1J8DA

Structure of the metal-free form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
180
structure length
180
Chain Sequence
b'MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGTSFAVADAPIYVKNAVDHVLSTHGGKGAFREMSDMILQAQGKSSVFDTAQGFLKSVKSMGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxy-D-mannose-octulosonate 8-phosphate phosphatase
publication title From structure to function: YrbI from Haemophilus influenzae (HI1679) is a phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Hydrolase
total genus 52
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1j8dA00
2YN4A 3L8FA 3L0BA 2R8XA 2OM6A 5AVZA 1U2TA 3DNPA 2Q4RA 2WF5A 4OCZA 2CFRA 4XPZA 5ALMA 3QNMA 2I33A 2RARA 4CF4A 2W4MA 3OCUA 3CNHA 4UU1A 4OHFA 2ZXEA 2I7DA 3ONNA 1ZRNA 2ZBFA 2FEAA 3SF0A 3L0CA 2MSNA 2HCFA 1IWOA 5AK4A 2HDOA 4PNHA 3L1VA 3NRJA 1Z4NA 3QU5A 4IG4A 2BDEA 4KYTA 3I76A 3N07A 1T5SA 3WK4A 3L8EA 3NANA 5ALXA 3QU7A 5AVXA 4KX5A 3N1UA 5IT0A 3OCVA 2WF6A 2GO7A 3L0YA 5AICA 4Y2RA 4Y3UA 2EATA 2IOFK 1TE2A 4EEKA 5ALSA 3N28A 2EAUA 2Q4TA 3AR7A 4Y2JA 1U2SA 1QYIA 3ZW7A 2JARA 4NABA 1L7MA 4B6JA 5ALGA 4Y2SA 3PGLA 1L7PA 3L8GA 1Z88A 4DW8A 5AVQA 5T41A 3E58A 3ZX5A 1QH9A 1S2OA 5IT4A 2G08A 4JB3A 3WGVA 1NRWA 1WPGA 3U7FB 3PGVA 3E8MA 2WHEA 3MPOA 1TJ5A 3DV9A 3U7GA 1SU4A 3DDHA 3FPSA 3M9LA 3WKAA 1YMQA 5AW9A 4YCMA 4BYGA 2JAOA 5AKKA 3OCWA 1MH9A 5AVVA 5AW2A 2WF9A 5AVTA 2Q5EA 3P96A 1L8OA 5A3QA 2FUCA 2YJ5A 3ZTWA 2WF8A 4DCCA 2RBKA 5AW0A 2YFYA 1TJ4A 5AVWA 1RKQA 3GYGA 1ZJJA 1QQ6A 1EK2A 5AKXA 3RFUA 1RRCA 3WGUA 2FPWA 3MMZA 3FZQA 5AM0A 3ET4A 2PQ0A 3EF0A 1RMTA 1ZD5A 2HSZA 5ALUA 2B82A 1LTQA 1Y8AA 4GXTA 4KNVA 1T5TA 3L1UA 2HF7A 3W5BA 2BY4A 1PW5A 2YJ4A 2ZG6A 4C4SA 2FPXA 2NYVA 4DFDA 4F71A 5AVUA 5ALJA 3SMVA 3F9RA 4FE3A 3R9KA 3U7HB 3OTQA 4UM7A 3B9RA 2RAVA 3ED5A 3WKCA 4EX6A 5AI4A 4CNQA 4BEWA 4CE6A 1Z4IA 3BWVA 1K1EA 3AR5A 4G63A 2CN1A 2AGVA 1RPZA 2VKQA 2WM8A 3SHQA 3U13A 4C4TA 1WVIA 2NO5A 1Z5GA 3WKBA 3OPXA 4Y2YA 4XQ0A 3U7EB 3QU4A 5AW3A 2B1RA 3QUTA 4AS2A 4F72A 3WK9A 3ZVNA 1RLMA 5ALQA 1JUDA 3WKDA 2HOQA 2QLTA 2I6XA 3B8EA 4UW9A 3UM9A 5ALVA 1RC8A 1RLTA 4YIHA 1RQLA 1U7OA 3MC1A 3L5KA 1VJRA 3L8HA 3FVVA 4YIKA 2D2VA 4BNDB 5ALOA 4HAIA 3WKEA 4H1WA 3A1EA 5AHXA 4UMFA 5AI8A 5AK5A 3ZI4A 3WK5A 5AKJA 3S6JA 3QU9A 2I55A 4RETA 3RF6A 3VAYA 2B8JA 5ALKA 2AH5A 2R8ZA 4L6CA 1RKUA 4Y2XA 3AR2A 1X42A 2G09A 5AM3A 2AUTA 1L8LA 3U26A 2YJ6A 5ALEA 4BKMA 2BDUA 3J7TA 2ODAA 2GHTA 4NAVA 2WF7A 5AKYA 5ALHA 3QX7A 2CFSA 5AIAA 5AW4A 1RLOA 3PCTA 1YV9A 3BA6A 3N5KA 1VFPA 3QUBA 2JAUA 4L57A 3NUQA 4KN8A 3IRUA 3KDPA 1WZCA 3A1DA 3ZX4A 5AM1A 1RDFA 3W5CA 4I9GA 3AR6A 1Z5UA 2P11A 5IS2A 2OYCA 4BX2A 2DQSA 5AK3A 1NF2A 1S8OA 4KX3A 4ZEWA 1Z4OA 3IB6A 4RESA 4GIBA 1U7PA 2MU1A 1ZD2P 4CF5A 2W11A 3EF1A 5AW5A 5AKIA 2HO4A 3NAMA 1O03A 3QYPA 2IA5A 4Y2UA 4HGOA 5FP0A 3WK7A 5AVRA 2B1QA 3E84A 5AKEA 4YCNA 2B0CA 3KZXA 3QLEA 1F5SA 1L7NA 4UMEA 4AS3A 1LVHA 3KBBA 1RMQA 3K1ZA 1YNSA 3R09A 2JAWA 3SKXA 3IJ5A 4BEVA 1L6RA 3PDWA 2HEGA 4UARA 4UMVA 5AI0A 5ALDA 1KYTA 1AQ6A 5A3SA 1Z4PX 2HHLA 2IOHA 3WK8A 1QQ5A 4HYTA 3KOOA 5ALNA 1O08A 3EPRA 3B9BA 5ALIA 2FUEA 2O9JA 5AIBA 1Q92A 2B8EA 3R4CA 3FGOA 4HGRA 3HYCA 5AM5A 3CZ4A 4UMDA 2I34A 1XPJA 3SKYA 2GFHA 2G07A 4DWOA 2OBBA 3AR4A 1N9KA 1ZS9A 4NFLA 2X4DA 4NWIA 4BX0A 3A1CA 1YDFA 3KC2A 4UATA 5AW8A 1Z4QA 1EK1A 4AP9A 4ZEXA 2ZBDA 2P27A 4Y2QA 4QJBA 4UAUA 2JGAA 2C4NA 3ZWKA 1YJ5A 2IOFA 5AKZA 3L7YA 2P69A 4BNDA 1ZOLA 1VJ5A 5AVYA 4Y2VA 3AR3A 5AESA 2W43A 4J2TA 5AM4A 3DAOA 1SWWA 4XOUA 5ALPA 3ZVMA 2GHQA 5AKHA 2IYEA 2ZBEA 2G06A 3AR8A 5AVSA 2HF2A 4UASA 2O2XA 4HGPA 5AI6A 5ALWA 4Y2PA 2CFTA 4EZEA 2C8LA 4EX7A 4OD0A 1TA0A 5ALZA 2GMWA 4NV0A 3QGMA 3OCXA 4QQFA 2YY6A 4UU0A 5ALYA 1FEZA 2C8KA 4HGNA 4MWOA 1U02A 4JDPA 3ZWDA 5AKLA 4OFZA 3I1YA 1Z4KA 3W5DA 3SD7A 1ZD3A 2YMMA 4EELA 2R8EA 3QUCA 2OA0A 2AMYA 2NO4A 1Z4JA 3U19A 2C88A 2G0AA 2YMLA 3OCYA 3EWIA 3ZVLA 2YJ3A 4Y2TA 3UMGA 2FDRA 2FPRA 3M1YA 1XP5A 4FFDA 5AK6A 3NIWA 3D6JA 4ZEVA 3N8GA 3SLRA 4J03A 1RKVA 4L6AA 1ZD4A 1L7OA 1Z4LA 2B30A 4KNWA 4HGQA 2FI1A 1XVIA 1QQ7A 2YMQA 2QYHA 2ZBGA 2RB5A 2HX1A 3ZUPA 3MN1A 3AR9A 4YH1A 5AKGA 2ZOSA 3TLMA 5A3RA 1TJ3A 1CQZA 3ZTYA 5AM2A 4IFTA 3ESRA 2YBDA 3UMBA 3QU2A 1WR8A 2FPUA 5AW6A 5AI5A 3ESQA 3WK6A 1Q91A 1J8DA 4O8CA 4C4RA 1RQNA 3ET5A 5JJBA 2C9MA 3UMCA 3QUQA 3FM9A 5E0OA 4XE5A 1ZRMA 3I6BA 1Z4MA 4BX3A 3KD3A 2WFAA 4E88A 1RMYA 2P9JA 4EENA 4MUMA 4UAVA 2I54A 3E81A 1T9ZA 5ALRA 5ALTA 4G9BA 2FPSA 3FPBA 2PR7A 4UM5A 5AI9A 2G1AA 4I9FA 1CR6A 4FYPA 1SWVA 4YGYA 2HI0A 2YMPA 3NALA 5ALFA 2EARA 3I28A 2PKEA 3QXGA 1YS9A 3A3YA 4CF3A 1NNLA 3HLTA 5AW7A 4BBJA 5AW1A 1J97A 1N8NA 2G80A 3OCZA 3ZU6A 4YCLA 2R8YA 3W5AA 3NASA 5ALLA
chains in the Genus database with same CATH superfamily
