1J8SA

Papg adhesin receptor binding domain-unbound form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords PYELONEPHRITIC ADHESIN
total genus 41
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8sA00
4Z3IA 4Z3JA 1J8RA 4Z3FA 4Z3EA 4Z3GA 4Z3HA 1J8SA
chains in the Genus database with same CATH superfamily
3UP6A 4G7SB 2B4CH 4LSRL 3QIBA 2N7AA 4YDZA 4YO0A 2V7HB 3B7TA 5TDNB 3NN8A 2PCFB 3C09C 4H13C 4HCRH 4XODA 2AJVL 3DVGA 1E6OL 4Y5XA 3T4YB 1TQUA 5EEZA 4ZAKB 2EH8L 2VLKA 1N0XH 3C5JB 3PDDA 3UPRB 3OMAB 2FHCA 1G9MC 4O51B 1K85A 2HRLA 3IDXH 5E94A 1IUZA 6TAAA 1Y1UA 4GB9A 3V6OE 5D71H 4ZMLA 1JV5A 1F4WL 1X5IA 4Y89A 1G6RA 2NY0C 2F6AA 3QRGL 5TD4A 1IM9D 2YD6A 1W80A 1AVAA 4E36A 3LH8A 3V4UL 1IC4L 1QACA 4IBUA 5IGXL 4BUQA 2R83A 1SDYA 3IRCA 2UV3A 2PABA 3GXDA 4NNXA 3BKJH 4CC4A 4N8CL 1FA4A 2Y69B 1QHOA 2WYTA 3EKCA 3IE9A 3PCYA 4JKPL 4PJXA 2VN6A 4TVPL 3SGDI 4E9TA 2XVBA 2Q3ZA 3WIIH 3HBZA 2WB1A 3VTMA 3QQ4B 3BAIA 1V10A 1WWAX 3KH4A 2A9AA 4M6NL 4PRPE 1AY1H 2AANA 4B27A 1V55B 4L37B 3QNXA 3IPEA 4L1HA 4HZLB 1FGNL 3HE7B 5HYQB 3ECBA 3IJ7A 4QO1B 1KCVL 2N7SA 4LEXH 4Z3TA 1G7JB 1XZWA 4P4KB 1M7UA 1W0WB 2X2JA 2UWEA 4ZPTB 5PAZA 1CFBA 4RIRB 4OQTA 3DXAE 2Y7NA 5I73C 4HC1L 2CBMA 4P9MH 4YNYB 3QI9D 4U1IA 3KVDD 1NLBH 5EZOL 4HIHA 4FC3E 3SDXB 1HZLA 5E5LA 1SXCA 4NPYB 5B8CA 5L2JB 4CDHA 5E2UH 3FZUC 1H8NA 1IIKA 2CGZA 1TMCB 2AMGA 2PPFA 4WWPA 2BY3A 4QYAA 3BZFA 3KPPB 4G1EA 4KK6C 1KV3A 1AXSA 1UACH 3U7WL 5H37G 4QHUB 4RMBA 1F4YH 3HG1A 3FT1A 2E27L 5CZRA 3LKOA 5GGSY 4HHGA 2E3VA 2HFGL 1IGFH 3KLLA 4YFEA 3QDME 4WU5B 4NAJA 3HC3L 1WEJH 3PWVA 3IF1B 3WFDH 2XQYA 3GMNB 4Y19B 5CD5D 4Y7OC 3ZIYA 3LQZA 2P48B 2OI9B 3F65A 3II1A 2ZX9A 3EUUA 4HIIA 2KERA 2HPTA 3LMJH 1IM3B 3MZTA 1MREH 4JGMA 5SX4I 4PWJA 3L81A 1IAMA 4NCDA 4FL4C 1GZPB 3L4VA 4HT1L 1JVOA 1XR8B 6PAZA 1JUFA 4UZSA 5EWIL 1HS6A 4FFZH 5EN3A 1I1RA 5F1SA 5AYTA 2I9TA 2VR8A 5F3FA 4PYGA 4HJSA 2ROYA 3KGSA 4ETQB 1NSNH 4YHYC 4AQEB 4MHHG 4F7MA 2W94A 1XD1A 1IM3D 2YSTA 2CCWA 1XGQB 3TNMA 4ZUSA 2YKKA 4EIGB 1MG3C 2HWZH 4JKPH 4PR5A 3PDOA 4B3EA 4AJWA 2ZYRA 4PJ5E 1KYOK 1U36A 2R29L 4XO9A 2NY1D 2AXJA 3ZQXA 3P3RA 5JHDB 3ESNA 1WA0X 2FVNA 1BAFL 3U6RB 2WTPA 2AJ3B 1GGYA 5DJZA 4LPUA 4D9LH 4X7FC 3X3FH 1CU4L 1T7YA 1UA3A 2ADIB 2FJHA 3LKRB 3HJEA 5ETUB 2F74A 1M1XA 2HP4A 4PLJD 1TZGH 4Q0XH 3IAGC 1T0NB 1NBVL 3E9UA 1M7IA 4ONFL 3T4AB 1SEQH 3WNNA 1AGCB 1RUAH 2OSXA 3LHPL 4AC2A 5LDUA 5FDWA 4R2GB 1MWAH 3H55A 3QEQB 3SKUD 3KR3L 4RAVA 2NY3C 4OZFH 4UIKL 3WTVA 1EFQA 2YARA 4Z7OB 3GS4A 1IJ9A 2Y6SD 1BA9A 3K2UL 3O4LB 3MRFB 3QIUC 2OP4H 2ZCHH 2QMJA 3LPWA 1GGBH 5I15H 5IFHL 3VXUA 4CA4A 4HK0B 3OKDA 4GI9A 2HT3D 4ODTH 2PR4H 4KGJA 3WNPA 3ZMRA 1BM7A 1CLZL 3QR1A 4I8DA 1S46A 1X9RA 4J23A 3DMMA 4MS8D 3UTSB 1L9MA 4L48A 3US0A 1E2WA 3QHTC 1THCA 3LSOA 1A3LL 1KJMB 1QEWB 2ZSVA 4N0FB 1JNLL 4M93C 4B50A 2JFCA 4I48B 4PJCE 2BY2A 5C0IA 5M95B 3DX9B 2C3VA 4M1GL 4AZ8A 4L23A 4G8GD 4R0LA 1WISA 3MRKA 4R7DA 4TS6A 1XMEB 5CEYB 5KG9B 2HSIA 4JKKA 4KMTL 3GT6A 2JXMA 4WEUD 5LN4A 3WHXB 2I24N 3WO4B 4WWNA 3BVNA 1RJYB 1CFMA 3QIUB 4PS4L 4EZJA 1AZBA 5I76A 4YGVB 1L0XA 1DDTA 2BNRB 3ULVD 3CHSA 5CJ8A 4JQIA 4HFUH 2A6JB 5KWYC 5M7QA 3EXJA 3B2VL 5ELIA 1WBXB 1QBLH 4IBLT 1WSST 2E6PA 4W93A 2A5UA 5IROA 3SYAA 3MJ9H 3OL2A 2F1AA 1MF2H 3GC3A 3PDGA 1JRHH 3GMRB 4J1UA 3GSVB 1A8ZA 2J1ZA 1K4CA 2PF6A 3B9KB 4N6RB 1WT5A 1GYCA 1HEJC 4GXFA 2WXKA 2XPGA 1I3VA 2VL5A 4AG4H 4AKQA 1R3IL 1ORSA 4GO9A 1DBMH 5FO8B 5I15L 5IFHH 5FYLD 2H26A 3QEGH 2ODIA 1AGBA 3SPJA 4EAEA 1MFAH 4Q6IB 5IVNA 5GS2D 1O9VA 4QXVA 1EDYA 1TQTA 5DJDB 3VD2A 2JJUA 1AO7D 1RZFH 5FKAA 5AKVA 1KTLB 5KYXA 1BEYH 3SOBH 1U8PA 5CMAA 1T7ZA 1TNMA 4F9LA 3SODB 1RMFH 4DGIH 2VXQH 1INDH 2EDTA 1J88A 1IFHH 5E0FA 1IM9A 1TZGL 5IBTH 1NUGA 3PREA 5SWZD 1FORL 4M3HA 2VQUA 4JFYA 1ZVSB 4O2EB 4PRAB 3MLXH 3T2NL 4FYSA 1RPKA 4KO6A 5DRXB 3RL1A 4D9LL 3X11B 4NP4H 1HQ4A 4AC4A 4RQQA 5E2TH 1TQBC 1ZS8B 3U46B 5AD0B 2BFVL 4JZJA 4R84A 5FFOA 2WWKT 5B1AB 3QZWA 3BUDA 4FI6A 1LHZA 5EO1B 1OLZA 3UGXA 4C56B 1A6WH 2DIBA 2EDYA 3FRUB 3T3ME 1X4ZA 2IWGA 2NT0A 4OI9A 4A6YH 1BOYA 3I50H 4N0UE 1A4JB 2QPFA 2X1XR 2ZXGA 3STBA 3EGDA 3GIZL 4XP6L 1DJHA 2GK0B 2YPKA 3CSYA 3HNSL 4JHAH 4U6YB 1B0IA 2GPZA 1W6LA 3ILPB 4QRBA 4NQUA 1HILA 4KNQA 2FYYB 3OAYH 2KKQA 1E4XL 5B21A 1MOEA 4QRUA 1PX4A 1EO8H 3R06A 1NCHA 3UYPA 5J1SC 4G70B 2QQQA 5IG7A 1H6FA 2CAKA 5DURB 3LH2H 4KPHL 2QVTA 4MZ3A 4RMUA 1X7TA 1GOFA 2QELA 5A3IC 3VW3H 3H56A 4MX7A 3FONA 4YHKH 1YNTA 3DROA 1ITBB 3U4BH 1AR1D 1LTXA 4AYFB 4MJ6A 4DVRL 5K93A 4LCWE 4EO5A 3E38A 4MMXA 4I1PA 3B9DA 3FO2A 1CFTB 2MPAH 3RWIA 4WW2C 1WT5C 5EU3B 5L7XH 3E6FB 3RIFK 3WV0A 4WKZB 2C9AA 3WE6A 4LOUD 3N1FC 1H5BC 2AABL 5DRWB 4LZKA 1AQDB 1MFBH 2H0PA 2VDQB 3HUJE 1KY7A 2B0SH 2FX9L 4J8RA 3B56A 2GKIA 1QR1B 1EPFA 3Q2WA 2NTFA 4NNPL 3FOLA 4HUWB 3NZUA 5DS1A 2J1KA 3QNFA 1E0OB 3HI1A 2WP3T 1IL1A 4HCFA 4ZS6D 1UZ6F 2D03L 4NKDA 2FNBA 4U6VL 5IVOA 1OSZB 2NX5E 1JWUA 2WV3A 4NM4H 5JOFA 5MERA 1FNHA 2IEPA 4KX7A 4X4MA 3UBXI 3AREA 1FV1B 2WVSA 3QHZH 4G5ZH 2JCWA 3ZU8A 4WWKC 1MFMA 1IT9L 2ATKB 1USZA 2LOEA 3BN9D 2N01B 4PY7A 1NWOA 4LE8A 4X5QA 4CC4C 4LL9A 1ZOXA 