1J95A

Kcsa potassium channel with tba (tetrabutylammonium) and potassium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VOLTAGE-GATED POTASSIUM CHANNEL
publication title Potassium channel receptor site for the inactivation gate and quaternary amine inhibitors
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 34
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1j95A00
1OCOC 4UUJC 2Q69A 4X8AA 4F4LA 4PDRA 3SYCA 2A9HA 3F5WC 3BEHA 1ORQC 3SYOA 3LDCA 5B3SC 1P7BA 2HG5C 1K4CC 4PDVA 3R65A 1V55C 3ZRSA 3SPJA 2K1EA 3OGCC 2A0LA 2IH1C 2X6AA 4QE9A 2ITCC 3ABMC 3E8GA 3IFXA 4XDLA 1R3JC 4GX5A 4PA9A 2EILC 4LCUC 4LP8A 4MTOA 3FB5C 2R9RB 1S5HC 1G4YB 3GB7C 4R6ZA 4DXWA 2X6BA 3ASOC 4GX1A 4CBCA 2ZXWC 3K0GA 2X6CA 2EIMC 4RUFA 3SPHA 3T2MA 2BOBC 3FB7C 4KFMA 1ZWIC 2WLIA 2WLJA 3AG3C 3AG4C 4WFFA 2Q6AA 3VOUA 2DYSC 4MVSA 4MW8A 1OCRC 2WLNA 3K04A 1K4DC 2OCCC 2WLMA 2HVKC 4MVOA 5CBHA 3F7YC 2DYRC 3ASNC 4WFGA 5EC2C 5B1AC 3RVZA 3LNMB 1OCCC 4G27B 2ATKC 3JYCA 3X2QC 2AHYA 5EBMC 2EINC 4X88A 3SPCA 2YEVA 5J9PC 5EK0A 2AHZA 5EC1C 3T4DA 2BOCC 4X89A 4QNHB 5CBFA 3STZC 4RUEA 2QKSA 3K0DA 4H37A 3SJQC 3SPGA 3E83A 3PJSK 4PDMA 3OR7C 2WLLB 4R8CA 2KB1A 2EIJC 1R3KC 3E8FA 3OR6C 4HYOA 3K08A 4J9ZB 4MVRA 4RAIA 4G28B 3EFFK 2HJFC 3HPLC 2DWEC 4GX2A 2ZD9A 2JK5C 1QLEC 2Q68A 3LDEA 4HZ3A 4MTFA 2DWDC 5CBGA 3UKMA 5IY5C 3STLC 4MW3A 2Q67A 3E86A 1LNQA 3E89A 2ITDC 4LBEC 4P30A 3FB6C 3FB8C 3OUFA 3K03A 1V54C 3UM7A 3ABLC 4R7CA 4GX0A 2WLHA 4XDJA 1XL6A 1OCZC 1R3LC 3RVYA 3E8HA 4H33A 4PA7A 3LDDA 3LUTB 4I9WA 3OUSA 1M56C 2WLKA 3F7VC 4MVMA 4RO2A 5B1BC 3RBZA 4MVZA 1R3IC 2WLIB 4JTAB 5KUMA 4MTGA 4OXSA 4XDKA 3IGAC 4BW5A 3ZJZA 4MS2A 1XL4A 4WFEA 4MVUA 5EBWC 1M57C 4ZBMA 4PDLA 2HFEC 2IH3C 4PA3A 3SYQA 2Y69C 4J9YB 1KKDA 4PA4A 2W0FC 3SPIA 2A79B 2NLJC 2QTOA 3AG2C 4QE7A 5KUKA 4MVQA 1JVMA 3T4ZA 3E8BA 4PA6A 4WFHA 5E1AC 3TCUA 4EKWA 2EIKC 4P2ZA 4P9OA 3KG2A 3AG1C 3SYAA 3K06A 4JTDB 5BZBA 4R50A 3T1CA 5EBLC 4TWKA 3WG7C 2WLLA 3ABKC 4MSWC 2P7TC 1BL8A 1J95A 4JTCB 3SYPA 3TETA 4P9PA 2H8PC 3RW0A 2HVJC
chains in the Genus database with same CATH superfamily
5AG2A 4PDRA 3CJHA 4YJ2A 2UUCO 3ZS8C 2E75B 5IT9N 4ASUG 4QE9A 3B8NA 1NVPD 1SERA 4WCEV 4LCUC 1OCOB 1AB3A 3CCVV 4CBCA 1KECA 1YJNV 2X6CA 4RUFA 5L3EA 4DUZO 1JR9A 4GCZA 2VQFO 4KFMA 1FXKB 5KMGB 3AG3C 2F43G 2ARHA 3P32A 3QNEA 5CN0A 3QTCA 3HB3B 4F6EA 3DC6A 3H1LH 5B1AC 1XOUA 5EBMC 3AK2A 2ZXWB 5JWPA 3WG7B 1Q90D 4YY3O 3H1JH 3E83A 4CH6A 3RGBA 1Q6HA 1YDXA 3FX7A 1W2BU 4FMTA 5IY5B 2PYLA 1I5YA 1WNSA 1VQMV 2YIAA 5GTIZ 5JQGB 1PL0A 4NTXA 4TV9A 2JDIG 5IYBO 1CXZB 1VEWA 2QE7G 3N2GB 4KUMA 2L35A 2XAGA 2E5LO 4LFAO 2PTMA 5L3DA 2CTWA 2WLKA 5JJNB 1WP8A 1N0NA 1GTOA 2LO1A 2EJRA 1OZ0A 1GO3F 2ZCEA 3ZMSA 1XNRB 2ZKOA 1DGSA 4K3AA 5LMNB 3CMAV 1NZ6A 2B1GA 2IH3C 2LW7A 1ZSPA 2W0FC 4O4JB 4I50B 1YF2A 2WA4A 3E8BA 5KX5B 1TUBA 3AG1C 4O2BB 4R50A 3WU2Z 4DV5O 5KA5A 1KUQA 2KQXA 1ZAUA 1H8EG 5E79Z 3W7SA 1L1FA 5LYJA 3TXSA 3H1KH 1SF9A 4TQFA 3KCYA 1I94B 1GN4A 4U3JA 1H8HG 1WPXA 4I0XB 2ZE8A 4GX5A 2JEXA 4DXWA 2G38A 3ZMUA 1N8RW 4PJ0Z 2VWKA 2P4KA 3P3PA 3MD0A 1N32O 4FM2A 1RFYA 4FLXA 2GTSA 4MW8A 4MVOA 1BCCH 1KD1W 3ASOB 1K97A 3AK1A 5IYZB 3GWKC 5CBFA 4K8ZA 2P22C 3CCMV 3CCQV 2XTAA 1XILA 4JI5B 4U7OA 4ABMA 2UXCB 1RPOA 1ZX3A 2OIEA 1NKDA 1FXKA 5KMGA 4O4HA 3SGIA 5KAIZ 2P90A 5LXTB 1TAEA 1XEQA 4Z2WA 5KA6A 1FJGO 5J2UA 4GKKB 2ZR2A 1NJIW 4X64O 5BR8O 4HBNA 1BMFG 2F93B 4PA7A 1YITV 1I08A 2CK3G 2E3CA 3NR7A 3OAAG 3JAKA 4PD4F 2NN4A 3WFVA 3QG5A 2Q8VA 1XL4A 4D7TA 5K1XA 2ADPA 4NYKA 2BCCH 4JAUA 4DR2O 4HNAA 3TCUA 1O9GA 3FFQA 3CRAA 3Q4HB 4CC5A 1AI6A 3T1CA 2PI5A 5EBLC 2QSAA 3CYOA 1D2DA 4K0KB 1TVKA 2CGNA 1S0VA 4DV7B 1OCOC 1Q6IA 2EIKB 1FXKC 3JSNA 1MA1A 2JGUA 3SPJA 3EHBB 5KHJA 4G2KA 2AZ2A 1Y4MA 3FB5C 1YCIA 4UVCA 1SA0B 2ZT9B 3DC5A 4O2BA 2ZXWC 3C3SA 1HNZB 2ZR3A 3D8CA 5B3SB 5J2TB 4ZHQB 3CPWU 1R6NA 5IY5C 4Z1MG 4JYAO 2WLMA 2HVKC 2Q5ZA 1Y76B 3E35A 5CA0B 3TXQA 1M1KW 4I0XA 5J9PC 1KU9A 1YXBA 3M8AA 1EM1A 4IGGA 4JI4O 3UO3A 5GONB 3CX5F 3SJAC 2A7WA 1N36O 3TK1A 1IBKB 4DR7O 2QKAA 5LGUA 3E89A 4X62O 2DN9A 4JI7B 1IBLB 4X66O 2XOKG 4NXMO 3QO5A 3R66A 5IYZA 5BMVB 4BW9A 4NVPA 1B6QA 3ZRXA 4RQEA 2QM8A 2N05A 1SQBH 2F95B 4B3MO 1PNMA 1UPGA 2N74A 2WPDG 1PV0A 5KUKA 4LF4O 4NB5A 4FLZA 2CGOA 3K59A 1N4CA 2Y4UA 3K06A 4J80A 2B1IA 4DR6B 1I7FA 4LFBO 1KQSU 2DW4A 1AR4A 4MSWC 3F5TA 4X1IB 1BL8A 3TETA 1HR0O 3SYPA 1VQ9V 2PGGA 1UFIA 4DO2A 2Y69B 3OGIB 1MZEA 3AG2B 3ZHQA 3BEHA 4B3RO 2GUZB 1QVFU 2QR4A 4GZRB 2D3OW 1VQ8V 1KP3A 3RYFB 2X6AA 3CE2A 2ZQMA 3Q4HA 4AQYO 4UV9A 5KHGA 1XNQO 3ASOC 2AZ0A 2RN9A 4WFFA 4JV5B 5LP6B 3CCUV 3ZHUA 2ZDIA 2R72A 4CS3A 2E76B 1YIJV 4OX9B 2YXHA 3CCEV 1M5IA 1EBOA 1G6UA 5LGTA 2W0XA 1H2KA 3BHPA 1PM9A 1AJPA 3KCXA 5GTHZ 3JATA 3HPLC 3ASNB 5LA6B 2YXLA 2FKXA 4JAAA 1FXHA 1Y76A 4P30A 3N27A 4JI1B 2GDSA 4X65B 1BZKA 1R6TA 4TV8B 2QGNA 1R3LC 3ZMVA 2OCHA 1JJOA 4H33A 2F4VB 5GONA 4MVMA 4LFCB 1J5EB 1AP6A 5JJEB 1QHTA 3JARB 1Y6XA 3IGAC 4FM1A 2OYQA 4LF7O 3JAWB 4MS2A 3A0HZ 2YDEA 5IJ9B 4L87A 4RQFA 2QTOA 1NS1A 1NTZH 4LF6O 5BMVA 2QWOB 2ZDIC 3ICXA 1S5LZ 2EIKC 3ZHTA 3JALA 4JYYA 3OEHG 2FB5A 1J95A 3M7MX 1K92A 2CUGA 3JAMN 3F5WC 5LHIA 1Y66A 2F66C 3G67A 5B3SC 5LHGA 2JIZG 1XNRO 1V9PA 4WBNB 1GH6A 2IH1C 2EBOA 4CS4A 5LMNO 4FLWA 3BA8A 1L8DA 4EEQA 1Y74B 2PZSA 1Z5VA 3SPHA 5EYPB 4CC6A 3S3XA 1EN6A 4JI0O 3B40A 2HKOA 2GUZA 2RDCA 1SQQH 1L0NH 3OM3B 4FLYA 1IXMA 3RYFA 3STZC 5D5QA 3RWRD 3ZEDA 2KKWA 2WLLB 2DMXA 3OMNB 4TOIA 2JVDA 2X0LA 1XMQO 3BRCA 2IU3A 4FJCC 1OJHA 1NH2D 4L8JA 2Q4PA 5KHKA 3IJ4A 3K9AA 1EFRG 4E2LA 3K9SA 2BE3A 3B4SA 3RBZA 4B7KA 2D2CB 1HNXB 5LA6A 2LQTA 2VWJA 4JI5O 1BHBA 3OFNG 2Y69C 4FM0A 3U0ZA 4JI6B 2A79B 4GYCB 4KL1A 3AG2C 4QE7A 2GV9A 1AVMA 2YI8A 4TV8A 3CCSV 1BS3A 1M90W 1Q43A 2Q0OC 1GN2A 5A9GA 4JTCB 3LSQA 