1J96A

Human 3alpha-hsd type 3 in ternary complex with nadp and testosterone
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
323
structure length
323
Chain Sequence
DDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3alpha-hydroxysteroid dehydrogenase type 3
publication title Structure of the human 3alpha-hydroxysteroid dehydrogenase type 3 in complex with testosterone and NADP at 1.25-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1j96A00
1M9HA 5KETA 4WDXA 3R43A 4XZNX 1XF0A 1VP5A 2PDCA 4QR6A 1PZ0A 3R94A 5AZ0A 3LZ3A 2IPGA 1LQAA 2F2KA 4IJRA 1IEIA 5HNTA 2NVCA 4XO6A 1UR3M 1AH4A 2PDPA 4YVPA 3UP8A 4PUUA 3LUTA 3LEPA 3KRBA 4EXAA 2DUZA 3V35A 4XZHA 2IPJA 3Q65A 4WEVX 3UZYA 4JTRA 1HW6A 3V0TA 3F7JA 3MC5A 4DZ5A 1QWKA 1PWLA 4JTAA 3M4HA 4YVXA 4JQAA 3WBXA 2HEJA 2IQ0A 1S1RA 4QX4A 4JTCA 1AZ2A 1XGDA 1YE6A 2PDWA 2IPFA 2IKGA 4HMNA 4QXIA 3LQLA 2HVNA 4PRTA 3H7UA 3FJNA 3G5EA 3H7RA 3G1RA 3UGRA 4JQ4A 2INEA 1RALA 1T41A 4Q3MA 3UZZA 3R8HA 2FVLA 4LB3A 1Q13A 2WZTA 3R7MA 4FZIA 3N6QA 1PWMA 2VDGA 2PDHA 4WDTA 2ALRA 2PDBA 3CV7A 1XJBA 4Q7BA 2PFHA 1IHIA 1ZQ5A 2ACUA 4DBWA 3T42A 4GQ0A 3BCJA 1ADSA 3UFYA 5LIWX 2PDXA 2PDNA 4L1XA 3FX4A 4H7CA 4DBSA 1YNQA 2FZ8A 2PDJA 4FALA 4MHBA 1S2AA 1QRQA 3S3GA 1FRBA 5LIXX 4PR4A 2PEVA 2QXWA 4GA8A 4WRHA 1R38A 1Z89A 1ZUAX 2IKHA 3NTYA 3U2CA 3P2VA 2FZBA 4XZLX 5LIKX 2PDUA 3R8GA 2BP1A 4YU1A 3N2TA 4R9OA 4JTDA 2FZDA 5HA7A 4ASTA 4WDWA 3CASA 2ISFA 3WBWA 1RY8A 4OTKA 4WDUA 4XVDA 4JIIX 5C7HA 2IPWA 3CAVA 3LZ5A 4PUWA 2FZ9A 3QKZA 3EAUA 4L1WA 4JTQA 3CMFA 1YNPA 1X98A 3H4GA 3GUGA 2PDFA 1ZSXA 1T40A 2R24A 2WZMA 3GHTA 2NVDA 4ICCX 3MB9A 2PDYA 1MRQA 3R6IA 3BUVA 5M2FX 3DOPA 2IKIA 4LAUA 1X97A 3R58A 4EXBA 1JEZA 5JH1A 4G5DA 3UYIA 4XK2A 2DV0A 3O0KA 2HE8A 1MI3A 5LIYX 1S1PA 2R9RA 2PZNA 5HNUA 1Z9AA 2PD9A 4RPQA 2IQDA 3CAQA 1AFSA 1A80A 2I17A 4JQ3A 1Z8AA 3M64A 5DANA 3WCZA 4JIRA 1PZ1A 3V0UA 2PDGA 4FAMA 3LBOA 2PDQA 1SM9A 1EKOA 1Z3NA 2C91A 3ONBA 2IKJA 3GHUA 3UWEA 4FA3A 3Q67A 4GIEA 4JQ2A 1MZRA 4HBKA 4XZIA 4GQGA 1AH3A 1RY0A 3LNMA 1Q5MA 4YVVA 3EB3A 3CV6A 1X96A 3C3UA 2HVOA 4YS1A 4XO7A 1AZ1A 2ACQA 3UZXA 3EB4A 2BGSA 3DN5A 1VBJA 4LB4A 3VXGA 2F38A 3UZWA 2CLPA 5JH2A 1S2CA 2FGBA 4JIHA 1GVEA 4LAZA 1HQTA 1K8CA 3M0IA 4GABA 4GACA 2I16A 4PMJA 2IS7A 3GHRA 1PYFA 3UG8A 2PDLA 3BV7A 3BURA 3V0SA 2HV5A 3O3RA 1US0A 5LIUX 4PRRA 2J8TA 4XZMX 3RX3A 3RX4A 1C9WA 1YE4A 4I5XA 3WG6A 3ONCA 5AZ1A 3V36A 3B3DA 4F40A 4WGHA 3LN3A 4AUBA 2PF8A 1EF3A 2A79A 3COTA 2HDJA 2ACSA 1OG6A 2DUXA 4XVEA 4H8NA 2PDMA 3LQGA 3LD5A 1AH0A 2PDIA 4NKCA 2PDKA 3LENA 4LBSA 4JQ1A 4IGSA 1ZGDA 1EXBA 1EL3A 3ERPA 2ACRA 4DBUA 4GCAA 4QBXA 4IJCA 3WBYA 4ZFCA 2HE5A 2P5NA 1J96A 4XAPA 3RX2A 1LWIA 2PD5A 2INZA 3D3FA 2BGQA 3GHSA 2AGTA 4LBRA
chains in the Genus database with same CATH superfamily
2KAUC 3RFAA 4XSMA 2HRWA 3C8NA 1JPMA 3TA6A 3R43A 4AZ7A 2J9ZA 1UASA 1EX5A 2EPLX 2GQAA 2P88A 3GH5A 2PDCA 4UOZA 1PZ0A 2ZZ5A 4D71A 3R94A 1KWKA 5IHRA 3S6TA 1NQKA 3IIZA 1XW8A 3W23A 1J5SA 1OFEA 3E49A 4L9ZA 4LEQA 3RPDA 2VM8A 4HHMA 4MYXA 1H2JA 5LGXA 3ARXA 4NZJA 3KTXA 4PUUA 3GNPA 1I2RA 1XQLA 1DTUA 1ZZMA 4S2BA 5I3HA 4DJEC 2OYMA 1XKYA 3BAJA 2XU2A 3KL3A 3QEZA 3CWOX 3D3AA 3RXZA 3PC0A 4QLLA 4OT7A 1A0CA 3WH6A 2TPSA 4PL2A 3MMWA 1TQJA 3CYJA 2OZTA 4Z2GA 1JZ5A 3DERA 2P0IA 1S5NA 3VOIA 2WMGA 4GZJA 2H9AB 4QITA 3VKAA 4NZ5A 5I5RA 5A94A 3H7RA 2YXGA 3MHFA 2XH0A 3THQA 3HN3A 4KGLA 4I6KA 4N02A 1NF0A 5F2GA 4GZIA 1V6UA 1DOSA 2E40A 3T09A 2A2IA 3EDJA 4UOJA 4E2OA 1D7KA 2Y5EA 3VCNA 2PDBA 3AU6A 2WHJA 4Q7BA 1LYXA 2ACUA 2PRLA 3L4VA 3FXYA 5CAHA 1UZHA 3QKEA 1M6JA 2ZZ6A 4HSHA 3L0GA 4J3WA 5EBAA 3DG7A 5ABEA 3VABA 3VD7A 2AMXA 1QO5A 3RCMA 3UNTA 3BG3A 4GA8A 1B3WA 4YNGA 3CHCA 2WCAA 3JS3A 3USZA 3OYXA 3FHAA 4WK9A 3AOFA 5KITA 2XFYA 3F4WA 4JTDA 1V3JA 4WOQA 4IIHA 3ZZ1A 4KCUA 3DHFA 6XIAA 3I6TA 5HINA 1RY8A 4S1FA 2RDXA 3ZJKA 1J11A 3B4UA 2CLLA 3VGHA 4JYDA 1QVBA 4O12A 3PTDA 4H8VA 4YTQA 3WQ4A 4UQEA 5MF5A 3VMPA 4E2DA 5EMYA 1V7AA 1IZKA 1JIBA 1GYLA 5ABFB 3ARRA 3HV8A 1Q6OA 1I2PA 1ZBWA 2H6RA 4IMFA 5H6HA 3TQKA 4RE2A 3H4GA 4PMQA 3LHYA 4AZBA 4BF5A 3AICA 1MNSA 4O17A 3I7QA 4PB5A 2OZ3A 4GVGA 1A4MA 3TTYA 1H7OA 1J18A 1EJRC 3EX2A 3KFTA 5M2FX 1HO4A 3TYCA 3I10A 3M7SA 3OZPA 1IXNA 3R58A 6REQB 4HHHA 3UY7A 1JQXA 1O7AA 3AXMA 5KZDA 2PCEA 1R6WA 1ZB5A 2ZOXA 3VKKA 3EDEA 5LIYX 3S2CA 4L4OA 3BOXA 3KRUA 2PZNA 1G5AA 4S38A 2ZE0A 3UG3A 4XWUA 1DQWA 3VE7A 3QXBA 1S5VA 1FY6A 1QPKA 4IFOA 3W2LA 3NZGA 3ZOAA 1R47A 1T7LA 4W8LA 3NQCA 4B9ZA 4JTKA 2OSWA 4Q7IA 2X40A 3E9AA 1V3IA 1LOQA 1YDYA 3AMLA 3T0AA 2ZA3A 5J04A 4DJFC 3VZYA 4OVXA 1EGVA 3RR1A 3CQKA 4A8RA 2J7GA 4KKXA 3O16A 3CUFA 2OGYA 4DM1A 2GGEA 3FYPA 4H1ZA 3UWEA 2Z2AA 3Q67A 5FJOA 3UWVA 1OGBA 2YBUA 1SSDA 1NFGA 2OLSA 1BXBA 3MUAA 3NQVA 2ZBTA 3TNOA 4AISA 1Q8AA 2WNWA 2AL2B 1QPNA 1JQVA 3A3XA 5E70A 5C0QA 3EB3A 2VR4A 3BICA 1MVYA 2G5WA 4HB7A 5G2HA 4HK6A 2ACQA 2QPXA 4IQDA 4ZXLA 3ZLFA 5KTLA 1EDTA 3N6JA 2WV8A 4JFSA 5T9CE 2V8ZA 4XZ9A 2VEGA 3LX9A 4K8HA 2WSYA 1PEZA 3W70A 3SCQA 4ACZB 2RGLA 1H3GA 1I9CB 1W9BM 4L80A 2F8QA 3IWPA 1GOMA 1W1TA 2FGBA 3HV9A 1IWBA 4QSHA 2Z29A 4ECLA 4Q8TA 3NM1A 1GVEA 2R1NA 5AHMA 