1J8SA

Papg adhesin receptor binding domain-unbound form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
b'WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYELONEPHRITIC ADHESIN
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
total genus 41
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8sA00
1J8SA 4Z3EA 4Z3IA 4Z3JA 4Z3FA 4Z3GA 4Z3HA 1J8RA
chains in the Genus database with same CATH superfamily
5CLYA 4IIZA 2QQQA 4HJGB 1C16A 2P28B 3QPXL 3HHMA 2YO3A 4AMKL 4PJBF 1OGAB 4KROC 5CWSB 1GGIH 4M1CC 4GP8B 4HULB 1NCAL 5EH1A 3L1OH 1QQDA 4WO4D 3BVXA 4OI8A 4Q2ZA 5DUPH 5DK3A 3HFFA 4RWYL 2D9QB 1MFDH 1E9PB 2VDKB 3NZHH 4FAAB 1JYXA 3TZVD 1EANA 2X3AA 2YKLL 5M94B 2F7RA 4JJOA 3DX9B 1KCLA 1QPKA 4U6YA 2DM7A 3GMPB 4U6TA 3SHSA 4FQHB 1JTOA 1QOKA 1T03L 4XBEL 5AW7B 3QEQE 3TA3A 4ERSL 3B56A 1CDUA 3BUYA 3LQMA 4XO5A 1TYEB 3ABZA 1P4IL 3PWLB 1KUMA 5IJCC 1OHZA 4Y5VA 1SQ2N 3UGEA 5CCHE 3GBDA 2E59A 4NHCH 3GXNA 3LKNB 2HVJB 4N2GA 4OJFH 3HZVA 3RWHB 1XGRA 5IM7A 2AC0A 4L37A 1GW6A 4L8SA 1MRCH 1GYCA 5KVEE 4Z7QF 2V7NA 1VRSA 3PABA 1U8JA 4E41D 5HXMA 2GJ6D 5IKCB 4E68A 1EXHA 3CVIH 1FO0B 4IDLA 4TUOA 5D6DA 5J0BA 5SV3A 2HN7A 2WINA 2Y3NA 1QBAA 4MJIB 1NBVL 2C1PB 3V0WL 2NTFA 1U3HC 4JN2A 3OHXB 3TN0C 1CQYA 2XCMC 2BSSB 3O3BA 2BHZA 3HS0C 3LNFA 4JM2A 3QUZA 2MMXA 4XNMA 1VEOA 1OGAE 4XHJC 4EAEA 1S7WB 4AKQA 4OF3A 4CC4C 4GXVH 4R7NB 4D0DA 4L9LA 3I85A 5E9DA 3RFZC 4AK2A 4FQIH 5EB9A 1K8DA 1LHZA 1AO7D 4H1LG 1U41A 5E99L 3GLEA 3UFIA 1CO1A 1FVEA 3BWAA 5IIEB 5EIIA 1MJUL 1IV8A 3SBQA 1AY1L 4AL8C 4F93B 3ROLB 2RB8A 3QDGD 1AS6A 1ROWA 4PB0H 5C0CB 5TDNA 3X1NA 5BW7A 4LIQE 2VN6A 4XN7A 4ETYA 4F7TB 4JLRB 3MX0B 3LV3B 3ZMRA 2RCSL 4BSVB 1QNZL 3UTTA 5C0RH 1G7PA 1XGUA 2BCMA 3MCYA 1JCKA 4FQLH 4OZFH 5EZJA 3MCLL 4RFEA 5FM5O 1OT4A 3KVDD 5JQ6H 4XMVA 2D3NA 3WXVL 1USQA 1GW0A 4LPXA 2Q86B 2IDQA 1MJ8H 5MHSE 1MAKA 3T2LA 1NTDA 4CNIB 1DHKA 3DVFA 5A7BA 1JNLL 4TQ8A 5F7MC 2WXLA 4UZUA 2APVA 1L9NA 3C5JB 3GIVB 1HHJA 4MJIE 5GS1A 1OQXA 3SY0A 1LXMA 2VDPB 1TMQA 3BWZA 4W9JC 1AE6L 4X7DC 4YHNA 5MEPB 3REVA 5HYSB 1S7XB 2NSMA 2VNCA 4K7PL 3O6FC 3VG0L 3ULVL 1VGEL 3W1ZA 2RAMA 4N0YL 2EDYA 3O9WA 3ZTNL 4UZSA 5KAQG 4JZNB 4G8EB 3LN4B 1P4BH 1MDAA 4PW3A 4H8VA 5IOKA 3W0WB 2B9BA 3FRUB 4PJDB 1J12A 5HVHB 3PNRB 1AACA 2PP8A 5AVSB 3MRJB 3S98A 3TF4A 1SJMA 1G0XA 4Z5RB 3GLDA 1BM7A 5EORL 1QD0A 2VO8A 4LEOA 3C2AL 1PZCA 2CIIB 2FBJL 3GLAA 2H26B 1C8QA 5CP7A 3JV5A 3AG4B 3PWUA 1WGVA 1RUAH 1BQSA 2CU9A 4WO4C 3DV4B 2CDGB 5EUOA 5DT1L 3LEVL 3MV7A 5C0CE 4HK3N 4NOBA 4XO3A 2FWLB 1AGCB 2NY5C 3AS2A 1NGQH 1SYSA 3II3A 4YHMH 3WN5A 3T2QA 1KULA 1UASA 2WWOA 3TZVC 2DWEA 3K6DA 1WAAE 4UT7L 1FIGL 3AMLA 3PJSA 3A4DA 1ONQA 2IXQA 3NFNB 4N20A 4QCIA 3EOAB 4YX2H 4GKZB 4LOFA 3BPCA 3C09C 3CPLA 1IBDA 3L3JB 1T83C 3OC8A 3BP4B 2PN5A 3HC3H 2Y22A 1G1YA 1JWSB 2EINB 5FYJU 4P4KC 3C6SB 3IKKA 3CZEA 1RUKL 3BEVB 2X1WL 3I9GL 4UB0L 5EN2A 1WD9A 3NFSH 5C0BA 1E5BA 1SNRA 3TFKD 4RAHA 3BKCH 5IVNA 1N0LA 5DZLA 1A66A 1RK1B 2XQBH 5HGAA 1K4DA 4X7TB 4XMPL 3QDMD 4MX7B 1V27A 5ESVA 5J13B 2R7EB 2AFNA 3LZPA 2C3WA 3LKQB 1J5OL 2B5IB 3I6KA 3W0WE 4PJDE 8PAZA 1Y7VA 2ZG1A 2GFBB 1VCAA 5CSGA 4LRNH 1Z5LB 1RQ5A 4XVTL 4NCC1 1Z6JT 1MIML 4CDHA 2XG5B 1O0VA 2AJVH 2K7QA 4R0LA 3VA6A 3T0WA 5HDLA 1MHCB 5DJ2A 3IPBA 5JW5B 2QSVA 3Q6FB 1OSZA 3BH9A 1EJFA 4IHOB 1TENA 2AQ2A 3ETTA 4HIEA 2JTYA 1SMOA 5ESQA 4OB5H 3HCVA 3AWEA 1I8MA 3FSZA 3ZJAA 5ADPH 1DZBA 4N28A 4CA4A 4Q6KA 3FO2B 1DQTA 1ES0A 5HYJA 4U1HB 2DQFB 4LLMA 1U4EA 4ZMLA 2FJUB 4LCCB 4B9JA 4NYLB 1AC0A 4UZGA 4F33A 5IEHB 3MJ6A 1NMCB 1S9VB 4LL9A 2OJZH 4APQA 2Y2WA 4AGOA 1SVCP 1P5UC 1QFPA 2NZ1A 1AS8A 2Y7NA 4XXDA 3MJ7A 2A2QT 5EEWA 2QKIB 3VFUA 1T7XA 2VSKB 1E7VA 3FN9A 3VFSB 1JZ4A 2SEBB 3CFUA 4EI5A 2XWJA 15C8H 2B20A 1XCTA 1EWHA 3O2DH 4KWUA 4B27A 2AJYL 4ZNEE 1A1OA 4MB4A 4XCEA 2ZKHH 3QZOA 3IDNA 1ZS8B 2FO4A 3SIKA 4N2MA 4J3WA 2WW8A 4HCIA 4R97B 3IFOB 3LH9A 5LKNA 1WWCA 1N5AB 1XFPA 4O02B 1IAOB 2KPWA 5EU6A 1OT1A 1JOIA 3B37A 4I85A 4PJBA 1IM3B 4EI6A 4EVNA 1F42A 5BVPH 3CZGA 3PGFH 2Q7YB 3QQNA 4G9FD 4KQ0A 1IKOP 5D96B 1EX0A 1F1GA 1IC7L 4C4UA 2BX5A 3QEHB 1BD2B 3KEDA 1QFWH 1MF2L 1PS3A 1RZ8A 4G8GD 3POHA 4AEEA 1KGIA 2D03L 4LASL 3QR1A 4PJEF 2X4RB 1NZRA 2OSYA 4NNXA 4FI7A 4XC3L 2PR4L 2K1MA 4Y4HA 3VRJB 5I1AB 2QTVA 2FO8A 4HUVA 2LT9A 2KZBA 3B3IB 1JPFB 5A2LH 5C0AA 2VXUL 1LO2H 2EVFA 2FLMA 1IGMH 3UAJD 5L88L 5LQBH 4QXGL 1CDBA 2WK2A 4Q6IA 1JDDA 3KGUA 2VZTA 3OXRA 4NHUB 3RWIB 4ZYKB 1L9QA 1WWWX 5KBLA 5HVFB 3MJ9L 1VKXB 3BDYH 2V9UA 3FJTA 2C4XA 3KYNB 3AMKA 4YBLB 3LMJH 4P46A 2J25A 4G6MH 1XZ0B 3RGVA 2A0LD 2UX6A 2FWOB 4NKMA 2YOAA 4XP9H 3KS0H 2VAJA 4OSUL 1JYVA 4I18A 4XZ4A 2OA9A 5HI3D 2VL5A 3S5YA 5B7MA 1ZT1B 4KTEH 5JTWA 2VQ1B 2OQJB 4AZ8B 1KGUA 3OB0H 4MWFA 4BQBA 3Q2VA 5DTFA 2CJUH 3QFDA 4ZZFA 1OTTD 4FABL 2QPFA 4PLOB 3SDCD 3TFKC 2Q10A 4KJPC 5F3FA 1AR1D 1V7MH 3MNWA 2DZEA 1XSJA 4Z7NE 4GUOA 4N90E 3AVEA 1UCBL 4PCSA 3ARTA 4PREB 4B6ZA 4NC0B 4Z7WB 2EVHA 1RZKL 5D1ZA 5F96L 4YLQT 2EECA 4TVPL 3BE1H 4FFVD 1BD2E 5SWQB 1S78D 6FABL 2B39A 1RMFH 5KG9B 3N40F 3KWUA 3DX8B 5AVZB 4O2EA 5J8OA 2ARWA 3IDYC 2E4TA 3ULUH 1Y6MR 3P0VH 3TT1L 4CADA 