1AI7A 3SDLA 3W7WA 1COWG 3ZMTA 3DGEA 3EVKA 2HG5C 4UCRA 5HFLA 3B2EE 5LP6C 1WP7A 1LUVA 2IJJA 2YEVB 1MG1A 2QA4V 3CP1A 3A2FA 2UXNA 2W6IG 2R9RB 3ABTA 1EZVH 1LUWA 1US6A 3VQXA 2VRZA 3D3QA 4B3SB 1NI8A 5JVDA 1OV9A 3VOUA 5LOVA 3K04A 1K4DC 5FPRA 4PV1B 3ASNC 1M9NA 2EILB 3ZBHA 4DV7O 4AILC 4DR5B 2JJ1G 2EZOA 1NT2B 3HKCB 2BTOA 3FKSG 1R1BA 3QF7A 1JQ0A 3C90A 3E22A 4KP4A 1N34B 4HZ3A 4DW0A 4O2AA 1KMIZ 5IYCO 2UXDB 5IJ0B 1Q81W 4E4EA 3UT5B 2GHYA 4DR1B 4KHPO 4H13B 1IX9A 4FK5C 1PPJH 1R73A 1MOFA 1XL6A 1AI4A 3ZX6A 2P06A 3LUTB 2Q7EA 3F7VC 3BA9A 2WLIB 2UXBB 5KUMA 2YUAA 2UUAB 3ZJZA 4MVUA 1A32A 2UU9O 3JCZA 1KKDA 4X1YA 4EFBA 4F6RB 4DV0B 5FNVB 4QJFB 2JGDB 1EZJA 2JS5A 2RJZA 3ETDA 4NTYA 5E1AC 5JCOA 3HKDA 2P6JA 1YVWA 2VQEO 4TWKA 3RW0A 4DV6B 2XNDG 3LNNA 2L6LA 2GSMB 2R70A 1VMGA 1EN4A 3SYOA 2XAJA 3J7AU 5KLVH 3OW2U 4DYLA 2K1EA 5B1OA 1KP2A 4NR1A 4I7ZB 1ZTEA 3ZN1A 3JASA 4GX1A 5ITZA 1FS0G 1CEZA 4GLXA 4DUYB 1AJNA 3JCUZ 1OCRC 1VQOV 3IAYA 4X1KB 4LF8O 5F2VO 4NXNB 4G27B 4BAYA 4LF5B 1IZ3A 2YEVA 4DRXB 1B04A 2QWPB 1N33B 1YI2V 1ENVA 4UFZA 2DJVA 4YIOA 1VF6C 3K08A 4W4LA 2OCCB 2HJFC 4B3TB 5JCOC 1HW7A 1YEWA 2HP8A 3K5OA 4UB8Z 1YJ9V 2Q68A 1AR5A 5JH7A 1VQ7V 1QR9A 3UKMA 3B09A 1K5SA 4DV2B 4UVAA 1QLNA 1GM7A 3FB8C 2IJKA 2CE4A 3ETGA 4JV5O 3K03A 1K8AW 2RQ6A 4R7CA 2NNUA 4B08A 3HKCA 4K35A 1QVGU 3G6BA 1ZL8B 1QLEB 4GUNA 2F1MA 2MK3A 1JFFB 4OXSA 1TA8A 4Z1VA 5CA1B 4ZBMA 1OCZB 1Q82W 3T1YO 1MZFA 4PA4A 2NLJC 4GKJB 4P9OA 2UUBB 4LH7A 4UCTA 2Q7HA 4DV3B 2IW5A 3LSSA 4P9PA 3G80A 2HVJC 3CXCU 4J42A 4UUJC 2OIGA 3UQ8A 2Z0AA 3ABUA 3BFRA 5JQGA 2XHBA 2F4VO 1S76D 1VQ5V 4PI0A 4JI8B 2EJ7A 1XUQA 3WB2A 5L3BA 3N2GA 4MT8A 2PF4E 5FNVA 5L3GA 2JGDA 2BTQB 4FZ0A 1SQXH 4HAMA 2EILC 1XMOB 3RYIB 4CH3A 4I55B 4K8XA 4YHHB 2BOBC 4H44B 1RM1B 4KXRA 1PKXA 3HKEB 1NTKH 2YXYA 4JI2B 1I0HA 1DK1A 3W7XA 2EIMB 2BOCC 4FFBB 4O4JA 3DTUB 4I50A 5KX5A 4RAIA 3AEIA 1NQTA 3EFFK 4TUYB 2UUCB 2C2AA 2FL4A 4MTFA 5H2FZ 4LF9O 3BY6A 4TSFG 5GW7A 3IC9A 1G8MA 3KZIZ 2EIJB 2JRIA 2ZM6O 4DUZB 4DRXA 2VQFB 1PP9H 4Q6GA 2XAQA 2XAFA 5IE9A 2EX3A 4B7EA 4I9WA 1LR1A 1HNWB 3ZHVA 4J7KA 4I9QA 1E79G 4QGPA 2V1DA 3ABLB 4YY3B 5FL7G 4JI3O 4BWAA 1Q6UA 5H6QA 3SYQA 4Q20A 3ZHSA 2FTKA 1JVMA 1BQZA 1ZL8A 2QEXV 3QO7A 3CCJV 3B8MA 1H2MA 4X8AA 1GKFA 2Z3YA 2E5LB 1BGYH 5LXTA 1JPXA 3SJBC 1SC5B 4PELA 3JD3A 1ZLZA 4XBFA 4FIPC 5A2QN 1NU1H 2IBZH 4PA9A 4LP8A 3G4SV 1CP9A 2PY5A 2Y4TA 5DEDA 1TUEB 2HHHO 2WLJA 4C7UA 2Q6AA 2P4VA 2OCCC 4DV1O 4J11A 1B3QA 2YIDA 4DV5B 2QDOA 4X88A 5EZYB 3SPCA 3CHXA 5H5NA 5EC1C 1Q3EA 1THZA 4LNUB 2EULA 4TQDA 1NR7A 3SJQC 3SPGA 3G6EV 1GMGA 1JCHA 3AG4B 1EN5A 2QM7A 3RYIA 4J41A 4I55A 5LMUO 2CTRA 2CDYA 2YSUB 4FFKA 1Y67A 1FXVA 1QLEC 3LDEA 3ZIAG 5IWAB 2DQ3A 2EINB 3STLC 4JASA 4MW3A 4B3SO 4LBEC 4IYIA 1VQLV 1URFA 2WSSG 4ZIBA 3N2KB 2CTPA 2Z5UA 3ZHRA 1N32B 1OCZC 4FFBA 3JD1A 1H2NA 3K3WA 2LJ2A 4DR5O 1WLEA 2PYJA 1SA0A 4IIJB 4YJ3B 4TUYA 2IU0A 1M4UA 4GT1A 5J2TA 4ZHQA 1PNKA 4JZ2A 1GAXA 3O65A 3RYHB 3I5DA 3OE7G 1AILA 5EIBC 5CA0A 2MW2B 4EB6B 3SPIA 5LGNA 1GN3A 3K79A 1MABG 4LH6A 1JX9A 5IYDO 2RCVA 1YZBA 1DTOA 1FPOA 4UCSA 3APQA 4X64B 2WAMA 5BR8B 4DV4B 1ORQC 1RM1C 3SR2C 5FLXN 1WAZA 1WN7A 2F23A 2FYUH 3OGCC 1H2LA 1IBMB 3E8GA 3IFXA 1K73W 2X6BA 2EIMC 3ZMZA 3PN1A 1Q8IA 2B9ZA 4J7ZA 1V55B 4DR2B 2KG7B 4WFGA 1VQ6V 2ATKC 3K5LA 5EK0A 1XBLA 4X89A 4D7SA 2EIJC 3A0RA 1VQNV 4CH4A 5CMUA 3P30A 2DWEC 4X1IA 1OCCB 1UJWB 3CJHB 4YJ2B 5DM6V 2H94A 1PD3A 3ABLC 5EZYA 4GX0A 1YTFB 2WLHA 4NXNO 3NXSA 3UO2A 1I94O 4JYAB 1P84F 4UV8A 3L71H 5TISZ 1OCRB 1RP3B 2CTQA 1TGOA 2AW9A 4DK0A 5LP6A 3K58A 4B3TO 4JI4B 3CXHF 4AI8A 5KAFZ 1W0KG 1FD9A 1N36B 1QNMA 4DR7B 2LFSA 4P2ZA 3KG2A 4WF9V 1K3EA 4NTWA 1YHQV 4UVBA 3RYCB 4WFBV 2AXTZ 4X62B 4IIJA 4X66B 3ETQA 4NXMB 3SYCA 1QCEA 4FLUA 3RYHA 2P67A 2UXCO 1K4CC 4PDVA 2K9PA 3CCRV 4EB6A 3ABKB 1NR1A 1S3JA 1MMMA 1K33A 4OPHA 2H3OA 3E2EA 4MTOA 4GKKO 1DF4A 4B3MB 3T2MA 2AGAA 1HWYA 1I5XA 1P7GA 3AG4C 3JARA 4LF4B 3I55V 3JAWA 3F7YC 3OD4A 1F23A 4TT3G 4LFBB 3J81N 3JYCA 1SETA 3CMEV 2EINC 5IJ9A 3OMAB 1HR0B 1TUBB 4CH5A 1VF7A 1K7DA 1YJWV 1SQVH 3VQVA 3WB1A 1R3KC 5L3FA 4B3RB 1IURA 1M93A 3VBBA 2Y0PA 5LYJB 2XUMA 1AJQA 4YHHO 1MSDA 3L9DA 5BXZA 3E86A 1N0JA 2KG7A 3FB6C 4U3JB 5B5EZ 4DR3B 4AQYB 4IT5A 1XNQB 4K0KO 1G1XB 4PHZA 4WBNA 1PL4A 3D36A 1VF5B 1JJ2U 1KB9F 3O9OA 1SESA 1Y74A 3LDDA 3U10A 4AHCA 1S5JA 2E74B 5EYPA 2JS3A 1P4RA 2ZE7A 1HNZO 3BPZA 1M56B 3B77A 3KKYA 1FKAO 1W59A 2LP7A 3ZCCA 3G71V 2OWOA 1WPBA 2HEPA 2WLLA 1SQGA 3M99B 2P7TC 4O4HB 3TGUH 2ZINA 3CWBH 3GWOA 1HNWO 5J2UB 4YXWG 1D5NA 3BABA 1IBKO 5B1NA 1V55C 1VF6A 5LL6Y 2OTJV 1KKCA 2A0LA 4CS2A 1NBMG 2ITCC 1NTMH 4LF7B 3FAVB 4JI7O 1IBLO 2JJ2G 3JAKB 3RYCA 2LW1A 1K34A 3D36C 3CB2A 3U11A 4LF6B 1OCCC 2CAZC 2AHYA 2XASA 4HNAB 2EZPA 5KHIA 4QNHB 2BSKB 2WA3A 2NR5A 1WA8B 3OR6C 4IL6Z 4G28B 2DE0X 1U97A 1TVKB 3FD9A 1F7YA 5H9CA 4BR6A 2DWDC 3AG7A 4DR6O 2Q7GA 4JPRA 4OPAA 5IDJA 2VS0A 4JI0B 2YS8A 5DECA 4WFAV 3MHHC 5LBQA 3OTFA 3BAAA 4MTGA 1PNLA 3CRMA 1V54B 4WFEA 5EBWC 5DN6G 4J9YB 1VARA 5IWAO 3JD0A 3EXAA 1XMQB 3FYEB 3OTOB 1XREA 3DSQA 2M7WA 4OX9O 3ABKC 3OT7A 3CC2V 2IJIA 4JAVA 2A9HA 4FZ1A 5IJ0A 3LDCA 5K1PA 1OHHG 4NKGB 3UT5A 1HP8A 4XDLA 3MDSA 4JI1O 4FPPA 4X65O 1ZUQA 1SKVA 3T1HB 2GBOA 2QKCA 4FVMA 1XHZA 1KC8W 3CRCA 4EFEA 2WLIA 1BT8A 3WB0A 3RT3C 4MVSA 4A5UB 4LFCO 5CBHA 1J5EO 1GM9A 4O4IB 4ZI7B 3RVZA 4DR4B 5EC2C 4H0LB 5D5PA 2ZIOA 2LGQA 2W6JG 4I4TB 4F6RA 1F4MA 4DV4O 4DK1A 3PJSK 4PDMA 2KB1A 4HYOA 3FAVA 1IBMO 1GK9A 2CH7B 2DYRB 3S3WA 3QO8A 3MHSC 4O4LB 3X2QB 1CPYA 2HLDG 3CRRA 1RPRA 2X7RB 1HDJA 2RNBA 1F4NA 3OMIB 4XDJA 1W0JG 2BSKA 3E8HA 3DXRB 4QPKA 1RSOB 1Q7YW 1M56C 1WA8A 4N23A 3SJCC 2V7QG 4N21A 2A3QA 2LFRA 5JJJB 4QPJA 4UB6Z 1DF5A 3UCSC 3OEEG 1DLBA 3H1IH 3H9VA 4X1KA 4BIZA 1IVSA 2Y48A 3T4ZA 3SYAA 1AI5A 3JATB 5H6RA 