3TXZA 1GVFA 4N0RA 4UWMA 4HT3A 2OX1A 3HG3A 4HNNA 2J9XA 3FA5A 1KA9F 3O3RA 2V5BA 4PTMA 2J8FA 2Z2BA 5CGQA 4BI6A 2OQLA 4D6HA 3TCEA 4A05A 3OVPA 3NQGA 1PE1A 3UR8A 1GKPA 5FI8A 5D03A 2YZRA 2VC6A 1TUFA 4RLIA 3VIFA 1DIDA 4LUSB 3EX3A 1PIGA 4R5EA 4TMCA 3QHMA 2PLKA 4BQ4A 1HG3A 4GH1A 2NQLA 4I7UA 4GBDA 4X60A 1RAKA 4NRSA 1H63A 3FXGA 4DELA 3FJLA 3GKFA 4NNAA 5CBBA 3PJUA 3VKJA 1BXNA 3LPGA 4B91A 4DXKA 5C9ZA 1U83A 4UUIA 5D2YA 1UKOA 4ZFCA 2E7FA 4S3DA 2P0OA 3R10A 4YHGA 3TWAA 4JIEA 3TW9A 1TWIA 1GOWA 3GNDA 3WDHA 1I75A 2PTXA 2HBVA 1ZBVA 3D3FA 1FXQA 4AW7A 2OT1A 2X42A 2ZADA 1SR9A 3S46A 4BWLA 3KHDA 1ECQA 4ZE4A 1JUEA 3BOFA 3WH8A 1NAL1 3WH5A 3MUZ1 2Z1VA 2YLAA 2ZRWA 4P8WA 3L5MA 3PWAA 3G1YA 3AIBA 1VFTA 2GJXB 5AKQA 1ADOA 4YMZA 5AZ0A 2Z00A 3MS8A 2GVJA 1RA5A 4PUJA 1LZOA 1REQB 4AX7A 3PR2A 2PB1A 1P0KA 5JBFA 3C5QA 3W29A 3W7GA 1PKMA 5HNTA 1MEWA 2E28A 2VTFA 3VGBA 5BZAA 4PCFA 4OUIA 2DJLA 5I06A 1V0KA 1CT5A 3VX1A 4PCTA 1LRQA 3KDNA 4CCEA 2XIMA 1D7FA 2WKJA 4LVGA 2DJXA 3BC9A 3S2LA 2JF6A 2FB2A 4C6PA 1J10A 3H2MA 2P3ZA 3B9NA 2DZPA 2DQXA 3M4HA 2E3ZA 5IOBA 3JU2A 3WBXA 1K6WA 4H6KA 3KBWA 3U6WA 2FJUB 3K4WA 3TDFA 4PEEA 4Y9OA 4HZMA 1XLIA 1JPHA 3CPRA 5DY3A 3CIXA 4KWOA 2SFPA 1X6UA 3FJNA 4CVUA 5FA5A 2XSAA 3BLFA 4AFYA 4LW7A 1VENA 3A22A 4PTWA 1KO0A 4AEOA 3PTMA 3GR8A 2VDGA 4KEVA 1P1XA 4AWEA 3ZLGA 4JAWA 1WDWA 2W5FA 3FNDA 2FH8A 3APYA 3VKCA 3WLIA 1XJBA 1Q6LA 1I4NA 4YTUA 3EWYA 2NV9A 3J7HA 3S5NA 3SRFA 1XPGA 3DX5A 4L1XA 4H7CA 2GDUA 4DBSA 3WH7A 3RO6A 3R12A 4O10A 1KM3A 3S1UA 4RV8A 2YX0A 3QY6A 1R9YA 2WKGA 4E8GA 4I3GA 3U57A 3W84A 3NTYA 1GKRA 4GUHA 4M7TA 4Q4PA 2EG7A 3H24A 3L4WA 1WA3A 3CPGA 3WQWA 2VFEA 4GXMA 4FLOA 4K68A 1WUEA 2VFGA 4CU6A 3TKFA 3ABZA 3F2CA 1AQ0A 3VO0A 2J8GA 3SCVA 2DSKA 3U7VA 3LI1A 2D2GA 4RE4A 2OTDA 1CGYA 5C7HA 4LWWA 1XGEA 1WXZA 1EYEA 3LZ5A 4F2TA 2PWEA 1KM1A 4L1WA 4XTDA 4HNVA 4R33A 4LUTB 1Q6CA 3LI0A 4C6JA 1GOQA 3UY8A 5AYBA 2HXUA 1B31A 4JX4A 3FS2A 4H9UA 2Z1KA 1AK5A 4AXKA 1VBRA 3G77A 4GI4A 3ARTA 3NZQA 4W5UA 4V27A 2QJHA 2NWSA 2QT3A 3AS3A 1QK0A 4CCDA 2QF7A 4OV4A 3PP7A 4PCPA 3LHWA 3GRIA 3LTSA 1IXOA 3VDHA 3WDRA 4DVOA 4HNOA 3VNMA 4U31A 1SJBA 5LGZA 4BF7A 2R14A 1W5NA 3SO7A 3AXHA 2X16A 2NQHA 3WL0A 2EPNA 2V69A 5FJIA 4EE9A 3CWNA 4DUXA 1UUOA 4UQCA 3SAZA 1Q6DA 2XG9A 2I17A 1YXCA 1VFMA 3UCQA 4AH7A 1E4IA 1XR2A 2OPJA 1W9PA 1V6WA 3NDYA 1FHVA 2ZC8A 1RP8A 2FH6A 3DU0A 3LBOA 1RXOB 4PYSA 1XLMA 1IR1A 1YDVA 5FJRA 3PBMA 4WKAA 2QDGA 3BAXA 3MVTA 1EJWC 3A4AA 1BYCA 2NT1A 1YKWA 1I2NA 1RA0A 4W7UA 4ZOEA 2PI6A 3GG1A 3S42A 1OCNA 4M6PA 4YVVA 1T99A 3CUIA 3PSVA 3W0KA 2HVOA 4O4WA 4UTWC 2CZFA 4RNJA 5I00A 3MO7A 5AECA 4MKSA 3OG2A 3W2MA 3N11A 1E4LA 3UZWA 2WBKA 3G3DA 4NHVA 3T78A 3PSWA 1UJPA 3N9SA 3BQ6A 1N55A 3WLOA 1KXHA 1PHWA 3N04A 3E2QA 2OZ8A 4KS0A 4L65A 1NP0A 2EKGA 3E1F1 1CGUA 3HO8A 3NQEA 1Q6QA 2EJ1A 3ENLA 1K4GA 3C6CA 3W7PA 1PAMA 4IPNB 4G9PA 1VEOA 1ADDA 4MWAE 1JNEA 2ZXAA 1Y65A 5I78A 4ZB2A 1TSIA 1PX8A 3W53A 1EJSC 1DJHA 3SCWA 4Z17A 1NOWA 2YBTA 3MPGA 5F4WA 1JJKA 2ACSA 1NOUA 2DUAA 1FXPA 1DV7A 1S2TA 2A3HA 4Y90A 4O8RA 1N82A 2XGBA 2ASHA 2BVDA 4LU0A 3UWWA 4OZOA 1EGMA 2PAJA 3PUEA 4Q7NA 5FESA 3PZMA 1DKWA 3GSMA 4JHZA 3TONA 5CBJA 1TIWA 1YXDA 3WBYA 2A7NA 1MSSA 4JTFA 1JPIA 1Z69A 5AVNA 4A3QA 4K3ZA 5FF7A 1XLKA 3GZ3A 5D9NA 1XIHA 5D9OA 2XN2A 3ZFHA 4H6EA 2XYLA 2C18A 3E2RA 2AGTA 3ITGA 2OR2A 1IZCA 1R8LA 5KETA 2A85A 1VBHA 3WQDA 5I3KA 3LMYA 1KB3A 4PCSA 1BYBA 3ZMRA 3PFMA 4C6DA 2ZC1A 1UPMB 4QQUA 1TZ7A 5EA9A 1E9LA 2PA6A 3QZEA 3G18A 3CZ8A 3KAOA 4O8AA 4E5TA 4IJRA 1IEIA 1NQ6A 2NX9A 2VXNA 3CO4A 2NVCA 1OM0A 1VEMA 1EJUC 3QYSA 3C2YA 1DJQA 2XVKA 4JR5A 3NGJA 1HW6A 2NW0A 1O5XA 4J3TA 3HPAA 1EUAA 3M0VA 4S39A 2EEXA 4DZ5A 1QWKA 4HJWA 5DN1A 1IWPA 3QQ0A 4A29A 5JIPA 4C60A 3REQA 1CGXA 1BHGA 2VC9A 1L2QA 1AZ2A 4HNCA 2CERA 4J9JA 2BXVA 1FCUA 2Z1SA 3MQTA 3CJPA 3UW6A 2PDWA 3EPOA 2BVTA 2TSYA 1VYSX 3TXVA 4B92A 1GOOA 4TTUA 2INEA 1RALA 2E6AA 4MYAA 3EX1A 4UTHA 2F6UA 3NEHA 3PNUA 1JZ2A 2VEKA 4IUOA 3T0CA 4FB7A 1A3HA 1R87A 2DZUA 2PC4A 4FZIA 3WQ6A 3QYQA 5CC7A 2A3LA 1V08A 2WC7A 1B5TA 4RZBA 2CHNA 3NL2A 1UD8A 1G7VA 5BROA 3C61A 3S1VA 3B8WA 2OELA 4LS0A 2E1WA 2YGYA 1P48A 4F0SA 1WKDA 1YTEA 4PA8A 2PWFA 3TZNA 2DW7A 2YPIA 1TJPA 2Y7GA 3ITYA 4ZMGA 2WVTA 4DJEA 2YW4A 3BCFA 5I2UA 3DENA 1LOLA 1R38A 5BXPA 4TO8A 2YCLA 4Q4KA 4HK7A 2P76A 3E5PA 2WHMA 3RNDA 2R1LA 4JHMA 2BP1A 2OYLA 5FEPA 4O18A 1NWUA 1VF8A 4R88A 3N2TA 2W4XA 1S3HA 1CLVA 4TQTA 5HA7A 2W3ZA 4B4HA 2WSQA 3TSDA 2Z6JA 4N9EA 1OC6A 3UA3A 3EA1A 3R89A 1X38A 3VD5A 4XG1A 4YHEA 4J2PA 3NJ3A 3KOXA 1DJNA 4Q8UA 1FWEC 1AJZA 4GFSA 4FOJA 3HIJA 1EF2A 3LV6A 3NR0A 3L4XA 1WKEA 1CCWB 4AEFA 3DKLA 4W93A 2I9EA 3A21A 4JYEA 4Y2WA 5KEZA 3HPSA 1NVMA 3SN1A 5D2WA 5J8LA 2V67A 4I7WA 2NUWA 1HVQA 4NZFA 2ABBA 4HNUA 5IDZA 3K8LA 4MG4A 3QOKA 4K38A 4LAUA 3DC0A 3C2VA 4S3FA 1FCBA 5JH1A 1T96A 1XV8A 3STFA 3NQ6A 1Y5WA 2OXNA 1TR9A 3KOFA 3Q45A 2I57A 4ZQRA 3BO9A 1KFLA 2GGGA 4NILA 4C5YA 3W25A 1GG1A 3H2CA 3W2JA 3LK6A 2PODA 2DORA 1JF5A 4I7VA 3VOHA 3NOEA 5F4SA 4CNTA 5C9WA 4V2XA 4F2UA 3SJ3A 2YXOA 4A6GA 1RD5A 4O1FA 2GUUA 3C52A 3A3WA 2JKAA 3B4YA 3AQUA 3AMGA 7XIMA 3S0CA 2OX4A 4JS3A 4GUJA 4YWIA 