1J8SA

Papg adhesin receptor binding domain-unbound form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords PYELONEPHRITIC ADHESIN
total genus 41
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8sA00
4Z3EA 4Z3JA 1J8SA 4Z3FA 4Z3GA 4Z3HA 1J8RA 4Z3IA
chains in the Genus database with same CATH superfamily
4BQ6A 3FKUS 1NDGA 1E5CA 4Y2DA 5D6CA 2J8UB 5KVGH 2VITA 1VDGA 4U6HA 1AHWA 1N9PA 4G43A 1V7NH 4MA7H 4EBQH 1TLMA 1FYTE 1W0WB 2OKMA 2Q9OA 1RJZA 3QORB 5KAQG 1RD6A 2Z34A 4JCWA 5T3XL 4MS6A 5KBKA 4XXDB 5L4IA 2X6BA 4EUPA 2WXMA 1XSIA 1JPGA 3BPLC 3DECA 3C9NB 2EINB 2Q7AA 5E9AA 4EJ1C 2ESVB 4YS4A 4PGBA 4G8EA 2VDQL 3AABA 1JPSH 5KTEH 3S35X 2EXYD 1KGWA 4HXBH 2MNWA 4JFZH 5TDNA 5E9DD 3S34L 4QNPF 3L9YA 1OPGL 5IG7B 1QRNB 4AGQA 5J3HD 1AZBA 4LEOA 3N9GL 5ITBL 3Q6GH 3FBKA 1EUUA 5AD0B 2CALA 3GXMA 3PXJA 4YSOA 4L5FE 1XWVA 1KYOK 1OO2A 2IADB 2Z92A 3OZ9L 1GXEA 2YOAA 1ZEAH 1OAXL 2J2ZA 2G5BA 2F7PA 2X1XR 5DMKB 2C9RA 5IM7B 3ULUH 3J2PA 1UZ8B 1IGYB 2P5EE 2RCSL 1NFDB 5CO1A 5A3ID 5DK2A 1CICB 2HVJB 4O02B 2JVUA 1ZWIB 3IM1A 4O2EB 2ENSA 1MFAH 3W9DB 2QEJA 1RJCA 3HVDA 2DIAA 1S4IA 1NOAA 2QT6A 3TYFA 5F9JA 2BOBA 1P4BL 2N1TE 5HHOB 5KS9F 5JW3L 5C6PB 1J5HA 2VM9A 2V6HA 1UC6A 1YN7B 4QF1A 4LSVL 1S7UA 1NUNB 1RUMH 1RH8A 1NC2B 2Y7MA 3VD3A 4TSAH 3GZOA 4WO4B 4AGLA 1RZ7H 2X1WL 4X4XB 1QG3A 3VFPA 4HKZB 3PYCA 2JWYA 5IGXL 2BLFA 2ED8A 3TBBA 2H45A 4GSDH 5DVPA 5J6HB 1P7QD 2ADIB 4HSAC 5HGGS 3BVNA 2QR0A 1XSKA 4UV7L 2F61A 3WUWB 4IRZH 4HULB 3B83A 3O4LB 1F6AB 4GB9A 3T4AB 3MV7B 3UXFA 1KCSH 3PY9A 5CGYC 4ZAKB 1OHZA 5GPRA 3VTAA 1O75A 3IU3A 4LU5H 4JL2A 1S7TB 4FP8H 2TSBA 2H2SC 4UTBL 1TDQA 3MRCB 5FK9B 2Q86B 4MZ2A 1WFTA 2AITA 4WNQB 2RA1A 3EOYG 2DQ6A 3O6LH 4M7KH 2X41A 1PNCA 2IF7A 1TYEB 2SODB 1I8UA 1EJ6A 3FRPG 4MJIB 4WO4D 3U2JA 3KGTA 2NZ9C 4YBQC 5BZDB 5FO9A 1C8PA 4GRWH 1AE6L 4LDCA 1HXMA 2XT1B 1U4FA 3I3BA 5ALCL 1AKPA 2ZSWA 1MCQA 4GUQA 5F7UA 3I6GA 5D7LE 4KPHH 4KY2A 5C09E 1SFHA 1S7XB 5GS2H 5CAYB 4HCFA 3G6JB 4KQ3H 3VM5A 3N2JA 2ZAGA 5EBGA 1AQ8A 3QFJD 1IBHA 3PWJA 3OC5A 4TKWA 4QGTA 3FO9A 3V5KB 3CJJA 1P84K 3GUTA 5E03A 1HH6A 3UG3A 4ONGH 4PRBA 1UD6A 2UZPA 3KHQA 1A2YB 1CFQB 2VIRA 3QNYB 4J1UA 4ODVL 5ESVB 5EU7E 4WW2C 2B0SL 3LQMA 1AZRA 1WHOA 3CH8A 5M95B 3OKEB 3QIWA 2XV3A 3ZU8A 4RH4A 5SX5K 1P4LB 1IB5A 1OSYA 3D8MA 3LS5L 2Y7NA 1L5GB 2WNWA 3A67L 2D03L 3CXDH 5EBWB 43CAA 1W0YT 4FNLH 3RIAF 1PX8A 5MEQA 4CDGC 4UMSA 3JTBA 4ELME 1OANA 1Z0MA 2MQ3A 2Y1VA 2AS5M 1T2JA 4FA8A 3QEUA 1NUFA 4JGJA 5ALCH 1T83C 4KKRA 4Q9BA 1NAMB 4A6YH 4HUUA 1IGIH 5IB3A 2BNQA 4JM4L 3N06B 4QRAA 4JHWH 4N2DA 3IJSB 1OEZW 2EILB 2Y7LA 3GSWB 3FO0L 1QR1B 3KL5A 4UQ2B 2AZUA 1RUML 1FNAA 1IGJA 1P4IH 3P73B 4X2UA 2BMKB 4OZFG 3U9WA 4AQ1A 4JN1L 3SKJH 3VYNA 4GSQA 3QYCA 4I0PC 2P5WB 1PAZA 3IEAA 2FJFB 3SQOH 2JKLA 3EGXB 1RV6X 5BW7A 5LO7A 3U0PB 3SZ6A 4Z3FA 3AG2B 3LPFA 3M17A 1GZHA 2XPGA 4XCEB 2XLLA 3COOA 1I4FB 4H20H 2GI0A 4LSSL 4OIIL 4GXFA 2P9RA 4JHWL 4RDBA 4JFPB 3UP6A 1HXKA 3VXSB 2VJXA 3MRHA 2R29L 3QUML 4C56E 2Y1ZA 3SDAA 4BZ2H 3VG0H 3IFNL 1KPRA 3ZL2A 4G3YL 4JRXD 2A74C 1DSFH 3MC0A 2WVTA 4P5RA 2F9BT 4GFTB 4TTDC 1Z6JT 1RUQL 2FWSA 1F45A 5CGBA 5FA3B 4JRXA 2R1YA 3QQ3A 1VGKB 4M6NH 5CP7B 5D4QA 1Q4NX 5IVXA 4PGDB 2ESVE 2MEJB 4ONFL 4AYBA 5F89A 2XWXA 1D6VL 2WLHA 3O2WL 4HJIA 1GJUA 3DMMB 3FPXA 5KUKA 2EDDA 3MLYL 4I88A 4ZMYA 2F54E 4XE5B 9PCYA 4RGMB 5KVDE 5B3JE 4IHOB 1GGBH 4HKJA 3TNMA 4YFLI 3QIUD 4CSZA 4RWYL 2DYPA 3TEZA 4J8RA 1AD0A 1XR9A 5BV7L 2B1OA 3ZIYA 3FB6A 4FKKA 5C7ZA 3FQTB 4R0LB 4P9HC 2B3IA 1DQIA 2Y6TE 3GHEL 4OFQA 3WNPA 3DIFB 3R06A 1RZGB 3PHQA 2IPUG 2ZKYA 2KDYA 1UT2A 4KDVA 3B34A 3L9RA 3STBA 1NPJA 4XBEH 1DVXA 4YNYB 2V7HA 4WFHD 4YDIH 4UNTA 6TAAA 4BFGA 3O8XA 4N0UB 4YBHA 2A9BA 1ZS2A 5LLIC 4KDWA 5DMIH 3V4VB 3FFDA 3G9VA 4NM4H 4WI7A 5DK0A 3CBRA 5J11C 1SOKA 1AHWC 2B14A 1T22B 1SJHA 4NO3B 2OJEB 2R9HC 2SEBB 4Y5YB 4D94A 1PX4A 3FFCB 4KX7A 1AZZC 3WEXB 4EI5D 2FLBT 3LRMA 1ND0B 1WFOA 1CXFA 1B6UA 3I74A 4MHHI 2WUBL 4X5RA 1A14H 4G8FB 4M1DH 1FZKB 1KV7A 1XHHA 2EE3A 4OQTH 1DFBL 1G1CA 4KTGA 2EIEA 1FH5H 3QT2A 3RWGB 2WP3O 1PTZA 5DZPA 4OLVH 4OQTL 4OJEH 3P11H 5TE4H 4NO0A 2PR4L 3WHXA 1SN5A 4R5TA 3WI9A 2YC1B 2OK0L 3OQRA 3QZNA 3ARGA 3UERA 1WFNA 4HWBH 4ABUA 5F1IA 1WP6A 3FB8A 3TA3C 1IM3D 4OB5L 4PJGF 2YUZA 3HI5L 4IMLB 3UIZA 4EI5B 1YYMH 2WOYA 1GS8A 5AYTA 3P9MB 2NNRA 1FL3A 3MBEC 3U7WL 4YLCA 2FWLB 3FONB 2NYZA 4LDOB 5AKRA 3UX9B 4XI5D 4L0ZA 1CXEA 2BSTA 3MV8E 4UWQB 2BP0A 5FOBB 1RSFA 5KVMC 2CKBB 2Z91B 3TA3A 3EOTL 1F3JA 4MAUL 1E5BA 1GYUA 3ILPA 3U4BH 4R8WL 4AYSA 2Y5QA 1B4RA 1DQTA 4YHPA 3G6DH 4OLZH 1E4WH 1IC4L 3AWGA 1D7BA 1YNKH 3FZUC 4LZKA 2MIZA 3K6DA 4RESB 5HGDB 4E36A 4DPBX 1J9TA 2DWTA 3LVTA 5ESQA 1LNUB 4GXVH 3TEUA 3MJ7B 3O45B 3CSGA 5DK3A 1WT5A 5L9DH 3ULVL 1YEFH 1XD1A 5CWSA 3WFBH 2HVBA 3DRTB 3AREB 4HOZA 2OZ4L 1S46A 1T7YA 1BZ7A 2FX7L 4HGMA 2YK1H 4PG2C 4ZZKA 4I1PA 2BS8A 1IC4H 1OXYA 3IDJA 1DZ0A 1HHGA 4MX7B 2UYLA 2VQUA 4X9IA 2ZWSA 4JQXA 3ASWA 2G0LA 4OU3A 3CLEH 5CLWA 2VXSH 3HE6D 2GY5A 3QA3B 3D39D 4JRLA 1P5VA 3L1OL 7CGTA 5I9QC 4V2BA 3BO8A 5GJSH 3NZ8A 3CLEL 1CLVA 3O0LA 4ZT1A 3MCG1 4XMLH 5B1JC 1DBMH 5SV4A 