4NKOB 5CD3B 1BIIA 3NCBB 5F8QC 2CBTA 1WAEA 2JKNA 4N2KA 5GRUL 1OGAE 1KLUB 4G6JL 3ZKND 3P4OA 4HJ1A 3NCWA 4PJGB 4K8RC 4DZBB 5EU4B 3WS6A 1G84A 4OCRH 4ZSOB 1MJJB 5FGSA 3BUBA 4N1CA 4KH9A 5I8KH 1TJGH 2F5BH 4EEEA 3KS0H 5DLLA 3KLKA 2L4OA 5FA3B 3QQDA 5DUPH 4KFMA 2B0SL 2FX9H 4PJFB 3WY1A 1P4BH 3CDZA 1AIFA 1YMHA 4Q9BA 5KBDA 3N44F 3S37L 1MWOA 3F7YB 5IM7A 5KAQF 3SE8L 5EF3A 1LDSA 1D2OA 5FR3A 5EZLB 3QDMD 4MQSB 5FLUA 2OQJB 4K0OA 4RRPM 3PV7A 2XZQL 3FCSB 1WZ1H 3OG4B 2TSAA 3RWHA 5IB2A 5IQMA 2YD7A 3MOBH 3VFRB 3MJ7A 5F8RC 5HHOA 1RZKH 3PWPB 4O2CA 2O1AA 5JOPD 3DV6A 3ZPDA 1WBZB 2MTAA 2Q7NA 1IAOA 5KSBA 4S1RL 2AAAA 2R2CA 4H8QA 4TUUA 2LGNA 2A77H 3QUMA 2W92A 3CFCL 2WXLA 2FD6H 2OV0A 1JZDC 1CGWA 1R1CA 3AMKA 4OD1L 2H45A 5GRUH 1E2ZA 1FAIL 3BRGC 3AUWB 3TO2A 3BPNB 3QYMA 1L6PA 3F6IA 3TEZA 5L2KA 1KFAH 4NN6C 2VN3A 5F1NB 2R69L 4AQ1B 2A9NL 3GMOA 5FECA 4HCRA 1TENA 5FO7B 1HCYA 4H0IA 5CBEA 5DHYB 1S9VA 2IFFH 4EQ2A 5E4IA 4R4ND 4L29A 3CNKA 5HGAA 4M8RA 5EU5B 2RACA 2BJML 3WNJA 35C8L 4GP5B 2NW3A 2H1LM 4M1DL 4S10A 1WIOA 5CGYC 4XOAA 1NCTA 4QT5B 1OQXA 4IEFA 4GW1A 5D72L 5GGVL 4QRSB 5MEPA 2WLJA 3MJ9L 1QSVA 1RIUH 3PY9A 2EDXA 3VJ6B 1WZMA 3QH3A 1BVKA 4H26B 1NDGA 3KGRA 2J8OA 2FIKA 1A7RL 1DQDL 2LW3A 3Q5TA 1DEEB 1L5GA 2NPLX 1DFXA 4M62L 3RZCB 2Y3NA 5EU4A 1PGRB 1AZVA 1E5YA 1ZLSH 5I6NA 2RGSA 3PL6C 4L3EA 1T4KA 2EEBA 4FTVB 5KANI 1PQZA 3MRGB 1JWSA 3DHMA 3BSZA 2Z7YA 2YGQA 4R4BB 4BZ1L 1YEDB 3PXJA 2DWSA 1JZGA 5IFAL 3SKJH 3AGVA 2YA0A 2ZUVA 1YJDL 2APSA 4MGXA 2Q7AA 3HNSH 3F00A 3OD3A 3H9HB 4BUGA 4I5BA 2CO7B 4XCEA 1VEMA 3C6LB 2XZAL 3U4EA 2AXGA 4JKWA 3ARDC 4Z7OF 1CGVA 2ZUWA 4TM9A 2Z8WC 1FF5A 1QA9A 1CLOH 2Z34A 4YHML 2BFVH 2EQDA 4FFYL 2EKSB 4MJ5B 1URZA 2Q8AH 4WW2A 1RHFA 4GKNA 3VCLB 4HS6A 1OB1B 2JQZA 2CDGB 4FQXC 4WWID 1KNOA 1MFCL 3KPMA 3IMSA 5F7MC 1RUQL 2AEOA 2G75B 4KQ4L 1SJMA 4JY5L 1ASQA 1AIZA 3Q2CA 5I5RA 2AJYH 1EEYA 2YAOA 3I9AA 2D7QA 3MRPB 1R4XA 1SJVA 4MNGE 3S3SA 2VM3A 4HMEA 1UUNA 3FZUD 3TJPA 4W9HC 3REVB 5DFAA 1RP9A 3Q3GB 2AJSH 2H2SC 2Z0UA 4XI5C 2VDLH 4XHJC 2BP8A 2AQNA 2VABA 3JQOB 4RWYL 3EFDL 4PIRF 2F7PA 2Z35A 2FO1A 3S5YA 3WIHL 1P4LA 3G3LA 4GRWE 1UT1A 4HVBA 5GRVK 5E70A 3HUJB 1F86A 2WCSA 3RKDD 4Z8FH 1F6AB 6CGTA 4PAZA 4CW1A 1JMZA 3FCBA 1QMUA 4L8BB 3TBTA 1HK6A 5MEQB 2CH8A 2IGFL 2CR3A 4X9BA 4TVPE 4PJ7F 1E8YA 2UZIH 5D7SH 3W9EA 4PLOB 1LO3L 5F7KC 1TCMA 5SV4A 1URIA 2A99A 4GRWH 2WSKA 5EWIH 1FNGA 1UWEH 5KN5B 2XDHA 4MRCA 5DJ6B 4JDTL 3T6WA 5GISL 1ACYH 4RQQB 1HL8A 3LNGA 4HJ0C 4QWWC 2Q87A 3TO4C 1ZLUH 1XCQA 3JWDL 2X4TA 3IE4A 3BP7A 5H94B 4BWWA 1RUMH 5CJBA 1YEJH 4JQIL 1WC7B 3FRPB 4KRPB 4APQB 2J44A 4GBXC 4JR9L 4OCYL 1H3WM 3CXDH 3EYQD 1Z3GL 3L9BA 4ZX6A 3OG6B 3FSZA 4JMXA 1UZ6E 3QJHB 4HU8A 1II4E 1YUHB 1ZHLB 2CKBA 4QRRB 1KTLA 3A67H 3IPBA 3EYFB 4ICXA 4Y4KB 2H8PA 2QQKH 1ZHBB 4I2XA 3U0PA 3V79C 4PJBE 1YNKL 5GS0C 4YDLB 3BI9X 2GUYA 5HYSA 4WO4A 4NO0B 1BVLB 2JELH 3RI5K 4IK6A 2EO9A 3RKPA 5I24A 3ULSA 1KGIA 3BIBX 1MNUL 1OAQH 1FE8H 2YRZA 2BVOB 3VSUA 1GGBL 4L05A 4N0CD 1G9MH 4N6RA 3FTXA 3BKCL 3VFNA 2X4NB 3B6SA 2VSMB 3IBOA 3DV4B 3L7EA 1LWHA 4IW4C 5AYUH 5FUCC 4BRJA 3PLYA 1F3JB 2P5EA 3B2PA 3FKUS 3U2JA 1XT5A 3RFZB 1ZK9A 3FXIC 2VLRA 3WL9A 3CLFH 2Q5BA 2PKDA 2G2RA 1CFSB 5E4AA 5HY9B 3FQ4A 2V3EA 3MREB 5F7DB 4IRJA 4ODVH 4E41D 1XO8A 4BD4A 5INCB 1BAWA 1CI3M 4PGJA 3EBHA 4Z78A 3VD5A 1I9IH 2EO1A 4HXAL 5EC2A 1XIWA 3AU1A 1ZE3H 5ENWA 4JM2D 5IQOA 2AKRB 1M2VB 4NUMA 2JWYA 1I7RB 4KRMB 2JJTC 1OPGL 1KLFA 4LASL 5EUOF 3X3GH 4Y2LA 3HR6A 4AZ8B 1I9RH 1WA2X 3MV7E 4PD4J 5CEZH 1L7IH 2ED6A 4WI0A 5I9QC 1HKLL 2HJFA 4HS8L 3LSOB 1MCWW 3VFVB 4M29A 2XSKA 5FYJE 3K72B 4OZIF 1MQ8A 3MFFA 2HPOA 1BLNB 4KZEH 1X5XA 1SJXA 3PIQB 4EVNB 1F90L 1BQLL 4OT1H 1O7SA 3RAJL 3DHJA 1QPPA 2APFA 1LK3L 4OCYH 5KBMA 5B38A 5JORB 3B3IA 1PTZA 1DJGA 2F54B 5AYUL 5A2AA 4OKDA 1OM3L 1KXTB 4ADGA 4F15C 1EGJL 2V8LA 4X6EB 5JQIB 2YOAA 3GHEH 3VFMB 2IOOA 3NZ8A 4M7LL 4X6CB 1BXVA 3C60A 3FTZA 3B3IB 3Q2VA 1XXDC 4XX5A 2IC2A 5KJRL 2NDFA 3NBNA 5F9OH 2DQ6A 2ESVB 4Z7UE 1S5IL 2HXAA 4JREC 3RTQC 1QRNB 1U2HA 3PIQA 2BXZA 3LAFA 4PWGA 3NCJL 3GYRA 4OZHA 2AITA 1ML0A 4OVUA 4Q4EA 1NEZB 3H6JA 4AT6A 1O7DC 1TQCB 2BVEA 3TTYA 4AYEC 4FQXA 5EHFA 4GAJL 4QR7A 4E9XA 1B4RA 3QQXA 4P59L 32C2B 1X44A 1I3GL 3QBTB 1QPKA 2GHWB 3EJSA 4ANKA 1OWRM 3FK3A 3D39B 1I7RA 1D7FA 3OF6D 4JR9H 1TO4A 4A37A 4PJBA 1E2VA 2D73A 4FS0A 5H35B 3Q2LA 5KS9B 2VDNH 3MMEB 3U7AA 2ZWNA 5EEUA 1S3KH 4Z1PA 1ZA3B 1H6EA 4UB0L 1YQVH 5TFSH 5IZ7A 1MNUH 5F7DA 5IVZB 2YUXA 1JP5A 3VXSE 2QZQA 5IHLB 1DUYA 3HEIB 2YD9A 4XMPH 4NQDB 2GTWB 3LQAL 5DYOB 5DZJA 1BJ1J 5ICZA 3UEZA 3TEWA 1FFRA 4JDZB 1IVTA 1XTMA 4H8WH 4JN2A 4LLUB 4N5ED 2WO2B 5D7LB 5EORH 4F7KA 3S35X 3S8FB 5FO2A 4LU5H 1XR8A 4JFHE 1U3HA 2F58L 4Y2DA 2V17H 4CVWA 3ZDZB 3HE7D 4ADIA 3DX0A 1U91A 3F7VA 1DQML 4KI5E 2IOIA 2AAVA 3EYUH 2WN2A 1ZSHA 2MKWA 3O6ML 4LBAA 2WGXA 3ESVF 1NJ9B 4EI6B 4DP2X 4RDQF 3PL6B 2HTLC 5FAAA 3T0ED 2EUWA 2QLYA 2D0HA 2NNFA 3V7AE 3BAJA 4G6KL 1QFWI 3REWA 3ZXAC 3IGKA 1N6QL 1AZUA 2CKBB 2VDMB 4JO4H 1MF2L 4N5UA 2MWCA 3HZKB 4WI3A 1EUUA 1Z1WA 2YMOA 4QHUA 3L95A 4PMEA 5FIEA 3O6LH 3PHQA 1G4MA 3OKEB 4BQ9A 2X6UA 