1J95A

Kcsa potassium channel with tba (tetrabutylammonium) and potassium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
b'LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VOLTAGE-GATED POTASSIUM CHANNEL
publication title Potassium channel receptor site for the inactivation gate and quaternary amine inhibitors
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 34
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1j95A00
1R3IC 1R3LC 2IH3C 3GB7C 2JK5C 2EINC 3AG1C 2EIKC 3AG2C 4GX0A 2EIJC 2HG5C 4H33A 4G27B 4P9PA 3SPCA 4LBEC 5EBMC 4PA4A 3ABMC 2QTOA 4R50A 4MSWC 4X88A 3SPHA 3ZRSA 4WFEA 2NLJC 5B1AC 1OCZC 2WLNA 2BOCC 2WLLB 3K0DA 4J9YB 4WFGA 1V54C 4PA7A 3E89A 4WFHA 3RW0A 3SPJA 1M57C 3OR7C 4WFFA 3LUTB 2Q67A 4PDMA 1K4CC 3OUSA 3E8FA 1OCRC 4QE9A 3UM7A 2HJFC 3E8BA 5KUMA 3SYAA 5J9PC 5BZBA 4GX5A 3SPIA 3T2MA 1P7BA 4X8AA 3E8GA 2BOBC 3R65A 1LNQA 3PJSK 4RUFA 3FB8C 2WLKA 4TWKA 5CBFA 3SJQC 2A0LA 1QLEC 3K03A 2ITDC 5EK0A 2R9RB 3SYCA 3ZJZA 3LNMB 4H37A 4F4LA 2A79B 1OCOC 2WLLA 4PA9A 3LDCA 3FB7C 4MW8A 4MTFA 4P30A 1K4DC 4XDKA 3SPGA 2DWDC 4MTGA 2HFEC 4MVOA 1XL4A 3KG2A 4MVMA 3SYPA 3FB5C 2X6BA 2H8PC 4R7CA 3OUFA 4X89A 2WLJA 3LDEA 3OR6C 4G28B 5EC2C 4GX2A 4UUJC 5B3SC 4HYOA 4GX1A 5CBHA 4MW3A 3STLC 3UKMA 1BL8A 1V55C 3IFXA 4OXSA 1JVMA 3ASOC 4R6ZA 3K0GA 3K06A 3SYQA 2HVKC 2DYSC 2KB1A 3EFFK 2HVJC 4J9ZB 1R3KC 2AHZA 3E86A 4KFMA 4P9OA 4RO2A 3SYOA 5EBLC 3ABKC 4CBCA 4R8CA 2DWEC 2DYRC 2X6CA 3VOUA 4PDVA 2WLHA 4XDJA 2W0FC 3E83A 3JYCA 2X6AA 2K1EA 4LP8A 4RUEA 3LDDA 3HPLC 5B1BC 3TETA 3RVYA 2OCCC 2WLMA 5IY5C 3ABLC 3IGAC 4MTOA 4MVRA 3F5WC 4QE7A 2AHYA 3T4ZA 3T4DA 4QNHB 2IH1C 4JTAB 2WLIB 4LCUC 4HZ3A 2A9HA 4MS2A 1G4YB 1J95A 1XL6A 2ATKC 3TCUA 2P7TC 4XDLA 4P2ZA 4PDRA 4JTDB 3RBZA 4MVSA 3K04A 2Y69C 4PA3A 2QKSA 2ITCC 3FB6C 2Q69A 3AG4C 4ZBMA 4DXWA 2ZXWC 2EIMC 3K08A 3STZC 3F7YC 5E1AC 2ZD9A 5KUKA 3AG3C 3E8HA 1M56C 4I9WA 4MVQA 1S5HC 2EILC 3F7VC 1OCCC 5EC1C 4JTCB 3WG7C 3RVZA 3X2QC 2Q6AA 1R3JC 3T1CA 4BW5A 2Q68A 1ORQC 3OGCC 3ASNC 4PA6A 4RAIA 1KKDA 2WLIA 2YEVA 4PDLA 4MVUA 1ZWIC 5CBGA 4EKWA 3BEHA 5EBWC 4MVZA
chains in the Genus database with same CATH superfamily
5JH7A 5FLXN 1R3LC 4J7ZA 4JV5B 3IAYA 4X62O 1YTFB 4H33A 1HNZB 3JAMN 1D5NA 2QWNB 1VF6A 2NLJC 1JQ0A 2Y4TA 5KA6A 4DV3B 4QJFB 1NH2B 1BGYH 4PDMA 4DR6B 4UV8A 4Z1MG 2OCHA 4OGQB 4B3RO 1YDXA 4E2LA 3K9SA 5BXZA 2KKWA 4GKJO 1O9HA 4LF8O 2UUCB 4F6RA 2YXLA 3K03A 1SKVA 5KAFZ 4DV6B 2ZNIA 1HNWO 3W7SA 2IBZH 4DV0O 2F66C 1OCOC 2YS8A 2EJRA 2XT9A 3TGUH 1NR7A 4JAVA 1KC8W 1N34O 3M8AA 2X7RB 4W4LA 1JJOA 1TUBB 1VARA 4PI0A 5CA3A 3CB2A 5CBHA 1WB7A 2JRIA 4NB5A 4O4IA 2HHHB 3G71V 2Y48A 3ABLB 3WB2A 1S76D 2HVKC 3HKBA 4EEQA 2LQTA 2AHZA 2XNDG 4CBCA 1AJQA 4RO2A 4JYYA 2DYRC 1QHTA 3H01A 1H2LA 1AI6A 4NVPA 4YJ2B 3IGAC 3OE7G 4BWAA 3VQYA 4K0KB 3U10A 2YEVB 2A9HA 1AR4A 2QTSA 1Y76B 4CH3A 4JTDB 3BY6A 3VQVA 4B3SB 2Q69A 2ZR3A 3ETGA 3AG3C 4FPPA 1RPRA 3D3QA 4KP4A 5A2QN 2Q6AA 4DUZO 3A8TA 4TOIA 4O4LB 5CB4B 3BEHA 2QWPB 1VQLV 3K5NA 1JOYA 2E5LO 5LMNB 1IDSA 4O4JA 5LGTA 2F4VB 3OT7A 4TQDA 1FD9A 1N36B 1N32B 1S3JA 2GTAA 1QCEA 3T1YB 4FMTA 3J81N 2VQEB 1OCRC 5BMVA 3CJHB 3CCUV 1DK1A 3ZMUA 1KP2A 5KHJA 4YHHB 2Z3YA 3ZBHA 3H1IH 5EK0A 1XNQB 2DQ3A 2HR3A 4DR2O 3H1HH 3I56V 2XAHA 2ZXWB 1M90W 1CPYA 3WB1A 3M7MX 2ZE6A 3OUFA 4LFCO 1HR0O 2PUSA 4MW3A 3ZN0A 3RWRD 4R6ZA 4JI6O 1N0NA 5ITZB 2P6JA 3MAQA 3JCZA 4DR4B 2ADPA 2R72A 5KA5A 3B8NA 4K8XA 2WLHA 2O57A 1FXKB 3T1HO 1MG1A 4I4TB 4JAAA 1TUBA 4MVRA 1GO3F 1ZL8B 4HZ3A 4UB8Z 1MABG 4JI8O 1EM1A 3X2QB 3RBZA 4U3FH 1K7DA 3PN1A 3STZC 4UVCA 5IYBO 1H8HG 2E75B 1H2NA 3JASB 4DK1A 4YJ2A 1JA8A 3CMAV 1ORQC 2YUAA 2P67A 2YEVA 5IJ9B 3SJCC 4LF7B 1Y76A 1PD3A 2JK5C 4PV1B 1G1XB 1ZAUA 5JJNB 4MSWC 1WN7A 4U3JB 2DMXA 4X1YB 3MDSA 5B1AC 2HJDA 3IC9A 2QEXV 2B1IA 3K0DA 4J41A 2CTWA 3LUTB 1SESA 4QIWF 3SYAA 4O4LA 5CB4A 4ZI7B 2QA4V 1OCOB 2OCCB 2Z5UA 1NTKH 1Y74B 3FB8C 4LH7A 2YXHA 4BIZA 5H9CA 3CCQV 4MW8A 1GM8A 4MVOA 1Z5VA 3CC2V 3ZS8C 3CJHA 2M6YA 2XOKG 5EC2C 4X65B 2PI5A 1COWG 3ASOC 3ZEDA 3W7UA 1AI5A 2F43G 2KB1A 4KXRA 5LA6B 1YCIA 5EBLC 5GONB 5H6RA 4UVAA 3ABMB 3AK2A 2ZINA 3AG3B 4D7SA 1E1QG 3DXRB 1XNRO 1KBHA 3JAKB 4JPRA 4JZ2A 3S3WA 1FXKA 3F7VC 2QR4A 4I4TA 3ABUA 3VQXA 4L87A 1KKDA 3W7TA 4PDLA 4BW9A 1ZL8A 3CSXA 4MT8A 1RFYA 1IBKB 4QGPA 1H2MA 4MVZA 1VF7A 1OCRB 2EIKC 2HG5C 4LBEC 3UO2A 4MTXA 5LMUB 1S77D 3OD4A 2JJ2G 4FM0A 4WFGA 5IE9A 1V54C 3E22B 3UQ8A 4WFFA 1NJIW 4QE9A 1AP6A 1KKCA 5CA1B 2HJFC 1NVPB 1RPOA 1OJHA 5IJ9A 1BE3H 4JI7B 4EFEA 4ABMA 1NS1A 3UCSC 3SJAC 3SYCA 1OV9A 4IT5A 4U3JA 4X1YA 1DF5A 3BVOA 3RYIA 1XMQO 1NU1H 2AGAA 1PNLA 3SYPA 1IBMB 1N34B 4JAUA 4ZI7A 5A9GA 1KP3A 5JWPA 4HYOA 4GX1A 5DN6G 4NKGB 1BZKA 1GN2A 3C3TA 5LXTB 1Y74A 1M93A 3F5TA 3E86A 1WPXA 1GN3A 3VOUA 2QKAA 3ZN1A 3JYCA 1N33O 3N2KB 4MTOA 1TA8A 2IH1C 3H9VA 2UXBO 2FB5A 2NNUA 5HFLA 1KYOF 1XBLA 4JI1O 1LR1A 2QKSA 2ITCC 5LA6A 2N74A 3CWBH 5GONA 4QPJA 3THOA 3QO7A 2VWKA 1E79G 3G6BA 4FM2A 4FLYA 3DC5A 5B1AB 4DUZB 5CBGA 3H1KH 4ZIBA 3DXRA 4O4HB 3FFQA 4H0LB 1VIBA 2A7WA 1AJNA 3JAKA 3A0HZ 2YXYA 2UUBO 2QTOA 4X88A 2W0XA 2Q9LA 3U11A 4X66O 3R66A 1PL4A 2CE4A 1Z2GA 1PKXA 4I7ZB 1K92A 4ZHQB 4B3TB 4JI0O 1FXVA 2F93B 5LOVB 4DR3B 4LR3A 2NR5A 5L3EA 3HR0A 3OM3B 1JFFB 1K5SA 4D6TH 4CS2A 3SJQC 2XUMA 1GTOA 1EZVH 2XHBA 3ASOB 1AI4A 3E22A 4DR2B 3APOA 1Q90D 2HFEC 5LP6C 5CA1A 3K59A 2W6JG 3OGIB 2JVDA 4LFAB 4UFZA 4KHPB 3OMIB 2ARHA 2YDEA 3SR2C 4KFMA 2DN9A 2X6CA 1EBOA 1I7FA 4GLXA 3FAVB 2FKXA 5KX5B 3DGEA 3LNNA 4FVMA 2ZE7A 4FLUA 3A0BZ 3WFVA 3CRQA 5LXTA 4JI3O 3N27A 2OYQA 2Q0OC 4NXNB 2ZXWC 5JJJB 2ZD9A 5HFMA 3ML0A 3WG7C 4GKKB 3K58A 2EIKB 1V9PA 3DSQA 3N2KA 1TVKB 1QR9A 2UXCB 3OTOO 1M4UA 5EBWC 1V54B 2DJVA 1BMFG 1GN4A 2UXXA 4AI8A 1B04A 1LUVA 3QO8A 3FYIB 1MOFA 4WFEA 3ZRSA 4X64O 1K3EA 