3SO3B 3V6ZB 3IPFA 2I5YL 4JR9L 3U25A 3LXAA 1J9RA 2LTQC 1I8KA 3BD5A 2VW7A 4N3UA 4ZOBA 3V4UH 3E6FB 1DUYA 2YK1L 1ZVYA 3C08H 1E9PB 3EG9A 2NDGA 1MNUH 5BQ7B 3OKLB 2WTRB 2WLIA 3QHTC 4CGUB 1F3DJ 4XNYH 3TIDA 4FZEL 5BZXA 1IBYA 4X98B 4YEEA 5JW4R 4BSJA 1R6VA 4PS7A 5B7FA 1KXTA 3PFUA 4JVWA 4Q0XL 3CPLB 2WBJC 1CD8A 7FABH 4Z7WF 1O6VA 2LT9A 4MAYB 2C1OB 3RDTA 4DGYH 1EDHA 4BZ1A 4XCNA 3S35L 4KXBA 5E7BA 2QZQA 3ES6A 1KTRL 4N2GA 3LN9A 4E41D 1DO5A 4WKZA 3VWJA 5TF0A 3MBWB 1TVHB 4N9GA 3NUKA 5D70L 1CD1B 2IQ9L 2WGNB 5EV7A 4BV1A 1ETJA 1J12A 3NRPA 2AHIA 3MFFB 2YGOA 1I9RH 5HDBF 1KIPA 1DVYA 3WFZA 3SDCA 1FA4A 3L4CA 3WENA 1B90A 4Z95H 4J5VA 2HN7A 4RBPH 4XPFL 4UDTB 3E8UL 3P9LA 4ODTH 4WWKA 1DBBH 3CSBA 2VZ1A 4MAYC 5IK3A 1K72A 1Y6KR 4HWBL 4R5XA 4L4JA 4HCRA 5BVPL 2XWRA 5AW6B 1FJ1B 4OZFH 2NY3C 5T5NG 3H0TB 4PJXF 1PY0A 1XGYH 2FJHA 2WVSA 4PJBA 2DQTL 1J8HA 3WGVB 3UBGA 1PY9A 4OLWH 3BP5A 2ZICA 4KUZL 1L9OA 5I5JA 3UTSA 1EAOA 4NWTH 3LIZH 5SWSD 1GCYA 3MV8A 4XR8C 4JM2D 3SSGA 5IIEA 4HKBB 3SDXB 1BW8A 1LO3H 3X1GA 4LLVB 4ZTOL 3CLFH 4P3CH 1MPAL 3QIBD 3A4EA 4QR7A 1YNLL 5IB5A 3L3HA 1KCBA 4JY5H 5EC1A 2GPZA 4Y4KD 5FO8B 4TVPL 5FFLA 4E9LA 1R34A 3ZHDA 3I3DA 1AOHA 3L5HA 4Y89A 3NFPB 3E3QC 3OB0K 4KJQD 5H8DA 4APQB 1EAQA 1ET7A 1WC7A 4DKFH 1I53A 2YN5A 4IRZL 2OMYB 5EO9A 5F6HJ 3X17A 1YLBB 3B6SB 2LAAA 3CVHA 1EO8L 4JFWA 4GEIA 1IC0A 1PDKA 1SXAA 2AMGA 1DJIA 1R5VB 4WSJA 1QUPA 1ORQA 2PKDA 4U1LA 3L4XA 2BW4A 5I0YA 1KIQA 5JQHC 1PPIA 2GI7A 3U46A 1FYTA 1RZFH 3M7OA 3RIFF 1U8IB 1TT6A 5AL0A 4OBRA 3QNZA 3P4OA 3T9WA 3TCLA 5HPMB 3A47A 4FQCL 4JCMA 2EUZA 1K4CB 1FNEB 3HR6A 4BELD 4ZFFB 3T0EA 3VWJC 1DBBL 3PUCA 3C87A 3FT4B 5F9WB 5I18L 1MCKA 4YZFF 1RJYB 4O51A 4QRSA 5JHLA 5IREA 4PGCA 4WF7A 3GSXB 2A7BA 2C4FU 4G5ZH 4Q7DA 5H94B 3VGFA 1EZVX 1NAMH 1BVNT 2YSSA 3IJHB 1F6FB 4TXVB 2MFNA 5AWNL 4BBWA 1XF2B 4L1SA 2WMPB 3I9PA 1DQDH 2ZKHL 2YOCA 2QLYA 3D85A 1T83A 4NQDE 4HMEA 5FYKE 3SQBB 3DI3B 5E2WH 3KAAA 4XNXL 5IR1A 2OTUB 2YAEA 3RGVB 3FTXA 3L17A 2UX7A 1CDGA 1FZMB 1N68A 3CXHJ 5C0FB 3QWNA 1YA5A 4QXTB 1JK9A 4YHOL 2VWEC 3RQ3A 2FCBA 2X4PB 3ELQA 1FORL 4KKLD 5HVWA 4J39A 2YARA 3R4DA 4JFOB 4EI0A 4ZX6A 3ARDA 1DVFD 4LLWB 2O5ZL 3S97C 1VACA 3PUUA 5HVHB 1ZRUA 4RIRB 3O4LD 4NUQA 4N0UE 2RMNA 3BCDA 3OG6B 5HHXH 5AOZA 1W8EA 4IGBA 4P0DA 1EH9A 2C7UA 5FHBL 1MFCH 2R69H 1NKRA 4PI2A 5HP5A 5CBAA 4ATTA 3CQFA 4PJEF 3P4NB 1X7QA 3CU1A 4PJCF 4O4YL 1KIUB 1MCDA 2WWKT 3EFDH 3PAVA 4FQQB 2R1XB 4PJ8A 1HZLA 1OT2A 5GZOD 3WN6A 1MHPL 5ANHA 4XNMA 3DBXB 3X14A 1XT5A 3OJMB 1QATA 5E8DL 3BRFA 5DTFB 1M4KA 1Z2KA 2ZP8A 1LO2H 4PREB 2VITB 4KRPB 3VB8A 5B22A 1TU2A 4CMHC 5HYJB 4G43B 3V6BR 1LDPL 3EJYC 3RGVC 5I6XC 1TO5A 4RWHA 1CICD 4JFYA 2DLHA 3RNKA 2DQHL 4NAJA 5DJ2A 2ZOKA 2ZP9A 3VGDA 2NPLX 1R0AL 4UBDC 2XKSA 1LO3L 2A0LD 1CR9L 5ACMA 4ODVH 3NQIA 2JB6B 3E6HB 3MGTB 4LSRL 4BZYA 5FUZL 2XUWA 1R3HB 3KE0A 4FXTA 4HZLB 4GW1A 1KG0A 3MPCA 4U3XA 3IAGC 1B0WA 1MLBA 3MLZH 3V0WL 5J13C 2B8OT 4D3CL 4F7KA 5DQJB 2IMMA 4RGMC 4U2ZA 1E3ZA 1EFXB 5CZVL 2HJKA 1TCRA 1ZE3C 3DJRA 3I9GH 4WDIA 3RURA 3VXUD 4AJYV 2ISDA 1BQHA 4JG0L 1L9SA 3SPIA 3OMNB 4UIKH 1JZ6A 1L3WA 4WW2A 2WCGA 1MFBL 4X7FC 5I0XA 5DMKA 3UTQA 3REVB 3NFSH 4JANB 1UZ8A 1N67A 3O6LL 2X4TA 4N1HB 4NQED 1NFDA 5L8JB 4GKOA 2AK4A 4NQEB 1KNOA 4F8QA 4O02A 5KVFL 3D25B 4GQZA 4O2EA 3LD8B 2CDEB 3MNZB 3CHOA 3NQKA 1BEXA 5F96H 4DKDC 4K94L 1MAMH 1X5JA 5GRYA 3NT0A 5I0ZA 2W9DL 5CKGA 1BF2A 5H35A 7PCYA 1BX2A 5FM8A 4BH8A 3D0VB 3BP7A 5GZOA 2PO6C 3UOAB 2DIBA 1UGNA 5IGXH 1ACYH 3DX8B 5J56B 5LHDA 3GMNB 1UM6L 3BI9X 3VWKD 2MH4A 2IWGA 4Y8DC 3ZYJA 2A83B 2PXYC 1T3FA 4MXQC 2XTSA 3O4LA 5DD1H 2ZOWA 1XEDA 4LEEA 5E9NA 2D4DA 2OMWA 3AXIA 1C5BH 1UGKA 4YHNB 3S3JA 2MOGA 3BWUC 5E6RB 2VR3A 2X7LA 4N0CC 5DMIL 2OSWA 3QDGD 4NENA 4KZDH 2VZSA 1G1YA 4L9DA 5EPMA 2RCSH 4TOYL 3AITA 5CIPH 3UZVA 3B2VH 2G75B 2GTZB 5J9PA 4LCCB 1TITA 2E7HA 3PFQA 4OGAD 4ES8A 4HHGA 1BOGA 1AMYA 1CFSA 4WEMB 5D2LB 5IQOA 3N42F 3DOHA 3VVWA 1SDYA 3EOAB 5L2JA 3DGGB 3B56A 1OGAA 2PYFA 2BW5A 4JHZA 3MRFB 4V33A 3KPOA 2CIIA 1P4UA 1T21A 4B3EA 4QHMB 2CDFB 2NY7H 2YFOA 5A3IC 4ANWA 2OMUA 3MXWL 3QK0A 5EZPA 1I9IH 3MRKA 3T0DA 3ARFD 3HC2A 3TP4A 3HPLA 3BPCA 1JZIA 3DO7A 1I7ZA 1EFXD 3HKZA 3MMEA 2N7BA 4G5AA 3BZEB 2VZ3A 5HTSA 1YNKL 4XC3H 2CZNA 4P04A 3SKOA 1EQWA 3DJSA 3PGCB 4DKAA 1QUNA 1T20B 3IDMA 3QQDB 5INDA 5I19H 4UT7H 2LU4A 5BJTB 3KCPB 1KCUH 3QEUB 2HX8A 3C8DA 5CZKA 4HA1A 5DJ8A 1U8OA 3JWNE 1T0PB 2K9UA 3L5JA 5KSBA 3EOTH 4MAUH 2ZSVB 5LG6A 4DQAA 2YA2A 4IRSB 2E27L 3LKRB 4X7DC 4PCTA 3ZDWA 3SDXE 5E1GA 2OR9L 4DQOL 3C5SB 4QY8B 5SX4H 4F57H 4NN7B 5AAMC 4YUEL 3CQPA 1IGJB 5I8KH 4P46B 1JZEA 4PP1D 5KANI 4L2LA 3TJEH 2CHDA 4QRTB 1HH9A 3D2TA 3I9GL 3PWNA 4PWEA 4G6JH 3JWNG 2VLMD 3BFWA 4OF3A 1ETA1 1NUGA 2BVQA 4B9KC 1KPUA 2OL3L 1QSEB 4YLBA 1H6EA 3CH1B 4BUGA 1UZ6E 2WUCH 3AY4A 1K5WA 1FFRA 3VXSE 3KR3H 5F97E 1U8PA 1WA1X 3UTTD 4N1CA 2YPLD 2VLLB 4OCMC 4N9OB 3BLKA 1CJYA 3WFEH 1KCRL 4BM7A 1RIHH 3STLB 4JO2H 5E4IA 2P7TB 3QHZL 1MKFA 1RPUA 3DUUA 3O8XD 4OVUA 2J4WH 1OF2A 4L2YA 5DRNA 4ZS6C 5ETUA 3C2AL 5CBEA 4KO6A 5CKAA 2WQAA 2OYMA 5AVYB 4D8PB 3NPZB 2ZNXA 3H9SE 3JV4B 3SE4C 