5FEBA 1R3LA 4BBWA 2Y23A 3RY5A 5MP6L 1TQSA 4HMEA 4MA7L 4L8BB 1FZMA 1MFVA 3D0VA 4S2SA 1PNDA 2P1YA 3KPLB 2V3EA 4LK4A 5AB9A 2R0WH 4Z7AA 3PAZA 4K9EH 2GUOB 4NT6A 3MRNA 3KL5A 2QDWA 1OAKH 3RJDA 1I4FA 2WVVA 4AIXA 4YAQA 2BZCA 2OXHA 4WNQA 1JUFA 1GR7A 4JGUA 4Q7DA 3S35X 2QGBA 4UTAL 4QTIL 3RL1A 4BGLA 4MJ5A 4F27A 5CLXA 4ENZA 5KJ7E 2EKSA 1D7BA 2EYSA 1A6AB 1N6VA 1BVLB 1MLCA 2WGNB 1XF5B 1W15A 2J8UF 3DXAA 4NO5A 3VXSB 2NOYA 2YGNA 5AB0A 4X5RA 2YMXH 3MJ9A 3T77B 4TNVF 1FZKB 3JUZA 1U95B 3UYPB 5KVDE 2WXKA 1XHHA 1AI1H 4PMFA 3FSOA 1PVHA 3A6CL 4MAYA 1EFXA 1NUGA 3DETD 3TO4A 3IKCB 5L8JB 4Z7WE 3RNKB 3T9WA 4RGNB 3NIGF 4QNPE 4Z18A 4YE4H 1OAUH 5HPMA 1JZJA 4KKNA 2IH1A 2H0EA 1TJHL 4N2LA 4XXCA 3NJIA 1HZLA 4OV6F 4YZWA 3CLEH 3OKMA 5AAPA 4Y9FA 1A21A 1C5DB 4XCCH 2ERJC 3OX8A 2LABA 3BWUF 5CIPB 4GQZA 3QNXA 1HEZA 1GAFH 3GTVA 2H7WA 1CXEA 4OD2A 3OSVA 2NMSA 3V0FA 3I6SA 4HJIA 4JRLA 3OZKA 3PWVB 4G6JH 5AZEL 5B8CB 4LAJH 2VDQB 3L3OB 1XGPB 2AK4E 5HHXL 4PWHA 2F61A 3Q7JA 5AVRB 2Y1VA 1MREH 3TX4A 4HJTA 4DPCX 4GRLB 3IMRA 2F8XC 4DP4X 4P3DB 1SF5A 5IW1A 5T1KB 2GEQA 5FM4A 3UAJC 5LUMA 1WC7B 4JO4H 5MERB 1HNFA 1C5CL 3MLUH 1NGPL 4ZD3L 1O5PA 3H7BA 2Z3FA 3M1OA 2CO7A 1QI3A 3GSUB 2B15A 3M17B 2A0LC 1XF1A 1ZXQA 2G9HA 3VXSE 1U92B 3BZ4A 2E8ZA 4BZ1H 4GW4B 1MN4A 4XAKE 1GYVA 4XP1L 4PRDB 5HI3C 1TDQA 4QJ5B 3IFNL 2HRLA 5A40E 1FFOA 1YJDH 4Z7IA 3EOBA 3WFHB 2LFEA 2J1XA 3KAAA 4RGNE 1OTTC 3UBGA 2MQ3A 4ACPA 1OQOA 4X4YA 4YLCA 4N2HA 1TXKA 4AEFA 1E5ZA 3KBEA 4KOCA 4NZUH 3SDCC 3MFGB 5C0DB 1JTTA 5I24A 2JKRM 1AR1C 1OLZA 5DUML 2VITB 3L3GA 2R83A 1N8ZA 2FIKB 3DVIA 4OGZA 1C12B 2CBOA 1WZLA 2PWEA 2B1HL 4EN2A 4P3CL 3FFOA 1S7VB 1UKQA 4FFVC 4QT5B 1TO4A 3GNMH 2X6BA 1S78C 2B59A 3IDIB 1ZSDA 4PJGB 4RFNC 3TIDA 3DVGA 1WCBB 2VDLH 3GMRB 4KJWD 5DJZA 3PDDA 1A6ZA 1NAMH 4KXZH 3HR5B 3UGUA 3OR7B 3O3DB 4GNKB 5ID0B 4M7LT 3DMMD 4KKZA 2YD4A 1ZVSA 3CVHA 5TDOA 5KW9H 2H6PB 2I9LA 2JF1A 3L7EB 4MNQB 1N6QH 3C6LC 3BO8B 3BZEA 2GT9A 3GWJA 2UWEF 1DP0A 1HSAB 2P47B 3FOMB 1L7TH 4O00A 1JHLH 1NBQA 3K72B 5EC1B 1J05B 4ICXA 3BP7A 4MMYA 4XGZB 3GSXB 4Q97A 5HGHB 3D6GA 4PGEA 2WWKO 2CNZA 2J6EH 1QFUH 2JXMA 2OL3L 3MRMB 4MJ6A 5DURB 3WXWL 1MCPH 5C8JB 4UCFA 4P5KB 4C54A 4JFYA 1AQDB 2VLRD 3G5YA 1JD9A 5JHDB 2YEVB 2X6CA 4GBXA 3S3DB 1A5FH 1YEJH 1ZT4A 4FTVB 1ANUA 4PS7A 4WW2B 4D0BA 3IFPB 3IGFA 1UWXH 3OD3A 2JELL 2QLYA 3MO1A 3EYOB 4KMLB 2VJ8A 1T1XB 1BFOB 3NRQA 4I5BB 4JFHD 2QVTA 1O7DE 5I1EL 3TESA 3HI1A 3JZ7A 3MXWL 4P9HL 5BS0B 3O6LH 3BHBA 4Z78B 1MNUH 1XB6A 2FEEI 3DETC 1TJIL 4UDTA 2F5AH 2GBAA 2DQJL 2FEDD 4XB8A 4ZOEA 1M4KA 3N85L 5GS3A 1QSEE 4PM1A 2XI9A 4PJEA 5TFSH 1LJMA 1Z1WA 2A6JB 4HA1A 4JR9H 1IRAY 5AZUA 3ZOAA 3EYFA 1G9NC 3GSQA 3TCLA 3BQUC 4MAUL 3GGWB 3STLB 3SB3A 3G5XB 3QIWD 4ODUA 3WV0A 4X9HA 3SBPA 2IPTL 2J2ZB 2NY4D 3B9KD 2PCXA 4B9YA 1P6FA 3UZEA 4EBQL 5L2KD 2ICCA 3MVSA 3OTTA 1DJSA 4MNQE 5D7JB 3BESR 4Z23A 3RWJB 4L4TA 4TXVB 3F12A 2HTKD 3HG1B 3HVNA 4I77L 3HMWL 4L1LA 1A65A 3KBFA 3M45A 4X4XB 3BEWB 2HXAA 1U2HA 5MEND 2BHUA 1ASPA 1SM3L 2XTJE 1FSKC 5DMGD 5JHDE 4Y5XB 2AV1B 3C5SB 1QLEB 4FTVE 4X5XA 3KYAA 3BXNA 3GKWL 4CSPA 3O4OB 4JHAL 1ZJAA 1FE8L 2OW7A 1CMOA 4LLYB 3LHPL 1MW1A 4FKKA 3ZE0F 2VRAA 1FYTD 4IBTA 4OF5A 1CI3M 4KNQA 1KTDA 5IMOA 1H0DB 5KBNC 2FGZA 5IFJA 4C57C 2OL3A 3UC2A 5DO2C 4BFOA 2NXYD 4HIJA 4NQQA 4PTUA 3BGFB 5KVFH 5LGHL 3S3JA 5C08D 4GXFA 2CBMA 5ECGA 4AYBA 1UT9A 4Y2DA 5C07E 3GMOA 4JFDA 1ACYH 1BGXL 4IJTA 4JRFA 2ZKYA 1VEPA 3T71A 1T04B 2W8CA 2MWCA 1CGSL 1GZPB 3QFJA 1JXGA 2AJSH 2C3VB 5DJ0B 4HUKB 3FL7A 2MQCA 3AB0B 4LLQA 1OXYA 3IGKA 3RTQA 5CM1A 1F56A 5ICXA 3U0TA 3HR6A 1JF1A 2ZF8A 3TBCA 1HOCB 4L8DA 2JCWA 4YEEA 4KJWC 4GLRI 1P9MA 3RY4A 4NN7C 1ZWIB 2HVBA 1H3PH 2WXRA 2QVKA 4HETA 3FPXA 3WS6C 5T8IA 4PRHD 2C1OB 2H5UA 2ZXWB 3WTWA 5D9SA 3TBWA 1BVNP 3HG1E 2IOOA 3DMMC 5D1ZI 3MFFB 3HAEB 5ALBL 3WEBA 3JZYA 5FK9A 2LFGA 3W82A 3OWEA 4JFTA 3B2MA 4F8LA 4PYGA 1BG9A 4N8VA 1BW8A 1R3JB 4YXHL 1QA9A 3ILPA 3PWPD 3HG3A 3LQAH 5ICZB 1A3LL 2J8UA 4I0PB 4B95C 1BYOA 3JWNH 5TF1H 5IOPB 1MVUA 3SQOL 2FZ3A 4HT1H 1FN4B 1UWEL 5E6RB 4X4ME 5AOMA 4PRPB 5EEZA 1NJ9A 3AW5A 1KIQB 4LCVA 1E2VA 2D7TH 2CQVA 1KC5H 4ZW7A 2HKFL 2W9DL 2YQ3A 3K5RA 4TQPA 4L3ED 5FCUL 5BXFA 1BQKA 1NGZB 4LSTH 3FQRA 3D05A 4OZIF 3QQ3A 1DQQB 4P2OC 3JUYA 5IJKA 1MRDL 4OZ4A 4ALAH 4L3AA 2EE6A 4B53A 1NAKL 3K6OA 1ZLUH 3SJVA 5A6LA 1HHHA 2KLTA 2AQ1A 1AOHA 4AWJC 3WJMA 5FYKU 5JMRA 4M56A 2FEDC 1J9RA 1AGEB 1UM6L 3ML9A 1YDPA 5F44A 2DY2A 2V5SA 4S1QL 5FHBL 1BV8A 4CILA 2ZXCA 4JFXA 4CDGC 4WRLA 3F58H 1NQBA 5KVMC 1I1RA 5EOTB 3KYOB 5D1QB 2QZ5A 3PWNB 4YUEL 3SPVA 2XN1A 3AT0A 5DHYB 1VFBB 2C7FA 2X1OA 2ORBL 5CZRA 3P3SA 4Z77A 2Y25A 2NY4C 3B9KC 4LBEA 1W72L 2VAAB 5FYKH 3TO2B 1GPOH 2RA1A 3EJJX 1IX2A 4ZO7A 1GOGA 4ZOBA 3NJVA 4QRUB 3RUGB 1R19A 5J6HB 3HG2A 5IWLC 4DEPB 3ARBB 3JT2A 1WO2A 4QPEA 5T1LA 2HTKC 1FH5L 3QJQB 4PJCB 4ZXBA 3QRGH 2XN9B 4KHTH 1P7HL 5EF3A 4KZDH 1IAKA 3PAUA 5HJ3A 4ORZC 3WFBH 3R8BB 2AXFB 1NIEA 2IDSA 4PRPE 2D7NA 4PCTA 4HS6A 3LS5H 4PLJD 2Y6SD 1MUJB 4A2LA 4K7PX 5AW9B 2JQAA 3C5XA 4JCMA 4KI5E 4K3EL 4M61B 3L3DB 1UD5A 1BBDL 2Z8SA 5DHMC 1I7RA 3D5OF 4DO6A 5K9KA 4R2GD 3RA7H 8FABA 2JB6B 