4NTYA 3RW0A 4KL1A 5B1OA 1BQZA 1K97A 2QWOB 3ZMVA 4O4HA 3QF7A 3OMNB 2CTRA 1VQ5V 3R65A 3B40A 1XDCA 5H2FZ 4BIOA 5H6QA 3ZMZA 2JEUA 1GMGA 5KAIZ 5KHKA 3JD4A 4ZHQA 2YI9A 1GM7A 4DV2O 5LOVA 1SQPH 1JFFA 4UUJC 1JX9A 2L35A 2RMKB 1IBLB 1IURA 2XAFA 4WCEV 2ZIMA 3BHPA 4I9QA 1P7GA 2JEXA 4IHJB 4N21A 2OCCC 2RJZA 4IGGA 1U96A 3U0ZA 4FZ0A 1F4NA 1W2BU 1JJ2U 2RQ6A 2HKOA 4LF6O 1L0LH 1EN4A 3RYFB 4LWSB 3K5LA 3OFNG 2VWJA 2VS0A 2W6IG 1XNRB 3BA9A 1HW7A 3CRCA 4AQYO 2YSUB 3F7YC 3L73H 3E8HA 1I5XA 4OPAA 2EILC 3JARB 5EC1C 4LFBB 3FAVA 5IYCO 3JD3A 4TV8B 3OGCC 5KX5A 1Q6HA 1F7YA 4PHZA 2LFSA 3ZMTA 4IL6Z 5L3GA 1EN5A 3J7AU 2EINC 1XEQA 2JIZG 4DV4B 1KB9F 3ABMC 3L9DA 1QVFU 3UT5B 4YY3B 1M57C 1NZ6A 1TVKA 1VMGA 4G2KA 1SA0B 5IDJA 5J9PC 4BAYA 5L3BA 1I94O 1AVMA 2EZOA 1P7BA 3SJBC 3E8GA 2XTAA 5LP6B 1CEZA 2ZKOA 4FIPC 3MHSC 1FJGB 1R6NA 5GW7A 4RQEA 3OEEG 3RYCB 4LF5O 2UU9O 2Y0IA 2Y69B 4CH5A 1R1BA 3AK3A 1XMQB 1BCCH 2WA3A 3H1LH 2H8PC 2P22C 4JYCA 1E1RG 4DR7B 4LF9O 3RGBA 4K3AA 1AILA 1D5AA 2BTOA 4J9ZB 4HAMA 3JD0A 5LHGA 4CZZA 2QGNA 4PDVA 2K1EA 4LP8A 3L75H 3Q4HB 1H38A 3HKEB 1GK9A 2OIGA 1N33B 4JTAB 4LCUC 1ZUQA 3WG7B 1FFXB 4MVSA 2QE7G 2WPDG 4FLTA 1BHBA 4C7UA 5E1AC 5BR8B 4IHJA 1VQKV 2EBOA 5KHHA 3E2EA 4B7KA 3RFRA 4EB6B 4JYAO 2UXDB 1WB8A 1ZWIC 1XILA 2FMLA 1R73A 2Z0AA 2UUAB 3RYFA 4LWSA 4X1IB 2ZE8A 1S5JA 1HP8A 4ASUG 1YHQV 2H3OA 2EIJC 4R50A 1V55B 1PPJH 2P06A 3JARA 2UUBB 2WLNA 2WLLB 4TV8A 2PYLA 4PA7A 5EZYB 4DUYO 2PYJA 4DV7O 2ZM6O 3JD2A 5BZBA 3P32A 1S0VA 1A32A 3W7WA 5IWAO 2MK3A 4Q6GA 3ZJZA 1K34A 1FS0G 3UT5A 4JI2O 2WWWA 4MTFA 1KD1W 3APQA 1K8AW 2RDCA 3KG2A 1SA0A 4J42A 3BAAA 4X89A 5B3SC 2YIBD 3STLC 4DO2A 4LF4O 5LP6A 4DV5O 4JYBA 3K0GA 2IJIA 5GTHZ 4FFBB 1YF2A 2DWEC 3RYCA 3N2GB 1DTOA 1URFA 3LDDA 1PNMA 3CEIA 2E76B 3P3NA 1SQBH 2EILB 4JV5O 1ZSPA 1XL6A 1HNZO 3WB0A 3K04A 2VRZA 4K35A 4JI3B 2ODMA 4DV1B 1MNGA 2N04A 3ICXA 1ROPA 4DR6O 3Q4HA 1AI7A 2EINB 3HKEA 3GWKC 4DR5B 2JGDB 1PM9A 1Q43A 2CK3G 4EKWA 1FFXA 1M57B 5ITZA 2UUCO 2WAMA 1FFTB 2IW5A 2Q5ZA 4NXMB 2ETNA 1BHAA 3NXSA 2HP8A 4WFHA 2X0LA 5AG2A 4EB6A 3ZCCA 4TV9B 3ABTA 1NT2B 3KCYA 2LFRA 4JZGA 1YI2V 1Q82W 5J2UB 2HHHO 3BRCA 4GX5A 4X1IA 3CCRV 1IVSA 3GWOA 1XI1A 5JQGB 5CBFA 1WNSA 2VQFO 4JI4O 2CTPA 4X62B 3D36C 3QVNA 3JASA 2WLLA 4P30A 5EZYA 5FPRA 4K0KO 5C8YB 4DV2B 3CCLV 4Z2WA 4G28B 1QBZA 2R70A 3HKCB 5DEDA 4B3SO 3CPWU 5IT9N 4B3RB 2KG7B 3P3PA 2RN9A 1WLEA 1R3KC 5FL7G 2M7WA 3ZMSA 4R8CA 5LGUA 4GKJB 1I5YA 1WA8B 1XQ8A 1QVGU 4LF8B 2JGUA 1HNWB 5IY5C 4DV0B 1GRJA 1K5QA 2HEPA 3K9AA 4O2AB 2OTLV 3ETEA 1G4YB 2F23A 2ATKC 2B1GA 2P7TC 5LMNO 1XMOO 4OX9O 1Q86W 3JATB 3O65A 1Y67A 4FFBA 1N36O 3K3WA 1N32O 3N2GA 2VQEO 4I9WA 4RWUA 1XREA 1SRYA 3H1JH 3RVZA 4K8ZA 1MZFA 1R3JC 2EIJB 5JVDB 2YIAA 3BFRA 2Q4PA 5JCOC 1PL0A 2A3QA 1F51A 2K9PA 1XNQO 1IZ3A 1TAEA 2P4KA 4TSFG 1KMIZ 2JS5A 3SPHA 1US6A 3CC7V 1KU9A 2JGDA 1IX9A 3KKYA 3L70H 3HKDB 4CC5A 1I08A 3ZHUA 4DR4O 3K5MA 1DLBA 1MSWD 1Q3EA 1I94B 2BOBC 1QQCA 3ETQA 1WAZA 4FLVA 4LH6A 3E35A 2QDOA 3ZX6A 4JI5O 2RCVA 1QLEC 2E5LB 5B3SB 5B66Z 1I0HA 2OWOA 4H37A 2ADQB 4I50B 5IYZB 4DW0A 3G80A 1SQFA 4TV9A 3K57A 4UCTA 2X6BA 1M56B 1ENVA 1YXBA 5J2UA 4R7CA 1EN6A 3K79A 1GH6A 4FK5C 2FL4A 2BTQB 2YICA 1KECA 3M99B 4WFAV 4IIJB 4TUYB 5JQGA 2ZCEA 1XOUA 2JJ1G 3EFFK 1P49A 3JALB 2QM7A 3CS5A 2QM8A 3ABKC 3CD6V 1SETA 2XAGA 2G38A 1B6QA 4UVBA 4XDJA 3NR7A 1YITV 1T5EA 1EFRG 5B1BC 5EIBD 2FYUH 3RVYA 1KUQA 5C8YA 4J7JA 2H94A 4UCUA 2F1MA 3L71H 2AHYA 2ZDIC 4LF7O 2DOSA 3C90A 4AILC 3HKCA 4TT3G 1NTZH 3TCUA 4L8JA 1SF9A 4XDLA 2KG7A 4LFCB 1HR0B 2Q7EA 2Y69C 4JI6B 3RT3C 2EZPA 3CC4V 1WA8A 4YIOA 3A2FA 5H5NA 1XHZA 3ZRWB 2XAJA 4UCVA 4JGSA 3T1CA 3T1HB 3B4SA 4UV9A 4PA6A 4O2AA 3RYHB 3D3IA 3AG7A 4GYCB 4J10A 2CUGA 3EVKA 5J2TB 3JATA 4JI8B 1UJWB 1YVWA 4PELA 2BSKB 2B9ZA 4IYHA 1B3QA 1N8RW 1VQOV 1VQ6V 5JVDA 1FPOA 1Y66A 2XASA 4DV7B 2PF4E 2AZ2A 4X8AA 2A0LA 1UPGA 5IWAB 2C2AA 2GUZB 3P30A 1P4RA 1FYJA 1VEWA 1LUWA 1Q6IA 3OW2U 1RP3B 2E3CA 4PA9A 3QNEA 3C3SA 4JI2B 4AHCA 3B77A 5CN0A 3HKDA 1SQXH 1VQPV 2GTSA 1S5LZ 2R9IA 1AR5A 4FZ1A 1V55C 1S72V 1CP9A 2PGGA 5IY5B 1W59A 1AJPA 2QKCA 3K06A 4LF4B 2DYSC 2NN4A 5EYPB 1SZXA 3CRRA 1JCHA 2W0FC 3E83A 4I50A 5IYZA 2WLMA 5LYJB 1YSCA 1YJWV 1IBKO 4DK0A 3F5WC 4QNHB 2HLDG 2BTQA 4YJ3B 1QU7A 1W0JG 4UB6Z 5D5QA 3QTCA 1VQMV 1YJNV 1TGOA 4IIJA 4TUYA 5LMUO 1M5IA 1HNXO 3FB6C 4U7NA 3AG4C 3JALA 2Y0PA 4DXWA 3SDLA 3MHHC 2ZR2A 1ZX3A 2ZE5A 1JMKC 4JTCB 2D3OW 2CGOA 2PZSA 4X1KB 3IJ4A 4JI7O 1SZTA 2CTQA 2L6LA 5KHIA 1R3IC 2Q0AA 1DGSA 3A0RA 3AG2C 1WP7A 4GX0A 2ZNJA 1Q7YW 2JS3A 1YTFD 3SPCA 1O9GA 1XUQA 3FYEB 3CXCU 2EX3A 3ZRWA 1K9MW 1IBMO 1AP5A 1MZEA 5FPOA 3SPJA 2LJ2A 4GZRB 2Q67A 3J80N 1K4CC 1NH2D 1QLEB 3RYHA 2KQXA 1FKAO 1N4CA 3T2MA 5J2TA 4LNUB 1TUEB 2IU0A 2R9RB 2VQFB 2BSKA 4JI4B 3L74H 2AXTZ 4A5UB 3FX7A 3ABKB 1G8MA 3D36A 4CH6A 5B1BB 2N05A 3CRMA 4Z1VA 3ASNB 1MMMA 4DW1A 4I5SA 4UCRA 4J7KA 5K1PA 2GUZA 4WF9V 1PP9H 1NQTA 3CMEV 1Q81W 5IJ0B 4WFBV 4B3MO 3T4DA 5GTIZ 3K5OA 3T4ZA 2LP7A 2WLIB 4FJCC 4HBNA 1J95A 1J5EO 3G6EV 4H44B 2IJHA 4OPHA 3CCVV 4I0XB 5BY1A 3CP1A 1XMOB 3S3XA 4OX9B 3CCSV 3OMAB 5EYPA 5FNVB 2DW4A 4B3TO 4H13B 4DR3O 5LYJA 3FKSG 4BR6A 4NTWA 5TISZ 4DR1O 4YJ3A 1EZJA 2UXBB 2IH3C 5JCOA 4JI1B 5D5PA 4BIUA 5EBMC 4FLWA 1M1KW 5C93A 1Q5OA 1OCZC 5LGNA 2BOCC 2LW1A 3TK1A 3E8FA 4UXNA 2GSMB 4LFAO 4X1KA 3ZHQA 5KUMA 5L3DA 4KHPO 1X59A 3ZHSA 3I55V 4FFKA 2WLKA 1WP8A 4ZOLB 1NR1A 4X20B 1XHXA 3LSSA 4XBFA 3AK1A 4JI5B 4JF3A 2P4VA 3TXSA 3FB7C 1GKFA 4ZKIA 2DWDC 4F6EA 4X66B 2DYSB 2EIMB 4X9QA 4B08A 4JI0B 3LDEA 1SS3A 3LSQA 4NXNO 3BPZA 1BQ0A 4LNUA 1YEWA 3SYQA 1L0NH 2D2CB 2CH7B 3EHBB 3JSLA 3DTUB 4GKKO 3CXHF 1M9NA 4RUEA 3TETA 3LSUA 3AG4B 2UXCO 4D7TA 5CMUA 2WSSG 2R9AA 4PD4F 5LHIA 3RN4A 4E4EA 1NTMH 5EIBC 2LGWA 3BA8A 4J11A 2LW7A 2YI8A 2ZDIA 1N0JA 2CDYA 4ZBMA 