1RVDA 1JSRA 2IIQA 3E9RA 2Z58A 1RFLA 4FD3A 3GLFB 3TH5A 4EVSA 4NZYA 4A8JA 3INTA 4XQCA 3UANA 3UJ3X 1J24A 4QU5A 3OZVA 2VJAA 3LRXA 5JNLA 1ZUD1 5AVZA 1N7GA 2ZQ5A 1UKBA 2F62A 3AUKA 1PFKA 3JQBA 4G3XA 2ACWA 5DO9A 3QKIA 1V2HE 1ECFA 4N5NA 4UE3S 3MTAA 5JO9A 4EBBA 1QGAA 5FBRB 4KSCA 2XCLA 5WRFA 2BHTA 3MAAC 2BFFB 2W93A 5C81A 4L02A 4UU1A 4X90A 4AI6A 3BZUA 2HXGA 2TSYB 4NF2A 2FE1A 1UIMA 3HSSA 1XXLA 2NO9A 3OJOA 3QNUA 4LISA 2H0QA 1JHVA 2I4RA 2PZLA 4NAUA 4IH1A 4KR9A 3W06A 1CUBA 4RD2A 4B6FA 3IKJA 4D92A 3D4BA 3GBSA 2PLAA 3I4LA 4NK4A 5IZCC 2PDAA 4BIMA 2EJUA 4ARCA 1U2GC 4NYJQ 4OK6A 3LQ2A 3U7JA 5JVDF 5I7SA 1XELA 4OOEA 1TLTA 3EFEA 1EBBA 4G85A 1QK4A 4EITA 1EX1A 3GFQA 5IYZB 5C8VA 4ZYVA 5J9FA 4MTLA 5CG1A 1E79A 3TW8A 1L4YA 2ZJ1A 3DOEA 4IG4A 1GXSA 4MYHA 1P74A 3IBSA 2N0SA 3N7TA 2DUJA 1ZW1A 3WLMA 2I0FA 1YAHA 2JFWA 4YUYA 2PJDA 2QTLA 3JD0A 1KO4A 3PP8A 4J07A 1T9CA 1QH0A 1USUA 4IQ4A 2VPPA 2WU4A 3ZE1B 3GC6A 4UDXX 4GWGA 3DFZA 4ONEA 3VPGA 5C31A 1Q57A 1KNQA 1FNBA 2CNWD 2QQ0A 5K8JB 3QW4B 1EGAA 4PYOA 3EVBA 1VPTA 3IAAA 2G1KA 4MZDA 1S1CA 1TCVA 2HAEA 2PIDA 4QZVA 2XCSB 1ZKMA 2CBXA 2F3RA 3WLRA 2IYYA 3K0HA 4KYVA 1ONPA 2QRKA 2NUAB 3VYSB 5C1OA 3TW0A 1WO8A 1Z7EA 2OGUA 3OE1A 3Q11A 4XB6B 1R8SA 1TM3E 4KGVA 4OREX 5AXBA 3W9SA 1S3GA 5L8VA 3WYGA 3HB4X 4NOJA 4PBTA 4JMLA 1KIFA 4UVEA 4DDHA 2HBZA 3L82B 2KWIA 5K7SA 3GLIA 4ZJYA 5H83A 1DJLA 1NLMA 3K8ZA 5EYPA 2OHFA 1ZGAA 4KPUB 1EVZA 3LKDA 4S05A 2CZCA 2D3WA 2CF5A 5DBFA 3HDTA 5A4AA 1ZI9A 2E1RA 3SZLA 4EO4A 5FPKA 3RIGA 1AQJA 1T6NA 2HFKA 4KWEA 3FOEC 3LLMA 5D6OA 1NN3A 3D54D 4Z9BA 2DWPA 2FZLA 4U6SA 4PZAA 3NM4A 1TJ5A 1A04A 2X41A 2Q41A 2O7NA 4KAXA 4TV9A 2XUJA 5H82A 1QVVA 3F5MA 4BZPA 3U7GA 4G4SP 1Y4ZA 4DTIA 1KYIA 1JEQB 1UEIA 2MDTA 1WX1A 4ME6A 4DF3A 5AW2A 4PYLA 2JK0A 5FFFA 3QPCA 3VM6A 4EY6A 3JZMA 2PGNA 1N3LA 3PVZA 4IF4A 8ABPA 3H1FA 2HJGA 4G0XA 2X3UA 2X2FA 2ZJZA 2LVBA 1U90A 3PUJA 3CNOA 1GCGA 2JDID 1AF7A 2YFYA 1UMCA 1XJWA 1W76A 4AW9A 1CVRA 1ZH4A 3WADA 5THXA 3OX3A 4RH0A 1I6KA 3JYOA 4D0LB 3W8EA 2FSHA 1N7HA 3C3WA 4RD0A 1UFVA 3VR3D 1AS2A 1QHHB 1NVBA 5IK2A 3ORQA 4H7FA 4AY5A 5JASA 4NMMA 4NFHA 2QVXX 4HEQA 4TL7A 3TRFA 4RTQA 2GRUA 2VZLA 3QWAA 3T94A 1YFZA 2RGNC 4G2NA 5LM3A 1NG1A 1DQRA 2HSZA 2WSBA 3DMTC 3IV9A 2XRMA 5MGBA 1U9ZA 2A7QA 3DEJA 3NWJA 4J43A 1VIMA 1WHSB 1K7EB 5K0GA 1NPTO 4DKJA 5C1BA 4MYTA 1I6LA 2FPXA 1OAAA 1UQUA 4KGDA 3SMVA 1N0VC 3F9RA 2AN3A 4MR7A 4GZLA 3O6VA 3AINA 2JK1A 3GFBA 3H5RA 3QLUA 3S1AA 3GRYA 4G5XA 2WSSD 4F0JA 1MRZA 2AJBA 1IYZA 2QN7A 3SS7X 1U8FO 1IY0A 2FJUA 3LQKA 3R5SA 4RH3A 1OREA 3A6FA 1PP4A 1KAQA 5CX1A 3ZWPA 1Q6ZA 4P98A 3VJKA 5KYUB 1TZBA 2P5YA 3FMVA 4N7BA 5B1SA 3UA4A 1IXSB 2J5KA 1K1EA 2EZUA 3LE8A 3T3DA 4BFSA 5KS2A 3IAM6 4UDOA 4HUJA 4EUSA 4JBWA 4LYJA 4OAPA 4W7SA 2LGJA 1T3GA 3W34A 1OAKA 1Z5GA 2CDCA 4E11A 1FY2A 4E15A 1TIKA 1GGJA 3KYBA 4INZA 3EZLA 1XZPA 1NVMB 1ZJYA 1JQ3A 2CHGA 1KPHA 1ML3A 3FZEA 3OTGA 2R85A 3AEQA 4HHEA 3QU4A 4QJ4A 4Y1RA 4AKSA 5TJHA 3WK9A 3KL4A 2IQIA 2G76A 3G02A 4H0NA 4AKIA 1D2GA 3RBZA 2ZW9A 2JEYA 2NU8A 3AO0B 2F8LA 1CULC 2HJVA 2CLLB 4ZO4A 3GDWA 3TLGA 5B12A 1F3OA 3ZIDA 1C2TA 3TKLA 4ER0A 4MGKR 4AZWA 4OH1A 4Z51A 4ZCIA 1LVUA 1UC8A 2BGGA 1G20E 2JPDA 4XGKA 4HB0A 1QZ3A 2J59A 3JWGA 4FHGA 5FADA 3WRYA 4ALMA 4D9EA 2XR1A 2OXTA 5HIAA 1GTSA 4G89A 1S2IA 1ZXBA 2BONA 2ZRFA 3TRKA 2PUEA 4B3JA 3EQZA 2RC5A 5THQA 2HMTA 3O83A 4IAOA 4OHKA 2PSJA 2CEAA 3E05A 3FKJA 5EUCA 3T1VA 1J00A 4DAOA 3MJDA 3IV6A 1U2QA 5EMNA 5TX7A 3QU9A 2PX6A 3P9YA 1PZXA 2B8JA 2HA7A 2YXLA 3PQCA 2GARA 2PK3A 1KC3A 4MEJA 1X94A 4DJJA 1O5IA 4L4ZA 3LI2A 4K9NA 4PAQA 4H3SA 5LQRA 2ZYAA 1PKXA 5COAA 4PLPA 2C94A 5KTNA 1OPRA 4GWKA 1QE0A 2JRCA 2VPZA 5HUHA 1E3EA 3O75A 4E3ZA 2AG6A 5BOSA 1QGED 1VP9A 3ZDCA 1WKVA 2GHTA 2IZ5A 3FYUC 4MR8A 4ZQCB 4DR5B 3A6PC 5YASA 3LO8A 5KNCA 1AU9A 5SY6A 4JP1A 5A6SB 1OIXA 5JPCA 1ACMA 1EBUA 3WRXA 1JG4A 4PGFA 4A9AA 3ZY3A 4EUEA 4E7OA 2YOHA 4TYPA 4JC5A 4MWTA 3DLIA 3VSDA 2PU7A 2HQRA 4YQZA 3A3KA 2OAEA 4RGYA 1PWEA 3A1DA 1UFKA 2WKWA 2OFPA 1IN7A 5BW4A 5CA1B 3UBTA 1NE7A 4R1PA 1GQYA 5JHHB 3LBYA 2BH9A 1Z5UA 5IS2A 1C8LA 3E18A 3E3AA 1Q3KA 4HMQA 4XQEA 3KYDA 4X8LA 5FB3A 3KV3O 2BRUA 4MAAA 1JFFB 5JMWA 3PGKA 5C5EA 4WRRA 1YU6A 1SBTA 3KSZO 4Q7EA 4XDGA 2WQ7A 3WICA 2R84A 3MAJA 3RF7A 4M6WB 4N5HX 4E4TA 4B8WA 1YVRA 1EGMB 2WM3A 3LLVA 3OCJA 2X6TA 4O4IB 2IU0A 1XO1A 5SZIA 4RELA 1CQJB 2WSLA 1YJQA 3UC5A 4EFKA 2WTMA 5FORA 4RENA 5JSKA 3NV9A 2HUPA 4UEQA 2QBYB 1LSSA 2XA2A 3BTSA 3HCCA 1ZIXA 3IT2A 3Q2IA 4XYEA 3FFXA 4KLAA 4CTJA 1ULAA 1ISMA 5F7OA 3QMPA 3PR2B 3IR5A 4H1UA 4BATA 4WZ6A 2SKCA 5ES3A 2O3JA 4HNTA 1JKFA 2JEOA 1OSNA 4UJ3A 1ZESA 2DBYA 4NBTA 4JBXA 2C97A 4XWTA 1Q1NA 3VSBA 3HZOA 4IRXA 5MDHA 3KZNA 2XXBA 5SYNA 1G4AE 4F5ZA 1K97A 1ZINA 4UQPA 1ESZA 3OEHA 1RAIA 2P2NA 2R96A 1C7RA 2Q0XA 2REQA 3JS5A 4UARA 4UMVA 4ZOCA 3SZ3A 4B7XA 3WSVA 3U3XA 2YC2C 4F12A 2B78A 1UJMA 4IILA 4V0QA 4XYGA 5A3VA 3LBIA 1N6PA 2HHLA 5IC6A 4KOEC 4JI0B 3BK7A 3PT9A 4FIZA 3AUYA 2PH7A 4BKOA 4EEZA 2DUNA 2ZWIA 2Y4OA 4R2IA 2B4KA 3EWAA 3OTHA 3TMYA 2D5BA 2DFDA 4UNNA 2ZVPX 1N2CA 2FCRA 3I83A 2XGMA 2QRLA 5H1YA 3W2FA 1PGNA 1P8JA 4LDPA 1RJWA 4CIBA 3DZHA 4ECAA 5KNDH 2PYZA 2WHPA 3ML1A 4WXPA 5I9TA 4OOFA 4KO3S 4NBUA 1VBNA 1SVMA 2FFQA 2IGBA 4DLBA 3N0RA 5EIWA 3QVSA 2G07A 4FMCF 5GZ1A 1X15A 4I08A 5DTMA 3T7CA 5JR3A 4HNAB 3IP8A 1QPGA 3H2JA 4GR5A 5KYNA 1XK7A 2Z5GA 4LF8B 4LWQA 4PICA 3F71A 2D7JA 3VOTA 1ZGJA 4CUJA 1T3LA 4YI5A 3UMSA 3TECE 1DXHA 2OKCA 2X2EA 4XGRA 1OE0A 5MF6A 1HDEA 1P9RA 3E9EA 1O5TA 3GPCA 3SQMA 2QSUA 1SUSA 4LRWA 5IH7A 4TRRA 1IZ7A 1VQ1A 1XNHA 