1J8HB

Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
188
structure length
180
Chain Sequence
b'TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Structure of a complex of the human alpha/beta T cell receptor (TCR) HA1.7, influenza hemagglutinin peptide, and major histocompatibility complex class II molecule, HLA-DR4 (DRA*0101 and DRB1*0401): insight into TCR cross-restriction and alloreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1j8hB01
4MB4A 5LKNA 4L4TE 1OAUH 1CICA 5HHMB 1OF2A 4LLMB 3HE7A 1XCTA 4L4VA 1DCLA 3L3KA 1QFWM 3F7YA 5LJYH 2P5EB 1YYMH 2PO6B 3PHOA 4HMEA 1VSCA 1PX3A 3WE6B 1BLNB 4JRXA 4P23C 5CMAB 1ZHBB 4LEOA 4ZDHA 3SKNB 3OAUL 1HYSC 3QCVH 4ELMA 1MF2H 1DQLH 5D5MA 4NUJB 4X6CF 2DBJA 3QEUB 1NGYB 4K8RC 2XFXA 2X9YA 3AU1B 1DVFD 4HUVA 3GJFA 4EI5A 2DB8A 5D2LF 1U92A 1DQJA 4MD5B 1CD9B 2AEPH 2MQ3A 4ODBD 4KI5D 1C5DB 1F13A 3VGAB 4UT7H 2WNGA 1WZ1L 4CU6A 4YXHH 4NQDA 1J8HE 3P77A 4OIIH 4PJDA 1PW3A 3PQYD 1N5AB 5JLZB 3QXDA 4DW2H 1J05A 5IF0B 2HWZL 4ONGL 5IM7B 3KJ6L 3MJ7A 3D18B 2I25N 5C9JB 3VWKD 4RGOH 1A9EB 1FO0H 4CADB 4TUOB 4S10A 5JOEA 2OCFD 1D5BB 3E2HB 2W60A 4P3DA 1TJHL 3V8OA 4UNVA 2NXZB 4NZTL 2DD8H 3SY0B 4APQB 2C3VA 5J9PA 1I8KB 4JFPB 3IVKA 2BNRD 5M94B 4FZ8L 3GMOA 4X9FA 5CJOH 5HGAB 5E8NA 1NANI 3RBGA 4OUUA 2DM7A 5CIPB 3D3VA 3E6FB 1FPTH 5AUMB 1AGCB 4OGAC 3U9UA 5EN2A 4K7FB 3IDMA 3P4NA 5DD5L 1KFAL 2VABB 5JZ7D 1MCRA 1LK2B 5DMKB 1MCPL 1GPOH 2NY5L 2FWOA 3ARBB 4AT6A 3VXPB 2KBGA 4Y2DB 5AG9A 2A77H 4ZNEA 3DETC 1N26A 3MNVB 1I7ZB 2F54B 3ARTA 4NQXA 1G6VK 1K5NA 2X42A 5DD0H 4I18C 4TTDC 1ZLSH 2VNCA 4EUPB 4M6ML 4HKXB 1D9KA 3BP5B 3H42L 4X8JA 2ADGA 1Z5LA 2PW2A 3QJHB 2XKNA 4L4JA 4N0CD 3R06B 2IFGA 4I0PC 3QDJD 3SDAD 4DQOH 3S36H 4RMVA 4H88H 4LSTH 3QUMA 4U1MB 2OR9L 5KS9F 3O6FD 1G7PB 2AK4E 4OLXL 1W2KT 3BUTA 2IBBA 1P4BL 1U58A 2R4SL 3MR9A 2RIKA 3DX7A 1XZ0B 1KTLA 4UNUA 2DQUL 1FZMB 4XCEB 4QY8B 4FTVA 1NBYA 2IFFH 5TDNA 5L2KA 4XMLL 1KCRH 2NCMA 5FYLD 2E7BA 1WEJL 4WTZG 4MSWB 1UCBH 4KUCF 1TJIL 5SX4I 5C0EB 2K7PA 3LKOA 2EKSB 4UBDD 3RY6A 1WFTA 3HLAB 1F5WA 2A6KA 3BQUD 1K4DB 2X44D 5HYEA 4G5ZL 2EIZB 3F7QA 4NWTL 4QHUA 1IGJB 4WU5A 4QRQB 3ULVH 5ACZB 5EU6E 1SYVB 3UBXG 1T0NA 3ME0A 1CFQB 5GS1C 1G9EA 1X6NA 4JY4A 4OFVA 4XAWL 1YYML 1IGCH 1OD9A 3OKMB 2X4QA 4NKIL 3FB8A 1XH3B 2IPKA 4G9DA 5DWUL 4P9HL 2QHRH 5I0ZA 1NCNA 3MOAH 2HT4C 5DJ6B 2XZAL 3SKJH 2QL1A 5TQ0H 4BFIA 3RVWD 1UM4H 5I17B 4Y8DC 1OGAB 4DVRL 3D48R 2RQ8A 1KGCE 4IOFD 3HE6C 5DSCB 1ROWA 3HI1B 3RVUD 5I66A 3RIAK 2KL6A 4ZOAA 2IALB 1KPRB 1QO3B 1QQDA 2CIIB 4X6FA 2PXYA 3MACL 4YXHL 2C1OB 1NEZB 1IFHH 3DX6B 1AHWB 4Y5VC 4PJXE 4G9FD 2HH0L 1RUQH 1JNLH 4GRLA 3VRLE 3JVGA 3WDIA 2IPUG 1MJ8H 3WS3B 4ZOCA 5EBMB 3V4PH 1ITBB 4FQLH 2DD8L 2X7LB 4NO2A 4ZXBD 3ZZ1A 1KT2B 5F9JB 2Z93B 4NQEE 4ZS6C 4HPOL 4U1JA 5CJOL 1F2XK 3O6MH 3ZT7A 3IETA 4U3CA 2VLLA 2D7PA 4JPWH 4LCIH 2DQGL 4HIEA 4ZFFB 1B4RA 4PRHB 1MUJB 4P48A 5FYJH 4PV9A 4EN3A 2BSSB 1QLEH 3C9NB 4XCCH 3PXHA 1FYTE 1EZVY 5DRWB 3QP3A 3LEXA 3OXSA 2P5WA 4XBPA 5BQ7A 1S7TA 3VFUA 3T1FB 1J5OH 3JBG7 4KDVA 5DD6A 3U0TA 4GRWF 3CD4A 4YBQC 3S7GA 2R1WA 3S98A 3VD5A 1XFPA 4K3HA 2R2BA 2OL3L 1RIHL 4H0HB 1T83A 4L8DB 3UDWC 5ITBH 5IB2A 3IDGA 4LCCA 4QHMB 3AM8A 5JMRA 3JTSB 2H2SD 2FR4A 2CKBA 2VB5A 2ICEB 3CH8A 4I2XB 5LGHL 4JM4H 4Z9KB 3T8XB 2G60H 1NGQL 2YD3A 3FJTA 3QULB 3VH8B 5ISZD 1KCRL 4HUWA 2IQ9H 3IJHB 2H9GA 1UCBL 5FHBL 1ZWIA 4Y4FA 5GRZA 3FFCD 4L8CA 1SBSH 5JO5B 3BXNB 5E56A 1DVFB 4U2YA 4KK9D 1R6VA 3MV8E 2P5EE 4G6MH 5HYQA 1C5BH 3VE0A 1M71B 5IQ9B 3SJVD 1ODAA 4ONOA 4DZBB 2V5YA 4HCRH 4RNRA 5CBAA 3V2AR 4BZYA 2FECI 3EJYD 3QUXA 2AXGB 4DKEL 4N8VB 2VE6B 4XGZA 3X3GH 3PQYB 2VITB 3C87A 4IHOB 4LGPB 4ODHL 1HSAA 3PUCA 2V2TB 1FL5B 4NYLA 3PHQB 4BH8A 2C7UB 1X4ZA 2FL5B 3VWKB 3P4MA 1LDSA 4HLJA 4H0IA 2VC2H 1MCEA 2HLFC 2AXJA 4OAWB 5AWNH 1AGFA 3QNXA 4KQ4H 3V7AG 4X4ZA 5HVWA 5IKCA 2BNRB 3X13A 4R90H 4MA8L 2CK0L 1IKNC 3TCXA 4J2XA 1G9NL 1CGTA 1I7UA 3LB6D 1MIEL 4X6CE 1Q9OB 4K07A 1CU4H 5D1ZA 3EOYG 1UM5L 4DTGH 1V8HA 4CNIB 3BP6A 1I1RA 1JHKH 1IL1A 4QYOB 5J06A 2P8PA 2P8MA 3RL1A 2YKLH 4WTZA 1MJ8L 4D0CB 5BMFH 2Z8SA 5IB3B 3HHRB 3MRJB 3OBAA 2PTUA 4PRBB 4K7PL 3IXTA 2Z4QA 5I16B 4ERSH 4NIKB 1DFBL 5LBSH 2R69L 3BN9C 3QDJB 2WWKT 3SDAB 2NQCA 4FQXD 3GBMH 3VMNA 3U7AA 1CD8A 1R3LA 2V5RA 4M5ZL 4FXKB 3O6FB 3T08A 1QFHA 1WBXA 2QJDA 5J57B 4LCIL 4WFGD 3VG0L 4ZPVB 4KK6D 1RURL 2APWA 3UBXA 4M03A 1J8KA 3TN0C 1AFVL 2YK1L 4RSVA 1BECA 1BMGA 1A7QH 1G7JB 4O2EA 2C4FU 4C56E 3VD9A 2C3WA 2XG4A 3LN5A 3KPTA 3DYPA 3E8UL 4B5EA 1MFEL 3HC4H 2DAVA 2P7TB 5E70A 3BQUB 3BWUC 3H7BA 5DZLA 3ZKMD 3SDYH 1V7NL 2GTZA 5ALCH 4YJZL 5B4MD 1DANT 5IQ7L 1NAMH 3SKUD 5ICYA 5E8PA 5E2JA 2YD7A 3R0NA 2DIBA 3SGDH 4Q0XH 2NX5D 3W2DL 3WFHB 3NTCL 1UXSA 4N0FA 3ZYJA 3DTXB 1HH6A 5BO1L 4JPVH 1JWMB 4O58L 2IG2L 5IBTH 4R96B 2R4RL 4JPIA 4CRPA 2R1YB 2IQ9L 5H94B 3KYAA 3NAAL 1RZKH 2F53D 1FL6B 4GKOA 1YDPB 3JWOC 5DHYA 4LLUA 2ED8A 4S1QH 5E7FA 1F4WL 2ATPB 3FQXA 5EZLA 3I6GB 5CSBA 1CWVA 2NZIA 3FB7B 5E0QA 5IG7A 3DBXA 4YO0A 4G8EB 5JPNA 3ARGD 5DQJB 2EYSA 3GJEB 4UDUA 2JB6B 2WUCL 2FYYB 3CDFA 2PCPB 1YN6B 3VWJA 3EO9L 4FQ2H 4U1IA 3QUML 