3O9OA 5KHGA 5DM6V 1NKDA 3CCMV 1M56C 5LHHA 3RYIB 1AR1B 3CCEV 1VQ8V 5IJ0A 3AG2B 2UXNA 1RSOB 1R6KA 4BW5A 2Q68A 2A06H 2WLIA 4MVUA 4HNAB 4JASA 2ZQMA 2V4DA 3B09A 3CCJV 2Q7HA 2DQ0A 1H2KA 1VF6C 2E74B 4I0XA 1Z5WA 1Y4MA 2LGQA 3AG1C 1D2DA 5FNVA 1JPXA 3WU2Z 4DV3O 4DYLA 2GBOA 4J9YB 1FXHA 4YXWG 2QWRB 4NYKA 2DYRB 4GUNA 1H2SB 1IBLO 1GAXA 3SPIA 5LL6Y 1YIJV 1DF4A 3OTOB 4NR1A 3PJSK 4RUFA 2PY5A 4WBNB 4DV6O 3QG5A 3D8CA 3VBBA 1SQVH 1K73W 2LO1A 2IJJA 2QM4A 1Q6UA 4W4KA 1VP7A 2A79B 1G6UA 4MTGA 4X64B 4O2BB 3FB5C 4GT1A 1K33A 5CA0B 3JAWB 4GX2A 3UKMA 2GDSA 3IFXA 1JVMA 1IXBA 2Q73A 4ZOLA 3I5DA 4X20A 4B7EA 3SYOA 4LFBO 2GV9A 5L3CA 1FAFA 4NTXA 3JCUZ 2BCCH 1Q8IA 2Q8VA 1VQ4V 4N23A 2YIBA 4IYIA 1H2GA 3QO5A 3FD9A 4P2ZA 2RNBA 4PDRA 2OIEA 4DV4O 5F2VO 2CH7A 1RM1C 2YIDA 4DRXB 1HNXB 4YY3O 4CS3A 1HDJA 4EFBA 1OCCC 1VQNV 2XAQA 5JJEB 1GM9A 1YZBA 4RAIA 2KSDA 3CX5F 3BABA 5K1XA 1OCZB 3CRAA 2MW2B 1VQ9V 1BS3A 3SGIA 2OTJV 3G4SV 4LF6B 1FJGO 2JDIG 5L3FA 2F4VO 2IJKA 1SC5B 2PTMA 3T1YO 2FTKA 4AQYB 3B8MA 1QR8A 1RSOA 3OR7C 4TQFA 4DR7O 1W0KG 3OUSA 1BSMA 3OAAG 1NVPD 4HNAA 4FLXA 4FM1A 4YHHO 3ETDA 4UCSA 2OT5A 2P5OA 1WPBA 3ZRVA 3TXQA 5KMGB 2CGNA 1Y6XA 2IU3A 2ITDC 3LNMB 5LBQA 4F4LA 1F23A 4FLZA 4XDKA 1PV0A 1SERA 1B06A 4MVMA 2B5UA 3UO3A 1X4TA 1YJ9V 4I55B 1BT8A 1BL8A 4OXSA 3TJTA 2V1DA 1QLNA 4ICGA 5BR8O 4WBNA 1OZ0A 2HVJC 3ZHTA 1VQ7V 3KZIZ 5E79Z 2WA4A 2X6AA 3KCXA 1H8EG 2UXDO 4LF5B 1QNMA 1SQQH 2Y4UA 2UU9B 1P84F 1R6TA 4O2BA 4Q20A 3ABLC 4QE7A 2UUAO 5CA0A 3JAWA 2YC0A 3DC6A 4B3MB 2ILMA 4MS2A 5B1NA 3CYOA 4CC6A 2EJ7A 1L1FA 5JH7B 1J5EB 2AW9A 3AEIA 4LF9B 4CS4A 4U7OA 1VF5B 3HB3B 4MVQA 1SQGA 1WJZA 2QWQB 5B5EZ 3AG1B 1KQSU 2CAZC 2V7QG 3ASNC 3ZHRA 1NBMG 3JSNA 3OTFA 4DR1B 5KLVH 3GB7C 3MD0A 4GCZA 4LC1A 2PI4A 3L72H 4G27B 4P9PA 4DRXA 4PA4A 4F6RB 1PNKA 1IXMA 3CHXA 2IM9A 1L8DA 3E89A 4PI2A 3UM7A 1MA1A 3E8BA 4JYAB 4O4IB 3ZIAG 3ZRXA 4UCOA 2EULA 1LNQA 4TWKA 3HKBB 4CH4A 3VQWA 4KUMA 3LDCA 3SPGA 1K4DC 3ZHVA 1ZLZA 3BCCH 3IC7A 3JD1A 2AZ0A 1XL4A 4X65O 1AROP 4DUYB 2WLJA 3OR6C 3OEHG 2ZM6B 4J80A 3GVMA 5KMGA 3CE2A 1U97A 4DV1O 1ZTEA 1MSDA 2GHYA 2P90A 1THZA 4P9OA 1F4MA 1UFIA 4DR5O 3HPLC 1RM1B 2QJ1A 1AB3A 3W7XA 2ZT9B 4I55A 1OCCB 2ZIOA 4NXMO 1FXKC 3G67A 4PJ0Z 4PA3A 4QPKA 2DE0X 4DV5B 2EIMC 2Q7GA 3K08A 3EXAA 4O4JB 5KUKA 5DECA 1S5HC 3X2QC 1CXZB 4YIPA 1GN6A 1HWYA 1NI8A 5BMVB 2BE3A 5IYDO 4RQFA 1JR9A 2F95B 1OHHG 3B2EE 2QSAA
chains in the Genus database with same CATH topology
1M57B 1R3LC 2IH3C 1FFTB 2IW5A 2WAMA 1YTFB 1AJNA 4H33A 4BIUA 5EBMC 2QTOA 4X88A 5C93A 1M1KW 1BHAA 2NLJC 1JQ0A 1OCZC 5LGNA 5KA6A 2BOCC 3NXSA 1PKXA 4QJFB 4WFHA 1NH2B 1K92A 2X0LA 4PDMA 3TK1A 4UV8A 1FXVA 3ZCCA 3E8FA 3ABTA 4UXNA 4Z1MG 2GSMB 2LFRA 5KUMA 1YI2V 1Q82W 5L3DA 5L3EA 4E2LA 3OM3B 4GX5A 3CCRV 1K5SA 3GWOA 3I55V 2WLKA 5CBFA 3SJQC 1NR1A 3K03A 1GTOA 3LSSA 4XBFA 3ASOB 4JF3A 3W7SA 1OCOC 2WLLA 2EJRA 3FB7C 1GKFA 4P30A 1AI4A 1NR7A 4ZKIA 4JAVA 2DWDC 2DYSB 2HFEC 2EIMB 1KC8W 2X7RB 2W6JG 3CCLV 3LDEA 4G28B 5CA3A 1QBZA 5CBHA 3LSQA 3CPWU 3G71V 2Y48A 3OMIB 3SYQA 3ABLB 1S76D 2HVKC 1WLEA 3EHBB 1R3KC 2AHZA 2M7WA 2XNDG 4KFMA 1AJQA 4RO2A 5FL7G 3ZMSA 3DTUB 4R8CA 4CBCA 2DYRC 2X6CA 5LGUA 1I5YA 3H01A 1QVGU 1EBOA 1M9NA 4RUEA 1AI6A 3TETA 3AG4B 5IY5C 1K5QA 3IGAC 5CMUA 3K9AA 2WSSG 3DGEA 3OE7G 2OTLV 2YEVB 3ETEA 2A9HA 5LHIA 1G4YB 3WFVA 2ATKC 2B1GA 2P7TC 4JTDB 3BY6A 1Q86W 2ZDIA 2Q69A 2ZR3A 3ETGA 4ZBMA 2ZXWC 3K3WA 5DM6V 2ZD9A 1NKDA 3AG3C 3CCMV 5HFMA 3ML0A 1M56C 4FPPA 4I9WA 5LHHA 1RPRA 1SRYA 1AR1B 3WG7C 3CCEV 3RVZA 1VQ8V 4KP4A 2EIKB 2UXNA 2Q6AA 3AG2B 2EIJB 1R3JC 1R6KA 4BW5A 2Q68A 1PL0A 2WLIA 1QR9A 1F51A 4MVUA 4JASA 2ZQMA 3CCJV 3BEHA 5EBWC 1VQLV 1V54B 2DQ0A 1JOYA 1Y4MA 1BMFG 3AG1C 2UXXA 4TSFG 1JPXA 3QO8A 3SPHA 5LGTA 3FYIB 1MOFA 4WFEA 3ZRSA 1K3EA 1S3JA 4J9YB 3CC7V 1QCEA 3RW0A 1FXHA 4FMTA 5B1OA 4YXWG 1OCRC 2DYRB 1K97A 3CCUV 3ZMUA 3ZMVA 1DLBA 3SPIA 1MSWD 1KP2A 1YIJV 3OMNB 1DF4A 2BOBC 1VQ5V 3R65A 3PJSK 2Z3YA 3E35A 4RUFA 5H6QA 3VBBA 1QLEC 5EK0A 3ZMZA 5B3SB 2DQ3A 2HR3A 1K73W 2IJJA 2JEUA 4H37A 1GMGA 2A79B 3JD4A 3I56V 2XAHA 4MTGA 2ZXWB 1M90W 1GM7A 1CPYA 3FB5C 2X6BA 4GT1A 1K33A 1ENVA 1M56B 4R7CA 3OUFA 3K79A 4GX2A 4UUJC 4FK5C 4MW3A 3UKMA 3ZN0A 1JX9A 4R6ZA 3IFXA 1JVMA 1KECA 2P6JA 3M99B 4WFAV 3JCZA 2XAFA 2JJ1G 4WCEV 3EFFK 2QM7A 3SYOA 2QM8A 3ABKC 2JEXA 5KA5A 3CD6V 3B8NA 1SETA 2XAGA 1B6QA 2WLHA 4UVBA 4XDJA 5L3CA 1YITV 1EFRG 1FXKB 5B1BC 4N21A 3RVYA 2OCCC 1MG1A 2H94A 1F4NA 1W2BU 1JJ2U 4MVRA 2AHYA 2ZDIC 1GO3F 1VQ4V 4N23A 2HKOA 1H2GA 4HZ3A 1MABG 3QO5A 4TT3G 3X2QB 3TCUA 4XDLA 4P2ZA 4PDRA 3RBZA 3OFNG 2Y69C 2W6IG 1RM1C 1K7DA 3STZC 2YSUB 3F7YC 2EZPA 3CC4V 4UVCA 3E8HA 5IYBO 1H8HG 1I5XA 2EILC 1OCCC 5EC1C 1VQNV 3ZRWB 5IYCO 2XAJA 3JD3A 2XAQA 4JGSA 3CMAV 3T1CA 1GM9A 1ORQC 3OGCC 4RAIA 4PA6A 4UV9A 2P67A 2YEVA 3D3IA 2LFSA 3ZMTA 1OCZB 5L3GA 1VQ9V 2OTJV 3G4SV 1PD3A 2EINC 2JK5C 2JDIG 5L3FA 1UJWB 2IJKA 2JIZG 4PELA 3ABMC 4MSWC 5B1AC 2QEXV 2FTKA 2B1IA 1QVFU 3B8MA 1QR8A 3K0DA 1N8RW 1VQOV 1VQ6V 1M57C 3OR7C 3LUTB 1Y66A 1W0KG 3OUSA 4G2KA 1SESA 2XASA 3OAAG 4QIWF 3SYAA 5IDJA 1NVPD 5J9PC 4BAYA 5L3BA 3ETDA 2QA4V 1OCOB 2OCCB 2OT5A 2Z5UA 2EZOA 3ZRVA 1P7BA 4X8AA 3E8GA 1CEZA 3FB8C 2IU3A 4FIPC 2A0LA 3MHSC 1R6NA 2ITDC 2C2AA 3LNMB 5GW7A 3P30A 1P4RA 4BIZA 5LBQA 3OEEG 4RQEA 4F4LA 5H9CA 3CCQV 1F23A 3OW2U 4PA9A 2Y69B 4MW8A 4XDKA 3QNEA 1SERA 1GM8A 4MVOA 4MVMA 2B5UA 3CC2V 3B77A 5CN0A 1VQPV 2H8PC 2R9IA 4JYCA 1YJ9V 1E1RG 2XOKG 5EC2C 2PI5A 1COWG 1BL8A 1V55C 4OXSA 3ASOC 1CP9A 1S72V 2V1DA 5IY5B 1AJPA 1QLNA 3K06A 1OZ0A 3W7UA 2DYSC 1AI5A 2F43G 2HVJC 2KB1A 4J9ZB 1VQ7V 4HAMA 5EBLC 3JD0A 5LHGA 4CZZA 4PDVA 1JCHA 2W0FC 3E83A 2X6AA 2K1EA 4LP8A 1H8EG 4UVAA 5H6RA 1H38A 2WLMA 1GK9A 1YSCA 3ABMB 4Q20A 1YJWV 3ABLC 4QE7A 3F5WC 3AG3B 4QNHB 4JTAB 4LCUC 2HLDG 1E1QG 4MS2A 5B1NA 3WG7B 1W0JG 3CYOA 1L1FA 1VQMV 1YJNV 4MVSA 3AEIA 3FB6C 4U7NA 3AG4C 2QE7G 2WPDG 4DXWA 4JPRA 1BHBA 5E1AC 4U7OA 3HB3B 3MHHC 2ZR2A 4MVQA 1VQKV 1FXKA 3F7VC 2EBOA 4JTCB 2D3OW 3E2EA 3AG1B 3ABUA 1KQSU 2V7QG 3ASNC 4L87A 1KKDA 3W7TA 4PDLA 4MT8A 1ZWIC 1NBMG 1R73A 1SZTA 4MVZA 1R3IC 3GB7C 3MD0A 4GCZA 4ASUG 1OCRB 3A0RA 4LC1A 1YHQV 2EIKC 3AG2C 4GX0A 2PI4A 2EIJC 2HG5C 1Q7YW 4G27B 4P9PA 3SPCA 4LBEC 1YTFD 4PA4A 4MTXA 4R50A 1S77D 1V55B 1PNKA 3FYEB 3CXCU 2JJ2G 1IXMA 2WLNA 3ZRWA 1K9MW 2WLLB 4WFGA 1V54C 4PA7A 3E89A 3SPJA 4WFFA 1NJIW 2Q67A 1NH2D 1K4CC 1QLEB 4QE9A 3UM7A 2HJFC 1NVPB 3JD2A 3E8BA 1RPOA 5BZBA 3P32A 3T2MA 1S0VA 3ZIAG 3ZRXA 1LNQA 3W7WA 2MK3A 4TWKA 1TUEB 2IU0A 3SYCA 1K34A 2R9RB 3ZJZA 1DF5A 1FS0G 4KUMA 2WWWA 3LDCA 4MTFA 3SPGA 1KD1W 1K4DC 1PNLA 3IC7A 3JD1A 1K8AW 1XL4A 3KG2A 3SYPA 3ABKB 1G8MA 1AROP 3D36A 4JAUA 4X89A 2WLJA 3OR6C 1KP3A 5B3SC 3OEHG 4HYOA 4GX1A 5B1BB 3STLC 4DO2A 5DN6G 3ASNB 4JYBA 3K0GA 2IJIA 2GHYA 4I5SA 2P90A 1THZA 3E86A 1WPXA 4P9OA 4WF9V 1F4MA 2DWEC 3VOUA 1NQTA 3CMEV 3ZN1A 1Q81W 3JYCA 1DTOA 3LDDA 3HPLC 1PNMA 1RM1B 4WFBV 3T4DA 4MTOA 3W7XA 3T4ZA 2IH1C 2LP7A 2WLIB 4FJCC 2NNUA 5HFLA 2EILB 1J95A 1OCCB 3G6EV 1XL6A 2IJHA 3CCVV 1FXKC 3CP1A 3K04A 4PA3A 2QKSA 2ITCC 4QPKA 3CCSV 2EIMC 3OMAB 3K08A 5KUKA 4QPJA 2DW4A 1ROPA 1S5HC 3QO7A 3X2QC 1AI7A 2EINB 1E79G 1HWYA 3FKSG 5IYDO 4RQFA 5B1AB 2CK3G 5CBGA 4EKWA 1EZJA 1OHHG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3I C;  1R3L C;  2IH3 C;  3GB7 C;  2JK5 C;  2EIN C;  3AG1 C;  2EIK C;  3AG2 C;  4GX0 A;  2EIJ C;  2HG5 C;  4H33 A;  4G27 B;  4P9P A;  3SPC A;  4LBE C;  5EBM C;  4PA4 A;  3ABM C;  2QTO A;  4R50 A;  4MSW C;  4X88 A;  3SPH A;  3ZRS A;  4WFE A;  2NLJ C;  5B1A C;  1OCZ C;  2WLN A;  2BOC C;  2WLL B;  3K0D A;  4J9Y B;  4WFG A;  1V54 C;  4PA7 A;  3E89 A;  4WFH A;  3RW0 A;  3SPJ A;  1M57 C;  3OR7 C;  4WFF A;  3LUT B;  2Q67 A;  4PDM A;  1K4C C;  3OUS A;  3E8F A;  1OCR C;  4QE9 A;  3UM7 A;  2HJF C;  3E8B A;  5KUM A;  3SYA A;  5J9P C;  5BZB A;  4GX5 A;  3SPI A;  3T2M A;  1P7B A;  4X8A A;  3E8G A;  2BOB C;  3R65 A;  1LNQ A;  3PJS K;  4RUF A;  3FB8 C;  2WLK A;  4TWK A;  5CBF A;  3SJQ C;  2A0L A;  1QLE C;  3K03 A;  2ITD C;  5EK0 A;  2R9R B;  3SYC A;  3ZJZ A;  3LNM B;  4H37 A;  4F4L A;  2A79 B;  1OCO C;  2WLL A;  4PA9 A;  3LDC A;  3FB7 C;  4MW8 A;  4MTF A;  4P30 A;  1K4D C;  4XDK A;  3SPG A;  2DWD C;  4MTG A;  2HFE C;  4MVO A;  1XL4 A;  3KG2 A;  4MVM A;  3SYP A;  3FB5 C;  2X6B A;  2H8P C;  4R7C A;  3OUF A;  4X89 A;  2WLJ A;  3LDE A;  3OR6 C;  4G28 B;  5EC2 C;  4GX2 A;  4UUJ C;  5B3S C;  4HYO A;  4GX1 A;  5CBH A;  4MW3 A;  3STL C;  3UKM A;  1BL8 A;  1V55 C;  3IFX A;  4OXS A;  1JVM A;  3ASO C;  4R6Z A;  3K0G A;  3K06 A;  3SYQ A;  2HVK C;  2DYS C;  2KB1 A;  3EFF K;  2HVJ C;  4J9Z B;  1R3K C;  2AHZ A;  3E86 A;  4KFM A;  4P9O A;  4RO2 A;  3SYO A;  5EBL C;  3ABK C;  4CBC A;  4R8C A;  2DWE C;  2DYR C;  2X6C A;  3VOU A;  4PDV A;  2WLH A;  4XDJ A;  2W0F C;  3E83 A;  3JYC A;  2X6A A;  2K1E A;  4LP8 A;  4RUE A;  3LDD A;  3HPL C;  5B1B C;  3TET A;  3RVY A;  2OCC C;  2WLM A;  5IY5 C;  3ABL C;  3IGA C;  4MTO A;  4MVR A;  3F5W C;  4QE7 A;  2AHY A;  3T4Z A;  3T4D A;  4QNH B;  2IH1 C;  4JTA B;  2WLI B;  4LCU C;  4HZ3 A;  2A9H A;  4MS2 A;  1G4Y B;  1J95 A;  1XL6 A;  2ATK C;  3TCU A;  2P7T C;  4XDL A;  4P2Z A;  4PDR A;  4JTD B;  3RBZ A;  4MVS A;  3K04 A;  2Y69 C;  4PA3 A;  2QKS A;  2ITC C;  3FB6 C;  2Q69 A;  3AG4 C;  4ZBM A;  4DXW A;  2ZXW C;  2EIM C;  3K08 A;  3STZ C;  3F7Y C;  5E1A C;  2ZD9 A;  5KUK A;  3AG3 C;  3E8H A;  1M56 C;  4I9W A;  4MVQ A;  1S5H C;  2EIL C;  3F7V C;  1OCC C;  5EC1 C;  4JTC B;  3WG7 C;  3RVZ A;  3X2Q C;  2Q6A A;  1R3J C;  3T1C A;  4BW5 A;  2Q68 A;  1ORQ C;  3OGC C;  3ASN C;  4PA6 A;  4RAI A;  1KKD A;  2WLI A;  2YEV A;  4PDL A;  4MVU A;  1ZWI C;  5CBG A;  4EKW A;  3BEH A;  5EBW C;  4MVZ A; 
#chains in the Genus database with same CATH topology
 5JH7 A;  5FLX N;  1R3L C;  4J7Z A;  4JV5 B;  3IAY A;  4X62 O;  1YTF B;  4H33 A;  1HNZ B;  3JAM N;  1D5N A;  2QWN B;  1VF6 A;  2NLJ C;  1JQ0 A;  2Y4T A;  5KA6 A;  4DV3 B;  4QJF B;  1NH2 B;  1BGY H;  4PDM A;  4DR6 B;  4UV8 A;  4Z1M G;  2OCH A;  4OGQ B;  4B3R O;  1YDX A;  4E2L A;  3K9S A;  5BXZ A;  2KKW A;  4GKJ O;  1O9H A;  4LF8 O;  2UUC B;  4F6R A;  2YXL A;  3K03 A;  1SKV A;  5KAF Z;  4DV6 B;  2ZNI A;  1HNW O;  3W7S A;  2IBZ H;  4DV0 O;  2F66 C;  1OCO C;  2YS8 A;  2EJR A;  2XT9 A;  3TGU H;  1NR7 A;  4JAV A;  1KC8 W;  1N34 O;  3M8A A;  2X7R B;  4W4L A;  1JJO A;  1TUB B;  1VAR A;  4PI0 A;  5CA3 A;  3CB2 A;  5CBH A;  1WB7 A;  2JRI A;  4NB5 A;  4O4I A;  2HHH B;  3G71 V;  2Y48 A;  3ABL B;  3WB2 A;  1S76 D;  2HVK C;  3HKB A;  4EEQ A;  2LQT A;  2AHZ A;  2XND G;  4CBC A;  1AJQ A;  4RO2 A;  4JYY A;  2DYR C;  1QHT A;  3H01 A;  1H2L A;  1AI6 A;  4NVP A;  4YJ2 B;  3IGA C;  3OE7 G;  4BWA A;  3VQY A;  4K0K B;  3U10 A;  2YEV B;  2A9H A;  1AR4 A;  2QTS A;  1Y76 B;  4CH3 A;  4JTD B;  3BY6 A;  3VQV A;  4B3S B;  2Q69 A;  2ZR3 A;  3ETG A;  3AG3 C;  4FPP A;  1RPR A;  3D3Q A;  4KP4 A;  5A2Q N;  2Q6A A;  4DUZ O;  3A8T A;  4TOI A;  4O4L B;  5CB4 B;  3BEH A;  2QWP B;  1VQL V;  3K5N A;  1JOY A;  2E5L O;  5LMN B;  1IDS A;  4O4J A;  5LGT A;  2F4V B;  3OT7 A;  4TQD A;  1FD9 A;  1N36 B;  1N32 B;  1S3J A;  2GTA A;  1QCE A;  3T1Y B;  4FMT A;  3J81 N;  2VQE B;  1OCR C;  5BMV A;  3CJH B;  3CCU V;  1DK1 A;  3ZMU A;  1KP2 A;  5KHJ A;  4YHH B;  2Z3Y A;  3ZBH A;  3H1I H;  5EK0 A;  1XNQ B;  2DQ3 A;  2HR3 A;  4DR2 O;  3H1H H;  3I56 V;  2XAH A;  2ZXW B;  1M90 W;  1CPY A;  3WB1 A;  3M7M X;  2ZE6 A;  3OUF A;  4LFC O;  1HR0 O;  2PUS A;  4MW3 A;  3ZN0 A;  3RWR D;  4R6Z A;  