3W7UA 3WG7C 1H2SB 1M57B 4KHPB 1GN6A 3HKBB 3ZRVA 4F4LA 2V4DA 3CRQA 4FLVA 3CEIA 1ROPA 3RFRA 2ZE5A 3APOA 3ZRSA 2ODMA 1QR8A 1X4TA 2QWNB 5CB4B 3CC7V 1S5HC 1BHAA 4U7NA 4IYHA 1E1QG 2UU9B 1MNGA 1VIBA 5EIBD 4X20B 2R9AA 1Q86W 1ZWIC 1JFFA 1SQFA 1FYJA 1BE3H 2WLNA 3ABMB 4LFAB 1SRYA 5CA1A 3H1HH 1H2GA 2VQEB 1HNXO 1Q5OA 2OT5A 1FFXB 2Q73A 4RUEA 2QKSA 3JALB 4H37A 3OR7C 4R8CA 3E8FA 4JI6O 3THOA 2DYSB 4QIWF 4GX2A 1JA8A 2JEUA 1Z5WA 2ZNJA 1WJZA 4O4IA 4ZI7A 1AP5A 2ZE6A 1V54C 3UM7A 2GTAA 4X9QA 1IDSA 3W7TA 4I4TA 1T5EA 2ILMA 3RVYA 2BTQA 1XI1A 3BCCH 3OUSA 2QWRB 4MVZA 1R3IC 4LF8B 3CS5A 2CH7A 1YSCA 1VP7A 4O4LA 4CZZA 3HKEA 2O57A 5KHHA 2WWWA 3L74H 4JF3A 3CC4V 2A06H 3ZRWB 3IC7A 5B1BB 2Y0IA 5FPOA 4DR3O 3DXRA 1RSOA 3JD4A 2YICA 1QQCA 1X59A 3BVOA 1GM8A 3L72H 5L3CA 5HFMA 1VQKV 1P7BA 1AROP 2M6YA 1N34O 3L75H 2UXDO 1E1RG 1P49A 1R3JC 1XQ8A 1S72V 4DR1O 2YI9A 1VQ4V 4IHJB 1BQ0A 1KYOF 2R9IA 4ZOLB 1FJGB 3T1YB 2FMLA 3HKBA 4JZGA 4J7JA 4FLTA 1VQPV 1XHXA 3CD6V 5C93A 2DYRC 2UXBO 3ETEA 3LNMB 1NH2B 3X2QC 2Q9LA 3FYIB 5C8YB 2UUAO 3HR0A 2AHZA 1Z2GA 4LWSB 4OGQB 5CB4A 3AG3B 4JYCA 5BY1A 2P5OA 4BIUA 4DV0O 3VQYA 5LHHA 5B1AB 2ZD9A 4X20A 5CBGA 1K5QA 1LNQA 2ITDC 3OUFA 1S77D 4DV6O 1F51A 1FFXA 1QU7A 3JSLA 4LC1A 3TJTA 1H38A 5JVDB 4JTAB 1SS3A 5LOVB 5B66Z 2DQ0A 2YC0A 2XT9A 1M57C 2HFEC 3P3NA 3K57A 4PA3A 2QTSA 4DW1A 4DUYO 3QVNA 4MVQA 3VQWA 2IJHA 1K9MW 2XAHA 4PA6A 4UCOA 4BIOA 4EKWA 4LF9B 4LNUA 4JTDB 5BZBA 3CSXA 4RWUA 4LF5O 1FFTB 3AK3A 3E22B 4YIPA 1N33O 4O2AB 2H8PC 2QM4A 2IM9A 2Q69A 2ZM6B 1L0LH 1FAFA 2YIBD 1IXBA 3CCLV 2KSDA 3AG1B 3H01A 3ZN0A 4PI2A 1SZXA 3R65A 1B06A 2ETNA 2Q0AA 3ZRWA 1SQPH 1WB8A 4DV2O 3ABMC 3A8TA 3N2KA 4UXNA 1WB7A 4UCVA 2OTLV 3L73H 4R6ZA 1G4YB 3GB7C 1NVPB 2HR3A 5CA3A 3K0GA 4JI3B 1BSMA 3OTOO 3FB7C 4YJ3A 3MAQA 4TV9B 2DYSC 3K5NA 4JGSA 2UXXA 1XDCA 4X1YB 4JYBA 1D5AA 2RMKB 2YIBA 2LGWA 2N04A 3T4DA 3L70H 2DOSA 3D3IA 3HKDB 3JD2A 3K0DA 2ZIMA 3A0BZ 4MVRA 4J9ZB 4IHJA 1AR1B 4ZOLA 4ZKIA 4GKJO 2JK5C 4LR3A 2UUBO 1U96A 4J10A 4DV3O 3T1HO 1JMKC 3GVMA 2Q67A 3LSUA 3I56V 2B5UA 1MSWD 2PI4A 4MTXA 4W4KA 5C8YA 2QJ1A 2HHHB 4LWSA 4DR4O 1SZTA 2ZNIA 3JASB 1O9HA 4JI8O 5ITZB 4DV1B 4RO2A 5B1BC 4ICGA 1GRJA 4XDKA 3K5MA 3J80N 2ADQB 3C3TA 4I5SA 2QWQB 4BW5A 1XMOO 4PDLA 4D6TH 1R6KA 3ML0A 1KBHA 1JOYA 1YTFD 5LMUB 4JI2O 3RN4A 4WFHA 2HJDA 4UCUA 1QBZA 2PUSA 5JH7B 4U3FH
chains in the Genus database with same CATH topology
4JAVA 4X8AA 1GKFA 2Z3YA 4PDRA 2A9HA 3F5WC 5LHIA 1Y66A 1JPXA 3LDCA 5B3SC 5LHGA 1OHHG 2JIZG 4PELA 3JD3A 2IH1C 4ASUG 2EBOA 4XBFA 4QE9A 4FIPC 3B8NA 4XDLA 1NVPD 1SERA 4PA9A 4LCUC 4LP8A 4WCEV 1OCOB 3CCVV 3G4SV 1CP9A 4CBCA 4FPPA 1KECA 3SPHA 2X6CA 1YJNV 4RUFA 5L3EA 1KC8W 4GCZA 1TUEB 1FXKB 4KFMA 2WLIA 2WLJA 3AG3C 2F43G 3P32A 3QNEA 2Q6AA 4MVSA 5CN0A 2OCCC 2HKOA 3HB3B 5CBHA 1GM9A 3RVZA 5EC2C 5B1AC 5EBMC 3OM3B 2ZXWB 4X88A 3SPCA 2W6JG 1IXMA 1F4MA 5EC1C 3WG7B 1THZA 3STZC 3SJQC 1NR7A 3G6EV 3SPGA 1GMGA 1JCHA 3E83A 3AG4B 3PJSK 4PDMA 2WLLB 2KB1A 4HYOA 3OMNB 2QM7A 1W2BU 4FMTA 5IY5B 1GK9A 1I5YA 2DYRB 2YSUB 1VQMV 2X0LA 1FXVA 1QLEC 3LDEA 3QO8A 3MHSC 3ZIAG 2DQ3A 3X2QB 1PL0A 2EINB 3STLC 1CPYA 2IU3A 4JASA 4MW3A 4FJCC 2HLDG 2JDIG 5IYBO 4LBEC 1NH2D 1RPRA 2QE7G 2X7RB 4KUMA 1VQLV 2WSSG 2XAGA 1F4NA 3K9AA 2Z5UA 3OMIB 1EFRG 4XDJA 4E2LA 1OCZC 1W0JG 3JD1A 5L3DA 3E8HA 4QPKA 3K3WA 1Q7YW 1M56C 1WLEA 2WLKA 4N23A 2V7QG 3RBZA 4N21A 2LFRA 1GTOA 2IU0A 2EJRA 1OZ0A 1GO3F 4QPJA 3ZMSA 4GT1A 1DF5A 1PNKA 3OEEG 1DLBA 3CMAV 2B1GA 2IH3C 1BHBA 3OE7G 3OFNG 2Y69C 2W0FC 3SPIA 2A79B 4BIZA 5LGNA 3K79A 3AG2C 4QE7A 2Y48A 3T4ZA 1MABG 3E8BA 1JX9A 3AG1C 1AI5A 3SYAA 4R50A 3CCSV 1M90W 5H6RA 3W7UA 3WG7C 5IYDO 5KA5A 1M57B 4JTCB 1H8EG 3W7SA 1DTOA 1L1FA 3ZRVA 3LSQA 1AI7A 4F4LA 2WAMA 3W7WA 1COWG 1ORQC 1RM1C 3ZMTA 3DGEA 1ROPA 2HG5C 5HFLA 3ZRSA 2YEVB 1H8HG 1WPXA 1MG1A 2IJJA 1QR8A 3OGCC 2QA4V 3CP1A 3E8GA 3IFXA 4GX5A 2UXNA 2W6IG 3CC7V 1K73W 2JEXA 2R9RB 1S5HC 4DXWA 3ABTA 3ZMUA 1N8RW 2X6BA 1BHAA 4U7NA 1E1QG 2EIMC 3ZMZA 1Q86W 3MD0A 1ZWIC 1V55B 3VOUA 4MW8A 2WLNA 3K04A 1K4DC 4MVOA 3ABMB 1SRYA 3ASNC 4WFGA 1VQ6V 1M9NA 2EILB 1H2GA 2ATKC 1KD1W 2JJ1G 3ASOB 1K97A 2OT5A 2EZOA 5EK0A 4X89A 5CBFA 3FKSG 4RUEA 2QKSA 4H37A 1JQ0A 3CCQV 3CCMV 3OR7C 4R8CA 3E8FA 2EIJC 3A0RA 1VQNV 5CMUA 2DYSB 3P30A 4KP4A 4U7OA 2DWEC 4QIWF 1RPOA 4GX2A 1OCCB 2JEUA 1NKDA 1FXKA 4HZ3A 1UJWB 5IYCO 2P90A 5DM6V 1Q81W 5KA6A 2GHYA 2H94A 2ZR2A 1PD3A 4FK5C 1V54C 3UM7A 1NJIW 3ABLC 1R73A 1MOFA 4GX0A 1YTFB 2WLHA 3W7TA 1XL6A 1AI4A 3RVYA 1BMFG 3NXSA 4PA7A 3LUTB 1YITV 3OUSA 3F7VC 4UV8A 2CK3G 4MVZA 1OCRB 1R3IC 2WLIB 3OAAG 5KUMA 1YSCA 3WFVA 4CZZA 3ZJZA 1XL4A 4MVUA 2WWWA 3JCZA 4JF3A 3CC4V 1KKDA 3ZRWB 3IC7A 1W0KG 4QJFB 4JAUA 1EZJA 5B1BB 3TCUA 3ETDA 5E1AC 2LFSA 4P2ZA 3KG2A 4WF9V 1K3EA 1AI6A 3T1CA 2PI5A 2P6JA 5EBLC 4UVBA 4TWKA 4WFBV 1YHQV 3JD4A 3CYOA 3RW0A 1S0VA 2XNDG 1OCOC 2GSMB 1GM8A 1QCEA 3SYCA 5L3CA 3SYOA 5HFMA 2P67A 2XAJA 2EIKB 1VQKV 1FXKC 1P7BA 1AROP 1K4CC 4PDVA 3CCRV 3OW2U 3SPJA 2K1EA 3EHBB 3ABKB 5B1OA 1E1RG 1NR1A 1KP2A 4G2KA 1S3JA 1K33A 1R3JC 3E2EA 1S72V 4MTOA 1Y4MA 3FB5C 1DF4A 4UVCA 3ZN1A 4GX1A 2ZXWC 1VQ4V 3T2MA 2R9IA 1FS0G 1HWYA 2ZR3A 1CEZA 5B3SB 3CPWU 1I5XA 3AG4C 1AJNA 1R6NA 5IY5C 3I55V 1OCRC 1VQPV 4Z1MG 2WLMA 2HVKC 1VQOV 3CD6V 3F7YC 2DYRC 3E35A 5C93A 1F23A 3ETEA 3LNMB 4TT3G 4G27B 4BAYA 3JYCA 3X2QC 1NH2B 1SETA 3CMEV 2EINC 3FYIB 1M1KW 2YEVA 3OMAB 5J9PC 2AHZA 1YI2V 1ENVA 1K7DA 1YJWV 3AG3B 4JYCA 1R3KC 5L3FA 3K08A 4BIUA 2OCCB 2HJFC 3VBBA 5LHHA 3TK1A 5B1AB 1YJ9V 2ZD9A 2Q68A 5CBGA 1K5QA 1VQ7V 1QR9A 3UKMA 1AJQA 5LGUA 1K5SA 4UVAA 3E89A 3E86A 1GM7A 1LNQA 2ITDC 1QLNA 3FB6C 3FB8C 3OUFA 2IJKA 3ETGA 1S77D 3K03A 2XOKG 1K8AW 3QO5A 4R7CA 2NNUA 1F51A 1QVGU 3D36A 1JJ2U 1QLEB 1B6QA 1SESA 3LDDA 4LC1A 3ZRXA 4RQEA 1H38A 2QM8A 2MK3A 