2DMKA 4Q9QH 2EH7H 2BMKA 1UJ3B 4PS4H 1XF1A 3O8XA 4G9FB 3QEQA 4QT5A 4L3EA 1QSEE 4KROC 2PR4L 2Z92A 1FBIH 2FRGP 5I1IH 4WCYL 2Z35B 3TFKC 1YA5A 4KQ4L 5ESVA 4J4PD 4ZXBB 4P2OD 3RL2B 3VXQB 4PJCA 3QA3B 5L7XL 3RWGA 3MMEB 4YIQA 3SQOL 4FQQA 3MRFB 3PGDA 4LLDA 1CDHA 4N0UA 3BJLA 4HJGB 3CX2A 2HTLD 1OY3B 1ED3B 4IRJA 1LEIA 3U83A 1MWAA 3DX9A 1A6TB 4L9LC 2A0LC 3TNNB 4MVBC 3JV0A 3UO1H 3L3DB 4WI9A 3TBSA 5EIQA 5FO9A 4KZEL 4B53A 1S7WA 1ZEAH 5D7LD 3GHBL 4YGVA 5ANME 2HRPH 3U46A 3BP4A 4XP9L 2VDOH 2YKLL 4XWGH 2DWDB 3R1GL 1IGTA 4HZLB 4RAHA 2PYFB 5I1DA 3IKKA 1FL3A 2XPGA 5T3ZH 5EIIA 4U1NB 5I8CB 2ZNWA 3DECA 1QSFA 1MEXH 5C0AE 3HUJB 1U91B 2R56L 1L4IA 1QLRA 4U6YA 1B90A 1HK6A 4YK4B 3VXUA 3GFUA 1FG2A 5ISZB 3LMJL 4HV8B 2ZSVA 3VFPB 3EFFB 1EAPB 3UJTH 1KPVA 3LEVL 1HHJB 1BQLH 3FFCB 1XMWA 3QRGH 2A6DA 4QGTA 1PG7W 4JEGB 4I2XE 4U1KB 2FD6H 5FM4A 4GJTB 1QRNE 3HC4L 2VAAA 4OM1L 1YMMA 3UPAA 4H26A 1T66D 3SJVB 1MI5A 5GRWA 3TYGH 1MREH 3BKCH 2DJUA 2VWEC 4JAMB 1I8IA 1PKQA 2VSDA 1I4FA 5EPMA 1FDLH 4DK3A 4GRWE 3X11B 2XOTA 3EOTL 3U30B 2EEBA 4LMQI 1T22A 2OJEB 3QFDA 2D7OA 5T1MA 2ITCA 4HHAB 5IBTL 5TE6H 3HRPA 1DUZA 3AAZA 4NQCA 5IMKA 4DUXA 2CUHA 3MRQA 1FFNB 1WSST 1RHFA 3ARDC 5C0IA 4L1DA 3PQYE 4H5SA 1QA9B 4NKQB 3D0LA 4BSWA 1P4IH 3IJYB 3M1BA 4F37K 2QQNL 1O0VA 4K71C 2VMFA 1YN7A 4I0KA 1PYWB 1ZT7B 3EYUL 4F58L 3RNQB 4ISVA 4JN2A 5I15L 3B8YA 1FVDA 3I6LD 5DA0B 1CGUA 1QNZH 1BOYA 4FQ2L 5D2NC 5JW4N 5L9DH 5FUOL 3H8NA 2YPLA 5TFSL 4PJIB 5F3HA 1VFAA 3FOLA 1LO5B 2CKBL 1EDQA 5IB1B 4LBEA 4FFYH 3VFVA 4QHLA 3GSOB 4LRNL 1TXKA 4NNXA 4I5BB 3TJEH 3VFSA 3V6OA 3P11L 15C8L 1EGJA 3B3IA 3LKNA 4H1LG 5BZWA 2D3VA 4FQXB 4FNLH 4XNXL 3L5XH 4Y5XC 1DDHA 4WI6A 5JNYA 3GIZH 1CT8A 2ZUXA 2HKHL 3TIDB 3MJ8A 1BZ7B 1QBLH 3U9PH 3WNLA 5SWQA 3PNWB 2DN7A 1CQYA 4G7VL 1KIRB 4Q6IC 5KG9A 1Q94B 3O3UN 3OKOB 1BIIA 4ORGB 3ECBA 4EDXA 3QDJE 3L3OA 5DJ2B 3VA6A 4JFQB 2DLGA 1N2RA 4HJJH 3ULUF 4XWGL 3B6SB 4YHMH 4JFDE 4MNGB 3IDIA 3STZB 1VGEL 3A67H 3WMSA 4OQTA 1HSBA 2FJGB 5FYLE 2X1XR 4A6YH 4XPAH 5HHOA 1Q72H 2FIKB 3LKQB 4KRNA 4RWYH 3MA7B 5TJWK 3SKOA 2X1WL 5J6HA 1SJHA 3I50L 4UTAL 3IF1B 2F5BH 4JR9H 4NT6A 5DRZB 4U31A 3PL6D 4MMXC 2NX5B 3S36X 3V4UH 4I48A 1RJCA 5SWSD 3IGAA 3HRZB 4R4NC 3GGWB 5B38B 3RA7L 1PZUB 2EDHA 1G1CA 4M61A 3TA3D 4WFFE 2E6PA 2QQKH 1JHLL 4EOWL 2D2OA 3BKJL 2F53B 2VLRA 5LXGL 1J1XL 4UV7H 5HGHA 1N5YH 3H7LA 3P4LA 3CNKA 4HFWA 4KGJA 4X7CC 2H8PA 3BGAA 4LHJB 2CDFB 3CC5B 4KC3B 2NXYC 2P47B 3CUPB 4L3CB 1YNLH 3TBWA 4J1UB 1LE5A 4Q97A 1RZGB 3RGHA 3E1F1 1AE6H 4UQ3A 1T2JA 1GC1C 5DRNB 1A0QH 3FN9A 3ARGB 5IFHL 4P2QA 4ACPA 5DJZA 4PTTA 3KPRE 1JF5A 5DJXB 1JHTA 1MLBA 1CGXA 1XT5A 4X80H 3HZVA 4M7JL 3EOBA 1A7NL 4ZS7H 4OB5L 1JF1A 5HI5D 1FIGH 2AGJL 4XAKD 1WT5C 4W6WB 1H5BC 5AD0A 1DEEA 2FCBA 2VDQL 5I19L 4LGSB 5TE6L 4HWBA 4HKBB 3OB0K 2PKDA 5E4EC 4NJ9H 4TSAL 3MRIB 5DS8A 1JN6A 4P2OB 4PRPA 2R0KH 3VD3A 3OB0H 3ZKXB 4BUGA 4QXGH 1NJ9B 3MV7E 4OCNC 4ALAH 3UPRA 3VXMD 3ZDYF 3C8KA 3B8SA 1WIPA 4U7MA 1G9ML 1ZS8A 3G9AB 3QUZD 1ES0B 4EDWL 1HEZB 2VUOA 2FX9H 4AG4L 4HUKB 3I6KA 5L9DL 1CQKA 1RIUL 3SPVA 2FJHA 4ODWA 3S34H 1KYOK 4KDWA 1Q1JL 3RVTC 3GSQA 3ZE0F 1CZ8H 3IDYC 5D7LB 2B2XH 1MCKA 4JO3H 1TCMA 3SE8H 4EKXA 4M7KH 2R0WH 2FO4A 1RJYB 1LP9F 4HQQH 4OIBA 1ZHNB 1X7QB 4WNQB 1JRHH 4FFZL 4FQCH 3ZE1E 1N6VA 2FX7H 1V3MA 3L5XL 4WHYH 3GSWB 4HIIA 4NKMB 3DI3B 4ZYKB 3H9HA 3O41A 3GIZL 1OAKH 1L0XA 3BSZH 1NC4A 4KH2A 4V1DD 5E2TL 4NBXB 3L7FA 1VADA 3C5ZC 1RUKL 3ARRA 4G8IB 5IFJA 2NTFA 3TNMB 3GSVA 4NN7B 4LNVA 5GSVB 4XPFH 2AJZB 1M7DA 4HAFA 1KLGA 3B2UC 3IU4L 3OG6B 5HDLA 3HMXL 1OGTB 3DVGA 3M07A 2ZOLA 4X99B 3O45B 1B88A 4KRPD 4YHML 1OQXA 4LPTA 3GEWB 3KJ4B 4C83A 4AENA 4CVXA 5ISZE 5FB8B 1WLHA 3VFRB 5ALBH 4FTVD 4XPAL 5L2KD 2KZ1B 1ND0B 5DC9B 4XBEL 5GPRA 4GXVH 2EXYC 4ZSOA 4JR9L 1WV7T 1NKOA 3KLDA 4S2SB 3SGJA 5C0DB 1BFTA 4L5FL 1B0WA 5CKGA 1JNNL 1MWAL 3SJVE 3DPBA 3HC3L 2CDEB 4TRPH 2M2DA 3LN9A 1MFAH 5KOVC 3D69B 5J4MA 3MJGX 3T09A 1F4AA 4J3TA 3C5JA 4C4KO 3S37L 6FABH 1G1YA 5D7IE 5E2VL 2XRAH 2RR3A 3DROB 2GK0B 3QDMA 3UC0L 5K9KA 1A2YA 4H1LA 1Z6JT 4Y16A 2FX8L 5CJBA 1A0QL 4OUOA 5D6CB 3RKDD 3WFCH 1SEBB 4DWHA 5C09A 1UCTA 3MA9L 5ENWA 1OAYH 5DQDH 3DMMC 4FABH 4KJYA 3G04B 2G75B 3BDBA 2OL3B 1R3KB 2VISB 3BH8B 1HDMA 5BZDA 3ULVF 3D85A 1NQBA 3T0DA 1HCFX 1R3IL 3GMNB 5ETUA 4O9HH 3KPMA 1IKFH 1H0DB 4NJ9L 3VXTB 7CGTA 4IS6A 3O81A 3STBA 3KLHD 4ZO9A 1S7RA 4N1CA 4HC1A 5I1CL 4JM2C 1F58L 1MOEA 3KWWB 5TDOA 5JPMA 1OCWH 4G7YL 1SMAA 2NR6D 1UZ8A 3L95A 3VFGL 4IOIA 4ALAL 4Q9BA 5D1QC 1YMHA 1VCAA 4D9LH 1BBJB 4GRLD 1ORQA 5EO1B 4ODSH 2AJYL 2XWTA 4NKDA 4N9GA 5FUZH 2D4FA 1YPZF 1EEYA 1HHGA 5GRVL 3UTZB 2VLKA 4KKCC 4KK8C 3OKNA 4QOKE 5EDXA 3T0EA 4J23A 1C16B 1CFNA 3CFKB 3BISA 4JO3L 1ETZA 5KVGH 3AB0C 2HMIC 4U05A 3SE8L 3V95A 3MLVH 4HWBH 4K23L 5T1DL 5FDWB 4ODXB 4EN3D 4KKAC 5A16A 3NACH 4JQIL 3SCMD 4ELMF 1CXFA 4FQCL 2FX7L 5FGCB 4U1HA 5D5MF 4JFZL 3C60C 4ZPTB 4PJHB 4QRUA 4IM8A 1TCRB 3PL6B 4MDIB 4C59B 4TNWK 2ERJC 2H6PA 5SWSB 4GW5B 3QO0A 1MJUH 4NN6B 5H8DA 3TA3B 1CLOL 3G5XA 4O51B 1ZAGA 3BYYA 5EORH 4B50A 2HJLA 1S7XB 4ETQA 4UQ2A 4TN9A 4BH7B 5CEZH 2ZCHL 1XCTB 4PJDF 1QPXA 5DMIL 