4JI6 O;  1N0N A;  5ITZ B;  2P6J A;  3MAQ A;  3JCZ A;  4DR4 B;  2ADP A;  2R72 A;  5KA5 A;  3B8N A;  4K8X A;  2WLH A;  2O57 A;  1FXK B;  3T1H O;  1MG1 A;  4I4T B;  4JAA A;  1TUB A;  4MVR A;  1GO3 F;  1ZL8 B;  4HZ3 A;  4UB8 Z;  1MAB G;  4JI8 O;  1EM1 A;  3X2Q B;  3RBZ A;  4U3F H;  1K7D A;  3PN1 A;  3STZ C;  4UVC A;  5IYB O;  1H8H G;  2E75 B;  1H2N A;  3JAS B;  4DK1 A;  4YJ2 A;  1JA8 A;  3CMA V;  1ORQ C;  2YUA A;  2P67 A;  2YEV A;  5IJ9 B;  3SJC C;  4LF7 B;  1Y76 A;  1PD3 A;  2JK5 C;  4PV1 B;  1G1X B;  1ZAU A;  5JJN B;  4MSW C;  1WN7 A;  4U3J B;  2DMX A;  4X1Y B;  3MDS A;  5B1A C;  2HJD A;  3IC9 A;  2QEX V;  2B1I A;  3K0D A;  4J41 A;  2CTW A;  3LUT B;  1SES A;  4QIW F;  3SYA A;  4O4L A;  5CB4 A;  4ZI7 B;  2QA4 V;  1OCO B;  2OCC B;  2Z5U A;  1NTK H;  1Y74 B;  3FB8 C;  4LH7 A;  2YXH A;  4BIZ A;  5H9C A;  3CCQ V;  4MW8 A;  1GM8 A;  4MVO A;  1Z5V A;  3CC2 V;  3ZS8 C;  3CJH A;  2M6Y A;  2XOK G;  5EC2 C;  4X65 B;  2PI5 A;  1COW G;  3ASO C;  3ZED A;  3W7U A;  1AI5 A;  2F43 G;  2KB1 A;  4KXR A;  5LA6 B;  1YCI A;  5EBL C;  5GON B;  5H6R A;  4UVA A;  3ABM B;  3AK2 A;  2ZIN A;  3AG3 B;  4D7S A;  1E1Q G;  3DXR B;  1XNR O;  1KBH A;  3JAK B;  4JPR A;  4JZ2 A;  3S3W A;  1FXK A;  3F7V C;  2QR4 A;  4I4T A;  3ABU A;  3VQX A;  4L87 A;  1KKD A;  3W7T A;  4PDL A;  4BW9 A;  1ZL8 A;  3CSX A;  4MT8 A;  1RFY A;  1IBK B;  4QGP A;  1H2M A;  4MVZ A;  1VF7 A;  1OCR B;  2EIK C;  2HG5 C;  4LBE C;  3UO2 A;  4MTX A;  5LMU B;  1S77 D;  3OD4 A;  2JJ2 G;  4FM0 A;  4WFG A;  5IE9 A;  1V54 C;  3E22 B;  3UQ8 A;  4WFF A;  1NJI W;  4QE9 A;  1AP6 A;  1KKC A;  5CA1 B;  2HJF C;  1NVP B;  1RPO A;  1OJH A;  5IJ9 A;  1BE3 H;  4JI7 B;  4EFE A;  4ABM A;  1NS1 A;  3UCS C;  3SJA C;  3SYC A;  1OV9 A;  4IT5 A;  4U3J A;  4X1Y A;  1DF5 A;  3BVO A;  3RYI A;  1XMQ O;  1NU1 H;  2AGA A;  1PNL A;  3SYP A;  1IBM B;  1N34 B;  4JAU A;  4ZI7 A;  5A9G A;  1KP3 A;  5JWP A;  4HYO A;  4GX1 A;  5DN6 G;  4NKG B;  1BZK A;  1GN2 A;  3C3T A;  5LXT B;  1Y74 A;  1M93 A;  3F5T A;  3E86 A;  1WPX A;  1GN3 A;  3VOU A;  2QKA A;  3ZN1 A;  3JYC A;  1N33 O;  3N2K B;  4MTO A;  1TA8 A;  2IH1 C;  3H9V A;  2UXB O;  2FB5 A;  2NNU A;  5HFL A;  1KYO F;  1XBL A;  4JI1 O;  1LR1 A;  2QKS A;  2ITC C;  5LA6 A;  2N74 A;  3CWB H;  5GON A;  4QPJ A;  3THO A;  3QO7 A;  2VWK A;  1E79 G;  3G6B A;  4FM2 A;  4FLY A;  3DC5 A;  5B1A B;  4DUZ B;  5CBG A;  3H1K H;  4ZIB A;  3DXR A;  4O4H B;  3FFQ A;  4H0L B;  1VIB A;  2A7W A;  1AJN A;  3JAK A;  3A0H Z;  2YXY A;  2UUB O;  2QTO A;  4X88 A;  2W0X A;  2Q9L A;  3U11 A;  4X66 O;  3R66 A;  1PL4 A;  2CE4 A;  1Z2G A;  1PKX A;  4I7Z B;  1K92 A;  4ZHQ B;  4B3T B;  4JI0 O;  1FXV A;  2F93 B;  5LOV B;  4DR3 B;  4LR3 A;  2NR5 A;  5L3E A;  3HR0 A;  3OM3 B;  1JFF B;  1K5S A;  4D6T H;  4CS2 A;  3SJQ C;  2XUM A;  1GTO A;  1EZV H;  2XHB A;  3ASO B;  1AI4 A;  3E22 A;  4DR2 B;  3APO A;  1Q90 D;  2HFE C;  5LP6 C;  5CA1 A;  3K59 A;  2W6J G;  3OGI B;  2JVD A;  4LFA B;  4UFZ A;  4KHP B;  3OMI B;  2ARH A;  2YDE A;  3SR2 C;  4KFM A;  2DN9 A;  2X6C A;  1EBO A;  1I7F A;  4GLX A;  3FAV B;  2FKX A;  5KX5 B;  3DGE A;  3LNN A;  4FVM A;  2ZE7 A;  4FLU A;  3A0B Z;  3WFV A;  3CRQ A;  5LXT A;  4JI3 O;  3N27 A;  2OYQ A;  2Q0O C;  4NXN B;  2ZXW C;  5JJJ B;  2ZD9 A;  5HFM A;  3ML0 A;  3WG7 C;  4GKK B;  3K58 A;  2EIK B;  1V9P A;  3DSQ A;  3N2K A;  1TVK B;  1QR9 A;  2UXC B;  3OTO O;  1M4U A;  5EBW C;  1V54 B;  2DJV A;  1BMF G;  1GN4 A;  2UXX A;  4AI8 A;  1B04 A;  1LUV A;  3QO8 A;  3FYI B;  1MOF A;  4WFE A;  3ZRS A;  4X64 O;  1K3E A;  4NTY A;  3RW0 A;  4KL1 A;  5B1O A;  1BQZ A;  1K97 A;  2QWO B;  3ZMV A;  4O4H A;  3QF7 A;  3OMN B;  2CTR A;  1VQ5 V;  3R65 A;  3B40 A;  1XDC A;  5H2F Z;  4BIO A;  5H6Q A;  3ZMZ A;  2JEU A;  1GMG A;  5KAI Z;  5KHK A;  3JD4 A;  4ZHQ A;  2YI9 A;  1GM7 A;  4DV2 O;  5LOV A;  1SQP H;  1JFF A;  4UUJ C;  1JX9 A;  2L35 A;  2RMK B;  1IBL B;  1IUR A;  2XAF A;  4WCE V;  2ZIM A;  3BHP A;  4I9Q A;  1P7G A;  2JEX A;  4IHJ B;  4N21 A;  2OCC C;  2RJZ A;  4IGG A;  1U96 A;  3U0Z A;  4FZ0 A;  1F4N A;  1W2B U;  1JJ2 U;  2RQ6 A;  2HKO A;  4LF6 O;  1L0L H;  1EN4 A;  3RYF B;  4LWS B;  3K5L A;  3OFN G;  2VWJ A;  2VS0 A;  2W6I G;  1XNR B;  3BA9 A;  1HW7 A;  3CRC A;  4AQY O;  2YSU B;  3F7Y C;  3L73 H;  3E8H A;  1I5X A;  4OPA A;  2EIL C;  3JAR B;  5EC1 C;  4LFB B;  3FAV A;  5IYC O;  3JD3 A;  4TV8 B;  3OGC C;  5KX5 A;  1Q6H A;  1F7Y A;  4PHZ A;  2LFS A;  3ZMT A;  4IL6 Z;  5L3G A;  1EN5 A;  3J7A U;  2EIN C;  1XEQ A;  2JIZ G;  4DV4 B;  1KB9 F;  3ABM C;  3L9D A;  1QVF U;  3UT5 B;  4YY3 B;  1M57 C;  1NZ6 A;  1TVK A;  1VMG A;  4G2K A;  1SA0 B;  5IDJ A;  5J9P C;  4BAY A;  5L3B A;  1I94 O;  1AVM A;  2EZO A;  1P7B A;  3SJB C;  3E8G A;  2XTA A;  5LP6 B;  1CEZ A;  2ZKO A;  4FIP C;  3MHS C;  1FJG B;  1R6N A;  5GW7 A;  4RQE A;  3OEE G;  3RYC B;  4LF5 O;  2UU9 O;  2Y0I A;  2Y69 B;  4CH5 A;  1R1B A;  3AK3 A;  1XMQ B;  1BCC H;  2WA3 A;  3H1L H;  2H8P C;  2P22 C;  4JYC A;  1E1R G;  4DR7 B;  4LF9 O;  3RGB A;  4K3A A;  1AIL A;  1D5A A;  2BTO A;  4J9Z B;  4HAM A;  3JD0 A;  5LHG A;  4CZZ A;  2QGN A;  4PDV A;  2K1E A;  4LP8 A;  3L75 H;  3Q4H B;  1H38 A;  3HKE B;  1GK9 A;  2OIG A;  1N33 B;  4JTA B;  4LCU C;  1ZUQ A;  3WG7 B;  1FFX B;  4MVS A;  2QE7 G;  2WPD G;  4FLT A;  1BHB A;  4C7U A;  5E1A C;  5BR8 B;  4IHJ A;  1VQK V;  2EBO A;  5KHH A;  3E2E A;  4B7K A;  3RFR A;  4EB6 B;  4JYA O;  2UXD B;  1WB8 A;  1ZWI C;  1XIL A;  2FML A;  1R73 A;  2Z0A A;  2UUA B;  3RYF A;  4LWS A;  4X1I B;  2ZE8 A;  1S5J A;  1HP8 A;  4ASU G;  1YHQ V;  2H3O A;  2EIJ C;  4R50 A;  1V55 B;  1PPJ H;  2P06 A;  3JAR A;  2UUB B;  2WLN A;  2WLL B;  4TV8 A;  2PYL A;  4PA7 