E9M A;  3WCQ A;  3TJP A;  4ANU A;  4ARI A;  1G6J A;  2Z59 B;  2ZJD A;  1WZ0 A;  2WQY B;  3L08 A;  4XWW A;  1C1Y B;  1RLF A;  3DHH C;  4P16 A;  2ZCB A;  2DLB A;  4ZYS A;  2LEK A;  2KJH B;  2MJE A;  2CJO A;  3HHM A;  2V4L A;  1GB4 A;  2RPQ A;  2HDE A;  2C7N B;  4OZB A;  3SFD B;  2WP9 B;  4B9K A;  2K8C A;  4K7W A;  3W5V B;  2IY1 B;  2B3A A;  3N32 A;  4L1B A;  3TCA A;  3ZNH B;  2ZEQ A;  1VZ6 A;  1OEY J;  4OZC A;  2MEK A;  2WHI A;  2M19 A;  2N1W A;  4ZRP A;  5G5G A;  2C7M B;  4IM3 A;  2PW9 A;  2WXR A;  4S0R A;  4M0W B;  2D3B A;  2KN4 A;  2Y5C A;  1I35 A;  2KN5 A;  2DWQ A;  2QIE B;  3V05 A;  1WY8 A;  5CHF A;  3BK1 A;  2JRI B;  2MQJ A;  5IO9 A;  2IO1 B;  4I6P A;  4E3C A;  1DOI A;  2IGH A;  1WX8 A;  1YMH E;  4CQN A;  1XF5 L;  4NAM A;  2RR9 A;  3TEY A;  3ML8 A;  3Q8E A;  4IC7 B;  5D7G A;  2KNB A;  1MG8 A;  1TY2 A;  1YOV B;  3A9J A;  1NVI D;  2A5U A;  2JZ3 B;  1HTO A;  4GGQ A;  1PUT A;  4HKQ A;  1L7Y A;  1L4Z B;  2DEN B;  1UUP A;  2HJ1 A;  3DBR B;  1CQV A;  2EMS A;  1VJK A;  3Q14 C;  2KJR A;  2DAF A;  2EEL A;  2LMC A;  2EKE C;  2L3Z A;  3Q8A A;  4ZRJ A;  3Q8C A;  2K8B A;  1OTR B;  4RCO A;  3IG3 A;  5AUI A;  1TY0 A;  2LHD A;  4LNI A;  4RFB A;  3ZRC A;  2N7E A;  3L10 B;  4ZRK A;  3AE2 B;  4DQO C;  3O13 A;  1A5R A;  2JF5 A;  3EFU A;  2EKI A;  4KVG B;  1FO4 A;  3B08 A;  4TUU A;  2WX1 A;  2G1E A;  4ZRI A;  2IBI B;  1WGG A;  1I4R A;  1BUI C;  1CZP A;  2KAN A;  2IZV B;  1GPX A;  5LXI B;  4MJS A;  3V3X A;  2RD0 A;  3VHT C;  1RRB A;  2WLB A;  2K6Q A;  2VH2 A;  1YX5 B;  3Q3J A;  5DPW A;  5HG2 A;  4JWS C;  2ONQ A;  4ARC A;  2JWU A;  3M63 B;  1ZKH A;  4NAW A;  5C2T B;  2K25 A;  2PE9 A;  3EA6 A;  1I7H A;  3SEB A;  3B9J A;  2KVZ A;  4YWG G;  3AEF B;  4OVV A;  3ZNZ B;  4RGO S;  3VH4 B;  3PHX B;  2KJ6 A;  5AZF A;  3UIO B;  3UGB B;  3A1Q A;  2D07 B;  4KDI C;  3B2F A;  3CWI A;  1UF0 A;  2PLP A;  3Q3F A;  2K9X A;  4XE0 A;  2REX A;  3BZD B;  1OGW A;  4HDQ A;  5C3J B;  2HTH A;  3NZ3 A;  4TQ0 A;  2NS5 A;  1D5X C;  2KMA A;  1IGD A;  3R7Q A;  3M95 A;  3MHZ A;  1EWC A;  2RSU A;  1YQ3 B;  2XEW A;  1XLP A;  3K9P B;  1V5O A;  4USA A;  1EO6 A;  2JSV X;  2NBW B;  1F52 A;  4WAF A;  1WI0 A;  2Z0D B;  4IDI A;  4MSQ B;  3AV8 A;  4TSS A;  3NOB A;  3H8H A;  3P4Q B;  1L2N A;  1V2Y A;  3T3N A;  1RAX A;  2N1V A;  1WGR A;  2D3A A;  3VQI A;  3JSV B;  4GB9 A;  1ET6 A;  1AAR A;  1KRH A;  3PLU A;  1L4D B;  1T0Q C;  3KWV A;  2RMM A;  2ZPY A;  1JRP A;  3KUD B;  3PO0 A;  1SXT A;  3DVG Y;  3QQ8 B;  4KX6 B;  1X1M A;  3J9C A;  3RT3 B;  5LXH A;  3DBR I;  4NJ7 A;  2BW2 A;  2PTL A;  1TYG B;  2MH7 A;  2WXM A;  3GS2 A;  2DAJ A;  4LLG M;  3QX1 A;  1GC6 A;  2KC2 A;  2OHF A;  1KM7 A;  5IOI A;  4KZC A;  1L5P A;  2BT6 A;  4S17 A;  1SBB B;  1F0Z A;  3VUY A;  1YN3 A;  1DOX A;  2IPK D;  1KTK A;  1OQY A;  2PMV A;  3NZS A;  2I38 A;  4HLE A;  2MP2 B;  1YQB A;  3HVZ A;  4IM2 A;  4GDK B;  4K3B A;  4YSX B;  1FRR A;  1VD2 A;  4LNF A;  2WXL A;  2QHO A;  1QOF A;  2WS3 B;  3B1L X;  1SIF A;  4AJY B;  3Q8F A;  5JZE B;  4GSW A;  4GOC A;  5IP4 D;  3RCZ A;  3ZLZ A;  3WAL A;  2G4S A;  4C4V A;  2FIF A;  2LUM A;  3A4S C;  1NYR A;  1R4M B;  4G11 A;  1JML A;  4FJZ A;  1QOG A;  3U7Z A;  3CIR B;  1BXT A;  4KGR A;  2YEP B;  1UNS A;  1A70 A;  1VRA B;  3DVN V;  2FCS A;  1UWX A;  1WM2 A;  2ZVO A;  2KLC A;  2KMC A;  2LVP A;  5FR3 A;  1PQS A;  3GZN I;  4EUT A;  1FPY A;  4BOS C;  2N7D A;  3BVZ A;  1VR9 A;  4MM3 A;  2LWP A;  5IN7 A;  1UD7 A;  2NR2 A;  3AE8 B;  4EZK A;  3MHS D;  4EZL A;  5D3I B;  2KDB A;  4IOI E;  4I6N B;  3AE9 B;  3L4P A;  1EUV B;  4LNO A;  1CK1 A;  2N0S B; 
#chains in the Genus database with same CATH homology
 2C7H A;  2N9X A;  2KX0 A;  4BVU C;  4LCD E;  2WDT B;  4MGI E;  4WJN A;  3IVF A;  4LJP B;  5D94 A;  2BKR B;  4I6L B;  3VXW A;  3ZDT A;  4MJS B;  2NBV B;  4NPN A;  2LRU A;  3ZTD A;  1J8C A;  1EF5 A;  4F7Z A;  4WJO A;  3ZKJ C;  1FXT B;  1WX9 A;  4IWO A;  3PVL A;  2MBQ A;  4A20 A;  1IPG A;  1P98 A;  1P0R A;  4JLC A;  4DHJ B;  2L8J A;  1ZW7 A;  2G3Q B;  2O2V A;  4IG7 B;  3SHQ A;  3PRM B;  1BT0 A;  2MW5 A;  2JY6 A;  3NZU