5BJTA 4X7SL 4XMKL 2GSGB 3F7YB 4LP5A 1F6LL 2HT2C 4LSPH 2G2RA 4E5XA 3MLSL 1LO0L 4LEOB 1CFVH 4LDOB 3U0WL 1EGJL 3VG9B 5GRXG 3D2UD 5KSBF 2VZVA 4QTHB 1XF3B 3EDKA 1INEL 4PJ8C 3RX7A 1WBYB 1A7OH 2FGZA 2XFXB 4YHKL 1BM3H 1KN4H 4HSQA 2J12B 3GMPB 2YUVA 2EDJA 1QEWB 1UWEL 4YDVA 2ADFL 4ZUVB 4RFOH 1MY7A 1U3JA 4MJ5A 1IGML 2QV2A 4X6DB 4NWUL 1F3RB 4W4NA 5BW7A 5JXEC 2YEZA 3QIWC 4GBXD 1ORSA 1IM3B 1ZLWH 5C0RH 1S7SA 5MP6H 4N0YL 4QRPE 3AVEA 4WI8A 1J05B 1HWHB 3OHXA 3VXMB 5IVZA 3MJ7B 4X6BB 4PJ9C 2BVOA 4OQTL 3NGBC 3BZEA 3QUZB 1UB6B 3T2NL 4NO0A 5JR1L 3O3DB 3ZDZF 4Y19D 3IJSA 4BKLB 3B9KD 4BK4A 3U0PA 5GSRA 2FEEI 2NY6C 4PLJC 3ZDXE 5DI8B 3QWRA 5J9PB 2R2HB 5GJTL 1EEZB 1IQDA 5E8NB 4NM8H 2MTPA 1JF6A 1HYRC 3QQ3B 5EWIH 5SV3A 2JJTA 2HTKD 3FMGH 2F15A 3U9UB 3V0VA 1QRKA 1ACZA 3IDMB 3P4NB 4MCYA 1RSFA 3HR6A 1CFTA 3P2TA 1RZFL 4KHTL 4PJGB 1OCWL 1KENH 5D1ZD 1EZVX 3DO3A 3M8OL 5HI4D 1YNKL 2I24N 3MGOB 3RIFK 3QNZA 3FTGA 1QUNA 3U48A 4DOHE 4V1DB 1RHHB 1K5NB 3HNSL 1QKZL 1JGVL 4ZUUA 4X8JB 2PETA 5CCKH 3SBWA 1OP5H 1KCVL 1TETL 4HUUA 4KRPB 4PJ5D 2L0DA 3NH7L 4HWBL 4P99A 3PP3H 1NKRA 1U58B 3MR9B 4K3EL 1UXWA 1YEIL 4JDTL 4PRAA 4FTVB 5TDNB 5L2KB 3ROOA 3SDCC 5SV4A 3EYFA 3F58L 3MUJA 2NY1C 2ZCLL 5EUKB 3WCYA 2FECL 3PWLA 4AIZA 2A1WL 1CE6B 1OPGL 3LKOB 4PBXA 2P8LA 3L7EA 2DDQH 2ILLA 3DVIA 3FQUA 3NIFF 4HMCA 4I3RH 1ZT1A 3NFPA 5KOMC 1LP9E 1I9RH 3ALWA 4UT9H 3S6CA 4O00A 3RWIA 4MX7A 4DGVL 3RTQC 4GMSL 2FBJH 1T2QH 5BXFB 4HK0B 4OZHA 4WU5B 5DXWA 1MQ8A 3C6LC 4HS3B 2UWEF 4RIRB 3WN5C 1I85C 4NZUL 1QG3A 3O2WH 1AGEB 1RZIA 2ZPKL 4MD4A 1MPAL 4JY4B 4RISH 1ZTXH 1QOKA 1JGUH 4KXZH 1U3YA 3MUGA 3QJFA 1CFVL 2E9IA 4BZ2H 2D31B 2IMNA 1MQKL 2IPKB 1XR9B 3PGCA 5ADPH 5AZEH 1BM3L 2A38A 2WIIB 3T0VA 1TNNA 5DD1H 1U2HA 4HX1B 3ET9F 1KELL 3FRUB 2DLEA 3GZKA 4TVSa 1RZJC 3ZKND 4F7PA 4R2GC 2ITDB 3T65B 4O02H 1N0XH 4XMPL 3DHMA 3I6LE 3KPSE 2H32A 5C0FB 1QQDB 1H3GA 4X6FB 1EERB 1FJ1A 3WDHA 2VN4A 1WC7A 4ZD3H 4FQ1H 1XIWD 5MP6L 1BEYH 3TBVA 2EDQA 4F2MB 3QEHA 1Z9LA 3O8XD 1A6AB 3T77B 4WWKC 4GRLB 4LLWB 1JYNA 4L3ED 2DQDL 1S7VA 4HS6A 5CD3B 2DJ4A 1FLRL 2G9HB 3HAEG 3MRNB 3QCTH 1A5FH 4JFHD 1KJVB 1MLCB 1OVZA 1TFHA 4JB9L 5ERWA 2ZSWB 4P2CG 5M95B 2XNAA 2YXMA 1GAFL 3G5ZB 1X4YA 4U1JB 2B5IC 1FAIL 1W0VA 4L8BA 2AVGA 3ARPA 3I84A 2N56A 3TBYB 5DJYA 5EU7E 2X4RA 2VKWA 3BZFB 4HIEB 1H3VA 4O2CA 4QCIB 4PV9B 4EN3B 5DYOB 5B39G 3SE4A 4P2RA 1KPUA 4I13B 3SCMB 1P1ZA 1EFXA 1NLDL 1NCBH 4M43H 4NHUA 5GISL 1BGXL 3OXSB 3C08H 1PQZB 5BQ7B 3MLUH 4KVNL 5T3XH 1S7TB 3DYMA 2JIXA 4WHCA 4Y89A 5JOFB 1T03H 1E6JH 1HZHH 1RU9H 4OCSL 5CILH 3ILPA 2R1WB 4Z7UB 4Q9RH 1A3QA 3OKLA 2P43B 4M93B 3QXAA 4U0QB 5C0JA 4F7CA 3X3FH 2R2BB 2DQJH 5C0CA 1V05A 5FGCE 2XA8L 3UYRH 5CCKL 4M7LT 3PE9A 1VKXA 4K3DL 4YBLC 3ZHDA 4PJHE 3TVMD 5BRZD 3RI5K 3FO1A 2HFGH 4LCCB 2V6HA 2BRRH 1DUYB 2AXFA 4M02A 5C0BA 5F7HA 1GGCH 4JZNB 2FR4B 2CKBB 2HFEA 3H3PL 4H20L 3WNNA 1YPZE 2E7LA 5GS0D 3VXUD 2WUBL 5T33H 2VLJD 4HC1L 4LEXH 1YY9C 2ZNXA 4UINL 4QXUH 1D5ZB 3D2UB 2CPCA 3H2WA 1J0KA 4L4VE 4WW2A 4L29B 2CK2A 2R8SH 2ZCKH 5D4QA 2OXHA 2DDQL 3L1OH 3JV6A 4I3RL 4KFZC 3S5LG 5HYQB 3BWAB 1KEML 4UT9L 1LK3H 2H26B 4HT1H 4M7LL 5CLTA 1I1YA 1TVHA 1KC5L 2VZTA 3GI8H 4ELME 5CBAB 3N1PC 4RNRB 1F4HA 3K8MA 1MRDL 5FK9A 2WLYA 3D0VA 3DRTA 3DO7A 5D5ME 3VGAC 4R4BA 2HJKA 4NQTA 4GBXB 2EEAA 5M7QA 1U8IA 2DWEB 5DD3L 5E8DH 4RISL 5DGQA 3HR5B 3P0YH 1H3WM 1JUFB 2OMBA 4GLRI 4NDMB 4XAKE 4TOYL 3S37X 3RDTC 2W65A 3BKML 4NYLB 4XP4L 5DEFB 3S35H 4BZ2L 3P4MB 2VYRE 2DQFA 1GGUA 4Y19B 3MOQA 1ZHLB 3B9KB 1DZBA 4NQCD 2YN5A 5ADPL 1AGFB 3PWJB 2MOVA 1Z3GL 4NQDE 4Z7NF 3HB3D 3SE3A 1L0QA 3A6OA 3HNTH 2H1PL 1AY1H 4PD4J 1SJEA 5E2WH 5DD1L 1A3LL 1A3RL 1G7QB 5CP7B 1JPGB 1Q9LB 1FNGB 3X13B 3EDDA 4XNYL 3VXME 5E8OB 5C70A 3GSUA 5MERB 1IJ9A 5K9QI 4WV1C 5F1IB 1MRFH 4LNRB 5JUEH 1K4CB 1J8HA 1N0XL 3OX8A 5FDYA 5D1ZB 3WS6A 5F7MC 1VFUA 3BPNB 1B0GB 3FO2A 3MRGB 3BP6B 3V4VH 4LIQH 5BVPH 3D3VE 1XR8A 4TNVF 2IANA 2GSIB 4NSKA 5JIKA 1FVCA 1NLBH 2DQCH 4WJ5A 2BK8A 1SEQL 4PJGE 5I9QC 5MEND 3IXTB 3QHZL 3RVVC 1TTFA 3WNKA 3S3PA 3UCRA 3FN0H 4KPHL 4ZNEE 5E8EA 4OCLC 1KLUB 1R3LB 1AQDB 4PJ5B 4V1DE 1KJ2B 2Z31A 4LLYA 5F7DA 3FT3A 4PTUB 5DFTA 1FHGA 2LU7A 2H32H 4WU7B 4F7TB 2X6MA 1Y0LB 1IAKA 5BCAA 1T7VA 2WMPA 3VXSD 4O2EB 3C08L 4UT6L 3U1SH 1S8DA 5FCSH 1CD1B 4GRMB 5H35A 3LN5B 4S1RL 3VMOA 1OM3H 5EB9A 3CFEB 3FOMA 3CU1A 2WWKO 4EBQH 2GTWA 1F97A 4OFYA 2YA2A 2CLRB 4Y5YA 3CLFH 4FTVE 4KTEH 5L2KE 5D1XD 2AK4A 3UYRL 3PWVA 4KK5C 1LO3L 3PIQA 2UZIH 2FSEA 4XPTH 3UEZA 4X4XB 5E8PB 3JTTB 1B2WH 2F5AH 2BRRL 5IEKB 1BZ9A 1CG9A 4JGJA 4OLYH 4Z18A 1G7HA 1UXSB 4HWZB 2UY7A 4M5YH 3O11A 4N0FB 4WUUD 4MQTB 5ID0A 1RPQA 1HH6B 3GM0A 4TQEH 5CJ5A 4XT1C 5KN5A 3FONB 1DBAL 4LEXL 4MXQC 1TZIB 1HILA 2MWCA 4JPIB 1IEAB 2XQYK 3JSSA 4CW1A 4RDQG 5CJXA 2W9LA 1QTYT 5FYKD 5DHYB 1ZVYA 4LLUB 3I02B 4PJCF 1G7IB 3NZ8A 4W68A 4WHTA 1V7MH 3HAEA 1ZA3B 4HMDA 1A4JB 5EZLB 1E4XI 4X5XA 3GK8L 2YD1A 2ADIA 4RMTA 2Q3ZA 5F9OH 5IB4B 3RVXC 1D3CA 1M1SA 4LVOB 4EUPG 2MCG1 2VH5H 5TE4H 1FFPB 3K2UL 4CN4A 4YPGB 2C4FT 1YEKL 5BV7C 2L4OA 1D5MA 1XIWB 5E8DL 3OKEB 4Z7QE 5I18L 3C09C 1AC0A 1NDMA 3O0RH 3EOAB 1D6VL 3EYOA 5B39A 