A;  5EZY B;  4DUY O;  2PYJ A;  4DV7 O;  2ZM6 O;  3JD2 A;  5BZB A;  3P32 A;  1S0V A;  1A32 A;  3W7W A;  5IWA O;  2MK3 A;  4Q6G A;  3ZJZ A;  1K34 A;  1FS0 G;  3UT5 A;  4JI2 O;  2WWW A;  4MTF A;  1KD1 W;  3APQ A;  1K8A W;  2RDC A;  3KG2 A;  1SA0 A;  4J42 A;  3BAA A;  4X89 A;  5B3S C;  2YIB D;  3STL C;  4DO2 A;  4LF4 O;  5LP6 A;  4DV5 O;  4JYB A;  3K0G A;  2IJI A;  5GTH Z;  4FFB B;  1YF2 A;  2DWE C;  3RYC A;  3N2G B;  1DTO A;  1URF A;  3LDD A;  1PNM A;  3CEI A;  2E76 B;  3P3N A;  1SQB H;  2EIL B;  4JV5 O;  1ZSP A;  1XL6 A;  1HNZ O;  3WB0 A;  3K04 A;  2VRZ A;  4K35 A;  4JI3 B;  2ODM A;  4DV1 B;  1MNG A;  2N04 A;  3ICX A;  1ROP A;  4DR6 O;  3Q4H A;  1AI7 A;  2EIN B;  3HKE A;  3GWK C;  4DR5 B;  2JGD B;  1PM9 A;  1Q43 A;  2CK3 G;  4EKW A;  1FFX A;  1M57 B;  5ITZ A;  2UUC O;  2WAM A;  1FFT B;  2IW5 A;  2Q5Z A;  4NXM B;  2ETN A;  1BHA A;  3NXS A;  2HP8 A;  4WFH A;  2X0L A;  5AG2 A;  4EB6 A;  3ZCC A;  4TV9 B;  3ABT A;  1NT2 B;  3KCY A;  2LFR A;  4JZG A;  1YI2 V;  1Q82 W;  5J2U B;  2HHH O;  3BRC A;  4GX5 A;  4X1I A;  3CCR V;  1IVS A;  3GWO A;  1XI1 A;  5JQG B;  5CBF A;  1WNS A;  2VQF O;  4JI4 O;  2CTP A;  4X62 B;  3D36 C;  3QVN A;  3JAS A;  2WLL A;  4P30 A;  5EZY A;  5FPR A;  4K0K O;  5C8Y B;  4DV2 B;  3CCL V;  4Z2W A;  4G28 B;  1QBZ A;  2R70 A;  3HKC B;  5DED A;  4B3S O;  3CPW U;  5IT9 N;  4B3R B;  2KG7 B;  3P3P A;  2RN9 A;  1WLE A;  1R3K C;  5FL7 G;  2M7W A;  3ZMS A;  4R8C A;  5LGU A;  4GKJ B;  1I5Y A;  1WA8 B;  1XQ8 A;  1QVG U;  4LF8 B;  2JGU A;  1HNW B;  5IY5 C;  4DV0 B;  1GRJ A;  1K5Q A;  2HEP A;  3K9A A;  4O2A B;  2OTL V;  3ETE A;  1G4Y B;  2F23 A;  2ATK C;  2B1G A;  2P7T C;  5LMN O;  1XMO O;  4OX9 O;  1Q86 W;  3JAT B;  3O65 A;  1Y67 A;  4FFB A;  1N36 O;  3K3W A;  1N32 O;  3N2G A;  2VQE O;  4I9W A;  4RWU A;  1XRE A;  1SRY A;  3H1J H;  3RVZ A;  4K8Z A;  1MZF A;  1R3J C;  2EIJ B;  5JVD B;  2YIA A;  3BFR A;  2Q4P A;  5JCO C;  1PL0 A;  2A3Q A;  1F51 A;  2K9P A;  1XNQ O;  1IZ3 A;  1TAE A;  2P4K A;  4TSF G;  1KMI Z;  2JS5 A;  3SPH A;  1US6 A;  3CC7 V;  1KU9 A;  2JGD A;  1IX9 A;  3KKY A;  3L70 H;  3HKD B;  4CC5 A;  1I08 A;  3ZHU A;  4DR4 O;  3K5M A;  1DLB A;  1MSW D;  1Q3E A;  1I94 B;  2BOB C;  1QQC A;  3ETQ A;  1WAZ A;  4FLV A;  4LH6 A;  3E35 A;  2QDO A;  3ZX6 A;  4JI5 O;  2RCV A;  1QLE C;  2E5L B;  5B3S B;  5B66 Z;  1I0H A;  2OWO A;  4H37 A;  2ADQ B;  4I50 B;  5IYZ B;  4DW0 A;  3G80 A;  1SQF A;  4TV9 A;  3K57 A;  4UCT A;  2X6B A;  1M56 B;  1ENV A;  1YXB A;  5J2U A;  4R7C A;  1EN6 A;  3K79 A;  1GH6 A;  4FK5 C;  2FL4 A;  2BTQ B;  2YIC A;  1KEC A;  3M99 B;  4WFA V;  4IIJ B;  4TUY B;  5JQG A;  2ZCE A;  1XOU A;  2JJ1 G;  3EFF K;  1P49 A;  3JAL B;  2QM7 A;  3CS5 A;  2QM8 A;  3ABK C;  3CD6 V;  1SET A;  2XAG A;  2G38 A;  1B6Q A;  4UVB A;  4XDJ A;  3NR7 A;  1YIT V;  1T5E A;  1EFR G;  5B1B C;  5EIB D;  2FYU H;  3RVY A;  1KUQ A;  5C8Y A;  4J7J A;  2H94 A;  4UCU A;  2F1M A;  3L71 H;  2AHY A;  2ZDI C;  4LF7 O;  2DOS A;  3C90 A;  4AIL C;  3HKC A;  4TT3 G;  1NTZ H;  3TCU A;  4L8J A;  1SF9 A;  4XDL A;  2KG7 A;  4LFC B;  1HR0 B;  2Q7E A;  2Y69 C;  4JI6 B;  3RT3 C;  2EZP A;  3CC4 V;  1WA8 A;  4YIO A;  3A2F A;  5H5N A;  1XHZ A;  3ZRW B;  2XAJ A;  4UCV A;  4JGS A;  3T1C A;  3T1H B;  3B4S A;  4UV9 A;  4PA6 A;  4O2A A;  3RYH B;  3D3I A;  3AG7 A;  4GYC B;  4J10 A;  2CUG A;  3EVK A;  5J2T B;  3JAT A;  4JI8 B;  1UJW B;  1YVW A;  4PEL A;  2BSK B;  2B9Z A;  4IYH A;  1B3Q A;  1N8R W;  1VQO V;  1VQ6 V;  5JVD A;  1FPO A;  1Y66 A;  2XAS A;  4DV7 B;  2PF4 E;  2AZ2 A;  4X8A A;  2A0L A;  1UPG A;  5IWA B;  2C2A A;  2GUZ B;  3P30 A;  1P4R A;  1FYJ A;  1VEW A;  1LUW A;  1Q6I A;  3OW2 U;  1RP3 B;  2E3C A;  4PA9 A;  3QNE A;  3C3S A;  4JI2 B;  4AHC A;  3B77 A;  5CN0 A;  3HKD A;  1SQX H;  1VQP V;  2GTS A;  1S5L Z;  2R9I A;  1AR5 A;  4FZ1 A;  1V55 C;  1S72 V;  1CP9 A;  2PGG A;  5IY5 B;  1W59 A;  1AJP A;  2QKC A;  3K06 A;  4LF4 B;  2DYS C;  2NN4 A;  5EYP B;  1SZX A;  3CRR A;  1JCH A;  2W0F C;  3E83 A;  4I50 A;  5IYZ A;  2WLM A;  5LYJ B;  1YSC A;  1YJW V;  1IBK O;  4DK0 A;  3F5W C;  4QNH B;  2HLD G;  2BTQ A;  4YJ3 B;  1QU7 A;  1W0J G;  4UB6 Z;  5D5Q A;  3QTC A;  1VQM V;  1YJN V;  1TGO A;  4IIJ A;  4TUY A;  5LMU O;  1M5I A;  1HNX O;  3FB6 C;  4U7N A;  3AG4 C;  3JAL A;  2Y0P A;  4DXW A;  3SDL A;  3MHH C;  2ZR2 A;  1ZX3 A;  2ZE5 A;  1JMK C;  4JTC B;  2D3O W;  2CGO A;  2PZS A;  4X1K B;  3IJ4 A;  4JI7 O;  1SZT A;  2CTQ A;  2L6L A;  5KHI A;  1R3I C;  2Q0A A;  1DGS A;  3A0R A;  3AG2 C;  1WP7 A;  4GX0 A;  2ZNJ A;  1Q7Y W;  2JS3 A;  1YTF D;  3SPC A;  1O9G A;  1XUQ A;  3FYE B;  3CXC U;  2EX3 A;  3ZRW A;  1K9M W;  1IBM O;  1AP5 A;  1MZE A;  5FPO A;  3SPJ A;  2LJ2 A;  4GZR B;  2Q67 A;  3J80 N;  1K4C C;  1NH2 D;  1QLE B;  3RYH A;  2KQX A;  1FKA O;  1N4C A;  3T2M A;  5J2T A;  4LNU B;  1TUE B;  2IU0 A;  2R9R B;  2VQF B;  2BSK A;  4JI4 B;  3L74 H;  2AXT Z;  4A5U B;  3FX7 A;  3ABK B;  1G8M A;  3D36 A;  4CH6 A;  5B1B B;  2N05 A;  3CRM A;  4Z1V A;  3ASN B;  1MMM A;  4DW1 A;  4I5S A;  4UCR A;  4J7K A;  5K1P A;  2GUZ A;  4WF9 V;  1PP9 H;  1NQT A;  3CME V;  1Q81 W;  5IJ0 B;  4WFB V;  4B3M O;  3T4D A;  5GTI Z;  3K5O A;  3T4Z A;  2LP7 A;  2WLI B;  4FJC C;  4HBN A;  1J95 A;  1J5E O;  3G6E V;  4H44 B;  2IJH A;  4OPH A;  3CCV V;  4I0X B;  5BY1 A;  3CP1 A;  1XMO B;  3S3X A;  4OX9 B;  3CCS V;  3OMA B;  5EYP A;  5FNV B;  2DW4 A;  4B3T O;  4H13 B;  4DR3 O;  5LYJ A;  3FKS G;  4BR6 A;  4NTW A;  5TIS Z;  4DR1 O;  4YJ3 A;  1EZJ A;  2UXB B;  2IH3 C;  5JCO A;  4JI1 B;  5D5P A;  4BIU A;  5EBM C;  4FLW A;  1M1K W;  5C93 A;  1Q5O A;  1OCZ C;  5LGN A;  2BOC C;  2LW1 A;  3TK1 A;  3E8F A;  4UXN A;  2GSM B;  