4TTGA 4ILSA 3B40A 2RAGA 4NI8A 3NOYA 3T6CA 4LF2A 1GQNA 4XUYA 1H41A 2ZWZA 3BAWA 4L7ZA 4HN4A 2Y24A 2Z27A 3AROA 4UXDA 4B2DD 2CHOA 4Q8MA 2DSZA 4XUGA 2GSJA 2NQJA 2ZRVA 2PURA 2H8ZA 3BG5A 2Y5JA 1R9ZA 3PANA 4LAZA 4HYWA 5HOSA 1O5QA 3GHRA 1TUXA 3H2NA 2E9LA 3TTEA 2X41A 4NG3A 3N3TA 3FKKA 4JTSA 2HBXA 1EUNA 5KZEA 4ICNA 2BHYA 2AL1A 3LYEA 4LBUA 4NF7A 1K02A 2PE4A 4BQ3A 1WAUA 5AZ1A 3CL8A 3V36A 1TELA 4DJFA 1FKXA 3IIXA 3URBA 1PDYA 5IBXC 4IT1A 2A6NA 5CGTA 4F40A 1UROA 3SFWA 1JGIA 1MQQA 3TJ4A 3M43A 3N14A 3WNPA 3UWYA 3EWDA 2HDJA 3KS6A 3H4WA 1VCFA 5E93A 3S2JA 3CAKA 3W02A 5HMSA 1E43A 4JKLA 3D6NA 5FJUA 2PDKA 3GWQA 5FAGA 3V1PA 3TMLA 4LBSA 2X1TA 4K6AA 1EQCA 5A6JA 5DX7A 2OG9A 4XKYA 3BTNA 3HTWA 3I65A 4GCAA 4DBUA 5CZKA 2XFWA 4N4PA 2TODA 2WMJA 1LUCA 4A8IA 4DO5A 1Q7ZA 2DY3A 2Q71A 4IPLA 4QS6A 1H1NA 2WBGA 2QPSA 3KS5A 4M51A 1LM1A 4KERA 1LCOA 2C16A 1G4EA 4QCFA 2AQOA 2DW6A 2XZ7A 4NYUA 4QJ4B 3KRZA 2FPTA 3MHGA 2VRJA 2A4AA 3P6LA 4P8UA 4LC6A 1DL3A 1DIOA 1WAWA 3CL7A 2V30A 1A5AA 2HPMA 3MBDA 1I1XA 1UZDA 3MTWA 5I6SA 3B9AA 4WSKA 4IMAA 2XISA 4UTJA 4H9MA 3GK0A 4H83A 4LF1A 5AC8A 5GQBA 5DCDA 4X2RA 4DJDC 2P53A 3FVDA 5H2ZA 1UMYA 3MUIA 1ZS2A 1JD7A 2X1IA 3RITA 1CBGA 5C55A 1KFCA 4DBEA 4DI9A 1EHAA 1DXIA 1C91A 3W27A 4OHQA 4UTTC 5LNVA 5FF3A 3V0TA 3LM7A 3CUGA 1SUXA 2X0SA 3QV6A 2ZA2A 1F07A 1SJAA 4YVXA 2DZBA 5HWJA 4JCMA 3H55A 5XIAA 4PMOA 3ZO9A 1XYLA 2C79A 1PVNA 1Z32X 2XVNA 1NWTA 2PLJA 3WF3A 1QPRA 1W9DM 2VQUA 1I2QA 3PZQA 4V28A 1PIFA 2QMJA 4JQ4A 2GVGA 4PN2A 5F7UA 3L21A 2YBVA 5G4EA 2FVLA 4QTGA 3APTA 3HU7A 1XRSA 5FF2A 3NVTA 3ZSTA 1J0ZA 3AC0A 3R7MA 1TJ2A 4IFKA 1GNXA 1GEHA 2Y89A 2PDHA 1PPIA 4ATDA 1ZP3A 2Z1BA 1HJUA 1E4MM 1SPQA 1JFHA 4HSNA 4IGNA 1W1VA 3EDFA 3EPMA 5JMUA 1R3WA 2CETA 3BCJA 1TJ1A 2G4FA 3KVKA 5A2AA 2GVLA 4O1BA 4Q32A 4CD4A 2UZ9A 3SCNA 2Q01A 1XYCA 3M5XA 1JCLA 1QRQA 1J4EA 3DYOA 3EZ4A 3LCFA 1TJRA 4X0VA 4KWWA 2IW0A 3VTRA 3S1XA 3UJRA 5BRBA 4DO6A 3SY8A 2UY3A 1TO3A 3C56A 4HVXA 2G3JA 1S5WA 4YU1A 2Y88A 1OHLA 1KLYA 2EG8A 1OF6A 4ASTA 2WLYA 2QUUA 3SUTA 3OLEA 1GW9A 3E96A 4L9XA 4IISA 3SGZA 1LRTA 1RJRA 2ZXDA 2WVVB 4IFRA 2VGIA 5AC4A 1RP9A 2WK2A 1Q4WA 4PMNA 4ZCWA 2CITA 2OEKA 2UY5A 2X1SA 3P7YA 4CGTA 4B3LA 4AZ6A 3APGA 1ISXA 4UR7A 2TYSA 1EEXA 4QE5A 4KF1A 3WUGA 5ABFA 3FKRA 3K13A 1IIGA 1CDGA 4XAGA 4UR8A 1VC4A 3MB9A 1GEQA 3ZT7A 3BUVA 1M04A 3HQPA 3WZ0E 4W9TA 2E67A 1ITXA 3M0ZA 3TK7A 3U8GA 2QKFA 5DQPA 3XISA 3O0KA 2WJEA 1R9XA 4AD5A 1RBLA 3S5OA 4FMVA 2BHZA 4A3UA 4OKDA 1P0EA 1Q63A 2RGMA 2NXHA 3SGGA 4LQ1A 3WQ5A 2XN0A 1XSJA 3ITXA 4GYPC 2KZHA 4EP8C 1I0DA 4GD0A 2PRHA 4HPGA 4Y6GA 5A5WA 3WUFA 2XGZA 2BDQA 1U2YA 4KFNA 1TRDA 2YL5A 5M03A 3W1UA 1N8IA 5CPQA 1YNYA 3POCA 3BLIA 1H09A 1KBKA 1UZ4A 2AAMA 1EJTC 3L66A 2CXEA 1KTBA 3BK0A 4GIEA 1WYIA 4BR1A 1H0IA 3SECA 1S5MA 4GQGA 3UPBA 2Z4GA 4QHRA 3W2UA 2NUYA 1JZ3A 3RG6A 3S47A 4Y7EA 4YXGA 1NSJA 3OLIA 4YS1A 3DAQA 4RZ6A 3DN5A 1KGXA 5H91A 2ZRZA 4JY8A 1XYAA 1RV8A 2GJNA 5C9UA 1CECA 4BHYA 2BG5A 4NNCA 3S9ZA 1E0TA 1VRXA 3F2BA 1DJIA 5PTDA 4Y9MA 3GB6A 4G8TA 4R34A 3SQSA 4XISA 2DZVA 2AMGA 2QDEA 1KTCA 4ROQA 3CEPA 1VD6A 1O6IA 1TPVA 2VWTA 3SN4A 3MUY1 4E2VA 4MM1A 1JDCA 3VVGA 2FZNA 3T4WA 4J7RA 3ONCA 1GQIA 3Q94A 4FEZA 3B3DA 2A3BA 3KM8A 3M46A 4HZ8A 4GI8A 5DLCA 4RDYA 5LKYA 1QBAA 2VOTA 5LYRA 2E5DA 4IMDA 3I6EA 2YSWA 4GZ7A 4C6LA 3G3MA 1WDPA 4WSHA 2PGEA 4LAOA 2PWUA 4XVEA 1PO9A 2MNRA 4H7VA 2QPUA 4N6FA 5I3FA 1TX2A 1NIUA 4F0HA 4XTIA 4HIBA 3PZOA 4UTWA 5G4HC 5A6MA 3WH9A 3W22A 1RCQA 4OBTA 3ZVHA 1WV2A 1HGYA 2WVUA 5CC3A 4GUGA 5CH9A 2YFOA 3LDVA 3W7HA 1ONEA 3OGRA 4W89A 5C6MA 3L5AA 3AWOA 2PGWA 3QPZA 2BOEX 3GAKA 2E9MA 1H4PA 2VX7A 1UD5A 1V0MA 4FP1A 2XINA 2R1KA 2D2JA 1JGMA 2NVAA 1M41A 2O4MA 2EGZA 1XF0A 3FW6A 3O6DA 3AHZA 2CZDA 3DGBA 1HUVA 1WDSA 3M7WA 1FWTA 3AMCA 4FXJA 2NQZA 1ZJBA 3V16A 2D20A 1OYAA 1LP6A 2OLHA 3H6OA 1UB3A 3BLDA 4X0NA 4UB9A 3WSUA 2Y63A 1V77A 5DMNA 2VGGA 2VGBA 3DZ1A 5GJNA 2ZVRA 1Y5XA 3F5KA 3QF0A 2ZX8A 2DSVA 3GG7A 3BGAA 2F2HA 2CPUA 1H50A 1REQA 4IZGA 1FTXA 1K77A 2CWXA 1ZTVA 5CBIA 1A3WA 1QDSA 3KOWA 4IX0A 1JZ7A 1LBMA 3EBVA 4LYQA 1L8PA 2I14A 3HOJA 3A5FA 4J27A 4FIQA 4W87A 1H11A 4LV4A 1LOSA 2XWDA 4H9XA 4AVOA 3C3NA 5K3VA 2HVNA 1MXDA 1DPMA 2A7PA 2YCEA 3E2VA 4Q8QA 3G5EA 4DYKA 3GTFA 1MQPA 4LB3A 3UT0A 1X8CA 1IXQA 3OLGA 5BMWA 2RUSA 1BVZA 3RU6A 4FXRA 1ZNNA 2EBNA 4NZ4A 3WQVA 1E70M 1TMHA 2YLLA 3BOLA 3L4UA 1EIXA 1EP3A 3L23A 2E0PA 2I5QA 4DQWA 2V5JA 2YL9A 2D23A 3KX6A 3OYZA 1J6OA 1CPUA 2ISSA 1F05A 3LTPA 1CGWA 5FL0A 3NXFA 1G9HA 4AC7C 4M56A 4MHBA 4H8UA 1XKJA 3LXCA 2GSEA 3PM6A 2GGHA 2IUZA 4WRHA 1Z89A 1ZUAX 1E55A 2OO6A 2ZUTA 2C1HA 1PTDA 3AS2A 2WZHA 4JKKA 3QW4B 1SZNA 1DE5A 3CYVA 2DSUA 1U22A 3H53A 2J74A 2WOQA 4W85A 3VNJA 1RCOB 2JGYA 2W61A 2PP0A 4RXGA 5RUBA 3ZQ9A 1W1ZA 2DZAA 5F2MA 1GVOA 3STPA 4DY1A 1K9FA 4TVUA 1UD4A 2I1OA 3HMJG 2JIEA 4F0RA 1BAGA 3ECQA 3RK8A 1P0DA 1FA2A 4DF0A 2XFRA 5CAKA 2HK1A 1LORA 1UIPA 1YNPA 3TN6A 3WMSA 2NQ9A 3GVVA 1B4KA 3IK4A 1UWIA 2O0TA 2R6OA 2VURA 3P74A 4FXSA 2HISA 3S5YA 1UKQA 5HMFA 2ZCGA 1NOFA 1U1JA 4PODA 2FFCA 3UXLA 4H6RA 4HA3A 4IQEA 1HJQA 3ABSA 5A6KA 1ZPTA 1IV8A 3LOTA 1EZWA 1TE6A 1TPEA 1SJDA 4MKVA 3TROA 