4JTAB 1P4RA 4OXSA 2DQ0A 4ZBMA 1M57C 2HFEC 1OCZB 1PNMA 4PA3A 1Q82W 2WPDG 4PA4A 2NLJC 1M56B 3B77A 5KUKA 4MVQA 2IJHA 1K9MW 2XAHA 4PA6A 2LP7A 3ZCCA 4EKWA 3G71V 4P9OA 3K06A 4JTDB 5BZBA 2B1IA 2IW5A 1FFTB 1KQSU 2DW4A 2WLLA 3M99B 4MSWC 3LSSA 2P7TC 1VQ9V 1BL8A 3TETA 3SYPA 4P9PA 2H8PC 4DO2A 2HVJC 2Y69B 3CXCU 4UUJC 2Q69A 3GWOA 3ABUA 1S76D 3AG2B 3BEHA 4YXWG 1QVFU 3CCLV 1VQ5V 3AG1B 3H01A 5B1NA 3ZN0A 2D3OW 1VQ8V 3R65A 1KP3A 1V55C 5L3BA 3ZRWA 4MT8A 5L3GA 2OTJV 2A0LA 2X6AA 1NBMG 2ITCC 3ABMC 4UXNA 4HAMA 2EILC 2ZQMA 2OTLV 4R6ZA 1G4YB 3GB7C 4UV9A 1NVPB 3ASOC 2HR3A 5CA3A 2JJ2G 3K0GA 1K34A 2BOBC 1RM1B 3FB7C 4WFFA 3CCUV 1PKXA 2DYSC 4JGSA 2UXXA 2ZDIA 4JYBA 1OCCC 3W7XA 1YIJV 2AHYA 2XASA 3CCEV 2EZPA 2EIMB 3T4DA 1EBOA 2BOCC 3D3IA 4QNHB 5LGTA 3JD2A 3K0DA 3DTUB 4RAIA 4J9ZB 3OR6C 4MVRA 1AJPA 3AEIA 4G28B 1NQTA 3EFFK 3HPLC 1AR1B 4ZKIA 2C2AA 3ASNB 5H9CA 2JK5C 4MTFA 2DWDC 3BY6A 4TSFG 5GW7A 1G8MA 2Q67A 1FXHA 3I56V 4P30A 2B5UA 4JPRA 1MSWD 2PI4A 4MTXA 2EIJB 5IDJA 1R3LC 2XAQA 1SZTA 2XAFA 3ZMVA 4WFAV 3MHHC 4H33A 4I9WA 4MVMA 5LBQA 4RO2A 5B1BC 4MTGA 4XDKA 1PNLA 1E79G 4I5SA 1V54B 3IGAC 2V1DA 4BW5A 3ABLB 4MS2A 4WFEA 5EBWC 5DN6G 4PDLA 5FL7G 1R6KA 5H6QA 3SYQA 4J9YB 3ML0A 4L87A 1JOYA 1YTFD 4Q20A 4RQFA 2QTOA 3JD0A 2FTKA 1JVMA 2ZDIC 4WFHA 3FYEB 2EIKC 2M7WA 2QEXV 3OEHG 1QBZA 3ABKC 3QO7A 3CCJV 3CC2V 3B8MA 2IJIA 1J95A 1K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  4UUJ C;  2Q69 A;  4X8A A;  4F4L A;  4PDR A;  3SYC A;  2A9H A;  3F5W C;  3BEH A;  1ORQ C;  3SYO A;  3LDC A;  5B3S C;  1P7B A;  2HG5 C;  1K4C C;  4PDV A;  3R65 A;  1V55 C;  3ZRS A;  3SPJ A;  2K1E A;  3OGC C;  2A0L A;  2IH1 C;  2X6A A;  4QE9 A;  2ITC C;  3ABM C;  3E8G A;  3IFX A;  4XDL A;  1R3J C;  4GX5 A;  4PA9 A;  2EIL C;  4LCU C;  4LP8 A;  4MTO A;  3FB5 C;  2R9R B;  1S5H C;  1G4Y B;  3GB7 C;  4R6Z A;  4DXW A;  2X6B A;  3ASO C;  4GX1 A;  4CBC A;  2ZXW C;  3K0G A;  2X6C A;  2EIM C;  4RUF A;  3SPH A;  3T2M A;  2BOB C;  3FB7 C;  4KFM A;  1ZWI C;  2WLI A;  2WLJ A;  3AG3 C;  3AG4 C;  4WFF A;  2Q6A A;  3VOU A;  2DYS C;  4MVS A;  4MW8 A;  1OCR C;  2WLN A;  3K04 A;  1K4D C;  2OCC C;  2WLM A;  2HVK C;  4MVO A;  5CBH A;  3F7Y C;  2DYR C;  3ASN C;  4WFG A;  5EC2 C;  5B1A C;  3RVZ A;  3LNM B;  1OCC C;  4G27 B;  2ATK C;  3JYC A;  3X2Q C;  2AHY A;  5EBM C;  2EIN C;  4X88 A;  3SPC A;  2YEV A;  5J9P C;  5EK0 A;  2AHZ A;  5EC1 C;  3T4D A;  2BOC C;  4X89 A;  4QNH B;  5CBF A;  3STZ C;  4RUE A;  2QKS A;  3K0D A;  4H37 A;  3SJQ C;  3SPG A;  3E83 A;  3PJS K;  4PDM A;  3OR7 C;  2WLL B;  4R8C A;  2KB1 A;  2EIJ C;  1R3K C;  3E8F A;  3OR6 C;  4HYO A;  3K08 A;  4J9Z B;  4MVR A;  4RAI A;  4G28 B;  3EFF K;  2HJF C;  3HPL C;  2DWE C;  4GX2 A;  2ZD9 A;  2JK5 C;  1QLE C;  2Q68 A;  3LDE A;  4HZ3 A;  4MTF A;  2DWD C;  5CBG A;  3UKM A;  5IY5 C;  3STL C;  4MW3 A;  2Q67 A;  3E86 A;  1LNQ A;  3E89 A;  2ITD C;  4LBE C;  4P30 A;  3FB6 C;  3FB8 C;  3OUF A;  3K03 A;  1V54 C;  3UM7 A;  3ABL C;  4R7C A;  4GX0 A;  2WLH A;  4XDJ A;  1XL6 A;  1OCZ C;  1R3L C;  3RVY A;  3E8H A;  4H33 A;  4PA7 A;  3LDD A;  3LUT B;  4I9W A;  3OUS A;  1M56 C;  2WLK A;  3F7V C;  4MVM A;  4RO2 A;  5B1B C;  3RBZ A;  4MVZ A;  1R3I C;  2WLI B;  4JTA B;  5KUM A;  4MTG A;  4OXS A;  4XDK A;  3IGA C;  4BW5 A;  3ZJZ A;  4MS2 A;  1XL4 A;  4WFE A;  4MVU A;  5EBW C;  1M57 C;  4ZBM A;  4PDL A;  2HFE C;  2IH3 C;  4PA3 A;  3SYQ A;  2Y69 C;  4J9Y B;  1KKD A;  4PA4 A;  2W0F C;  3SPI A;  2A79 B;  2NLJ C;  2QTO A;  3AG2 C;  4QE7 A;  5KUK A;  4MVQ A;  1JVM A;  3T4Z A;  3E8B A;  4PA6 A;  4WFH A;  5E1A C;  3TCU A;  4EKW A;  2EIK C;  4P2Z A;  4P9O A;  3KG2 A;  3AG1 C;  3SYA A;  3K06 A;  4JTD B;  5BZB A;  4R50 A;  3T1C A;  5EBL C;  4TWK A;  3WG7 C;  2WLL A;  3ABK C;  4MSW C;  2P7T C;  1BL8 A;  1J95 A;  4JTC B;  3SYP A;  3TET A;  4P9P A;  2H8P C;  3RW0 A;  2HVJ C; 
#chains in the Genus database with same CATH topology
 5AG2 A;  4PDR A;  3CJH A;  4YJ2 A;  2UUC O;  3ZS8 C;  2E75 B;  5IT9 N;  4ASU G;  4QE9 A;  3B8N A;  1NVP D;  1SER A;  4WCE V;  4LCU C;  1OCO B;  1AB3 A;  3CCV V;  4CBC A;  1KEC A;  1YJN V;  2X6C A;  4RUF A;  5L3E A;  4DUZ O;  1JR9 A;  4GCZ A;  2VQF O;  4KFM A;  1FXK B;  5KMG B;  3AG3 C;  2F43 G;  2ARH A;  3P32 A;  3QNE A;  5CN0 A;  3QTC A;  3HB3 B;  4F6E A;  3DC6 A;  3H1L H;  5B1A C;  1XOU A;  5EBM C;  3AK2 A;  2ZXW B;  5JWP A;  3WG7 B;  1Q90 D;  4YY3 O;  3H1J H;  3E83 A;  4CH6 A;  3RGB A;  1Q6H A;  1YDX A;  3FX7 A;  1W2B U;  4FMT A;  5IY5 B;  2PYL A;  1I5Y A;  1WNS A;  1VQM V;  2YIA A;  5GTI Z;  5JQG B;  1PL0 A;  4NTX A;  4TV9 A;  2JDI G;  5IYB O;  1CXZ B;  1VEW A;  2QE7 G;  3N2G B;  4KUM A;  2L35 A;  2XAG A;  2E5L O;  4LFA O;  2PTM A;  5L3D A;  2CTW A;  2WLK A;  5JJN B;  1WP8 A;  1N0N A;  1GTO A;  2LO1 A;  2EJR A;  1OZ0 A;  1GO3 F;  2ZCE A;  3ZMS A;  1XNR B;  2ZKO A;  1DGS A;  4K3A A;  5LMN B;  3CMA V;  1NZ6 A;  2B1G A;  2IH3 C;  2LW7 A;  1ZSP A;  2W0F C;  4O4J B;  4I50 B;  1YF2 A;  2WA4 A;  3E8B A;  5KX5 B;  1TUB A;  3AG1 C;  4O2B B;  4R50 A;  3WU2 Z;  4DV5 O;  5KA5 A;  1KUQ A;  2KQX A;  1ZAU A;  1H8E G;  5E79 Z;  3W7S A;  1L1F A;  5LYJ A;  3TXS A;  3H1K H;  1SF9 A;  4TQF A;  3KCY A;  1I94 B;  1GN4 A;  4U3J A;  1H8H G;  1WPX A;  4I0X B;  2ZE8 A;  4GX5 A;  2JEX A;  4DXW A;  2G38 A;  3ZMU A;  1N8R W;  4PJ0 Z;  2VWK A;  2P4K A;  3P3P A;  3MD0 A;  1N32 O;  4FM2 A;  1RFY A;  4FLX A;  2GTS A;  4MW8 A;  4MVO A;  1BCC H;  1KD1 W;  3ASO B;  1K97 A;  3AK1 A;  5IYZ B;  3GWK C;  5CBF A;  4K8Z A;  2P22 C;  3CCM V;  3CCQ V;  2XTA A;  1XIL A;  4JI5 B;  4U7O A;  4ABM A;  2UXC B;  1RPO A;  1ZX3 A;  2OIE A;  1NKD A;  1FXK A;  5KMG A;  4O4H A;  3SGI A;  5KAI Z;  2P90 A;  5LXT