4LFA O;  4X1K A;  3ZHQ A;  5KUM A;  5L3D A;  4KHP O;  1X59 A;  3ZHS A;  3I55 V;  4FFK A;  2WLK A;  1WP8 A;  4ZOL B;  1NR1 A;  4X20 B;  1XHX A;  3LSS A;  4XBF A;  3AK1 A;  4JI5 B;  4JF3 A;  2P4V A;  3TXS A;  3FB7 C;  1GKF A;  4ZKI A;  2DWD C;  4F6E A;  4X66 B;  2DYS B;  2EIM B;  4X9Q A;  4B08 A;  4JI0 B;  3LDE A;  1SS3 A;  3LSQ A;  4NXN O;  3BPZ A;  1BQ0 A;  4LNU A;  1YEW A;  3SYQ A;  1L0N H;  2D2C B;  2CH7 B;  3EHB B;  3JSL A;  3DTU B;  4GKK O;  3CXH F;  1M9N A;  4RUE A;  3TET A;  3LSU A;  3AG4 B;  2UXC O;  4D7T A;  5CMU A;  2WSS G;  2R9A A;  4PD4 F;  5LHI A;  3RN4 A;  4E4E A;  1NTM H;  5EIB C;  2LGW A;  3BA8 A;  4J11 A;  2LW7 A;  2YI8 A;  2ZDI A;  1N0J A;  2CDY A;  4ZBM A;  3O9O A;  5KHG A;  5DM6 V;  1NKD A;  3CCM V;  1M56 C;  5LHH A;  3RYI B;  1AR1 B;  3CCE V;  1VQ8 V;  5IJ0 A;  3AG2 B;  2UXN A;  1RSO B;  1R6K A;  4BW5 A;  2Q68 A;  2A06 H;  2WLI A;  4MVU A;  4HNA B;  4JAS A;  2ZQM A;  2V4D A;  3B09 A;  3CCJ V;  2Q7H A;  2DQ0 A;  1H2K A;  1VF6 C;  2E74 B;  4I0X A;  1Z5W A;  1Y4M A;  2LGQ A;  3AG1 C;  1D2D A;  5FNV A;  1JPX A;  3WU2 Z;  4DV3 O;  4DYL A;  2GBO A;  4J9Y B;  1FXH A;  4YXW G;  2QWR B;  4NYK A;  2DYR B;  4GUN A;  1H2S B;  1IBL O;  1GAX A;  3SPI A;  5LL6 Y;  1YIJ V;  1DF4 A;  3OTO B;  4NR1 A;  3PJS K;  4RUF A;  2PY5 A;  4WBN B;  4DV6 O;  3QG5 A;  3D8C A;  3VBB A;  1SQV H;  1K73 W;  2LO1 A;  2IJJ A;  2QM4 A;  1Q6U A;  4W4K A;  1VP7 A;  2A79 B;  1G6U A;  4MTG A;  4X64 B;  4O2B B;  3FB5 C;  4GT1 A;  1K33 A;  5CA0 B;  3JAW B;  4GX2 A;  3UKM A;  2GDS A;  3IFX A;  1JVM A;  1IXB A;  2Q73 A;  4ZOL A;  3I5D A;  4X20 A;  4B7E A;  3SYO A;  4LFB O;  2GV9 A;  5L3C A;  1FAF A;  4NTX A;  3JCU Z;  2BCC H;  1Q8I A;  2Q8V A;  1VQ4 V;  4N23 A;  2YIB A;  4IYI A;  1H2G A;  3QO5 A;  3FD9 A;  4P2Z A;  2RNB A;  4PDR A;  2OIE A;  4DV4 O;  5F2V O;  2CH7 A;  1RM1 C;  2YID A;  4DRX B;  1HNX B;  4YY3 O;  4CS3 A;  1HDJ A;  4EFB A;  1OCC C;  1VQN V;  2XAQ A;  5JJE B;  1GM9 A;  1YZB A;  4RAI A;  2KSD A;  3CX5 F;  3BAB A;  5K1X A;  1OCZ B;  3CRA A;  2MW2 B;  1VQ9 V;  1BS3 A;  3SGI A;  2OTJ V;  3G4S V;  4LF6 B;  1FJG O;  2JDI G;  5L3F A;  2F4V O;  2IJK A;  1SC5 B;  2PTM A;  3T1Y O;  2FTK A;  4AQY B;  3B8M A;  1QR8 A;  1RSO A;  3OR7 C;  4TQF A;  4DR7 O;  1W0K G;  3OUS A;  1BSM A;  3OAA G;  1NVP D;  4HNA A;  4FLX A;  4FM1 A;  4YHH O;  3ETD A;  4UCS A;  2OT5 A;  2P5O A;  1WPB A;  3ZRV A;  3TXQ A;  5KMG B;  2CGN A;  1Y6X A;  2IU3 A;  2ITD C;  3LNM B;  5LBQ A;  4F4L A;  1F23 A;  4FLZ A;  4XDK A;  1PV0 A;  1SER A;  1B06 A;  4MVM A;  2B5U A;  3UO3 A;  1X4T A;  1YJ9 V;  4I55 B;  1BT8 A;  1BL8 A;  4OXS A;  3TJT A;  2V1D A;  1QLN A;  4ICG A;  5BR8 O;  4WBN A;  1OZ0 A;  2HVJ C;  3ZHT A;  1VQ7 V;  3KZI Z;  5E79 Z;  2WA4 A;  2X6A A;  3KCX A;  1H8E G;  2UXD O;  4LF5 B;  1QNM A;  1SQQ H;  2Y4U A;  2UU9 B;  1P84 F;  1R6T A;  4O2B A;  4Q20 A;  3ABL C;  4QE7 A;  2UUA O;  5CA0 A;  3JAW A;  2YC0 A;  3DC6 A;  4B3M B;  2ILM A;  4MS2 A;  5B1N A;  3CYO A;  4CC6 A;  2EJ7 A;  1L1F A;  5JH7 B;  1J5E B;  2AW9 A;  3AEI A;  4LF9 B;  4CS4 A;  4U7O A;  1VF5 B;  3HB3 B;  4MVQ A;  1SQG A;  1WJZ A;  2QWQ B;  5B5E Z;  3AG1 B;  1KQS U;  2CAZ C;  2V7Q G;  3ASN C;  3ZHR A;  1NBM G;  3JSN A;  3OTF A;  4DR1 B;  5KLV H;  3GB7 C;  3MD0 A;  4GCZ A;  4LC1 A;  2PI4 A;  3L72 H;  4G27 B;  4P9P A;  4DRX A;  4PA4 A;  4F6R B;  1PNK A;  1IXM A;  3CHX A;  2IM9 A;  1L8D A;  3E89 A;  4PI2 A;  3UM7 A;  1MA1 A;  3E8B A;  4JYA B;  4O4I B;  3ZIA G;  3ZRX A;  4UCO A;  2EUL A;  1LNQ A;  4TWK A;  3HKB B;  4CH4 A;  3VQW A;  4KUM A;  3LDC A;  3SPG A;  1K4D C;  3ZHV A;  1ZLZ A;  3BCC H;  3IC7 A;  3JD1 A;  2AZ0 A;  1XL4 A;  4X65 O;  1ARO P;  4DUY B;  2WLJ A;  3OR6 C;  3OEH G;  2ZM6 B;  4J80 A;  3GVM A;  5KMG A;  3CE2 A;  1U97 A;  4DV1 O;  1ZTE A;  1MSD A;  2GHY A;  2P90 A;  1THZ A;  4P9O A;  1F4M A;  1UFI A;  4DR5 O;  3HPL C;  1RM1 B;  2QJ1 A;  1AB3 A;  3W7X A;  2ZT9 B;  4I55 A;  1OCC B;  2ZIO A;  4NXM O;  1FXK C;  3G67 A;  4PJ0 Z;  4PA3 A;  4QPK A;  2DE0 X;  4DV5 B;  2EIM C;  2Q7G A;  3K08 A;  3EXA A;  4O4J B;  5KUK A;  5DEC A;  1S5H C;  3X2Q C;  1CXZ B;  4YIP A;  1GN6 A;  1HWY A;  1NI8 A;  5BMV B;  2BE3 A;  5IYD O;  4RQF A;  1JR9 A;  2F95 B;  1OHH G;  3B2E E;  2QSA A; 
#chains in the Genus database with same CATH homology
 1M57 B;  1R3L C;  2IH3 C;  1FFT B;  2IW5 A;  2WAM A;  1YTF B;  1AJN A;  4H33 A;  4BIU A;  5EBM C;  2QTO A;  4X88 A;  5C93 A;  1M1K W;  1BHA A;  2NLJ C;  1JQ0 A;  1OCZ C;  5LGN A;  5KA6 A;  2BOC C;  3NXS A;  1PKX A;  4QJF B;  4WFH A;  1NH2 B;  1K92 A;  2X0L A;  4PDM A;  3TK1 A;  4UV8 A;  1FXV A;  3ZCC A;  3E8F A;  3ABT A;  4UXN A;  4Z1M G;  2GSM B;  2LFR A;  5KUM A;  1YI2 V;  1Q82 W;  5L3D A;  5L3E A;  4E2L A;  3OM3 B;  4GX5 A;  3CCR V;  1K5S A;  3GWO A;  3I55 V;  2WLK A;  5CBF A;  3SJQ C;  1NR1 A;  3K03 A;  1GTO A;  3LSS A;  4XBF A;  3ASO B;  4JF3 A;  3W7S A;  1OCO C;  2WLL A;  2EJR A;  3FB7 C;  1GKF A;  4P30 A;  1AI4 A;  1NR7 A;  4ZKI A;  4JAV A;  2DWD C;  2DYS B;  2HFE C;  2EIM B;  1KC8 W;  2X7R B;  2W6J G;  3CCL V;  3LDE A;  4G28 B;  5CA3 A;  1QBZ A;  5CBH A;  3LSQ A;  3CPW U;  3G71 V;  2Y48 A;  3OMI B;  3SYQ A;  3ABL B;  1S76 D;  2HVK C;  1WLE A;  3EHB B;  1R3K C;  2AHZ A;  2M7W A;  2XND G;  4KFM A;  1AJQ A;  4RO2 A;  5FL7 G;  3ZMS A;  3DTU B;  4R8C A;  4CBC A;  2DYR C;  2X6C A;  5LGU A;  1I5Y A;  3H01 A;  1QVG U;  1EBO A;  1M9N A;  4RUE A;  1AI6 A;  3TET A;  3AG4 B;  5IY5 C;  1K5Q A;  3IGA C;  5CMU A;  3K9A A;  2WSS G;  3DGE A;  3OE7 G;  2OTL V;  2YEV B;  3ETE A;  2A9H A;  5LHI A;  1G4Y B;  3WFV A;  2ATK C;  2B1G A;  2P7T C;  4JTD B;  3BY6 A;  1Q86 W;  2ZDI A;  2Q69 A;  2ZR3 