3SD5A 1P84J 3V7AG 4JUSA 4LO9A 5T3XL 2ATAA 1HH9A 3CLFH 2GCYA 2NXYC 1OTSD 3T1FB 4F7MA 4L4VA 4L0YA 1J11A 4JANA 4AI7A 3HE6B 2BW4A 2IG2H 1T3FB 3GB7A 2DD8H 3L45A 1DFXA 2Q2EB 3L3KA 2CJTA 5D1QE 4Z7NF 5I8KH 2G60H 1GGBL 3SKJL 4IGBB 4ZTOL 1Q94A 5ES4B 2YGOA 3BFWA 3BSZL 5IHZB 4XMUA 1S7TB 5DUBA 3T0ED 3SDXF 5K9QG 3MV8A 3SOBL 1ODAA 4NBZB 2WCPA 3O8XA 2ZTBA 3PAYA 3V4UH 3ZR6A 4HKXB 4OLXH 2CLRA 3M1BB 3TGXA 2UWEA 1UHVA 3RUGE 5T3ZH 1KJ2B 3MOAL 3FQ2A 4OT1H 5GGRY 4PJCE 3GSRB 5JZ7C 4L5FE 2XN9E 4NCC2 3DOSA 3FB5A 4Z3FA 2UXFA 3U1PA 2EACA 1I1YA 2ZJSH 3SE3C 3F6JA 1JGVL 4WQOA 1KCRH 4WFHE 1BYPA 1TKWA 4NP4H 2WANA 1NM4A 1W72A 2YGPA 2YIHA 4KAQL 4QDGA 4XNYL 4LESA 4YHIA 5EBWB 1PSKL 4F7PB 4AQAB 1UD6A 5JA8B 25C8H 1XEDA 3U0WL 1KEML 2W9LA 3VFTB 5F2FA 1DLFH 2JTDA 2YK1L 3E8UL 4N22A 3U25A 1SOQA 3DX3A 2EDLA 3L1FA 3WJJA 4EOWL 1E9QB 1YYLL 1WZAA 5K39B 3O3EB 1F3JB 1T21A 1FPTH 5ITFA 3Q3GB 2DN7A 1AJ7H 2YAEA 4FP8H 1NCWL 5LBSL 3WAKA 2A5UA 3D18A 1Y18B 1ZHNA 4QHNB 5DZOA 4LCYA 5FYLL 5GZOA 1AH1A 3SGDH 5CUSH 2OLDA 4AG4H 2YD6A 1OSEA 2CLZB 3IEAA 5ALCH 1PPIA 3MYJA 5HDOA 1S5IH 1IEHA 3GK8L 4X7SH 3TN0B 3UO8B 2WM0A 1I9IH 3TH4T 3TV8A 1SEQH 4LCWB 1GHFL 4RZCA 1INEH 3HS0B 1E8WA 3H3PH 1ADQL 5BRZD 3V0IA 5E1AA 4FNLH 2OMWA 1SXAA 4J3OG 1KPUB 4K5PA 1KGCE 3D52A 4AVHA 3T2OA 1P1ZA 3HLAB 3QJHA 1VFOA 4AVIA 3O2VH 1QSFA 4MNHB 5T33H 2UY6B 1YEEL 2DKUA 1OAQL 2Q0ZX 3AAZA 3WO4C 3JVFC 2NQDA 4HFUH 3BSZA 4IRJC 2ZKWA 2ARJB 5HGGS 3QCVH 2M26A 1KIUA 4MRCA 3VTMA 4FADA 5CEZD 4X9FA 1JYWA 2VMEA 4JPWH 4QXUH 3X1BA 1R5WA 4ODWA 4NAJA 1DQDH 1FFPB 3G5ZB 1FI8C 1FNLA 1IGFH 1MFAH 3FQNA 2BW5A 4U7MA 4IBUA 3CN3A 3EGSB 3HFML 3V6FB 2OMUA 2ZUXA 4KKPA 3VD0A 2ZSWB 4YHOH 3FBQA 4PLJC 2X4UB 3QUYB 3TBVA 4IBSA 4ZO9A 2VQUA 5GISL 1IKFH 1ACZA 4R84A 3Q5YA 2HH0L 2AI0H 2H2SD 4NO0B 5BZWB 4XX1E 4Q9RH 4WIQA 5K5YA 3BN3B 4JPSA 4R2GC 4PJ9D 4JE0A 3O3AA 4S1SL 3VD9A 4LARL 3HHSB 4UV4L 5I1DB 43C9A 1EO5A 3NA4A 3OF6D 5C0IB 3LXCA 4FQXA 1BFTA 1Q9KA 2EVGA 2OMXB 3FPYA 2P5EA 1B90A 3QI9D 1T7VA 3O6FB 4LCWE 4F5CA 2FATL 2CJ3A 5F7EL 3D39E 3ILEA 4LLWA 4AQOA 1WH0A 2YPLA 1D9KD 2BLFA 5LBSA 3MA7A 2MEJB 4HC1H 3N44B 2DQIH 5ADOL 3DX6A 2DWYA 3T0EC 3IAQA 4K3JH 1ASOA 3UBXA 4CJ1A 1OP5K 3ULUD 4J3OD 5FGCB 4F24A 1FFNA 2O1AA 1DQJA 3MREA 4U3HA 4HOMA 3FT1A 3UPRA 2DIAA 5LDSA 3R4RA 1D2PA 1DR9A 1VZHA 2DL9A 2ITCA 4ADJA 4NZJA 1E6OL 4LOVA 1ADQA 3RKPA 5BVJA 5FW7A 1E3FA 1G7JA 2YPKA 4FXKC 4MCZB 5CKGA 1UZ6E 3TZVB 5INDA 4R5VA 4TUJA 4BQ6A 2JFCA 1L3NA 3QDJA 5DEFB 2QR0B 4TN9A 5GGTH 1EH9A 3C09B 3CUPB 2C9AA 3DHMA 4Y4KB 1XH3B 2FSEA 4AXWB 4OZIA 2EYTB 5I23A 1CLYL 4G59C 1DEEA 3E6HA 3NDYE 4P4KB 3T65B 1IAIH 3NIDE 2BNQA 3KBPA 4RRPG 3MGTA 1JVOA 1Z9PA 1OE3A 3G6AA 1TIUA 5F9DC 4ZNEA 4CN1A 1P84K 3KHOA 3N1QC 2VMJA 3A67L 4V1DA 4FQCL 4YOKA 2EXTA 1DVYA 5G2NA 2X4QB 3ZHDA 3APDA 1BZ7B 2JKNA 4MD0A 5K93A 1ET7A 1J1XH 1PQZA 2CR0A 4FYTA 2EC9U 5EOCJ 3K81A 3MJ8A 4E9XA 2BP8A 1RJLA 2VLJA 2EIEA 3MNVB 4XNUH 2YN5A 4P2YA 2WOYA 5FGCE 4OTXH 3BUTA 4IOIB 3BAEH 1RUQL 4CN4A 2YSTA 1DSFL 2HFFA 4FFZH 1XGQB 2WHVA 2VDML 4MYPA 2E56A 1ZLDA 1YMMD 1ZHLA 2ZQKA 5EUKB 1I3VA 1DUZB 3LX9A 4S1DC 3X1GA 1AO7B 4KMTL 4YBQC 1WVZA 1O6SB 3MJGX 1K4CB 4HBCH 5KVDL 3CFCH 1QW9A 3G04B 3AU0A 5CR1A 3D8MA 3HS8A 4FQ2H 4BA8A 3I50L 1KZYA 1INDH 4M6OH 5AB2A 4LSPL 1FYHB 4HK0A 3ULSB 2R29L 1P5UB 1PLCA 1O6VA 4HP5A 4MNGA 4LL1A 4K23L 1KBGH 2Y1ZA 2FT8A 5IVXE 1V3KA 4DN3H 1BFSA 3UTPE 1UOWA 1WEJH 1USZA 1DJIA 2H2SC 4O5LL 1U3NA 1C7SA 3RIAF 4GKOA 2BSTA 2PTUA 4XO4A 1ZLSL 2QELA 4YSEA 2GJ6E 4QRTB 1KB5B 5JLZA 2CUMA 4N85A 5IG7B 4DK5A 1EAOA 2XXCB 2LLNA 4PJ9C 5HVGB 4CU7A 5FDYA 4JQIL 2P7TB 1T0MB 2ZZUT 4U1MB 5FGSA 3SDXA 2R0LH 2PP7A 3HE7D 3H0TA 4RAUA 2I60L 4HUXB 5KYYA 4JVUA 1G7MB 3UOAB 1U3ZA 2XQYG 3SQRA 1UTDA 4GKNB 1EGJL 2EE3A 1M3IA 3QI9C 4Z7OF 2ESVD 2VZUA 4NDMB 4YVUA 1X7SA 3ARED 1E6JH 4MB3A 4WI7A 4Z76A 2P3YA 1BVKA 3IJYB 1FIEA 4FCHA 2M8XA 3RDTD 4KX9A 4YR6B 4C56A 5AALA 3EGXB 3NSDA 1KTCA 2AGJL 1VGKA 5EU3B 3RWDA 1R3HA 2BS8A 1YEFL 1S9YA 3FTVA 2J12B 3ARGA 4PGBB 3ULUC 4X5WB 1AO7E 4HLZG 4BFBD 4BCZA 1XF4B 3PP3H 3ARWA 2H32B 2E7LA 3TPUB 2FYYB 3MCKA 2XV3A 2XA8L 4FYQA 3VXUA 4M7JH 2QMJA 3UG5A 3ZZSA 4NJ9H 3DIFB 4DIXA 2IADB 3ZSSA 3QNZA 3MHZA 2MPVA 4GRWH 5GRUH 1W0VA 3INUL 1LDPL 1TZIA 1UA6L 2J88H 3QO0B 4N8PA 5CLTA 2Z8WC 3FXIC 4K9EC 2Q6WA 4AQEB 2QQKL 4DK3A 3ET9F 1NGYA 4PG9B 4EN3C 2AERT 3ARSA 3DPBA 4JDZA 4HZAA 5ENWB 1YNKH 3A4AA 5I66B 1RFDL 3IAGC 4WI4A 2ZP0T 5DJYB 1IVLA 3DX2A 4N1CA 5CLZA 5MEQB 1T6BX 3V55A 1NC2A 1ZTXL 3OKOA 4JG0L 4B0MB 1K8IB 4G43A 5J6GA 3RVUD 4OM0L 3X13A 4Y8AA 4LVOC 3FQ1A 3NN8A 3NTCL 2GJZA 4JY5L 4DHLA 1ZTMA 1NANH 3G6DH 7PAZA 2QSCH 1F2XK 2VXSH 4N6RA 3VWKA 3BKJL 2JIXD 5D4QA 2L7EA 2XVGA 1E5CA 2DQDL 3OAYK 3GS4A 1YEWA 4HAKA 4K5NA 3KH4A 3ZL4L 3I84A 5B38B 4A04A 1WBXB 2H6OA 2X5PA 3CSFA 1M1XA 4FQ1L 1WP6A 5J1SC 4JY6B 1NMAH 2GAZB 1R0AH 1J8HA 2WBJD 5BUAA 5C92A 1KDIA 4K71B 1ORQB 4JQIA 3QHZL 1IVTA 3KPSD 1S7SB 2AK4A 5KOVC 5TGBB 1V10A 2WLYA 2X3CA 4OCMC 2VDRL 5HHNA 1H15B 3ZRFC 1HE7A 1EGJA 1NFIB 2IH8A 3KJ6L 4HKBA 5IB1B 3HNVL 1IILE 1EVTC 3I02A 2WUCH 2MTPA 4X98A 1UZ8B 3ZHKA 1UD3A 2W0FB 4ZBJA 2XVBA 3TVMC 