A;  4W9H A;  3V6E B;  1WM3 A;  5E6P A;  2G45 B;  2KO3 A;  1NBF C;  1WIA A;  2L7R A;  2MA9 B;  3HM3 A;  4EEW A;  1P3Q U;  4MH0 E;  3D32 A;  4W9C A;  3L54 A;  4AOF A;  2DYO A;  3DQV A;  1Q5W B;  4ZYN A;  2CU1 A;  2R2O A;  1CMX B;  1WE7 A;  1WRD B;  1GC7 A;  2KZR A;  3S2A A;  4HWI B;  3ONS A;  3APF A;  2BYE A;  4TQ1 A;  5C23 A;  4W9G A;  3VAW A;  4W9F A;  3X23 A;  2GBJ A;  1P9D U;  2NPT B;  2J0J A;  3CF6 E;  1V80 A;  3QA8 A;  4XX5 A;  3RUL A;  2V3S A;  1XQQ A;  2XBB C;  2KLG A;  3L16 A;  4FAD A;  3W1S C;  1V81 A;  3U30 A;  3R3M A;  1E8Z A;  2R2Q A;  2J7Q B;  3O65 B;  3CST A;  1E5W A;  1UH6 A;  2JUO A;  4FLH A;  4HXD A;  4W9J A;  2KFK B;  3HK0 A;  4BBN F;  2CS4 A;  2CKH B;  2UWQ A;  3KUC B;  2BGF A;  2L05 A;  3ECI A;  1WR6 E;  2PE6 B;  2JT4 B;  5AEK B;  4MGK E;  2MCN B;  2IO0 B;  4B95 A;  1UBI A;  1U4A A;  2N9E B;  1V5T A;  2BWF A;  2KC1 A;  3PLV A;  4PS7 A;  1E8X A;  4KDL B;  4ANW A;  2UYZ B;  3TJP A;  4ANU A;  1E8Y A;  4HCP B;  3TL5 A;  2CHX A;  2LJ5 A;  1G6J A;  2BWE S;  1VCB A;  2Z59 B;  2ZJD A;  1WZ0 A;  2D2Q A;  4AWJ A;  3L08 A;  4KSL C;  1KJT A;  1C1Y B;  1RLF A;  5AZG A;  3KH0 A;  2ZCB A;  3L13 A;  2L00 B;  4ANV A;  2DZM A;  4WWO A;  2DZK A;  2KJH B;  2IO2 B;  2BF8 B;  5DPT A;  4W9E A;  3QK0 A;  3HHM A;  4DDG D;  2V4L A;  2GBK A;  2RPQ A;  1NI2 A;  2C7N B;  3A1Q B;  5AZH A;  4MGZ E;  1XD3 B;  1F9J A;  3JSV A;  1TGZ B;  3OAW A;  3ZNI D;  4B9K A;  5J17 A;  5KHQ A;  1WXV A;  2K8C A;  4K7W A;  2V1Y A;  2IY1 B;  2B3A A;  4XC2 A;  3N32 A;  4FA6 A;  3R66 C;  2K1F A;  3PRE A;  4LDT B;  3VUX A;  2JXX A;  2LVQ A;  3TCA A;  5IA7 A;  3ZNH B;  4CHK A;  1S3S G;  1OEY J;  1LQB A;  2ZEQ A;  2GOW A;  3OJ3 A;  3ZTC A;  2M1M A;  1WE6 A;  3U7D A;  2KOX A;  2KWV B;  4URK A;  1E8W A;  1JRU A;  2LGY A;  4NY0 A;  2N1W A;  2XK5 A;  3JVZ X;  4XZ4 A;  3EC8 A;  4IW0 A;  2L0T A;  1E7U A;  1Y8R C;  5DCN A;  2C7M B;  1YD8 U;  5CHV C;  4IM3 A;  3VFK A;  4MSM B;  2JPH A;  4HJK A;  4M0W B;  2WYQ A;  3UF8 A;  4BKS A;  4BBN C;  3RUI B;  2KQS A;  1I35 A;  