4W8HA 5KU1A 3DB2A 3NH9A 1F7VA 4F5WA 3HWWA 4RHEA 4TUYF 2CHFA 1N5MA 2IPXA 5F3RA 4P08A 2CB9A 4MQMA 2C4MA 3A9WA 4Q05A 1FLDA 2BFDB 5JARA 2C5FA 1Y5RA 4FFRA 4Q4DA 2JC3A 3BG5A 1ONOA 1D9ZA 3KVOA 5KNBA 5EMMA 4C1NA 4KPGA 5CNJA 4KRFA 3ETGA 3C8ZA 4IUDS 1KDPA 2HDWA 3DXFA 4LYFA 4CKWB 2UUBB 4RDXA 3UHAA 1J90A 2RGDA 4TTSA 4ZDIA 2X5XA 3X1WA 1G7CA 1P3DA 1Z0AA 3FSRA 2LP4Y 4DWWA 1LW6E 4K0KB 4DJEC 1PK9A 3LVQE 3K70B 5EMJA 3EPHA 2YS6A 4TWZA 5DGHA 2O59A 4DLZA 4G1CA 4G56A 1YS2X 3LF2A 3Q7RA 4P34A 2ZRHA 2AXQA 1FBNA 1QOPB 1TTPB 1VJCA 1VLJA 2PZGA 3GQBB 2ZI7A 4CIXA 3T8YA 2YRXA 1K8XB 1OMOA 3I1YA 1P0MA 4L72A 3A8TA 3W6ZA 3WTBA 5BSTA 4EELA 3R8XA 1WCYA 2NO4A 1TUIA 3AZOA 2DJIA 3FPAA 3KG2A 2ETVA 4WECA 5TMPA 1C9DB 4FC7A 2QG9A 4TXLA 4JLVA 3B70A 4BV8A 1O58A 5HKAA 2XT9A 1N9ZA 4ZVOA 1PX2A 3D7LA 1G64A 2JFHA 4CM9A 2W83A 5CLLA 4JZKA 3SZOA 1DDOA 4UM9D 4DIUA 4ZO8A 2LRHA 5TVGA 5GGYA 3D0OA 2JH3A 1L7OA 1Z39A 2X8AA 3IC5A 3RSQA 5A9RA 2FI1A 2WAMA 5H80A 1Q1EA 3LC1O 2IITA 4ZZ3A 2HK8A 2OVFA 1DQNA 1RBZA 3GGJA 2FX5A 5EI5A 2ZYUX 3GLHB 3H5LA 1NT4A 3AR9A 2BF7A 3KJZA 1YB7A 4F2HA 1G60A 2XE8A 4FFPA 4INJA 3P7MA 3T3EA 4PG4A 3UMBA 1YZ3A 1WR8A 2NV6A 5LZ5A 1Y3HA 1HRKA 2C92A 4GEKA 1JEDA 1ZGGA 2QD5A 3A6GA 5DRTA 5LNK6 3KXKA 4B80A 2OZPA 2EZ9A 3MILA 4TT8A 5FL3A 1W5EA 3C5WP 5EFOA 1T5OA 3ET5A 4PO3X 4TV8A 1MO5A 3RNLA 3P19A 3H9EO 3OT5A 5C1IA 4EGQA 4AUMA 5LNK1 1ZH8A 2ZYHA 1D1PA 2ZBUA 4QELA 3EQ8A 1DAGA 1YRQA 1K6EA 5ULLA 2FSVC 4ILEA 3ZWWA 1CD5A 5KJEA 2C95A 4HDKB 4ERXA 3HA5A 2YZNA 2OCXA 2Z2XA 4GNRA 3ZWMA 3IJPA 4RD1A 3DMDA 3TQTA 3HTXA 3AI3A 2GJAA 4Q9JA 1PGJA 3BXZA 2ZRGA 4URHA 4X7MA 4Y9DA 4FEYA 1B15A 1XJ5A 1T6XA 3GDFA 3BF8A 4JJZA 3LC0A 1SWVA 2OMEA 5REQA 2VATA 2ILVA 3CSDA 4BCDA 4D74A 3IE1A 4RPGA 4X61A 1EJ0A 4FNOA 4Z8XA 3IQDB 4JU8A 1A96A 4GP7A 2P79A 3EODA 4IIHA 4ZV4A 2MR5A 2J5RA 1GPJA 2RCNA 1M5UA 1NNLA 2Z4RA 5F9FA 3PR1A 4DLWA 2C9CA 1KQPA 2V03A 3O0DA 3AYZB 3OCZA 5HOQA 2V45A 4P58A 1T2FA 1K8ZB 4I81A 1B23P 3E7FA 1O95A 1C2YA 4EQ6A 2C20A 2QLNA 1P6UA 1KBQA 1SCDA 2JFVA 5HE9A 1EK6A 1ZGBA 2PXAA 1Z16A 4MITA 5KPJA 3LMKA 4BUZA 3IYLW 3OHMA 1OTXA 2QKYA 3M5DA 4Q9KA 3V2HA 2NAFA 3BXXA 4P38A 1CY4A 2HIMA 4KFCA 1P73A 2V5AA 4GUDA 4FQ8A 4MRPA 3HFGA 4NBLA 2QJOA 3O3CA 5KDLA 2HN9A 3ENQA 5E1BA 3BIFA 1P61B 1DAFA 4RF2A 2B8NA 1MC4A 4KQ6A 1P31A 2MIIA 1H85A 4B2IA 2P30A 4MKZA 1RC1A 2UVDA 3KHUA 3LL7A 4NU5A 3T7JA 2AFHA 3DQQA 1JTEA 4I4TB 3HDJA 4B35A 1A95A 4YJ2F 5JSZB 2JAHA 2VQSA 3ZDFA 3TFWA 1Y7IA 5TB5A 1ZCJA 5JQGF 3K0CC 3HCFA 4O4JF 3DHNA 3A3OA 2EBHX 1HNZB 4IIUA 1UEJA 1ZK0A 1DO2A 2DQYA 5FTKA 3QQ5A 3KVRA 1G2QA 3VAAA 4AC9A 5JRJA 3K9HA 2C96A 1AA9A 1KI6A 4BDSA 5HW0A 3L1VA 5IWCA 1Z4NA 2XUDA 3ETNA 2VYVD 3NJ4A 4CUZA 2BDEA 1XEXA 2PSDA 4N40A 5TV2A 4AO8A 5KBYA 4LXQA 3N07A 1HLDA 3VV2A 3WB2A 1AM4D 1QO0D 1QIMA 3WSWA 2ZI9A 1P7YA 3WWCA 2EBFX 4YV7A 1NDQA 3E23A 3QV1A 1FRFS 2BAGA 4I1VA 5CM9C 5EJ5A 3L6DA 5KVQA 5B3AA 3O4HA 2IHJA 1RNLA 1BXGA 2PZMA 2RH5A 4FC6A 5IULC 5JATA 3G9QA 4FFBA 4YMSA 4PZUA 4DCSA 2D2IA 3H2HA 3JTMA 3QTTA 5H5JA 3T5DA 3QEKA 5EJ9A 1Z36A 1RZRA 1SIUA 2NX2A 4TMZA 1Z3CA 1LJUA 4JLSA 1T0BA 3QKTA 4HTFB 2GFIA 2WZCA 3HNRA 3K0AA 4K46A 5EINA 4QWMA 1CWUA 2RH4A 3Q8KA 1IHYA 5J2TA 3H2BA 4HQFA 1KRXA 3BMXA 1F9EA 1SBNE 3BB3A 4BE7B 1GR0A 3F3SA 1F06A 4P9NA 2V6FA 2BP7B 3PWKA 2I6GA 4NOMA 3T1NA 5KTYA 3WGHA 3NDRA 3G1TA 4GOND 2MOKA 1LPBB 3D2CA 1FSSA 2FFRA 5GONB 5E7MA 2YYZA 4IXWA 4DLUA 1B26A 3BD9A 4CF6A 2QAJA 3LUBA 4D8WA 3RARA 5IARA 3AP3A 1J0BA 3AVQA 4E14A 2VXOA 5AD1A 5HA5A 3ZLJA 3D6AA 4NR0A 4Z49A 3QK7A 4LOKA 4DWJA 3MCWA 2K4MA 1I7LA 3GJ7A 1UBCA 1XQWA 3OZCA 2W58A 4OHOA 1ZR2A 2BM0A 5JBIA 1OJLA 1G6HA 3B53X 3KPUA 5H0IA 5FOQA 4ZCPA 3T7KA 4MMZB 2GAIA 3NT4A 4M4SA 4MICA 4UUNA 4WCFB 4N3GA 2AJDA 2EU8A 4F4IA 1WB5A 3DOCA 1FVFA 2DUMA 2ZB2A 4X54A 2FGJA 2AI2A 1B16A 4Q9LA 1LUAA 1RCTE 1L8OA 1ZSYA 2M98A 2YJ5A 2L0XA 5A3QA 4Z53A 3GLRA 2B5VA 1YR2A 1OBVA 3PCXA 3H84A 1C1DB 1J8YF 3H11A 2RK6A 4PTLA 1SXPA 2RBKA 1XQYA 2A9VA 1RTKA 1T2VA 3FF1A 3T5CA 4EG8A 5K4HA 3EZXA 3F90A 4JT4A 2DQ4A 2EYQA 1P18A 1UBOS 1XIVA 2JFUA 3GYGA 4Z0TA 3L4JA 3LY8A 4I36A 2GXSA 3RU3A 3H1PA 2AS0A 4F5YA 3TG8A 1RRCA 1ZNYA 3FH0A 2YNMA 3OM1A 4GL2A 3I32A 1H5UA 1KVRA 1W5TA 2F1OA 3ET4A 4Q03A 1WUYA 1RAAA 3QXXA 4XIYA 1YZQA 4JCOA 1W1WA 3MW8A 4D3YA 2XDQA 1M66A 1LS1A 1C3OB 4IEFB 4WLVA 5LA6A 4R81A 3C5CA 3NXKA 2QEQA 3O03A 1VHTA 4AECA 3GDHA 3T06B 2FSSA 4X8OA 5D3ZA 3BVPA 5IXYA 3BREA 3JD3A 2EKZA 4KNVA 2ATCA 5CRIA 4PFSA 4WVLA 5EN4A 1WZ2A 1FFYA 4XUCA 5DNUA 2CYBA 3FWZA 3RK4A 4K1LA 5FNVA 3M34A 5EXDA 3VUFA 4F96A 4AQ7A 1WDMA 3GLHE 4UU7A 4MKFA 4PC7A 3AFIA 5CFZA 4JUIA 3COJA 4FE3A 1JPNA 4XUEA 3M4JA 4OSOA 1PFUA 2BE9A 2J3MA 4BVBA 1IJEA 1QYCA 2OK8A 5ED0A 3ZH2A 1XG5A 1P2GA 4GPZA 2FPGA 5CW1A 4LTNA 5CFQA 2VNAA 5I4IA 3O93A 4AJLA 4BV3A 4CNQA 4YJHA 4H6VA 4ZVQA 4LI0A 5BXQC 1ZHHA 1NI4B 5G3ZA 4RJTA 1CC1S 2CT8A 3PFKA 4KR0A 4YMHA 4RQTA 5AR1A 5F76A 3SIRA 1NU8A 2FXIA 5E2AA 3CBGA 3LX5A 1RPZA 5K3CA 3D8NA 2BSAA 3I9V6 4V38A 5TQ2A 3WBKA 3MBIA 3NWBA 4K6OA 3NKVA 3KR0A 1XJQA 5EFZA 2CL7X 5AUQA 3WIDA 4TYMA 2DC1A 2HQOA 3F8SA 5KSWB 4RUKA 3DBRA 3KZKA 4WNCA 3H87A 1NLZA 1FQOA 1G55A 4ZOQI 1CEXA 