5IR1A 3O8XB 4NRZA 1FZKB 2XZQL 5EC1B 3FT2B 1C7TA 4QT5B 5D7KD 5IW1A 1IILE 1ZT4B 3TZVA 4L3EB 3UTTA 1FNSL 4LQ1A 3WXWH 1NGXA 3QUKB 2W0FB 2BVPA 3FQWB 4P5KB 5SX5H 3HNTL 2EIBA 1HH9B 4KVCL 1NGWA 2FLRT 3P9WB 4TULH 2EE6A 1XGPB 2R2CA 2YUXA 1R3HA 4XVSH 3UP1A 5T5FH 3F7VA 1HHKA 3BMWA 3RAJH 2CO7B 2OI9C 2A83A 4PIRF 3RHWF 1XGQA 2AEWA 1HQRA 5DMYA 3NCJL 1JMXA 5CEXB 1KXVC 3SE9H 3U46B 3BP4B 3VJ6B 1WBZB 5I0DA 2Z0BA 4L8SA 1NMCC 3CFCL 4YHNA 3OXRA 4WGWB 2BCKA 3H9ZA 3T0BA 1MCOH 1BD2A 2AABH 4OZGB 2XPGB 1IAMA 3MRKA 1HN1A 5K33A 3S5LA 2MQ0A 1UB5B 1KF9B 5J3HC 3OGOE 4X5LA 3TVMB 4OZ4A 5BRZB 4HIXL 3MYJA 1T7WA 1IBGL 4NO5A 1P4LA 2W0PA 4U6YB 1F3DH 4TYUA 2X40A 1F42A 3E6HB 2LV4A 5E9DD 3K8LA 3OSKA 3VXUB 2VLJB 4Y5VA 1MJJA 2X70B 1AQKL 3F12A 2ZSVB 1I3GH 1JTPA 4AYFA 3ILQD 5IIEB 4N1EA 1PZ5A 3V0WL 4KDTA 4JRYA 4JFFA 4F33B 1TIUA 5E2UL 5IVXA 1Y6MR 5F1NA 5IMOA 3VXRD 2LABA 4Z76A 2PF6A 5K9QG 2BSRA 3TPUB 3EW3B 2VAAB 5HVHB 3GSRA 1KTRL 4WEMB 3CVIH 2IADA 5LAXB 1I8IB 1GGYA 4KAQH 3UMTA 1U3HC 5D9SB 5EPMB 5F71A 5EOCH 1NCCH 4M5YL 3G6JB 1KEGL 5AYUL 3QFDB 5T1MB 4TQEL 3QIUC 2ITCB 5BOPA 5CJQH 2IC2A 1TPXC 4NQCB 2M26A 2YPVL 2UYLB 2PO6A 1NGZB 3NCFB 1U8PA 3WE6A 1BLNA 3QWQB 4MQXD 5CMAA 1ZHBA 3G5VB 3I3DA 5C0NC 4Q2ZB 4OV5B 4OZIB 4BSWB 5FKAB 4OCYH 5F7LB 4UUJB 2WSKA 4YAQB 3QUYC 1YYLL 4NUJA 3QEUA 5F7EL 1NGYA 5I6XC 5F9OL 3Q1SH 2E6JA 4WI7A 1T3FA 2VDNH 3AU1A 4JN2B 4HDIB 4OZFH 3VFTA 12E8H 2AJSL 4MD5A 5CZXC 3TO4C 4UILH 5L8LB 1C5DA 1VFAB 3DGGB 3FOLB 1Q9WB 1L7IL 1F4XL 4U1SB 5JW4R 4LBEB 2BNUB 5TE7L 3WD5H 4QHLB 1N5AA 3VH8G 5IF0A 3BD5A 1X6LA 4F8QA 4XNZC 1RY7B 3WNPA 1ZMYA 3ESVF 3VFSB 5MENB 3D18A 1PD6A 4YDLC 4JPKL 3B3IB 1BAFH 5C9JA 1YEDA 5BZWB 1A9EA 2DBLL 2LU4A 4TSCH 4TUOA 1QFWI 3VCLB 1D5BA 5JW3H 4FMKA 5MEQB 1HKLL 1GYAA 2EXWC 3SY0A 1UA6L 2JE8A 3QQ4B 1I8KA 4JFPA 2R9HC 5HGAA 5SWQB 2Q86B 4KUZH 1F3DJ 3TT3H 3E6FA 3Q6GH 5TDPA 5KG9B 3FB5B 1BIIB 1AGCA 3ECBB 3VXSB 4K7FA 1XF5B 4G6AD 5IT2L 2VABA 4OD3H 1LK2A 5JXAH 2I26N 3BAEH 3MO1A 1WUNT 3INUH 5MI0B 3VXPA 1HINL 3IDIB 3WKMH 4Y2DA 5IJVB 1C1EH 5GRUH 5KZCD 4DGYH 3MNVA 1BBDL 5BS0A 4KHXH 3LAFA 5D1XB 1IKNA 2F54A 1U42A 5DUML 1P2CA 1SJHB 2D7TH 2IBZY 3B43A 1I9IL 3TJHC 1RUAH 1M4KA 2YWYA 5E94A 4NT6B 4QXTB 4HKXA 1BJ1H 1A6WH 3BP5A 3NFSH 2VXQL 4I48B 4WUUB 3QJHA 1NUGA 3R06A 5EOCJ 1YEHL 4U1MA 4N8CL 4DGIL 1O5DT 2GQHA 1XZ0A 1PBYA 1NMBH 4QY8A 4XCEA 4XPBH 4Z7VA 3H6JA 5ID1B 2IH3B 1Q8MA 3JWDC 4K8RL 3CCHA 4POYA 3BRDA 3AC0A 1LE5B 4MSWA 4NRYA 4UQ3B 4XP5H 4Y4HC 5C0EA 1HIMH 3FL7A 4FMFA 3RZCC 5FCUL 2EICA 4JZJC 2EKSA 1MCQA 5IK3A 2OP4H 4ODTL 4PTTB 4R4FH 5GRYA 5EBLB 3HLAA 1JHTB 1OW0A 4F15B 5JW5B 3GKWH 3IDXH 1K4DA 5I1EH 3TWCL 4EVNB 4AQ1B 1NCCL 2EIZA 3KXFA 4HPYL 4ZAKC 1UT9A 1OSZB 2YUWA 4IEFB 1LILA 1DEEB 1SYVA 2Y6SD 1OAQL 1HHIB 1OT2A 2HVKB 3UTQB 3BPCB 4X9IA 3LQAC 1GHFH 4U4BA 3OG4B 1TQCB 5HD8D 1S3KL 4AEEA 1FGVH 3OKMA 5FGBA 1AXSB 35C8L 4K94C 1XH3A 2GI7A 3GMQB 4P5TD 5FOBA 1RVFL 3UPRB 3QEQE 4OM0L 3C8KB 1UVQB 1IC4H 4L3EE 1ZS8B 4QWWD 5JQ6L 4NO0D 3WIHH 2DTMH 3QFJD 3K8KA 1F11A 5DJ6A 4JHZA 4LPWA 4POZC 5FYJD 5I17A 3U7WL 1PY4A 1OGAA 4PJCE 3IS0X 5DSCA 2MNUA 3HI1A 1OP3K 3QRFM 3MBEC 4OSUH 2VDPH 2IALA 1KPRA 1QO3A 2D7MA 4RFNB 2A9NH 1UFUA 4BQ6A 4B0MM 1AHWA 4BZ1L 1U8MB 4M62H 2DI9A 4MAUL 1G0YR 2OMNA 3HKFA 4PJAF 2EH8L 1UYWH 1KV3A 3HFMH 2CQVA 3MPCA 5H2BB 3ALPA 2ORBH 5CZVL 2EIEA 1BIHA 3WS3A 1MH5B 4RGNE 3OAYH 4HIIB 4NFBA 1GIGL 5EBMA 1EHXA 5J8OA 3H9HB 4HF5H 1NAKH 1X5IA 2X7LA 3DXAD 3L5WB 1KT2A 5E99L 3RWCB 2Z93A 3L7FB 2ENSA 5E9DB 5FECB 4OBSA 5E6IC 3C2AH 4OZGE 4ONHA 1BJ1J 5HDQH 2AI0L 2OR7A 4LASH 5H37H 4QRSB 4HULB 5LWYL 1KLGB 4AEIH 4ZFFA 4WI5A 3NABH 3QISA 4PRHA 4UOW0 3DVGB 3MLRH 4GAJH 2BSSA 1ZGLB 2EZ0D 1CLYH 3R0MA 1YNTA 1FH5L 4OD3L 1T0PB 4JFXB 3E0GA 3VXRB 1S9KC 3C9NA 3INUL 4ZOBA 3W39B 5DRWA 5GIRA 3VXUE 1I8LA 5IHZB 3FQRB 4P46C 4HKZB 5HY9B 5IEHA 4KHXL 2Y36H 4FXLA 4PG2A 4Z95H 1XF2B 4PB9L 1UWGH 4ZSOB 1CL7I 3EKCA 4LU5L 4DN4H 4L9LA 2AKRB 4NNYB 2VUYA 3HI6H 4ZQKB 3VFNB 3EO0B 1YMME 4WWID 1MI5E 3OL2A 4ZUTB 5CIPH 1E6OL 5I8KH 4DKAA 4QHMA 3VRIB 3JTSA 4ELKB 1PKQE 1EBPA 1Z9SA 2ICEA 4I2XA 1GOFA 3LS4L 3EYSH 2W9DL 2FEEL 3IKCB 3G6JE 3V79C 5B21A 5KSAC 2FIRT 2OZ4A 2FGWH 5K9KB 1A2YB 3VI3F 2J4WL 4PY8J 3RWHB 5JO5A 5IFAL 3BXNA 1DVFA 4GW4A 4NQCE 1IMHC 3FCTB 2ZWLT 3FHQA 1MCCA 4KQ3H 2UZXB 1FSKB 5FKPB 3ARQA 3U2SB 2HAZA 4OZIE 4HAGA 4DZBA 4EUPH 5I1EL 1T04B 4UAOC 4WIQA 5FUCE 5IBLC 1II4E 4QHKJ 3DOSA 5C71A 2AK1H 1Z9OA 1ZVSB 1D5IH 2IJ0C 2AXGA 5DQ9B 4LRIA 2R0LL 3BEVA 2K9UA 2VE6A 5E00A 43C9B 1I7RB 2VITA 4I3SH 3RY5A 3NA4A 2V2TA 1FL5A 2DICA 1G7LA 1NBVL 3DRQA 1S7RB 4DEPC 1BWWA 5AYQA 1FYHB 1HNFA 2C7UA 2YPLE 3VWKA 1UZ8B 2EE3A 3OPZL 3ARVA 5F9WC 3IB4A 4PJEA 4P3WA 4EEEA 1ORQB 1IGYA 2BNRA 3LIZL 4LSRL 1H15B 4J6RH 4YR6B 4YE4L 3V6OE 4HFUH 1H8OA 1A6PA 4XVJL 3OV6A 4YEEA 4UIKL 4XPGH 4XNUH 4HXAL 3MOBH 4P4KC 2F19L 1U8JB 4WTXA 1AO7A 5D7SL 5JDSA 1ETZB 3ARWA 3BH9A 1RMFH 3CZFB 4CNIA 1NGPH 4ZUWB 3DX8B 1QD0A 4U0RB 5A16B 5C0GB 5KZCB 4J3XA 4AL8H 4P2RD 1UYWL 5KTEH 3HFML 3ROLA 3VGEA 1F45A 2J88H 1EFXD 3LEYH 5IB3A 5L6YH 4OFPA 3L5HA 4LARH 5T1LD 1UKSA 3MRJA 4PRBA 5HYIA 2PTTA 3LN4B 4QRUB 