1J98A

The 1.2 angstrom structure of bacillus subtilis luxs
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
153
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title The 1.2 A Structure of a Novel Quorum-Sensing Protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 45
structure length 153
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j98A00
1J6WA 2FQTA 4XCHA 1JVIA 1VGXA 1JQWA 1VH2A 1J6XA 1JOEA 1VJEA 1INNA 1YCLA 2FQOA 5E68A 1IE0A 1J6VA 1J98A
chains in the Genus database with same CATH superfamily
4XLNA 3LAJA 1UV7A 3GEHA 3S1MK 4A3BC 1XZPA 3HKZD 1TWGA 1V5VA 1WCMC 3CQZK 2NVQC 1J6VA 1Y1WC 3L4JA 1TWCK 2PPBA 1C0AA 1K83C 3S1QC 4C45A 4BY1K 3A8JA 1I6VA 2E2HC 2BE5A 4Y7NC 5C4JK 1O24A 3H0GC 4LQYA 2WB1D 4C2MC 1BGWA 3CQZA 1EK8A 3GEIA 4RMFA 3G4AA 1TWCA 4KB2A 1O27A 5FLMC 3M3YC 2JA5A 2O5JA 3GTLC 1O25A 3GTMC 2ZFZA 4ZH4A 1IL2A 4QIWL 4OIOA 4A3BK 2JA8C 3S17C 1Y1VA 2NVQK 4XCHA 3S16K 5IOQA 3S2DC 5EGEA 3AD8C 4MQ9A 1TWHK 4P5AA 1O2FB 3FKIC 2E2HK 1TWAK 5C44K 3S1RC 4Y7NK 3A8IA 1WSVA 3T01A 1IBAA 3H3VD 4Y52C 4G0UA 3HOZC 3Q3QA 2GSNA 1WCMA 4PABA 1WOSA 3I4MC 1Y1WA 4KASA 1TWHA 5FLMK 2E2HA 1IS1A 3GTLK 4XLPA 1TWAA 3S1NK 4A3LK 1F93A 4O2DA 3S14C 4BXXK 2JA8K 3S17K 3N0BA 3A8KA 3GTLA 1WSRA 1VH2A 3BP3A 3S1RK 1B4AA 4OINA 3S2HC 3WODA 4Y52K 3HOZK 2CW0A 2PA8L 1ZBSA 4GZYA 1IQ0A 3GTJC 1TWFC 3FKIA 4A3KK 1B4BA 5IP7K 1HQMA 5IOSA 2A69A 1RU0A 4BBSC 4G7HA 3TFJA 2A6EA 5D4DA 2WAQL 4LJZA 1VGXA 3HXAA 2R92C 2CFAB 3HOWC 4KATA 1KQ4A 4LR2A 4YG2A 3S2HK 1XXBA 3PO3K 4WJ4A 1I50K 5TMCA 2Y0SL 2PA8D 3GTJK 4A3DK 1INNA 4GT9A 3CQZC 1YX2A 5IYCK 3HOUK 1VRQC 4BBSK 2R93K 3T02A 2EBBA 3ADAC 4QJVB 4Q5SA 1WIHA 4LLGA 5C4JC 1I6HC 5M3FK 4GTBA 4C3IK 3GTJA 1ZXOA 1TWFA 2R92K 3OEPA 4GTEA 5M5YK 4P9SA 5HL8A 4BLAA 2B63K 4KAWX 1WQFA 4KMHA 1XZPB 2R92A 2A68A 1G51A 3GEEA 5IP9K 3S16C 4KC6A 2B63A 3ERED 2E2JC 5M3MK 1HI9A 1TWHC 2JH3A 4G7OA 5C4XK 1PJ6A 1TWAC 1USOA 4G0WA 5C44C 1JQWA 4KARA 1I6HK 4G0VA 3SZZA 3RZOK 3GTOK 1J6WA 4J3NA 3K7AC 3S1NC 4A3LC 4GTLA 4BXXC 1IE0A 3G4CA 1EI6A 2GSUA 4LK0A 3S0XA 4KMUA 2E2JK 1XXCA 4DDQA 3FOEA 1O2BA 3SZYA 4GTAA 4A3CK 4P5BA 