B;  1TAE A;  1XEQ A;  4Z2W A;  5KA6 A;  1FJG O;  5J2U A;  4GKK B;  2ZR2 A;  1NJI W;  4X64 O;  5BR8 O;  4HBN A;  1BMF G;  2F93 B;  4PA7 A;  1YIT V;  1I08 A;  2CK3 G;  2E3C A;  3NR7 A;  3OAA G;  3JAK A;  4PD4 F;  2NN4 A;  3WFV A;  3QG5 A;  2Q8V A;  1XL4 A;  4D7T A;  5K1X A;  2ADP A;  4NYK A;  2BCC H;  4JAU A;  4DR2 O;  4HNA A;  3TCU A;  1O9G A;  3FFQ A;  3CRA A;  3Q4H B;  4CC5 A;  1AI6 A;  3T1C A;  2PI5 A;  5EBL C;  2QSA A;  3CYO A;  1D2D A;  4K0K B;  1TVK A;  2CGN A;  1S0V A;  4DV7 B;  1OCO C;  1Q6I A;  2EIK B;  1FXK C;  3JSN A;  1MA1 A;  2JGU A;  3SPJ A;  3EHB B;  5KHJ A;  4G2K A;  2AZ2 A;  1Y4M A;  3FB5 C;  1YCI A;  4UVC A;  1SA0 B;  2ZT9 B;  3DC5 A;  4O2B A;  2ZXW C;  3C3S A;  1HNZ B;  2ZR3 A;  3D8C A;  5B3S B;  5J2T B;  4ZHQ B;  3CPW U;  1R6N A;  5IY5 C;  4Z1M G;  4JYA O;  2WLM A;  2HVK C;  2Q5Z A;  1Y76 B;  3E35 A;  5CA0 B;  3TXQ A;  1M1K W;  4I0X A;  5J9P C;  1KU9 A;  1YXB A;  3M8A A;  1EM1 A;  4IGG A;  4JI4 O;  3UO3 A;  5GON B;  3CX5 F;  3SJA C;  2A7W A;  1N36 O;  3TK1 A;  1IBK B;  4DR7 O;  2QKA A;  5LGU A;  3E89 A;  4X62 O;  2DN9 A;  4JI7 B;  1IBL B;  4X66 O;  2XOK G;  4NXM O;  3QO5 A;  3R66 A;  5IYZ A;  5BMV B;  4BW9 A;  4NVP A;  1B6Q A;  3ZRX A;  4RQE A;  2QM8 A;  2N05 A;  1SQB H;  2F95 B;  4B3M O;  1PNM A;  1UPG A;  2N74 A;  2WPD G;  1PV0 A;  5KUK A;  4LF4 O;  4NB5 A;  4FLZ A;  2CGO A;  3K59 A;  1N4C A;  2Y4U A;  3K06 A;  4J80 A;  2B1I A;  4DR6 B;  1I7F A;  4LFB O;  1KQS U;  2DW4 A;  1AR4 A;  4MSW C;  3F5T A;  4X1I B;  1BL8 A;  3TET A;  1HR0 O;  3SYP A;  1VQ9 V;  2PGG A;  1UFI A;  4DO2 A;  2Y69 B;  3OGI B;  1MZE A;  3AG2 B;  3ZHQ A;  3BEH A;  4B3R O;  2GUZ B;  1QVF U;  2QR4 A;  4GZR B;  2D3O W;  1VQ8 V;  1KP3 A;  3RYF B;  2X6A A;  3CE2 A;  2ZQM A;  3Q4H A;  4AQY O;  4UV9 A;  5KHG A;  1XNQ O;  3ASO C;  2AZ0 A;  2RN9 A;  4WFF A;  4JV5 B;  5LP6 B;  3CCU V;  3ZHU A;  2ZDI A;  2R72 A;  4CS3 A;  2E76 B;  1YIJ V;  4OX9 B;  2YXH A;  3CCE V;  1M5I A;  1EBO A;  1G6U A;  5LGT A;  2W0X A;  1H2K A;  3BHP A;  1PM9 A;  1AJP A;  3KCX A;  5GTH Z;  3JAT A;  3HPL C;  3ASN B;  5LA6 B;  2YXL A;  2FKX A;  4JAA A;  1FXH A;  1Y76 A;  4P30 A;  3N27 A;  4JI1 B;  2GDS A;  4X65 B;  1BZK A;  1R6T A;  4TV8 B;  2QGN A;  1R3L C;  3ZMV A;  2OCH A;  1JJO A;  4H33 A;  2F4V B;  5GON A;  4MVM A;  4LFC B;  1J5E B;  1AP6 A;  5JJE B;  1QHT A;  3JAR B;  1Y6X A;  3IGA C;  4FM1 A;  2OYQ A;  4LF7 O;  3JAW B;  4MS2 A;  3A0H Z;  2YDE A;  5IJ9 B;  4L87 A;  4RQF A;  2QTO A;  1NS1 A;  1NTZ H;  4LF6 O;  5BMV A;  2QWO B;  2ZDI C;  3ICX A;  1S5L Z;  2EIK C;  3ZHT A;  3JAL A;  4JYY A;  3OEH G;  2FB5 A;  1J95 A;  3M7M X;  1K92 A;  2CUG A;  3JAM N;  3F5W C;  5LHI A;  1Y66 A;  2F66 C;  3G67 A;  5B3S C;  5LHG A;  2JIZ G;  1XNR O;  1V9P A;  4WBN B;  1GH6 A;  2IH1 C;  2EBO A;  4CS4 A;  5LMN O;  4FLW A;  3BA8 A;  1L8D A;  4EEQ A;  1Y74 B;  2PZS A;  1Z5V A;  3SPH A;  5EYP B;  4CC6 A;  3S3X A;  1EN6 A;  4JI0 O;  3B40 A;  2HKO A;  2GUZ A;  2RDC A;  1SQQ H;  1L0N H;  3OM3 B;  4FLY A;  1IXM A;  3RYF A;  3STZ C;  5D5Q A;  3RWR D;  3ZED A;  2KKW A;  2WLL B;  2DMX A;  3OMN B;  4TOI A;  2JVD A;  2X0L A;  1XMQ O;  3BRC A;  2IU3 A;  4FJC C;  1OJH A;  1NH2 D;  4L8J A;  2Q4P A;  5KHK A;  3IJ4 A;  3K9A A;  1EFR G;  4E2L A;  3K9S A;  2BE3 A;  3B4S A;  3RBZ A;  4B7K A;  2D2C B;  1HNX B;  5LA6 A;  2LQT A;  2VWJ A;  4JI5 O;  1BHB A;  3OFN G;  2Y69 C;  4FM0 A;  3U0Z A;  4JI6 B;  2A79 B;  4GYC B;  4KL1 A;  3AG2 C;  4QE7 A;  2GV9 A;  1AVM A;  2YI8 A;  4TV8 A;  3CCS V;  1BS3 A;  1M90 W;  1Q43 A;  2Q0O C;  1GN2 A;  5A9G A;  4JTC B;  3LSQ A;  1AI7 A;  3SDL A;  3W7W A;  1COW G;  3ZMT A;  3DGE A;  3EVK A;  2HG5 C;  4UCR A;  5HFL A;  3B2E E;  5LP6 C;  1WP7 A;  1LUV A;  2IJJ A;  2YEV B;  1MG1 A;  2QA4 V;  3CP1 A;  3A2F A;  2UXN A;  2W6I G;  2R9R B;  3ABT A;  1EZV H;  1LUW A;  1US6 A;  3VQX A;  2VRZ A;  3D3Q A;  4B3S B;  1NI8 A;  5JVD A;  1OV9 A;  3VOU A;  5LOV A;  3K04 A;  1K4D C;  5FPR A;  4PV1 B;  3ASN C;  1M9N A;  2EIL B;  3ZBH A;  4DV7 O;  4AIL C;  4DR5 B;  2JJ1 G;  2EZO A;  1NT2 B;  3HKC B;  2BTO A;  3FKS G;  1R1B A;  3QF7 A;  1JQ0 A;  3C90 A;  3E22 A;  4KP4 A;  1N34 B;  4HZ3 A;  4DW0 A;  4O2A A;  1KMI Z;  5IYC O;  2UXD B;  5IJ0 B;  1Q81 W;  4E4E A;  3UT5 B;  2GHY A;  4DR1 B;  4KHP O;  4H13 B;  1IX9 A;  4FK5 C;  1PPJ H;  1R73 A;  1MOF A;  1XL6 A;  1AI4 A;  3ZX6 A;  2P06 A;  3LUT B;  2Q7E A;  3F7V C;  3BA9 A;  2WLI B;  2UXB B;  5KUM A;  2YUA A;  2UUA B;  3ZJZ A;  4MVU A;  1A32 A;  2UU9 O;  3JCZ A;  1KKD A;  4X1Y A;  4EFB A;  4F6R B;  4DV0 B;  5FNV B;  4QJF B;  2JGD B;  1EZJ A;  2JS5 A;  2RJZ A;  3ETD A;  4NTY A;  5E1A C;  5JCO A;  3HKD A;  2P6J A;  1YVW A;  2VQE O;  4TWK A;  3RW0 A;  4DV6 B;  2XND G;  3LNN A;  2L6L A;  2GSM B;  2R70 A;  1VMG A;  1EN4 A;  3SYO A;  2XAJ A;  3J7A U;  5KLV H;  3OW2 U;  4DYL A;  2K1E A;  5B1O A;  1KP2 A;  4NR1 A;  4I7Z B;  1ZTE A;  3ZN1 A;  3JAS A;  4GX1 A;  5ITZ A;  1FS0 G;  1CEZ A;  4GLX A;  4DUY B;  1AJN A;  3JCU Z;  1OCR C;  1VQO V;  3IAY A;  4X1K B;  4LF8 O;  5F2V O;  4NXN B;  4G27 B;  4BAY A;  4LF5 B;  1IZ3 A;  2YEV A;  4DRX B;  1B04 A;  2QWP B;  1N33 B;  1YI2 V;  1ENV A;  4UFZ A;  2DJV A;  4YIO A;  1VF6 C;  3K08 A;  4W4L A;  2OCC B;  2HJF C;  4B3T B;  5JCO C;  1HW7 A;  1YEW A;  2HP8 A;  3K5O A;  4UB8 Z;  1YJ9 V;  2Q68 A;  1AR5 A;  5JH7 A;  1VQ7 V;  1QR9 A;  3UKM A;  3B09 A;  1K5S A;  4DV2 B;  4UVA A;  1QLN A;  1GM7 A;  3FB8 C;  2IJK A;  2CE4 A;  3ETG A;  4JV5 O;  3K03 A;  1K8A W;  2RQ6 A;  4R7C A;  2NNU A;  4B08 A;  3HKC A;  4K35 A;  1QVG U;  3G6B A;  1ZL8 B;  1QLE B;  4GUN A;  2F1M A;  2MK3 A;  1JFF B;  4OXS A;  1TA8 A;  4Z1V A;  5CA1 B;  