2HT4D 5B7EA 4U0RB 1JN6B 2E59A 3ISYA 5AQ0A 3X12A 3G6AA 5DHYB 5HHQA 1J5CA 1CIUA 3X2QB 3LRGA 3UGEA 2QADC 2D3NA 4TPRH 4L8CA 4KRNA 4MJHA 4MNHB 3C09C 3GS7A 2NQ3A 1KCVH 1L4IA 5LNEA 5HI5C 2HFTA 1YY8A 4AV4A 1W0VA 4PRNB 5CN3A 2ATKA 2ROXA 3W11D 3EJCA 1AD0B 3HBPA 3S3DB 1FZJB 4IEFA 4UUJA 4NYLA 4Z8FL 2AW2A 5D93C 3NIGB 3DVGA 2VXQH 3INOA 4L37A 2A1WH 4G42A 4GAYA 4ZYKB 4GMTH 3K72B 3T3MF 1L0YA 3IU4H 3WMPA 2FSEB 2JLPA 5BZWB 4WQOA 4YAQA 8PAZA 3L08A 4Z3EA 4G6KL 1A65A 3QRBA 4AYMC 2GITB 4G1EB 1CLOH 1E2ZA 4X80H 1DYZA 1KC5H 4TV3A 1OE3A 2SEBA 1H3PL 2A9AA 2B4CC 3BXNB 3L6FA 1FAIH 3MV9E 4KK8C 5DZAA 1ZV9A 1N5AA 4LCUB 4JFHE 4Y5YC 3BD4A 4J3OD 3FTGB 1KENH 1YMHA 2MNUA 1LE9B 1CO1A 4HIEB 2AFNA 3V6OA 4OGYH 3BVUA 5DZLA 2MCAA 1MVYA 1N5YH 1SBSL 1YEKH 1WH0A 1AZVA 1PS3A 4RX4A 4KOCA 1NMBL 2OMZB 3D39B 4PRID 1O5DT 3EYSH 1T2XA 5L6YH 1TZAA 5GGVY 3BKMH 1DQQB 2BSCA 4ATWA 1RZKH 2AERT 3ULAB 1J9QA 3C8KB 3HI6L 5I16A 3ZK0A 5SX5H 2HX9A 1NLDL 2I9LB 3QVAA 3FQ4A 4KK6C 3KNBB 5ICYB 1N6VA 4EI5A 3LKOA 4KBPA 4AT6B 2G2PA 3GRGA 4QCIB 1RP9A 1E9OA 1QI4A 5MERB 1BFOA 5IROA 4L1BA 1S9WB 1SM3L 2ERJB 4JZJB 4OJAA 2BSED 5JPMA 1TSRA 5BRQA 1F18A 3QDMD 4KTEH 5E4EB 3OQ3B 2YWYA 5DUPL 1L7IL 4AITA 3P30L 2BOLA 5I76A 1RMFL 4WFGE 1PSKL 2K1MA 5D8JL 4TSBH 2DQCL 2HLAB 4IJ3C 3L3JA 5C0GA 3PV7A 3NK3A 5BXFB 2P5EA 3VD4A 3CLWA 2MPAH 2P42B 3NPSC 3ZL4L 2NQDA 3KYOB 4PVLA 2UWEB 4LPWA 1YPZF 2DLFH 1MDAA 3AMLA 3SPCA 3GYRA 4HOXA 1S6NA 2W94A 3BE1L 4APXA 1A6ZB 4M1CC 1QACA 2ZAIA 5JW4M 4DK5A 2GQHA 2W91A 3L3OC 4OZGE 1RJLB 3TV3L 5F7HA 2VXQL 4MD5A 1U8HB 2W07A 1HIML 5EN2A 2VKWA 4PWJA 2EDLA 4QYAA 4XPBH 4J4PA 4PWGA 4ZO8A 2J3SA 3UDWC 1KB5A 2WWMD 1U3JA 2CO7A 3ILQC 3QC6X 1IBGH 3TBWA 2WN2A 4NO0D 2DJ4A 4TSBL 1HX0A 5GS1C 2EDNA 3UTSE 5EOCJ 3R7QA 2DD8L 2CCVA 3ARGD 3D34A 1RZKC 1ZIAA 3LJ3A 4ZUSA 2N1KA 4M8QA 2VRKA 4HPYH 4IRJB 2LQRA 3EO0A 1QPPA 1E27B 5T33L 3FU3A 3P69A 3T1WA 4PRDA 5I1EH 2HG5A 5EZLA 4RMTA 1A1NB 1QFUL 5GRJH 5BUAA 2GYSA 3ARYA 4I4WA 1IGFH 4NAMA 1ZT1B 4AUJA 3O6MH 2H3NA 3V0GA 12E8L 1SHMA 4JPKL 2BZCA 5EF1A 3P30H 1ODUA 2QSCL 5TFSH 2A6DB 3NJNA 1DJWA 1YEIH 2N3JA 4JO8A 3D4CA 1AXTH 1OTSD 4GJTB 1L6ZA 4OCYL 4A7UA 4WSKA 5F7NC 5CR1A 2WYIA 3RI5F 4BKTC 5L8KB 3FT3B 1AIFA 3CPLA 3HG3A 4GNKB 4IBVA 2OR8A 3WL9A 3QG7L 1KN2L 1IKNA 4HQQL 5D2LE 4G9FB 1Q9OA 4Q97A 3TVMC 1CLZL 4ERSH 3ES6B 1OB0A 4F8OA 3DIDA 4KVNH 3FCSB 2IQAA 3WIHH 3M07A 2BC4A 1SJMA 1OAKH 2OMXA 4KRMB 2WYHA 4H8UA 3RGHA 1EEZB 4ODHL 3ARDD 4E42A 2X2IA 3AQZA 3GTNA 5HYSA 3PL6B 1KTLA 1G9NC 1ONQA 5GJSL 1ETB1 4PJAF 4FADA 3ULUL 3CSYB 3OZ9H 5BRZA 2P8MB 1KGJA 5B38A 4U7SA 3CC5A 2LFEA 2IIJA 4WTQA 4LRIA 5FYJD 1YEDB 1AJ7H 3RDTD 3FB5A 5JUEH 2D7OA 4Y4HC 4CMMA 2HZHA 2DW5A 2GBAA 2X2JA 3UAAA 2VZOA 1XCQB 4ANVA 2ZIDA 1OD7A 1RK1B 4MZRA 5IB1B 5FUZH 2B1AL 2WTOA 1A4JB 4Q0XH 5HJ3B 1CK0L 2ADFH 5LWYL 1NCBH 3AWEA 4IDJH 1FV1A 4AH2A 3N91A 4WHYH 3F8UB 3HC3H 4BE5A 5KZCB 4FD0A 3IFOB 1ZLVH 1F90L 4FMKA 3RX7A 1TNMA 5GGRA 3L3KA 5D7LD 4NKMB 5ICXA 3C5ZD 3V0VB 3T65A 4F7TB 2Y1YA 4X6CE 4RAVB 1EMTL 5DJCB 4CUCA 4H8WL 3MODH 3RJDA 5KANG 1IV8A 2COVD 5HYFA 4P4KC 5GGVH 1GC1H 1V3KA 3KGUA 3TBYA 3KPSB 1UEYA 1UXWA 4W9HC 1BJ1J 1TVBB 3BAJA 4BFBD 4ANUA 4IU2A 5E4AA 2OV0A 4AZ8B 3WTSA 3C12A 3EFDL 4A2LA 1PDKB 3SE9H 4OZHA 2JKRM 5D1XD 1WZAA 5ERWB 1NC4B 4BWUA 1EXUB 4OJFL 4C4UA 4HC1A 1RUKH 1OAUH 2GB2A 4KRPD 2CU9A 1IKOP 5D71L 4E2OA 4ZX4A 4JFED 5CGTA 1UACH 1K4CA 1FRGL 2FYYA 3RUGF 2PNDA 1KCSL 3FTWA 3U6XS 1QNZH 4UTAL 4LNRB 2YKLL 4W9EC 1F11B 3BJ91 1MI5E 2XWEA 4NKQB 4B9FA 3WEMA 5F7DA 1X9LA 1BD2E 4KNUA 4YDMA 5LXGL 1IQDA 4ABWA 3KWTA 1ADQA 1E7UA 5GGQH 5D9SA 2JIXD 4ZPVA 3O3BA 1JZGA 4CW1B 5CUSL 1A22B 3B3IB 1MHCB 4NHUB 3D48R 1RULH 2QQLH 3MLXL 2APFA 4H25A 2OXGB 2WQWA 1GZQA 1QFUH 4BQCA 4FNSA 1HK6A 3QJVB 3AU1A 4MXWL 4QWWC 2P8PB 4YHMH 3MA9L 5GJTH 5DJXA 3GSVB 5F7MC 2COQA 3KPMA 5A2LH 1UWFA 1ZJAA 4O9HH 4UT7L 3VXMD 6FABL 3OKKA 4F2ME 3CGTA 2Y25A 4HAKA 5ITBH 1NBQA 5JW4Q 2UZXA 4XP4L 1OW0C 3QDHA 4LKCA 4E68A 2A4EA 2G3XA 1CDJA 1CIDA 4WWID 1RIVH 5HYJE 1NDGB 4AC2A 5SWQB 4LLQB 2DM4A 3RJOA 4M5TA 4MNGE 5AAWC 1P7QB 2WW8A 4K94C 4DESA 3MCLL 1JHTA 5LGYA 1HI6B 5B1KA 3KPLB 3CHRA 2NSMA 3TBVA 4NN7C 1UB6A 1MRCH 4IBTA 4UIMB 3K8LA 4HWZA 2O93L 4ODXB 5JZ7C 2Z35B 4M61B 3DETD 3L5IA 4Y4HB 5E5LA 4RRPG 5IHHA 1CVRA 3GTVA 3UZQB 4D0CA 1YNLH 3Q05A 3LQZA 3L4YA 5F0JB 2IDQA 2F19L 4S0TD 2YAPA 1R3KA 2DQGH 3SJVD 5TQ2H 4A2EA 4XNZB 3PPEA 2VAAB 1ACYL 2CAKA 1I1YA 4LOVA 4KZDL 1B3IA 5TQ0H 3LS4L 2ZUXA 3VI4F 4GAGL 5B4MC 3TASA 5T3XE 1L0QA 2F5BL 4XZUB 5B8CC 5CLXA 5HGAB 4B50A 5E8NB 1TCRB 4MJ4A 1QSED 2G3ZA 5FYKL 1D9KA 5F88B 4UQCA 4UNVA 3SYAA 4C56A 2IAND 2X40A 1OK0A 2JFCA 1EK3A 4DHLA 5CJ5A 4IU3A 4MZ3A 3UDWA 3VFRA 4V1DE 2BCKB 4HU2A 4JDVB 2PN5A 3LDBC 1RUQH 2BSSA 5FYJU 4KROB 2X70B 1B4JL 3QJHA 1KEGH 1HHIA 2VR9A 4H8PA 1BBJB 3U1SH 1IAMA 1UA6L 2WKGA 2XV2A 1F4WL 2G0KA 3AJ7A 2XACC 2IWKA 3DV4A 5EU5A 1SUHA 1I1AB 1YECH 5EUOB 5CHNA 4HEMA 3JUYA 3LRSB 5GRXG 1J8HE 2XRAL 3IRZA 4W9IC 5HYQB 3ULUD 4Y4FB 2FT7A 5BMFH 1GY1A 1MVUA 5JHDB 2E74C 2VO8A 3SE6A 5C0BB 4OUUA 1QFHA 1BBDH 5DQ9A 3IT8D 4AXWB 5EIIB 1GIGL 4WGKA 2FNWA 5HHPA 1GOGA 