3OKEA 5HJBA 2HKAA 3ZDYF 5I15L 2XPGA 1T2XA 5INCB 2OMTB 1DDTA 5IBUB 3ZLQC 2AS5M 1JXFA 3HN3A 3P02A 3VFPB 4Z0XA 1WHOA 3RIKA 4HCRH 2YAPA 2IAMA 4R96B 4OCYH 4UM8B 2GI0A 4X6BB 3L4XA 4JFOA 5DQ9A 5DMKA 2WZAA 1NWOA 3U7YH 1RURL 2AKRB 1H9DA 1NCOA 1ZANH 4PRNB 3FHAA 5AYUH 5I71C 3ARFC 4NXSA 3MGOB 2GY7B 1YJDC 4TNFA 2X4SB 4UILL 1RJYB 5HGBA 2DYPD 5JDSA 3QNYB 4GT7A 4NPKA 5D1XD 1MZYA 3IS0X 5E00A 3LOWA 1OF2A 4JRYD 2NYYD 4ZJ9A 4MDJA 4FFYH 3DTUB 2GJJA 4OFDA 3IS1X 1FG2B 3TM6A 3UJJH 4JNXA 1TEFA 1MJ7H 3CHRA 4NWUH 4OF0A 3BFQG 4J6IA 5IQ9B 2HRGA 3EYUH 3AREC 3JV0A 1FLRL 3BD5A 5DZNA 4PJIF 2VUKA 1IBYA 5H94A 3RDTC 1I8KA 3QR2A 3UAAA 3CZFA 2MHAA 4G8GB 1PZAA 4HEME 1VJSA 3P4OB 4X6CB 4LU5L 3K6SB 4PWGA 3IPEA 1IBHA 1XDTT 2DQMA 5F9JB 4RGMC 1KN2H 3ABKB 3QXAA 4OIIH 3WTYA 4U0QB 1OWRM 3VVWA 3CZNA 1NBYB 1IGJA 2A9NL 4X6EB 1CPUA 2KC0A 1U6AH 3DO4A 4J3SA 5D7IB 2X4PA 3G3LA 1PW3A 5JW3L 3WN6A 2O5NA 4ZS7L 2ZUSA 2CAKA 1ZA6B 4XNQB 1CB4A 3QIBA 3CQPA 2ZUWA 4M8QA 4HIPA 1H8LA 1FUNA 5GGSB 4B9KC 5IB3A 3IK2A 4R6UA 4YHKL 1AD9B 2RTTA 3DIVA 2V9QA 3SCMA 1G4RA 1MQKH 4IM8A 1OAYH 3OSKA 4XR8C 3SDAA 4M29A 2AJZB 5DMIL 2YZ8A 4A1RA 3IWVA 5BJTB 1NCBL 2OW6A 3D0LA 4BJLA 3RKDD 5HHPB 1OANA 2JKTM 1U8IB 1EXGA 2FIRT 3PLYA 4LF3A 5DC0A 1DFBL 1QSEA 2BY1A 3KYMA 4R90L 1AR1B 1FJ1A 7CGTA 3DLQR 3F7KA 4PJ8A 4KU1A 5GJTH 2VKWA 4I89A 1CGTA 3BAJA 3NRPA 3GC3A 4ADGA 3R18A 4JHVA 1R75A 1N70A 2IPKB 3HZYB 2A9AA 4X8GA 4YPGA 4DGVL 5JW4M 4S0HA 1NCCL 4PRID 3RWFB 4L1DA 2C3HA 3UTSA 4J4PD 1A14L 1JGDA 4G8GE 4RFNB 2DBLH 1PZ5A 5H37H 2MPAH 1NBZB 2VIRA 1Y0LB 3BO8A 2G5BA 2W59A 2ZYHA 3V0VB 4NQCA 4TKWA 2RGSA 5DMJB 2XWEA 3MBED 4F3FA 5C0FA 5KSVB 1B0IA 5FYKD 2BZDA 5E6ID 5D7IE 5ANME 3U1SH 3K2UL 3P4NA 4TNEA 1PDKB 1BJ8A 3C6LB 5FUCC 3G08B 4XVUD 4U1JB 3UX9B 2BNRD 2IFGA 4QRPA 1S9XA 4QTHA 5GSVA 5LWYL 5C86A 4AW7A 2FX8H 1WWAX 2AANA 3IJ7A 1EZUA 2ENQA 1CIUA 5FFGA 3MC0A 5FS5A 3ETBF 3KE0A 1KIPA 4HBQA 3QJFA 4KNSA 1IC5H 3GHBL 4LCUB 5B3JF 4S1RL 1OPGH 2EO9A 1X5LA 4GUPA 3PF2A 3WNMA 4R4NC 2P46B 1T0NB 1X9QA 3MA9L 2FD6H 4LCIH 1CLZL 1U8CA 2JMRA 1VACB 3MNMA 2P8PB 1FGVL 3H6JA 1G9MH 3P40A 4PGJA 4F9PC 3UDWA 1SDAB 3UCRA 1YN7A 1MQ8A 5C07A 1QLFB 4TSCL 1THAA 3FT4B 4G6FD 4WHTB 3MRDB 2V17H 4D9QD 4PJHB 3E1F1 4DETA 5D1XC 4LLUB 4BEIA 2NYYC 3MDJA 4GI8A 5CILL 4OVVA 3S48A 4WK2B 4HX1B 4DP2X 4K07A 4G1MB 4AVKA 5LAPA 3WBDA 5FWQA 2YA0A 3DSFL 3IN2A 1OALA 4OZGF 2R23B 2VJ0A 4OD1H 4RMUA 1TSRA 1BBJB 1RPKA 3IFLL 3BQUB 4CMMB 5DMYA 3Q8FA 1WD8A 2AK1H 5G5DA 2GY5A 2CGYA 2QFRA 2FR4B 5DZ9A 5K9JL 5T5NF 5CBEB 1SGKA 4BKTC 2SODB 1E27B 2UUDK 1LL1A 2W92A 4JG9A 5T3ZD 5FKAB 5B1KA 1HQ4B 4GAYB 1A0QH 5SWSB 4DP8X 2DH3A 1RZJL 1U8QA 3CDZA 4Y5YC 5F1IA 3ZKND 3WELA 4EQ2A 5H2BB 1WCQA 5E6ZA 4DPRA 1A6WL 4MKMA 2AMUA 3O6MH 5J1AA 2FJSA 3AM8C 5IROD 3UZQB 1FVCA 1BLNA 4XE5B 4QYOB 5E03A 1KCUL 2WXNA 3G9VA 3LQAC 4YZFE 1FSKB 3GHEL 3GI8H 1GGUA 3GSNH 3JWNC 1XMEB 2CWRA 4NS0A 5LGJB 3IPFA 3RNQB 4M62H 1FQ9C 4KKRA 1MFCH 1WTGT 3RZCB 2JB5L 2CO6B 1G43A 2WXOA 4WWKC 2DQTH 4Y16A 4JY4B 3MRGA 1S3KH 4BZ2H 4XCNB 3TC9A 2R2HB 2BIPA 4QKXB 5AOLA 4G5ZH 4Y4FD 3DUUB 3X1FA 1T1YB 5DDHA 3NIDF 3VTAA 1ZDSA 4PJHE 2YJLA 4C4BA 3RKDC 1IBFA 3QJOA 5AW0B 3MUHL 1E4KA 1TQVA 2VLMD 1GY2A 1KPVA 5D5MB 4ALAC 2AJ3A 1TQBB 3B83A 3GS0A 3Q2CA 4JZOB 1WFIA 3EFDH 1GJUA 4NIYE 3CHPA 4PAZA 2DAVA 4L5FL 2VDKH 2VM4A 3H4HA 3RQ3A 3SYAA 1TJMA 4UQ9A 5TH2B 2BDNH 4XZUA 3DJZA 2E7CA 5TDPA 2BFVL 1CFQA 3WD5L 1F6AA 1J1PH 2QPEB 4AIZA 3P4LA 1OD7A 3T4AB 4U6XB 3P2DA 4NNYA 2EE0A 3RVWC 3V4LA 4J4PC 2GSIA 2K78A 3JWDL 1NCTA 3QC6X 4WKXA 3A6BH 1R9FA 2P8LA 2MFNA 4NN7B 3FT3A 4BUQA 4UAOC 1SEBA 4C4KT 3QXWA 3SE8H 2WNWA 4ODHH 5CCKH 3OAZK 3MRCB 1X5AA 3DRTA 4EUPB 3DDGA 4RBPH 3MBEC 3ARVA 2DQHL 4MVBD 4B9PA 4DGYH 4F15C 2OULB 5E6IC 5GS0H 1BVZA 3AXLA 4JRWA 1CFBA 2ZCHH 2UZYB 4PB9L 3IVKB 5DR5L 3ISWA 3Q06A 1TG8A 1JTPA 4A67A 3WMPA 4UMSA 5CJ8A 4XOAA 2E27H 3AG2B 3I75B 2GTWA 2EVIA 3WNPA 4AX3A 3NABL 1KTLB 5L4MA 3I6GB 3JYCA 3V4PL 2VLRB 2CPUA 5LGKA 2VSMB 2A83A 2VLKD 5BQ7A 3O41B 2A6IB 4YDZA 1DBKL 1WV7T 4WKZA 5JHLL 5M95B 4JJHA 1NA8A 2A74C 4UQEA 3L9RB 4P2OB 5D5ME 3W57A 1JRHL 2DWSA 1O7VA 5IVXF 3B2UD 3SGKA 3WUWA 2B7DT 4WI6A 1MCDA 3HKZA 2BSBA 4P2CG 4PJIA 1I1AA 1YPZF 3VI3A 3QUMA 1PFCA 2O5ZH 2MQ0A 3C5ZD 3US1A 4QXVA 3GT6A 2X7LA 5FR3A 3BUIA 1P7KB 2ISDA 3GXDA 1XF3A 4I2XA 5EV7A 2Q8BL 3KVQA 3GMQA 4AYFA 5IFAL 4ZFZA 3IAPA 4NN6C 3ZUCA 4ZSOB 1BX2B 2PR9A 2BRRL 2VR5A 3VXMB 5FHAL 1AFVL 1S5HB 1FNGA 3U7AA 1EZVY 4FFWD 4HWUA 4U3SB 5F7WC 2NY4B 2BSDA 3B9KB 1QRKA 1Q9WB 2R0KH 3VH8A 5F7FA 5TQ0H 4XCFL 4NRXA 4GY4A 2R4RL 4HCGA 5EO9A 2NW2B 3H42H 4HIXH 3F84A 1VPOH 2UXVA 4IJ3C 4ZRGA 2R69H 3N43B 2C9RA 5EO1B 4GAGL 4BQ9A 1KLUB 4R5XA 3ZKNC 1OP3H 1EJ6A 3PHOB 2YFOA 1YN6A 3JTTA 4M48H 1MHHA 3T2NH 1FNSH 4DAGL 2PMZA 5IROC 3NESA 4NZTH 3UTQA 3RVVD 3W9DB 1UZGA 1KXTB 5FV1L 1G6RL 2E0PA 4W4OC 2GITB 2VLRE 4HV8A 2BXYA 2IOIA 2AV7B 2PW2B 3FU7A 3MACL 5IGXL 1SLXA 5GRYA 4NQUA 3LZFH 4P04A 4PJ5D 1TQWA 2Z64C 1JV2A 4JFHE 2VERN 5EBLB 1J18A 2I25N 4K94L 1KMGA 1Q1JL 4ZQKA 2KH2B 4Y4FC 2B1AL 3VGEA 3BZ5A 3R1GH 1JPSH 5EN3A 1Q0YL 4UDUA 1JMXA 3VGBA 2NXYB 4K2UL 5D70L 3MBWA 4FJZA 1NIBA 