2KN5 A;  3NHE B;  5TR5 A;  5G2N A;  1WY8 A;  3DCG A;  4RMA A;  2FCM A;  2JRI B;  5CHF A;  2KDI A;  3L17 A;  2MQJ A;  3DVN U;  4JL9 A;  2DYB A;  5JHB A;  3AU4 A;  2IO1 B;  2VRR B;  4JQW C;  2KKC A;  3DPD A;  1UGM A;  4I6P A;  2C5L C;  4E3C A;  2JWZ A;  3B0A A;  3W1Y A;  4KSK C;  4IUM B;  1WX8 A;  2L0F A;  3VTU A;  4WQO B;  1Z5S B;  2RR9 A;  1J19 A;  3ML8 A;  3LDZ E;  2WX0 A;  2KX3 A;  4IC7 B;  1WXS A;  2KDE B;  4G0N B;  5D7G A;  2KNB A;  1MG8 A;  3W1S A;  1WGD A;  2LZ6 A;  3A9J A;  3WIM A;  3A4R A;  1LM8 B;  2A5U A;  2JZ3 B;  3AXC A;  4J6I A;  1YJ1 A;  5E6O A;  4GGQ A;  3DVG X;  1LFD A;  3IFW B;  1H8C A;  1L7Y A;  2DEN B;  4W9D A;  2HJ8 A;  4II3 B;  2KK8 A;  2EMS A;  2AL6 A;  3WAP A;  2EMT A;  3H7S A;  2KJR A;  2DAF A;  2LVO A;  2MX2 A;  4E71 A;  2EKE C;  2L3Z A;  3ZNG C;  1OEY A;  4G50 A;  4ZRJ A;  1V49 A;  3TBL D;  2K8B A;  3OJ4 B;  3JW0 X;  3UQB A;  4JIO U;  1OTR B;  2MBO A;  3PS6 A;  1TBE A;  4K1R B;  3IG3 A;  4N9F 4;  1TTN A;  2FCN A;  3PZD A;  4E74 A;  4GDL A;  2DZJ A;  3ZRC A;  2FID A;  1GUA B;  4NJ6 A;  2N7E A;  2M4N A;  4FBJ B;  1E7V A;  2O6V B;  4IM0 A;  3L10 B;  3UIP B;  2KXJ A;  3A9K A;  3SU8 X;  4ZRK A;  4KZ0 A;  3DDC B;  2AYO B;  1A5R A;  2JF5 A;  4CYE A;  3QAQ A;  2MBH A;  4A3P A;  5JH5 C;  3EFU A;  4KVG B;  3I3T B;  1M94 A;  3H7P B;  3B08 A;  4TUU A;  2WX1 A;  4PS3 A;  4IWQ A;  3WA0 A;  2FAZ A;  2IY0 B;  2YLM A;  5D6J B;  4RM9 A;  3RZW C;  1GNU A;  4ZRI A;  3JYU A;  2IBI B;  1WGG A;  4DDI D;  4NQK E;  2KAN A;  1H4R A;  2IO3 B;  2K8H A;  1Z2M A;  3T9L A;  4HK2 A;  2IZV B;  1GG3 A;  4RM8 A;  2HD5 B;  2C9W B;  3DBS A;  5LXI B;  3BY4 B;  2LI5 A;  4MJS A;  4ZDV A;  3HIZ A;  2CHZ A;  2RD0 A;  3VHT C;  1RRB A;  4M8M A;  2K6Q A;  1WGH A;  1YX5 B;  2ZPN A;  2KD0 A;  4HDO A;  3HM6 X;  3Q3J A;  1P1A A;  1WF9 A;  4HPM B;  5DPW A;  2AL3 A;  3H9D A;  4M8N A;  2LUE A;  4HVB A;  2YVC A;  4BKG A;  2O6V D;  1K8R B;  4JGH B;  2D3G A;  4F1S A;  1HE8 A;  1ZKH A;  3M63 B;  4ICU A;  4NAW A;  2Z0E B;  3MTN B;  3QCA A;  2KVR A;  