4ZBM A;  1OCZ B;  1Q82 W;  3T1Y O;  1MZF A;  4PA4 A;  2NLJ C;  4GKJ B;  4P9O A;  2UUB B;  4LH7 A;  4UCT A;  2Q7H A;  4DV3 B;  2IW5 A;  3LSS A;  4P9P A;  3G80 A;  2HVJ C;  3CXC U;  4J42 A;  4UUJ C;  2OIG A;  3UQ8 A;  2Z0A A;  3ABU A;  3BFR A;  5JQG A;  2XHB A;  2F4V O;  1S76 D;  1VQ5 V;  4PI0 A;  4JI8 B;  2EJ7 A;  1XUQ A;  3WB2 A;  5L3B A;  3N2G A;  4MT8 A;  2PF4 E;  5FNV A;  5L3G A;  2JGD A;  2BTQ B;  4FZ0 A;  1SQX H;  4HAM A;  2EIL C;  1XMO B;  3RYI B;  4CH3 A;  4I55 B;  4K8X A;  4YHH B;  2BOB C;  4H44 B;  1RM1 B;  4KXR A;  1PKX A;  3HKE B;  1NTK H;  2YXY A;  4JI2 B;  1I0H A;  1DK1 A;  3W7X A;  2EIM B;  2BOC C;  4FFB B;  4O4J A;  3DTU B;  4I50 A;  5KX5 A;  4RAI A;  3AEI A;  1NQT A;  3EFF K;  4TUY B;  2UUC B;  2C2A A;  2FL4 A;  4MTF A;  5H2F Z;  4LF9 O;  3BY6 A;  4TSF G;  5GW7 A;  3IC9 A;  1G8M A;  3KZI Z;  2EIJ B;  2JRI A;  2ZM6 O;  4DUZ B;  4DRX A;  2VQF B;  1PP9 H;  4Q6G A;  2XAQ A;  2XAF A;  5IE9 A;  2EX3 A;  4B7E A;  4I9W A;  1LR1 A;  1HNW B;  3ZHV A;  4J7K A;  4I9Q A;  1E79 G;  4QGP A;  2V1D A;  3ABL B;  4YY3 B;  5FL7 G;  4JI3 O;  4BWA A;  1Q6U A;  5H6Q A;  3SYQ A;  4Q20 A;  3ZHS A;  2FTK A;  1JVM A;  1BQZ A;  1ZL8 A;  2QEX V;  3QO7 A;  3CCJ V;  3B8M A;  1H2M A;  4X8A A;  1GKF A;  2Z3Y A;  2E5L B;  1BGY H;  5LXT A;  1JPX A;  3SJB C;  1SC5 B;  4PEL A;  3JD3 A;  1ZLZ A;  4XBF A;  4FIP C;  5A2Q N;  1NU1 H;  2IBZ H;  4PA9 A;  4LP8 A;  3G4S V;  1CP9 A;  2PY5 A;  2Y4T A;  5DED A;  1TUE B;  2HHH O;  2WLJ A;  4C7U A;  2Q6A A;  2P4V A;  2OCC C;  4DV1 O;  4J11 A;  1B3Q A;  2YID A;  4DV5 B;  2QDO A;  4X88 A;  5EZY B;  3SPC A;  3CHX A;  5H5N A;  5EC1 C;  1Q3E A;  1THZ A;  4LNU B;  2EUL A;  4TQD A;  1NR7 A;  3SJQ C;  3SPG A;  3G6E V;  1GMG A;  1JCH A;  3AG4 B;  1EN5 A;  2QM7 A;  3RYI A;  4J41 A;  4I55 A;  5LMU O;  2CTR A;  2CDY A;  2YSU B;  4FFK A;  1Y67 A;  1FXV A;  1QLE C;  3LDE A;  3ZIA G;  5IWA B;  2DQ3 A;  2EIN B;  3STL C;  4JAS A;  4MW3 A;  4B3S O;  4LBE C;  4IYI A;  1VQL V;  1URF A;  2WSS G;  4ZIB A;  3N2K B;  2CTP A;  2Z5U A;  3ZHR A;  1N32 B;  1OCZ C;  4FFB A;  3JD1 A;  1H2N A;  3K3W A;  2LJ2 A;  4DR5 O;  1WLE A;  2PYJ A;  1SA0 A;  4IIJ B;  4YJ3 B;  4TUY A;  2IU0 A;  1M4U A;  4GT1 A;  5J2T A;  4ZHQ A;  1PNK A;  4JZ2 A;  1GAX A;  3O65 A;  3RYH B;  3I5D A;  3OE7 G;  1AIL A;  5EIB C;  5CA0 A;  2MW2 B;  4EB6 B;  3SPI A;  5LGN A;  1GN3 A;  3K79 A;  1MAB G;  4LH6 A;  1JX9 A;  5IYD O;  2RCV A;  1YZB A;  1DTO A;  1FPO A;  4UCS A;  3APQ A;  4X64 B;  2WAM A;  5BR8 B;  4DV4 B;  1ORQ C;  1RM1 C;  3SR2 C;  5FLX N;  1WAZ A;  1WN7 A;  2F23 A;  2FYU H;  3OGC C;  1H2L A;  1IBM B;  3E8G A;  3IFX A;  1K73 W;  2X6B A;  2EIM C;  3ZMZ A;  3PN1 A;  1Q8I A;  2B9Z A;  4J7Z A;  1V55 B;  4DR2 B;  2KG7 B;  4WFG A;  1VQ6 V;  2ATK C;  3K5L A;  5EK0 A;  1XBL A;  4X89 A;  4D7S A;  2EIJ C;  3A0R A;  1VQN V;  4CH4 A;  5CMU A;  3P30 A;  2DWE C;  4X1I A;  1OCC B;  1UJW B;  3CJH B;  4YJ2 B;  5DM6 V;  2H94 A;  1PD3 A;  3ABL C;  5EZY A;  4GX0 A;  1YTF B;  2WLH A;  4NXN O;  3NXS A;  3UO2 A;  1I94 O;  4JYA B;  1P84 F;  4UV8 A;  3L71 H;  5TIS Z;  1OCR B;  1RP3 B;  2CTQ A;  1TGO A;  2AW9 A;  4DK0 A;  5LP6 A;  3K58 A;  4B3T O;  4JI4 B;  3CXH F;  4AI8 A;  5KAF Z;  1W0K G;  1FD9 A;  1N36 B;  1QNM A;  4DR7 B;  2LFS A;  4P2Z A;  3KG2 A;  4WF9 V;  1K3E A;  4NTW A;  1YHQ V;  4UVB A;  3RYC B;  4WFB V;  2AXT Z;  4X62 B;  4IIJ A;  4X66 B;  3ETQ A;  4NXM B;  3SYC A;  1QCE A;  4FLU A;  3RYH A;  2P67 A;  2UXC O;  1K4C C;  4PDV A;  2K9P A;  3CCR V;  4EB6 A;  3ABK B;  1NR1 A;  1S3J A;  1MMM A;  1K33 A;  4OPH A;  2H3O A;  3E2E A;  4MTO A;  4GKK O;  1DF4 A;  4B3M B;  3T2M A;  2AGA A;  1HWY A;  1I5X A;  1P7G A;  3AG4 C;  3JAR A;  4LF4 B;  3I55 V;  3JAW A;  3F7Y C;  3OD4 A;  1F23 A;  4TT3 G;  4LFB B;  3J81 N;  3JYC A;  1SET A;  3CME V;  2EIN C;  5IJ9 A;  3OMA B;  1HR0 B;  1TUB B;  4CH5 A;  1VF7 A;  1K7D A;  1YJW V;  1SQV H;  3VQV A;  3WB1 A;  1R3K C;  5L3F A;  4B3R B;  1IUR A;  1M93 A;  3VBB A;  2Y0P A;  5LYJ B;  2XUM A;  1AJQ A;  4YHH O;  1MSD A;  3L9D A;  5BXZ A;  3E86 A;  1N0J A;  2KG7 A;  3FB6 C;  4U3J B;  5B5E Z;  4DR3 B;  4AQY B;  4IT5 A;  1XNQ B;  4K0K O;  1G1X B;  4PHZ A;  4WBN A;  1PL4 A;  3D36 A;  1VF5 B;  1JJ2 U;  1KB9 F;  3O9O A;  1SES A;  1Y74 A;  3LDD A;  3U10 A;  4AHC A;  1S5J A;  2E74 B;  5EYP A;  2JS3 A;  1P4R A;  2ZE7 A;  1HNZ O;  3BPZ A;  1M56 B;  3B77 A;  3KKY A;  1FKA O;  1W59 A;  2LP7 A;  3ZCC A;  3G71 V;  2OWO A;  1WPB A;  2HEP A;  2WLL A;  1SQG A;  3M99 B;  2P7T C;  4O4H B;  3TGU H;  2ZIN A;  3CWB H;  3GWO A;  1HNW O;  5J2U B;  4YXW G;  1D5N A;  3BAB A;  1IBK O;  5B1N A;  1V55 C;  1VF6 A;  5LL6 Y;  2OTJ V;  1KKC A;  2A0L A;  4CS2 A;  1NBM G;  2ITC C;  1NTM H;  4LF7 B;  3FAV B;  4JI7 O;  1IBL O;  2JJ2 G;  3JAK B;  3RYC A;  2LW1 A;  1K34 A;  3D36 C;  3CB2 A;  3U11 A;  4LF6 B;  1OCC C;  2CAZ C;  2AHY A;  2XAS A;  4HNA B;  2EZP A;  5KHI A;  4QNH B;  2BSK B;  2WA3 A;  2NR5 A;  1WA8 B;  3OR6 C;  4IL6 Z;  4G28 B;  2DE0 X;  1U97 A;  1TVK B;  3FD9 A;  1F7Y A;  5H9C A;  4BR6 A;  2DWD C;  3AG7 A;  4DR6 O;  2Q7G A;  4JPR A;  4OPA A;  5IDJ A;  2VS0 A;  4JI0 B;  2YS8 A;  5DEC A;  4WFA V;  3MHH C;  5LBQ A;  3OTF A;  3BAA A;  4MTG A;  1PNL A;  3CRM A;  1V54 B;  4WFE A;  5EBW C;  5DN6 G;  4J9Y B;  1VAR A;  5IWA O;  3JD0 A;  3EXA A;  1XMQ B;  3FYE B;  3OTO B;  1XRE A;  3DSQ A;  2M7W A;  4OX9 O;  3ABK C;  3OT7 A;  3CC2 V;  2IJI A;  4JAV A;  2A9H A;  4FZ1 A;  5IJ0 A;  3LDC A;  5K1P A;  1OHH G;  4NKG B;  3UT5 A;  1HP8 A;  4XDL A;  3MDS A;  4JI1 O;  4FPP A;  4X65 O;  1ZUQ A;  1SKV A;  3T1H B;  2GBO A;  2QKC A;  4FVM A;  1XHZ A;  1KC8 W;  3CRC A;  4EFE A;  2WLI