A;  3ETG A;  4ZBM A;  2ZXW C;  3K3W A;  5DM6 V;  2ZD9 A;  1NKD A;  3AG3 C;  3CCM V;  5HFM A;  3ML0 A;  1M56 C;  4FPP A;  4I9W A;  5LHH A;  1RPR A;  1SRY A;  1AR1 B;  3WG7 C;  3CCE V;  3RVZ A;  1VQ8 V;  4KP4 A;  2EIK B;  2UXN A;  2Q6A A;  3AG2 B;  2EIJ B;  1R3J C;  1R6K A;  4BW5 A;  2Q68 A;  1PL0 A;  2WLI A;  1QR9 A;  1F51 A;  4MVU A;  4JAS A;  2ZQM A;  3CCJ V;  3BEH A;  5EBW C;  1VQL V;  1V54 B;  2DQ0 A;  1JOY A;  1Y4M A;  1BMF G;  3AG1 C;  2UXX A;  4TSF G;  1JPX A;  3QO8 A;  3SPH A;  5LGT A;  3FYI B;  1MOF A;  4WFE A;  3ZRS A;  1K3E A;  1S3J A;  4J9Y B;  3CC7 V;  1QCE A;  3RW0 A;  1FXH A;  4FMT A;  5B1O A;  4YXW G;  1OCR C;  2DYR B;  1K97 A;  3CCU V;  3ZMU A;  3ZMV A;  1DLB A;  3SPI A;  1MSW D;  1KP2 A;  1YIJ V;  3OMN B;  1DF4 A;  2BOB C;  1VQ5 V;  3R65 A;  3PJS K;  2Z3Y A;  3E35 A;  4RUF A;  5H6Q A;  3VBB A;  1QLE C;  5EK0 A;  3ZMZ A;  5B3S B;  2DQ3 A;  2HR3 A;  1K73 W;  2IJJ A;  2JEU A;  4H37 A;  1GMG A;  2A79 B;  3JD4 A;  3I56 V;  2XAH A;  4MTG A;  2ZXW B;  1M90 W;  1GM7 A;  1CPY A;  3FB5 C;  2X6B A;  4GT1 A;  1K33 A;  1ENV A;  1M56 B;  4R7C A;  3OUF A;  3K79 A;  4GX2 A;  4UUJ C;  4FK5 C;  4MW3 A;  3UKM A;  3ZN0 A;  1JX9 A;  4R6Z A;  3IFX A;  1JVM A;  1KEC A;  2P6J A;  3M99 B;  4WFA V;  3JCZ A;  2XAF A;  2JJ1 G;  4WCE V;  3EFF K;  2QM7 A;  3SYO A;  2QM8 A;  3ABK C;  2JEX A;  5KA5 A;  3CD6 V;  3B8N A;  1SET A;  2XAG A;  1B6Q A;  2WLH A;  4UVB A;  4XDJ A;  5L3C A;  1YIT V;  1EFR G;  1FXK B;  5B1B C;  4N21 A;  3RVY A;  2OCC C;  1MG1 A;  2H94 A;  1F4N A;  1W2B U;  1JJ2 U;  4MVR A;  2AHY A;  2ZDI C;  1GO3 F;  1VQ4 V;  4N23 A;  2HKO A;  1H2G A;  4HZ3 A;  1MAB G;  3QO5 A;  4TT3 G;  3X2Q B;  3TCU A;  4XDL A;  4P2Z A;  4PDR A;  3RBZ A;  3OFN G;  2Y69 C;  2W6I G;  1RM1 C;  1K7D A;  3STZ C;  2YSU B;  3F7Y C;  2EZP A;  3CC4 V;  4UVC A;  3E8H A;  5IYB O;  1H8H G;  1I5X A;  2EIL C;  1OCC C;  5EC1 C;  1VQN V;  3ZRW B;  5IYC O;  2XAJ A;  3JD3 A;  2XAQ A;  4JGS A;  3CMA V;  3T1C A;  1GM9 A;  1ORQ C;  3OGC C;  4RAI A;  4PA6 A;  4UV9 A;  2P67 A;  2YEV A;  3D3I A;  2LFS A;  3ZMT A;  1OCZ B;  5L3G A;  1VQ9 V;  2OTJ V;  3G4S V;  1PD3 A;  2EIN C;  2JK5 C;  2JDI G;  5L3F A;  1UJW B;  2IJK A;  2JIZ G;  4PEL A;  3ABM C;  4MSW C;  5B1A C;  2QEX V;  2FTK A;  2B1I A;  1QVF U;  3B8M A;  1QR8 A;  3K0D A;  1N8R W;  1VQO V;  1VQ6 V;  1M57 C;  3OR7 C;  3LUT B;  1Y66 A;  1W0K G;  3OUS A;  4G2K A;  1SES A;  2XAS A;  3OAA G;  4QIW F;  3SYA A;  5IDJ A;  1NVP D;  5J9P C;  4BAY A;  5L3B A;  3ETD A;  2QA4 V;  1OCO B;  2OCC B;  2OT5 A;  2Z5U A;  2EZO A;  3ZRV A;  1P7B A;  4X8A A;  3E8G A;  1CEZ A;  3FB8 C;  2IU3 A;  4FIP C;  2A0L A;  3MHS C;  1R6N A;  2ITD C;  2C2A A;  3LNM B;  5GW7 A;  3P30 A;  1P4R A;  4BIZ A;  5LBQ A;  3OEE G;  4RQE A;  4F4L A;  5H9C A;  3CCQ V;  1F23 A;  3OW2 U;  4PA9 A;  2Y69 B;  4MW8 A;  4XDK A;  3QNE A;  1SER A;  1GM8 A;  4MVO A;  4MVM A;  2B5U A;  3CC2 V;  3B77 A;  5CN0 A;  1VQP V;  2H8P C;  2R9I A;  4JYC A;  1YJ9 V;  1E1R G;  2XOK G;  5EC2 C;  2PI5 A;  1COW G;  1BL8 A;  1V55 C;  4OXS A;  3ASO C;  1CP9 A;  1S72 V;  2V1D A;  5IY5 B;  1AJP A;  1QLN A;  3K06 A;  1OZ0 A;  3W7U A;  2DYS C;  1AI5 A;  2F43 G;  2HVJ C;  2KB1 A;  4J9Z B;  1VQ7 V;  4HAM A;  5EBL C;  3JD0 A;  5LHG A;  4CZZ A;  4PDV A;  1JCH A;  2W0F C;  3E83 A;  2X6A A;  2K1E A;  4LP8 A;  1H8E G;  4UVA A;  5H6R A;  1H38 A;  2WLM A;  1GK9 A;  1YSC A;  3ABM B;  4Q20 A;  1YJW V;  3ABL C;  4QE7 A;  3F5W C;  3AG3 B;  4QNH B;  4JTA B;  4LCU C;  2HLD G;  1E1Q G;  4MS2 A;  5B1N A;  3WG7 B;  1W0J G;  3CYO A;  1L1F A;  1VQM V;  1YJN V;  4MVS A;  3AEI A;  3FB6 C;  4U7N A;  3AG4 C;  2QE7 G;  2WPD G;  4DXW A;  4JPR A;  1BHB A;  5E1A C;  4U7O A;  3HB3 B;  3MHH C;  2ZR2 A;  4MVQ A;  1VQK V;  1FXK A;  3F7V C;  2EBO A;  4JTC B;  2D3O W;  3E2E A;  3AG1 B;  3ABU A;  1KQS U;  2V7Q G;  3ASN C;  4L87 A;  1KKD A;  3W7T A;  4PDL A;  4MT8 A;  1ZWI C;  1NBM G;  1R73 A;  1SZT A;  4MVZ A;  1R3I C;  3GB7 C;  3MD0 A;  4GCZ A;  4ASU G;  1OCR B;  3A0R A;  4LC1 A;  1YHQ V;  2EIK C;  3AG2 C;  4GX0 A;  2PI4 A;  2EIJ C;  2HG5 C;  1Q7Y W;  4G27 B;  4P9P A;  3SPC A;  4LBE C;  1YTF D;  4PA4 A;  4MTX A;  4R50 A;  1S77 D;  1V55 B;  1PNK A;  3FYE B;  3CXC U;  2JJ2 G;  1IXM A;  2WLN A;  3ZRW A;  1K9M W;  2WLL B;  4WFG A;  1V54 C;  4PA7 A;  3E89 A;  3SPJ A;  4WFF A;  1NJI W;  2Q67 A;  1NH2 D;  1K4C C;  1QLE B;  4QE9 A;  3UM7 A;  2HJF C;  1NVP B;  3JD2 A;  3E8B A;  1RPO A;  5BZB A;  3P32 A;  3T2M A;  1S0V A;  3ZIA G;  3ZRX A;  1LNQ A;  3W7W A;  2MK3 A;  4TWK A;  1TUE B;  2IU0 A;  3SYC A;  1K34 A;  2R9R B;  3ZJZ A;  1DF5 A;  1FS0 G;  4KUM A;  2WWW A;  3LDC A;  4MTF A;  3SPG A;  1KD1 W;  1K4D C;  1PNL A;  3IC7 A;  3JD1 A;  1K8A W;  1XL4 A;  3KG2 A;  3SYP A;  3ABK B;  1G8M A;  1ARO P;  3D36 A;  4JAU A;  4X89 A;  2WLJ A;  3OR6 C;  1KP3 A;  5B3S C;  3OEH G;  4HYO A;  4GX1 A;  5B1B B;  3STL C;  4DO2 A;  5DN6 G;  3ASN B;  4JYB A;  3K0G A;  2IJI A;  2GHY A;  4I5S A;  2P90 A;  1THZ A;  3E86 A;  1WPX A;  4P9O A;  4WF9 V;  1F4M A;  2DWE C;  3VOU A;  1NQT A;  3CME V;  3ZN1 A;  1Q81 W;  3JYC A;  1DTO A;  3LDD A;  3HPL C;  1PNM A;  1RM1 B;  4WFB V;  3T4D A;  4MTO A;  3W7X A;  3T4Z A;  2IH1 C;  2LP7 A;  2WLI B;  4FJC C;  2NNU A;  5HFL A;  2EIL B;  1J95 A;  1OCC B;  3G6E V;  1XL6 A;  2IJH A;  3CCV V;  1FXK C;  3CP1 A;  3K04 A;  4PA3 A;  2QKS A;  2ITC C;  4QPK A;  3CCS V;  2EIM C;  3OMA B;  3K08 A;  5KUK A;  4QPJ A;  2DW4 A;  1ROP A;  1S5H C;  3QO7 A;  3X2Q C;  1AI7 A;  2EIN B;  1E79 G;  1HWY A;  3FKS G;  5IYD O;  4RQF A;  5B1A B;  2CK3 G;  5CBG A;  4EKW A;  1EZJ A;  1OHH G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...