1U93B 4HF5L 4WFED 2JIXD 1ZGLP 2NY3D 1MFBH 5HJ3B 1KIQA 5I16A 2DQTH 3QO0B 4NUGH 5JA9A 2ZUQC 3QDJA 3C2AL 1MNUL 4LPXA 4EJ1C 5DJAA 1K8DA 5IESL 1PEZA 3O6FA 5HHOE 1U8HA 4GG6F 4ZPVA 4JHWH 3C5SB 3QXUA 3NABL 4NQSB 4GAJL 3N50A 4Q58C 3LRGA 4O4YL 3ULUC 4RGMB 2NY5C 2DYPD 3AFLA 1JYXA 5BV7H 5I8OH 1IEBA 4LL9A 1G7JA 1R5WB 4LSQL 4OTXH 2G2RB 2N7AA 4OD2B 4WO4C 4HBCL 4Y5XA 4IIQB 5AZ2H 5JHLL 2VLRE 4KKLD 4G80A 2C1PB 1W72L 1UWGL 1N7ML 2P7TA 3BQUA 5I1KH 4LAJH 3QG6B 3TV3L 1P5VA 2X4OA 3ULSA 4JY5L 2XXMB 3CLEH 4MJ5B 3VRJB 4P2QE 3NMEA 3QO1B 1EV2E 3WFHA 5KW9H 1KJ3L 1S9VB 2LTQB 3DTXA 4URTB 5IUSA 4NNPL 1YEFH 2YEZB 1WIUA 4X8XA 5DVLA 4YUEH 1JWMA 1RFDH 2GFBA 4R96A 2VAJA 4P5TB 1X5YA 3V5KA 5B3JF 3OHXB 1I9JL 4YFDB 1AGBB 1FL6A 2FGWL 2ZKHL 4M48H 3O3EB 5D7KE 1L7TL 4NO0B 2ATPA 4M3JA 4RFEB 5K9JH 3IJSB 3MCKA 3U0PB 4QKXB 3MJ6A 1Q0XH 4XC3L 3I6GA 1JFQH 2IAMD 3FB7A 2ICWI 3QWOB 4G8EA 4JO1H 3QPQC 2HKFL 2JB6A 1KN2L 2FYYA 2PCPA 2GJZA 5B38G 1TJGH 3W5MA 1K3ZA 3AXLB 3THMH 1UJ3A 3V0VB 2R2EB 4Z0XA 4G9FA 2JTDA 4PJ7F 2OJZL 2X4SA 4P23D 5T3ZD 4TVPL 2XTLA 2BXZA 5GRJL 7FABL 1HYSD 2Z35A 1INDL 3QNZB 4NRXB 1YEEH 5CUSL 4PP2A 3FTGB 3DXAB 3RL2A 3VXQA 3MUY1 3QA3A 4K8RD 4GRWH 4RMQA 4N5UA 2MCPH 1FG9C 1F4YL 2OBGA 4OLZH 4HJGA 4XPGL 4KMQA 1A6TA 4LPCA 1KNOB 3TNNA 4WFHD 1P7KB 2OS7A 3QG7L 5CGYC 1UXWB 3RX5A 5E9DE 3KPNA 2CRIA 5AAWA 2VO5A 5KTEL 3ARXA 1EJOL 2DWDA 5I30L 3LEYL 2GJ6D 1S78C 1FE8L 2AJXL 5DZNA 3RU8L 2OK0L 5JW4Q 5D93C 3NN8A 1IC5H 3GO1L 4PUBL 3B9VA 1BPVA 5L88L 2JB5L 1MFBL 1U6AL 4U1NA 3FQUB 5I8CA 1ZT1B 4PLOB 5FGRA 4K3JL 3CVHH 4YFLF 3HUJA 4X4YA 1U91A 1W0YT 4JZOB 2ZJSH 4YX2H 4CU7A 4JHWL 1MCNA 1U8KB 4OZHB 4ZSOE 3Q5YA 4OGAD 1A9BB 4DCQB 4GMTL 1B6DA 3VFPA 3EFFA 1EAPA 5I8OL 2J6EH 4XNQB 4PRIA 1SHMA 3JWOL 4FS0A 3SO3B 4YHOL 1HHJA 3MROA 3FFCA 1VERA 3MUGB 2YRLA 4YC2C 1UENA 3T3MF 3DETD 3VGGA 2D0HA 3WJJA 3ZTJG 3MODL 3PGCB 5L8KB 1CBVL 2E3VA 4KTDL 3SJVA 2Y72A 3O3AB 2VDRL 5I1KL 4TTDD 2EEDA 1QYGL 3QDME 2NNAB 4JAMA 5FV1L 4ZODA 3GSNB 3FRPA 4I0PD 4XHQA 1CDBA 5KVEH 3X11A 4MCZB 5C09E 5I75C 4X9HA 2OX5A 4J3WA 5ELIA 2OJEA 5DFWH 5EUOA 2OTWB 1NEUA 3DIFB 1FFRA 1RFDL 2DL2A 2BSTB 1BVKB 2JJUA 5FYLH 2DMCA 2Y7QB 3PABB 4Z7WA 1OAZL 1BX2A 1DL7L 2AJUH 1QA9A 4QHNB 5EU7C 4W4OA 3BGFC 4HS6B 3B9AA 3IJYA 4LSSH 2WBJC 2EO9A 3ORJA 4M1DH 1PYWA 1MVFA 1ZT7A 4JO1L 2CMRH 1E0OB 3HZKB 1UM6L 3ULVC 5TPWL 1MCWM 1W0VB 2O5XL 2XZCL 4L8BB 1IAIH 1EHAA 2VXUH 2IPTH 3V6FB 2GYSA 3QIBC 2W38A 4PJIA 4PLKC 2E27H 2J8UA 3B5HA 1I9EA 2IGFH 4WUKH 5IB1A 2VLKE 4P2RB 3KG5A 5F7YC 4XB8A 1VHPA 1OB1A 1EFXB 3GSOA 4NHUB 3WFEL 2QHLA 4LSVL 5T1LB 1YEEL 3K3QA 2OZ4L 3GMRB 3TT1H 1Z9MA 1NAMB 4WW2F 4GSDL 1GZPB 2JIXB 3CFJB 2NY3B 3PWNB 3ILPB 2HT4D 1TVDA 3GBNH 4FQXA 1YJDH 1BD2D 4LVHB 3OKLB 4OCXH 1G9NC 1P6FA 3TIDA 3BDYH 3EIFA 5IBUB 1CICC 1BZ7A 3HE6D 5CBEB 3F6LA 3HE7C 3PNWA 3H3KA 1KIRA 3S8WA 2DYPB 1Q94A 3OKOA 2VL4A 2QLVB 4JM2A 43CAA 4ORGA 1H3PH 1T6WA 2HFEB 2VRAA 5DJ2A 1A7PL 3Q0HA 4JANB 4JFQA 4ZFZB 5EA0H 4W70A 5I74C 1AXIB 3B6SA 2B0SL 5D1QA 1E4XL 4MNGA 5HYSA 1DBML 3QH3B 3TH4T 2YMXL 4S0TD 3OAZH 4R0LC 4JRYD 4JFFD 5D8JH 1GGBL 3STZA 2M8XA 2NY0C 5DUPH 3LQAH 4LDEB 5DZOA 5INCB 4KU1A 3I9GH 2FJGA 1KCUL 2JELL 2VDKL 4XP6L 5ABDE 2IBGA 2WBWB 4EI5C 4EXKA 2FIKA 3LKQA 3MA7A 4K94H 5DUBA 1BF2A 4JN1H 2NW2B 3IF1A 4ZS6D 5AEAA 1TVHB 5DRZA 4DN3L 2NX5A 2VXVL 3DSNA 1VPOH 3DRTB 3VFMB 3P30H 3HRZA 2HJKB 3GGWA 5B38A 4KKBC 3BHBB 1U8IB 1A1MB 2CGRL 5D6DA 2P24B 2F53A 2Q8AL 5J56B 1MCWW 2DQIL 4FOMA 3C60A 3CC5A 3CUPA 3KYKL 4J1UA 1RZGA 2EDKA 2IAMB 3GRWA 4YBQD 5DRNA 3RQ3A 3A6CH 1MAML 1F2QA 5CAYB 5DJXA 3W0WD 4LDLB 5KVEL 3C2SA 4IRZH 4HS8H 2XY2A 3QQ9C 5DTFB 1R5IA 4LMQE 1TZHB 3UYPA 4HKBA 4GO6B 4P23B 2QSVA 1NFDB 3MRIA 4ZTPH 1X5LA 4G8GA 2VR4A 1J12A 5KJRL 4JGUA 4P2OA 4PJ8A 3O4OC 5J12C 1MAJA 4OLWH 3IFOB 2OTUB 1A6ZB 1NJ9A 4WJ5B 3CMOH 2XTJC 5I1HH 1D9KC 1ES0A 4OF6A 5KBNC 1HEZA 5B3JE 5A3IC 2CDGB 3V6ZB 1XGYL 5EOQH 5E8EB 3WFZA 2FB4L 2VXUL 4H8WH 4LP4A 1B0RA 4LLYB 3QSKB 3IFLL 5D7LA 4QNPF 4WUKL 2IGFL 4U7SA 3O6LH 4PJBB 3ZTNL 4CKVX 5DEZA 1ZLVK 4G6JH 4HWEH 1NBQA 2NY4C 2GJ6B 1U2CA 1TVBB 5EBWA 1WZLA 1RJYA 2VDMH 4LSUL 1S8DB 4M4PA 3RUGB 2HLFD 1ZHNA 1ZLVH 3EYQC 5KVDL 3IFNH 3RY6C 3X12B 2A9ML 4I77H 1HHHA 1J88A 1YJDL 4NKMA 4B7IA 2YPKA 5FO7A 4ZYKA 4PB0L 5BS0D 4WEBL 4OT1L 1EK3A 1GZQA 1URLA 4BSVA 3PGFH 4XPHL 4G8IA 3TNMA 1DN0A 5F8RC 5LVEA 5GSVA 4G6KL 5A2JH 4HUXB 1DBJL 1QPPA 4GS7C 1OGTA 1LGVA 4YNYB 5KN5B 3O45A 4KMTL 3DVFA 3PDOB 1OWWA 4OZHE 5C7XL 1GC1L 4K55A 1WTLA 5C3LD 1ADQA 2NPLX 2JKXA 4I18B 2DKMA 3S3JA 3VFRA 3NZ8B 3LH2L 5HDOA 1C5CL 1ND0A 3FZUC 3FFDB 3HAEB 2Y07L 1JTOA 1ITCA 4M1GL 4JDVB 4I0PB 4S2SA 3BN9D 5ACLA 5C0DA 2DMBA 5JOPE 2PXYC 1HQ4B 1T5WB 4K2UL 2CDEA 3NVQA 2VTFA 2ADJA 3TN0D 3ELAT 1NDMB 5IB5B 4XTRC 3EYOB 3KXFD 3D69A 5HGBB 4G43B 3T2OA 3MRRB 5IW1B 1FVEB 1AI1L 1QFWL 4X6EB 4NPYA 1AD9A 3UTTB 1U0QA 1NGXB 3DROA 5HBBA 2HWZH 4ONGH 4P57B 5IHUL 2BVPB 3LQZB 3HZYB 3WL9B 3KJ6H 4TUJA 2QEJA 5EIVA 2FH8A 4UDTA 4D2NA 2PTVA 5FOJA 2EDYA 1PX4A 5D6CA 4M6NH 1SEBA 5GGQL 3RTQA 2H41A 4YDKL 2PYED 2G75A 2JJSC 1R3KA 1TJHH 1RJZB 1I85A 1IARB 5DHXB 3T3ME 1A14L 4GAYA 1TLKA 4C58B 