4ZFQA 4DP8X 1U21A 1U95B 2AJVH 3WFCL 5B8CB 5L2JA 2MCMA 4K3DH 3T2OA 2XPYA 3NA4A 5AZ2H 5KSAB 3TBBA 5E00A 5AENA 1J48A 1A6UL 2VB5A 2N59A 3L3HB 3PAYA 4G8IB 4WV1A 3FN0L 4PJGF 2GTWA 5FHAH 1U58A 2DDQL 3OBAA 3ZYIA 4BFOA 1NAMH 5IVZA 1RXLA 3HBPA 3GF8A 2IMMA 4OU3A 5FYJU 1W72L 4X6DE 4OLVH 5T1LB 1XGPA 4K4KA 4Y4HA 3UJIL 4Y9GA 4IKIA 1JNLH 2VLKD 3JVGC 4HKXA 3RVVC 1BBDH 4QTHA 1JZ3A 2V3FA 2DJMA 1EAPA 3BPNC 4KH2A 1RUQH 1U8HB 2CR6A 4K8RL 1FCCA 4XPGH 4DHLA 4F7EB 3C5XA 3MPCA 3DC0A 3TJEH 1S8DB 2ORBH 4K2UH 3S97C 4W9DC 1FFOB 2IAMB 1ZVNA 3O3UN 4R4FH 3TN0C 1O0VA 1NC4A 1NEPA 1VGEL 2FAUA 3MN8A 3NJMA 4L5FH 3MRNA 4KDWA 1MHCB 3DX2A 2QVIA 1TVBB 1TSHA 4IYKA 3MACH 3VRJB 1I1AC 4JO3H 1OK0A 4KI5D 4Y5XB 2Z4TA 5B8CC 3FQ1A 1N6UA 4BRVA 5IB5A 4ATWA 1EBPA 2V2WA 5FYLH 3GSOB 4GRLB 4OB5H 2CE6A 2JKWA 3IDUA 1RZPA 3O9WC 4WDIA 3WUWG 3CFCH 4MXVE 4JN1H 1WTGT 1NCGA 1X5HA 2VN5A 1DN0B 4P3DB 2GCYA 3NQIA 4YSTA 4BWTA 4BFRA 4HK3N 3DNKA 3GBDA 5GSVA 3NDZE 3VXSD 3FO0L 1RZKL 1H3PH 1TOXA 3SKOB 2D31B 3VX0A 3LKNA 3QS2A 4RX4D 1VLXA 3P0VH 2HLEB 4KZCA 3RVXC 3MGOB 3W57A 1CS6A 2OI9C 3H9HA 4BZ1A 4LKXB 1KLFB 4FNLL 4W9EC 1E28A 5JUEL 3GINA 2YK1H 4L8DB 4P23C 4PV9B 4KVNH 2BVUA 3HTLX 2I32A 4AUJA 5T3ZH 4GRLC 3TCLA 2GJ6E 3IU4L 2J8UF 5JHDE 4L2LA 2D2CC 3NJXA 3KCPA 4AZUA 5BO0D 3MRGA 3F6JA 4J6IA 4P46C 1K2DB 2CHXA 1Y07A 2E6JA 2UX7A 3ABZA 1SHMA 3RNQB 4DAGL 4ORZC 3F7QA 4NUJB 5KEZA 2WWNA 5CJQL 2ZJSL 3K6IA 3NGBB 4MWFB 3KYMB 5I1AB 2OMXB 2WOYA 4MJIB 1EA9C 4PRNB 3LRKA 1BVKB 5IT2H 1I8UA 1JPTH 2H32H 1J0HA 1E8XA 1FZOA 4KGLA 4YOKA 1IGYA 4A2MA 4NZ8A 5C7XH 5TQ2H 4CKVX 4C55A 3HE7C 4IEFB 4I3RL 5D2NC 5DMYA 5D2LB 3VXTA 3PP4L 3ZE2B 2NW3B 4NO0A 4WZ9A 5HYSB 3VU2A 5I1EL 4W9ZA 3DURA 5ABDE 5D1QD 4XVJH 4H7VA 4OF8A 1SN5A 1KB5L 2PO6C 1D5BB 2VC2H 3FNKA 3Q0HA 4WUUB 5C09A 1VA9A 3L3GB 4GG6E 2H8PB 1PZ5B 5D6DA 2GAZB 4AIEA 4B9FA 3WO3B 4P99A 1S9VB 2VZ1A 2XWTA 3UBFA 1TJGL 4M4RB 3LNFA 1RURH 2QEJA 1Q1JH 2FQEA 2JB5H 2CLVA 2Y3AA 3GSNB 5AKRA 1C8PA 3MRMB 4R90H 2OTWB 3O8XC 3VFTB 1B3IA 5AG9A 3LTVA 1M4KA 1GGUA 1KPVA 3NABH 3QHFH 4R7NA 5IB4A 3S2AA 5BJTB 2R23A 3GZPA 4FXGB 5DJAB 4IKKA 3IS1X 3OSKA 4OLWH 3CMOH 3TBYB 1INEL 1HL9A 4TSAL 3UADA 2XVLA 2MQCA 4GSUA 3RWFB 3S5LA 2H6PB 4FABL 2Y1ZA 2V8MA 4G42B 4TLKA 1J5OH 5B4MC 1CE6B 2IGFH 3F5WA 3RVWD 4JRYB 3W9EB 3TEXA 5DC4B 3TZVC 5IGXH 2Y5QA 3MJ7B 3KPNA 1E4WL 2WWKO 5ILTH 1E67A 5FUZH 2JTYA 1SN2A 4AGMA 4Q9QL 1G87A 1P7QD 5D71L 5JW4M 3BPLB 2CRIA 2WBJD 2Z7WA 2Y6TE 4FFTA 3AG1B 2V2TA 3CVHB 4NN5C 2FJGA 4RWYH 1J10A 4HLEA 4JFVA 4D7BA 3I6GB 3QG6B 4U31A 5I1JH 2F15A 4U6TA 5AKSA 4PWHA 3PL6D 4LVNC 2B39A 4E42B 4OIBA 5L6YL 1EK3A 1N2RB 2FX8L 3K8LA 1E8WA 2WJ7A 1FNEA 4OF3A 4ABUA 3LQMA 3NSXA 1A4CA 2E8ZA 3N43F 4FFVD 3TYGL 3OHMB 3O6KH 3IJYA 2OMBA 4MWFA 1U8LA 4NBYB 3ZTCC 1TQSA 3QARA 5D9SA 3OTTA 3HVNA 3ML8A 3WFDL 2NY5H 4FX5A 2D03H 1ADQL 1OWWA 5EC1A 3OJ2C 2B1AH 3JUZA 1XGYL 2X70A 2W0KA 4WSKA 1R3HB 1BIIB 3FN0H 2Z31D 5IKCA 3HMXA 5DA4A 3VI4F 3NZHL 1EVUA 2YRLA 3E3QE 2OZNA 2WMPB 3DWTA 4Z7WA 1F4AA 1BWWA 5MEOA 3X2QB 2GSGA 2NTSP 3SZ6A 4QRQA 5I66B 4GYBA 4TSBL 5C0DB 4ZMTA 1XF2B 2KPWA 4D0CA 2VDKB 5JOFB 3AXLB 4K5OA 1Z9NA 1OOAA 1AGDB 1IKOP 4OJAA 2BHZA 2NXYD 1KT2B 3A6BH 4GKZA 4GBXB 2EEAA 2NTFB 2OJEA 2XTSA 3A4DA 4QRQB 3JV4A 2A6KB 1QVOA 3PHOA 5CCHE 2YIHA 3NYKA 5H8DA 4GG6A 1C12A 1WWBX 2XYCA 3ULUE 1UXLA 3ET9F 4FQIH 4G6FD 3GHBH 2R27A 4J2QA 4NP4L 5G4MA 2CIKA 4RGNB 3MLWH 4AYMC 4GNKB 4QI3A 4K3JL 2C9SA 3G5ZB 5EO9B 2QSQA 2ZKMX 3GKZA 3VI4A 2YUZA 3ZX1A 1X5KA 2P3YA 2Y1AA 3C8KA 4MMXB 5DVPA 3KXFB 3GMLB 3SIKA 4M02A 4DUWA 4HG4J 3NTCL 3VRIB 3NCFB 4N2LA 3GSWA 3DX8B 3LKSB 3D0LB 3FONB 4OJFL 4FD0A 3MC0A 5DHVB 5DMGC 4BSWB 4XBGA 4HAFA 2YRBA 1GW0A 4Q8BA 3FAWA 1EJ6A 2CLZA 2VJXA 4NN7C 1NGYA 5DD0H 4N1EA 5DVKA 3ZHNA 2OMUA 5IUSA 2IADA 3NPZB 4UT9L 1MJUH 1U4EA 3CFIC 3MCG1 2YMXH 4APXA 2R4SL 2JKIS 3CPUA 1EAPB 5AB1A 4L29B 5JA8B 4M1GH 4Y88A 3UBXA 2QR0B 4JFQA 1AQ8A 2XG5A 3D7PA 4U6YA 3W1ZA 4U7KA 1PL3A 3X1NA 3ESMA 3ZTDC 4HALA 4LP5A 4NOBA 4AK2A 4KROD 4QGTA 3PHSA 1VGKB 3IMBA 1SF5A 2XKSA 2ZWSA 1SY6H 3D4GA 1RIVL 1B0WA 3EJPA 4C56A 3EYSL 2CLRB 3K2KA 4M5TA 3RWFA 2YBGA 3CQPA 3DOSB 3TBYA 4IS6A 4F92B 2A9DA 1CE1L 3ULVC 3ZUCA 2WSDA 1QO3B 2L3BA 3LIZL 4DKFL 3GMMA 1D5ZB 4JG9A 4U1SA 4D9QE 5ADOL 4JFYB 4B9CA 3V7MA 3BPOB 1UJ3C 2IDTA 4PWFA 3TC9A 2EEDA 3BWSA 4YSAA 3UZQB 4K3EL 3MOQA 2UYLB 2GFBA 2B1HL 2GG1A 4NLHA 3AFLA 4PJGE 3GSNA 4XVSL 1KBBA 1J0JA 1WFJA 2FRGP 1JV2B 4DERA 4ZO8A 3T3MF 5C70A 3L3OA 4GRMB 1BF8A 4R3SB 5F44A 4DF9A 1FSKB 1DL7H 1R17A 2HVJA 4S2SB 1D2PA 1LEGA 3DIFB 5C09B 1N59A 4V1DD 3ATFA 3OHXC 3OLGA 4Q6IA 3X12A 3O3DA 3GBMH 4ZXBC 4FLOA 5DUPL 3PJSA 5AB0A 1HKLH 3V4VB 1KV7A 1C08B 3FT9A 3WCYA 4LARH 4KXBA 2PP9A 1NL0L 4HC1A 1U8OA 3QDJD 3S36H 1QQDA 3PWLA 3VA2C 1NMBH 4F7PB 5E0QA 3O41A 2YAFA 2I60L 5DO2C 5CGBA 4BGDA 5CLTA 3HS8A 1MCJA 1AQMA 4GUQA 3W0WD 2ZONA 4YS4A 3O2VL 4O02H 1NGWB 1KXHA 5CZVH 3UG5A 4C4KT 2VXQA 3S96A 1T1WB 3QCUL 2VW4A 4X6CF 5DYOA 4HS3B 4AVJA 1I1AA 4S1QL 2EE3A 4YDNA 3P9WB 1OHZA 4FQJL 3C12A 4I9WE 4OCWL 3MMEA 2J6EH 4M8UA 5ECGA 4DEPB 4YDKL 4XZ4A 3O3BB 4X5LA 4PV9A 4LLWB 3V0VA 4Z7WE 3E7JA 