A;  1BT8 A;  3WB0 A;  3RT3 C;  4MVS A;  4A5U B;  4LFC O;  5CBH A;  1J5E O;  1GM9 A;  4O4I B;  4ZI7 B;  3RVZ A;  4DR4 B;  5EC2 C;  4H0L B;  5D5P A;  2ZIO A;  2LGQ A;  2W6J G;  4I4T B;  4F6R A;  1F4M A;  4DV4 O;  4DK1 A;  3PJS K;  4PDM A;  2KB1 A;  4HYO A;  3FAV A;  1IBM O;  1GK9 A;  2CH7 B;  2DYR B;  3S3W A;  3QO8 A;  3MHS C;  4O4L B;  3X2Q B;  1CPY A;  2HLD G;  3CRR A;  1RPR A;  2X7R B;  1HDJ A;  2RNB A;  1F4N A;  3OMI B;  4XDJ A;  1W0J G;  2BSK A;  3E8H A;  3DXR B;  4QPK A;  1RSO B;  1Q7Y W;  1M56 C;  1WA8 A;  4N23 A;  3SJC C;  2V7Q G;  4N21 A;  2A3Q A;  2LFR A;  5JJJ B;  4QPJ A;  4UB6 Z;  1DF5 A;  3UCS C;  3OEE G;  1DLB A;  3H1I H;  3H9V A;  4X1K A;  4BIZ A;  1IVS A;  2Y48 A;  3T4Z A;  3SYA A;  1AI5 A;  3JAT B;  5H6R A;  3W7U A;  3WG7 C;  1H2S B;  1M57 B;  4KHP B;  1GN6 A;  3HKB B;  3ZRV A;  4F4L A;  2V4D A;  3CRQ A;  4FLV A;  3CEI A;  1ROP A;  3RFR A;  2ZE5 A;  3APO A;  3ZRS A;  2ODM A;  1QR8 A;  1X4T A;  2QWN B;  5CB4 B;  3CC7 V;  1S5H C;  1BHA A;  4U7N A;  4IYH A;  1E1Q G;  2UU9 B;  1MNG A;  1VIB A;  5EIB D;  4X20 B;  2R9A A;  1Q86 W;  1ZWI C;  1JFF A;  1SQF A;  1FYJ A;  1BE3 H;  2WLN A;  3ABM B;  4LFA B;  1SRY A;  5CA1 A;  3H1H H;  1H2G A;  2VQE B;  1HNX O;  1Q5O A;  2OT5 A;  1FFX B;  2Q73 A;  4RUE A;  2QKS A;  3JAL B;  4H37 A;  3OR7 C;  4R8C A;  3E8F A;  4JI6 O;  3THO A;  2DYS B;  4QIW F;  4GX2 A;  1JA8 A;  2JEU A;  1Z5W A;  2ZNJ A;  1WJZ A;  4O4I A;  4ZI7 A;  1AP5 A;  2ZE6 A;  1V54 C;  3UM7 A;  2GTA A;  4X9Q A;  1IDS A;  3W7T A;  4I4T A;  1T5E A;  2ILM A;  3RVY A;  2BTQ A;  1XI1 A;  3BCC H;  3OUS A;  2QWR B;  4MVZ A;  1R3I C;  4LF8 B;  3CS5 A;  2CH7 A;  1YSC A;  1VP7 A;  4O4L A;  4CZZ A;  3HKE A;  2O57 A;  5KHH A;  2WWW A;  3L74 H;  4JF3 A;  3CC4 V;  2A06 H;  3ZRW B;  3IC7 A;  5B1B B;  2Y0I A;  5FPO A;  4DR3 O;  3DXR A;  1RSO A;  3JD4 A;  2YIC A;  1QQC A;  1X59 A;  3BVO A;  1GM8 A;  3L72 H;  5L3C A;  5HFM A;  1VQK V;  1P7B A;  1ARO P;  2M6Y A;  1N34 O;  3L75 H;  2UXD O;  1E1R G;  1P49 A;  1R3J C;  1XQ8 A;  1S72 V;  4DR1 O;  2YI9 A;  1VQ4 V;  4IHJ B;  1BQ0 A;  1KYO F;  2R9I A;  4ZOL B;  1FJG B;  3T1Y B;  2FML A;  3HKB A;  4JZG A;  4J7J A;  4FLT A;  1VQP V;  1XHX A;  3CD6 V;  5C93 A;  2DYR C;  2UXB O;  3ETE A;  3LNM B;  1NH2 B;  3X2Q C;  2Q9L A;  3FYI B;  5C8Y B;  2UUA O;  3HR0 A;  2AHZ A;  1Z2G A;  4LWS B;  4OGQ B;  5CB4 A;  3AG3 B;  4JYC A;  5BY1 A;  2P5O A;  4BIU A;  4DV0 O;  3VQY A;  5LHH A;  5B1A B;  2ZD9 A;  4X20 A;  5CBG A;  1K5Q A;  1LNQ A;  2ITD C;  3OUF A;  1S77 D;  4DV6 O;  1F51 A;  1FFX A;  1QU7 A;  3JSL A;  4LC1 A;  3TJT A;  1H38 A;  5JVD B;  4JTA B;  1SS3 A;  5LOV B;  5B66 Z;  2DQ0 A;  2YC0 A;  2XT9 A;  1M57 C;  2HFE C;  3P3N A;  3K57 A;  4PA3 A;  2QTS A;  4DW1 A;  4DUY O;  3QVN A;  4MVQ A;  3VQW A;  2IJH A;  1K9M W;  2XAH A;  4PA6 A;  4UCO A;  4BIO A;  4EKW A;  4LF9 B;  4LNU A;  4JTD B;  5BZB A;  3CSX A;  4RWU A;  4LF5 O;  1FFT B;  3AK3 A;  3E22 B;  4YIP A;  1N33 O;  4O2A B;  2H8P C;  2QM4 A;  2IM9 A;  2Q69 A;  2ZM6 B;  1L0L H;  1FAF A;  2YIB D;  1IXB A;  3CCL V;  2KSD A;  3AG1 B;  3H01 A;  3ZN0 A;  4PI2 A;  1SZX A;  3R65 A;  1B06 A;  2ETN A;  2Q0A A;  3ZRW A;  1SQP H;  1WB8 A;  4DV2 O;  3ABM C;  3A8T A;  3N2K A;  4UXN A;  1WB7 A;  4UCV A;  2OTL V;  3L73 H;  4R6Z A;  1G4Y B;  3GB7 C;  1NVP B;  2HR3 A;  5CA3 A;  3K0G A;  4JI3 B;  1BSM A;  3OTO O;  3FB7 C;  4YJ3 A;  3MAQ A;  4TV9 B;  2DYS C;  3K5N A;  4JGS A;  2UXX A;  1XDC A;  4X1Y B;  4JYB A;  1D5A A;  2RMK B;  2YIB A;  2LGW A;  2N04 A;  3T4D A;  3L70 H;  2DOS A;  3D3I A;  3HKD B;  3JD2 A;  3K0D A;  2ZIM A;  3A0B Z;  4MVR A;  4J9Z B;  4IHJ A;  1AR1 B;  4ZOL A;  4ZKI A;  4GKJ O;  2JK5 C;  4LR3 A;  2UUB O;  1U96 A;  4J10 A;  4DV3 O;  3T1H O;  1JMK C;  3GVM A;  2Q67 A;  3LSU A;  3I56 V;  2B5U A;  1MSW D;  2PI4 A;  4MTX A;  4W4K A;  5C8Y A;  2QJ1 A;  2HHH B;  4LWS A;  4DR4 O;  1SZT A;  2ZNI A;  3JAS B;  1O9H A;  4JI8 O;  5ITZ B;  4DV1 B;  4RO2 A;  5B1B C;  4ICG A;  1GRJ A;  4XDK A;  3K5M A;  3J80 N;  2ADQ B;  3C3T A;  4I5S A;  2QWQ B;  4BW5 A;  1XMO O;  4PDL A;  4D6T H;  1R6K A;  3ML0 A;  1KBH A;  1JOY A;  1YTF D;  5LMU B;  4JI2 O;  3RN4 A;  4WFH A;  2HJD A;  4UCU A;  1QBZ A;  2PUS A;  5JH7 B;  4U3F H; 
#chains in the Genus database with same CATH homology
 4JAV A;  4X8A A;  1GKF A;  2Z3Y A;  4PDR A;  2A9H A;  3F5W C;  5LHI A;  1Y66 A;  1JPX A;  3LDC A;  5B3S C;  5LHG A;  1OHH G;  2JIZ G;  4PEL A;  3JD3 A;  2IH1 C;  4ASU G;  2EBO A;  4XBF A;  4QE9 A;  4FIP C;  3B8N A;  4XDL A;  1NVP D;  1SER A;  4PA9 A;  4LCU C;  4LP8 A;  4WCE V;  1OCO B;  3CCV V;  3G4S V;  1CP9 A;  4CBC A;  4FPP A;  1KEC A;  3SPH A;  2X6C A;  1YJN V;  4RUF A;  5L3E A;  1KC8 W;  4GCZ A;  1TUE B;  1FXK B;  4KFM A;  2WLI A;  2WLJ A;  3AG3 C;  2F43 G;  3P32 A;  3QNE A;  2Q6A A;  4MVS A;  5CN0 A;  2OCC C;  2HKO A;  3HB3 B;  5CBH A;  1GM9 A;  3RVZ A;  5EC2 C;  5B1A C;  5EBM C;  3OM3 B;  2ZXW B;  4X88 A;  3SPC A;  2W6J G;  1IXM A;  1F4M A;  5EC1 C;  3WG7 B;  1THZ A;  3STZ C;  3SJQ C;  1NR7 A;  3G6E V;  3SPG A;  1GMG A;  1JCH A;  3E83 A;  3AG4 B;  3PJS K;  4PDM A;  2WLL B;  2KB1 A;  4HYO A;  3OMN B;  2QM7 A;  1W2B U;  4FMT A;  5IY5 B;  1GK9 A;  1I5Y A;  2DYR B;  2YSU B;  1VQM V;  2X0L A;  1FXV A;  1QLE C;  3LDE A;  3QO8 A;  3MHS C;  3ZIA G;  2DQ3 A;  3X2Q B;  1PL0 A;  2EIN B;  3STL C;  1CPY A;  2IU3 A;  4JAS A;  4MW3 A;  4FJC C;  2HLD G;  2JDI G;  5IYB O;  4LBE C;  1NH2 D;  1RPR A;  2QE7 G;  2X7R B;  4KUM A;  1VQL V;  2WSS G;  2XAG A;  1F4N A;  3K9A A;  2Z5U A;  3OMI B;  1EFR G;  4XDJ A;  4E2L A;  1OCZ C;  1W0J G;  3JD1 A;  5L3D A;  3E8H A;  4QPK A;  3K3W A;  1Q7Y W;  1M56 C;  