2WWCA 4RPQA 1E15A 3OOQA 2WM0A 4FNUA 1AFSA 4K2SA 1PX4A 3ZIZA 3LLFA 4HPHA 5I07A 1JDDA 4HJFA 3NPWA 4L61A 4XSLA 2HPIA 3GIYA 3MI2A 3STCA 3E5BA 1A5BA 4Z1YA 4HOWA 4GNVA 3TYBA 1UR2A 3IS4A 3TJXA 2OFJA 4LXFA 1QUMA 3DYPA 4GO9A 1YYAA 1DBTA 1GJUA 1V02A 4DF1A 2EXOA 5D09A 4FX6M 3QC0A 3VC6A 4IF2A 1VQTA 4N9BA 1OZMA 2BVYA 4A4AA 4W8AA 2F84A 2VR5A 3PUDA 1AZ1A 1FHLA 2ZZ7A 3F4DA 1PL9A 4CQAA 4UFJA 4AD0A 1EPXA 1S2VA 3OIHA 1J0HA 2QR6A 1OFPA 4ZL1A 2ODOA 3I3DA 2CZEA 4UNIA 4AG0A 4OECA 3LBMA 4DJDD 5FCZA 2XIQA 4C6MA 3DFSA 1KBIA 3GDRA 3VK5A 1BKSA 3ARYA 4MNJA 3W87A 3QY7A 1EA9C 1QFEA 2D0GA 3DEQA 3QMSA 3M07A 3JZEA 5HBFA 4DAFA 2GFTA 1EHNA 4O19A 3P14A 3WG6A 3KDOA 5C8BB 1CGTA 4FNPA 4QG6A 5I3GA 3DKJA 4JTHA 1XDLA 4IXXA 5DY2A 3VDBA 1B9BA 2DIKA 3G1SA 3W3OA 2ZRXA 1J6PA 3KUMA 1FFRA 1XH1A 3WL1A 4KFOA 4IQJA 1AH0A 3RAOA 2ZQ0A 1B3OA 1A4LA 4OV9A 3H12A 5SWUA 3OBEA 1YDNA 4N4QA 1EXBA 3UR7A 2VEMA 4S3CA 1EL3A 4QEHA 1F2JA 2ACRA 1A5SA 3NFUA 4NU7A 1OC7A 5HAOA 5I0DA 1YHTA 2W6RA 1CGVA 3OQ8A 1YADA 4M8UA 4UFMA 3L2IA 4GZEA 3FCPA 1PX3A 3RX2A 1YLVA 5DCBA 5G1TA 3WLNA 3BZJA 4PB3A 5A2BA 4LUYA 2CBJA 5HULA 4GLEA 4L1GA 1OFOA 4JYFA 3SQLA 1CTNA 3H70A 5REQA 4CQ9A 1BLIA 1WXYA 3W1QA 3W7MA 2J4GA 3TZFA 1QNOA 1GYMA 1WZLA 4GISA 3MSRA 4M1RA 1K3UA 5D2VA 1IT7A 2G3IA 2D24A 3DC8A 4UMAA 5BXTA 2WJZA 3Q2DA 1VPQA 1ZAJA 5JQ9A 5A6LA 1H49A 5IBXA 2NXGA 5JBDA 3KTSA 3RR4A 1V6YA 1HP4A 4S3JA 4NX5A 1YEYA 1P5BA 2ZUVA 4GIYA 3DFPA 5EU9A 2Y2WA 1O1ZA 3PWGA 1LT7A 2ZZ1A 4MSSA 2QCDB 3ID7A 4PULA 5A6SA 3W81A 3MO4A 2WZIA 1W3IA 3GQYA 3FVMA 4G6CA 4O1EA 1U5VA 4JTCA 2EJAA 3W00A 3CHVA 3OQEA 5FD0A 1XDMA 2V3DA 1BSIA 2HXTA 3IJ6A 4BA0A 2XJ7A 1UWUA 4DPPA 1UZ1A 1GTEA 4HSOA 4ATLA 4TX8A 3SB0A 1VJIA 1OX5A 2X30A 5LXXA 5HR7A 3G0XA 3HZ3A 1A0DA 1UUMA 3PG8A 5T9BG 3VDCA 3QMTA 4BI5A 3IJQA 1GVRA 1IZJA 1GQJA 3UXAA 2QNEA 3W7EA 1U5HA 4BQ5A 3E02A 5KMYA 1EA0A 3N4FA 4KCTA 3GIQA 1UWQA 3UQNA 3OZOA 5E6ZA 4DJDA 3TVAA 4Z0JA 3SCRA 3AHVA 3HG4A 4R85A 3S3GA 3EDKA 5AY7A 4UTTA 5AHLA 3HG2A 4AWUA 2UY4A 3O07A 1SW0A 3WEMA 3T44A 5A6AA 1V0LA 3L0KA 3G6MA 4GQBA 3I3EA 4Z2KA 4X2PA 1L6FA 4MGGA 2OU4A 3S5ZA 5CSRA 2RKXA 2DU2A 3H8AA 2FZDA 2CXGA 3IRSA 4EACA 1V4YA 2QLYA 2PC8A 3KVJA 1R30A 4S3AA 4GC3A 3BZGA 3JRKA 3VGFA 3PZUA 3U9IA 4MZ8A 2ZX5A 4JFTA 1TIMA 1XBVA 1KFBA 3U5YA 1OIFA 4MWAA 1DHKA 4XD5A 1N7KA 3NSMA 3EMQA 4IPIA 4D6FA 3ZVIA 4PMXA 4E4UA 2Q6ZA 2FMNA 3IGUA 5TIMA 5AC5A 4US5A 4BWLC 2WMIA 1W0MA 1ZSXA 4ZQPA 2J7BA 1TV2A 4ICMA 4D6IA 1KRAC 2PUZA 4CKQA 2VZUA 1W9XA 4CCCA 1IIHA 2YFNA 3O05A 4GVIA 1ZJIA 4LRTA 1DJXA 1V3MA 2BFGA 4ZR8A 1F74A 4O0ZA 1B3XA 1ICPA 3K30A 4CNPA 2VO5A 4HD5A 2D2OA 5CPNA 1QI0A 1B1YA 4ZB5A 6ENLA 2Q09A 3U2ZA 1AD1A 5G2IA 3KL5A 4QGCA 1OG0A 1E6PA 1JRCA 4YL2A 2GWGA 2Z6IA 3UNDA 4EKJA 2VD8A 3B0PA 3PJTA 1LLZA 3TYZA 4A3RA 2OLAA 1MO0A 1MUCA 3KOZA 4FAMA 1UIOA 1AW1A 2OSXA 1WBHA 4FF5A 5D8WA 5LNUA 3S6OA 4IICA 1XIIA 3G1VA 5CGMA 3OTRA 1MFUA 1MNZA 5I02A 2J75A 1GT8A 3B8IA 4QAIA 2OO0A 1GW1A 3UETA 1KXVA 1HN1A 1VCGA 4DYEA 4XZIA 2CCRA 4HU0A 2ADAA 4PBGA 4WQ6A 3TYDA 4LTSA 3TCSA 3O7UA 2V5CA 5IHSA 4LYPA 5FF0A 4ACYA 2XM2A 4I6VA 3HPZA 2J7EA 3K4AA 1J12A 4FSAA 1UYQA 1TV3A 4D8ZA 2CLMA 3RRXA 4EK7A 2CLPA 1GTHA 3BAIA 2XH7A 4CN1A 1CX9A 2PTYA 3RM9A 3M0JA 2YA1A 4LY4A 3SURA 2J47A 4DPQA 1NWRA 4HMEA 3TC7A 4PMJA 1JRBA 3ITTA 2EPHA 1M7XA 2RJGA 4KQNA 3W7CA 4RCXA 3REQB 5LHEA 1K4HA 3DBPA 2NX3A 3PULA 4Y8EA 3DCPA 4GYPA 3NWRA 4PRRA 3M16A 1VRDA 1XLBA 4FOKA 4YTTA 3F4CA 2TMDA 1DORA 1B0IA 2VUNA 2NV1A 3T8QA 4I9JA 4KCVA 4H9VA 2GUBA 2QCFA 3TN5A 3LN3A 3G1XA 1H5YA 3WQFA 5I3IA 3OA5A 4G7FA 4C6QA 1F9CA 1F3TA 4JD4A 1ISZA 2CLIA 4J5NA 2EAWA 3TYUA 2V81A 3LENA 4F0LA 3ABOA 5BCAA 4QAWA 4JQ1A 3LHVA 4LX4A 1V51A 1BG9A 1ZGDA 3EKGA 4P7RA 3WK2A 3BE7A 3CZJA 4HN8A 2NX1A 4Z2HA 1WDRA 1AJ0A 3GU9A 3W82A 1K1DA 4IIEA 3P67A 3HQOA 4OBRA 3WNMA 4KGJA 4B5TA 3SUUA 3NQBA 4CVWA 3W7DA 4Q8NA 2YCLB 3VKBA 3M1ZA 2CIPA 3NPUA 4KRUA 2A3CA 3W7JA 3UJFA 3RYSA 3CTTA 4Q8PA 3PY2A 5B7YA 4CQCA 2PPGA 5JU6A 3FK4A 1O1HA 2QMKA 2AAAA 2TAAA 1UWSA 4JTGA 1OABA 3MY9A 5BOEA 1OX6A 3WEOA 5XINA 3WEZA 3LMZA 3PTQA 3K4DA 4LRSA 3RLHA 1NFPA 4L64A 1DQUA 4NAFA 2PP1A 2VKZG 3KRBA 3M0KA 2A3EA 3MKKA 1ONRA 5DT5A 3Q65A 2VFHA 4IM4A 4WX2A 3F7JA 2QCCA 1K8XA 3U5UA 2YYUA 4TR9A 3N12A 4JQAA 1W2VA 4U10A 3TIMA 4NSBA 1SZRA 1BKHA 4O1AA 4ORMA 4BFAA 4GKTA 1W9UA 3BLEA 3RHGA 1EB3A 1OJXA 1H61A 4MF4A 4O4VA 3FV9A 1G4TA 2Z7KA 2J25A 1WXJA 5D02A 5FIPA 2YW3A 4I9TA 1HIZA 1XRVA 4N6EA 3ZS4A 3AYTA 3TN3A 1HKMA 2J24A 4QG8A 2WSKA 4QFUA 1AL7A 4BF9A 1XX1A 3BJSA 2PTZA 5TBOA 4IGMA 1DJYA 4Z1BA 1TE1A 4DAIA 4EAMA 3SRHA 1XRFA 1BQCA 3NQDA 1GHRA 3AUJA 3FY1A 4QLKA 4US6A 5U4NA 4ZTYA 3WIJA 1QI2A 4UZUA 1O94A 4BCEA 1OEPA 1FWRA 1MUWA 1ZCOA 1XFBA 1UWRA 5GPRA 3CBWA 6XIMA 4XZLX 4L6DA 1RPKA 2XDFA 3F5JA 4EWND 4JN8A 1VLIA 1WKYA 2GPTA 5H8PA 3EDDA 1B54A 3LS9A 1TMLA 4OOUA 1E6QM 3U2OA 2RFGA 3GW0A 1KD0A 3NVDA 3L65A 3SSJA 3N2CA 1V0NA 3GZAA 2O7QA 4DUOA 4TVCA 1CXFA 2JEQA 5LNSA 2BWGA 3R25A 3QV9A 3F03K 4ZQNA 1MDLA 1VJZA 4WXYA 3B8DA 5A1AA 1OY0A 5HANA 2O4QA 3BL3A 4FNQA 1BVWA 4RXFA 1XD0A 3CMJA 1XBYA 3VD9A 5H8MA 1RBAA 2WXDM 1ITQA 2VI0A 3SCUA 4KEZA 1A5NC 