2GW5A 1UOVA 1HE7A 5H2BA 5JOPE 4M1CC 5J13C 4MJ4A 5DD1H 4HJ0D 5ESVA 1KJMA 1QEWA 4KVPA 3QQ9D 5HHME 2AZAA 1YYLL 1SJHB 4XMLL 3MJ9A 2BY0A 3LZLA 4QRTA 1QG3A 4AEEA 4HGKC 4JUSA 4LF3A 1UFUA 3BOVA 4RAUB 4X8JA 1NUFA 3UAAA 2JSFA 4G8GB 1KN4H 5EA0H 3DJTA 2R29A 3VUAA 1HSBB 3FO2B 1QX1A 2XNAB 3RB7A 9PCYA 1NDMA 4LK4A 3VRJA 3JWNH 4POYA 2EE0A 4XPBL 2HX7A 1RZJC 1R9FA 4OGXH 1Z5LB 1VGEH 1MI5D 5KTEH 3UG3A 2VE6B 2OZ4L 1OGAD 3W9DB 4XI5D 4AIOA 1VFBB 3FUDA 3UC0H 4EI5A 3LKRA 2A73B 4XPGL 1HSAA 1ZHNB 1AG6A 5ETUA 4X7TB 4G72B 3S3CB 3QEUA 4UNVA 1F4YL 5AAMA 5C08A 3U6RA 1N8OE 4YL9A 2XVGA 1R3JA 2MNUA 1M2VA 5CLZA 1KACB 1PY9A 4AE0A 1A7QH 4UTAH 1HHKA 5CSZB 2BDNL 2EDFA 1YECH 2DRUA 3W2DH 3KBFA 1IILE 1JPEA 1DCLA 1M1SA 4UIMA 3OKOB 3LMJL 5C3TA 4AQ8C 1ZY9A 3WLBB 3VH8G 3PNWA 1FORH 4P46D 1W8NA 3B34A 2AK4B 1TLKA 4GW5B 4XT1C 1NBQA 1HHJA 2P7TA 2WCPA 3C6EA 4DGIL 2G60L 3MJ6A 4O2EA 4AYDC 5IW6B 1SEBA 4HV8B 4M8VA 4DGUA 2AJYL 1L0QA 3RTQD 2AC0A 1GZPA 4P07A 3PABA 1NLDH 4F7PA 2HT3C 3SD2A 3GIVB 5EUOA 5DWUL 3WNOA 3N40P 4ELKB 3KXFE 4M3JA 2NY2C 3T6XA 1ETB1 3B5TA 4KK5C 4POZC 1BD2E 3B7RL 4B7IA 5F3BA 3AXHA 4NQVB 1ZT4A 4OLEA 5D7JC 1CLOL 3DIFA 4M48H 2BX5A 1JNNH 4EOWH 3CZFB 1IKFH 1JVKA 2E75C 1MQKH 3PGDA 2VL5B 2ZAIA 1RIHH 3HHMA 1U91B 2AVGA 3RRQA 4ACTA 4UMSA 1P6AB 4XOCA 3RDTA 2GFBB 3JWNG 5HI5C 2V5TA 1NA8A 1I1AD 1U8MA 2XLLA 4GP8B 1CD0A 1NFKA 1TYEB 3X14B 4XNUH 4HUUA 3QW9A 1CT8A 1YEKL 3K4AA 3BH8B 4JN2B 1I9RL 1D5ZA 5FV1L 4Y2OB 4ZFOA 3G6AA 2YWZA 3TU6A 2NY4D 3JWDH 4GW5A 4KHTH 1KY6A 3V4UH 4BUHA 2MH4A 5GS0D 5KN5A 4UOW1 5EFIB 4WK4B 2DLTA 3FB8A 3RGHA 4MD0A 3O6FD 4M7KH 2DKMA 2GUOA 2BNRA 1XXFC 3GXIA 2G3XA 2W59A 4XMKL 3FFDA 3TT1H 3KPSD 1BLIA 4JL1A 5DT1L 2CKBL 2VDML 4MYPA 4FQHB 1OALA 4OIFA 5IB1A 2IXQA 3KHQA 1N7MH 2QZ5A 3VWJA 2OXHA 3NH7L 3KW8A 4P59H 4W9IC 5AZEH 3ZTJG 3N85H 5JXEC 3VQLA 1KXQE 4OCSL 4KJYB 1WH0A 1T1YA 3DX7A 5TK2A 2ZSVB 2BW5A 1S3RA 4N0FA 4QJ5B 1GJIA 2BP8B 5BPPA 5JPNA 5I6OA 1P7HL 4CSSA 4MS6A 4BM7A 4GAYA 1JGEB 3KPSB 2G3MA 5DD0L 4OV5B 5DHVA 5FM4A 2ESVA 2VLKB 3QDMA 5CD5C 4KROC 2A6DB 4B0MB 1R46A 2IPTH 5BZDA 5HI5D 2AP2A 3HBGA 3TF4A 1E3ZA 5FW8A 2OR9H 2XNAA 4DW2L 3FQNB 3VI4B 4NPKA 4C59B 2XWJB 1DE4A 3M17A 4X4KA 3CGTA 1FAIH 2QGDA 3CHRA 4DIXA 1LLAA 4UQ2B 3EO1A 4AV4A 1QLFA 3IS0X 1J12A 1F1GA 2Z1PA 3NFPB 3CK0L 5IJDC 1VCBC 1RP8A 2OJEB 3U4EB 3VWKD 2R8SL 2C1OB 2JB5L 1OPGH 4DKFH 3MBEB 1A7NH 4I85A 5T1LD 3I9GH 2R0WH 3V4PB 5BQDA 3KLAB 1UVQB 5IW1B 1KCRL 4GLRH 3V0DA 2ZYIA 2Z31A 4PCYA 4A66A 2V5RA 2X1PA 1FPTL 3B83A 2LHAA 1MHPH 4XCYB 4Z7WB 5BS0D 4U7SA 3GLAA 5E24E 4P2OC 2K4WA 1MY5A 4PJ7E 2PPEA 2NSMA 4HS3A 6FABL 1H0DA 4YR6B 1JYXA 3RU8H 2VLRB 4RGMB 1QTSA 3VG9C 2VDQH 1PJ9A 3KVQA 5GSRA 2OPCA 5CJOH 1DJYA 2J5LB 3WBDA 3NZHH 5DK2A 1C8QA 1RVFL 2VO8A 3BDYL 2OR8A 3FT3B 4RMRA 2OX5A 3BH9B 4YHLH 2EYSA 3HG4A 1MJ7L 2VSCA 3KNBA 2VRQA 4ODUB 1ZGLM 3WFHA 1Q94B 5DC2A 2BIPA 2JJTA 1N2RA 1WEJL 3KW7A 4ELMA 3IGAA 3SQBB 4B5ZA 3FBQA 1C08A 1IEBA 2IQAB 3WXVH 3SE6A 2Z31C 4IOFD 4CADA 3DYOA 5E6YA 4G5ZL 2XA8L 3BVDB 3T0AA 3OLIA 3EYFA 1FIEA 4EN3A 2WLHA 4GW4B 2A0LD 4F37F 4FQIL 4B9IA 1SRDA 3DPDA 3BW9A 4HPOL 1NMBL 3L2NA 4N2FA 5FO7A 4XWGL 4JRYA 4DKTA 5MENA 1PS3A 3HJ0A 3OSVA 2YPLB 4Z6AT 2G0KA 5E6RB 3VMOA 3ZHKA 3AACA 2OSLA 3Q8BA 1JF5A 2NNCA 1ZRUA 4FP8H 3SDXA 3JVGA 1COBA 2QQNH 4RNRA 4PJ5D 4KUCF 2DI9A 4Z3GA 4G83A 2QADD 2R23B 4XCFL 3KWUA 4YSEA 1F45A 3GEWB 3LB6D 4WRLA 4W9GC 4YSCA 2DQTL 4ELMF 4Q9CA 1ZKAA 5BUPA 4Q89A 3DOSA 3PQYD 4PB9L 2YGOA 1L9SA 4KWUA 2VXSL 4P4KA 3AW5A 2WWOA 5KVGL 2R0WL 4HG4K 4M4RA 5A1AA 1H5BA 5SWZB 5SWQB 4UTBL 3VO0A 2R9HD 5EBMB 3RY5A 4ZX4A 2BVQB 4TKWA 2AQ2A 3BKJL 4KUCD 3O4OB 3OKLB 3WDHA 5DFVC 4QHKI 3G9VA 1GYWA 1MFVA 3GSNL 1CIDA 3EFDH 4PWKA 3PJNA 1JXFA 1YNTF 3T65B 3QUXB 4JVPA 1BYOA 5HDRA 4QHPA 2X6BA 1UJTA 1LP9F 1BBJB 1YMHB 4ODSH 1MVUA 4BDVA 3K2MC 4YHYB 1G9EA 4CBZA 4JK0D 2EH8H 1HVXA 4ODUA 4BE5A 2KL6A 1JPTL 3VVVA 5HYJB 3FBKA 3BD5A 3GIZH 2CGRH 4JCMA 1PG7H 1BDYA 1S7SB 1CUOA 3C8KB 1NC2A 2B7DT 2CNYA 4K3EH 5CJQH 1N6VA 4PJAF 3NN8B 2IBZX 3IWUA 1OK8A 5T1KB 1LL1A 3S4SB 1PSKL 3RIAF 1IZJA 1M71B 2H9GA 5FHAL 4OZHE 3NRPA 2VERA 5CP3H 3FB6A 3LIZH 2NY0B 2H6OA 4PRIA 3CFEB 3JTTB 3QPXL 3M07A 4NN7B 4Q52A 3PHAA 3DXAD 2MCAA 3HRPA 3E80A 5FFLA 5LG6A 4HGMA 2BOCA 4ZX5A 3PWUB 5IROD 2X6VA 1F97A 2MHAA 3OLEA 3AC0A 3WHE0 5E9DB 3P9LA 5LCVA 5T3ZE 4DN4H 4Z7NF 2Z31B 2HCZX 3ARGA 5E56A 4H8VA 3NIFB 1UVQA 1ZEAH 3QZLA 1XF4B 4C56D 1UD3A 5IW1A 3QUZD 4LDLB 2RIKA 3JZYA 2LQRA 2MQ3A 1CK0L 5A2KH 1IQWH 5JO5B 1AH1A 4IIQB 2JKLA 1E4XI 3M1OA 1E6JL 3WTSA 1YSOA 3OAWA 1XF4A 2WBKA 1UENA 4IRSA 4W9KC 2HVKA 1AQHA 3MLRL 5C6PB 1DN0A 4P3DA 1U92B 1WBYB 4JPKH 4A67A 4UQBA 2VDOB 5DEFA 1ZLDA 4U0RC 4YSRA 5BUGA 1NQBA 1BV8A 4ZODA 3ETSA 4NC0B 4A2LA 3GRGA 1BQHB 3BP4B 4JDEA 4JG1L 1JHLL 4R2GC 2IV9A 3P3SA 3FQNA 4ANXA 3ZL4L 2VWEC 1PIFA 1RJZB 3CN4A 3DMMD 3MROB 3SDXE 2D7NA 1IC5H 3FQ2A 2A6DA 4R26L 4Z0BH 1RIUL 1A9EB 5JQ6L 3IJYB 2UWEF 1PKOA 3GI8H 3EOYG 4IU3A 3DROB 1ZHKB 3Q01A 3D5OF 3MCYA 4PRBA 5I5MA 1DJZA 4HCGA 4QRSA 5MEPB 5ACMA 3MBEC 2Y5TA 5KW9H 1FFOA 3S6CA 1TIUA 4QCIB 5I6XC 4ZI8A 5EIIB 5DUMH 3MLYH 2UVEA 