3NDZE 1IZKA 4KNSA 5CSZB 3ROOB 3L45A 3UBFA 3VFWA 3EO9L 5IW1B 3NZHH 2ATPB 4H8VA 1FC1A 4YPGA 5C8JB 4OZIF 1IKNC 3NCCB 4HJGA 1J48A 2Q8BL 2FWOA 2VSCA 2R23B 5BZDA 1SXNA 2AJSL 2IV9A 3T0WA 2YPLB 2CXKA 3RBGA 2LOEA 2Z6FA 1BAWA 1CI3M 5GRVL 4JM2C 4Z7VE 4PGEA 1HNFA 1JPEA 1JZ7A 3ZE2E 4P5MB 1YAIA 2FX8L 4HK3N 3NEEA 3OTTA 3PWJB 3VWKA 1OGPA 4G9FE 1G6RB 2VSMB 3EOAA 2DAVA 1EJOL 3D0LA 2FX7H 4K3JH 3PABB 1IVTA 4YVUA 4F7PB 2JV6A 3V7AE 1FL5B 2VL5A 2YPKB 1UWXH 1FG9C 2C9XA 1BBDL 4DPRA 3QDJE 4UV7H 1GRWA 2PYED 1WK0A 2PUQT 4Z0XB 1OK8A 2ZG3A 2GC7C 2OSXA 4BUQA 1L5GA 4UYQA 4WUUA 4NQCA 3FUMA 1ZMYA 1Q1JH 2ZX6A 1IM9A 4OFPA 1NCHA 2R69L 1R4XA 5FA4B 5I1IH 4NDMA 2DJSA 1IM9D 4M8VA 4XNUL 4G7YL 2ZWZA 4FFWD 2HPOA 4XCFH 4YQXH 2BNQB 2GJPA 3S36X 1JV5A 2BNQD 4UQ3A 5AUMA 3IVKA 2PO6D 5BJTA 2GHZA 1OOWA 1MELA 4WI0A 1KMGA 2G30A 3H53A 3ATEA 1QR1A 4Y19E 2D4FA 3CN3A 3FCTB 5B1JA 1Y0LB 4PJIA 4ETQA 1A9EA 4NO2A 3RVVC 1XCTA 1LO0H 4L3EA 2F1AA 5C6TH 5C0CA 4GIAA 2O72A 3LV3A 1OCWL 3MLTA 3UO1H 5IMKA 2A74A 1EUTA 1R3JA 2XTJE 3ZZQA 4F7MA 4NGHH 1N2RB 2HA1A 5CJQH 5EZIL 5JIMA 1NDTA 3OKOA 4M93C 5BO1H 1X4XA 2AQNA 5KS9E 5EF0A 3MGOA 1PMYA 2XPGB 4XGZA 5FR3A 4YBLB 2M83A 3IDIB 5E00B 2QFPA 4M3KB 4NFBA 5LN8A 1QBLL 5EG6C 2DWSA 4CA4A 5JOEA 4U6XA 3QUXC 2YAMA 4TN9A 2NOYA 4RFNB 4J2QA 3N41B 1QHQA 3EDKA 1RHHA 5E6IC 1TNNA 3MRRA 3GMQA 1O9VA 3CZFB 3T3PF 2WLKA 1N0LA 4XO3A 4A2GA 2PTTA 3UG5A 3TO4D 3DOIA 1JIBA 4OCSH 1YYCA 2H8PA 4MSWB 4ZMLA 3RWHB 1K85A 2HSIA 3EYSL 5A2CA 1T6WA 1ITBB 1JZDC 1SDDA 2C1PA 4I13B 1IM3A 3E9TA 5HYSG 4AJ0A 2C4XA 1Q0YL 1IFRA 4DOHB 1CPUA 2DBJA 4R84A 5EZOL 2IDCA 2JCWA 5GS0H 2XKNA 1D6EA 1P0SE 3ZTJH 4DSYA 4X4MA 1H3XA 3T2PA 2KH2B 3CK0H 3WSQL 3CVCA 4NZTH 3LQAC 4JG1L 3DKHA 1K6QL 1UH4A 3IXTB 3MRDB 2W80C 4ANKA 2EDWA 1VCBC 1A8ZA 1E5UI 5F7WC 1S9VB 5D7IB 2P5WE 1J86A 4NYLB 3V0JA 4WTZA 2D2CC 3OR6A 4ODSL 3Q06A 5E51A 1UYWL 4HIJB 4N6RB 5I1GL 1MFEH 2YD0A 1X44A 3IU4L 5KS9A 4KZ0A 5JW4N 3VQ1C 4JM2F 2NY2D 5SX4I 2DIJA 1N64H 1KLGA 4NKOB 5DD6A 1YEEL 4AEEA 1I8AA 3NSDA 4M7LH 4D9RE 1UXSB 1XAKA 4I89A 4ZMVA 1Q9WA 3KPNB 3O6KL 4WI6A 2M1KA 4U1JA 1CLCA 3ZKSD 3ZO9A 4YSCA 4U4IA 3Q0HA 4AC4A 1AH1A 1EEYB 5TDOA 3AC0A 1YC7A 3Q5YA 3MKKA 4W9LC 1INEL 1U8KB 3F64A 4X6CF 3OKDA 4U1MA 3ZBMA 2XWDA 4OLZL 3NBNA 3VGEA 3QXAB 2V5TA 3DV6A 3BXNA 3L6FB 4RA0C 3WIIH 2RD0A 1N5AB 1ZVNA 2B08A 4LCUA 3IJEB 4ZNCD 3ULVE 1UKQA 3CVBA 3A4FA 3L3DB 2J5LB 3WJLA 1S7QB 3RZCC 3GJFH 4X8JB 1SFDA 1YQ2A 2R0WH 5B4MD 2V9RA 2HPTA 1JNNH 3O8XC 1WBYA 4ZAKC 3QUZC 3VFOB 1MEXL 2NRDA 4NJAH 4NQQA 3T1FB 5L2KD 4WU5A 4OCRL 5E24E 1HKFA 2V8LA 1UOLA 3K5RA 2P43B 4JHBA 4XP1L 4AOFA 5CD3A 3ORJA 1S5HB 2DQDL 3PJLA 1GYWA 2DJMA 4I1RA 1N4XH 1RU9H 1GYAA 5ICYA 1MNNA 3LEYH 4N0RA 3S2CA 4CU6A 4PG2A 3J7HA 1MRDH 2F68X 3UAJA 2NTFB 5IESH 3S88H 3VFUA 1KYUA 4P23A 1TQVA 2GK0B 1J5DA 4P5KB 3K7UA 4R7DB 4TTGA 5DD3H 2OCJA 4PJ9C 3TH2T 3VUAA 2H32H 4CVWA 2ZWNA 4LCVA 4XO8A 3QORC 3G5WA 2OA9A 1JWSA 1EHKB 2YXMA 3U83A 2PPFA 3L3JB 3UEZA 5EHFA 3ZMRA 5JPNA 2R2EA 3SKNB 2XWTA 3VXMB 1AZUA 2FJGA 3WTYA 3KLHD 2YJQA 1RUPL 1PNDA 2OZNA 1UD5A 4LIQE 5EEXA 3T04D 3AREA 1GVIA 4PLKD 4HKZA 1KB9K 1TZIB 3ET9F 3N55A 1GC1C 4M9OA 4JPSA 4LHJB 4OKVB 4D9RD 5IMLB 5EO1B 3KPTA 2ADIA 1UURA 3HNSL 5TD4A 5C92A 4JB9L 2W07B 4JJOA 1CB4A 1CC3A 4WCYH 5EN2B 1BM3L 4KKCD 3WYRA 4AEHH 4BFIB 2VMCA 4AMKL 4CSTA 3QHFH 4PJAA 1NGYB 5L0QC 3K0YA 1AC6A 3FU8A 4JFUA 3B4NA 4NN6B 4DUVA 4WCYL 2OULB 4WTXA 1VCAA 5FPIA 1ORSB 3INUH 2B1HH 1O6SA 4KGLA 1JV2A 1TR7A 1JERA 4ZUWB 2VB5A 4YE4H 3C60A 5DT1H 1W9XA 4N8VA 4M56A 2EC9T 2JCCA 3R8BB 4N90E 1QFWM 5L2KA 3M7FB 1BDYA 4PV8A 4F2FA 4I4WB 3P2DA 3RTLA 4FEMA 2BVPB 4QLRA 2ALWA 5EF2A 1JGLL 2DQCH 1BZDA 1T7VA 4WK2B 3RUGE 1CFTB 1HSBA 3SGKC 3F7PC 1JF5A 4HQQH 5LGHH 1JF1A 5H2BA 3GUTB 2GIYA 2NUTA 1SHSA 4GSRA 5E56A 1AOZA 3QNYA 1WWAX 4OUOA 3CSPA 1GMIA 2JXMA 4O4YH 1SEQH 4MRBA 4WKZB 5J6GA 1OGAE 3DX6A 4ODHH 4S11A 3FQUB 2K4AA 5K69A 4DF9A 2MPVA 5E2JA 2XX1A 2BP8A 3GSRB 3JZ7A 2WZ0A 1WIOA 2OTWB 3PDDA 2CO2A 1I85A 2KC0A 3NABL 3PAZA 4UQAA 4EKXA 4P4RA 4PS4H 3KWVA 5HHMB 2L8AA 5FFOA 1NAMA 4Z77B 2AEIT 2VUOA 4O5LH 1UOKA 4E0RB 1ONQB 4TL5A 2HVKB 3MAWA 3OKMA 4RISL 1JFQH 2H3KA 3B2MA 1RCYA 5EOQH 4FLOA 4CVZA 2E86A 4H88L 2VXTH 2VABA 1HINL 5TGBB 3L4TA 4E9VA 2QHRH 4B9PA 4F27A 3NEOA 2E9WA 2V3DA 4YK4C 3MBEB 3RYMA 3SDXA 4S1SL 3WY2A 4BSVB 5KVFH 1A7NH 3D33A 1R3IH 3HMXH 2IAMB 4RQQA 1NBCA 1WISA 3U0PA 3U2IA 4MWFB 4WFHE 1JL8A 4QXGL 2QPDB 3M17B 4UAOB 3T0XA 2PWEA 3BWAB 2Q8AH 2R51A 4GRWE 1YUHB 4A2DA 2DWXA 2QADD 4BSWA 1FV1B 4AH2B 1UD3A 3I2CL 2FR4B 1F4XH 4E41B 2PYEE 1OY3B 2CR3A 3CFIC 3MVSA 1WC7B 4M43H 4MB4A 3DSFL 5ILTH 1L6XA 1TJGL 1AQKL 3EJJX 3O6FD 1NCGA 4QRPA 4OBSA 5LBSL 2B77A 3B6SA 3PS6A 4WKXA 2Y72A 3HG4A 2LGNA 1HINH 4NB7A 3H6AA 5DMJB 1PG7L 5LNDA 1ZSDB 3SJVA 1BZ9A 1KCVL 1JCKA 4MZIA 1R5VA 3NIFB 4YSAA 3TJPA 4YZWA 2WQSA 4BKLB 4JGNA 1OP9A 3EHBD 3K2KA 3GI9L 4PJBF 4N0FA 4F1ZA 4B96A 4GPVA 5HPMA 4NCC2 2PP7A 3CN2A 1FNFA 2P44B 1EXUA 5CS7A 4WFGD 4C56D 2R2HB 4MBRA 3RX5A 2WXHA 4Z7QB 1X5XA 1YJDH 1FPTL 1OCCB 2AV1B 2FATH 4LT7A 2B4CH 5IFHL 3Q1SH 3G7TA 4H88H 4KK8D 1Z3GH 5CIPB 4PLJC 