1XC4A 3G22A 5HQEA 4C6NA 2Q8XA 2Y62A 5ABGA 4JIPA 3S4TA 2VVSA 4MB1A 4AMAA 2CC0A 2ALDA 2FVMA 2IKIA 3ALGA 4BY3A 1XYMA 4IWWA 4E3TA 3TC6A 3I3BA 3N9RA 5J5RA 1DIKA 5CC5A 1JEZA 2XVGA 2WKLA 3PS7A 3ZJ6A 1OZQA 5MHBA 1W3JA 1R2RA 4DM2A 4Z1AA 7PTDA 1OINA 2X8RA 4XKYB 3TR9A 1LUCB 4JFVA 3FDKA 3NCOA 4JBRA 3GXNA 3W01A 2X2YA 1B4EA 1EFZA 1RCXB 3WUEA 4HMCA 3AJXA 2QJGA 1O4UA 1OC5A 3S83A 1U1HA 4JL2A 3NQAA 4JX6A 4GINA 2OVLA 4PUDA 1ML1A 3JR2A 2QS8A 2HK0A 4FLSA 1S2UA 1SFJA 1UH2A 4HCHA 1OK6A 1CLKA 4PTVA 3V3WA 1CWYA 5EYWA 4D8AA 3VGGA 4LYKA 3EGJA 5E0KA 4CD6A 1HFBA 3LNMA 2PBGA 2QV5A 3HGOA 1TWDA 2BBFA 4W7VA 5HJXA 3GUWA 4C91A 5C71A 1J0IA 4ZEPA 3SJNA 1RUSA 1QAPA 1GZJA 4DXVA 3LTYA 4NZ1A 5CG7A 3TUUA 4KWUA 3VXGA 4PSRA 4Y96A 5GVJA 5EFFA 2BOGX 5BU9A 2W92A 3RDKA 3ITOA 1AQMA 2FGZA 1JF6A 1HQTA 4UQBA 4PUMA 1M7OA 1J0YA 2O55A 3DYMA 1M7JA 5LXEA 2PF0A 2J7CA 3MKCA 2HV5A 2XIIA 2Y7EA 2QCGA 5CLTA 2VT0A 3NQ7A 3AYSA 1S46A 4HYVA 3SRKA 4PBEA 2V68A 2UBPC 3IGXA 2VWSA 5M17A 3TNBA 3R11A 3OGSA 3ZR5A 3FAWA 1XUZA 4EANA 3PZVA 5FJPA 1V79A 4A3YA 1W2PA 4JDYA 1BEUA 3VUPA 3FYYA 1EF3A 2A79A 1FVPA 1KRBC 4F2BA 4IFKB 4JNMA 4M3PA 1HJSA 3WF1A 3VD3A 2Z28A 2ZTJA 3EXRA 3LHZA 4PTNA 1FH8A 1JUBA 3MVIA 2OGJA 3NDOA 1FDJA 4HPXA 5K9DA 2Z1WA 4C6EA 3K1DA 4WJXA 4EPEC 1W9VA 3KCOA 4IJCA 4DBDA 2PP3A 2C19A 5F1VA 2GGIA 2XSBA 1SO5A 3GNRA 3VGEA 1SMAA 4R9XA 3VOJA 3FN9A 3DHDA 3GR4A 3E38A 3TQ0A 2R94A 1C93A 2C8NA 1T0OA 4I5RA 1M9HA 3P60A 4G1NA 4AZCA 1UP0A 4F0KA 4WJ8A 1O5KA 1J79A 4GO8A 4DWSA 2WHLA 1W54A 2YL8A 5GNZA 1B3ZA 3P0WA 3I4EA 1I6NA 4B5WA 2ZVIA 3P8IA 4PGLA 3UGVA 1A47A 1NDZA 2Y85A 3M6DA 4K39A 4MMWA 4UZSA 3EA2A 3VIKA 3B8VA 2G0WA 2PDPA 4YVPA 4H4IA 1XYZA 1ICSA 5LA1A 3UZJA 3N25A 1E72M 1XQKA 2VC5A 3AXIA 2BLEA 1GOXA 8XIMA 1S39A 5T26A 2DT0A 3W71A 1FKWA 3W24A 2XSXA 1JZ4A 3VKDA 2V2DA 3BGGA 5K2ZA 4UTMA 1JDAA 3O0FA 4RUBA 3GTIA 1DJGA 1RZMA 2NSXA 3CEUA 2VUYA 4KT2A 5D30A 1PZ2A 3PB0A 5EPDA 3SIMA 2REQA 1K70A 3GX9A 4PRTA 2YJQA 1ECEA 2PU1A 3BMVA 3G6LA 4HA1A 4UQDA 2QCLA 3UR2A 1Q6EA 3GDLA 4O52A 5AHEA 5IRPA 2J7DA 2Z2UA 1TR1A 4C7DA 2J66A 3BPWA 4C1NA 3T05A 4MB3A 3W1RA 2OCZA 2WB5A 1XBZA 3T7VA 7TAAA 1TQXA 4RJEA 2PRMA 1ZQ5A 1OADA 1RJQA 4TU1A 3WQEA 1EIBA 1XI3A 4Q8WA 2QGYA 4C65A 4ADUA 3GVRA 2C3ZA 1YNQA 3NM3A 1KM2A 1Y0EA 1A50A 1E51A 4ZO8A 4ZOCA 4MJ2A 1XRTA 3STGA 4QS5A 2A0NA 4IX2A 3PJWA 1H51A 2P10A 3U2CA 5LIKX 3PFRA 3CXOA 1B3YA 2H3DA 3HF3A 4MJMA 4NT0A 3BJFA 2YL6A 4O0KA 2OOGA 4NP7A 2WNZA 2QVHA 3UPWA 4AHQA 2ON3A 2ZZ2A 2JKEA 4WCJA 3F4NA 1EXPA 5FL1A 4UCFA 2C0AA 1VPXA 1W1IE 2QUVA 1Q8JA 1FWGC 1SGJA 2O9TA 4O28A 4P7NA 1MRAA 3DIPA 2EG6A 4UQ9A 3KW3A 3QOMA 4NJJA 1E0XA 2Y6ZA 2Y70A 3W2NA 1ITCA 2WQDA 4NAEA 3TJIA 3MKVA 3DESA 5E0CA 4QCEA 3GHTA 4H6QA 3IJ9A 3Q58A 4ICCX 3SR7A 1AW5A 1R3VA 4PUNA 4D6CA 7REQB 1SFLA 2QDDA 3LBCA 3S8HA 1AA1B 1W37A 4L6OA 1QW8A 3BMWA 4JGDA 1TCDA 3MP5A 3R8RA 3II1A 2ATMA 2X0HA 4J3UA 3UU0A 4M19A 4AIOA 1PS9A 3W73A 1QI3A 1QI5A 1WZAA 3GBDA 3C2RA 1F7BA 3UCDA 1IT8A 2EO7A 2AOSA 7A3HA 4XIAA 4TMBA 1NTHA 2DH2A 3ZVHB 4MNMA 3C0QA 2MANA 1VS1A 3W4RA 5AHFA 4JIRA 5CJNA 5D33A 1ZRQA 1E1EA 1G4PA 4KW2A 3CC1A 2JQXA 4K1WA 4UR9A 5CPLA 3MANA 1TWWA 1JZ6A 1PKYA 3D46A 3H2EA 3CIWA 4R53A 4POCA 5L6UA 4PE8A 1P7TA 1KW1A 4J35A 1YMYA 2VX5A 4H9YA 4H41A 1L9WA 1QT1A 5DMLA 4QEEA 2Z24A 3VNIA 1Q5MA 2WPBA 5G5IA 3DBNA 2WMKA 1T8XA 2D3NA 3CV6A 1GVYA 4UCGA 3EB4A 4JX5A 1FDZA 1FWAC 4IMCA 1K9EA 4QM1A 4FK9A 1KFEA 4AD3A 3AALA 5IFTA 4X3ZA 3THUA 1HZYA 2EF9A 3NG3A 3RPMA 4YJ5A 3CWHA 4JIHA 4OQVA 2Y7FA 4Q33A 3IJIA 3PF3A 3IUDA 3VOFA 1CENA 3B97A 2FQIA 4AY7A 2V2HA 5BNKA 3BV7A 1GZGA 1H0GA 4XD6A 2PZ0A 1AUSL 4MZYA 1FWJC 3IUHA 4PUEA 3ITCA 4GJIA 1KCZA 3CLWA 2J8TA 1UR0A 3RX3A 3UWQA 4PBFA 2YA2A 3U4AA 5C54A 4EX4A 4A2RA 1OB0A 3MHUA 3MV11 2PLMA 3W6YA 1E3XA 3P5YA 3PVFA 2D2HA 1PYMA 3L5LA 3K1GA 2F9RA 3W1LA 1EOMA 3HQ1A 5CZJA 2WZEA 1TPH1 3DG6A 2DVUA 4FI4A 5HMEA 3DH7A 1OD8A 4QDWA 5H8UA 3KL0A 3RLVA 1H7NA 4TXEA 3EWXA 2VDIA 3SBFA 4M7SA 3A4XA 3NZ1A 1OT1A 3M0MA 3C2OA 4ENLA 1I2OA 4GGBA 1NWSA 4HA4A 4FX8A 2HE5A 4XX6A 1W8GA 3VIOA 1M53A 4GGHA 3Q37A 3M5VA 1QU4A 2EPOA 3GLCA 2WSRA 4WF7A 1ZHAA 3AFBA 3GDBA 3TTQA 4S3BA 3IV3A 4FOUA 1V03A 1RPXA 2YYTA 4GCXA 1GJWA 2QW5A 2W27A 3A4JA 2MUCA 5I03A 2INFA 3DXIA 4MOZA 4W5ZA 3SY5A 1KFKA 3LZ3A 2WO5A 2BZNA 3PZIA 5FJJA 4ORIA 1R5YA 2R8WA 1TYGA 3PUGA 1KCLA 2ZTKA 4J4KA 1SSGA 5EKYA 1XSIA 3ZYZA 2QCHA 4LT9A 5I3JA 5GJPA 1XXXA 3UZYA 4KWSA 2NZLA 3WD2A 1CNVA 2XFFA 3WQGA 1EP1A 1RQBA 5DXYA 2DIEA 3LHUA 3FLUA 3L7RA 4AZIA 1G6CA 5FJTA 1JUKA 2QCDA 3UVIA 3OHIA 2CZVA 4LV9A 3ATYA 3E0VA 2F7FA 4FR6A 1WUFA 1XUUA 3KVLA 2G8ZA 4HMNA 3A5VA 4XZBA 4ZZ9A 3G1RA 3KLLA 3MUCA 1XLEA 3QV8A 4Q3MA 3R8HA 1E71M 4J3VA 3HM7A 1Q13A 1K6AA 1PCKA 3AAMA 4GY7A 4QISA 1JCTA 2ZUWA 4RW5A 1MW3A 5DRCA 1V6XA 3WUBA 4F9JA 1PWMA 1TTPA 4H2HA 4MY9A 3OZYA 1QNQA 3ANUA 1W3LA 5F2LA 3TFCA 4LAKA 3ZJ7A 3W7KA 2QUTA 1UD6A 3EYPA 4LNCA 1UR9A 3TTOA 3GDTA 1XLGA 3PB2A 1XPYA 2QXWA 1G4SA 2JALA 3MDUA 5LNWA 2A5HA 3GDKA 1CXEA 2DQWA 3UXDA 1N8WA 1XH2A 1I8JA 3A6OA 1LT8A 1IEQA 5IM51 4NASA 4C6BA 3URAA 3L4ZA 4E8DA 2W91A 1X1ZA 2G3FA 1LL6A 5C2GA 2F6XA 2ZICA 3PBWA 5LHFA 3TX9A 