1HYRC 2C1PA 3CVHA 3EF7A 4G3YH 4IHOA 1CGTA 1GIGL 1BVNT 4NLAA 5AVRB 5K39A 4G6JH 5B3NA 2NZIA 4NDMA 4F3FB 5C3LD 2VUKA 4U1LA 4F37K 3D9AH 2GK0A 3P11L 5TF1H 3SJVD 1SLWA 3FFDB 2WYHA 1QATA 4AQZA 5EZJA 2Y2TA 1CE6A 3ZTNL 2GUOB 4LIQE 1R0AL 3T77B 5IVXE 5KBPA 2R0LH 5D7IA 4R5TA 1NEZG 1YCSA 4QD2E 5KYWB 4YVNA 2FEDC 4PV1C 4JZJB 4YK4C 3AZUA 4WV1B 2NX5A 2Z65C 3U9PL 5ISZE 1NM4A 3RB5A 5I8EA 4KZ0A 3CX5K 2OFQA 3BH8A 2VMDA 2YAQA 3D12B 1WZLA 2VM9A 3QR2A 1RU9L 5I30H 2ZX6A 3EDJA 1KPUA 3QT2A 1NICA 2WM0A 4XP4L 3DMMC 5LAXA 3ARGC 3RDTB 5KSBB 4QMEA 2XN9D 3CXFA 3NG5A 4Y16B 4Z7QF 3CFUA 2BOBA 5B1JC 1LK3H 3VSVA 1SEQL 5IB2B 4P3CL 3N50A 3VAEA 4PREA 4IRJC 1GS6X 3F85A 4HLZH 3REWB 1Z5YD 3VM7A 2W91A 2FR4A 5K9JH 3GGWB 3HS0C 3LDBC 3KLDA 3OKKA 4IM8A 4WJG3 3ISYA 4B97A 1KB5A 3CLEL 4WEEA 5EBLB 5EZLA 1PG7X 2H26B 2E7LA 2DJUA 4ZUTA 3SGJC 4KJWD 4UT6L 5FO8A 1Q1PA 3FC8A 5JHBA 1KB9J 4Y2DD 1P4BL 5TH2B 3QXUA 1E7VA 3QJTB 3QQNA 4XPAH 1FVEB 4JRYD 1RJLA 1YEFH 1MW1A 4QRPD 1MCLA 2AK1H 2XKUA 1ZLEA 3KS0J 5LBVA 1RURL 2ZWLT 4A7SA 5CCJA 5DC0A 4HJGA 3BH9A 2VXTH 4NFDA 3SJVB 5EA0L 1SM3H 3V0JA 4LHUB 5IEKA 1KCBA 4HEPG 1Q0EA 1BVZA 2G0LA 4JJHA 5FEBA 2V17L 4EXKA 2Y7OA 2M83A 3GBNH 4YQXL 3AM8A 1U2CA 5CD3A 4J4PA 5KSBE 5LB1A 1CMOA 4YGVA 2Y5EA 3II2A 2WQWA 2B5IB 1HOCA 1YQVL 3L54A 4ZMPA 4PRIE 1MJ7H 5D1XA 2MTPA 3CSFA 1MW2A 4G6AD 5C6TL 3MRQA 4I9XA 6PCYA 1HHGB 1RAMA 3V4PA 1I8IA 3EJJX 3BP6A 3PE9A 3GB7B 4JO5A 4WTWA 5FLVA 3H6AA 3FOLB 2P1YA 3SKOA 4YXLL 4X7SH 3A21A 4N3UA 5GSVB 3AVEA 4XR8C 3HG5A 3NT0A 1MG2C 2WBJC 3C60D 4PY8I 3IDNB 5DFVD 4NO0D 1DVTA 1JPSL 5D1XC 5JW4Q 2LVEA 4B9GA 1SN0A 1ND0B 1FC2D 1MCDA 1SM3L 3AMLA 1HOEA 2N3JA 2NT1A 3KD4A 3NFSL 4AENA 2QFPA 5D7IE 2P49B 1KXTA 4UF7C 1ADWA 4YDJB 4G8GA 3BDYH 2AK1L 4MJ6B 2WSPA 4RAVB 4HWBL 2GJPA 4K71C 1JZ4A 4I77H 5F7LB 3MRNB 1JN6A 1SJHA 5AZEL 3VGDA 3K72A 2CHWA 3MTXA 1FH5H 2FEDD 2DB8A 3DVIA 4NRYB 4D8PB 1VPOH 3FCTA 5KJ4A 1C5BL 1Q0XL 4QJ3B 1HILB 2AJ3A 1R5IB 4TNGA 4QTHB 1BSIA 1LO2H 3TVMA 4QHLB 2R1WA 4N2GA 1DZBA 1TZHA 4XO3A 5FUOL 1CPUA 2HLAA 4FJZA 4S0TD 2ALWA 4JO1L 4MD0B 3O4OC 3SDDD 2IVFC 5EFIA 1KFGA 3MU3A 4OAWA 3BT2H 4AIXA 4EN2A 4AQEA 4TOYH 1HQ4B 4ONGH 5E00B 2AQSA 4EDXB 5F9JB 1NSNL 2KZKA 2O5YH 2LR4A 5IEKB 1N7ML 3X14A 4S1QH 2VL4A 3VQ1C 1Q9LB 2XJKA 1OSYA 1NEUA 2GBVA 3TONA 3M45A 1DQTA 1YN6B 4P5KA 4WO4D 5AOLA 4NQCD 1TVDA 1PEWA 4L4TE 4MQTB 1X5FA 3HZKA 3Q5OA 3FPYA 3NJHA 2GJZA 4HIIB 3TVMD 1V3MA 3L4YA 3LQZB 4HKZB 3VYOA 3WDIA 5E9DE 5I6KA 3V4LA 2J5WA 2CPUA 5D1XE 3CN2A 2XXMB 3MDJA 3UFIA 2DTMH 4AUUA 3QCVL 3K91A 2ORBL 2IGTA 4Y4KA 1KULA 2ICWJ 5A43C 1J1OL 3BJ91 4E9YA 3A0OA 3KGTA 5EUOB 1ILUA 1JPSH 3L3OB 4GRMA 4LRIC 5E8DL 3UTZA 1JV2A 2Z93A 4FXGC 2DPKA 4K07A 2CO4A 5K1JA 1YN6A 4P5KB 1UGNA 3EAKA 4WI6A 2VERN 3MRCB 3MUZ1 2AI0L 4N0CC 1Q38A 1IMHC 2WKLA 1SEBB 4ZW7A 2Z64C 1QRNE 3BP7B 4OIIH 2ARJB 3GHBL 4NWUH 1NCDH 1AI1H 1FLRH 4D9RE 2YZ8A 1ASPA 4BZ2A 1TQVA 5J3HD 1RULH 1XGZA 2R2EB 1JGIA 2A6JA 3S3DB 1RUML 5SWSB 1T7XA 3K6NA 2XWBA 1BZOA 2BC4B 4GQPH 4PS4H 4MXVF 1ZA3A 1BCIA 2FH6A 3QDHA 2DWDB 4LLVB 5TE7L 4ABVA 2VDRB 4LAQH 1MIML 2NY3B 3BVNB 3QIUA 5DJCB 3ESPA 2RH0A 4DKDC 2IIJA 1R3JB 3SDDA 3AUVA 2Z7ZA 3TVMB 8FABB 3TWCH 5HGBB 4PJXB 3VMNA 5KG9A 3HUJA 4GXVL 4YPJA 2VT0A 3MNZA 1R5IA 1G1OA 1NIDA 3MRKB 2ZTBA 2X9YA 4KXZH 4XNYH 5D5MB 2C1PB 2HT4C 5DEGB 4N8CH 1VKXA 3NJJA 3LQAH 4XPBH 3CFQA 1PKQE 1RZGB 1VB9A 2PTUA 3UTSA 2J21A 3W9DA 3U0WH 1YDPB 5TPWL 2ZCZA 4XOBA 3O6MH 3MJ8B 4R0LC 2EACA 1CD8A 1PIGA 1YEIL 4X42A 3DX8A 3LKSA 5JHLH 5I28A 4JFOB 4HD5A 4YUEL 5E9NA 1RJZA 3GMLA 1VERA 1UM4H 4KU1A 3KPMB 4X6EA 3FPXA 1C5DB 1IE5A 3PV6B 2V7HA 2QQKL 4PJIB 4X7CC 2VQ1B 2WAQA 1CR9L 3TZVA 4X8JB 5JR1L 1MRFL 1U9KA 1ZIBA 5I1JL 3IDNA 4HLJA 4QRTB 1Z3GH 1XHHA 2K6WA 3PG2A 2QKIB 4WJKB 2QADC 4Y1AD 2BW4A 1T66C 2RTTA 2NOYA 3KYKH 2CHZA 4LKCA 4S11A 2X44D 2HVKB 4XCNB 1GGIL 3PRZA 4IRSB 5ISZA 5CCKH 2AEQL 4H20H 4HX1A 3IDGA 4UTAL 3T08A 4UBDD 1EGJH 4JQVC 5DD6A 3D50A 4KMLB 1B0GB 1FG2B 3GBLA 1XF2A 3D25B 5CUSH 2A0LC 2FQGA 5EZPA 5SX5H 5FO9B 5IF0B 5IIEA 4LLWA 5L4IA 2KQNA 3B1UA 2HKHH 1XIWB 1XH2A 4UM9D 3SN6N 4AL8L 5EEWA 2FEEI 3QRFM 1LE5B 3QG7H 3N3EA 5CGTA 3KCWA 3IPFA 1ETA1 1IARB 5D1ZA 2HKFH 4JCLA 4AOFA 1JWSB 3UJJL 1I1AB 3NCJH 1QZ1A 1D6EA 1KJVB 4P5MB 5AEAA 2H4EA 2X70B 3S4SA 4JY6B 4BZYA 5MEND 5A6LA 5EC1B 2IDCA 3EH4B 4ZUVA 1Q1JL 1L5GB 2IDFA 3QFJD 1TTFA 1VAHA 3CPLB 4CGUB 5BV7L 3I6KA 4FI7A 1NFDE 2X4NA 2VZOA 3DYPA 2X88A 3PJLA 4FYQA 5F3HB 1JAEA 2GITB 1RJLB 5F89B 2YEZB 4TMPA 1RUKL 2ZCKH 1OCOB 4HIXL 5F9WB 3WKML 3HNVH 3QS3A 1NZRA 5E9AA 5GGQL 5HGDA 4IGBC 5DI8A 1INEH 4TSAH 3WTXA 1Z7JA 3UIYA 1OD7A 1BVLA 4Z23A 2X0VA 4FKKA 4LNRB 4ZYKA 5I1HH 1KB5B 5EBLA 3S0PA 1BHGA 2ZPKH 4AITA 1EX0A 4ZO6A 3IF1A 4WEBL 3TYFA 3FQWB 3TBCA 1U3JA 4B9KC 2G9HB 3LEYH 3KPRE 1SLUA 3D85D 4J3UA 2HUEA 1PW3A 3B9KD 5EBMA 1ZHLA 4P2RA 4HXBL 1CDYA 3HC2A 4K9EL 1ZLWH 1TZOA 3BVWA 3N1MC 4G7VH 1PZAA 5AOJA 1IKNA 5IQLA 4G42A 2LFGA 3MFGB 5C9JA 2IF7A 5LAXB 3V5DB 2I85A 2CKNA 2EADA 1BOGB 1KPUB 4M43H 4ODWB 3EYSH 3MSPA 5H94A 4L3ED 1HXMB 5AVWB 4M6OL 3P4LA 3Q1SH 4TL5A 4YNYA 3WTTA 5I8EB 3CZLA 3QUYD 3HFFA 4ZPTA 2XX1A 