2FJ0A 4ZV7A 3OA0A 4IO0A 4Y1EA 3MHTA 3I9V1 3MBKA 4MV7A 1OW3B 2X14A 4XZ3A 5AK0A 4YFVA 4BGUA 2FUG6 2V5UA 4YVFA 4ZO6A 2ZWVA 3KQSA 5AJZA 5HDQA 5U4XA 3UJAA 3GVIA 2GFQA 4U7WA 3B48A 3IKVA 2MSCB 4PNPA 1QHIA 3B8EA 3E9ZA 5FOXA 3BD6A 1B00A 2QN8A 1RWWA 1WKBA 4MWBA 3TQIA 3KQOA 4LMAA 4XSHA 2GXAA 1W9HA 2ZTSA 1E4EB 2J0VA 4OQFA 4DILA 5HKOA 3ZHVA 1KI7A 1LK0A 4CLXA 3CH4B 5KMGA 4A6DA 1NJGA 1DOAA 2H4ZA 3QFRA 1U1GA 3ESDA 2HMAA 2ZCUA 1AT1A 3KT8A 4BQEA 2NMVA 3HRIA 1TDJA 1RQPA 5BWNA 4HXYA 1G8KA 1TM2A 2I55A 2A92A 3T7SA 4O3MA 3GAFA 2FZWA 2DLCX 4DR6B 2C00A 1C41A 1ZVKA 5ECGC 3FR8A 2N1BA 4AJ2A 2WD7B 1LTHR 5KJFA 3HA2A 1GOTA 2XHZA 3QJYA 4JQOA 4UTRA 1UBMS 1GPUA 3TIIA 5B6PA 4WPGA 1OXBB 4JUFA 3AIOA 3LUDA 2G88A 2ZT7A 4QXPA 5L4NA 5JUWA 1OLUA 5FYDA 2YV4A 3GK3A 4HZGA 2E48A 2VUTA 1OKKA 5ESWA 1YB6A 4CHGA 2CFSA 1GQRA 1D6JA 3MVEA 1D1QA 2CXRA 4KVFA 1E7WA 4WBNB 1YVEI 3C6BA 4II7A 1IFXA 2YVUA 4MR9B 5FPTA 5HBRA 5T57A 4ZIRB 1AF4A 2UYHA 4KE8A 1W93A 1HRDA 2QI9C 4L57A 3SEQA 1L5KA 2LCIA 1QIFA 2CLOB 2WA2A 2YW2A 3PXCX 4LCEA 5FD8A 2XTAA 1U3FA 2DQKA 2NVUA 2EGUA 5DEOA 1AKWA 3IR7A 3PC7A 1UMDB 3VFDA 4E5MA 3EIWA 3O91A 5TT0A 3ZD6A 1WSAA 3SKVA 2OHVA 4EF4A 5A5EA 5BYKA 3OTWA 4OIFA 2YRFA 4PYIA 5TXGA 4AJEA 4MA0A 4U9IS 2PLFA 1YQ9A 3CEJA 5EIOA 4X1YA 1YF3A 4P3KA 1UH5A 1SURA 4IRMA 3R5FA 1SBZA 3EAFA 3EZNA 2V97A 1VSTA 3FFAA 5FBWB 1P0FA 1W85A 1S8OA 4RJLA 2YJZA 1ZVJA 1FYDA 4R1LA 4BHTA 4M53A 3X1YA 2DFVA 4Q24A 1DL5A 1OV4A 1WQ3A 3LQYA 1A1VA 2H0RA 1M1NA 3D31A 3R0XA 3JAMA 2WSYB 1DO8A 2XUIA 3PXXA 1VP3A 4P3OA 3T12A 2DPLA 4M9SA 3EF1A 1WDTA 3ZTTA 1IQ0A 2X8WA 1RLIA 4ZANA 2JAQA 3WK7A 4ENTA 1EAYA 1BJTA 4FYVA 4A0HA 5FTLA 1TRKA 1F5SA 3TQCA 4YYEA 4ALJA 4C5CA 1O9BA 2CJXA 1HYBA 3F3MA 2IBMA 4PXYA 1J21A 2JIZA 4DCNA 4WQMA 2QVZX 2PQ6A 3EBLA 1XDDA 2FZGA 1M73E 2OY0A 1KAHA 2VT2A 2BGNA 3CJRA 4LOIA 4X7RA 4DANA 1S2MA 3ZCXA 4A8HA 1QG6A 1XX6A 1Z0JA 2HCJB 3ZGLA 1J0AA 4PVCA 3SJUA 3I53A 3PFBA 2V8OA 2Y2UA 4GLJA 2BN4A 1R4AA 2VYFA 4IJKA 4QICA 1T91A 5JXJA 1BDMA 4CEJA 1P6XA 4YJDA 5A3SA 4JHLA 2V7TA 2DHEA 1EGHA 2DLNA 5D87A 1EQ2A 3JR3A 3C6XA 4MW5A 4RVSA 5KYKA 1PWYE 2DKFA 2XQIA 2Y71A 1H1DA 3AHEA 3JAKA 4ARZA 4DY4A 5IKXA 3GLGA 4OVKA 2GYVA 3JCZA 2C7RA 1QF6A 4PPFA 3ICWA 1I33A 1O08A 2JGLA 3E27A 3OPQA 2DEUA 2CDBA 3I0NA 2Z6VA 1G7SA 3AY7A 1T4GA 3FOCA 4D9BA 2QP4A 4HGRA 4P8RA 3UCFA 5ADVA 3KQNA 3IKTA 4OY3A 4CLOA 5HKBA 1QGUA 4KYUA 4I3HA 3KSBC 5JRZA 4F8JA 2Q1TA 2YIMA 3KLNA 4D79A 4DWOA 1RCUA 1Y8RA 2QD4A 1NXOA 1TYEB 1XTKA 3EDCA 3UK7A 3BPSA 4A1FA 2I62A 2ZRIA 3HJTA 1E92A 1NVVR 2W0SA 4YA6A 3RRNA 2PBLA 1JECA 1K0UA 1R0WA 1MABB 1E3JA 1P4SA 5CA0B 4KW7A 4US1R 621PA 4P7FA 2O2SA 1OFTA 2O06A 3K31A 4S1PA 1HPLA 1T4CA 1CHNA 1KK1A 1U9YA 2H31A 1EB8A 2OC4A 3HCEA 3HY4A 4FHEA 3V1LA 3PVCA 1AG9A 5E2BA 3PJDA 3RTDA 1EP3B 1SXJA 4K6HA 1BIFA 2I99A 2R1UA 3FYTA 1II9A 1LW7A 4MS3B 1QG0A 1VPDA 4FN4A 3HR8A 2YN2A 4JJ8A 3WYEA 5AQ1A 4MULA 4U9UA 2R25B 1C3LA 3NC1C 4D43A 4XOUA 1LC3A 1J2RA 4YRJA 4J75A 2RGRA 3KFXA 2VBIA 2VQ3A 1E0AA 3F6BX 2JVJA 3RSGA 3O8CA 1G1AA 1OZFA 3ESBA 1IHPA 1V4BA 2AKYA 2HYDA 3R5JA 2QWXA 3TNDA 1AKTA 3MJRA 3X1MA 1NMEA 2VXYA 3IP6A 4L75A 3BSFA 5I7HA 3FWPA 2QPAA 2ZWOA 5IJ9B 4LC1A 1CIVA 3IR6A 4XQGA 2IV7A 4UHEA 2R6HA 3X1DA 1ODKA 3CM0A 4EZEA 4U7PB 1QK5A 2E9SA 1PR6A 5EQTA 4HF7A 2WTXA 3IURA 3GRCA 3A31A 1VMIA 4FMBB 3VC7A 3BGSA 2HXYA 2YY6A 3TFQA 2PSFA 1UPTA 2H1WA 4E12A 2G71A 4P31A 1NC1A 4HZIA 3CW2A 3RT9A 5B7GA 3QRWA 4UTVA 4ASUD 1BYUA 3W5DA 3JV7A 4QGHA 2PBZA 5BNZA 1KYWA 4OXNA 2YC4C 3AT1A 3GJ4A 3K9LA 3OF2A 4JI6B 3OCYA 1OLOA 3UJ7A 4DSUA 2AKEA 2P1DA 4L22A 3FETA 3VAZA 3SF8A 4QBKA 3ZVLA 2AK2A 1PJ3A 2VDWA 3LPCA 4POAA 3SR4A 3ST7A 1MRSA 1X1AA 3DTVA 2BEUA 2R6CA 4Q1BA 2K2QB 5FKJA 1K27A 3AY3A 3UYLA 3FOAA 2WG0A 2Z3VA 4I1YA 2R11A 5KU7A 4XXHA 3RKUA 3IT3A 1T6BY 4P83A 4RK0A 4UHJA 1JBKA 1UDXA 2QYOA 3SIPA 3UHPA 7ABPA 5KQSA 4MPDA 2NZWA 2WIAA 1PR5A 2OD2A 2ONZA 2F1HA 4Q12A 8GPBA 3I2FA 4JVNA 4JBIA 3E2PA 4KZKA 4U7DA 1TK2A 4K81B 3HUFA 1QIJA 1MTZA 2GSDA 2W2KB 5LP6F 1QFXA 3QMVA 4GOOD 4MV9A 1VGVA 2WKPA 3AL0C 4BDTA 4M49A 1DKMA 4P53A 4DCUA 4NENA 1J1IA 1S96A 1C0PA 2O6LA 2IVZA 2J0QA 2AQIA 3PE3A 3IP3A 4QOHA 5BN1A 1ORHA 1R64A 2RI1A 5LQSA 5AMXA 3AB7A 4EWLA 1EESA 1KO1A 3HUUA 2VPXA 5M2QA 4DV0B 1BW9A 1UBFA 2DUUA 4G5QA 2JW5A 4XE5A 3PT5A 3ZY5A 2J3DA 1LFAA 1ZJ4A 4S3MA 5CDTA 2FMFA 1J2JA 1AZWA 1L5SA 3PGXA 4HRVA 1V37A 5CGQB 3RFFA 3U40A 1JDSA 3IEUA 4E88A 5KAMA 4J1SA 4URVR 2NPOA 3H7AA 4UAVA 3M3HA 1SXIA 3ZBQA 3B7WA 3ACDA 2I9PA 1CRWG 3IILA 4CIAA 1ZR4A 3FPBA 5T7BA 3REGA 1X1DA 1MDFA 2XNDA 3KUKA 4L74A 2R65A 3BSWA 1SO8A 3IXLA 4MYRA 2BW0A 3EGCA 4HDCA 1W88B 2GN6A 3MJFA 3NVAA 5HIMA 5JE8A 1XMJA 2ST1A 4FQ5A 4FYJA 5HQTA 5CH3A 4FW9A 3WB0A 1RXVA 1H94A 3I28A 4OBBA 2C5LA 3VHXB 2C0CA 1OH5A 2N47A 4RVFA 3FYDA 3A2KA 2EHJA 2NSYA 4I50A 3RROA 4DEYA 1D2AA 4DUPA 2GLTA 4XVUA 4W5JA 1BEUB 2IZ7A 2WOOA 2L17A 4LK2A 1TUGA 4OMUA 4QVKA 4CLRA 3TF5A 4KR2A 2PGXA 1WOYA 2ZSFA 1Z38A 2G80A 3DXXA 4X20A 1WD5A 4OJMX 1I4WA 1T3TA 2AKAB 2PTGA 2R8YA 4GW3A 4ZDJA 1WVMA 4M0FA 1VPEA 3L8FA 4NYIQ 4X1IA 7GPBA 4EZBA 1BMQA 1UOPA 1TZKA 3DG9A 3LUGA 4JX9A 5ADWA 2UXDB 1EM8B 2P0EA 1ST3A 3N0VA 3IOBA 