3O4LE 3HRZB 2WNGA 3WS3A 3GSNH 4FCHA 4OIFA 5E5MA 3D3VA 2AGJL 2VN4A 3QRGL 3ZKXB 1WCBB 3ULSA 3A3YB 4XX5A 5AVRB 1RZ7L 1AY1H 1Y1DA 4NPYB 3ULUE 2M8XA 1HAWA 4LSVH 3LKNB 4JPWL 3NZHL 1IQDB 4JREC 1GYCA 3GWJA 4NBZB 2EDEA 2ZUVA 2WC7A 3WIHA 2HAZA 5D9SB 1MJ7L 3IGLA 1JK9B 1UA6H 1THCA 1MW0A 5I1HL 5IQMA 1G7IA 1XF1A 4PP1C 5AOKA 1OGAD 1NGXB 3P0VH 2ICWI 2HJFB 32C2B 1T0NA 3N1PC 2VJ0A 3B8YA 1IT9H 1UB5B 4FJZA 5D7LA 3WO4B 4G8FA 3DVFA 3OX8B 1LEIB 5IFJA 1NFDE 5IVNA 3VB9A 3A4AA 1I9RL 4HS6A 3MRPA 3AU1B 3UO8B 5IWLC 1AVAA 4JJ5A 4YSDA 3Q6FB 4XBGA 4JN2B 3WHXB 4Q9QL 3FQYA 1KUMA 4JFDB 4RGOL 4YVNA 3L4VA 4G8GD 1E4KA 1LMKA 1J8KA 4LQFL 3X11B 1JGLH 1ZA6A 2BVTA 3O3AB 4TYUA 1XX9C 1KXQA 1BLNB 4M48H 2Y6SC 2JQZA 1UT1A 1YEJL 5T3ZE 4QRRE 3U30C 5JW5B 1JZFA 1RURL 1CL7L 1OCRB 4RGNE 2OQJB 1NGQL 2XWZA 2I26N 4I0PB 4LLQA 4MA1C 5FOBA 3S5ZA 1WCQA 1G0YR 5K9QI 3FU7B 5FKAA 2Z91A 4ZMZA 1H0DB 4NRZA 3QEQA 2QSVA 4QYOA 1F3DH 3MACL 4HV8B 1E4XI 4X7TA 4UIMA 5E9DA 3HUJA 3PAYA 2ZOKB 4TUKL 4OFDA 4LK4A 4M61A 4Y4HA 2Z8RA 1MF2H 2AZAA 3B7YA 3KPRB 3F7RA 4TNEA 4P9HH 4U6YA 1WTLA 2J4WL 4I3RH 3L9BA 4H13C 2YQ3A 1FH2A 5LKNA 3U7YH 1EDYA 2ENQA 4WFED 1R3HA 3WNJA 1SXCA 3ESVF 2ZXBA 3B2VL 1CF8L 5G4MA 3MUZ1 4ZFQA 4A6YA 4XMPL 4X4KA 4UT9H 1UEMA 5J3HC 1H5BC 4PJEA 4RFEA 1I1YB 2E9JA 3MCKA 4WDIB 4AIEA 3AGVA 3SCMD 2L04A 1QLRA 4UTBH 4XXWC 2RJMA 4GEJA 3SCMB 1CICA 1LHZA 1X7TA 4LVNC 3BPOB 4XZUA 4WW2B 4MS8C 1Z5YD 2XN0A 5E6ZA 1WWCA 1WUZA 3IS1X 5L7XH 2XV0A 1OWWA 1HHGB 3A6OA 1QR4A 1GTFA 4FTVB 1CLYH 4NQEA 1KXVC 3EBAA 4K8RL 5I26A 4OLVL 4R90L 3TVMB 3KLSA 1FFQA 2OR9H 2JJSA 4GG6F 3KPRD 3K1DA 1JWMB 1NCDL 1YDPB 2BNUA 3BEVA 4XAWH 2XRAH 4Z7UE 2NNAB 4G8GA 2Q6WA 1JD9A 3QUYC 1CDBA 1JAEA 1FLRH 4WEBH 1GTNA 3O11B 1NTDA 1QW9A 3NIDB 5L4FA 5J6SA 2HUEA 4G6JL 5CFHA 5CN1A 3E38A 5C2BH 1QFWI 3I50L 2JF1A 2B2XH 3MV7A 4L8SC 3BSZL 5EUOA 5CILL 5IHUH 4AEIH 4R9HA 2CBPA 4WSGA 1FGNH 3ZDYB 4MQ7A 3VDAA 3QFJA 2DICA 4UV4H 1U8LA 3ROLA 1II4E 1FL6B 1A7BA 4ZFOL 5C1MB 4I18A 1E28B 1TZHB 3TZVD 4L8SA 5GSRA 3QW9A 1G5AA 4PCKA 4PWFA 5CEZL 2WQUA 1CS6A 3CFKB 4GLRH 4LL1A 4X42A 1FRGH 4OF7A 2XQ0A 1XF4A 4CVUA 4FCAA 3V95A 3N6YA 5CSZA 1UH3A 3ROOA 3ZKQD 1MJ8H 4N0CD 3BN3B 3GSUA 1H6UA 2E8ZA 1XIWB 5J9PB 4WY7H 4JPQA 2R23A 3SBPA 1BOGB 3DURB 2YPLA 4LB8A 1JXKA 3QWOA 2G5RA 4EVNA 2CPCA 5FAAA 3MUGA 1YEGH 1HH6B 1TEYA 1CLYL 5CR8A 1J1XL 1MW3A 2A5UA 2P5WD 2Z1KA 3EFFB 3NG5A 4L4VB 4P9HL 1FG2B 2EEAA 1DSFL 2BNRB 2OSYA 2CO6B 1OIOA 4HSQA 4BHUI 5LCVH 1MCFA 1NMCB 3L1FA 5J5EA 1NM9A 1T21B 2YJLA 2Y0SA 4HFWB 4EBQL 4OZIA 3FN0H 3LPWA 4LVHB 4LGPB 2GJ6B 4NKDB 3HPLB 5I6PA 1IL1A 3OAYK 4IJ3B 3FCGA 4P4KD 3QH3A 2DWEA 1L9NA 4HKBA 1A6TA 2NTSP 4BQBA 3B9DA 4F7CA 4AL8L 2WINB 2RAMA 3DROA 5E4EC 2FIKA 4PSRA 5M7QA 1M57B 5JHDD 3MUHL 3QXDA 3ATFA 1OL0A 4YHLH 2G60L 4QRRD 5FO7A 3STZB 5DEFA 2GBTA 5EC1B 3X3GH 2A6JB 4PRHD 5K9JL 5G5DA 4LRNH 4APQA 2DQEH 5AW7B 2CRYA 3ULVF 3PP3H 4QXWA 3VDCA 4C83A 3CDYA 4UQ9A 4WI0B 4EDWH 2WBWB 1PBYA 1WO2A 3FK3A 5DYOA 3TONA 3N44B 4HUXB 5L9DL 3W81A 4OT1H 5ISZB 1KT2B 5EOCL 4BFFA 1C5CH 1R19A 1QBLH 2CLVA 3MLTB 4U7KA 2BVQB 2X4RB 4POUB 1E4KC 1FDLH 4JO4L 4KKPA 3WJJC 5AB2A 3P4OB 2FQFA 4IIZA 3HLAA 2JKNA 4GG8A 4R2GB 1E6OL 1K8IA 2AXWA 4R96A 4NQEE 1JPST 2ZF8A 5EWIL 3NSFA 1RJYA 1QFWH 4K71B 3WKYA 3CHSA 1CVSC 1NMAH 2CJ3A 3BOVA 5H94A 4U49A 4FFVD 3UCQA 1E5ZA 1U4EA 2CNYA 5DUJA 4X0KA 3HI5H 3HS0B 5ITFB 4CSSA 4H0LC 1XF2A 3CZSA 4DW2L 1KN4H 4FNQA 1Q9KA 4PRIA 3VYOA 2V37A 3HAEG 4EZLA 2JELH 4NLAA 4XNUH 1M9WA 2CG9X 3VGAC 3BHBA 4L29B 2V5YA 4HU8A 3MNWB 1K5NA 3K8MA 5CZXC 1ZHLA 4HUVB 1NQBA 2J5LC 1CQKA 5HXMA 2NXYC 2PCPB 1NBYA 3QO0A 1OP5H 4OFKA 2QSQA 4B0MB 1MCRA 4R0LA 4FTVD 1EEUA 4YWGL 1NCAH 4H40A 2X4PA 4GAJL 4Z9KB 1EHLL 1AZCA 4Q4EA 4XP9H 3HG1E 5A7EA 4U4BA 3GRBA 2XKNB 3LD8C 2FUQA 1U6AH 1FFOA 4JFEB 5DZVA 1M6OB 3WY1A 5FEBA 5HY9A 2DM7A 3BH8A 4TLTA 4RIRA 5FYJL 1PLGL 1HEZA 2BFVH 4IOSD 3GXUB 3G5YA 3CNKA 3LZRA 1E2WA 4J3WA 3H2PA 4Y5YA 3WNIA 5CBAB 1MUJB 1OT1A 2CD0A 1YN6B 4NM8H 4P2OB 4FTVE 4MJ6A 1N3NB 1KFAH 1WA0X 3TA4D 3DWTA 3FCUB 5AW2B 4PMFA 3OJDB 3SDDA 3BPOC 4RZKA 1JPTL 2HTLC 3CZEA 5E0FA 2P8LA 1S9XA 1NH6A 1QFWL 5BOPA 3I6SA 5EWIH 2JJTC 2VERA 4TL4A 3BUDA 3EGSA 4XP4H 5F3BA 3U0WH 2R69A 4V2CB 5EC2B 4EUPB 4ZZFA 1IAII 3EJQA 4NC0B 5GZNA 2PCFB 1QPKA 4P3DA 4UYPA 3TF4A 1YEWA 1TU2B 6CGTA 5HYJA 1UD4A 3OKDB 2ESVA 3GRWL 3WJJA 1VGEL 2JCCF 3AAZB 3ALPA 3TH3T 2EXWD 2EP6A 1O9ZA 1IBDA 3H9YA 4IBYA 4A7GA 2X89D 1HOCB 5ICUA 3OAYH 3N40P 3PHAA 1A1MA 1CQYA 4PJHE 1M3JA 4ODBD 3P9MA 2VR4A 5F1NB 4GO9A 4H2CA 1X4ZA 4NCC1 4WO0A 5BQDA 1QZ1A 2BSTB 3L3GA 4M5ZH 3RZCB 1KV3A 2CKBA 5DQJA 5K9JH 1LILA 1SXSA 1IKFL 4A7SA 3S9DB 2W81C 3ZYOA 1ML0A 1ZOXA 4DPAX 4J3OG 4X7SL 3N1GC 4P2QD 4DGYL 3U0WL 1UG9A 1KEGL 1S9WA 2WKOA 1H3UA 5JDSA 5TQ0L 2IBZX 1JGIA 1L9TA 2UY7B 4YBLC 1CE6B 4OW6A 1CBVH 2XA3A 2Z0BA 4UAHA 1BVKA 2NY0B 4OCNC 4ACTA 2OPCA 4P23B 4F9LA 1ZXKA 4TSCH 1B2YA 4R7DA 4UOW0 4EEEA 3QWQB 4PRHE 3EJRA 3NZUA 4NO5A 5D7SL 5HDQH 5C07E 3SY0B 5BXFA 1KIRB 3H3BC 5T3XD 1YUKB 4M5ZL 1WQVT 3CIQA 5FYKU 4PH8A 5F8RC 4CN4A 1OTUD 1C12B 3B2XA 4RVBA 1N6UA 3S4SB 3NRQA 5T1MB 2VQ4A 5FFGA 5H35B 