3DOIA 3IU4H 4TULH 2AABH 1YMME 5DURD 5AZUA 3MZGB 4U1NA 3D9AL 5TF1L 3V5DA 2V33A 3MUHL 4LIQH 3SZKC 4YHZL 3WY4A 2CLVB 3ECBB 1R3KA 3TASA 3UTQB 4A63A 4FNLH 3BE1H 1FZJB 4W9CC 3PWPA 4UV4H 4Y1AB 1H6UA 1MJUL 4P2RB 3DARA 1BZ7A 2GIYA 4PJXE 5AW8B 3ZO0A 1F6AA 2QR0A 5GJSH 4WENB 4Y9CA 3D48R 1CDIA 3P77A 5CO1A 4FG4A 4LNRA 3BZ4B 2F53E 1EJFA 4KKCC 5D5MF 2VABB 1BQRA 4GRWB 4I88A 4P2OB 1RZ8A 3ZL4H 4O2FA 5GGQH 5F3HA 3LS4L 3Q3GA 1GRWA 3CZKA 3QQDB 2F7QA 2QDVA 4WFFE 4PS7A 3AQZA 5DZAA 3I3DA 3LPGA 4IMKA 4NXKA 4RISL 3KYMA 2E9GA 5I1AA 2AK4E 5KVDH 2WINB 4ZFOL 3Q44A 2P44B 2HFFB 4OCRL 3QPQD 4AVKA 4OI8A 4TNWF 1P53A 2VJ8A 3BP4A 2W60B 3D05A 5C9KA 4HFWA 5B3JE 2E7DA 1I7TB 4HS6B 1WFTA 1G0XA 2AXHA 1WBYA 1W91A 4XP9H 2R1YA 2BIIA 4CMMA 1QVOB 4W9LC 4Z7UF 3JTSB 4L0PB 1AD9B 3SYQA 4L8DA 1YZZA 3CE1A 5SWSD 3NTCH 3D25A 4GKZB 3QDAA 5FO9A 3KPOA 1HYSD 4TULL 1OSZA 4I5BB 1MAKA 2VITB 2R56H 3HI1B 3WYRA 1JCKA 5I23A 3AXLA 2J8UA 2C1OA 1MAJA 4GINA 3NIGE 2OW6A 4NCC1 4N8UA 2XTJC 3WXWL 5DK0A 1U33A 4LKCB 4EIBA 4G59C 1L6ZA 4J8RB 3L4XA 3KPRA 4BK5C 4QXWA 3EO1B 3CFEA 2X2IA 4OM1L 4WY7L 4ELDA 4HXBH 3PS6A 1PQZB 3UXFA 1AE6H 1BG9A 1UA7A 2WQRA 4HFWB 4FTVA 3TZVB 1KBVA 2O72A 4OCSH 1S9XB 4GRLA 4NWTH 3UROR 4L3EB 5KVDL 5LG1A 1A2YA 2KLTA 5HVHB 1YY9D 3EW3B 4HJJH 2EIDA 4ISVB 5LQBH 2FIKB 5AVTB 4N2BA 2CNZA 3G6JA 1YNTB 5DR5H 5JXAH 3U4BL 2AJXH 4GAYB 4AIZB 1IAII 5IG7B 4WF7A 2CO3A 3I6GA 1S8DA 5F7NC 1ID5I 5LBSA 1HAUA 2FJGB 3P77B 3ELAT 1RI8A 3H53A 2H41A 2X53A 5D5MA 2AGJL 1E4XH 3QZOA 4KJQD 4Z7VA 3X1BA 2IXQB 3J27A 3F7PC 3NJLA 4ZDHB 2X4UB 3ZO9A 1XGPB 5DJCA 4KK8D 1TVHA 3LRGA 4OZGF 4N2NA 1AR1C 4NGHH 3D1MC 4JG5A 4FXLA 3QG7L 5E6ID 2BNRE 1GC1H 5HD8D 1NCIA 3NDYE 2NQCA 4HH8A 3L1FA 5E1QA 2H6PA 5A3ID 4U1NB 4Y5XC 5L2KB 1CBVL 5I0XA 1AE6L 2P80A 3LXBA 4NM4L 3VXUE 1F6LL 5LXGL 4FXGA 3WSQL 2KI6A 4XP1L 5HJDA 3JWOL 4MA7L 4Y2OA 1QSFD 4JRXA 1ZVSA 2AEQH 3WY3A 4IRZA 4PCKA 4BEIA 4D8OA 4E9VA 3UTSE 2PXYB 3GSRB 1EH9A 2DLHA 3G6DL 1CO1A 1BW8A 2J57A 3L2MA 2E86A 4HBQA 2CJTA 2Z93B 3SGEI 3ZRFC 4B9YA 5DVNA 4KRPD 4APQD 3RGVD 3OC5A 1D5IL 4MMZC 1MRCL 1IEHA 3FCSA 5J9PA 3ARWA 2G9HA 1KN2L 1NCOA 3TYFB 1AYRA 3L3DA 2EEFA 4NC1E 2FLBT 4NQVA 4G8FA 4ZYKB 2B2XL 1KJ3H 5HBBA 3TA3C 1F2XK 4H40A 3QAZB 5DI8B 2KUTA 2Q86B 3TPKA 1ACXA 4TSCH 4JY4A 2P5WD 3V52H 1PCSA 5EOCL 1K4CB 4OUUA 5B22A 5CJXA 5LBGA 1U3HB 3HRZA 5K1NA 3MOBL 3BD4A 2OX5B 4Y8DC 3ZLQC 4HIJA 3C75A 4ZSOA 3Q9PA 3FU5A 5HHVL 5GGTA 3M8OL 2IAAC 1I3GH 1UWGL 1IQDB 4YC2C 2DEYX 2AK4A 1EDQA 4AVHA 3LXUX 3SE8H 4XAKD 4WU7A 4R96B 1K2DA 1Z9OA 3QGVA 4YSSA 4TOYL 3UAJC 4YC2B 3KCPB 2PNDA 3U1SH 3EXLA 4YWGL 2NCEA 1KTBA 4PY7B 4GUPB 3SDCD 1KWKA 1QBML 2XQBH 3G6JE 2ITDA 1AO7A 5I0WA 3D39A 1B0GA 4XWOC 3AB0C 2QGEA 4Y16D 3D6GA 4MNHA 3CAFA 4FNRA 1MREL 5EO0B 3DX9A 3WG7B 2XZQH 5ISZB 4Z7AA 4DOHE 3VM5A 2CUHA 1RY7B 2PWDA 1HE8A 3ABMB 2VE6A 3THMH 1LQBC 3V0WH 5C0FA 4KI5F 4RFOL 2ENPA 4ZQTA 3QFGA 3V2AR 4DPAX 3O2VH 3L4ZA 3HLAB 3OKDB 3VE0B 4ELME 3OPZH 1DE4B 3M17B 3C60B 1ETZB 4P05A 4A6YA 2J1YA 3ELQA 3NZ8B 3FUMA 4AENB 2XV0A 3MI6A 3TFBA 5G4NA 5TQ0L 1Z0NA 2EJ1A 5JQHC 1TVBA 4YDKH 4XNQB 1I9IL 2A38A 5AUMB 3IK2A 2DIEA 4EVNA 1Q0YL 2FJUB 1MHCA 1QZNA 4EE2A 1BZDA 3T1WA 1JGEA 5GS2H 4ZOEA 1YDPA 2PUQT 2O4EA 3H3BC 3I75A 3NH7H 3CVIL 1RZGA 2HJFB 3P9MA 3PWPD 5ESVB 1NGZB 1ZJBA 1F42A 3QCUH 4KNUA 4U1GB 5TE4L 1VKXB 2ZPKL 4XMKH 1W72H 2NXZD 3CN0A 1I1CA 4FERA 3SO3B 4MNHB 1N5YL 4HHAB 1BZQK 1HAWA 5HGBA 2RAMA 4BFIB 3V0VB 1MIMH 3CIQA 3IJSB 1M56B 3E2HB 3L9YA 1A4JA 4RGNE 3X3FL 2F08A 1QI3A 1OCCB 2FSDA 3SGJA 2W9EH 4YEFA 2R29H 4J3OC 2XWBB 3FB8B 4R4FL 1CFSA 2DKSA 5HY9A 3V7AG 3GRWA 1I9JL 4ETQA 4GQRA 3S96B 1ZS8A 4OZHF 2HX9A 4ZFOB 4IJ3B 3KLSA 1RIHL 1E5ZA 1IE4A 3WU1A 1DQVA 3KGUA 2YGPA 2JI1A 1WAPA 3NVQA 4ZSOE 1JPST 5HHVH 3MRCA 3F12B 4MMXC 1DVYA 5I9QB 2A4CA 1VSCA 4PCSA 4H1LG 3OKEA 2WXHA 4F8TA 4UAOB 2BVOA 2EC9T 3RY4A 1HZHL 4NUQA 1D5XA 4KAQH 4OF5A 3VI4E 4XX1G 4KUZH 1FO0H 4EBQL 3O3DB 3KYKL 4PJXF 4CSPA 2PYEA 3K7UA 1N59B 2J1WA 3E2HC 3P54A 4MAYD 2RBLA 4AQ1C 2VN7A 2X4SA 4OGZA 3L5HA 2X4RA 1FGVL 2KLRA 3EOTH 4XC1L 3GIVA 3FTUA 5B39B 5F2FA 3KPPA 2AEIT 4PJIF 4LFHG 4KBPA 4YUEH 5T3XD 3DTUB 2IPTL 4NZUL 3TFKC 4K3JH 2E27H 5DZVA 3HCVB 2ZX5A 4ZNCD 4JRXB 5CFAA 5F9JA 1B4LA 4ZOBA 1AOHA 4C4BA 1QPXA 4X83A 1W0WA 3TCTA 4OH2A 4WHYG 1DYZA 2WD0A 4LOUC 5I75C 1YA5A 3EJUA 4U3CA 3MV9E 2ZP9A 4UIMB 5GRXG 3E6HB 4DQOL 4Q7DA 3VD3A 2G3NA 1TZAA 4QF1A 3LDBB 3ZSTA 2IDQA 2V9UA 2VC2B 4L8BA 3TBTB 2GC4C 4L4VB 1MFDH 5HVHC 5I5IA 2ZUYA 1FFTB 1FGNH 3SDAB 3HS9A 4FYRA 4HUKB 3QC6X 4KKBD 1S5IH 3JBG7 3QEUB 4JO4L 3FCTB 2F5AH 1OAXL 2JKSA 4KXAA 5CJXC 2K45A 3HZYA 1I9JH 1P84J 2IADB 2CD0A 1TKWB 4NN5B 1RULL 1G6RB 1NGYB 5E7FA 1AKJD 4JM4L 2TSBA 4XBGB 2FEEL 1WICA 3TO4B 1UT2A 3MRPA 3LEXA 3DIDA 4WV1C 2JIXD 1Z6JT 5JW3H 2P4AB 1PAMA 4BCXA 3CMGA 1V3JA 4YDJA 4WFFD 2Q3AA 2Q76A 4K7PL 4HJJL 4A6YB 1XWVA 4RESB 3LZPA 2GTZA 3CZEA 1NMCC 4PJ8B 5B38B 3D8MA 3HLAA 2ICWI 3QEQA 4O4YL 5AFAA 5IWLC 1WAAE 2EXWC 2NYZA 4CMHC 2F53D 3U7WH 4MJ5A 1NCWL 4WTXA 2R69A 1FC1A 1YYMH 2CO1A 4H44C 4TXVB 2IPUG 3RWDA 3KBPA 4OCLC 1T0NA 1XMWA 3FT2B 1KT2A 4A1RA 2K9FB 2AXGB 