4RL6A 2E5LB 3DEZA 3NTOA 4OCZA 4RCYA 1NKVA 2XOKA 3FOZA 2G6TA 3ENWA 2ZTVA 1ZQ9A 1F2TA 3DHEA 3FW1A 4JOBA 1JV2B 2CF6A 1CUHA 1IN1A 5DLDA 2CHUA 3OCUA 2FTKE 2RHRA 2V6GA 3C3EA 2F1JA 2I7DA 4PYQA 4HNHA 4PRLA 1UEXC 1FFEA 3Q0TA 4Y9RA 3CVOA 3VPXA 5M04A 1IOWA 3MWDB 2I87A 1H8ED 3NHFA 2YOFA 3HMKA 1P5JA 2Z1MA 4JVSB 5LMUB 4HAYA 2EJCA 3OZTA 2NSDA 2Z9CA 3FSEA 3I5UA 1KHTA 2QLBA 4A2QA 2PUAA 3BXEA 1Z9BA 3FR7A 3BE8A 3RWBA 4TKVB 5CIWA 2PXHA 4D7AA 1OCEA 2PT7A 1DLIA 4KG7A 2FP4B 1QS0A 2XNJA 3X2SA 3IDSA 5F5LA 1M6HA 3KEGA 1T5SA 5AHOA 1WBBA 3FPGA 4JXZA 3U4HA 4U4AA 4R6XA 2WF6A 1O9HA 1NVEA 1PZFA 4DQKA 1PS0A 1Y6ZA 2I6QA 2ODEA 3S5JA 4ACAA 5HUJA 1NTOA 2BGIA 2PL3A 2QRVA 2Q45A 4IXMA 2AW3A 1PNRA 4KDRA 4OKIA 4UUOA 1ODSA 2GD0A 2ZRBA 5L3QB 3D8SA 3HPRA 1RYMA 2HSEA 2B37A 4JT2A 5D84A 4NCBA 1OXTA 3SSNA 4BQRA 3U7HB 3QPAA 2P3QA 2FW0A 4WCVA 4WOCA 2MSKA 4CV0A 5MHTA 2BFEB 1EIWA 1SUAA 5A06A 5FI0B 1HOTA 1FRNA 2HF9A 2VPTA 5EP4A 1PEYA 5ILQA 1L7PA 1XDWA 1Z88A 4I5IA 4BFLA 2PVPA 3LCCA 3STWA 5SY4A 4C6SA 1P4RA 3V2IA 1TKRA 3FJ1A 2BLLA 2BKAA 1T5DX 3L7MA 1MQ8B 4HFNA 4TROA 5EZSA 3D02A 3LVFO 1EFVB 5G1PA 3CLRC 4QJ5A 4OYLA 1BHO1 4CMIB 3OJXA 4N76A 1KU0A 5FF9A 5LXTA 1JKJA 2MYNA 3PQFA 4DYDA 3U61B 5FWXB 3WQBA 5BN3A 3KP1A 1UF9A 5JBNA 3HFSA 5C8YA 4QOFA 5AW9A 2IW3A 5K51A 5A5DA 4EYOA 1IDN1 1AZLA 2JFBA 2Q5EA 3DEAA 1BE6A 1PZMA 5LOVB 4G1MB 3OZEA 1F4LA 3OQ1A 1T0IA 4P1ZA 4ZRMA 3REQB 3T5MA 5B5SA 4RTKA 1R5JA 2DJ5A 5DISB 4ZC8A 1NVKA 1NLFA 3BL5A 3UGQA 1KDTA 2GCNA 4N48A 4QXMA 1RBQA 4KQFA 5LVAA 1XAIA 3UFBA 1PGQA 3IUPA 4A2WA 2RJ3A 1T0JB 4L2IA 1XZIA 1CDDA 3PZRA 1VBFA 2XBUA 4PXSA 5L6MB 3A1NA 3BMOB 4LJ9A 2BKUA 2WT9A 3E4DA 2GAOA 1XC7A 3FKSA 5A7GA 4YQFA 2C9BA 2QMYA 1ISHA 3NGLA 4OQXA 1KS9A 3WLPA 2BIFA 4A6XA 3ZHUA 2ZT5A 4FKMA 3TTWA 2QU8A 1O6BA 1ULHA 3OY2A 5FV7A 1XRQA 3DGFC 3HR7A 1EUCA 4P84A 5F77A 4CMJA 3KXPA 4EF6A 3SHWA 3KZVA 1M6EX 3MD0A 5DKFA 4F2GA 3EVDA 3HSKA 1NY5A 1T3SA 3VU0A 1PW7A 1EFKA 1NGSA 3R6GA 2HF7A 4H31A 4MB0A 3MCAA 4AXXA 3GD5A 1V8OA 4A03A 3BXFA 3E0XA 2KQUA 1IHUA 5DWDA 1KJJA 4W82A 4JBNA 5EJIA 1O0CA 1D5WA 1YULA 1CCWA 1BEEA 1ICEA 1LRLA 2XMQA 2X0DA 4AY6A 2H9IA 1FP4A 3N2GB 3TOZA 2QAIA 5CEJA 2P3LA 5HKKD 3MQFA 2QXYA 4D8TA 1XMOB 3ZXXA 2F3UA 3O8QB 4IICA 4LV6A 2YZGA 2YUTA 2R60A 3ABSB 3GLFA 2V3VA 4DR2B 4L9RA 2QJWA 3PFHA 1J23A 2EP8A 4GSYA 3RUEA 5HGXA 4M7PA 6REQA 4X6YA 2VQEB 2VUSA 5I9BA 1CS0A 2WV9A 2D0IA 1Q0RA 3SWWA 4DXAA 3KJIA 4Q82A 4GGOA 2WUGA 2OHGA 4GDFA 1XZBA 4YAJA 2Q4BA 4GMDA 3MJEA 5CK4A 3GFSA 5DYWA 3WIEA 5C9ZA 2I2FA 3KCQA 1VRVA 3ZZNA 3OPXA 3RIMA 2SBTA 1JPJA 3PUKA 4HUQB 4Q4HA 4DDTA 4R0MA 3AZPA 1L4LA 3NIBA 2FG6C 5AW3A 3A7DA 2FEXA 2O57A 3P9XA 3CUKA 5KC8A 3K1AB 3C8UA 4C3ZA 5JFOA 3NYQA 5M29A 4DDVA 4B5LA 2QT9A 3LLUA 5K0FA 4GXQA 4BPBA 4ZCRA 4QUBA 3L7OA 4TSRA 4PAMA 1N4AA 1QAOA 3ZGOA 3L5OA 3FWKA 1TO1E 4BRSA 1OYWA 2RKOA 1VKNA 3GJXC 4Q3OA 4CR8A 3STHA 3DCNA 1RYHA 3OSUA 1JU3A 3X2FA 1T36B 5KKAA 1C1HA 1ZKDA 3GUCA 4R2WA 2AXEA 2Z1NA 4CODB 1DQPA 1E9RA 5BSEA 2ZB8A 1EWKA 1U65A 4Q4JB 3OZAA 5FUBA 5HF5A 3TD2A 5JCOC 2ZUTA 3V33A 3ZBPA 5EGNA 4QBTA 2XGSA 3KEOA 3EUEA 2YXNA 3ZI4A 1Y8ZA 3DBLB 3EFBA 1BDBA 1G3RA 5J59A 4NZZA 2CL0X 4D46A 3RUCA 1CR1A 2NUAA 5J3JA 2O2CA 5IP5A 1G2PA 2Z3WA 4DV2B 4L6CA 3ZXYA 1UANA 2VH5R 1JXQA 3GGOA 1MW8X 1EZZA 1UT5A 2HCBA 3HWSA 2YKGA 1RIFA 3AP2A 2G09A 4JC4A 3TBFA 1NRXA 4FFLA 1FFHA 1NP3A 2ZB7A 3FOWA 4PX5A 2F4NA 2YJ6A 1J39A 3AK4A 2Y66A 3CT6A 4J7XA 4U2FA 1L5HA 3CLHA 3WVNA 1KH1A 1JKXA 3C4QA 2P4EA 3AWIA 5AKYA 5EPOA 3HXOA 1HEIA 2LKDA 5IKMA 1KY2A 2JGIA 5F2KA 3F6SA 1H9CA 2IHBA 3RS9A 3WGMA 5A4IS 5GPBA 5JECA 5IJ9A 5JAIA 2BJWA 3MSCA 3NWOA 4FS8A 2PU5A 4MJLA 2GXQA 3T5TA 5EUQB 2IKQA 3JZDA 2KYRA 1Y80A 2GPJA 4IIEA 4W9RA 4YALA 4XYLA 4EVRA 4IFIA 5DNWA 3L43A 1QKKA 1FJHA 1WZCA 1AGNA 4NU6A 1FMJA 2F3QA 5H4HA 4I7EA 3UAXA 3DE0X 2QLJA 2O7SA 1LC0A 1Z2OX 5FH9A 3PZBA 1IIRA 5BNWA 1GUZA 2OBYA 3DZKA 1Z7GA 2QY6A 1L0BA 3EUAA 3H9QA 4QASA 3TIVA 1VPWA 1JBEA 4BECA 4WA8A 4K03A 2QJFA 5DLYA 5DXFA 5FQOA 4KQIA 4LF7B 1T24A 3EEYA 4LZWA 2X9GA 3O9MA 3C8DA 3N2YA 4UKDA 3IB6A 4N0EA 1JB9A 2IYXA 1F48A 2RHWA 1RYDA 3AW9A 1GZ4A 3DPSA 1QHHA 4RESA 4GIBA 4WBSA 2BMDA 3CRNA 2QSJA 3IUEA 3EIEA 4P33A 3AUTA 3AJDA 2ZTLA 3L7DA 3HC7A 2VF8A 2CNLA 1O03A 1TOAA 3HV0A 1UT8A 2IC5A 1FNMA 2ORED 4DCMA 3PV0A 3ZW8A 2XF8A 2PZAA 3DMYA 3DZIA 4KP7A 1YR9A 3E9QA 4HLQB 4V1CA 1W8DA 5LYJF 3NMUF 5HRAA 3ANYB 3UV6A 2GNPA 4B43A 1C4OA 1WHSA 3TGLA 4KZPA 1H3NA 2HWKA 3ENKA 2QVLA 1RWVA 3P2EA 4S35A 4X1OA 3IJ5A 5G4LA 1KSJA 1DJPA 4EKIA 1RRPA 3L6RA 3NBYC 3FVRA 1MIHA 1MEEA 1KTIA 1AV7A 3EBPA 1B6TA 2G9ZA 1LVGA 5KYXB 1IUNA 3K6SB 1NF9A 3K6RA 2AG0A 1FDRA 3NRBA 3OX1A 1FTNA 4I19A 3GJYA 3A1FA 1JHDA 3FTPA 4WY8A 3SY8A 1KY3A 2IELA 2ATXA 3RV4A 3A7EA 1U5BB 1UWKA 3R6WA 1U4NA 3E5NA 3RS7A 3VYUB 4TKUA 5DBOA 1PG5A 1GEEA 5JJKA 1GGVA 3HBLA 1YA4A 4LJ8A 1KEEA 1OXXK 1XA3A 5E6UB 4LJKA 4N0MA 4EB8A 4OIMA 1XRRA 3VO8A 1PLKA 4ZYUA 5EP2A 4DV7B 1EFLA 5FLEX 2GHRA 2Y68A 1N25A 1Y8QB 4B0OA 2YR0A 4ZYYA 3AC0A 4WKNA 1N9KA 5FBLB 3RKRA 4DM3A 3WSTA 4JEHA 3MOSA 1TM7E 1F6DA 5JTUA 4CXMA 3H1AA 3W8FA 1YB2A 3COWA 2JCSA 2Q3HA 4OH7A 4QTXA 4D44A 2VAPA 3NNNA 4B09A 1FVXA 