1U6AL 3FO2B 4OJYA 3BZFB 2FHCA 3BP7B 1BMWA 3GSNB 5DHVA 4PS3A 2ICEC 5KW9H 3BWZA 3DX8A 2Z8WC 2BHFA 1PKQE 5CSGA 2NLJB 3MQIA 1RVFH 5HI3C 4PIRF 3AQDA 3F6IA 4KAQH 4EI6A 4XCCL 3E80A 4JHAL 4MD0A 1A7OL 4KUZH 2WLLB 3IGAB 5EO1A 4OLWL 4DKFL 5BS0D 3RWCB 5HGHB 5E2TL 5INCA 3IF1B 3EO0B 4GO6B 1FE8L 5DRZB 5JZ7D 1RXLA 5GHWL 1I9JH 5GRUL 4L48A 2QPFA 1HXMB 1E9PA 1UOVA 2AJZB 4I9WD 1PEZA 4IDJL 4QTHB 1CK0H 5T1KA 3SIKA 2YWZA 4GMSL 3BDXA 2VXQA 2YEZB 2PWDA 3UZVB 4BYHA 5J0BA 1GGYA 1JSYA 3R0MA 4GKNB 5ADPH 2E6QA 2VDNH 4QT5A 4JVPA 4PEEA 3FMGH 4KJPD 4ZTPH 5K9OB 3AADB 3VI4A 3TN0B 3VXME 3PWPD 3D4GA 3PNRB 3TN0D 1KJVA 2B59A 2RFXA 2VM3A 2K70A 3NAAH 1OGAB 2PYFB 2J6EA 1MCCA 4O9HL 1HSBB 1KJ3L 3MRFA 5EOQL 3DJTA 3QIWB 4HFUL 4XPAL 1QEXA 4G7VH 2MCG1 2CIIB 2DMHA 3MBWA 4XP9L 3RLSA 2FT8A 3DTXB 4NRYB 3BT2H 3QR0A 4L3CB 4DKEH 2YGQA 5DR5H 4G9FA 1YG9A 3LSOB 1P7KA 5F1KC 4NI6A 4QHLA 1KIPB 1VFUA 3BKYL 4HAFA 4J3VA 1CGUA 1REIA 4UINH 5IV2B 2AQ2A 5B38G 4JPVH 4MNGA 3QXUA 5IHLB 1TQBB 4M29A 1LMIA 3BN9C 5T1DL 5BVJB 4FS0A 1DQJA 3L7EA 1XGRB 3U4AA 2GSMB 3JVFC 4OKDA 5DJYA 1PX3A 3D50A 1HTYA 4PLKC 4D7BA 1U8OB 4UOW1 1SEQL 5ABZA 3DA0A 5JIHA 3SE9L 3WEOA 2AJXH 2F58H 3QUGA 2BMKA 4AQ1B 1HC1A 5KVGE 4DPCX 3N41F 1QX1A 1KEML 3TFKD 1W15A 1RAMA 1E3FA 3IRPX 3FUNA 4JFEE 3C60D 4CVZB 4NQDB 2ZYIA 5F9AC 2Y5EA 5CJXA 3QIBA 4LLYA 2FSDA 4WENB 3TT3L 4Y2OB 3UTPE 1SUJA 3ARBB 4JPVL 4KKBD 4PRPE 2GY7B 4ZTPL 3ZRCC 3MBEA 4BSVA 1N6QH 2OCCB 3GXTA 2K7QA 1CGWA 4PCYA 2X0UA 3B43A 2VXUL 4XOBA 2Y69B 5JIIA 4MMZC 1C08B 4PY8I 4XPAH 1WEJH 3QJQB 4OLYH 4X9FA 5JXEC 4MKTA 5HHVH 2EE2A 3C5ZC 4L05A 2WXPA 4P23C 1U8QA 4E41A 2ZOLB 4GIOA 2D31A 3V4PA 1EHAA 2JI2A 4LKXA 3TYGH 3NSCA 4JRXB 5CP7A 1VGKA 3U9PL 3GZKA 4N28A 1ZLWH 3U46B 5IBLD 4PTUA 5BRPA 3KXFD 3FT9A 5GIRB 1GGCL 1R5IA 4QHKJ 4PJGA 4Z7NE 3HNSH 2GJZA 2E75C 5KUMA 2Z3FA 3O2WH 4YHKH 4Z7QE 3BRDA 2XI9A 4N5ED 3TBCA 2VXUH 1OP4A 4J8RB 4DGUA 2QFRA 4O51B 3ZZSA 2LTQB 4HVBA 4JY4A 1EIBA 1KPVB 4ZO7A 4C8XA 3FN0L 3S0PA 4IKLA 2HP4A 3CUPB 2APXA 2VRAA 3WNKA 4G8GE 4MASA 2HMID 3GB7B 1S9KC 4IBUA 3NGBB 5FB8B 2BK8A 2VR6A 1HILA 3MNVB 3PNWB 4IEFB 4UUJB 3EBGA 3SQBA 1I1AC 3H42L 2ZCKL 3VSTA 1WZ1H 2DLTA 1RVFL 5E5MB 1LO5A 1T22A 1FH5L 3FQWA 1O5PA 4XX1E 2FL5B 2CNZA 4DT2A 1VPOH 5I6NA 3CFTA 4AM0B 4BIKA 4L8DB 1MJ8L 3F58L 4HUMB 4ZAKD 1SJEA 3VXPB 1GGIH 5IFHH 3K81A 2CLRB 3UAFA 3PE9A 3THMH 3BKML 2OXGA 3QJXA 3RJQB 3DGCR 4MDJB 1GGIL 2WP3T 3FAWA 3GXPA 3IMWA 5D7KE 5EA0L 1NUDA 4OFYD 2Q3XA 4Z7VF 4PJFF 4POYA 4AM0Q 5H4YA 4TLKA 1H3GA 1U3HB 1YSOA 4WJ5B 4XN8A 4IDLA 4HIEA 1AR1B 4KI5C 4UV4L 5EEVA 1IEBB 4I9XA 3HZVB 4LFHD 3PP3K 5K9KA 4XBEL 5D2NA 5KBMA 1YEIL 1TQSA 1GHFH 3D9AH 3ZE1E 5TF1L 5HDLA 4Y19D 3V9FA 4JDZA 4GRWF 5IOPA 1R47A 4W4NA 2K3TA 2W0LA 1A4BA 4OV5A 2D03H 1DVFB 5I1AB 2BNQE 1C7SA 1H8NA 5CINL 3AMKA 4IIQA 5JO5A 3F2LA 1T0MA 2XBTA 5DZJA 1SLUA 1F3JB 2IOOA 3EHBC 4R4FH 3RPBA 5AG9A 2OQJA 1IAKB 3CWGA 4M7ZB 1N7ML 1CFVL 2XZCH 5FKAB 1GGCH 3A21A 1NINA 4U1GB 4FFTA 2NSQA 5HD8D 3UZQA 4NQVA 1X5AA 1DHKA 4S2SB 4OI7A 4Y4FC 3LNHA 1MCJA 1AHKA 2O6EA 3KPRA 4FMVA 4I77L 2E7BA 1GSMA 4ORZC 4P4KB 4GRMA 5CWSB 3VU2A 1KOAA 3MV7D 2H1PH 4UTAA 1P5UA 4XMPH 3MTRA 1LEKA 1ZLUH 1TO4A 4X9YA 5DJDB 2PP9A 2DLFL 2J88H 2VH5L 1ZIBA 2YD2A 4F33B 3VXRE 5J11B 1G6VK 1ZPUA 3HOGA 5A2FA 3SHSA 1QFOA 5F9JB 3N1FC 4Y9BA 3X1BA 4Z7WB 1NCUA 3QRFM 1NC2D 1NGZA 2P47B 5DJ6B 3TEWA 3BKJH 4BUHA 4NZUL 3NJMA 3BSGA 5GS3A 3QDME 3D25A 4MA3A 1NC2A 2IV8A 4WO4A 3GS4A 3VH8G 5B21A 5CCHE 4X4XA 1M9SA 1GZPA 1K3ZA 3NIDE 3P0YH 3VD5A 5IROC 5D1QC 1PKOA 3HNVH 4FXKA 4W9KC 4LSSH 4UAOC 1BQSA 3LRLA 1YNTF 3WD5H 2WXIA 3AG4B 4G6AD 4JM4H 1N70A 4HX1B 1QAWA 3VAEA 3K8KA 3OHXB 5CZRA 1I1AA 3ZDZB 3PGDA 3OKLA 2DOCA 2D7QA 3GMNA 1HZHH 3BPNC 4MQXD 4X4ME 1D5BA 4MJ5A 1FDLL 4IRZA 4PRIE 1H3PH 5F7YC 2WWNA 5F9OH 4R26L 3RWFB 1CGXA 3DX0A 2BHZA 1TMCB 3VSUA 4U6VH 4HJEA 2C1OA 2HLEB 4KHXH 4AYEC 5C6TL 1N26A 4N68A 1UA3A 1LO0L 1UJ3C 4KGJA 1U8LB 4LLMB 4JBSA 4ZX5A 3CZLA 2DQJH 1C5DA 4U6VL 3DC0A 3GUFA 4PRAA 2WKOF 4GI6A 3O9WD 3WL9B 4N9GB 5IW1A 1YECL 4KK5D 2KT6A 3KVDD 3MJ8A 4IS6A 4Y16D 4Y5VA 3RVUC 2CPUA 1UXMA 2ORBL 2NQCA 1FAIL 1HE8A 4LVOC 2VMDA 4TVSa 3G6JA 4KVPA 1QSEE 5I1IL 1I1CA 2HYMA 3ZO0A 2NY5C 4Z7UB 1AGFA 4PP2A 4JFZL 2XOTA 3WKNA 4NFCA 3IE4A 4NT6A 5KYWB 3WDHA 4F58L 1VKXA 4K73A 4Q74A 3WBDA 4LDEB 1U91B 3JWNC 3VX0A 2B3RA 3OWEA 4GMTL 4EN3B 1JHLH 4OH2A 1F4YH 1FG2A 1VA9A 1VZGA 1UD8A 1ZS8A 2A6IB 4TVPH 3CDGA 3NGBC 5D6DC 1MLCA 3KM2A 4MAYD 1PLGH 1MRCL 3H9SB 4Z0XA 2F2HA 4PR5A 1OAYH 3FH7A 1NGPH 4W1TA 4GW4B 2R8SH 4P2AA 1NIBA 3V6OC 1IMHC 5ID0A 3MR9A 2OI9C 3KCPA 3IS0X 3EYVA 1XZ0B 2DWEB 4N2MA 2YEVB 2WYTA 4JO1L 1ECYA 3AFLA 2JNZA 3LEYL 3T4YA 1EHNA 3ARWA 3NFPA 5IVZA 5F72S 1MSPA 4NN6C 5I1JL 4Y9FA 1KBVA 4FFWC 3L3OB 2D7PA 3L3KB 1AXIB 2P5WA 2CE6A 2J56A 3T65B 3QCVH 5IBUB 3CVHB 2MOVA 5GS0D 4ECNA 5E08L 3G08B 2BJMH 3GXIA 4ZD3H 4L3EB 4C83B 3DRQB 5C0CD 4PJCA 4UZSA 5KVDL 4BHUA 4ADJA 4JKNA 3CH1A 1TVBA 2BP3A 1MXGA 1FYTB 4CC1A 2HB0A 2X4SA 4NWTL 3WFEL 5I0VA 1S3RA 3ME0B 5DQDL 1A25A 4FDWA 4UF7C 4JKPH 2FH8A 1KGCD 4UZGA 4YXHH 4DAGL 4Z76B 3F7YB 2CGRH 4Y5XA 4XAWL 2BIPA 