4FZ8H 3P9MA 5GS1B 5DA4A 2DLIA 4KTYA 4F80A 3GMNA 2I60L 3QNYA 2A83B 2W92A 5HVFB 5DHVA 1OTTC 4PJFB 1H0DA 2QR0A 5JIPA 3VXTA 3G5YA 3DUSA 5DD5H 5IVXF 3LDBC 4ONFL 4D0DA 2NY5H 4OLWL 1RV6X 4F3FB 1IC1A 4XBGB 1BD2B 4P2RE 4O2FB 3MRKB 1BBJA 1M05B 1T83C 3S5LB 5EO1A 4CAGA 5LGJA 4I0CC 3HE6B 2BY2A 4Y7MA 4X4MA 4D94A 4WFEE 3MYJB 5CWSA 3UTZA 4LCCC 1N0LA 4M6MH 5CEZD 3AM8C 4MZ2A 2YD8A 2BVYA 4YZFF 4X5WB 5CP3A 1C16A 4Y5VB 1QVOA 1QHPA 1SYSA 3CFKA 2O5YL 3QXWA 3SDXB 5C0CE 2OR9H 4OLXH 5F7WC 1PZ5B 4WVRA 1DBBH 1P4BH 2R4SH 5D96C 1U41A 5TQ2L 4JRYB 4JFFB 5FDWA 5IHLB 4KROD 4ODXA 4Y4FC 1OQOA 1EXUB 5A2FA 3TFKD 5GGVY 5C0BE 2IMMA 4Y8AA 1M7XA 5F1NB 4XMLH 1KIPB 2BSRB 1WEJH 3GSRB 2WW8A 1TJIH 3MNWB 1TCRA 4MDIA 3PWPD 4HD9A 3GSXA 1DBKH 5SWSA 5CLWA 2CSPA 1T21B 3C8HA 5FYKU 4GW5A 3QUXC 4LCWD 4U33A 3SKMB 2A0LD 3TA3A 1ACYH 4G5ZH 4MVBD 4N5EC 4O51A 2R15A 1F6AB 4NWTH 1YEGL 3DARA 1S7XA 4BH7A 4OQ1A 1DE4B 4X7TA 4M6OL 3SGEI 2GSGA 1T1WA 2HA1A 4XAWH 2VDLL 1U8PB 1VGKA 3FO9A 4JE4B 5I71C 1T6VN 1P69B 4NKIH 3ZTJH 2XQBH 1WWCA 4JLRA 4QTHA 1XF3A 5DWUH 5FO8B 4FFVC 2QTEA 3W0WB 1S5IL 3A0OA 5E5UB 1WBYA 4P9HH 1T3FB 3LZFH 3J7HA 3GMPA 4GKNA 4D9RD 1OTUC 3IRZA 3VFTB 1LEGB 1QEWA 1T7YA 2XZAH 4ZUVA 5TF0A 2B39A 2GEEA 4DVRH 1VB9A 4X6DA 1IGIL 3BT2L 4LLQA 4PGBB 3K46A 2EC8A 3MACH 1IM3A 3UZEA 1RUPL 1JGEB 3S4SB 4DUWA 5IMMB 1L9MA 3GMMB 3VXMA 4X6BA 2HH0H 4CN1A 3QUZA 1UB6A 1YEDB 3O3DA 4M6NL 3BZ4B 1W72B 4BKLA 1PLGL 1R3JB 1W0WA 2N7BA 1UH3A 2IANE 5DI8A 5IHBA 3OKYA 1AJ7L 2E7CA 3NIDE 2R2HA 1N6UA 1EEZA 4HPOH 3BE1L 5FIEA 5CFHA 3FQNB 1JNHB 1K8IB 4PPTA 3QQ3A 5TDPB 2Y5EA 1IAOB 4GQ9L 2CD0A 2DQGH 3SDDC 3QAZC 4JKWA 5ICZB 4WFHE 4BQBA 1RULL 3BFOA 1AO7D 1Z0MA 4ODUB 4PJGA 3K74B 3ZT5A 5B8CC 3KVQA 3MO1B 1A64A 1CL7L 4JO4L 3T04D 2WQ8A 3ARDD 5CKAA 1J1PL 1P7QD 3MGOA 5E6YA 4XH2B 4MAYC 5D2LA 5I8EA 3GRWL 1VDGA 3Q5OA 5BS0B 4V1DA 4WV1A 2O61B 1EMTL 4EIZC 4OGXH 1RHHA 1P2CB 1Q0YL 3NCYP 4CVWA 4JFYB 2EDBA 2CO6B 1IT9L 5E94B 3OJMB 2OL3H 1RIHH 4HK3N 1GGIL 4PGZA 3QEGL 3VDCA 4GKSB 4D8PA 3LD8C 5LG1A 5DVNA 3ARZA 1DBBL 3LPGA 1L9NA 4OF5A 1LEKB 5LGHH 1ERNA 1NGQH 4Z7VB 4TSBL 1X5HA 3LQMA 3CCHB 4QNPE 3DUHA 4NRYB 5EUKA 1NC2D 5FHBH 5F6IC 2CJUH 2Y4SA 1CE6A 1DBKL 1W8OA 4RX4D 5IK3B 2A6JA 3IDUA 3VWJC 2NYYC 1FZJB 3QZWB 1VESA 3VGHA 3N85L 5FM5M 3ZSTA 3TN0B 1ACYL 5LCVL 5JHDD 2QSTA 4CVZB 1FRGL 3KXFB 5BXFA 3MJ9A 3MBXL 4HK0A 3ZMRA 2VJXA 4R7NB 4UIMB 4HS3A 2EDOA 4RIRA 5FF6A 4DKEH 5LQBL 5IJKA 1V3LA 1AGEA 1C7SA 5J1SC 1KTKE 3MLWL 1OSPL 4ODHH 4PP1C 2V5SA 3E3QE 3MXWL 3QXVA 2VSCA 2D31A 4RBPH 2XQBL 1HI6B 5FOBB 5HHXL 1XR9A 2PYEB 2R0ZH 3ZLQC 4LPYA 3UTTE 2WIIA 3LZFL 3RGVC 4IRJC 4ZG1A 4XI5C 5KS9A 4NCC1 1F11B 4HX1A 4MA8H 3FRUA 2CRMA 2CK0H 4PGDB 1BFVH 2RCSL 1QR4A 4OI7A 1W8NA 4R4ND 4RAVB 2ITDA 2J3SA 3T65A 1G9NH 3HCVA 2DLHA 4JVUA 1MIEH 1IC7L 4AY0A 3K1KC 2MJWA 4RGNC 5C0FA 4XC1H 3LY6A 5T3XD 5DMJB 1UM5H 1J0IA 5FHAL 4F2MA 2Q8BH 5DFVC 1TITA 2YC1B 1BHGA 1ADQL 2NXYD 1QSVA 1A6AA 3T77A 2OR8A 1CD0A 4LLWA 4PJFE 4NKOB 4U6TA 5J13C 3GJFK 5CD3A 2G9HA 5GHWL 1CLZL 4YBHA 3MRNA 4K7PH 1KJVA 1MLCA 2A74B 2ZSWA 2N1KA 4IDJL 5FGSA 1BD2E 1DFBH 3G5ZA 3GJFH 2R69H 3EFDL 4ONHB 3TBYA 4M5ZH 3VG0H 4IRSC 3BZFA 4QCIA 4JHAL 4YXKL 4KROB 1RURH 5DYOA 1F90L 1AFVH 1YNTB 2F8VA 3I85A 1J0JA 2YK1H 3SCMA 1A47A 3BPOC 5IGXL 5GIRB 2EDLA 3DVNA 1PQZA 1C12A 3PV6A 1MHCB 4RA0C 3LRSA 3PWPB 2SEBB 5IEHB 4OF0A 3E8UH 5JOFA 3AS1A 4JRYE 4JFFE 4OGXL 4LCWB 1MFEH 1DEDA 4Z7UA 5IVXE 3GB7B 4W6YB 4L9LB 4JQVA 3U6RA 4KI5F 1V7NH 2X9XA 5IQ7H 3L3HB 3RVTD 3LPFA 5ILTL 3WO4C 1K6QL 1JL8A 4OCWL 1DUYA 3W2DH 4JZNA 3NTCH 1QFOA 5BO1H 5HHVL 5HI3C 4O58H 4YZFE 2IG2H 3H9YA 3QHTC 2G5BB 2EYTB 2R4RH 5HHME 1D5ZA 3D2UA 4MZ3A 4PRID 3NAAH 5FXCH 3NZHL 2ZG1A 1X9QA 2CJUL 4MJ6B 4L29A 3L5JA 4GW4B 3W11C 1F4WH 1JNJA 2V9TA 3DHJA 3BWAA 2H26A 4AMKL 3C5ZD 1MHHB 4MD0B 3MV9D 2WUCH 3QHFH 3EO9H 3B2UD 3CXDL 4GBXA 3BEVB 5KSUB 3BYTA 2DWEA 3QUMH 5E00B 1QZ1A 1AIFB 1KCSL 3K80A 5FYJU 5JW4M 3K1DA 3VD4A 3HR5A 3VFOB 1JUFA 4NDMA 1T1XB 3RWDB 1G7LB 3DRQB 3V6OC 3NA9L 4KJPC 5DEFA 4X7DC 3GHEL 2ZG2A 1KOAA 4Y19A 1ZHLA 2PR4H 3B9KA 3JUYA 4V2BA 1NCAH 4WCYH 1YEJL 3PWJA 2DQHH 2R0ZL 4AIOA 4GT7A 4PJEB 1B4JL 1A21A 2IQAA 2EXYD 1IGYB 2FLBT 4MNQD 3D9AL 1G7QA 5CP7A 5L7XH 1JPGA 1Q9LA 1FNGA 4LVNC 3OKDA 5E8OA 3SQOH 3MFFB 5MERA 1BFVL 5EULV 2WM0A 3FO0L 5F1IA 4LNRA 5C6WH 1GH7A 1K4CA 3QIUA 3KYNA 1RK0B 1PG7L 3OR6B 1AO7B 4XC1L 4F9LA 5JDSB 1CR9L 3BH9B 2WWMC 4E42B 3ARDB 1B0GA 2Q8BL 3MRGA 3WFBL 1P7QB 4KZEH 3VXOB 1K2DB 3FB6B 4GKZB 3GHBH 4OFKA 3CSGA 4WDIB 4XP9H 4JQXA 3EZJB 2GSIA 3ROLB 3R1GH 4K71B 5GGVL 2DOCA 5JORB 2B7DT 2D7QA 4LPVA 2PTTB 4PG9B 3DMMD 2Y9RT 5D2NB 3MRBB 1KIQB 3ZHKA 1VA9A 3RWJB 4FG6C 4KJQC 1KLUA 3DV6B 5DJAB 1K8DB 5FA3A 5BS0E 1AQDA 4PJ5A 2JCCB 2R56H 1KJ2A 2IH1A 2F54E 5HDBE 3UXFA 1U8HB 1T4KA 3U4EA 1LDPL 4JREC 4S1DC 4PTUA 3H3BC 4PGCB 4WU7A 1S5HA 1D6EB 4F7TA 3LMJH 2MQCA 1VFBA 1Y0LA 2YD6A 8CGTA 4JM2D 1KACB 1IEBB 1JPST 5DURD 5J1AB 3LEVH 1NC2B 4FFWC 5I73C 2FHFA 4P0DA 3NCMA 1CD1A 4HXBL 4GRMA 1T1YB 4N90D 4Y5XB 5D1QD 4G80B 3O2DA 4AEHH 4ESKA 3CFEA 3EZ8A 5F21B 4OM1H 2CLRA 4Z7VE 1NMAL 4TVPE 5JHDB 4HGKC 4Q6IB 2A2QT 