3E9YA 5DCUA 2QG4A 5BUZA 4X8MA 1UFQA 3WLNA 1SPXA 2FWJA 5FWYA 3UMRA 3N2KB 2NYRA 4BMZA 2GI4A 1K63A 3TEJA 1NA5A 5TMEA 4R68A 3U4QB 2C83A 3H1EA 1EWRA 1W47A 1YJXA 2ANBA 2ONCA 2VC2B 3AU9A 5A9SB 3RC8A 3C7DB 3SYLA 3LOQA 1A8SA 1ZGHA 4YCDA 5AOCA 3CA8A 4F1JA 4FIDA 4WZAE 5FTNA 1T10A 3C2QA 3CE6A 3EZFA 1RI5A 3D1LA 4CQJA 1JPUA 3C15C 5K45A 1JIJA 3UMMA 2XB4A 4DSAA 1CG6A 1XWFA 3A1WA 4G65A 2BTQB 2P7HA 3AGQA 2O2XA 2ZJAA 4UEOA 2NP6A 1FXWA 3FLAA 1BCRA 2QZSA 2ZVQX 3VR5A 2OT3B 1YDMA 1AKNA 1S8FA 4F5DA 4P4TA 1GZ3A 2G6BA 2FXVA 3NTVA 2V6MA 3R44A 4DLRA 1ZISA 4OD0A 5LLSA 2VTBB 3IUYA 1MW9X 1SXGA 4C6TB 3GEBA 4M1YA 1DZ3A 2Z9DA 2RONA 3EXAA 3VH3A 2WD9A 1JYFA 3EMDA 3TK1A 1EXWA 3H1GA 1NG9A 1B8PA 3RTCA 1HEYA 1WZEA 2QMOA 3MT9A 3JVVA 1KWGA 1ZNXA 2HSDA 3SYMA 1TMGE 2KX7A 5AHRA 1MJGM 4O29A 1TAUA 2GNOA 1FS6A 1UKZA 1TAHA 2DB3A 2WFLA 3DMNA 5HG0A 3OIGA 3OU7A 1GZDA 4E0BA 5FI3A 1Z4JA 3ZV4A 5KZMB 2V96A 3WIBA 3AVWA 3GN2A 1RWPA 1W0KA 2E4ZA 5CDGA 4M7OA 1ODFA 3EA4A 3GEDA 2GEBA 5CA1A 2AX4A 3LHDA 5KTPA 3QIAA 2PXCA 5CVEA 1KI3A 3WMGA 1OFIA 1SKUA 1K08A 4KR7A 2B20A 5HS4A 2P2DA 1Z22A 3SLRA 1JAYA 1GZ6A 3V3TA 4DMGA 1JFFA 3CB2A 3U48A 4HVLA 5HJ5A 1AGXA 3A4MA 4FGJA 3V97A 2H4FA 2IX3A 1IUPA 4MK4A 1DCKA 3TI7A 3NHYA 1K2VN 2Y1XA 3IVRA 3K0FA 4OHPA 2IS4A 1Y81A 1DFGA 1NFRA 1XWIA 2D1SA 2J09A 3CCCA 1H2ZA 3GEGA 4M6WA 1QB8A 1CRQA 1GPH1 2QMQA 3CURA 4X24A 5F7XA 1THTA 1GPAA 2H08A 4O4IA 3HJAA 1CDEA 2QE6A 2H51A 4CKYA 1NBHA 3GDGA 4N4AA 3RTGA 5AI5A 3FI0A 2YFQA 3ES9A 4GQAA 1WUJS 3Q87B 4GKAA 1V1RA 1WMFA 2XD4A 4EP1A 2BGMA 2J6HA 2C54A 1C1YA 1W36B 3M8KA 4HEHA 3RS8A 4KQGA 1T35A 1WOMA 1FSGA 1KERA 3UMCA 1TF5A 4QBGB 4B71A 4X6LA 1NBEA 1U0TA 2QUBA 2XUOA 3SEZA 1B0PA 1O57A 4JH0A 4PLWA 5PNTA 4TWIA 3SJBA 2NT3A 2EHDA 1PD1A 4LFBB 2C9OA 3AEKB 1XDBA 3UMVA 1H9BA 1U0BB 3RK1A 5C37A 1CNFA 1SRQA 2I54A 2G40A 3IAS6 5D51S 3C3AA 2BHSA 1PNTA 3PHCA 3PHJA 2FPSA 1GA1A 2O0JA 3BULA 3COPA 4DJAA 5KOJA 4N18A 2EW2A 3JPYA 3IIKA 1K86A 2CGEA 2AYXA 1V5EA 2B0JA 1NSYA 3NCHA 3KM0A 1PVDA 1DIGA 2HI0A 1WCIA 3DKRA 3IAS1 5CIQA 3WA7A 5E6RB 1HLGA 2HJWA 5ALFA 3ZLBA 2EC5A 4MRRA 3EGDB 1V1MB 4YPVA 1KQFA 2I22A 1SVUA 4XD7D 1IBKB 1TVEA 2FF7A 4AX8A 5I8PA 5KWIA 2H29A 3B5EA 2X13A 4YMWA 5TMDA 4S1VA 2X0FA 4D8XA 3HU3A 2OGSA 5BP7A 5AW7A 1E1RD 1U8YA 5JY6A 1VLLA 1X1SA 4U00A 5EJ8A 5TS2A 3ORRA 1QX3A 3NW9A 3TO5A 3IEMA 3HO8A 1OFUX 1NVVQ 3BX1A 3M5PA 4HNAA 4HXEB 5ERYA 4MQ6A 1S3IA 1AN0A 3NAZA 1ZM3A 3MWKA 5DX1A 1WPQA 1NVUQ 3OVMA 2C04A 1W7AA 1D2HA 5FWDA 1LZLA 4CKEA 2GBLA 1D4OA 3IEIA 2DYKA 5SYMA 4FFNA 2Z43A 2O8EB 4C7VA 4JCCA 1DELA 1LK7A 4MRAA 1T2CA 4IWXA 1BE8A 5G0TA 4PFJA 3EGVA 1IY1A 2GTIA 3IDAA 3NTQA 2ZYRA 5HTOA 1R6BX 4QPJC 1J1UA 4WN9B 4WI1A 1U0OC 2HNBA 5BSMA 1GKLA 5L7YA 1SR8A 1S2LA 4QQKA 3S44A 5TLSA 2FEAA 4OQEA 4BQQA 4FLEA 4HATA 1OWNA 3I30X 4O2BA 3KPVA 4WK6A 5AJWA 4CRWB 4D9FA 2C82A 3ESXA 4WLEA 1GTL1 1PJAA 4O2LA 1BEZA 3AU8A 1BMFA 3IPXA 7ADHA 1TQDA 2G72A 3CZ5A 3VYRB 3MXTA 4O6VA 5TQ0B 3FVWA 1T8PA 3E7WA 4DQLA 1XPOA 3L8EA 1OF1A 1QO9A 1WM1A 3JVUA 3JYLA 1N6IA 4DQ0A 1SCIA 4BCBA 1OKKD 5IW8A 4G5YA 4DKXA 3H19A 1NJ5A 4ZVKA 4DJ5X 1ZRSA 1BD3A 1CNMA 4LYAA 4H59A 4X63A 4A1OA 2F43B 4KXUA 2O5VA 1JDVA 3OBBA 4HNSA 4IBOA 4BO4A 4F97A 2ZE7A 3JU3A 1P4AA 3GQBA 4N12A 1TECE 3VR6H 3RVMA 5A4MS 3ZXIA 3GUYA 1E32A 3N7UA 3VZSA 1DI0A 5BQOA 2R87A 1QRSA 1JR3E 5EWJA 1PJCA 2JARA 5FBKA 3WJAA 3F6PA 1EFHA 1Z26A 2X0JA 4BNIA 3ZV7A 1P80A 1VL6A 2BR3A 4TRMA 3GB9A 1C1XA 1XDSA 3F8WA 4DCTA 5HIIA 4W5TA 1XZNA 3GLKA 1KYZA 3H4VA 1SOWA 3B20A 3Q9SA 4L9AA 1KE1A 1JJ7A 3O7WA 1SHJA 3FAKA 3MIZA 1V9CA 5DT2A 2F55A 1YDGA 2NADA 4C76A 1GYPA 2RIPA 1BX1A 4ZCSA 1AQNA 4MW2A 1IY9A 2GNAA 3NBQA 3V6MA 1Y7HA 1YE8A 1LLFA 3EARA 5KNCH 4MYCA 1ZD8A 4DMHA 3TJZA 1R0KA 4RQUA 4E5YA 1EFRA 3N2IA 4N5IX 3ZEAA 1UBGA 3Q85A 2ZYTX 4BNUA 3HM9A 4PO8A 2H1VA 3NH6A 4BIIA 4WJKB 4EW3A 4IKOA 4MTCA 2WV7A 4FQ7A 4FOPA 4PN7A 1DP4A 2JLXA 3HY3A 5JVDB 3UY4A 5LZ2A 4E2WA 1X7DA 3BHJA 4A8TA 1M9NA 2CE7A 1U3TA 1COZA 3QXSA 4XYMA 2IPLA 4DPKA 3C6YA 3AVVA 1SC4A 4TMYA 2JIZD 2RGUA 5FO0A 4US2R 1BE1A 2XKKA 3B1FA 3B3AA 1RWQA 4NC9A 5JI2E 5AW0A 4UAJA 4PSDA 5IHXA 3K73O 3LCJA 1WJGA 4DRYA 1A5BB 3KVNA 1JXMA 3UG7A 4P6VF 4EJ6A 3BFXA 2BFNA 4FMPA 5K8VA 2OZLA 3JQAB 3TQQA 2Y1LA 3B5JA 5HVNA 2DFNA 5AM0A 4HDKA 2OFXA 1M1ZA 3G5TA 2OXEA 1VL0A 1HYQA 1FDVA 1Q15A 4JBGA 3TTYA 4HQKA 1JDNA 5C52B 4NBKA 2RGBA 4LPKA 3DZFA 5J2UF 4C87A 2XXJA 3ETEA 1P1HA 4MI1A 4HH0A 2QD1A 1BXRA 3PF9A 2WUEA 1UOEA 2G5PA 4G4SO 4N5MA 1XRPA 3EZ7A 4FGKA 4F7DA 2QZ9A 1K8QA 1U0FA 2IYVA 4MWGA 4RDHA 1KORA 1O96B 2YVLA 2BV3A 2JJ1A 3AMVA 4G6ZA 4GI3A 2VJLA 1W75A 4GP6A 3Q15C 4JLJA 1CZOA 4WFQA 3EGEA 3CMCO 2IUTA 2OV3A 5ENVA 2I8AA 1WXXA 2Q6OA 3L6UA 3DOFA 2WVJA 4OP2A 3UKOA 2XUKA 4ZGBA 4D25A 4CQMA 4Z54A 1U0GA 4WD3A 1JG6A 3VU3A 2GA9A 3IPCA 3OPMA 2CXHA 4CE6A 3DA8A 1J56A 1UDWA 1CJVC 5AXAA 4TZ0A 4KEAA 2R8PA 1BQEA 4M3NA 4DRXB 2QRQA 1DC3A 2GBIA 1YR6A 1YQWA 3F2VA 1M34B 4K3UA 4R1NA 4WA7A 3SFTA 3VX4A 2AMVA 2FAXA 3JQ7B 3VUEA 4OGFA 3VI4B 3CMMA 2O1XA 3AM3A 2XB6A 4CG1A 1FE8A 3ASUA 1JYEA 2JI6A 4M0EA 4OBWA 2B1GA 3DOHA 1MXFA 1BWSA 1YIAA 1U9IA 2POCA 3TLKA 4FSHA 4RW0A 5DYYA 1XOIA 4HJXA 3L9WA 4KTTE 