3ENE A;  3WAO A;  3KW5 B;  3K9O B;  2K25 A;  2PE9 A;  1TZ1 A;  5CX3 A;  3UIN B;  3H1U A;  2LRW A;  4AJW A;  4NAW B;  4EKU A;  1WH3 A;  4YL8 A;  2GBN A;  4X57 B;  1WJ4 A;  3N3K B;  4OVV A;  1WR1 A;  3PGE A;  1WZ3 A;  3ZNZ B;  4BKS D;  2GBR A;  3VH4 B;  3CSF A;  3PHX B;  3ZO5 B;  2KJ6 A;  5AZF A;  1LXD A;  2KQ7 A;  2N4F A;  3UGB B;  3UIO B;  3A1Q A;  3MJW A;  1V9J A;  4WWN A;  2D07 B;  2PJH A;  2LXA A;  2K39 A;  2MRP A;  2XK5 B;  5DPR A;  2PPH A;  3V60 A;  4KDI C;  1J0G A;  1S1Q B;  3M62 B;  1UZX B;  3QWZ B;  4FHK A;  2M17 A;  3Q3F A;  4II2 B;  2REX A;  3H7P A;  1OGW A;  2I1K A;  4BKT A;  4HDQ A;  5L83 A;  2C60 A;  3NS8 A;  2HTH A;  4WJP A;  4WWP A;  2WWZ A;  2O2V B;  3RZF A;  4TQ0 A;  2NS5 A;  1WJU A;  3V61 A;  3DBH I;  4CO7 A;  2KMA A;  5FR6 A;  3PHW B;  3A9K B;  3R7Q A;  3M95 A;  4OVU A;  3RD2 A;  1EF1 A;  1T0Y A;  4W9I A;  4DXA B;  3TMP B;  2RSU A;  4ICV A;  4GMV A;  3AU5 A;  2XEW A;  3K9P B;  1V5O A;  1R4N I;  5KHO A;  2KFJ A;  1EO6 A;  3M3J A;  2I1J A;  2KHW B;  2NBW B;  2LXC A;  2BYV E;  5C1Z A;  2ZNV B;  3VVW B;  3V62 A;  5DPS A;  4PYZ A;  3ZVV A;  4KIK A;  2J0K A;  4FUL A;  2KWC A;  2AWT A;  2BYF A;  1XT9 B;  4K7U A;  1WI0 A;  2Z0D B;  4MSQ B;  3RYT A;  1WJ6 A;  3LJ3 A;  3NOB A;  2CR5 A;  1L2N A;  4DWF A;  5E6N A;  2NVU I;  4GIV A;  2NCN A;  1V2Y A;  3VTV A;  4AP4 C;  3PSE B;  1RAX A;  2N1V A;  2N9P C;  3IHP C;  1WGR A;  3KYD D;  4W9L A;  3U8Z A;  3VQI A;  3JSV B;  4GDK A;  1KOT A;  3PLU A;  4GB9 A;  1AAR A;  3ALB A;  4DHJ D;  4DK5 A;  2HE7 A;  2GBM A;  1V6E A;  2JZZ A;  2ZPY A;  4NQL B;  3TIX A;  3KUD B;  3A9J B;  3DVG Y;  3QC8 B;  3QQ8 B;  4KIK B;  1X1M A;  1IP9 A;  1D3Z A;  3VUW A;  1YX6 B;  2CHW A;  2IYD B;  3KVF B;  5CTR C;  3RT3 B;  5LXH A;  3DBR I;  4NJ7 A;  4B6W A;  2W9N A;  2A4Z A;  5CHW A;  2M0X A;  2ZCC A;  3WAN A;  2DAJ A;  4LDT D;  3QX1 A;  1GJZ A;  4DBG A;  1GC6 A;  2KC2 A;  3VH3 B;  4MEM A;  1KM7 A;  1WGY A;  4KZC A;  1UBQ A;  3C0R B;  4ANX A;  2D10 A;  4BOZ B;  1V86 A;  2FNJ B;  3PRZ A;  2ZNV C;  1C3T