4R7DB 4KKCD 4YDJB 4G42B 5IMLB 4KK8D 4CUCA 2BJML 2X4OB 3KR3L 3ULSB 4X4XA 1GCFA 3JTTA 4HIJB 1T0MA 4NC0B 5IEKA 4A2MA 3EOTH 8FABA 4HWZA 2HMID 1MIML 2B4CL 2YBRB 3FONA 2OLDA 2P1YA 2WBKA 1TZIA 2GFBB 3G6AB 4KKAD 3KXFE 4FXGB 1YQVH 4M7ZC 1IEAA 3T4YA 3V5KB 3O4LA 3LV3B 2DKUA 4XXDB 1V3JA 3I02A 1G7IA 3C60D 1IGFL 1NL0L 1ZA3A 5DO2C 1AP2B 3MCKB 1A4JA 4KMLB 4JG0L 2QQNH 1EVUA 4GW1B 5IB4A 4OD1H 2I9LB 3EYUH 4F58H 1GXEA 4MXWL 3RNKB 4X7EC 3IS1X 1FFPA 1KUMA 3QHFL 4YPGA 2IWGA 5I15H 1M6OA 2WINB 3WJLA 2NW3B 2MFNA 2GJZB 5FUOH 5DT1L 1XIWA 3OKEA 5TFSH 3EOAA 3HMXA 3ZE1F 4Z0XB 2CKBH 1QP1A 3GNML 1FNFA 4Z8FL 1FZKA 1OGAE 2FEDC 2NXYB 5EC1A 4DZ8B 3FT2A 5BVJB 5K9OB 2X4SB 2HT2D 1ZT4A 4LRNH 5C92A 3QUKA 1NCAL 1KBGL 2W0FA 2DQHL 4P5KA 3FQWA 4JZJA 4PP2B 1OD7A 4G8GD 2KZWA 3BP7B 15C8H 3P11H 4P4RA 3DNKA 3STLB 4RWHA 1HH9A 4PJ8D 1JIBA 4YLQT 2AJ3B 3BOVA 2MMXA 1XGPA 4XNXH 5F89B 5C07D 1A7RH 3HUJF 4LK4A 4M4RA 4Y1AA 5EZOL 3OKKB 4E41D 1H5BB 2HKHH 3BW9A 4NHCH 5DC0A 5E4EB 3MJ9L 2H3NB 5JXED 4G7VH 4NN5C 1X5KA 4G3YL 2KDGA 32C2A 2DQEL 3QIWD 4YQXL 4TUKL 5CEXA 3KPNB 3WLBA 3RWFB 5EU3A 3TBTB 3VJ6A 1WBZA 4KJWC 4PJ9D 3ZYZA 4XCYA 5F3BB 4PRHE 2X89D 5F6HJ 5DLML 1VGEH 3HI5L 3HTLX 3NN8B 4OZGA 2NY6D 4PLJD 3MUHL 4U1GC 5E95B 1UB5A 1MSPA 3I50H 3ARSA 4UTAH 3TVMA 3MBEA 5BRZA 3IDYB 3DV4B 4X4YB 1JZ3A 2DIJA 4K9EL 3V52H 2WZPD 1EO8L 4LCWE 5D7IF 4ORZC 5F8QC 3E6HA 1G0DA 3RA7H 2VLJA 4WHDA 2X70A 1GRWA 4PR5A 5J6GB 5IIEA 5HHNB 2B1AH 4PRIB 1JHLH 4EOWH 3BKJH 4DAGL 5LXGH 2EDDA 4LOUC 2BVTA 1J1XH 3MROB 4Y16C 4MJ2A 4F33A 1O7VA 1JGDA 4EXPX 2BOCA 5K59F 4AEHL 3TPUA 4GXUN 4OFDA 5DDHB 3C5ZB 3MRPB 5IFHH 1NCTA 3MV9B 5LAXA 5F88A 4KRMB 5CZKA 5D9SA 2RB8A 3P73B 3AUVA 4M1CC 4D9RE 2EE2A 3ZO0A 4M7JH 1KJ2H 3B83A 3IT8D 4PJIF 5HGGS 3VW3L 1A7NH 3G6JA 4OB5H 2AGJH 3PP4L 4M8QB 5EUOB 3RP1A 4TNVK 5I19H 2VDQH 2ZUYA 4KI5E 1FFOB 1YQVL 3FHAA 4Z7WB 4BQCA 1A6UL 4TSAH 2UYLA 1BX2B 1NGZA 3FQTB 3SDCD 1WISA 4Z77A 3G5VA 3UTSA 1DTUA 2NY1D 4MNQB 4Q2ZA 4OZIA 4OV5A 5FKAA 2YSSA 5EU6D 1SY6A 1CDJA 4UUJA 2LE9A 4YH6A 4YAQA 1TDQA 1BP3B 3LHPL 1G9MH 4EDWH 4OD1L 5E1AB 3KHQA 1WIOA 4HDIA 3T0EC 4AG4H 2Q6WB 1TQBC 3S88L 3RTQD 1F3JB 1RIUH 4PJEE 2QSQA 3C6LD 2I9TB 2BNRE 4ODVL 2J8UB 1Q1JH 3MTRA 2RJMA 3DGGA 1Q9WA 2F74B 1CFSB 4U1SA 5AG8A 2BNUA 1D5XA 5F7FA 5KSAA 2IPUK 1OB1B 3N1QC 1DQML 3KPLB 3LOWA 2DLTA 1AO7E 4JDZA 1BQHB 5MENA 1LWRA 3DMMB 4DKDC 4J7RA 5B22A 4FFZH 3Q48A 4D0BB 3VCLA 1A7RL 2X4PB 3WIIL 3OZ9L 5MEQA 3RRQA 4NHCL 1OAXL 1IVLA 5E2TH 3QQ4A 4OKVB 4R2GD 2DKSA 1RUKH 2Q86A 4YFEA 3FB5A 4PBWD 4JM2B 2QADC 43CAB 5HXMA 5DURB 3VXSA 3IU4H 1XF5A 4HG4K 3HMXH 4O5LL 2JCCE 5T1KD 1OOAA 5D1QB 5HYSB 1I1AC 4WWKD 2AJVL 4YWGL 2EDFA 3MRDA 3SEPA 5GZNC 5IJVA 5EU4B 4KV5F 3UTPD 3DURB 5D1XA 5ADOL 1WFOA 3KLAB 2V7HB 4Q7DA 3V5DB 3HNVL 5DUBB 4XBEH 2WP3O 4CMMA 4QXTA 3V52L 4L5FH 3AB0B 4LQFL 4WUUA 3BIBX 1JNNH 1MWAH 1N64L 4YHZL 4XWOC 2R29H 4RQQB 1N6QL 2YOCA 3HC3H 1G6RA 3WXVL 4XX1E 2B1AL 2C3XA 4J8RB 3RY4A 4GUPB 1N4XL 3ZDXF 4N9OB 2OQJB 1XGRB 3C60B 3S37H 5ID1A 5E2VH 5I1AB 2IH3A 2RHEA 1X5ZA 2ERJB 3UC0H 1DLHB 2FX8H 2BHYA 4FA8A 1NANH 5TGBA 3VFWB 3MA9H 2C5DC 3D39A 3MXVL 5EBLA 1WAAA 3KYOB 5JW5A 3G6DH 4FQIL 5J11C 1KJ2L 5F96L 3P9LB 2AEQL 3OF6D 4EVNA 1NBZA 4AM0B 5EZIL 4ZO7A 1OSZA 5CHNB 1R5IB 3MV8D 3WHXB 5HVGB 4UOJA 1R3IH 4YHYC 1K85A 1OARL 1HHIA 3EYVB 2HVKA 4WO4A 3UTQA 3VA2C 1YY9D 2CLZA 3BPCA 4LAQL 5I1CH 4G8GB 1F58H 1S9XB 3O2VL 2W07A 4G7YH 1AXSA 4PJ8B 2JK5A 1VEMA 1WZKA 3VFGH 3GMQA 2Y5TA 4G9FE 3HMWL 3O2DL 3DYOA 4M6AA 4PRDB 5C07B 1K3IA 4X98B 1UVQA 4E41B 5MEOB 1EA9C 2GIYA 2AJYH 2LFGA 1CGWA 3SBWC 3Q5TA 1BREA 3SGDI 5GZOC 1B0RB 1PG7X 1MFDL 3QIWB 1PAMA 4IMKA 4XHJC 3U82B 5TF1L 2VZ1A 2I07A 1EIBA 4MS8C 1EO5A 3RDTD 3U4AA 4PJ9B 3NGBB 5SX4H 4K23H 5T1DH 1U8MA 5EBWB 2YN3A 4JQIH 1AH1A 2NY6B 3HG1D 3GI9L 5H2BA 4HG4J 4K7PX 3NBNA 1HHHB 3HA0A 3QPXH 1MH5A 5A43C 2YPKB 5FO7B 4JFZH 1FGNL 1SMOA 1YZZA 3T3PE 3DSFH 1O7SA 3L5WA 1GZQB 4OLUL 3RWCA 3C6SB 3JV4B 1T20B 4BSVB 2F58L 2I27N 5E9DA 5FECA 5E4IA 1DN0B 4Z7OE 1J1OL 3CPLA 4MA1C 1CLOH 1JPTL 3L9RB 4QRSA 4NBZB 3HUJE 1ZGLA 2ZCHH 1QFUL 4JFXA 3VXRA 1BF8A 5DMIH 4X7SH 3EHBC 4XMKH 1MFCL 3W39A 1MCIA 5IHZA 3FQRA 3OR7B 4HKZA 5HY9A 2CRYA 3MLSH 1LO0H 4I9WD 2ARJB 4OFIA 2Q7YB 3U0WH 4PRIE 1EGJH 5LGKA 2EDNA 2LQRA 4QGYA 2NY2C 1XF2A 3FFCE 3RVVD 4R8WL 4Y4KC 1INEH 1KB5B 3W9EB 4TPRH 2AKRA 4NNYA 4YHKH 4C56D 4ZQKA 2EDWA 1CS6A 3N1GC 2CUMA 1WCBB 4DFIA 2CR6A 3VFNA 1UWEH 2AV7A 2ADFH 4ZUSA 3EO0A 2R29L 4ZUTA 2ADJB 1IGMH 3LVEA 3VRIA 3QYCA 4NWUH 4ELKA 1FO0A 2FATL 2X41A 2GCYB 3SDCB 2EDEA 2NY1B 2A73A 4NPYB 3IKCA 1AD9B 4UTBL 5EU6B 4N0YH 5JQHC 3S97C 3KAAA 5EUOE 4TUJB 1LO2L 4OQTH 4UDTB 3RWHA 1IE5A 3T2NH 1E4WL 5JR1H 4F9PA 4Z7WE 2HN7B 3FCTA 3EUUA 3RTQB 1CF8H 5FKPA 3AY4A 1RZ7L 4KK5D 3U2SA 3WN5B 3G6DL 3C6LB 4Q9CA 4YHPB 1T04A 2AP2A 4GAYB 4LPUA 4P5MA 5K59E 5GJTH 3P9MB 1ZVSA 5GS0L 5DQ9A 4MA7L 2QQLL 3SE4C 2CKNA 3QNYB 1NCWH 4U6HB 4NM4L 43C9A 1I7RA 5DHVB 3D6GA 4MXQD 3QI9C 2QR0B 4MDJA 3ZKSD 3G5YB 3DUSB 1CE1L 1AD0B 1RZFH 3L6FB 4FQJL 4KHTH 4D0DB 4KUCD 4PJIE 2J8HA 3AS3A 5DVOA 3O6KL 1IAIM 1OT1A 2ICWB 2J8UE 3JV5A 3M8OH 1YNKH 2OTPA 4PJXB 