4WI9A 4Z7OF 3TWCL 3CZFA 4MCMA 3O3EB 4OF0A 4PM1A 1JMZA 2GUOA 4OT1L 4ZFGL 2ZWKA 1V54B 2UXVA 4J3OF 4QOKD 3UC0L 2ICWJ 2ZPKH 3S3BB 3BSZH 5AKTA 5KBPA 4L8CB 2UXFA 5AAMA 4MCYA 3MBXL 5KVEH 4GQ9H 4HZ1A 3O3BB 5ISZE 1T4KB 1QSFB 3K2IA 2OBGA 4K71C 3WEBA 1YY8B 1EZUA 1CCZA 3F7LA 3NIGE 3I3EA 4TM9A 5T1LD 1G6RH 3B37A 4P3WA 1OM9A 1M7IA 3ARDB 3TTYA 1SPDA 5E23A 4CKQA 3T3ME 5D1XE 3MRDA 5F44A 2Q3ZA 1QOKA 5D5MB 2IVFC 4M3JA 3W11C 5BOZG 1WWWX 2UVEA 4JFFA 4KI1A 2XTJB 3DMMC 3MOBL 2L0DA 1M6OA 1J8RA 2X10A 4QAMB 1EMTH 1SY6H 2V8MA 3S96A 1T66D 4AV0A 3NP3A 5KG9A 1DE4A 3CFDB 1MAKA 2FQGA 4PJ8B 4OD1L 4AENB 5KS9B 3G9AB 3N85L 1IARB 1AKJD 3L4ZA 1KJ2A 1Z9SA 4S10A 4L4VE 1UZ6F 5F7EH 3UTTA 5KVGL 2P1YA 3QQXA 4MVBD 4LPYA 3QFGA 2H2PD 5DVOA 3CTTA 2XXMB 4F58H 2EXYC 3QDGE 2D9CA 3MUY1 4WAFA 1SOXA 4X6EB 2VXSL 1WFIA 5HD8C 4JREB 2A9CA 4NO0B 3GBLA 4XMKL 2VMFA 2YC1A 1PW3A 3LN5A 1OM3H 2CUAA 1KXQE 2FRGP 5J8OA 4H8WH 4PYGA 3F62A 1J18A 3O3DB 2Z4QA 3M1CA 4F8NA 1AYOA 4J3OC 5BVPH 4PJ7B 4R4BA 4WTZG 1CTNA 1HFUA 4R4NC 1YMMB 3MGTA 2IDFA 2Y22A 3EOBB 4OJCA 4O58H 4GW1B 3TTSA 3VFOA 4R83A 2ADFL 2NMSA 2PW2B 2I9LA 2X2UA 2C3WA 3NZSA 4Q6KA 5AYQA 5C97A 2R56L 1QKZH 1YNTA 5FCSH 4R3SB 3UYOD 3HS9A 2A9NL 5CXPA 4IOFC 4Q89A 4KKQA 5IB4A 3WIIL 2BIQA 5I75C 4U1KB 2HVJA 5IFAH 1L3NA 3KGSA 3NIDF 3TL5A 3BGAA 2C9AA 4JFFE 5F71A 5DD3L 4WEBL 1KN2H 1XIWC 2ZF9A 3RWDB 3RFZC 5MENE 2NNFA 4FMFA 2GK0A 3PHSA 4NUGL 4J3XA 3JXAA 4WUKL 3E1F1 3I02A 3GMMA 4RFNC 1KJMB 4M5YL 1M42A 2AGJH 3SYQA 3P3UA 2Y36H 3MNZA 2AP2A 3KYNB 5AALA 1R0AH 5FIEA 4HIHB 4Z7VA 3DYPA 2EKSA 3V5HA 2APBA 3HN5A 2G4GA 3QPXH 1A6ZA 4FFYL 3SKNA 2DQEL 3T2QA 1YZZA 3S48A 5C3IA 2BJML 4EQ2A 2OJZH 4K0OA 1HL5A 2FJGB 1SYVA 4EXPX 1JK8A 1F6AA 1C16B 1OP3H 2AQRA 4X8CA 3BAKA 5F9DC 4JVUA 4OZIE 5I1DB 4FQHB 1CGSL 3UAJD 4OF5A 5IMLA 1HWHB 2XBDA 1K8DB 4EZJA 3GSNA 3RPIB 5AVVB 1T3FB 3QQNA 5IB2A 4Q8BA 4BFIA 2BDNL 2NLJA 4KK5C 3B7RL 4M8QB 5KSBE 3AW5A 3FUDA 3MV7E 1PG7H 2WLLA 3MRLA 3EYFA 5I30H 3BPNB 5EIIA 3RWCA 5E94A 1BD2B 4JY5L 3KHOA 1A7QL 3MACH 3ZN6A 1J9SA 2GC4C 2WLIB 2OYKA 5K5YA 4YPGB 5C8JA 5FECA 4ETYA 1PZ5A 3QQ9C 1SLWA 2BSBA 4AK2A 2Q3AA 5E8DH 2D3LA 1KTJA 3CZGA 5LXVA 1AYRA 3FO9B 1M1XA 3KEDA 3OB0H 5CJBA 3V5KA 2A6DA 5KYNA 4M00A 4M9PA 1NL0L 2WAHA 4XP6L 1M7DA 2VIRB 1MWOA 2R0ZL 4NLHA 5LJYH 1QTYT 4Q52A 4PLNC 1RZJC 5LBSH 3QSKB 1QA9B 3VTMA 5I6LA 1KJVB 2G5UA 3PRZA 4QHMA 3ERXA 3RB5A 5BS0A 4RGOH 2N7SA 3NA9H 3TX4A 4F3FA 3PREA 2QGDA 5MEQB 4K15A 1CXKA 1U3YA 3QEHB 2QTVA 3A0OA 2JKWA 3BZEA 3B9KB 1J8SA 2X28A 3KXFB 1QLFB 4G5ZL 5IEKA 5IB3B 3SQRA 2QQQA 3LIUA 1W91A 3NABH 1BZEA 2BY3A 3OB8A 1PEWA 4HJJH 4QHLB 2YS4A 4U3CA 3KWUA 4XMTA 3EDFA 4LOEA 3KEHA 1T89A 3PDOA 4H44C 3NCXA 5FYKH 5I15L 2J71A 3CSYA 5J1SC 4QI3A 5D7KD 1KJ2L 3NMEA 4IRSC 2XV6B 4JQVC 4MNGB 4WNJA 5ACZB 4NDMB 1QEWB 2F54A 2PWFA 3P73A 3RL1A 3N3EA 3VD1A 2XWCA 3IWVA 2NZ1A 3BP5B 1VFMA 1YEDA 2R0ZH 2WV3A 3TIEB 3UTSB 3PJSB 2J5WA 3QJFB 3UMTA 3G5ZB 5KSAB 3G3LA 5EORL 1RK1A 5D1XB 5IB1A 1WUNT 3ARBD 3WHE0 1B0GA 2ZX7A 3VI3E 2QLVB 4BK5C 2BINA 3DVNB 1D5ZB 1U33A 4LLYB 3BCFA 5I15H 2VLLA 4D9QD 1FVEB 3HG0A 3I6LD 3QJUB 5E6IA 3VXSA 2HFGL 3P40A 2V2XB 4HJJL 1IQWL 4NKMA 4U0RC 1WHPA 1HNGA 3LEXB 4KROC 5DJCA 5K1NA 1KPRB 3KH4A 5DRXA 2MKLC 1SN2A 4F9PA 4YDJA 2O26U 3EF7A 43C9B 4WI5A 1LQSR 3P1VA 4U1LB 5EU6B 3SYPA 1KTDB 3CFEA 4TNVF 2DL2A 4AQ8C 4HG4J 3JV4A 4JMNA 1MH5B 2HWZH 3LXBA 2BVUA 1J0IA 2IFFH 4TUOA 3JWDH 3VRIB 2VLRE 3CXDL 3HE7B 2VOTA 3LYRA 4FG2A 2ATAA 1XO8A 3US9A 2WIIB 2P3YA 2XHNA 1R5IB 3FUJA 4NIKB 5AW0B 2WANA 3NCJH 4XC1L 4PLJD 2NY4B 2XJKA 1RZGA 3GM8A 4PY7B 3TH4T 3L9RB 4P9MH 3QAZB 5C0BE 5HI4C 2V7HB 3V0IA 4GINA 4G7RB 1KB5L 4MCNA 2XXFA 4NP4L 3TBTA 3BN9D 3TT3H 1CZ8L 1I7UA 1IJ9A 2HWZL 2PO6B 5FOJA 4AMWA 2H5UA 2PLTA 2XQBH 3CX5K 4IRJC 3UTPD 4HXAL 2LLNA 1GHFL 1SHXA 3S36L 3RG1C 3E8UH 3VWJD 4HIJA 4N6RA 1YRKA 3CU7A 5J89A 4NPYA 1UVQB 1XTMA 4NHUA 1Q72H 4G1EA 4OR1A 5CM1A 1G9MH 4NKOA 5DD6B 2QELA 3RI5K 3EH1A 5LB1A 4DGIL 2XVKA 4J3BA 1JOIA 5JOPD 3D2UA 3N43B 4JE0A 1I3RB 1BAGA 3UTTE 3OZKA 5G2NA 5D70H 3VXSD 5DO8A 3IJYA 2MKWA 3V5DA 3BZ5A 2EDTA 3MU3A 3QULA 1NSNH 1YMHB 1COBA 1LE9A 3RHWF 4AVKA 3U4EB 1BD2D 4MDJA 3P4NA 4FYTA 2PR4H 1LE5A 4Z7AA 5KSAD 4FQQA 2VERN 3O9WA 5IVXF 4LVNB 1ZTXL 4YO0A 4B6ZA 1XH2A 1H8LA 1BVLB 2ZG2A 3AT9A 4RDQF 4X8JA 5EU7C 2ITCA 5C08E 1PY4A 3QWRD 3APFA 2KLTA 1TPXC 4HP5A 4M4RB 1A5FL 3V0DA 2ZXAA 3VMPA 4LCCC 2JLLA 2Q7NA 3FC8A 4EDXB 3KNBA 5EZJA 5JHBA 3L5WA 1DVFA 5DHDA 4H4NA 1DO6A 1BFOB 5FHAH 2HKHH 1DQML 3KW7A 4RFOL 4YHPB 2I5YH 4F57L 2J55A 4JZJA 2Z7ZA 1BCIA 1CD0A 3OPZH 5AW5B 2X5PA 4XN5A 1PZUB 1H0DA 2ARJQ 3MOAH 1G7LA 5C0BD 5I76B 1NFIB 4QYOB 1AIZA 3QCUH 3VFUB 2R4RL 4IMKA 4HZLA 1KG0B 5FV2A 4YSTA 3H55A 4FKEA 2CUMA 4JUSA 5I0DA 1E4XL 1HWGB 1G9MC 4NIYE 4KQ3L 1ZD6A 2HJKB 1UWEL 4XCYB 4FTDA 5GS2D 3SCMC 3ZTNL 3DSFH 5GGSY 2QPSA 3HBQA 2A2QT 1DQLL 1FYTD 3VCLB 1E9QB 4ELDA 2QL1A 3A6CH 5HHVL 5JHLL 5E99L 1GJIA 3GBEA 1N7MH 1IIKA 5E7FA 3DXAA 3EUUA 3B1UA 5F88A 1LEKB 3CN0A 4X5XA 5HVHC 4CVXB 1QLRB 3CX2A 3LRKA 4OM0L 3SCMA 5IZ7A 4CU8A 4P07A 3PQYB 1QBAA 2DI9A 1PIGA 2CGRL 4I87A 4W9GC 1I8IB 3LNIA 