A;  5IAA C;  3QIJ A;  1E90 A;  4FJY A;  1QZE A;  5HKH A;  2MWS B;  2MBE A;  4DHZ B;  4FN2 A;  4NNJ B;  2RGF A;  2MBB B;  1UEL A;  2NPT A;  4MGY E;  2KTF A;  2KTR B;  3QHT A;  3VUY A;  4F8C B;  5L95 C;  5BO4 B;  1WXM A;  3SD5 A;  1Q1O A;  5EDS A;  1WX7 A;  2D11 A;  2OJR A;  4FHJ A;  4EOY A;  1OQY A;  2KFK A;  3NZS A;  4WAA A;  4HLE A;  2M8S A;  2MSE D;  3ML9 A;  2O6V A;  2MP2 B;  1YQB A;  3QAR A;  2ASQ A;  4HCN B;  3P2B A;  4IM2 A;  4W9K A;  2DHZ A;  4DHZ E;  5JHA A;  4GDK B;  1ISN A;  1VD2 A;  2LAS A;  4MDK E;  4GXB A;  3N30 A;  3NY5 A;  1YIW A;  2QHO A;  2DX5 B;  3OLM D;  2LD9 A;  3PV1 A;  3B1L X;  4K81 A;  1SIF A;  1KLV A;  4AJY B;  3PPA A;  4KV2 A;  5JZE B;  4GU2 A;  5J2R A;  4GSW A;  2NBU A;  3ZDM C;  4GOC A;  4FJV B;  1IYF A;  4BFR A;  1WMH B;  1SGH A;  1Q0W B;  1WXA A;  2L76 A;  3EEC A;  3VDZ A;  3UQA A;  5J18 A;  2KWU B;  3KYC D;  5D2M B;  3RCZ A;  3ZLZ A;  3WAL A;  2MP2 A;  2GMI C;  4AUQ C;  2FCQ A;  2G4S A;  4PYU A;  4WJQ A;  1WYW B;  2FIF A;  5LLI A;  3A4S C;  4LJO B;  2BKF A;  3L0W B;  2PEA A;  3DOW A;  2LGD A;  4G11 A;  4GN1 A;  4FJZ A;  3PTF C;  1WJN A;  3CMM B;  4IWP A;  2DYM A;  2KTR A;  1NDD A;  3APC A;  2FCS A;  3DVN V;  3ZUN A;  1WM2 A;  2ZVO A;  3APD A;  3IBE A;  2KLC A;  3PRP B;  2ZVN A;  4P7I A;  4EFO A;  2KMC A;  2LVP A;  3PT2 B;  1WMH A;  2FUH B;  1PQS A;  3GZN I;  4G3X B;  5G55 A;  3T8M A;  1WFY A;  3AUL A;  4EUT A;  2KDF B;  4BOS C;  2N7D A;  1I42 A;  3V6C B;  2LGX A;  3SDL C;  3GOE A;  3H6N A;  2ZZP B;  4MM3 A;  2J0M A;  3DBL I;  2LWP A;  1RFA A;  2OOB B;  1UD7 A;  2G4D B;  2NR2 A;  2Y5B B;  3BIN A;  2MLB A;  2JVC A;  3AI5 A;  3KUZ A;  3ZW3 A;  4EZK A;  3EHV A;  4TV3 A;  3MHS D;  1SE9 A;  4ASW C;  3WAM A;  4EZJ A;  2DZI A;  4HPL B;  3X0W A;  4TKN A;  4EZL A;  2KDB A;  3ZRF A;  4MEL A;  4K7S A;  4I6N B;  5GMV A;  2BPS A;  3VTW A;  3A33 B;  3ZIM A;  2JRH A;  1EUV B;  3R7R A;  4PS8 A;  1ZGU B;  3QJZ A;  2AEH A;  4A3O A;  1R4M I;  4GDL B;  2K6D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...