5C7VA 2IPWA 3CQIA 1QOPA 2UV8G 3KVMA 1BRLA 2H8XA 3NO5A 3K8KA 3TYAA 3KZPA 2DZXA 2VOMA 2CLKA 4J1OA 4RDVA 3M0YA 1E3ZA 1CZ1A 2FLIA 3W6MA 4ZO6A 2W0UA 3P5ZA 4E0CA 4O1DA 4LYRA 1OFDA 1VFSA 3EB2A 1E4NA 4AIBA 1JPDX 3I7SA 2YDAA 1GKQA 4DJED 4HTBA 1PJ9A 5D8ZA 3DOPA 5TQLA 3TWBA 1F73A 1X97A 2O9RA 4GVFA 3TAOA 4H2CA 4GUFA 3CHFA 5K7JA 5C2CA 1TZ9A 2DV0A 1K7FA 2GJRA 1C90A 3L2MA 1AMKA 2C15A 5MKGB 1F6PA 1EC9A 1H1YA 3NL6A 5D4YA 4QNWA 4AU0A 3B03A 1UUQA 3WF4A 2FPVA 3W9ZA 3ISIX 2ZRUA 1QBBA 1D8WA 3P84A 1ONXA 1HGWA 2XWEA 1E5NA 3B0UX 1TFVA 2HWGA 1GOIA 3ZJ8A 4A8LA 1SM9A 1BSLA 4EPDC 5EY5A 3MCMA 5REQB 3VILA 2X1RA 3VPLA 1OCQA 5CPTA 4RX0A 4Y9NA 1TVLA 3HFYA 2VDHA 3R1ZA 3S2MA 1FH7A 3UG5A 4PMZA 4WSJA 1C7TA 3WBAA 3ITVA 1Z48A 4AD2A 4U2YA 1Q3NA 3UZXA 1YQ2A 1UH4A 3ZWTA 4TUFA 4ERAA 4BKNA 4M0XA 2QDHA 1SZFA 4C1KA 5JH2A 1RK5A 2WW5A 1IGSA 1OCJA 2VELA 2Y61A 1TX0A 3CT7A 4U5KA 2X7WA 4MNKA 3WMLA 3CUHA 3QZ6A 4Z2IA 3UG8A 1TWZA 4IP7A 4Q6XA 3STEA 2JK2A 1IEVA 3LRLA 1H7PA 5FEWA 3VC5A 3A9IA 1ME8A 1AMYA 1B9ZA 3WK0A 3VM5A 5M5DA 5DFAA 3AIVA 2WQPA 4HU3A 3UBPC 3HURA 1JI2A 4JHOA 1FWFC 3VNZA 1RSCA 1HXJA 2B7OA 3GXPA 1W5QA 2AQVA 5CSSA 3E12A 1C7SA 5HUOA 4H04A 1OFRA 2E9BA 1EDQA 3PBVA 1WBJA 1PSCA 2E8ZA 2VRKA 1V8EA 1BFNA 4DEFA 5HXMA 1XGZA 2Q8ZA 3W07A 2NLYA 2ZWYA 3URQA 2YXXA 1GCYA 4INFA 1Z6KA 4ES4A 4GKLA 5H1WA 3MI6A 4E4PA 3FYOA 3WNLA 3SM0A 1YBQA 4LNYA 3TH6A 4GPNA 3DFNA 5EL1A 3TLLA 2PWHA 4JDBA 2YDQA 1JYWA 1UA7A 1Q65A 3WD3A 2FTPA 1RJPA 4PB4A 3SUVA 2QV4A 4DJFD 1OGGA 3INPA 2CLFA 1B2YA 1E0VA 1XLLA 3ANYA 1VHNA 1O12A 3T8LA 4FPSA 2NLIA 4I90A 3GY1A 5IDIA 3IIOA 3ZT6A 1JCXA 1C8VA 4CD7A 6ALDA 4NQ1A 3G24A 5CPSA 1MUMA 3FA3A 4FLRA 3T2PA 2GGJA 2DT2A 4JKMA 1TVNA 5T8GA 4MWAB 3EWWA 5DBUA 1HL2A 2QF8A 2BOFX 2IPJA 1ZCCA 3E0LA 1SFSA 1U5JA 1TKKA 4JTRA 3WLKX 2WMIB 3NL3A 4CNSA 1HNYA 1SMDA 2POTA 1XCFA 1W5OA 1A3XA 3WX7A 4CD5A 1S1RA 4PC8A 2VCCA 1JAEA 3ELFA 3WKZA 3WLHA 3OW1A 4RNFA 3W86A 4AF0A 3U48A 2O9PA 2POZA 3CPUA 2ZX7A 2E68A 3VNKA 1LG2A 3VA8A 4F66A 1DWIM 3CZGA 7ODCA 3UXIA 3M41A 5DF0A 3MMTA 1YTKA 2WZTA 3AU2A 2BY3A 3SFKA 4F9DA 2PWVA 4R3UA 2JE8A 1M7PA 1MXGA 3KP1A 3BSHA 3O06A 3OBKA 3N73A 3QM3A 3NA8A 3VMNA 3H26A 4MB4A 1J2WA 3IK2A 3EOSA 3S9YA 2V63A 1ZAIA 3GG0A 5EMJA 3WNNA 1EP2A 1ZLPA 4CLMA 1E6NA 1ISYA 2C0HA 2Q02A 2D0HA 4KEMA 3M6YA 3V5CA 3N15A 1GK8A 1XHGA 3RU8X 4XAFA 1SO6A 3OA3A 4TV6A 4WZHA 2WLZA 3FSTA 3CZLA 2W67A 3UJEA 3ZR6A 1NY1A 3MWCA 1VPYA 5ABTA 1BPLB 2G50A 1V7YA 3QBUA 1LQ2A 2Y8UA 3LNPA 4RNHA 1FWHC 3A12A 3IANA 4UFIA 1RQHA 4BQ2A 5BRQA 3F4VA 5K4XA 3QFEA 2JF7A 3NGFA 4WDUA 3SN0A 1GUVA 2QIIA 4GJJA 2PS2A 1K8ZA 1H62A 2E6FA 4UTUA 1XIEA 4PUKA 2UY2A 3TYEA 4E6MA 2FZ9A 3CZKA 5BXSA 1TV4A 3MJYA 4JOMA 4QQ3A 3TU9A 1QNPA 3ARSA 1O95A 3EX6A 3JVAA 4NI3A 1OBAA 1NDVA 1OT2A 4GY0A 4ATWA 1KXQA 4PFHA 3GC5A 3R6IA 1VGAA 3GS6A 3DGRA 2BB0A 3CUXA 2WYSA 1JL8A 2JEPA 3Q4DA 1TTJA 4OJYA 4WXZA 1DWJM 4Q4RA 3O15A 3M47A 4AYGA 5FEXA 2Y1HA 1Q6GA 2VRQA 1L2UA 1HP5A 2QJMA 3AHYA 4RW3A 5BU6A 2R9RA 3GNOA 3IPWA 4UIOA 2OMAA 2PD9A 1GYNA 1NDYA 3BANA 5D04C 2BSLA 4GX9A 3B8SA 3R2GA 5TD4A 1XIBA 3NXLA 3N19B 4ZSTA 3LSCA 3M64A 1W31A 3PBUA 5C2XA 2GQ9A 2G41A 3BJTA 4GC4A 4H00A 1RQEA 2C14A 4NXSA 5A6BA 3TJLA 1UKPA 4AZHA 1EKOA 2TRSA 1DQXA 1UW9A 2ZIDA 3HGRA 3NPVA 4KETA 5DXXA 2BMBA 3VNYA 1M5WA 1TZZA 2GZXA 4A21A 5LA2A 3L4TA 1AH3A 4LGXA 5TAOA 3S9IA 1T6MA 4JZ5A 3HFTA 3SCTA 4ADTA 2Y0FA 5HPCA 5EMKA 1RLDA 5E5CA 3JW7A 3N2OA 2DPEA 4J2MA 4E2BA 1VBJA 4FLQA 4M29A 4WR3A 4C7GA 2FTYA 1TG7A 4NAFB 1MFVA 2YCIX 3FGCB 2OEJA 1PZ3A 4NXKA 1N2VA 1XCXA 4MDPA 3LSBA 3M0IA 4GACA 4GXPA 4KRZA 3CH0A 3GXDA 4RNIA 2J27A 4OU1A 1SVDA 1XYBA 4RL3A 4URIA 3V0SA 3CB3A 4NJKA 1VJSA 4M82A 2G4JA 3TOYA 3H4XA 1NFBA 1KKOA 3PN8A 1W3NA 2VFIA 2ZRYA 3VZZA 1J9YA 2E4TA 3WD4A 1KGUA 4CU8A 1CB2A 3VOCA 3LGGA 3NIYA 3N4EA 1TA3B 1KNWA 1Y7VA 4JXCA 1UKTA 2Z0IA 4MY8A 3QLLA 4L9YA 2OQYA 1QTWA 3AS0A 1WZMA 2B7NA 3LB0A 4GK8A 1TRIA 1OG6A 5AVHA 2DUXA 4GI6A 4DYJA 4DF2A 1D8CA 2E1DA 4PMRA 4UFKA 1EH9A 3AI0A 3WLSA 4MWAC 4F48A 4IGSA 4DRSA 3NPXA 1JYVA 3D5HA 3W76A 4FF7A 3MA8A 3DECA 3SIZA 2FGLA 2CZ5A 3CB8A 3LCIA 2R1PA 3WNKA 5CC6A 1KV8A 4QJ5B 3RCYA 3CGTA 3SEPA 1E40A 4KWVA 4WHBA 4YPJA 1J96A 4V1XA 1F8IA 3PHAA 5D2TA 1VBGA 3BMXA 1GOKA 1S38A 1ITUA 1ISWA 4NYYA 5FKYA 5T91A 1XL9A 4IP4A 1P4CA 1XLCA 2C1IA 2BGQA 2Y8KA 3AZRA 1R46A 2V5KA 1EDGA 4PTDA 1KRMA 3QN3A 5HWMA 1VP5A 3WFZA 4ERIA 3UJ2A 4AY1A 3I4KA 5KZMA 1LQAA 1BD0A 4PMYA 1UR8A 4QDPA 2QJJA 1HJXA 4NZCA 4RZ4A 4XAYA 4QIUA 4HA0A 3T4CA 1EZ2A 2QIWA 4P8XA 4MAZA 1QK2A 4WUIA 4C90A 3TQPA 2YIHA 2OOFA 5FSDC 1PWLA 3AMKA 3M44A 2V3GA 1RLCL 1DXEA 1WNOA 2ZDSA 1L0PA 1F8MA 1WO2A 5ENLA 3I6RA 3MU7A 2VZTA 4IL2A 1SW3A 3WF0A 3EOUA 1R3QA 4NIRA 2DT3A 2PGFA 4QXIA 4P2VA 3GDMA 1PIIA 2P8CA 1G94A 3W2KA 3R4IA 4HMDA 1VAHA 1T41A 3UF9A 1F3WA 3SUSA 4XD3A 4ADSA 5BRPA 4ROPA 3W74A 3F1QA 5JVLA 2NQ5A 1WOBA 1R3SA 1XP3A 5K9XA 2RHGA 4HZ6A 5E1QA 2A6LA 3RMEA 1V3LA 4S3KA 1D3CA 1DHPA 1HKKA 5EMLA 2G96A 2EPMX 2Q8LA 2FVKA 1L6YA 1ADSA 2PDNA 5I23A 4HPJA 1OFBA 1CW2A 3W7RA 8CGTA 2VCAA 3CH9A 1OSEA 1P43A 4GNKB 3G1AA 1FHDA 4DLFA 1US2A 2PEVA 3MT1A 5AYIA 4CNNA 4C6FA 4ONVA 4ZGYA 