5JDJA 4PJHF 1MVUA 4ZFOB 2BOBA 4R2GB 5LGJB 2BXYA 3HNSH 3RVXD 1C08A 1H15A 4YR6A 1QKZH 1QSED 2R1XB 1FNAA 3BUYB 5CWSB 1UQSB 1JGVH 1YECL 5F72S 1CCZA 3DI2B 4DKFH 2E7LC 3UBXI 4NP4H 4P9ML 1QVOB 2XA3A 1U8JA 5T1KB 1KCVH 1SYSB 1TETH 3N9GL 5A1AA 3CZFA 4WFGE 3NH7H 4ZUWA 2DLFL 4K3EH 2CIKA 4WWKB 4PGEB 3DX8A 1YEIH 4JDTH 5C0GA 4WW2C 2WBJA 3U36B 5D7JC 4MB3A 3IDJB 4OGYL 2Y06L 2XI9A 5I1JL 1WZMA 1WFUA 2B8OT 3QPXL 1HKFA 1SY6L 3F58H 4U2ZA 2ZCLH 2EDRA 4N90E 2B5IB 3LN4A 1CTNA 4GAGL 4MNGE 1U93A 2A1WH 3DSFL 4R26L 3TP4A 4AJ0A 3GSXB 1OPGH 5HJ3A 4NQVB 4ENEC 2VOTA 4UV4L 3TM6A 3QIBA 5EZJB 1I3VA 4J3SA 1SM3H 1JPFA 3BPLC 3VXNB 1AXTL 4DGVH 4X6DF 4OCRH 4GMSH 25C8L 3C5SA 4NOBA 4JKPL 4NQSA 4CMHC 4YXLL 2J5LC 4NZUH 4X7TB 3WV0A 4C57C 2NX5E 3TH3T 1MELA 4U6VL 2ZPKH 1MPAH 5C0AD 2XV6B 3VI4E 1T1WB 1R5WA 3WFDL 5C6TL 3SE3C 1VGKB 3FO9B 1PSKL 4OD2A 5HGDB 4KGLA 4IIQA 4QRRD 1MQKH 2F53E 4RZCA 4ZTOL 2C1PA 4JLRB 4RRPG 4U3XA 4Z0BH 4JO2L 1WICA 4YGAB 4TPRL 4YBLB 5A2LH 1EHLL 5J3HD 5EU5B 3Q6FB 1OP9A 4GKNB 4M8VA 3QG6A 2NLJB 3PV7A 4N1HB 1JJUA 5FM5O 5IBUG 1KELH 4KV5E 3MV8B 2ED9A 1Y18B 3WS6C 4KZDH 4XXCC 1ZLWK 3VRJA 1EEUA 1QRND 3REWB 3GM8A 1N3NB 3QO1A 4L3AA 1FN4A 4XMPH 1S9VA 4H25B 2C4XA 2QQQA 3WLWC 4LLQB 4R0LA 4WRLA 1Q9KB 3BIKB 3HPJB 4PJGF 4PLNC 1FNLA 3FT4B 2VIRB 4P5TA 4D9QD 4D3CL 6CGTA 1AGBA 3O3EA 2E6QA 3O9WC 3KPOA 1LE9B 3UX9B 3QFJA 5DK3A 2DQDH 4RFEA 2ENYA 3B4NA 1FLRH 1W0WB 1CF8L 4CU8A 4G8GE 4MJ4A 1JV5B 2Z31C 2FO1A 3QWOA 1T1ZA 2V17L 4XNMA 2D0GA 2VXSL 4JB9H 1U3HD 3QDHA 3UJJL 2CLVA 1GAFH 2KKQA 5C07E 1FAIH 5CD5C 2WV3A 5JMOC 4E41E 3RDTB 5F97E 5J7CC 1NCWL 5DR5H 2QSCL 1OTSC 1G6RL 3QIUD 3AXLA 4MJIA 1UZ6E 2J7LA 2R2EA 5KSBA 1KULA 4KKNA 5FYKL 3HG1B 4X6CB 3V5HB 4HZAA 2RAMA 1NLDH 5D7LE 5C0ND 5GISH 1BGXH 3CFBA 2BVEA 1SQ2N 1J18A 2VKXA 3PWUB 4KVNH 4NRXA 4U7KA 4Y5YC 5D2LB 5I8EB 3WUWB 4FP8L 3G08B 4H1LH 5L0QC 3DXAA 3QUYD 2V9QA 4WV1B 4LHUD 3MLXL 5GGSB 2BNQA 4OCSH 1OP5K 4I4WB 4ETYA 3BKYL 4JY6A 3MSPA 5CZXD 3PP3K 3TO4D 3ULUL 2XA8H 4DKFL 2XYCA 4PRNB 5HYFA 4D8PB 4NP4L 4K3DH 1KNOA 1P7KA 5DRXB 1P53A 5I1GL 1FORL 4XRCB 5C9KA 4HGWB 1VACB 5C3TA 5CJXC 3BI9X 3H3PH 3WUZA 1DSFL 5D72L 4H20H 2WUBH 4HC1H 3REVB 3HS0B 3CK0L 1E4KC 5I9QB 4HCRA 3D87B 4UINH 3H0TB 3NPSC 1A1OB 4M00A 3AMLA 1S9WB 4C56B 4Z7QF 4LSDA 2A6JB 2I5YL 4JFDD 5AAMA 1NCUA 2EXWD 4NQUA 1KEMH 4M7LH 3E3QC 4NZRL 2R9HD 1SM3L 1KC5H 2VXTH 1E4JA 3LKPA 4JZOA 1MRDH 4OCRL 3KPPB 3NCCB 1U8KA 1A9BA 2OSLB 5FF6B 2JJVA 3BESR 3P0VL 3TZVC 4DCQA 2O5ZH 5DD3H 1MHPL 4XNQA 4FZEL 2FJFB 4S1SL 1EH9A 5E7BA 4NJAL 4TOYH 4IDLA 4ZFGL 3BKMH 4XP4H 1HCVA 3CMGA 1JRHI 1WF5A 3O4LD 3MLTB 4XVUC 1OAUL 4WFFD 3WEXA 4Z0BL 1Z3GH 4LFHD 2YWZA 3TJHD 3O3AA 2H1PH 5KS9B 1A3RH 1A3LH 3ARFC 1HNGA 3PJSB 4XNYH 2NNAA 3GSNA 4KZDL 2RFXB 2HVJB 1HOCA 3HCVB 3QCVL 4MCZA 1YC7A 4EI6B 1MF2L 2BY0A 1DQLL 2EC9U 3L3JA 1T89C 2OTWA 3DIFA 3KPRD 4L8SC 2QKIA 5EH1A 2BSTA 2X4UB 4PD4K 1BVKA 4M3KB 3PABA 2Y7QA 1CXKA 1JBJA 3RPIB 4QHNA 5CJ8A 2AEPL 4Y4HD 4E9LA 2HT3C 1QSEB 4Z7UF 3RZCD 1SEQH 4HK3J 4UT7L 2UWEA 3QHZH 3AREC 4OIIL 3HZKA 5BV7B 1RK1A 4MNHB 3GMLB 4DW2L 3C09B 4KPHH 2YRZA 4ZAKD 4JVPA 4Y1AD 3MV7D 5DR5L 3V6FA 4NOFA 4KDTC 4RGOL 5EG6C 1FO0L 4R97C 4X4ME 2VZOA 4BQ8A 4DJMA 4BJLA 1QLFA 2ATKB 5A2KH 5T1LA 3DVNB 4UT6H 5F44A 1C12B 3PV6B 3GMRA 1NAMA 3LRSB 1GZPA 3CFJA 1CFBA 3WHE1 5ANMB 1AR1C 3PWNA 4IJ3C 2JJSA 4RRPA 4S1RH 1FPTL 4AQOA 5EOTB 3M17B 3LS5H 3UTPE 2LU3A 4POZD 3L3IB 3C8DA 3U6RB 2OI9B 4X9BA 3S96B 1GPOL 4LLVB 4RMRA 4F7EB 1LO3H 5CBEA 1DR9A 3MBED 3OGCB 2A77L 2DYPA 5SWSE 5C0AB 1NMCB 2PO6C 5DD0L 4JANA 4ZFZA 1ZLSL 1DBAH 4QRRB 2H2PC 3QH3A 1CDYA 1IEHA 4JJHA 2B1HH 2W1NA 3MRHA 4P3CH 2Z91B 3QBTB 5F1OB 3S36L 4DQOL 1CN4A 4H88L 4LSTL 5INCA 4X0KB 5GGRY 2MPAH 4OGZA 5FA4A 5GXBB 1KTDB 3EJZC 2NW2A 3GK8H 4R9HA 2VXTL 1QRNB 5E6ID 2GITB 4PY7B 4Z5RA 5L2JA 2IFFL 3VFMA 5JTWA 3K2UH 5HPMB 4MXVE 3BHBA 3P4OA 5F7UA 1YEKH 1A1MA 1Y6KR 2O5ZL 2GJJA 5I18H 1ZE3C 2P24A 2GY5A 4HJ0C 1D6VH 4GRWB 4PV8A 2XZQH 4PREB 4P46D 4X6DE 3VGDA 1FNSH 4HKJA 3X14B 5DMGC 1CXHA 2IAMA 3E2HC 5ICXA 3R8BB 3ULVL 3HZMB 2NXZC 5GGRA 2IQAB 3UTSD 1U3HB 3MREA 4JG1H 3UYOD 4APQC 4KVCH 1YUHA 3OKDB 1XCQB 3WNOA 1IGCL 1JWUB 3A6BH 3QIUB 1U8QA 5EO9B 1U8OB 1SJVA 3KYNB 1R5VB 3BIAX 1I8MB 5DTFA 1TPXB 2XXCB 1TZHA 3OJVC 2QHRL 4P23A 3MOAL 3ARBC 2LVCA 1NFDA 4Y2DC 2ESVD 3NCJH 3SKJL 2YD5A 5TQ0L 3UJIH 3CVHB 1UM4L 5KSAD 3QUYB 4LHUB 3CFCH 5I6XB 3IFOA 2OTUA 4XCFH 1A6ZA 4E0RB 3HG1E 1MCBA 3CAFA 3TO4B 1GOGA 1IFHL 3RWEB 2CDGA 3V6ZA 5D2LE 5IBLD 2YR3A 5FA3B 1ZK9A 3GSNH 4HIXH 3MNZB 1RUQL 2VLMD 2IH1B 1JNLL 1IBGH 1IQWH 3N0PB 1T4KB 3U4EB 2D9QB 3QDGD 1MRCH 4PJBA 1S5HB 3V4PL 1BOGB 2YZ8A 1AQKH 1VFBB 1U95B 1NCDH 3IDNB 3CFDB 4WHYG 4XNZB 5GJSH 4FQLL 4YDLB 2GJ6A 3V0WH 1TVBA 3S4SG 2Y23A 5DJCB 2BHUA 4QOKD 2B20A 3RUGA 3O6ML 5E2UH 3QB7C 2ZOKA 1UWXK 4Y88A 3ETBF 1G84A 1XGUB 3X12A 1U3ZA 4JFDB 4JPWL 2MHAB 3LS5L 4I9WE 5FYJL 1OW0C 1QLEL 5C2BH 4UOW1 4Q6YA 1UWXH 2NZ9C 1FC1A 1INQB 4XCCL 1F6FB 1U8LB 2XY1A 4C54A 3SDDA 4P4KD 2H45A 2D03H 1T0MB 4XB7A 1J5OL 4HUXA 2CXGA 2J1KA 2WIMA 8FABB 3K4ZA 5B8CA 1WVZA 3EJJX 2ZZUT 5AYUH 1KEGH 4YNYA 1ZVHA 5FGBC 3PDOA 4MAYA