4OA8A 3HKCB 1OI7A 1RWBA 1FP6A 3TVDA 1V5FA 1PHPA 2Q1SA 3FHCB 3JQ6A 3URMA 5A4KA 4UZEA 4N6NA 2V3CC 1B8NA 1IMJA 1ODCA 1SCUB 2GBLC 4GGMX 2W8ZA 4XJSA 1PS8A 3H75A 3U44B 4DZTA 5JEDA 5A2QA 3NHZA 1N9GA 2PIAA 4LGMA 3SVZA 4AX4A 3AV0B 1X7XB 2AN5A 1C9EA 3DKPA 4KE9A 3SHOA 1LQ2A 2IIVA 1JA9A 1WXGA 1ILWA 1U2DC 4WJZA 1UJNA 3H2SA 3PUYA 1DJNA 2D2VA 2OAP1 2FMTA 4TTIA 2EDCA 1T8UA 2FN3A 2P1ZA 3ZCQA 3JVIA 2W6OA 3B2EA 3CLRD 3HZZA 1HI9A 4A5OA 3QENA 3GMTA 1E2UA 3QEMA 3LLCA 2QTRA 3BSSA 4KI7A 4HTFA 3OP1A 4B73A 3WAJA 4RETA 3I73A 5ALKA 2M6SA 2WPDA 4BVEA 4M76B 2D6FA 4KN9S 4IZOA 1RI3A 4JOQA 5BQXA 3DTVD 4GM4A 1G7TA 2ISQA 4H15A 3ZPXA 2BP7A 1G5RA 4ZKDA 1U0LA 5K5EA 4A8PA 1KMHB 2RJNA 1E3WA 5JDIC 1HL7A 1MVOA 1C80A 2AN9A 3HU5A 4MV0A 3UAGA 4NSNA 2OD7A 2F3TA 4NMHA 2Q1UA 1DKQA 3W3ZB 2CMFA 2YWRA 2ODAA 1CZNA 1YKFA 2ODWA 3AGPA 2FR8C 1QVRA 3UTDA 4A2PA 5CEEA 1AH2A 3ETHA 4KE6A 3DD5A 4YBRA 1DC5A 3LY5A 4OKNA 1QF7A 2IEIA 3N58A 4RSHA 1RHJA 3DNMA 1QR6A 5AXDA 2CB0A 2IQ5A 4H16A 2QZPA 1GCIA 1X6VA 1OBFO 3WQRA 1VFPA 3L46A 3NIFB 2CV2A 5K1ZA 1PNQA 1IN5A 1IU9A 1QIKA 3DS8A 4RK5A 2C5SA 4D0NA 4CG2A 4RPCA 5L51A 1E9VA 4U2KA 4EI2A 2PVCA 2BUAA 3KDPA 1YASA 5D3QA 5TDHA 4B75A 4ESEA 1PG2A 4RPLA 4LF5B 3EXEB 2GGSA 1J7KA 2NVOA 4DQXA 1KWKA 1IEWA 2P11A 4XR9A 1Q77A 2MT9A 4R31A 1LSOA 1M8KA 1URPA 3DEYX 1TMOA 1C1DA 1FK8A 1G4HA 2COKA 3MFYA 4J3NA 1NI3A 1Y4AE 2CZGA 2ZIAA 4MIOA 3IP7A 4JASB 3DM9B 3PRYA 5AOBA 4L5YA 5TMBA 4IX9A 1KVQA 5LLDA 5LQAA 4ZEWA 2FN9A 2IDJA 1XV5A 3CEMA 1C9NA 3O9VA 2C78A 4LOJA 4PC3A 4E5PA 3G9UA 4LJ5A 3KDAA 2Y0CA 4Q4AA 2RAPA 2XNDD 3ESZA 3TINA 2IUYA 5J58A 3FXAA 3GA7A 1ECBA 3DZ8A 2HO4A 1UMBB 2JH9A 1IXZA 4TLCA 5CH8A 4F3RA 4HYQA 4LKOA 3C3PA 3H2ZA 3WGYA 2AT1A 4ZVPA 3PX3A 3HPQA 3IQEA 3O2QB 2CJWB 3JQFA 4M9CA 2ZJ2A 3KE9A 3KKOA 4RX1A 4QL3A 5F1OA 3IQGX 3HVHA 4TZKA 1EUZA 3LUKA 2E6UX 3EMBA 1ZVMA 1E9AA 3M6IA 4IV8A 1XLWA 1T9KA 2R00C 4RABA 2YDYA 3HP4A 3FPKA 3IPYA 3V80A 3K0SA 3BH6A 3B1YA 1GA4A 4WY2A 1KYTA 5K0NA 4AVYA 1Z4PX 2SNIE 1W581 1UDAA 5F52A 3B2QA 3GLSA 4I3GA 2WBLC 1UK8A 4NJOA 4EYQA 5EKUA 1ZFNA 2I8LA 2P4HX 3F1LA 1NI4A 1ZJ6A 4JL5A 1OIWA 2XSZA 1VFNA 3VU9B 1LLUA 1W5SA 4QDTA 2NXEA 2I7CA 4KXFB 4U6NA 3VKWA 3GXBA 3S2UA 4BVHA 5ADUS 4LOHA 1HYGA 3LQ4A 2OCIA 1M7HA 5HQ3A 4F3TA 3AJ9A 2GO1A 1UZMA 3NTLA 2ZRLA 4TQUS 5DTRA 4ZJPA 2DR2A 4F6RB 3E7PA 1JR4A 3CZ4A 5GINE 3I01A 4PHHA 5JD3A 2GFHA 4IJ5A 4RK4A 1IG3A 1UPBA 1X80B 1HR0B 1EVJA 3AR4A 1GZ5A 3A9RA 4YP9A 3D3NA 3MMXA 1T43A 3HUTA 4G67A 4NFLA 2NYUA 4BVGA 4BZXA 2P91A 3RRZA 1ZG3A 3AHJA 1NXQA 2RHBA 2ZUWA 4TMFA 4WXMA 2GERA 2X5OA 5JLAA 3U3OA 3IBFA 4EGFA 1JLKA 5CDYA 3N87A 5B53A 3W1VA 4HYYA 1BWQA 1KP2A 3TLZA 2QORA 4EFMA 5DNCA 1ZH0A 1RTTA 1TEXA 4RLSA 5HILA 5J40A 5JFGA 2IWHA 2Q3FA 2B35A 3CE9A 5D3MB 1KS2A 1U9IC 1UAAA 3T54A 1TZ2A 3L7YA 2RGXA 2VNHA 2FLWA 3SXUB 1VJ5A 1RYZA 1JAIA 1LPPA 2VF7A 1MO3A 4LJSA 4RXMA 3T3IA 1KEWA 4BVFA 4OHRA 3CZRA 2UYQA 3AM1A 3RS0A 1XDGA 4PQGA 4UBKA 4RMNA 5JXIA 1E3QA 1L2TA 2ZSAA 4KQMA 3MCVA 4DL9A 3AERA 3K1YA 2YWBA 5LBUA 4BO1A 4QJ3A 5A03A 2XLBA 1A5ZA 1Q7TA 4FYIA 2PSHA 4HGPA 1M34E 4RL4A 4C89A 4I1IA 3BT7A 5I9IA 2PZFA 4NDNE 4F4HA 2WD7A 3IDZA 3PUHA 3GH1A 3V2GA 2XDAA 4U2GA 4J4TA 4KO4S 4A3SA 4EJ0A 4G0VA 3LIIA 1XZFA 4IZHA 4JENA 3V7FA 2BR4A 4HAXA 1N1GA 3V1TC 3EXIB 3RT7A 2X1MA 1UPXA 4OJQA 4D0SA 3VJLA 1DUVG 4FX2A 3CFYA 2WDZA 2RGCA 2P8SA 1Q0PA 2LBPA 2H2HA 4JB0A 1OZAA 3COSA 4CCWA 4WBNA 5HPYB 3Q5GA 3E03A 3WJ2A 2C2GA 3TUJC 4FMCB 3V8NA 1YKSA 2JJ2D 3AF0A 3H18A 1GNLA 4RZ3A 4C7OA 3L7KA 2H5IA 5F5XA 1B42A 1UMDA 4HVTA 3MPUA 5KAPA 5JW6A 1Q6YA 4LXHA 5AJYA 3UMGA 3UZUA 5DP1A 1LB1B 3FNFA 3FZYA 3N8DA 5LB2A 1C29B 3ZBTA 3N9IA 1KMNA 4UULA 3HDYA 1KJ9A 1FVHA 3E35A 3PJGA 4L8GA 5D7NA 4ZT4A 1ZH6A 3TIFA 4Q7MB 4EPVA 3N6VA 4RMGA 1AHIA 5FLYA 2WLTA 4E2YA 6Q21A 2O19A 2BYTA 1ZD4A 5FHRA 4PSAA 2YXBA 3HJGA 4TUYB 3TIGA 2C8JA 3R5XA 1W30A 2EG5A 2PO7A 3R1IA 1FC0A 2NV2B 5DXAA 3FKSD 1SM4A 5G0VA 1PJBA 2YV5A 5CDSA 1RLJA 4RTJA 4WCFC 3DJFA 1QWOA 1AKYA 1EEXB 3LOPA 4MV8A 1X14A 3UK1A 3AF4A 2VP3A 5H8WA 3JQQA 1ACJA 5DDIP 3HHPA 2A4KA 2QRZA 4BZQA 5EC8A 5KCMA 1W94A 2HA0A 3FSGD 2UZ1B 4C4PA 3WK6A 2OEPA 2KS6A 3AUFA 3ZI7A 1YBFA 1RQNA 2WUDA 2OOKA 3B1ZA 4D8YA 1E96A 1D8TA 1JHOA 1VXRA 1QM5A 2XCUA 2ISSD 1Z7WA 3AJEA 4S2UA 4OUDA 1VDZA 4GI2A 5BWMA 4Q16A 2UYGA 1V25A 4DLTA 4I1UA 3EIUA 4O2AF 1GZHB 1S2GA 4AYXA 5K4GA 1K98A 5EKXA 3L3BA 3LNTA 4EPXA 1K6JA 3GOHA 2IYZA 2QYTA 3U7RA 2R97A 3UFXA 4MZXA 2I6SA 1H6BA 3QMMA 1Z07A 1WSBA 2CXTA 5BN5B 1AZSC 1R0YA 3D4IA 1MC5A 2Q27A 1QUFA 4L5IA 3ZCSA 4C2BA 1HSZA 3WHPA 2NTJA 2W37A 3OT1B 5DNVA 3ZWNA 5BYJA 3TB6A 1PR9A 1NYRA 2OORC 3AEZA 3OI7A 1Y1SA 1D4ZA 1VB5A 3G5UA 1YUMA 4LG1A 2XQGA 2AC2A 3U4IA 2A5GA 3ZE7A 3AESB 4YRGA 3VRHA 1QYVA 5DM0A 2XD9A 3A1UA 3FIUA 4DNQA 3EEFA 1SJ9A 3D7RA 4W5NA 4N1AA 4JB2A 2A0XA 3JAWB 1VI5A 4Q21A 5HMMA 1BS2A 2ZI3A 2IV2X 2EP7A 5DI3B 3RTAA 1DC6A 1FDUA 1ND5A 3WWOA 1SCBA 3EIHA 2FZVA 3C14C 1HE8B 2BT4A 3U4CA 3F49S 5LBTA 2XZLA 1Q0LA 5DCWA 3KQLA 1OFGA 1N1DA 2IDMA 1OBHA 1KO7A 2F67A 1HMPA 4IRUB 5CA0A 4E1AA 5IANA 3GT3A 1IATA 2VJQA 3I9JA 1GG5A 2I4LA 4RF3A 4UC0A 1H2EA 2HRZA 1UK6A 1FRVA 2VWHA 2NZ8A 3AHGA 3DE1X 