4HUWA 4OCSL 1EHXA 1HCFX 4FN0A 2HXAA 5CEYB 1JNLL 3HMWH 4FA6A 1NGYA 5D4JA 3UPRB 2EC8A 4LESA 3UBXI 4DP4X 4BH8B 3MSPA 4QO1A 5I2IA 4WHYG 4YSEA 4A2MA 3E6FA 4XE0A 1O6SB 4DJMA 4DOHE 3U79A 2BVOA 3ETBJ 4MNQA 4H20L 4OIIH 2NNAA 2HFEA 3F84A 5EU5B 5EZOH 4ZUWA 4ADGA 5DZNA 4HGWA 3SDXF 2HRGA 1G7PA 3WDJA 2NY1C 4PJXA 5KBDA 4G2AA 4KMTH 4IIQC 5DFTA 1MVUB 2ZQKA 5JHDA 3LB6D 4DP5X 1JWUB 3OAUH 3VRLE 1VFOA 2R15A 2MCPH 4LVEA 1E40A 1EO5A 3TJEL 5IT2H 3RWEA 4HCGA 1HN1A 5I1JH 4APQD 2O5XH 3WLBA 5CEZH 1ZANH 3UO1L 3KJ6H 1DVQA 4L9LA 3E9UA 3F01A 3ABMB 5IBTH 4KI5E 5IW6B 1I1FB 2XTJD 3JWOC 3ZSSA 4F8PA 5BOJA 2DDQH 1AC0A 4U1NB 2UY6A 4U1SB 3OXSA 1ZPLA 4HPYL 5T33H 2AAAA 2V2TA 1M2VB 1UASA 5AEAA 2B2XL 2BC4B 2W88A 3WFHA 3SBRA 3TJHC 4ILDA 4AGOA 1BMZA 2LU5A 2WZ5A 3EXJA 3FU6A 3IJ8A 2ZXEB 4DO6A 2V2WA 4KI5F 1A3ZA 4HC1H 2TRYA 4OTXL 3QXWA 4KKBC 4B3VA 1HIMH 4Z7UA 3ZRSA 3MRQB 1ACXA 2WO4A 1OTUC 2E7DA 4LEXL 3VM7A 3MLYH 3PABA 3AY2A 3VXTA 2OMUB 1FL5A 2VL5B 4IBQA 1E8WA 1NCBL 5I0WA 5A16B 4U1GC 4OZHF 1DFXA 1CL7H 1I3GH 5JIQA 2IG2L 2ZUUA 4L5FH 2AMUA 1RP8A 2A4CA 3LKQA 5DHXB 1U93A 4Q2ZA 4FF9A 1IX2A 4HFWA 4HDIB 2MPAL 1WIUA 1T5KA 4H1LG 4XH2B 3UAEA 1XCQA 4WUUB 1BP3B 4H8WC 2H32A 3FT2B 2VTFA 3QJSB 4Q9QH 1LVEA 5IBLC 1XBDA 3LPPA 4E5XG 5CP3H 2IAMA 3CMOL 1VFBB 4UQ3B 3RE0A 3IVKB 2H41A 4RGNC 4IYKA 3BVTA 5DDHA 5JLZA 5CGMA 1I8LC 4DN3L 3NCYP 5CD5D 1G0DA 3T4YB 3FSWA 2H6PB 3WXVH 3LDBB 4LPTA 5C0CB 2H9GB 3L3OA 4LSUL 5FXCH 4FQXD 1G7HB 1QABA 3K71A 1IUZA 3KDPB 2ZONA 4IU2B 2R29H 2Y4SA 3LTVA 1MFVA 1MWAA 3JYBA 1E5YA 1CURA 3OAZK 1FNEA 3T0EB 3MGOB 4KFZC 5JNYB 2FD6L 5HI4D 2P7TA 2FB4L 3UJJH 4P2OC 4PGCB 3R8QA 3BQUC 3KPQA 2L3BA 3MA7A 3RU8L 3ME0A 3ESMA 4KDTA 1VENA 3F5WB 4IBWA 1ZSHA 1ZXQA 1FO0H 3MLSH 1BQLL 1KBGH 2AXFB 3RB7A 3QUKB 3VW3H 2QBWA 4H2AA 4DN4H 2UXTA 4JFFD 1TTAA 2WMPA 3DO4A 1DBAL 5SWZA 2ZX9A 2VLJE 2YAOA 5CJQL 3X12B 3OJ2C 3UG4A 2OMNA 1MEXH 5DHYA 5HHQB 4Y5XB 3LOWA 3HRZA 2BS71 5DO2D 2ERJC 2J88L 4PJHF 2MOQA 2Z31B 4MNHA 4OD2B 1T2QH 2O1AA 3IK2A 4AI7A 1WCBA 2GUOB 4V1DD 1F4HA 4JQVA 1INDL 3TO4C 4HFUH 4CNIA 2V17H 1E6JL 5I8OL 3B3IA 5FDYA 3BEWB 1KBWA 1IBGL 5TDPB 4UOQA 1DJYA 4LLWA 4PU2A 3HS0C 32C2A 2MMXA 3MRGA 4BZ2A 1QWUA 4PB9L 5DFWH 5KYYB 4XVJL 4XX1G 2CK2A 1V10A 4NC1E 4FNRA 2D0HA 4IGBB 2YD5A 4L3ED 1N18A 4OCYH 4YAQB 5TH2B 3LAFA 3SDCC 5DS8A 4HPOH 4N8VG 4OF8A 4Y2DB 5D6CB 2YBRA 1IBZA 3ENEA 4AVIA 1YEHL 1ZHNB 3EGDA 3RL2A 3Q1SL 1AHWB 3H4FA 3SYOA 2UZXB 3HN8A 2OX5B 5B8CA 1OGSA 3DX1A 5I30L 3F7VB 1DE4B 1HHJA 3CFDA 1LP9B 1KFGA 1XGPB 5T5FH 2DF3A 1QYGL 1WZMA 4DN3H 1BLNA 1A1OA 2EDOA 2UXGA 3D51A 4PJ9A 3VACA 3FRPA 3DV6B 4JFYB 4XN1A 3A23A 2Y7SA 2NX5D 2XBZA 4R0LC 3GBNL 4DGVH 4X6EA 5F3HA 4P3DB 3H9SD 4ZJ9A 2VWEE 2W5PA 3L3DA 4TVUA 2DIEA 1OAYL 3BH4A 5HYJD 1AQDB 2KZBA 3OF6D 2WUCL 3VG9C 4K55A 1DQQA 2PR9A 1NLDH 2XWBA 2WIMA 1W6WA 3I85A 5ILTL 5AD0A 4FP8L 1HCYA 1D5XB 4EO5A 2X89A 3D18B 5JYLA 2H47C 3QRLA 4AT6A 2VAAA 4GI8A 3GEFA 4M7LT 5F1NA 3DDGA 3EFOB 1OF0A 5DMGD 4QWWD 2JJVA 1S5HA 2PW2A 2KYIA 4MJIE 3GMOB 1UM4L 4PB9H 1X5YA 2E7LC 4HWEH 3EDEA 3SO3C 2FGWH 2VLME 2BXYA 3MOQA 1UOWA 2CRMA 4A38A 3ARVA 2VLKD 2KPWA 2JJTA 4DZBB 1NLBL 1OALA 1YMMD 1R3LA 3L1EA 4XNXH 5I9QB 1HZKA 4QOKB 1P4BH 2UY7A 1KLFA 3SGKA 3BC9A 3ZT6A 4E41E 2BP5M 2N7AA 1CT8A 1QKZL 1B4TA 2HRLA 4CC4A 4YHIA 3HR5A 3U36A 4DH2A 5SWSA 3GMMB 2NUPB 1F00I 5F3FA 5ABDE 1BBJA 3NVQA 1RJLA 1I7TB 4ELMB 2XN2A 4YHYB 2LR4A 2IH8A 2YHGA 3RFZB 1U95A 1U8HA 1KYOJ 3P77A 4WEUD 4KH9A 2RQEA 4AGPA 4G8GB 3SE8H 5HI3D 2H2SD 2KL6A 2BPBA 1M56B 1EPFA 2EIJB 3BFQG 4FERA 1XMEB 4M8UA 3WY4A 3LEVL 4FLRA 3QS3A 1QBML 1SYVB 2A83A 5FW8A 4AMKH 1UKTA 4P46C 3AUWB 4Y4FA 3VXNA 1U9KA 1VZIA 1RIUH 5TJWK 2Z9TA 4ZUSB 4JFXA 1L0XA 1A6VH 2NY5H 5GGUA 3S4SG 1ZLUK 4ODWB 4MD0B 2K3HA 4H26B 3Q8CA 4I85A 4PRDB 3V4VL 3RPIA 1ZVSA 4OGAC 2IOMA 1GC1L 2ZCKH 3TOPA 1RUPH 5INCB 5JXAH 4L8SB 3QI9B 3WTVA 2YD4A 3VFWB 4UU9B 1ID5I 1QYGH 4HHAB 2ATPA 1DQMH 1Z9NA 4N8VB 5IJDC 2G75A 1IVLA 2GTZA 1X5LA 4OF6A 5FM4A 1FCGA 5T3XH 2WCSA 1EJOH 1INQB 4OLUL 4ICWA 1L6PA 1RUKL 1MZZA 5E94B 5FYLL 5L88H 2ETWA 2EXSA 5LBGA 2IGLA 3TO2B 2WXQA 1KXVA 2CHXA 4J3UA 2NX5B 3GSUB 5AB1A 4WWOA 3RA7L 2CGZA 1Q9LB 4M5YH 2VQ1A 4AQEA 3T0VA 2F58L 3OD3A 3VWKB 4TVPD 4AKQA 2JE8A 2B59B 3VRJA 2NUTB 5HDBE 5IMOB 1KELL 2ZXGA 1M7DB 4HH9B 4JAMA 4KZCA 2DV6A 3MLUL 4L8BA 2YGVA 1WIPA 2VC2H 4PS8A 3TYGL 2FEDC 3X3FL 5AAPA 3CSFA 3H2WA 3DTXA 4KKNA 3SE8L 1GIGH 2CH8A 3V10A 2GEQA 3GD1C 5C0RL 4GKZB 4OCWH 4UINL 5HBBA 4RZCA 4F3FB 1QUNB 4C58B 5INDB 2Q76A 2UX6A 4QDGA 4DTGH 4KO9A 4RMWA 3AS0A 2HKFL 4KMLB 5A6LA 3NFSL 3ARRA 4PJBE 1DJXA 3EZJB 5DJ8B 2WNKA 5F7FA 2H6OA 5FA4A 3UEQA 3BRGC 3DROB 3MTXA 2V33A 5BVJA 2PW1B 3BIBX 2X38A 4UB0L 3I50H 5DJYB 5F8QC 3OKMB 5AFAA 3C5SA 4M5SA 2Q10A 2B5IB 4HIIA 5EU6D 3MLVL 4DERA 5ALBH 1OSZA 5I1CH 4N8CL 1A9EB 1W6LA 4NO2B 2CA3A 3FF8A 4L23A 4XHJC 2FUTA 5AVSB 3U4BL 4N26A 3L2LA 3QHZH 2A9NH 4K7FB 3ZZ1A 4Z7OB 4X6DB 1I4FA 4C54A 5KJ7E 3G5ZA 4JFPA 4YL9A 2QVTA 3VXQB 3G04B 4MLSA 3FOMB 4BJLA 1CDCA 3HG1A 3T6WA 3VFNB 2AEQL 3QJOA 1JG9A 5C6WH 3EAKA 1IE4A 4PG9B 4XGZB 3T2OA 2EZ0C 2KBGA 2WB1A 3LH8A 1TZ8A 5DFVD 1AR2A