3V4PA 5C08B 4DQAA 3IXAA 1VHPA 2BOBB 3OKNA 4W68A 2E6PA 1TZ8A 1CD1A 1KPRB 3DYPA 4I48A 3ENEA 1M7XA 4D3CH 2A1WL 1P0SE 5JHLA 1SFDA 4JW3A 4OQTL 4ZSOE 1IARB 5BZZA 3VXME 4ANKA 4XBPA 4ONFH 1AOZA 5TTRA 1Z0MA 1F2QA 1HYSD 4MA1C 4KY1L 1THCA 3IGAA 1UOLA 5F3BA 2OSXA 3S5LG 2DYRB 2R56H 2LAGB 4NI3A 3FS9A 5IJVB 2BP0A 2AITA 3WGUB 1J48A 3R8QA 4IRZL 2NSQA 3APMA 4NZDA 1MHEA 3SKMB 2WTOA 4PRHB 1NKGA 2ZKXA 2F68X 1A9EB 4MVBC 1XGZA 1KN4L 1NC4A 1WZ1H 1MWAL 1OK0A 3FFCD 2GYSA 3SGEI 3UO1H 2GJPA 1MAMH 4XODA 3VFTA 5MENE 4PTTA 1YY8B 4MQ7A 1I1FA 4JG5A 3PWPB 3KLKA 4CW1B 4TSBL 1H5BA 3L95A 1KYFA 5F1KC 2AJUL 2UZIH 1WZMA 2K45A 1YLBB 2VR6A 3CDGA 3QG7H 4UU9B 3CHQA 1BF5A 3CHXA 1E28A 2QLVB 2EZ0D 5I1HL 4YO0A 5ISZB 1UH3A 1ROCA 2CKBH 5I76A 5C1MB 3FQWA 1SBSL 3GIZL 2BSEA 4MCYB 1G6RA 1R24A 3DJSA 5C70A 2GIXA 2YOCA 1WFOA 1XT5A 5C08E 2WGXA 3TBSB 5L7XL 3CFKA 4OZGA 3B2UC 3LRHA 1U3HA 4DW2H 1NUNB 3V0GA 5DJ6B 2UY7B 1L7IH 1KCVH 1IKNC 2NDFA 4MXQC 1BQLL 2NY0B 3D39A 4GG6B 1DE4A 3W39B 4HGMA 3C5ZC 5D7SL 3SO5A 3S34L 5B39G 4CC4A 1OM3L 2BH0A 1E5AA 4R26H 3DVNB 1A3ZA 4G3YL 3RFZA 3RWCA 1T4WA 5D72L 3KNBA 2KPNA 3OR6B 1WT5A 1M6UA 4LSQH 5HDQL 1SYVA 2PNDA 4AYDC 4PRHE 1PIFA 5I1LB 4FFWC 1JXJA 2EADA 5KAQF 1HEJC 2ZXQA 4NQDB 4AJWA 1Z7JA 1CTOA 1AQKL 2YA2A 3EFFA 4OQTA 2L7QA 3DSNA 4IRJB 3AS0A 1FDLL 4GRMB 4AQ1C 1KFGA 5DD5H 4LAQL 4FEIA 3EJCA 4YDJB 1XCQA 3KPNB 2PCPA 2PWDA 2IH3B 2FWUA 3PWPE 5F7LB 1DJHA 4OV5B 2X6MA 5B22A 1XWVA 1FL6A 2FX7L 4U1LB 4IRZA 2WXFA 4H20H 4KUZL 4TL5A 5E2JA 4X2UA 3DGGA 3RVVC 4A2HA 8CGTA 3KG5A 4H0GA 2OXGB 2D0FA 4U6VL 3NGBC 1XL4A 2VN3A 3QCUL 4I3SL 1ORSB 2FUTA 1KBPA 1MWAA 4NOFA 3EG9A 1BAFH 3DX7B 4KDTC 1WZKA 4KOBA 2C34A 3BAWA 1Y6NR 2O6PA 2X4NA 4I0CC 5IR1A 3GUFA 5JQIB 3IT8D 3RG1C 2R2CA 3B8SA 3CBJB 1HI6A 3A21A 3WI9A 3V8CA 5I9QB 4G8FB 1SOSA 3L3IB 3BWSA 4FA6A 3EFOB 3K0WA 5FO8B 4GG6E 1LWHA 3FT2A 1QFOA 3B7UX 1RZQA 3LTVA 4IBVA 3VGAC 4N0FB 4B7LA 4YXKL 1OCRB 2OZ4L 1BQHA 5FA4B 3ECQA 1YUHA 3QUXA 3WOVA 1H6UA 4W4NA 1KFAL 3T0AA 1Z9MA 3PP4H 4JL1A 2R1YB 5IMLB 2VR7A 1CT8A 1KWKA 4OGQC 5DWPA 3UC0H 4F1SA 1HYSC 3TBTB 1TITA 4NQDE 5FGRA 4WO4A 4NKIL 5KN5B 2WLJA 1YAZA 3GSWB 2JI2A 2R0ZH 3GZQA 3A0OA 3MOBH 1ERNA 5DLMH 5LBGA 1GGTA 1PX4A 5IVZB 4M8RA 2WAQA 3VD1A 2FH6A 1BZ9A 4OGAD 4OLVH 3OG6B 5CP3H 5DGRA 2D2CC 2Z1PA 1JHKL 2B1OA 1WDAA 1JNHB 4FXKB 3U0PB 3FRPB 2X10A 1KXQE 1W8NA 3HNTL 3SKOB 1HS6A 1H6FA 2IQAB 3JV4B 1N64L 3FT9A 5DD0H 5GIRB 1SUJA 3L7FA 3ES6A 2XKUA 1G6VK 4ZUSA 3R7QA 2Z31D 4BKLB 1QFWM 2Y06L 2BRQA 4Y2OA 5IVXA 4HH9A 1PL3A 2FB4L 4HEPA 5F21B 2ICWA 1Y1DA 1L5GA 1PCXA 3MLRH 1BQ5A 1KNOB 2DTSA 2DQEL 5IEKB 3DO7B 2EDBA 1YPZA 4HJSA 1JK8A 2EZ0C 1OB1A 4WUKH 2GJ6A 1XQ4A 5EZLB 3UEZA 4E41A 1IQWL 1F13A 2J1KA 2F74B 3KL0A 2BPBA 4U1GC 2MSPA 3S3BB 4ZFGH 1YEKH 2BJMH 1GZQB 3FULA 3LH2H 2WUBH 2XRAH 3N55A 2BSCA 4NUGL 3QZWG 4ZMOA 4ZMVA 5IV2A 2Z4QA 3VMNA 4BSWA 2VO5A 3NT0A 5K33A 5LJYH 4QI3A 1JI2A 1J0KA 2XZCL 1HSBB 3U6XA 4ZI8A 4IIQA 5KYXB 3P73B 2Q7AA 2QPSA 4YXLL 3OG4B 2JCCF 4NM4L 1JWUA 5KBPA 3MSPA 3BRFA 3FSAA 4R7DA 3T0EE 5C0GA 5E1IA 1CTMA 3VI4F 1N5YH 2QPDB 1MEXL 3KWWA 3Q6GH 3UH8A 4N8VG 5KTEH 1ZK9A 1HINH 2Q3AA 3IETB 1WAPA 3WIAA 3ESMA 4AQ8C 4X6DB 3GBMH 2CO2A 2DEXX 4IOFD 2OZ4A 1F4AA 5BO0D 4DKEH 1A25A 4M8UA 1T7YA 4NUJB 3HG5A 3SPCA 3ARRA 4F7CA 2IDTA 1T5WA 3QDGA 5GJSL 2V8MA 2YUVA 3CDYA 2ZKMX 1W6LA 3S7GA 3ULSA 1KGYE 5SV4A 1YY9D 5DZJA 2YD2A 5D71L 2XFGB 4NLHA 3POCA 1BXAA 3F7YA 3DJTA 1TT6A 1WFJA 4N24A 1TTGA 3MV9D 4GFTB 1ZV5A 2ZWZA 4UM9B 1PYWA 3WFDH 5AD0A 1CFTA 4HGKC 1UXSB 1YMHA 3TWCL 4DQOL 2Y2YA 4Z3JA 2XC8A 5BOJA 1QRND 1G7IB 1P2CB 4NQED 5CIPH 1WHPA 2ITDB 1KCKA 2GHWB 2H2PD 5F1NA 4K8RH 3ABMB 4U7KA 3TT3L 4LEXL 4NKDB 1X4ZA 2DWXA 4JFFA 2HSIA 3VXOA 3ZTCC 1MCLA 4PJ9B 4XPTH 3L54A 1AZZC 2NY6D 3NACL 1WITA 2LU4A 2JSFA 3DC0A 4MA8L 3S5ZA 3TEUA 4B9GA 3E80A 4S10A 1ZXKA 5I5MA 1SJXA 4ZW5A 3FH5A 3TEYA 4IRSD 4DP9X 4HWBA 4UINH 3IF1B 3QI9B 1AZNA 4I4WB 4PIBA 2HG5B 5DYOA 2E3VA 5JORB 2GVYA 5F3HB 1NUFA 3FU8A 1HHGB 2H3KA 3VXNA 1XF2B 4X6DE 3MROA 4JG1L 4YWGH 1A6VH 4RISH 1GOHA 2QADD 3HRZB 4U33A 3CFQA 2XWTB 3RB5A 2ZT9C 3BAYA 4WWPA 5IJDC 4FLHA 2K4AA 2PKDA 4FHJA 4DVBB 1BXVA 4GAFB 3QPXH 1TEYA 1NGWA 1NCDL 4YN3A 4JBSA 4KK8D 4AMKH 5J1TC 3OMNB 5I1IL 1NCAH 3VFWA 4FZEH 4KVCL 4AKPA 2DYSB 1JRHI 4OGAC 1D5BA 1IEAB 5F6HJ 5GQBA 1FC2D 1PG7H 5AUMA 1OZUA 4D0CB 4OLYL 2CK0L 1LO5B 3X12B 3RIAK 3KCWA 4QRQA 1BWWA 3KPPA 2BCKA 2Z7UA 4NJAL 3DBXB 4YDVB 2IALB 4EN3B 1T03H 2FYVA 4XBEH 2DM2A 5F89B 1OCCB 4XNAA 1QTYT 3QPQC 4ERSH 4JDEA 4G71B 1ULVA 4OLUL 2WYZA 1XR9B 3EO0B 5I8OL 2QL1A 4HUUB 5FWRA 3K7UA 2AF2A 1LP9E 2FGWL 5E5MB 2VXTH 4H8QA 1CE1L 1M71A 3E0GA 3WIFB 4JKLA 3A47A 2G75A 5JW4R 5GGQL 1CFNB 4LVOB 5B38A 3T6QC 4GMTL 4ONHB 1TJXA 2UYLB 3HJ0A 3QDMA 4XPAH 5GGUA 4MD4B 3T8XA 4IQHA 4N5ED 3CC5B 3D12B 1SY6L 4UIMA 4Z3EA 4OLWH 4Z7VF 3H9SB 4LOEA 2ROYA 3RHWK 3E6FA 4XMLH 4V33A 4D8PA 3KXFD 5D4JA 3KZ8A 2X4TB 4XBGA 4UBDD 3D69B 3MRLB 3BGMA 3RPBA 3LRLA 4YIQB 1MXGA 2P43B 3C8HA 3KYKL 5JPMA 3R06B 1NBVH 4XB3A 2APXA 5KYUB 3V0WH 3BT2H 5EZIL 3RGBA 1D5IL 4A39A 4BH8A 1BLIA 5FF6A 2EIBA 3N1MC 4L23A 3D3VB 3ROOB 2ZYRA 3O45B 3TFBA 