1WQHA 1F9NA 4A3IC 3HOVC 5C3EC 4FZBA 3MMLB 5IYDC 3GTKK 3K7AK 4A3KC 2P8TA 1J6XA 3LAPA 5IP7C 2RH6A 4KMDA 4QIWD 3L4KA 3M4OK 5M5XK 1DCOA 1YNNA 4BY7C 3GTKA 4AYBL 4ILDA 3FHZA 2P5MA 5IORA 3GTQC 3I4NK 3GTGC 2GAHC 2NVTK 3IPJA 3PO3C 4A3IK 1F7VA 3HOYK 3GIRA 3GSIA 3N3YA 1I50C 2VUMC 2Y3PA 3HOVK 5C3EK 2E2IC 1DD5A 4A3DC 5IYDK 5CHPA 5IYCC 5TJ3A 5M5WK 3TFIA 1BJTA 5TMFA 3HOUC 4G7ZA 2ZUFA 2R93C 2XCQA 1ZQ1C 2JA6K 3RZDC 3PO2C 4BY7K 4C3IC 2ZUEA 3GTQK 4AYBD 1EH1A 2B63C 3GTGK 5EGHA 4A93C 1R9TK 2JA6A 2VUMK 2NVXC 2E2IK 4XSXA 4OIQA 4JK1A 5IP9C 3GTQA 3GTGA 4GTCA 2JA7C 1EQRA 1PJ5A 2FQOA 5C4XC 1R9TA 4BBRC 4BKWA 1USMA 1I50A 1SFOC 2VUMA 3FOFA 3RZDK 3PO2K 2E2IA 4FM9A 2WAQD 4C3JK 3RZOC 4AH6A 3GTOC 2FQTA 1XZQA 2R93A 4A93K 2GSOA 2R7ZK 2NVXK 3AD7C 2GAGC 2V6UA 4MEXA 4A3JK 2W7VA 2WB1L 1ISEA 2Y0SD 3HOXK 4PAAA 4A3GK 2JA7K 3CAGA 1BDFA 3DXJA 4X6AK 4BBRK 1WOOA 1SFOK 2R7ZA 2NVXA 4WJ3M 4A3CC 4Q4ZA 4KB4A 4GFQA 5JFEA 4LK1A 4A3FK 3S15K 2JA7A 3GTKC 3GTPC 5IYBK 1L0WA 1SFOA 2PMZL 2NVYK 3OREA 3M4OC 2JA5K 1I3QC 3GTOA 4YFNA 3N0CA 2D6FC 3H3VL 3BUEA 3TFHA 1DCPA 3AH5A 3I4NC 1Y1VK 2NVYA 1PJ7A 2NVTC 1O2AA 5JVOA 1VJEA 3HOYC 4M1XA 3GTPK 1EFWA 3V4GA 2RGRA 1WCMK 1O26A 1Y1WK 2XCOA 3AD9C 1GE9A 1YCLA 1K83K 2PMZD 4KMAA 5IOTA 1I3QK 5E68A 3S1QK 2JA6C 1IW7A 1JVIA 4KDDA 1XPPA 3GTPA 3H0GK 4LOWA 4C2MK 3NUHA 4GTFA 4A3MC 4XSZA 1K83A 3M3YK 1I3QA 1R9TC 3JSTA 4WILA 4C3HC 3GTMK 1J98A 1ZYRA 3EQLA 1BS2A 3H0GA 4A3EC 4KM9A 4KN7A 3OPFA 1O28A 1X31C 4YFKA 3QX3A 1DCHA 2O5IA 3S2DK 5CJ9A 5L46A 1VLOA 2XCRB 1ZVUA 3GTMA 3AQOA 3FKIK 1AB4A 2YU9C 1JOEA 4C3JC 1WORA 4OIRA 4A3MK 2A6HA 2PHCB 3I4MK 4BLBA 5FJ8K 4MEYA 4C3HK 2R7ZC 1SMYA 1WQGA 3S14K 4A3EK 4YFXA 4A3JC 3HOXC 4A3GC 2KWAA 2CFAA 1F7UA 4X6AC 1TWGC 4NOIA 2YU9K 1YNJA 4A3FC 3VA7A 3HKZL 4GTDA 3S1MC 3S15C 1XZQB 2V6SA 3GDZA 3TTGA 5IYBC 1WOPA 1TWFK 1O29A 2YU9A 3BP8C 2NVYC 3AQPA 1TWCC 4OIPA 2JA5C 4QJVA 4BY1C 4KN4A 4KM8A 3LPXA 1XXAA 3T00A 2V6TA 1TWGK 3HOWK 1Y1VC
chains in the Genus database with same CATH topology