1WLE A;  2WLK A;  4N23 A;  2V7Q G;  3RBZ A;  4N21 A;  2LFR A;  1GTO A;  2IU0 A;  2EJR A;  1OZ0 A;  1GO3 F;  4QPJ A;  3ZMS A;  4GT1 A;  1DF5 A;  1PNK A;  3OEE G;  1DLB A;  3CMA V;  2B1G A;  2IH3 C;  1BHB A;  3OE7 G;  3OFN G;  2Y69 C;  2W0F C;  3SPI A;  2A79 B;  4BIZ A;  5LGN A;  3K79 A;  3AG2 C;  4QE7 A;  2Y48 A;  3T4Z A;  1MAB G;  3E8B A;  1JX9 A;  3AG1 C;  1AI5 A;  3SYA A;  4R50 A;  3CCS V;  1M90 W;  5H6R A;  3W7U A;  3WG7 C;  5IYD O;  5KA5 A;  1M57 B;  4JTC B;  1H8E G;  3W7S A;  1DTO A;  1L1F A;  3ZRV A;  3LSQ A;  1AI7 A;  4F4L A;  2WAM A;  3W7W A;  1COW G;  1ORQ C;  1RM1 C;  3ZMT A;  3DGE A;  1ROP A;  2HG5 C;  5HFL A;  3ZRS A;  2YEV B;  1H8H G;  1WPX A;  1MG1 A;  2IJJ A;  1QR8 A;  3OGC C;  2QA4 V;  3CP1 A;  3E8G A;  3IFX A;  4GX5 A;  2UXN A;  2W6I G;  3CC7 V;  1K73 W;  2JEX A;  2R9R B;  1S5H C;  4DXW A;  3ABT A;  3ZMU A;  1N8R W;  2X6B A;  1BHA A;  4U7N A;  1E1Q G;  2EIM C;  3ZMZ A;  1Q86 W;  3MD0 A;  1ZWI C;  1V55 B;  3VOU A;  4MW8 A;  2WLN A;  3K04 A;  1K4D C;  4MVO A;  3ABM B;  1SRY A;  3ASN C;  4WFG A;  1VQ6 V;  1M9N A;  2EIL B;  1H2G A;  2ATK C;  1KD1 W;  2JJ1 G;  3ASO B;  1K97 A;  2OT5 A;  2EZO A;  5EK0 A;  4X89 A;  5CBF A;  3FKS G;  4RUE A;  2QKS A;  4H37 A;  1JQ0 A;  3CCQ V;  3CCM V;  3OR7 C;  4R8C A;  3E8F A;  2EIJ C;  3A0R A;  1VQN V;  5CMU A;  2DYS B;  3P30 A;  4KP4 A;  4U7O A;  2DWE C;  4QIW F;  1RPO A;  4GX2 A;  1OCC B;  2JEU A;  1NKD A;  1FXK A;  4HZ3 A;  1UJW B;  5IYC O;  2P90 A;  5DM6 V;  1Q81 W;  5KA6 A;  2GHY A;  2H94 A;  2ZR2 A;  1PD3 A;  4FK5 C;  1V54 C;  3UM7 A;  1NJI W;  3ABL C;  1R73 A;  1MOF A;  4GX0 A;  1YTF B;  2WLH A;  3W7T A;  1XL6 A;  1AI4 A;  3RVY A;  1BMF G;  3NXS A;  4PA7 A;  3LUT B;  1YIT V;  3OUS A;  3F7V C;  4UV8 A;  2CK3 G;  4MVZ A;  1OCR B;  1R3I C;  2WLI B;  3OAA G;  5KUM A;  1YSC A;  3WFV A;  4CZZ A;  3ZJZ A;  1XL4 A;  4MVU A;  2WWW A;  3JCZ A;  4JF3 A;  3CC4 V;  1KKD A;  3ZRW B;  3IC7 A;  1W0K G;  4QJF B;  4JAU A;  1EZJ A;  5B1B B;  3TCU A;  3ETD A;  5E1A C;  2LFS A;  4P2Z A;  3KG2 A;  4WF9 V;  1K3E A;  1AI6 A;  3T1C A;  2PI5 A;  2P6J A;  5EBL C;  4UVB A;  4TWK A;  4WFB V;  1YHQ V;  3JD4 A;  3CYO A;  3RW0 A;  1S0V A;  2XND G;  1OCO C;  2GSM B;  1GM8 A;  1QCE A;  3SYC A;  5L3C A;  3SYO A;  5HFM A;  2P67 A;  2XAJ A;  2EIK B;  1VQK V;  1FXK C;  1P7B A;  1ARO P;  1K4C C;  4PDV A;  3CCR V;  3OW2 U;  3SPJ A;  2K1E A;  3EHB B;  3ABK B;  5B1O A;  1E1R G;  1NR1 A;  1KP2 A;  4G2K A;  1S3J A;  1K33 A;  1R3J C;  3E2E A;  1S72 V;  4MTO A;  1Y4M A;  3FB5 C;  1DF4 A;  4UVC A;  3ZN1 A;  4GX1 A;  2ZXW C;  1VQ4 V;  3T2M A;  2R9I A;  1FS0 G;  1HWY A;  2ZR3 A;  1CEZ A;  5B3S B;  3CPW U;  1I5X A;  3AG4 C;  1AJN A;  1R6N A;  5IY5 C;  3I55 V;  1OCR C;  1VQP V;  4Z1M G;  2WLM A;  2HVK C;  1VQO V;  3CD6 V;  3F7Y C;  2DYR C;  3E35 A;  5C93 A;  1F23 A;  3ETE A;  3LNM B;  4TT3 G;  4G27 B;  4BAY A;  3JYC A;  3X2Q C;  1NH2 B;  1SET A;  3CME V;  2EIN C;  3FYI B;  1M1K W;  2YEV A;  3OMA B;  5J9P C;  2AHZ A;  1YI2 V;  1ENV A;  1K7D A;  1YJW V;  3AG3 B;  4JYC A;  1R3K C;  5L3F A;  3K08 A;  4BIU A;  2OCC B;  2HJF C;  3VBB A;  5LHH A;  3TK1 A;  5B1A B;  1YJ9 V;  2ZD9 A;  2Q68 A;  5CBG A;  1K5Q A;  1VQ7 V;  1QR9 A;  3UKM A;  1AJQ A;  5LGU A;  1K5S A;  4UVA A;  3E89 A;  3E86 A;  1GM7 A;  1LNQ A;  2ITD C;  1QLN A;  3FB6 C;  3FB8 C;  3OUF A;  2IJK A;  3ETG A;  1S77 D;  3K03 A;  2XOK G;  1K8A W;  3QO5 A;  4R7C A;  2NNU A;  1F51 A;  1QVG U;  3D36 A;  1JJ2 U;  1QLE B;  1B6Q A;  1SES A;  3LDD A;  4LC1 A;  3ZRX A;  4RQE A;  1H38 A;  2QM8 A;  2MK3 A;  4JTA B;  1P4R A;  4OXS A;  2DQ0 A;  4ZBM A;  1M57 C;  2HFE C;  1OCZ B;  1PNM A;  4PA3 A;  1Q82 W;  2WPD G;  4PA4 A;  2NLJ C;  1M56 B;  3B77 A;  5KUK A;  4MVQ A;  2IJH A;  1K9M W;  2XAH A;  4PA6 A;  2LP7 A;  3ZCC A;  4EKW A;  3G71 V;  4P9O A;  3K06 A;  4JTD B;  5BZB A;  2B1I A;  2IW5 A;  1FFT B;  1KQS U;  2DW4 A;  2WLL A;  3M99 B;  4MSW C;  3LSS A;  2P7T C;  1VQ9 V;  1BL8 A;  3TET A;  3SYP A;  4P9P A;  2H8P C;  4DO2 A;  2HVJ C;  2Y69 B;  3CXC U;  4UUJ C;  2Q69 A;  3GWO A;  3ABU A;  1S76 D;  3AG2 B;  3BEH A;  4YXW G;  1QVF U;  3CCL V;  1VQ5 V;  3AG1 B;  3H01 A;  5B1N A;  3ZN0 A;  2D3O W;  1VQ8 V;  3R65 A;  1KP3 A;  1V55 C;  5L3B A;  3ZRW A;  4MT8 A;  5L3G A;  2OTJ V;  2A0L A;  2X6A A;  1NBM G;  2ITC C;  3ABM C;  4UXN A;  4HAM A;  2EIL C;  2ZQM A;  2OTL V;  4R6Z A;  1G4Y B;  3GB7 C;  4UV9 A;  1NVP B;  3ASO C;  2HR3 A;  5CA3 A;  2JJ2 G;  3K0G A;  1K34 A;  2BOB C;  1RM1 B;  3FB7 C;  4WFF A;  3CCU V;  1PKX A;  2DYS C;  4JGS A;  2UXX A;  2ZDI A;  4JYB A;  1OCC C;  3W7X A;  1YIJ V;  2AHY A;  2XAS A;  3CCE V;  2EZP A;  2EIM B;  3T4D A;  1EBO A;  2BOC C;  3D3I A;  4QNH B;  5LGT A;  3JD2 A;  3K0D A;  3DTU B;  4RAI A;  4J9Z B;  3OR6 C;  4MVR A;  1AJP A;  3AEI A;  4G28 B;  1NQT A;  3EFF K;  3HPL C;  1AR1 B;  4ZKI A;  2C2A A;  3ASN B;  5H9C A;  2JK5 C;  4MTF A;  2DWD C;  3BY6 A;  4TSF G;  5GW7 A;  1G8M A;  2Q67 A;  1FXH A;  3I56 V;  4P30 A;  2B5U A;  4JPR A;  1MSW D;  2PI4 A;  4MTX A;  2EIJ B;  5IDJ A;  1R3L C;  2XAQ A;  1SZT A;  2XAF A;  3ZMV A;  4WFA V;  3MHH C;  4H33 A;  4I9W A;  4MVM A;  5LBQ A;  4RO2 A;  5B1B C;  4MTG A;  4XDK A;  1PNL A;  1E79 G;  4I5S A;  1V54 B;  3IGA C;  2V1D A;  4BW5 A;  3ABL B;  4MS2 A;  4WFE A;  5EBW C;  5DN6 G;  4PDL A;  5FL7 G;  1R6K A;  5H6Q A;  3SYQ A;  4J9Y B;  3ML0 A;  4L87 A;  1JOY A;  1YTF D;  4Q20 A;  4RQF A;  2QTO A;  3JD0 A;  2FTK A;  1JVM A;  2ZDI C;  4WFH A;  3FYE B;  2EIK C;  2M7W A;  2QEX V;  3OEH G;  1QBZ A;  3ABK C;  3QO7 A;  3CCJ V;  3CC2 V;  3B8M A;  2IJI A;  1J95 A;  1K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...