5DEGB 1PF3A 2NYZA 4H26B 4GSUA 1AYOA 2Q3XA 4RRPM 3WO3B 3GMNA 3ULUE 4FTDA 1D5MA 1RSFA 4WEUD 1MI5D 2L3BA 4DO4A 2D0GA 5KUMA 5EPMA 4IOFC 1DQVA 3B5TA 3S8GB 4NFBA 1ZHKA 4XP5L 3S0PA 1LEIA 5I1CH 3FONA 1YMMB 4A2FA 1KCWA 4JZJC 4XNZC 3TIEA 1JPGA 5E99H 3MRRA 5B3NA 5BPPA 2VC2B 1J87A 2AVGA 3UG4A 3EW3B 3TEZA 3L5XH 3H9HB 3TVMB 3FU6A 1AY1H 1YY9C 1HDMB 3RX5A 1AP2B 4DEUA 1HE8A 5AVUB 3SN6N 3BDXA 3PV6A 3TNNB 2PW1B 1F58L 3H3BC 4G6KL 1UXLA 4N8CL 3K8LA 3MRPB 1T7WA 3MRFA 5BMFL 5CSZA 1QNZH 4D8OA 5ETUB 1S8DB 2K3HA 4FEMA 5AW2B 4N4YB 4UV7L 3MCLH 1FV1B 2IBBA 4WNSA 1EAJA 4ZT1A 4JPVL 2CCLA 3S96B 4AT6A 3PJNA 3WXVH 3ARFB 2H2PC 1NDMA 1ZV9A 4C47A 4ZTPL 2CLVB 3H9SE 2E74C 2ZSVA 5KZCB 1G84A 2PCFB 1HK6A 1OGAD 4JPIA 4W9KC 1TFPA 3AITA 1JNLH 4KDVA 3V5DA 2YMTA 4TRPL 4EDXA 4HOZA 3D34A 4G9FA 4BH7B 5HY9B 4W9HC 3N5AA 2XLLA 4FG0A 1AE6H 5EOQL 1MH5B 2XXGA 3ZQ9A 4MS6A 4IRSC 1BJ1J 2XWRA 3WTUA 1YG9A 2Z7YA 3BUBA 3VG0H 1VGEH 2ESVB 4ATTA 3ULVH 3CNKA 3AREB 3ZTNH 5LCVL 5AG9A 1SY6A 2QHRH 4PP2A 3RDTB 1W2KT 1AXSA 4H8PA 1W8EA 1I7ZB 4NQSB 1JNJA 4MMZC 1TCMA 2VDLB 1G7LA 3ZE2E 2NCEA 1YMME 2HYMA 1A7OL 2PO6A 3UAJA 2FH8A 1XSOA 3AY4A 4LKXA 1QACA 4O2CB 5ANMA 3TNMA 1B2WL 4RGMB 1GS6X 1KLFB 3BZDA 3C2AH 4KK8C 3UZVA 5CFHA 5CINH 1KIRA 2FBJH 4HKZA 1IGCL 1ND0B 4M8VA 1ECZA 1ETZB 1U8NA 3II1A 4R3SB 5DT1H 3LEVH 5G4NA 2ICEC 2XICA 4W9IC 2LW3A 1HWWA 3RY6A 5MHSD 3FB8B 1MSPA 3D2TA 3OB0K 5HYSG 1FIGH 3EDFA 4PH8A 3TTSA 4ZX6A 2ENSA 1G4MA 4ZPTA 2PTVA 1LK2A 1Q9LA 2ED9A 3E2HC 3P77B 5I30L 1X5HA 2CK2A 2R1WB 2W07A 5J89A 3ATAA 1ICTA 4WFED 3SDCA 4ZS6D 3VXPA 4NWTL 1RUKH 3TCTA 2YKKA 1V54B 1G9MC 1TQUA 2JCCA 3I9GH 1A4AA 4UB0H 3CFBB 3MLPA 3U30B 1F4HA 2D8KA 2Y6TE 3ECBB 3GTTA 3VGHA 1L0XA 3VI4A 1BVOA 4LDLB 3EH4B 3T3PF 2JIXB 1UVQA 3K8KA 3HAEH 5CMAA 2ICWI 4UBDC 2ESVE 1J9SA 3BZFB 4XMPH 5E1HB 1L0PA 3IDMA 1ZOXA 1V7NL 2C7UA 3I3BA 1HL5A 3BFOA 4UAHA 5TD4A 2FJGB 5C0CD 1YEDB 4WI0A 1S46A 1JS4A 5AOKA 3NYKA 2EIJB 3HMXA 4JMXA 1L9OA 1N0XH 4YE0A 1M1SA 4LVEA 5I8CA 1M53A 1PZDA 1VADA 3KPSB 3P9WB 1AIFA 1F1AA 2NY3D 1MIMH 4U05A 3ZKMD 1UJTA 3WNOA 1TCRB 3Q9QA 1A7QL 2NRDA 1A4JA 2R2EA 4XN5A 3LN5A 5EO0A 3NJKA 2WQAA 5LCVA 4AYEC 3X2QB 4JL2A 2VABA 4OLZL 3BP5A 4TL4A 2N4IA 4ZFFA 2Z35A 3VFRB 1H8NA 4HAGA 2CH8A 2WNXA 3HOGA 3DOHA 1URZA 3BKML 3KDMB 5JMOC 1D6EB 3L17A 3JTSA 1U8OB 3GJFA 1CZ8L 4XCYB 1A7RH 5GSRA 2CIKB 5F7AA 4KVNL 4G70B 4C58B 4CU6A 4KGLA 2MOVA 5CAYB 1II4E 3AADB 1UB6B 3LKRB 3UXFA 1X9LA 1IBGL 2FX9L 2VWEC 3C2SA 4L8CB 3WHE1 4BFKA 3W0WD 1EPFA 5EFIA 1AANA 4RIRA 4WHDA 4DZ8A 2WQSA 3FB6B 4GKSB 4H5SB 4DZBB 4M6ML 2DYPB 1NFAA 2DB8A 2AJYH 4X80L 2OYKA 5D1XB 3ATEA 2HLFD 1CFSB 4OBSA 5IHBA 3RAJL 2PYFB 3K71A 1DANU 1JN6B 2BVPB 4MJ4A 1UXWA 4WI8A 3GUTB 4AH2A 2EUZA 3APFA 5C0JA 1PY9A 3AWGA 3WGVB 4FLSA 4XP4L 3V6ZB 1HCFX 5ESAB 1OP5H 5IZ7A 5KSAA 4HPOL 5ACZB 3KPSE 2CUAA 2BIQA 4P57A 5JNYA 4JAMB 4ZMTA 2GABA 2AQNA 4D9RE 4UNIA 3REWB 1MF2H 3R4DA 4L2LA 2D03H 4LASH 4GSDL 4BRVA 3EYVA 5L4IA 1LEKA 4XC3H 2PR4H 1LQBC 3ME0B 1H6TA 3QWQB 5FUCE 4AV0A 5I1JL 4B9CA 4BCYA 1H6EA 1M7DB 4Y5YB 2E9IA 3DURB 2F19L 3V9CA 1R5IA 5JIIA 1I8AA 1BMZA 1UYWL 4TUKL 5GS2D 2ZONA 2VXUH 5GS0C 5CS7A 3FCTA 3K6NA 1EUTA 2HUHA 2ZX5A 1OGSA 1U93B 4QXGH 4OCWL 5DJAB 1BM3L 1BREA 1HCZA 3PGDB 3ELQA 3CXHJ 5JR1L 1YO4A 5HTSA 3MJ9H 3EOTH 2Z91B 1RJCA 1FHGA 1Q72L 2PUQT 2DWDA 1FORL 1KB3A 3RPIB 3TYFA 3VFGL 4GIPD 4JFQA 5CXPA 2MCG1 4WWKB 5E94A 3VG9C 4Z7VA 5CEXA 4NRZA 4N9GA 1DCEA 2OMZA 1XIWC 2YWZA 1HH6A 1EBAA 3O6KL 5C9KA 3P3TA 4LSVL 1MFEL 5D1XE 3FQUB 4LGRB 5KVFE 1OWWA 4ANUA 1Z5YD 1IC4L 4JRYE 1CG9B 1AIZA 1Z0NA 4FE9A 1KJ2H 5TH2A 4R5TA 1T66D 1GGIL 1UEMA 2XSKA 2ZWSA 3DROB 3FCSB 4FABH 4KV5E 1DLHB 5DI8B 2CDEA 3VJ6B 4QRSB 1DDHA 3F6IA 4WY7L 1MFDL 1I3GL 2AMGA 3QQXA 2HLAA 1RZKH 1RLWA 3B2DC 3EJYD 5F96H 4ZUTB 2OMVB 4FNRA 3WS6A 2BNUB 2FL5A 1JVKA 1S3RA 4YSQA 4PRIB 4ZDHB 4B7IA 6FABH 3DMMA 3PL6D 4N0UB 2OR9L 3CH1B 4UNUA 4MJ2A 1CFMA 4UAOB 3BPNC 3FUKA 1Z9LA 4Y19B 3BPLB 5F7DB 2NY3C 3TH2T 3TT1H 3ZKMC 3IVKA 2YJQA 3ZYJA 1T4KB 4ELKB 3VFNB 1ZJBA 3H85A 2UV3A 2LAAA 2J5WA 5ILTL 5D8JL 3FMGL 5MP6H 4MA7H 4F15B 3FT0A 5IB2B 2PYED 2YXWA 4WDIB 4GO6B 1JZGA 1BZ8A 1QZNA 2EDNA 3C60B 3QORA 4H1LB 3HJEA 3B1TA 3ESNA 4UNTA 4WSJA 2RQEA 1UWXK 3JWNE 4QHPA 3CVIL 5I6KA 4P2RA 3RWEA 1QO3A 4WV1B 1MPAL 3HUJF 3V0AC 4OUUB 1MRFL 5MI0C 4A7SA 3LKPB 4ZW8A 2VE6B 4N68A 3KPRB 2L4OA 4UTAH 4KI1A 3OJDB 4QTIH 1TVBA 3BVNB 3D4YA 5KBDA 1RIHL 3OXSA 1GGCL 1JP5A 1F45A 3ZDZB 4L2YA 1WSST 3FH7A 1I8IA 5CEYB 1J5DA 2I07A 4JO3L 4HWEL 4XWOC 2HFEA 5I73C 1SF3A 1A7NL 4H40A 3A6CH 3BJLA 3RIFF 4U1SA 4A7TA 2P80D 3MLTB 5K1JA 3FU3A 2KKQA 2QZQA 3ZHFA 2A9BA 1QWUA 5L8LB 2Y1AA 2PXYC 4P4RA 4WU5B 3M8OL 3QUKB 2KI6A 5I0DA 3FSWA 4L29A 5IUSA 3G7TA 3QIWA 1RJZB 4MS8D 4PRIE 5DF0A 4F58L 3B9VA 1HESA 4QWWD 3CVCA 5AW1B 4U3XA 4KGJA 4NN6B 2MJWA 5L2KA 2WIIB 2EC8A 4Y19E 3HPLB 3IJEB 2C9QA 1SVZA 1ZT7B 3DRQA 3P2TA 2YHGA 1D6VL 1AHKA 1M2VA 4TLKA 4P5TC 5AAMA 4N0CD 5AZEH 3V4VL 5FYKE 3AS3A 4E0RA 4ZX3A 5JQ6L 1KGWA 5DJCB 5HHXH 1C08A 4WW1A 4IJ3B 1WFTA 2BNRE 2I7OA 5MENA 4P5RA 2EDDA 4WGVB 3F7RA 1NL0H 1PBYA 4BFJA 4U1KA 4H0LC 1U8HB 3UADA 1UH2A 2WTRB 3CN4A 