4CEXC 3V7PA 1R2SA 3GYEA 4Q8OA 3NQMA 4EPKA 3RM8A 3EEZA 3BW4A 3PNZA 5E9XA 1V02E 4IPJA 1OYBA 4JPGA 1POJA 1IF2A 2Y7DA 2FYMA 2CWNA 1VFLA 4MVAA 3ARQA 1VHCA 4HHPA 4B5VA 3P3BA 1BYDA 2XUCA 4KEUA 1AQHA 1HKWA 3FAXA 3AZSA 3QRHA 2W66A 4IL0A 3EAUA 4FNRA 5LNRA 3O9NA 3V1HA 3D0CA 1RHCA 3H7VA 3QHOA 3W1AA 3WENA 3ZWSA 3KRSA 3BVJA 4AD4A 2E77A 4LVBA 1IE7C 1JXKA 4XKMA 3VZXA 4B5UA 3HG5A 4ZTXA 4WJEA 2WWDA 3AIRA 5CQ1A 3CLMA 1UWTA 7REQA 3V75A 2V82A 3T2OA 4QE4A 1EX1A 3K8MA 1Z9AA 1SJCA 4N9DA 2VJXA 3QR1A 3VD4A 1R7AA 1FP9A 5I3DA 1FQ0A 2J6XA 4OE7A 4GE8A 3WDJA 4JQ3A 3QC3A 3VCCA 3S1WA 2PU0A 3P80A 1CB7B 1PZ1A 1C29A 3B9DA 1JFXA 1UQZA 2NSOA 1BXCA 4MTVA 3NSNA 5D9MA 1HTIA 4OIFA 3ZLHA 4GYKA 1D2KA 2PWDA 3ALFA 1G1YA 1JXJA 3ONBA 4X22A 2GQ8A 1WB0A 3UWUA 3TQVA 3OVQA 4FA3A 4AZCB 4D72A 4HBKA 4WGXA 4EIVA 1Q2RA 1R3YA 2XH2A 4DWSB 4GWEA 2VZVA 3GFYA 3RMJA 2FMOA 1XDJA 3MZ2A 1F76A 3C3UA 3LM3A 1ALDA 3JUGA 3ABXA 1DJWA 5LZLA 1KFWA 1IXPA 2DZTA 2F38A 3B9EA 4BI7A 3NNTA 5K9CA 1UC5A 4F8XA 1XIJA 4Z1DA 1K7XA 4W8BA 4GVHA 1EBHA 5K4ZA 4C7FA 2F61A 4I5UA 1UKSA 4RE0A 4YYFA 3QJAA 2VEPA 2L5HA 3N4AA 1PYFA 4CQ8A 3QSTA 2PDLA 1QASA 2VD9A 2PTDA 5D38A 3W75A 3P82A 3O8AA 1F6KA 4UQAA 1C9WA 4G2DA 3MCNA 4YTRA 4DO7A 2FB3A 3AISA 2ZUUA 2REQB 3PBYA 4MFDA 4Z1CA 2D3LA 4DUVA 3C4UA 4LALA 2E25A 3IJ7A 1QNRA 4H8HA 1X6NA 2DGAA 4WGHA 5JIWA 4GNJA 3TFXA 1O68A 2H90A 1UP3A 1TPDA 4C1NB 1IQ8A 1E9IA 1EJ7L 4MY1A 1XLHA 2QUNA 1L6GA 3MW7A 5TF0A 3CZEA 4DIAA 3HPXA 1QXLA 3G1HA 3CL6A 4JFWA 2G3MA 3TEVA 3IVUA 4UTFA 3H2FA 1X7FA 1E56A 1KQYA 5HDRA 1QOQA 3N34A 3OPSA 2JFEX 1Z44A 2DIJA 4DUWA 4ZQOA 4RDWA 2XVLA 4TX6A 3B06A 3LY0A 2E6YA 3LA4A 2P50A 3MV01 3K46A 3E0IA 1E0WA 1G69A 3QV7A 4HQVA 5AC6A 3MDWA 4WDXA 4QR6A 1K7EA 3KE0A 1DTNA 3SCPA 1XLDA 1G01A 2CLOA 3AIUA 1NELA 1UA3A 2F2KA 4PZVA 3QPYA 4DI8A 5HWNA 1QJWA 1O60A 4LS1A 2YA0A 5HPOA 9XIMA 3W7IA 1GZ1A 4XO6A 3UP8A 1GQKA 4MB5A 2QEZA 1QHOA 3HA1A 4LCRA 4XZHA 3EOEA 4NAEB 3DG3A 1LQ0A 4AYSA 1A5UA 3B8TA 5FOOA 4GG9A 1ZJAA 4JTAA 3WJXA 3T08A 2QYGA 2C7FA 2BX7A 4R7JA 3LCGA 5BW6A 3FSUA 4QX4A 2J9YA 2DZSA 3RN6A 3VX0A 2Z25A 1YE6A 3WDQA 4TIMA 2VYOA 3WJZA 2IKGA 1ESWA 2QCNA 2G3NA 4JNZA 4HGXA 4G7EA 3AIQA 1Z42A 1SZGA 3DFQA 3TP4A 4IG2B 3VGDA 3H7UA 1OYCA 3UGRA 1QR7A 1W1PA 3UZZA 3W7OA 3AMDA 3NZRA 4EWJA 1A0EA 1OIMA 5HJYA 3ABRA 2ALRA 1W6TA 2WJFA 2GYIA 1ZP4A 2IXUA 4LUJA 4HK5A 4HNTA 1LWHA 1LL4A 4ML4A 4S23A 3WJWA 3UFYA 2RDTA 4U28A 4IXHA 3FX4A 1ZFJA 1NP2A 4J3SA 1OK4A 1VLWA 2PDJA 4FALA 1P7TB 4TVDA 3KEHA 3S2NA 2WCGA 3AYRA 1FRBA 2Z26A 1DVJA 5CG0A 1HKIA 2EPKX 4LVAA 5DRIA 1SO3A 4D9PA 3KBVA 2OT0A 3LU2A 3WJYA 1M3UA 3IJLA 4MDOA 3VE9A 4V15A 2R82A 4DZAA 2VEIA 2GL5A 3CQ0A 4MJ4A 1EQPA 2WC3A 3O63A 1UOZA 4X9SA 5BOOA 3LPFA 2PGRA 4GH3A 3WBEA 3MUXA 5FACA 3IV8A 1ICQA 1IGWA 3VDGA 4XVDA 1R7OA 3CAVA 3WLMA 5A6TC 3A64A 1KGWA 4LY8A 3LRMA 1LTDA 1JI1A 1X98A 3OODA 4RDZA 3EMZA 4WKFA 4KRTA 1P0BA 2R24A 3AWNA 3RM4A 2BY2A 2XPKA 2EHHA 5FSEC 2OODA 1PKNA 4DWSC 3VDAA 4XBSA 5ABHA 2JIWA 3CIVA 3BW3A 4JCLA 4RZ5A 1KBLA 3KBJA 3GG8A 3KCJA 1SFTA 3VMOA 1EOKA 3IVTA 2J79A 2C71A 1XM3A 3IACA 4M24A 3UYIA 3QGAC 2A7RA 2CW6A 1ZU8A 3T07A 3W7LA 2VX6A 1B90A 1KR1A 5B80A 1HVXA 5FF4A 4HOZA 1Q85A 2DVXA 2DDXA 4O50A 1F4HA 1Q2SA 2E5BA 3CAQA 1BWLA 3CQJA 1PCWA 3USBA 5G2WA 3LCHA 1GORA 1WDDA 3AIEA 1UPPA 1A80A 6PTDA 1LL7A 5MKGA 1Z8AA 1UJQA 5DANA 1NF7A 1JAKA 3V0UA 3AJ7A 1AODA 2Z1XA 4MWAD 1A49A 4UTLA 4XAZA 3WQPA 4KESA 2C91A 1I60A 2PSNA 4US5D 4MPKA 3QTGA 3GHUA 1ENUA 2QULA 3K5XA 3H2AA 2A3AA 1QOXA 1MZRA 2GDVA 3UR5A 3ZXWA 2VC7A 5L9FA 5DT7A 3SZ8A 3WMCA 4S2CA 1E1CA 4LJ3A 2G95A 6A3HA 2HVMA 4ERGA 3THCA 4D6JA 2ZUNA 3SY1A 1JCMP 4OBSA 3NQ2A 4A2SA 4P5UA 3DHUA 3C0JA 4DNHA 3R0KA 4IMEA 4BEUA 3HGJA 3RPTA 4MADA 1AG1O 1XD1A 3FIGA 4ZA0A 4NNBA 3WFLA 3G0UA 3IJDA 4IQLA 3A47A 2OYKA 4Z0SA 4EOUA 2VFFA 2V38A 3W26A 4C6KA 1WDQA 4A3HA 3WLRA 3NYDA 3WD0A 1PTAA 4GY1A 5A2CA 3GIPA 3GXFA 3BH4A 3P8JA 4N7QA 4OUEA 3NYZA 4M6UA 2OEMA 5HK4A 2Y8VA 1LF1A 4ZOBA 5LIUX 3KWXA 1GVIA 3DDMA 2AKMA 1VEPA 3MCOA 1K03A 3BLLA 4HKPA 1YTDA 3K2GA 3M5ZA 1MXSA 3TSBA 2V3EA 3HJZA 4F79A 1F5ZA 1QPOA 1E6ZA 1VBUA 3OVGA 1ZY9A 3W72A 2CLHA 2HNHA 5E0FA 4GI9A 3T0BA 1SZEA 3V18A 5BXRA 2PF8A 4ZOAA 3CM4A 5A8OA 1POKA 1WQ5A 1US3A 1UD3A 4B3ZA 4NX0A 4D6EA 2HROA 2PDMA 3T1GA 3LQGA 3T40A 3N9KA 2XM1A 3EXTA 2QVNA 3PJXA 3VU2A 3DFOA 4J28A 3R5EA 1XBXA 1VCVA 3L0NA 3PK7A 4UMBA 1QNSA 3ANVA 3QFWA 1C8QA 2G97A 5CZ0A 1UQYA 2W79A 4OOZA 3PAJA 4M6VA 4JFUA 2INZA 4S3GA 3B8UA 5TNVA 1EBGA 4G1KA 2ZX6A 2Q3OA 3LCWA 2ATSA 1YPXA 3HB9A 4U5IA 4REQA 4F3HA 4A8NA 3VNLA 3COTA 4LS2A 4CN6A 5DEZA 2BASA 3ES8A 4CQDA 4F0MA 4JNYA 3RO8A 4H7ZA 1I45A 4MAVA 3B0YA 3GVGA 1T8QA 1FX6A 4EF9A 4V33A 1M03A 1DE6A 5KSWA 2GK1A 1DIEA 4AHPA 2DT1A 2ZX9A 9RUBA 3P62A 1CYGA 1AH4A 1BRLB 4UC5A 3C0SA 2VZOA 3MZNA 4XZWA 3CHEA 3KP0A 3VFCA 3WYZA 1H7XA 2FHFA 4LPCA 2V3FA 2ESCA 3VUSA 4IHCA 1IEWA 3N18A 1KWGA 7CGTA 1F4AA 1S5TA 1VFFA 3GFZA 1KM4A 3CS2A 3M0HA 4PCNA 2HEJA 2J88A 1FWCC 1LDCA 4JN6A 1FDYA 1FBAA 4L56A 4D1JA 3MP3A 3EEGA 4WY0A 2XVPA 2ZZ3A 3GBEA 2WNNA 4AIUA 4K7VA 4LSBA 1KKRA 3PPCA 4IMGA 1PB0A 1MQRA 3HPFA 3CU2A 2D0FA 4ZQCA 1IT0A 1DWAM 