1IRAY 1U3HC 1OSPH 4LPWA 2ADIA 2FJHB 1HNGA 3FH5A 1NBCA 3D3VD 2XQYG 4XCEB 2VITA 1EWHA 2Y9RT 3QUHA 3Q7JA 3T3PF 4ODVL 2X40A 1SHXA 4D0CB 4GRWF 1R75A 1BMZA 1A8JH 3MTRA 1HINL 3H0TA 3ARFA 3P9LB 2DYPA 1OP3K 2GSGB 4E68A 4PWEA 2MHAB 1KYDA 1E7UA 4GH7B 4O00A 2K1MA 5GIRB 4GUPA 1JNHB 3WI9A 2Q0ZX 3EUDA 4LVNB 2JNZA 4WI4A 3ZKNC 4XP9L 2W0LA 3FB6B 3TNMB 4F93B 4LCCA 2WWMD 4Z18A 4FEMA 4HWUA 5C0BB 1PD6A 4R96A 5CGMA 1CXHA 5CEZL 1CU4H 3CFDA 1T1WA 3BKCH 4NQEB 4HCIA 1SXZA 2HLFC 4M5ZL 3QA3A 4QRRD 2VXTL 4GRLD 3RZCA 2V9QA 5D9SB 1OZUA 1M42A 1D3CA 4XN7A 1XIWD 4UM9B 4FMVA 3UJTL 1D7CA 2EE9A 1RKRA 2XWZA 3B6SB 3HN5A 5F7EL 3K74B 3GHEL 3O41B 4ESKA 3KPRD 4TTDD 1L3NA 1MVUB 5EB9A 4BDVB 2SODB 2AERT 1PX3A 4P46B 5HDWA 3OAZK 4AXWB 4XVTL 5KJ7E 1JXGA 1SDDA 1EHLL 1AQKH 3FAXA 3EJYC 5J6GA 3BZ4A 5KOVC 4AW4A 1WGVA 1YYCA 4G8FB 1HWHB 1UWGH 2D2OA 3X12B 1UA6L 3Q05A 3GXPA 2WXFA 4I77L 3OKLA 1S6NA 3M88A 3O2WH 1OAZL 1ZT7A 4PJAB 2BVQA 3IBEA 5HJ3A 3KPNB 4R3SA 3QJHA 1LP9E 4FQ1L 3QFJE 2J55A 5DU7A 1FZJA 1TQBB 2HMIC 1B9KA 1BAFH 1Q72H 3QZMA 4Y16A 1OV8A 3UBXG 4EZMA 4G43A 4RRPG 5TQ0H 1JZHA 4DK3A 4LPTA 3ZT6A 1YAZA 4P5RA 4U7MA 1VFAA 2QSCH 1NCJA 1U30A 3NIFF 1XCQB 3WJLA 3AADB 1KB9K 2CJUL 2L7EA 2KDYA 2XN0A 3SO3C 3TO2B 5I1EH 3DSFL 4RNRB 5DJ6A 2OJ1A 2DF3A 3QXVA 5CZKA 3VFTA 4PP2B 3JYBA 3FU8A 4J3TA 3VXRD 3T77A 1HH9B 3BT0A 3I74A 4C4UA 5MENB 4QNPF 1NOLA 3O6FC 1XEUA 5HHOB 4OKVB 4G7VL 2WQUA 7CGTA 2X4UA 3FH8A 3QEQE 4YXHH 4GG8B 5F70A 2YZ1A 4EN3B 1PZ5A 2XG5B 1H3TA 2CG9X 4U3SA 5FW7A 2BZ7A 2WXOA 3FQWA 2WNWA 5IHUL 1M7XA 4APXB 2YC1A 1A02N 2QT6A 4F7TA 3HHSA 1CGYA 4W4OA 2OTPA 2XTJB 4MQXC 4OFQA 3Q6GH 4AGOA 3T0VA 4HUXB 4C54A 1OAZH 2OMUB 2Y5TB 3ATEA 1GC1L 2Y2WA 1OAJA 4OJFH 2V9RA 3WFHB 4L1LA 4JFXB 4HIPA 3NESA 3RUGF 4JFFD 4NUGH 3I9IA 3FT3A 3KBHE 4JL2A 2X5PA 3GKWH 2QL1A 4MB3A 1Z66A 2ZICA 2ENJA 5D7IF 4KKCD 3GQFA 3U83A 4ZS7L 1OGTB 4I0PA 1X5LA 2R1XA 3P4OB 2XWRA 4GKLA 4LMQE 3VNZA 3LV3B 3S35H 1J9SA 3QORB 3ZBMA 2EKJA 3N1PC 2VDQL 1HH6B 4MXQD 4PJ5B 2FO4A 3SBRA 3T5WA 3ZYJA 4GKNB 3QUGA 1UEMA 4UI2A 3GBML 2IH9A 4BK5A 2BNQE 5FGCE 1LE5A 1JOIA 1MAML 5FS5A 5DK0B 1HL5A 1ZCRA 2FJSA 2MIZA 4GBXA 2WLZA 3HS0A 4NEHB 2ZXBA 3K4ZA 1YC7A 1B4JL 1NPJA 5DD6B 2AQ1A 5BNXD 2GT9A 1ZPUA 4FLRA 3LZNA 1TTGA 4HX1B 4Y7MA 4NHUB 4LGRB 3NEOA 5BV7C 3K0WA 3QK0A 4PJEE 4YHKL 4ZW8A 1MCPH 1QLFB 5HD8C 1IBDA 4DJMA 5E6SB 2UZXA 3ARYA 3TN0B 2YN5A 5BZWB 1R3HA 1BZ9A 1KIRA 1M71A 2H9GB 2W60A 1B2YA 4LHUD 3EDFA 4AMKL 2MOGA 5L8JB 4XP1H 1AZRA 2ZKWA 2R1XB 4J4PC 1RZ7L 2Z8VC 3IU3B 4XMUA 1USQA 1BXAA 3QORD 2VW7A 5FM5M 1OCZB 4JHAL 3ZUNC 4B5EA 1KB3A 5HYJA 1IEAB 1CYXA 4B53A 1NDGB 3A3YB 3H3KA 5EU7C 1FNEB 1NPNA 3VJ6A 2ESVE 2I7SA 4NAMA 4A6YL 2ZT9C 4P4KD 3SPVA 1OKEA 1BBJA 3PQYA 5E08H 3GI9H 2QVKA 2IAMA 5FUZL 3QG6A 3LB6C 4OM1H 4WY7H 5E2VL 3NJGA 3MQIA 3S35L 2XN9A 2VXUH 2ILLA 2WLIA 3CFNA 3QE5A 4PHXA 1QNIA 3HHSB 1RPUA 1VZIA 1ZV9A 4XN2A 1R47A 5EU5A 5FOJA 3MNZB 2DM3A 4KNTA 5I1KL 4U3SB 3K6FA 3TS8A 2XTJD 4ZOCA 3KJ6L 4CU7A 4GG8A 1W0VA 1H5BB 1N3NA 5SWZA 4YDLC 1AGEB 4Y1AA 1AR1B 3NABL 1R3KB 1MHPL 5F1NA 3UTQA 1TDQA 3FTWA 4AQ1A 3QXAA 2WTOA 5SWSA 1CC3A 4XTRC 1IGMH 4KVNL 1G9NH 3D30A 2AQQA 1I53A 2XRAL 2JE8A 3LH9A 2DQCL 1X5YA 3G6AB 4ZAKD 3ZHFA 5IHWA 1QI5A 4MAUH 1HXMA 3TA3A 4OD2A 1ZGLB 3DGDA 4L2YA 2OSLB 2C4FT 1OO2A 4EDWH 1WZ1L 2OCFD 4V11A 1U95A 2AEWA 2HRPH 3ZE0E 1JBJA 4JHBA 2YQ3A 3IYLW 3PHQB 3VTTA 4QDGA 5LWYL 3C87A 2ZWYA 4ENED 1XF5B 2CPCA 4L0YA 1LO4H 2OL3L 2WN3A 2X1QA 2XXFA 4HIEA 4LVOC 1SYSA 4GW4A 4GPVA 4PB0L 3ILQD 3L3GA 3U7YL 5F7FA 2OQJA 1CXEA 1EDHA 4CADB 2WO3B 4H88L 5I1CL 3QJVB 4GMTH 3ZTJH 3QQ9C 4OJEH 5HGDB 3BSGA 4ZO9A 5TQ2L 3PXHA 4MDRA 5D1QA 4S1RH 2YEZA 4BH7B 4X5WA 4XO5A 3CDZB 3BH4A 1FZOB 4B95C 1JIBA 1QASA 4WFHD 2O5XL 3LEYL 2V5MA 5D6CB 5DK2B 2Y0SA 4FTDA 3DX4A 1HHJB 2P7TB 3V8OA 3DETD 4L0ZA 4A2FA 1D6EB 1G0DA 2QHRH 5C0BA 2PXYD 3PNWB 2YS4A 2WUCL 2QBWA 4MFHA 3RIAK 1WLHA 1O9ZA 1KBKA 1JSYA 4J3OF 4C83B 3WS3A 1I75A 1MCHA 1SUHA 3ARGD 1EZSA 4Y1SA 5H35A 2EZ0D 2Q2LA 4QHLA 1NC4D 1MW0A 2BDNH 3MYJA 5D2LF 3QISA 4A2GA 3WN6A 1BFSA 4R0LB 1UM6H 5C08B 4PRID 4EZKA 1KWGA 2J88H 3F04A 1DVFB 1D6VL 4POUB 4X7TA 5F6IC 5JDSB 4HUWA 1SVZA 2HYMA 5TTRA 2MNWA 4N2HA 2DQTH 2IH8A 2QKIA 4CN4A 1T2JA 5I8CA 1V54B 3C09B 4XVTH 1TYRA 3TVMC 4X99B 4JFPA 4Z7IA 4HK0A 2NSXA 2D7MA 3BWUF 4PJIA 3H4HA 1HSBA 1TTRA 3FUFA 4ZZFA 1EJOL 2XIDA 4YHPB 2DJ4A 3IKKA 1GXEA 3X1GA 4Q14A 2D3NA 1X5MA 4HPOH 5T33L 4JZJC 4YK4B 5DQDL 3WN5B 3MFFB 5T1DH 1U0QA 2NY4C 2KZ1B 1TKWA 1M1XB 2WBWB 3GXFA 4H8PA 3HZYB 2IBBA 1SBBA 4CN1A 3BXNA 4QHMB 1IAIL 4JKLA 5DD1L 1CGUA 4P2RE 1OTTD 3SDAA 1U8QA 3SGDH 1WDAA 2N0MA 2XN9E 3ILPA 4R8WL 3VWJB 5K9QG 4L4VA 4DVRH 2FLRT 4Z7UB 5JHDA 4FQHA 4QHNA 2M8XA 1E4JA 3LX9A 4BFBD 4DGVH 5IB1B 4NI6A 5EC2B 5ENWB 3GXNA 4CN6A 4M7KL 3BHBB 4Z78B 2E7MA 4XP5H 2DWDA 4K94C 4LLVA 4Q74A 2GBTA 3FRUA 3BFOA 4UQIM 3S8WA 1BFVL 1MCWM 2W9DL 1U58B 5ITBH 1VIWA 5MHSE 2DL2A 3K4DA 1MWAA 4KK5D 1X5ZA 4POZD 5A2JH 5BRPA 3UTTD 4JHWH 4O4YH 3RFZA 1TSRA 4XWOD 1NBYA 3FW6A 2TAAA 3C08L 5D6DC 2PP8A 3H9YA 2GI7A 3LPFA 2DQEH 1LYQA 3FSWA 5HHMB 1UADC 3JWNE 3AT0A 1OB0A 2VGLM 3T8XB 