1J6WA 2FQTA 4XCHA 1JVIA 1VGXA 1JQWA 1VH2A 1J6XA 1JOEA 1VJEA 1INNA 1YCLA 2FQOA 5E68A 1IE0A 1J6VA 1J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6W A;  2FQT A;  4XCH A;  1JVI A;  1VGX A;  1JQW A;  1VH2 A;  1J6X A;  1JOE A;  1VJE A;  1INN A;  1YCL A;  2FQO A;  5E68 A;  1IE0 A;  1J6V A;  1J98 A; 
#chains in the Genus database with same CATH topology
 4XLN A;  3LAJ A;  1UV7 A;  3GEH A;  3S1M K;  4A3B C;  1XZP A;  3HKZ D;  1TWG A;  1V5V A;  1WCM C;  3CQZ K;  2NVQ C;  1J6V A;  1Y1W C;  3L4J A;  1TWC K;  2PPB A;  1C0A A;  1K83 C;  3S1Q C;  4C45 A;  4BY1 K;  3A8J A;  1I6V A;  2E2H C;  2BE5 A;  4Y7N C;  5C4J K;  1O24 A;  3H0G C;  4LQY A;  2WB1 D;  4C2M C;  1BGW A;  3CQZ A;  1EK8 A;  3GEI A;  4RMF A;  3G4A A;  1TWC A;  4KB2 A;  1O27 A;  5FLM C;  3M3Y C;  2JA5 A;  2O5J A;  3GTL C;  1O25 A;  3GTM C;  2ZFZ A;  4ZH4 A;  1IL2 A;  4QIW L;  4OIO A;  4A3B K;  2JA8 C;  3S17 C;  1Y1V A;  2NVQ K;  4XCH A;  3S16 K;  5IOQ A;  3S2D C;  5EGE A;  3AD8 C;  4MQ9 A;  1TWH K;  4P5A A;  1O2F B;  3FKI C;  2E2H K;  1TWA K;  5C44 K;  3S1R C;  4Y7N K;  3A8I A;  1WSV A;  3T01 A;  1IBA A;  3H3V D;  4Y52 C;  4G0U A;  3HOZ C;  3Q3Q A;  2GSN A;  1WCM A;  4PAB A;  1WOS A;  3I4M C;  1Y1W A;  4KAS A;  1TWH A;  5FLM K;  2E2H A;  1IS1 A;  3GTL K;  4XLP A;  1TWA A;  3S1N K;  4A3L K;  1F93 A;  4O2D A;  3S14 C;  4BXX K;  2JA8 K;  3S17 K;  3N0B A;  3A8K A;  3GTL A;  1WSR A;  1VH2 A;  3BP3 A;  3S1R K;  1B4A A;  4OIN A;  3S2H C;  3WOD A;  4Y52 K;  3HOZ K;  2CW0 A;  2PA8 L;  1ZBS A;  4GZY A;  1IQ0 A;  3GTJ C;  1TWF C;  3FKI A;  4A3K K;  1B4B A;  5IP7 K;  1HQM A;  5IOS A;  2A69 A;  1RU0 A;  4BBS C;  4G7H A;  3TFJ A;  2A6E A;  5D4D A;  2WAQ L;  4LJZ A;  1VGX A;  3HXA A;  2R92 C;  2CFA B;  3HOW C;  4KAT A;  1KQ4 A;  4LR2 A;  4YG2 A;  3S2H K;  1XXB A;  3PO3 K;  4WJ4 A;  1I50 K;  5TMC A;  2Y0S L;  2PA8 D;  3GTJ K;  4A3D K;  1INN A;  4GT9 A;  3CQZ C;  1YX2 A;  5IYC K;  3HOU K;  1VRQ C;  4BBS K;  2R93 K;  3T02 A;  2EBB A;  3ADA C;  4QJV B;  4Q5S A;  1WIH A;  4LLG A;  5C4J C;  1I6H C;  5M3F K;  4GTB A;  4C3I K;  3GTJ A;  1ZXO A;  1TWF A;  2R92 K;  3OEP A;  4GTE A;  5M5Y K;  4P9S A;  5HL8 A;  4BLA A;  2B63 K;  4KAW X;  1WQF A;  4KMH A;  1XZP B;  2R92 