5JOPE 3FFDB 1C5CH 5F93C 1NGPH 3DV6A 4ZD3H 3E9UA 2XJKA 3AROA 3KPRE 3PUCA 5AAWA 1FYTA 4P23D 2HJFB 1RZ7L 1ZVNA 5HHOB 2V9RA 1FZJB 3SEPA 1P7QA 3UAEA 3ZDZE 1L0QA 1SZNA 2OBGA 1LVEA 1ZVHA 2B5IC 2NQ3A 4XP1H 1OSPL 1WK0A 3L5HA 3IFNH 3VXTB 1ZHBA 5KJRL 2FJHB 2F54D 2VW7A 1KPRA 4Y4FB 4ONGL 4JEGB 2ZX9A 1LP9F 4D9QE 4HKJA 3WHXB 4KKBD 1RIVH 5CD3B 5DJDB 1M7IA 4OY9A 1AGBA 2YRZA 3RDJA 3CMOL 4HF5L 2I32A 4HWZA 1E0OB 5DUMH 3T1WA 2WXPA 2ZP8A 2X41A 3T4YA 1N59A 1HHIA 4JREC 3FTWA 1N2RA 1NGQL 2B1HH 4AENB 1DQIA 3SKNB 4GKLA 3Q1SL 3VXQB 1ZA3A 2ENYA 2CA4A 1DBMH 1A2YA 5I1GL 4ODTH 4MA1B 2ZCKL 4LCCC 1UWYA 3IMUA 3OKLB 4N1EA 1GMIA 1OAZL 3DI2B 1AKJA 5BRQA 5T3ZE 3PL6C 2GC7C 2LTQC 5F88A 1V3JA 1A64A 1UACL 3ULUF 4BFIB 1OIOA 4J3OF 1YNLL 3TA3D 4PJ6A 5FB8A 2VXVL 5TE4H 5L4JA 1SXCA 3GSVA 3FUNA 3L6FA 2MH4A 5DRNB 2J4WL 3IJHA 2XZAH 5FXCH 3VFOB 4HU8A 3IN0A 2ZUQC 3BDBA 3CXHK 5DS8A 3W37A 3LPPA 2HJLB 5HHOE 3OQRA 4OZFA 4RGND 4B9FA 1UJ3C 1XCWA 2XQBL 2XT1B 3HA0A 4LHJB 3V4VA 3D4GA 4KRMB 3VGFA 1CWVA 5GZNC 1P5VA 3W5MA 4R97C 1LD9A 2OL3H 3X17A 1EXUB 1R34A 4L3EA 5TE6L 4MQSB 3WLWD 1EJOH 2W65A 2E7BA 1K72A 3LPOA 1KELL 4LHUB 3P9LB 4LRNL 3H2QA 2VLKB 2W60B 2F0CA 4B3EA 1XGTB 2F53A 2IQ9L 2J7LA 2JELH 4K8RD 3KW7A 3IU3A 2CR3A 2R2BB 2CRMA 2VLME 3GMMB 4HIHB 5T5FH 5I1EH 1A4KA 3MXWH 5EBMA 4JM2D 3G6JB 5EOCH 4RMQA 1ZMYA 2BOLA 2K6YA 2ZXAA 4PHZA 5ERWB 1TJIH 1LEGB 2DQJH 4HU2A 5DCCA 4HHAA 5JHAA 2AXGA 4OB5L 1E4XI 3AUVA 3N85H 4XP6L 5GGVL 3D85A 3VQLA 2VH5L 5E9DD 5ADPL 3B2VH 4MS8C 3G9AB 4YHLL 1X5YA 4XMTA 1E30A 1IAIM 3PWJA 1A3RL 4QWWC 3EH5B 3H2WA 5I18L 1MFBL 2YD7A 2CHWA 3CLWA 4YBLC 2H0PA 1R5VA 1ACXA 4RH4A 4ZW6A 2DI7A 2H9GB 2W80C 3LVTA 3AJ7A 1CE6A 2ADIB 5IFHL 3VD3A 3MRHA 4NNPL 1NCJA 4N0CC 2HT2D 4EBQH 2AEOA 3ZN6A 5E8NB 4AQ1B 1TU2B 2BVQA 3IDJA 3ZE2F 2MKLC 5FO7B 5DC4B 5FECB 3K80A 1KV3A 3CFMA 4CVZA 2J8HA 4H8HA 3WJLC 4I77H 1KB5H 3HMWH 3Q9PA 4X6FA 4J3BA 5LDUA 3RWGA 3PHQA 5E7BA 1IJNA 4MSWA 2ZKHL 3KPMA 4AGLA 4Z7UF 3BC9A 5CHNA 5JPNA 5IHHA 2BHYA 3LNEA 2X12A 4BK5C 1SM3H 4J8RA 3EXLA 4P23C 3NH7L 5EEVA 3GKWH 3F05A 4JHAH 1A3QA 5IESL 4C83A 2IANB 2VLKE 1XH0A 1WRFA 3LHPH 2X6AA 4HZLA 2FECL 3QJZA 4U6HA 2ADYA 1EFQA 1F97A 2IBZX 2AXWA 3EADA 3G6JE 1BOGA 2NR6A 2NXZD 4OCLC 3GI9H 4X8JB 1TVHB 4OM1L 5IW3A 4JFPB 4Q9QH 5IMLA 5LGHH 4X5QA 1DUYB 2CO4A 1NIFA 2H32H 3VGAB 1PJWA 2COQA 3N41B 5D7LA 4ABVA 5A1AA 3T0EA 1BGXH 4MNQD 2Y7QB 4RQQA 2X4OA 4J39A 3MRIB 1IQDB 3GEWB 1KTRL 5CEZL 3ILQD 4FXLA 1U8PA 1GGYA 4ISVA 2EDOA 5HI4D 4PGZA 3FO1B 3KLLA 3MV7D 2ZOKB 2V2WA 5DURD 1B0GB 2Q3ZA 3KR3L 5E24E 4A2EA 5KBKA 3MRKB 2CM6A 3ZHNA 3CXDL 4JPKL 4TOYL 4FTVD 3GD1C 3R0NA 5C2BL 1FVDB 3HG0A 3FUHA 1CXKA 5EZOH 3FQ4A 4MDIB 1IM9B 2I24N 4FNPA 3HUJA 3TA3C 3VE0B 3W2DL 1GC1H 5ALBH 4U1IB 4EI0A 2GK0A 3FFCB 2EIDA 5BS0D 4Y5VC 3DARA 3DJ9A 4LQ1A 2NZIA 4Y1AA 4QLWA 4YXHH 4PY8I 3FTGB 3DJRA 3F85A 1ESOA 1EEZA 2Y5TA 4ODVL 3E8VA 2XY1A 5B1BB 2CHNA 2YARA 3CFNA 2CR6A 1LE5B 5I74C 1OPOA 3SQOH 1JVLA 4KJYA 4L8SC 2B4CL 1UWEH 4Y9EA 2L7UA 2OJ1A 2XN0A 4G42B 4PJ5E 3WLWC 1Q38A 1PTZA 5D6DC 2PLTA 5E8PB 2HKFH 1EQWA 1WUNT 2HFTA 2W9DH 2MQGA 2YR3A 4U1GB 2G3XA 4K8RC 1D5ZA 1Q9OA 3C6EA 1IL1B 1MRDH 5B8CC 3BYTA 3HAEG 1ET5A 3AGWA 4ANVA 5D7JD 1LO4H 4JM2C 4K3GA 1I9EA 1QPXA 3QUZC 5E2UL 5BRZA 3PPSA 2HT3D 1HXYB 2IDFA 1UM6H 1EEYB 4YSPA 2J43A 5FHBH 3QEUA 3VD7A 2EDKA 1AQMA 2R0WL 2W0KA 4CKVX 3ULVD 2C4FT 1SJEA 4L9LC 1AQHA 3U36B 5LN4A 1RY7B 5SX4H 4RMWA 4QHUB 2UUDH 4DKAA 5D2LF 2YBRB 1NLBL 2R9HD 1QW8A 3IMWA 1FZOA 1JXDA 1KCSL 2EIZA 3LPWA 2ORBH 2WLIB 3MRBB 4MTMA 3NZ8A 1P4LB 2F2HA 4BCXA 1S4IA 5BW7C 4M02A 1MLBA 3GPSA 4PR5B 2HT2C 1W72H 3FFCE 5B1AB 4TLTA 3C87A 1KT2B 4MA3B 3CIAA 2CGRL 3KPOA 4KO7A 4NZRL 1FH5H 3UMTA 1I3RA 4KPHH 4NFCA 3QEGL 4GRWB 2Y7LA 4F8NA 3QAZC 4CAGA 2G2RA 5C09A 3LIUA 4AK1A 1IGYA 1JHTA 2YAQA 3D25A 1LP9A 5LXVA 1L0YA 4JCWA 1OGTB 3VRIB 4UQ3A 3ZTJG 4AC4A 3VM7A 3OLDA 4TPRL 2ENJA 5TE7L 3AU1B 1BBDH 4MAZA 2NUTB 1VSCA 5GS1C 3BH8A 4J23A 1MCOL 4RAVA 4NZ8A 1B0RB 5DVPA 1ITBB 3OF6A 1J0JA 5AOZA 5EWIL 2LLGA 1DVQA 2NXZC 3O9WC 5T3XH 1ACCA 4M3HA 1S2EA 1Q0XH 1E42A 1K5NA 5FGBA 1JF5A 1TF4A 4LLDB 4A7UA 2H3NB 1D9KA 5CJOH 5KOMC 3DWTA 3OQ3B 4GAJL 3LKOB 1ETB1 2K3TA 2WWKT 4KV5F 4LP8A 3MU3A 1DVZA 1N3NB 2ZWYA 3UERA 5GPRA 4JHWL 4JO4L 5C9JB 4P07A 4ZMNA 3ILQC 4GG8A 3SKJH 4ZTOH 2YEZA 1JG9A 3B3BA 3BSZH 3M46A 3OKDB 1UQSA 1XGYH 3OAZH 5C0AD 2XWBB 4RMVA 3SOBH 1CBVL 3HLKA 4K5MA 3BVVA 3WN5C 4PRPD 4UTBL 1J0YA 3APNA 3MOAH 2BOCB 5CCJA 2MCPL 1CLCA 4BE5A 2BMKA 4WW2C 4HOXA 4KI5D 4XH2B 3W38A 5FDWA 2UVEA 4HUWB 1TTAA 4G82A 7FABL 4I3GA 4GRWE 3PY9A 2ZOLA 1E43A 4QXTA 1RZIA 4FD0A 1UWFA 5IF0A 4X0KB 1LNUA 2EDMA 4B97A 3IB4A 1EZLA 3P69A 1JV5B 3FB7A 2H45A 1JGVH 2NNCA 3MRQA 3WLBA 2CDFA 2PPCA 4O51A 5T1MB 2WMPB 4QOKB 4XNYH 4KAQH 5AW5B 4RESB 1VFAB 3OPZL 1PSKH 1UA3A 4APXB 2LU5A 2WVSA 3S2AA 3U0WH 3SDYH 3JV6A 4UUJB 4H8UA 2YK1H 4LNVA 3E8UH 2F1EA 3GPEA 1ZGLM 5D1QD 4LPWA 1SN2A 1HHKB 2J71A 3AQZA 1YYLH 3DIDA 1TZHB 4OFQA 1A9BA 3P3RA 1U8MB 2WWMD 1NAML 2XIDA 3IRZA 4E9TA 3W11D 3FTSA 2P8MA 4X4ZA 5LBSH 5B1JA 4NRYB 4ELMB 1MCFA 5FYLH 3U4KA 4IKIA 3BLKA 1IEBB 2AQQA 1DBAL 1I9JH 2EEBA 