4RY8A 4DS3A 1EWYA 4Q3CA 4Z99A 1SHZA 4MS3A 4RXUA 4AK9A 2XHEA 1FUIA 3ESAA 2BKLA 1TKBA 3MD9A 4LX8A 4CDGA 1EQAA 1G18A 5IVDA 4DBLE 1W73A 2EKLA 4ILKA 4IQGA 5IAEA 4NNOA 3ZHOA 4ARIA 2EF1A 4OHBA 4H2DA 4Z9AA 5BSVA 1IWOA 3HVIA 2VAMA 3KPJA 4WZBA 2YCBA 3W90A 1WQ4A 5AK4A 3ZZMA 2I29A 4E94A 3NRJA 3FNEA 4U7HA 3SDSA 1XTUA 3QU5A 4MW4A 3SHVA 1HT0A 2BJVA 2VK2A 3ABZA 2Q8PA 3KLMX 5HK8A 1P7CA 5C7YA 4G5OA 2JLUA 2J5BA 2X9VA 5C5IA 3U3DA 3SDBA 3M2PA 4E3WA 2MMGA 1TVMA 4YP5A 4J1NA 5GP1A 5K01A 2GO7A 4LV8B 2ZULA 1V7PC 1ZK2A 3THWA 5A04A 2HHHB 4EPRA 1M74A 4RV5A 1TE2A 5T3UA 4LPSA 4Q01A 3I1IA 1VL8A 3OIUA 4NPCA 1XNRB 1WEHA 3PC6A 4OG2A 1WPRA 2IOYA 2I6FA 4KDEA 4CEIA 4ZYWA 1EE2A 1LBQA 4EHHA 4B3GA 5DNAA 3WLLA 4OQZA 1N5LA 2W6QA 2NU6A 2LCFA 4OLFA 1UBLS 1UXJA 1X1CA 4TYQA 2PMWB 1FTSA 4PM4A 4GVLA 3FDXA 2C9DA 4P4LA 4BEBA 3AVXA 2XEXA 4AZTA 2GPNA 3EFHA 4QEKA 4NQZA 3ZD7A 1XE3A 2JFPA 3SBOA 2CCGA 2W6IA 4WXHA 3VTAA 4ADSG 1ZONA 2EKQA 5CLQA 3KB8A 3M83A 2QUIA 2WJWA 3DAFA 1YWGO 4DR7B 1VG9B 1RHMA 2RDMA 1H69A 3JZAA 5CXQA 1X7YA 5CJ2A 2C2YA 2WICA 4N7JA 3WNVA 4EUKA 3D2AA 4QXQA 4HDOB 2CDNA 3PR3A 4JR1A 4YJ2B 2PBFA 3T99A 1L3BA 3USES 2W2KA 4O4JB 5JQGB 2J4CA 1YMQA 4MWCA 1LZKA 4WOBA 4U1RA 1QPZA 3NYIA 4W99A 1NOIA 4PZCA 1CZHA 1UP4A 2Q0QA 1YE3A 2WJ4A 2Q7XA 2R5NA 3NHLA 2IPOA 2AW5A 2VH1A 3AYXB 4H7PA 4R41A 3W2IA 2RHMA 1TB4A 4PC1A 4ROSA 3ZTWA 3AI2A 1V9LA 2VJBA 3OPYA 1GAEO 3P0FA 2YJTD 3QVJA 1FXUA 4TX1A 3RRXA 2FRDA 5DM60 2CHVA 3EVAA 4XB1A 3EPPA 3DF7A 1QDLB 2F00A 3FNIA 3LWDA 4N3AA 1FSPA 1R12A 3GAMA 4BNTA 1JKIA 5EE0A 2ZSEA 2P40A 2PQ0A 3DVAA 4UOEA 1ZEMA 2MYTA 1MB4A 3K09A 4L8LA 4ML3A 4P7KA 4AO6A 4ANFA 3ZDDA 4JBYA 2QX7A 3V55A 1TYDE 3OFKA 4BMOB 1L5GB 3BWDD 3L49A 4UM8B 4ZPJA 1UK7A 3DKKA 2B82A 2HIAA 1LTQA 3FKQA 4D9JA 3FVQA 5L4LA 2PMKA 2HW8A 4GXTA 1II8A 1C7QA 1QCYA 4DUZB 1TL7C 4TM8A 4DCJA 5LP1A 3INNA 3U81A 3TTVA 3VHXA 1XBTA 1TQ2A 4ND7A 2J6IA 2FSFA 4OLBA 4G0MA 3CRW1 1PSZA 2WNSA 3RTBA 1DJQA 4AP6A 1H93A 1TLFA 4QG3A 3ADCA 4DGQA 1BQ3A 3NHPA 3AQ4A 2YWHA 3HFRA 1NFQA 1Z0IA 3HCWA 4GH5A 3BRSA 2M6LA 1QDEA 2WHQA 5C4IA 3TBKA 1MX3A 2HWXA 4GI1A 2DHRA 2GILA 3RU9A 1DMRA 1N2JA 3WIVA 2WJGA 4QBFA 4I4LA 1HE2A 2BD0A 1X7WB 4CZ2A 4ENQA 5KYYB 3ROQA 3RSLA 1XMPA 3BWVA 4IIFA 4E5SA 1EM8A 2ZUBA 5JZVA 2E89A 1M5TA 5JCZA 2Y27A 3EJ6A 3S2YA 1KK3A 1VL5A 4OPMA 4EJMA 3IXQA 5EZQA 5K3OA 2DBRA 1CBUA 5LUBA 4V2IA 5ETJA 4LWOA 2R6GA 3GCDA 2J46A 3A14A 4XASA 2IHNA 2AWNA 5KTOA 1ID8A 1KEUA 4EHAA 1EH5A 4TWRA 1DFIA 2FDXA 3MWDA 1KF0A 2H4HA 4JWTA 4GR4A 4ZVLA 5K0SA 2C4TA 5JZSA 1NL3A 4G0ZA 1N0IA 3ND6A 4G0PA 1QF9A 3R5TA 3VR5D 1QPBA 5EWLA 1Z8HA 3QWBA 4EOGA 3I4FA 1TVCA 1O4WA 3SXPA 4Q7QA 4S12A 2PL1A 4HAZA 3OO1A 2GPBA 4Q02A 4AZ3A 3WLIA 1KIMA 1D0IA 3K5WA 5C3MA 5JCPA 1EP9A 1B6RA 4UHBA 2V7VA 4HJRA 4QX6A 2WTNA 2NPFA 1XZHA 4H17A 2EWMA 1Z8NA 4HZUB 3WKEA 4H7HA 3Q5DA 3G13A 4NBNA 4FJ2A 1R50A 1E2GA 4K9RA 5C4MA 4DIEA 3THYB 2ALJA 2F59A 3BDVA 2WJ3A 121PA 1GRQA 2AEJA 4KFTA 3ZIUA 3CINA 4R6WA 3VAYA 1W0KD 1HX7A 4JI3B 4F2WA 2A0FA 2XWPA 3P2IA 5IDYA 5BVHB 3S0JA 1FDWA 1MO4A 4HPWA 4TVBA 2BMFA 4TLMB 3LX6A 2M32A 4GM1A 2OBNA 2HK9A 5T4HA 4QREA 4C5AA 1VMAA 5IJWA 2O5EA 5KNLA 3EAGA 1Z15A 1GTJ1 3BN3A 4MUXA 4GU5A 3C74A 1G7RA 1NASA 2ZYSA 3IMEA 1IRXA 3HMQA 1EFVA 2V65A 3RNOA 2QR3A 3FYUB 1JT2A 1OWLA 3ROKA 4QPZA 5C32A 5K0EA 2J3JA 2H9YA 2B7CA 2BBTA 1XA0A 4CMIA 2XCTB 3O7MA 2IY8A 4G86A 1UBKS 5IAKA 2QF7A 1WXQA 4ISCA 1JP7A 1KU6A 2NV0A 3FOBA 3H97A 4JKIA 4QIHA 5FWXA 3TIXB 3MGAA 4TMWA 2V9PA 3TAXA 4ENPA 1XXHB 3KL2A 3PEFA 3W8RA 1E5DA 1DC4A 1GGMA 2F90A 4AICA 5FBVB 1XZCA 2VRNA 2G3YA 2AI3A 3MMNA 1VYUA 1YCGA 3EC1A 2Q6TA 1GTVA 1GTMA 1KEVA 2CL6X 2ZGVA 4I9GA 5JZ9A 1CETA 3W78A 4WJLA 3REQA 2ZUEA 1QRDA 2ZAGA 3EQ6A 1GG2A 4TL8A 3WMRA 3HQ4O 1H1LB 2I66A 2QOEA 3DE6X 1YIOA 2OLKA 3DE7X 3LX4A 5JNTA 3MOGA 1Q1AA 4DG5A 4D1YA 1BN7A 4YMGA 1OX4B 1BKYA 1RPTA 2APJA 4HI0E 4G25A 3TZLA 3EF3A 4GF5A 4N01A 3K4HA 5EXEA 13PKA 2OQIA 3NLLA 4PQEA 3T9DA 1R0SA 1IM8A 4K87A 4WK0B 3TRHA 3V7NA 4REMA 2HLHA 4DSNA 3ILYA 1TC1A 1FBTA 2ID9A 5C8DA 3QYPA 1BCSB 2Z4TA 1K9SA 5EXSA 5AKEA 1SZCA 2Q8NA 2QS9A 1ZI8A 1M0TA 1V16A 2PQ2A 4YJGB 5F1PA 1Q16A 1XZKA 3RVQA 4L4RA 1U99A 6REQB 5A6VA 1B3BA 3AB8A 1XEAA 3ND9A 3UJCA 1E2LA 1FW6A 3QX3A 1SZJG 4KFRA 4X60A 4BEVA 1L6RA 1P17A 3AJAA 4E1VA 5IAOA 2NXWA 3N2GA 4FR2A 4KIFA 3V46A 3P9SA 4HDNB 1MJ5A 2FX3A 1LF5A 2G7ZA 5ALDA 1QNFA 3O8QA 3F1KA 3FSJX 3A10A 4HDQB 5C1DA 2V74B 3ONWA 4RWZA 5CYFA 1SVOA 4FUQA 3C3DA 2XZDA 1CY8A 4L95C 5ALNA 5KVCA 1TKAA 2ZRMA 4WADA 1TIBA 3L0SA 4RZHA 3RK0A 3X2EA 4EL5A 5BSWA 3B9BA 1YZGA 1G6KA 5ALIA 5H16A 3ZNQA 4DCOA 3E22B 2FPIA 3DVRX 1VSUA 2YHIB 1PJ8A 3TLJA 4GVPA 1ZA1A 1DQYA 3KDSE 4ZXFA 2DLDA 3UJDA 3VR6D 4YXWD 2XYGA 4U8GA 1ZU5A 2XMSA 1NV9A 3RSFA 5FFNA 4PINA 3RM3A 5F7ZA 3JRXA 4YAOA 2HQSA 4OJNA 4PONA 1WL8A 5FBQB 1QZUA 4ON9A 1YZYA 2H3HA 2P9CA 2VF2A 3M6WA 3OLZA 3QPBA 3M1IA 4YCSA 5B30A 1EEHA 4R5HA 4Y30A 4AN0A 2ZBVA 4NJMB 1L5RA 2DWUA 1T1RA 3P0EA 4GZMA 4FDMA 4WY5A 2AE2A 3AHFA 4YJFB 4HLNA 4HQOA 5GONF 1JVNA 1KSFX 5KREA 3PLRA 3JD1A 3K70D 1T13A 3FHOA 2CCKA 1NQTA 4ZI5A 3VPAA 2Q50A 4HGYA 3DWFA 1T36A 1CRLA 1YJBA 3OECA 2C4NA 1P7VA 4R7ZA 5BW8A