5C0GB 2E4FA 3OB8A 3L3IB 3US1A 5I74C 3HNTH 2UXFA 3LZFL 2DQFA 4MJJA 3APDA 3GS7A 3WIHH 1IZKA 5F9OL 5KYXB 2OTUB 1JTTA 1R3IH 3NIFE 1OF0A 5AAMC 3APFA 1EEZB 5DJDA 5ICYB 3PYCA 1A25A 2VZUA 4Z3FA 5K1VA 1EMTL 2PYEB 1CICB 1F4WH 2BO0A 2BSBA 2FR4B 2G2PA 1PYWB 2P24A 4KO9A 3FSAA 1OM3H 4PREB 3BAKA 3OB0K 4U3HA 4ELKA 4PG2A 2GJZB 2JQMA 4YE4L 4YSDA 1N0XL 1YEEL 5DJ8A 3MLUH 1JJUA 1AXSB 3V0HA 3QJXA 5AOMA 2E9JA 1T2XA 3PABB 3KPQB 4UT7H 5DCCA 3GSVA 4X4ME 3FF8A 4F5CE 4PJHA 4H8WL 5KBLA 4I0PD 3ZGHA 1AKJA 1TNNA 2WCGA 5FGBA 4L8SC 4F8LA 5AOZA 3CWGA 2BVYA 1K9TA 5D55A 4EDXA 1XZ0A 1QO3A 3L4WA 4L5FL 2NX5B 2H3NA 2H1PH 1GKOA 2UWEB 4IS6B 4OLUL 4XXCC 4HA1A 1YEIH 2BXYA 4OAWB 1CE1H 2CBOA 3TJHC 5I30L 1KBGL 1N9PA 4DPBX 3IMRA 1BZEA 3S2CA 5AL8A 5I76B 5KS9A 5FCUH 4IGBA 1HHKB 1MCFA 1J0ZA 1CYWA 1Y6KR 4FG0A 3I6LE 3KM2A 1LEKA 2K3HA 3WHXA 3AS2A 5DD3H 2I26N 3CBJB 2FYVA 3TV3L 5DO2D 3UBXB 4BA0A 1PZDA 4JGNA 3GXTA 2WIMA 5J3HC 4IHOB 1TITA 4ZMQA 3DO3A 1CQKA 1YEWA 1REIA 3KHOA 4FQXB 4I48A 5C0IB 5EIIA 4QCIA 4X4XB 3WIIL 2VR7A 4G9DB 2AGJH 3TWYA 1GR7A 3II3A 1L9TA 2L7JA 1HCFX 1YG9A 3Q06A 4XNQA 5AUMA 3MLPA 43CAB 4G7QB 5EU6E 3O0LA 4I1NB 3CN3A 1R6VA 4NQSA 3VXUB 2ICWB 3MROA 1N4XL 3MGTB 1S7VB 2B5IC 4Y2DC 2G75A 4BFJA 2ZG1A 1N5YH 1KENL 3DA0A 3UMNA 3MLUL 5CXPA 5TDNA 5J8OA 1BQHA 1DL7L 1ND0A 1NGQH 1KEML 4TQEH 2YUVA 4J39A 3MV8E 4U2YA 4EIZC 3QYNA 1C12B 3GLZA 1U92A 3UG4A 1UD8A 4DQOH 1XH3A 1J1OH 2A6KA 3TGXA 4NQTA 1X7SA 5D5ME 3BYYA 3EHBD 4KQ3H 4PTTA 3RA7H 1RV6X 4TPRL 2WVUA 3MBXH 4FG6C 3O6FA 1AGDA 1B2WL 3UMTA 1K6QL 4PP1C 1XFPA 2EDBA 4MJID 1C16B 3F7KA 1DQDH 4XBMA 2ITDB 2ZIDA 5I66A 1A6AA 3D3VB 3BKML 3C8DA 2A1WL 5MEOB 3BEWB 3KDPB 1YEDA 2XICA 3V9EA 5IR1B 2WMPA 1AS7A 4J3OG 4RCAA 5INCA 3THML 1IX2A 4XO4A 5CSGA 1OARL 5IKCB 4ZUSB 3FO1B 4N25A 3T6VA 3UPAA 5DS8B 2VRKA 2UZYB 4U4IA 1MVYA 1GTFA 4AY0A 1NGPL 4M6AA 1JFHA 1DLHB 4GOSA 2EO7A 4ECNA 2A2QT 4WUUD 3O3EB 1NGWA 4Y16C 1NC2B 3HIZA 5BRQA 4E41A 4W6WB 3F3HA 1V27A 3D39D 3RDTC 2I9TB 3OXSB 2LV4A 1ITCA 3VYPA 2CK0H 3DV4A 3L7EB 1DDHA 4HJGB 3IFNH 3QH3B 1KYOJ 4NZRH 1HN1A 2GYSA 4JFFE 1JK9B 3G7TA 3GUTA 2WYIA 4FNPA 1IM3A 3GSUA 4NS0A 5FYKU 4RISH 3CUPA 3T65A 3UZVA 4BV1A 5CZXC 3QFDB 4ZMXA 4ZUTB 3TH4T 5J5EA 2FHBA 4WFGE 2VR9A 3GMNA 4Y19A 2VLLB 3L3DB 4O9HL 2B14A 3GGWA 4O58L 2E9WA 3CU1A 3UC0L 4S2SA 4FYTA 3SDDC 4I2XB 5J9PB 3ZSSA 1EZVX 4GAGH 4F33A 2YAEA 3QC5X 2BOBB 1N64H 1N5AA 1PZSA 2CM5A 3KEHA 2NDGA 3QEQD 1J9QA 5KBKA 1HX0A 4RMWA 1W15A 4J8QA 4D0DA 2OSWA 4BE6A 4FZEL 1MCCA 1TFPA 4NIKB 3UZQA 3BCDA 4TNEA 3S5LB 4HIHB 1DQQA 5AALA 5EV7A 4F7CA 2JCCA 4CVZB 5IUCA 4U1SB 4PJHE 1KELL 4LCYA 2ETWA 2AVFA 4LCVA 3PWJB 3ILDA 3K80A 4JJOA 5E5UB 1FNGB 2J12B 3R1GL 2CLRA 2P8PB 4QO1A 3X1EA 1VGKA 2GVYA 1V7ML 2BSTB 4O2CB 3O3AB 1DJWA 3N42B 1UURA 3OAZH 4N20A 4U1LB 4YXKL 4MB4A 4Z7VB 1MI5A 1D5BA 1X7QA 3BISA 3CZSA 5F7WC 1S7QB 2K70A 2JKXA 5K39B 2X3AA 2AJUL 4M6ML 3K6SB 4FF9A 1SLXA 1GVIA 2DKUA 3VXTB 4J3BA 1P7QB 2VDKH 4PRDB 1XCWA 3R18A 3ZMEA 4FZ8H 4PRHE 4TUJB 4XPHH 2HFGH 4BSWA 5I1HL 2CBQA 3A6CL 1MCBA 2JB6B 1XSOA 2FHFA 3C5JA 1G94A 1XSJA 3UPRA 4UZGA 4JFSA 3WXVL 4ZAKA 3BDBA 3ZDXF 5F6IB 1E30A 3KXFA 4M5YH 5GHWH 4PJGA 5EPMA 4XP4H 2AHIA 2KS0A 3B1TA 3LIZA 4HOWA 1U8CB 4QRRE 2XWEA 5CP3A 5FC9A 1U93A 3VG0H 5AAWA 4PI0A 1OB1A 3JWOH 4MA7H 6FABH 1HNFA 2WW8A 4BKTC 3KPRB 1IO4C 2OSYA 1C5CL 2ATKA 2PO6B 1A4BA 3TCLB 3U1SL 2ZOKB 5FUCE 3IXTB 1FV1A 1ZXQA 2VR3A 1I4FA 1KFAL 3EFOB 2ZUXA 5EU6B 3A67L 1ERNA 3A6OA 3GJFK 4IBQA 3EH3B 3LRMA 2WXQA 1JWUB 4ZTPH 5I18H 4BFNA 1IL1B 3CZUB 2W88A 3MGOA 1BVNP 4IHBA 5E8EA 2F8OA 5ITFA 3FF7A 4GMSH 1GJUA 2WXJA 4UILL 5DZ9A 1KTKE 1JS4A 1ZD6A 4K7PX 2DM7A 5B39G 1BEXA 1WE5A 3WIFB 5C0EA 5K59F 1LEIA 3HA0A 1AQDA 3T2QA 3MRBB 1CFQA 1KIQB 2NW2A 4JFTA 2GSIA 4WKZA 2XWJA 2X1OA 4WTZG 3VGHA 1JDAA 2FB4L 1T4KB 5LVEA 4JS7A 1Q90A 3RWIB 1QNZL 3M7FB 5IB5B 2EIZA 3B8SA 3HZMA 2A7BA 1DCEA 1QFUL 2WINA 2XWCA 3O6KL 1Q9OB 2VXQL 5BZDB 3SD5A 3LIUA 4JRXE 1OVZA 3V55A 3VDAA 2NY1B 1O6SB 3BZ5A 4E42A 5I82A 3RX5A 5JPNB 1T04A 3BQUC 3H9ZA 4Q6KA 1OY3B 3QUXA 4FJ6A 3R06B 2PTVA 2X4OB 1SXNA 1UFGA 4YHOL 3QJFA 2FYYA 4BKSC 2BSED 1U8HA 3H9SB 3MLYL 1L9RA 2R69H 5HGAB 4DAGH 5I0DA 2AV7A 4HKXB 4XXDB 5DRZB 3KYAA 4IBVA 1ZWIA 1M05A 2PPDA 3FQXB 5D7EA 4G7YH 1GS8A 3CV5A 1MCQA 4Y4HB 1JRHL 5SWQA 3WE1A 4BBWA 2QV4A 3GMOB 3O4LE 2FO8A 3UPCA 3ASWA 1PZ3A 3DSNB 4JVWA 4QEGA 3V4VH 3TEUA 2WXIA 4JPWH 4LGPB 4BSVB 4OFYA 4PVNA 2ITFA 5DUBA 4FDWA 5DRNA 1GY1A 3AT9A 3N0PB 2Q8AL 2XY2A 4Q6IC 2DV6A 1NGXA 4R7NB 2A3TA 4YE0A 4PRAA 4HUUB 1PSKH 2Y36L 4TPRH 5ICUA 1BOGA 1S7RA 2OTWA 1CQYA 2OMZA 1FBIH 4JFDD 1CDCA 4UM8B 2F19L 4LVEA 1DSFH 3QUXD 3VRLF 3BWUC 1DBBH 2X9WA 3N0AA 2FJFB 5IMLB 2J25A 2D7PA 3IB4A 4BYHA 4WUUA 3CJJA 3A4AA 1GPOH 2FGWL 3ATAA 4FGMA 3N9GH 4G6FB 4HKJB 4IDJL 5FA4A 3SE4A 3DURB 4PI2A 1AGBB 1NJ9A 4WTQA 5G55A 1MI5E 3S37H 1H3UA 3I85A 4DSYA 4EI6A 5F3BB 2ZUTA 2E7HA 3S7GA 1ORSB 1ZT1A 2EIJB 4P9HC 5HYIA 3MACL 4FXTA 3DI2B 4WAFA 4ZFGL 3F7VB 3F7RA 4PJFA 3WEAA 4WNQA 3B9KA 5FA3A 3KNBB 3RY6C 4MJIA 2QQLL 2HB0A 5LNDA 3OM3B 5JMRA 4RGOL 5EN2B 2FIRT 1MJJA 2R9HC 4I2XE 5HJGA 4ZUVB 4LLUA 3SE4C 1DJIA