1W0YT 3ARBD 4QY8B 1NDGA 3LEXB 4NBYB 4X99B 2HT3C 4R0LC 1M6OB 4ZPVA 2D7PA 4HDIA 2ZF9A 3GK8H 5E08L 1JHLL 1WIOA 3LAFA 1RHHB 3ULVC 2W95A 3IDGA 3SO3C 4XO8A 4QO1A 2RFXB 1GHFH 2ODHA 2OSLB 2EYRA 1ADQH 4YQXL 2YRPA 3X14B 1A1MA 4LPYA 1BIIB 4HS8L 1VFUA 4TQIA 5D6CB 1KV7A 1U0QA 2Z92B 2HJKA 3EGDB 3FW6A 3O4OC 2GIYA 3VUAA 1Z2KA 1F3RB 1T1WA 4Z7UA 2F08A 3ARDA 4Z95L 1OAQH 2NT0A 1E65A 4RZKA 4JZJB 4XNZB 3VFMB 4XX1G 5IB4B 5E6UB 2ZXGA 1AD0B 2E9BA 4OFKA 4APQC 1EHXA 2VKXA 3PNWB 3MLSL 5DRWB 1NFDB 2BSRB 3N3EA 2EKJA 2L04A 3O6LL 4G9DA 4WI9A 5JXED 3EF4A 4UTBA 3QXDA 3WSQL 4I1NB 2F5AL 3HEIB 2A6KB 4TTDD 2UXGA 2FEJA 3MZGB 4AITA 4RRPA 5I19L 1IGTB 4MAYD 4UIKL 1EFXD 5TFSL 3IDXL 4IGBD 3TO4D 5DK2B 1WBZA 3LSOB 1FC1A 2PCFA 4NQEB 3N0AA 1JFQH 3WG7B 4UMGA 2HH0H 4MMXA 4CSTA 5J56B 3HE7A 1U8LA 5JHBA 3MR9B 3O0RL 3KLSA 1WWBX 4ILDA 3LEYL 4S1SH 1WBYA 4M1CD 4MJHA 2J57A 4LARH 4UV4H 3IXTB 1CDGA 2E75C 1PGRB 3TYGL 4UTCA 2X9WA 4PLNC 3FQTB 3WE1A 4IU2A 1NGXA 4Q52A 4MBRA 1NAMA 1UD8A 4LVNB 1DVFB 4MD5B 1PAZA 3CXFA 5I8EB 4A2GA 3FUJA 2QSQA 5ADOH 4MMZB 3EOYG 1XL6A 4KBPA 3NFPA 1U4FA 4IU3A 1A6TB 1B0WA 1UURA 2ZUYA 3VB9A 4R4BB 3W56A 4DP5X 5JA9A 1EHLL 1NLDL 2NY7L 2VL4A 2I5YH 5DJ8B 4HJ1A 1FH2A 1NFDE 4Z0BL 2QHLA 4HSCX 1T6WA 1E6OH 4AUYA 2J56A 2ICEB 1F00I 2RIKA 4I18C 3F00A 4XRCA 3MV9E 5DS2A 3VQ2C 2WN2A 2ZUVA 3CFDA 2FQDA 1ACYL 1G1KA 1JZ6A 4HUCA 2X70A 3E2HB 1QRNE 2IDCA 1FNHA 1DO5A 3FN0L 2X42A 4NQEE 1CLYH 3PG2A 1RUMH 4AGNA 3ECBA 3CX5J 3NCMA 4M00A 2Z65C 5IMKB 1GCYA 1IJ9A 2BVOB 1KCBA 3MLVL 3NPZB 4XHJD 3ZE1B 3DECA 3QIUA 4QEGA 4IDJH 5CN3A 4XO9A 2EEXA 3HZ3A 2WCGA 2WWMC 3A67H 3KLAB 4LT7A 1HXMA 4FQCH 5DHEA 4NPYA 3W11C 2YRLA 4NQVB 3LRSA 1O7SA 4EUPH 4YSUA 2XQYA 2PTTB 2XBZA 2Y7OA 4UANA 2XKNA 4JFUA 5D2LA 3DYMA 5C0EB 2ZIDA 2BC4B 5FUOL 2WBJA 2HP4A 4QRRB 4L4JA 43CAA 3B4NA 4JFEB 1E7UA 4MLSA 1XB3A 3QWOB 4OF8A 3NQKA 1FNEA 1N7MH 3L08A 3QS2A 3ZDXF 1OAXH 5AKVA 5TF1L 3EJQA 4PV9B 2VLLB 4RNRB 5BZDA 3CQQA 4G1EB 4W6YB 5CJQL 5DJXA 1FCGA 3QUYD 1LE9B 2ATPA 4EXKA 2EVJA 2FECI 2VDMH 2AXJA 2D7TL 3FO9B 5FV2A 1F4XL 4NO0D 4Y9GA 1QFWI 5F0LB 2XV2A 4X42A 3OKKB 4YVNA 3BW9B 1GTNA 2V2XB 2EDXA 4PG2A 3L1GA 2DKSA 4GBXD 3QA3B 4L1TA 3P0GB 3U4EB 4ALAL 5EF1A 2R1XA 3WE6B 2O5XL 2AQTA 3BD4A 2GEEA 1KGJA 3T6WA 5A2IH 5JXEC 2IFFL 4LKCA 3I50H 4WWNA 1OCZB 2ZAGA 3F7VA 4ZUWB 4OZHF 2GSGA 3RL2B 1RZFL 3CN0A 3O3UN 2XG4A 3LB6C 2R29H 2WQWA 2DLEA 3F58L 1M7UA 4MAYC 1CVRA 3GMLA 1E2ZA 4IGBC 3TO4C 4J2XA 4POZD 4AYMC 2P42B 2V2TB 4K23H 2RD0A 4NAMA 3ARQA 3GO1L 4JRYA 3VXRA 2EQDA 1H3GA 3OGCB 4O5LH 4XPFH 1ZLSH 5FIEA 3ZYOA 5EU4A 3EZJB 3PHSA 5E2TL 1M05A 4KO6A 4M4RA 3BVWA 1U58B 3CSYA 1ILUA 3KXFE 1YQVL 5IB5A 1UC6A 1LM8V 4QRRE 2YC1B 4JQIH 2Z6FA 5KSUB 2LR4A 5IK3A 1H9VA 4JFEE 4PJ7F 5CN2A 2G2NA 3HC4L 4G2AA 1T5XB 2XNAB 3CBRA 3QXTA 2I60H 1PEWA 5FOBA 3QQDB 3QRGL 2EXWC 5FUZH 3L5WA 4KHTL 1KJVB 1B3JA 1RZKC 3VQ1C 2WLHA 5CBAB 2XTLA 1SHMA 4BIKA 4P59H 4U1NB 5A3IC 5LHDA 2Q76A 1EJ8A 4CL7A 1MI5E 3RVTD 4PV8B 1YNTB 4E5XB 2WXJA 3KL3A 1OB0A 2NLJA 3IGUA 4Y4KD 5FX3A 4R7XA 2WLLB 3TBYA 2AGJH 4XTRC 3BIKA 2D31B 4PJAB 1MHPL 1URLA 1YEFH 1IIIA 4QTFA 1A1NA 1VZIA 3PAVA 4P4KD 1UGKA 1RCYA 3KCPA 1UWGL 3PQYA 4QAMB 4WSGA 3ZUNC 4CC1A 1RULL 1YHPA 4OFYD 2XA8H 3RA7L 3D9AL 4K55A 1EA9C 3UTPD 5G4MA 4XC1H 2RACA 4ODXA 4GYBA 1WYJA 1UA6H 1WF5A 2IG2L 3CBKB 4J3UA 4KRPD 5KS9F 2OJEB 2QQKH 4E42B 3VSTA 2HAZA 3VWJA 5HYFA 4QF1A 5FO9B 1YECL 3QG6A 1TPXC 4G8IB 1XR8A 3HZMB 2G60L 1RFDH 2ZNWA 5DHVA 2VWEE 2X38A 4QHMA 3VG9B 2FWSA 4Z9KB 3DROA 4JFDD 1XIWB 2EEFA 4PGCA 2NUPA 1ZTXH 5D2NA 4GSRA 1AS7A 4YGVB 3S4SA 4F7EA 3QFJD 2QJDA 4OM0H 4P5MB 4HLEA 3NTCH 5I16A 1BEYH 3FUFA 4JY5H 3EO1A 2XU9A 1QEWB 1FRGH 32C2A 1IAMA 3HPJA 5DK0B 3BKJH 4ZUUA 4JFSA 2BP3A 3GRGA 1F0LA 4IMLB 1IIKA 2DQDH 1BWMA 3ZL4H 3DTXB 1MW0A 4JB9L 4ETQB 3LD8C 1KDJA 3F64A 4FQ1H 5A2FA 2Q87A 5EIQA 2F7QA 1CUOA 3BIBX 3MBEA 3L5JA 3WEXA 4PJAE 3APCA 5JIDA 3D4CA 4HQQL 3QHZH 3GEFA 5E6IA 4JFWA 2Z7ZA 25C8L 1QR1B 3BPNB 2DI9A 2YGQA 4G83A 4DCQB 2NY3B 2VDRH 1HILA 3IJSA 1PEZA 3QUYC 4KHXH 2BNRA 2VCOA 1REIA 4GI9A 4M9OA 1CFVL 1T1ZB 3KJ6H 2BY3A 5IP4A 1DZ0A 3VRLE 5L2JA 3HNVH 1JGEB 1M3JA 1AJ7L 4BWUA 3L16A 4FP8L 1WAEA 3IMSA 2Z93A 1RAMA 2ENPA 4GBXC 4LNRB 2K8QA 2CXKA 2Y69B 3U46B 5B38G 2JKWA 2X44D 4XN9A 1B2YA 5MI0B 2V37A 2EEDA 1INQB 2A74A 4HS3A 1W16A 3QO1B 2WKOF 2OX5A 4X50A 5F7NC 3NCFB 4WFEE 4X7SL 2NX5B 3CX5K 1A8JH 1I9IL 2JK5B 2DOCA 4K7FB 1FL5B 1GL4B 2ADGB 2YFNA 4POZC 1RURH 3H3PL 4FNLL 3KGRA 5DEJA 2ADJA 2W0LA 4JRXA 2NW3A 4JK0D 5I2IB 1HQRB 1ITCA 4FQQA 4UILH 5I73B 3ATDA 4NO2B 5HHQA 2AAAA 1BCIA 3RP1A 4IEFB 1VENA 2FEEL 3LJ3A 1VAHA 2PXYB 3QCVL 3T3MB 4NQXA 4AYGA 1BZEA 1JK9A 1PCSA 3O4LB 3H6AA 3UZEC 3QH3B 3T08A 1DQDL 1SJHA 1FLRH 3BGAA 2X9XA 4PSRA 4R7VA 5HJGA 2F18A 1TTUA 4JO5A 3RVTC 2ATKA 4Y4KC 4N5UA 4IBYA 4P5TB 1P4UA 1KY6A 2VISB 5KSBB 2JJTC 3H3KA 2F5BL 1LWJA 4FKEA 1BHGA 1E9OA 4LU5H 1IKFL 2QFPA 5F9OH 5KWYC 4EQ3A 5DD6A 1X7QA 4NENB 1N18A 3VGGA 4KZCA 4KXZI 4W4OA 4Q9RL 2A9NH 3BMWA 3QQ4B 4V2CB 1LLAA 5DYFA 3VD5A 5JXAL 5CR8A 5D7KD 5SWZB 3V5HB 4KJPD 4HGWA 4PJFB 1BZDA 3HC0B 4KFMA 3FO0L 4ZS7H 4I0KA 1ZK5A 3TXAA 4EMZA 4G5AA