1OX4A 2YB4A 1V3KA 1MYRA 1RBOB 2FKPA 3IRDA 4HYRA 1XS2A 1GWJA 1MZHA 3ICJA 4GFIA 2IMRA 4DLMA 1QW9A 4RPPA 4B4FA 3P0XA 4E8CA 1BGAA 8XIAA 2RDUA 1M68A 4W7WA 2DEPA 1THFD 2ISVA 2PFHA 4NVTA 3RUBL 1BYAA 4ZE5A 3MMUA 3W83A 6TAAA 4FNTA 4MKNA 4AVNA 3TLQA 5GNXA 1TJ0A 5LIWX 3T9PA 4K8EA 1GPWA 2FZ8A 1JG9A 2VL4A 4S3EA 4NJHA 4UTIA 1UCWA 4XBKA 1XG4A 4PR4A 1UOKA 5AYZA 3FA4A 5DCEA 5EMUA 4UNLA 4QJ1A 3QTPA 1FWBC 3W88A 3WD1A 4JTJA 2PDUA 5I24A 3IGSA 4LH8A 2CLEA 3R8GA 1B3VA 4Z42C 4D2JA 5D32A 2V5LA 4FX7A 4W86A 4HU8A 2WM1A 3QVQA 1OF8A 2HNEA 2EQDA 3HQNA 2QGHA 6CGTA 3H54A 3WBWA 1SO4A 5CKSA 3OEXA 3TMQA 4WKHA 5F2IA 1BWKA 2CKSA 2C1GA 2R1MA 1W5PA 5C9XA 4YWSA 4ZENA 5EMMA 2XIJA 4LEFA 1FWNA 2J62A 1A5OC 4MUZA 2GOKA 2VGFA 4K8GA 3GUGA 2QQ6A 4AAJA 3AUOA 3FOKA 5G1MA 5HNRA 3UYCA 2NVDA 5AHNA 5AFDA 2BY1A 4Y9AA 1LBFA 3GH4A 3NO1A 2PDYA 4UFLA 2IXVA 3FHQA 2DH3A 4JTLA 1KC7A 2GJPA 3TW6A 4HOXA 3IARA 3MI3A 3WJSA 1PTGA 1CXHA 2ZUSA 2B7PA 5JUVA 1QMLA 4EXBA 1V5XA 4N42A 2H9AA 3JZUA 4M81A 2FFIA 4XK2A 5AN7A 1L6WA 4B2DA 1WE5A 2H3BA 4XD4A 3RLUA 4DB7A 5U7SA 2VHLA 4JIQA 1OFQA 5CEWA 5CJMA 2GSHA 1GG0A 2CEQA 1BF2A 4O11A 5HUPA 1LG1A 2WMFA 3DHPA 5CCZA 1X6LA 3FEQA 2QCEA 1YXYA 4AX6A 1CIUA 1MDRA 3NURA 5EB8A 3WCZA 1AL8A 4YIWA 1KCXA 1YBQB 1KBJA 1OVDA 5J5DA 3IVSA 3VIJA 4EAYA 3N6HA 4HCDA 1GQLA 1Q7QA 5DBTA 4A22A 4AVFA 3LLDA 3KBMA 1A53A 4JQ2A 3POHA 4Q4SA 3W28A 3VIHA 4BZYA 2QZRA 4JN7A 1YPFA 1BF6A 3UPMA 1NEYA 3G8EA 3OHMB 3BCDA 5CJ5A 2QUMA 3WQCA 1M01A 1X96A 2GVEA 3GAYA 1T5AA 3TTSA 2WVSA 3VCRA 1TV8A 1TREA 1JR1A 5M3WA 5JXQA 3THDA 5GNYA 2X05A 3H2OA 4E4FA 2ISDA 1TTQA 2ZKMX 2IS7A 4DXXA 4AXNA 3FGCA 2JBMA 1V6VA 4U3CA 2J6VA 5CLWA 3W85A 1US0A 2R91A 3L67A 4XZMX 4GHRA 3DI1A 3WLLA 3RX4A 2HJPA 4AF0B 4JEQA 4Q22A 3MYPA 4B9YA 1OFAA 3YPIA 3P61A 4NL1A 1DWFM 3PG9A 3UD6A 3IGHX 3GC2A 5AB3A 1KLZA 1CEOA 3E74A 4AMCA 5CSUA 4BS0A 1ONWA 2YCKX 3UG4A 4AUBA 5BWAA 1J8VA 3GTNA 3GVWA 1JDFA 1ME7A 4E3VA 5B7ZA 1FFQA 3M5YA 4C1LA 1Y8BA 4K1GA 3UERA 1NH6A 1TA3A 3W1PA 1XLJA 4H8NA 6REQA 9CGTA 4NKCA 2YKKA 4YN5A 2KX9A 4XB3A 3GW3A 3GFXA 4W84A 4CNUA 3PTKA 2D1ZA 4G56A 4RV3A 2V6AA 3BXWA 1L8NA 2DVTA 3GD6A 1LWJA 5F1UA 1IYXA 1XC6A 3XIMA 5CPOA 1A5KC 1XWYA 1TMQA 4L5ZA 1GVQA 3VFLA 1W1B1 3SCSA 2BNJA 2PD5A 1EJVC 4KIRA 5LA0A 2E6DA 3GC4A 4M80A 3W37A 4AQLA 3KOYA 1FWIC 3O2LA 3GHSA 4BEQA 4L4PA 1TPFA 1ODZA 3U3HA 3C2EA 1JYXA 4R7WA 2P1FA 2X2GA 4KIEA 4PFMA 5BYWA 2VP8A 4WD0A 1ZENA 4GRSA 2I9UA 4J40A 1IR2A 3GXTA 3V5FA 4CN4A 1W3KA 1D9EA 2AL2A 1FWWA 2YCJA 3A23A 1WCGA 4UMCA 1DWGM 3LV5A 3KBNA 1SQ7A 1XICA 3A3HA 3M0XA 1BQGA 3S5SA 1CXIA 4U33A 5C70A 3AIWA 3LUTA 4ACZA 3QR0A 2BXYA 4PRWA 1UMLA 3QGKC 4WEVX 3L4YA 1MW0A 1ZJHA 2DSWA 2QJNA 4QJ3B 4D6DA 3MC5A 4DX3A 1Q6FA 1W3HA 5HMDA 3WK3A 5GJMA 1H7WA 3GNXA 2VEFA 1X1OA 3QHNA 2NUXA 3ORWA 3N17A 2OB3A 4O57A 3RJYA 3EKLA 1W91A 1TCMA 1HT6A 3TV8A 1NU5A 2WAGA 2OJPA 3G8RA 1S3TC 1X39A 4HPNA 3UVAA 2NT0A 1UP2A 3W38A 4LUSA 4DWSD 4LVDA 1ME9A 4DZHA 2ANUA 3MSYA 3N1AA 4PEKA 1RR2A 3GO2A 2XGIA 4WDTA 2YZ5A 4QSFA 3G1DA 2VR2A 1C9DA 1H7RA 3OU8A 4FIRA 2PTWA 4IGHA 1C8YA 2Q3RA 1IHIA 2DP3A 3MBFA 1FOBA 1IWAA 3RRAA 2QHAA 3LCLA 4CCZA 4A35A 3W1TA 3T42A 1W5MA 3BAKA 4R7OA 1GONA 1E1FA 4RE3A 2PDXA 1YW1A 1FP8A 3DFTA 4IPPA 4FNSA 2WPGA 4R27A 3VIMA 4HTYA 1R86A 4LCSA 3GVQA 1ZBKA 2PLCA 1TPWA 3LRKA 1E9YB 1YRRA 3P2VA 4RKAA 1Q4NX 3V5OA 4EXQA 2C6QA 4PSPA 3BG9A 1XIFA 4R9OA 1JCNA 4GYJA 3WK1A 4GMEA 3TW7A 4O53A 3KTCA 1P6BA 2BS9A 3DUGA 1X1NA 2GJXA 3OO2A 3THAA 2ISFA 1UH3A 2CESA 1EYWA 3G0SA 1OQFA 1EJXC 3ZSSA 3QLDA 1XFCA 1KM5A 3V4BA 1UD2A 1J2BA 4PUWA 3QR3A 4H01A 3IAQA 3QKZA 4QRNA 2PCQA 4QNEA 3D47A 3W6LA 2OWCA 3VNDA 3GYCA 5HR6A 1K9DA 4WY0F 2VCBA 4AIEA 4CQBA 5LSMA 5KZ6A 1EO7A 3BWWA 1KXTA 5AC7A 1TTIA 3W7QA 5D05A 5I09A 2E09A 3VIGA 3WLJA 2FDMA 4IH3A 1KBBA 1W3TA 5CZTA 2V2CA 3NZPA 1LLOA 2GOUA 1OD0A 2HE8A 3BARA 4EF8A 1MI3A 2DZWA 1S1PA 3WF2A 1RVKA 5HNUA 4ZO7A 9XIAA 5A8MA 4NZ3A 4AWTA 1TPC1 2IQDA 3O1NA 1EWDA 3VAVA 3TE9A 3SW6A 4C6CA 3E0WA 3IUIA 3L12A 3T0DA 2WJDA 4FXFA 1A5MC 4H9TA 2OSYA 2PDGA 2B7QA 4GIAA 3FJ6A 4L6HA 3I7RA 4RR4A 3U4FA 3OGVA 4WLCA 2ZUMA 4PMVA 4JICA 3TC3A 1W56A 1PXGA 2PMQA 5DELA 3GH7A 2O9OA 4MLRA 4U3AA 2V0TA 1MEIA 2YR1A 3KZSA 1DYSA 1VZWA 2HCVA 1QI4A 1RY0A 3RLGA 3WY1A 1WP6A 2V5DA 4P8VA 1OGSA 1TWSA 3NAVA 3KHJA 2XIOA 3VINA 4XO7A 4IIDA 3KBSA 2BGSA 3AO0A 2HSAA 1PKLA 1QNVA 3MP4A 4Z2JA 2D22A 1G67A 3BSMA 3ZM8A 2I5GA 4B3KA 1N8FA 2A1YA 8RUCA 3OB8A 3NQ8A 2B0MA 3GTXA 3OJGA 1O5RA 3U2EA 3H21A 1K8CA 3UWZA 4UTKA 2I16A 4F4RA 4U4MA 4Q4QA 3ARZA 2HZGA 1KRCC 3PPFA 4JY9A 3QY8A 3BURA 3B0VC 3NUKA 1FWSA 4U2ZA 3W1XA 4X63A 3TOPA 4LUTA 4HCLA 3AZTA 3P93A 4O1CA 3O6CA 1JCJA 1UHVA 4YYCA 1DP0A 1UG6A 4DHGA 3TR2A 3DI0A 3LXBA 3GU2A 1PDZA 5CZSA 5HQMA 2ZE3A 3F2DA 2GJLA 3P81A 1JDEA 3HBLA 4N9CA 5CXPA 3L2LA 3RIKA 4NY2A 1VR6A 1JULA 2Y5SA 2I7GA 3KXQA 4I8DA 1QHZA 1I0BA 3E0FA 5E09A 3PPHA 3TAKA 3ERPA 1JZ8A 4ZVJA 4OWGA 3BGJA 5A95A 4IP5A 3BLOA 2E5CA 3RCNA 3ITLA 2P5NA 3GU1A 5KINA 4XAPA 1C8XA 1X8FA 1R3RA 3T2QA 1E9ZB 3OZMA 1YX1A 2WANA 1AW2A 3BSGA 1TVPA 4IIBA 1V93A 3EOLA 2FPYA 1FUYA 3HGSA 4GJ1A 1TPUA 4UBPC 4XZNX 3CNYA 3QGVA 1NM9A 4O13A