A;  2A68 A;  1G51 A;  3GEE A;  5IP9 K;  3S16 C;  4KC6 A;  2B63 A;  3ERE D;  2E2J C;  5M3M K;  1HI9 A;  1TWH C;  2JH3 A;  4G7O A;  5C4X K;  1PJ6 A;  1TWA C;  1USO A;  4G0W A;  5C44 C;  1JQW A;  4KAR A;  1I6H K;  4G0V A;  3SZZ A;  3RZO K;  3GTO K;  1J6W A;  4J3N A;  3K7A C;  3S1N C;  4A3L C;  4GTL A;  4BXX C;  1IE0 A;  3G4C A;  1EI6 A;  2GSU A;  4LK0 A;  3S0X A;  4KMU A;  2E2J K;  1XXC A;  4DDQ A;  3FOE A;  1O2B A;  3SZY A;  4GTA A;  4A3C K;  4P5B A;  1WQH A;  1F9N A;  4A3I C;  3HOV C;  5C3E C;  4FZB A;  3MML B;  5IYD C;  3GTK K;  3K7A K;  4A3K C;  2P8T A;  1J6X A;  3LAP A;  5IP7 C;  2RH6 A;  4KMD A;  4QIW D;  3L4K A;  3M4O K;  5M5X K;  1DCO A;  1YNN A;  4BY7 C;  3GTK A;  4AYB L;  4ILD A;  3FHZ A;  2P5M A;  5IOR A;  3GTQ C;  3I4N K;  3GTG C;  2GAH C;  2NVT K;  3IPJ A;  3PO3 C;  4A3I K;  1F7V A;  3HOY K;  3GIR A;  3GSI A;  3N3Y A;  1I50 C;  2VUM C;  2Y3P A;  3HOV K;  5C3E K;  2E2I C;  1DD5 A;  4A3D C;  5IYD K;  5CHP A;  5IYC C;  5TJ3 A;  5M5W K;  3TFI A;  1BJT A;  5TMF A;  3HOU C;  4G7Z A;  2ZUF A;  2R93 C;  2XCQ A;  1ZQ1 C;  2JA6 K;  3RZD C;  3PO2 C;  4BY7 K;  4C3I C;  2ZUE A;  3GTQ K;  4AYB D;  1EH1 A;  2B63 C;  3GTG K;  5EGH A;  4A93 C;  1R9T K;  2JA6 A;  2VUM K;  2NVX C;  2E2I K;  4XSX A;  4OIQ A;  4JK1 A;  5IP9 C;  3GTQ A;  3GTG A;  4GTC A;  2JA7 C;  1EQR A;  1PJ5 A;  2FQO A;  5C4X C;  1R9T A;  4BBR C;  4BKW A;  1USM A;  1I50 A;  1SFO C;  2VUM A;  3FOF A;  3RZD K;  3PO2 K;  2E2I A;  4FM9 A;  2WAQ D;  4C3J K;  3RZO C;  4AH6 A;  3GTO C;  2FQT A;  1XZQ A;  2R93 A;  4A93 K;  2GSO A;  2R7Z K;  2NVX K;  3AD7 C;  2GAG C;  2V6U A;  4MEX A;  4A3J K;  2W7V A;  2WB1 L;  1ISE A;  2Y0S D;  3HOX K;  4PAA A;  4A3G K;  2JA7 K;  3CAG A;  1BDF A;  3DXJ A;  4X6A K;  4BBR K;  1WOO A;  1SFO K;  2R7Z A;  2NVX A;  4WJ3 M;  4A3C C;  4Q4Z A;  4KB4 A;  4GFQ A;  5JFE A;  4LK1 A;  4A3F K;  3S15 K;  2JA7 A;  3GTK C;  3GTP C;  5IYB K;  1L0W A;  1SFO A;  2PMZ L;  2NVY K;  3ORE A;  3M4O C;  2JA5 K;  1I3Q C;  3GTO A;  4YFN A;  3N0C A;  2D6F C;  3H3V L;  3BUE A;  3TFH A;  1DCP A;  3AH5 A;  3I4N C;  1Y1V K;  2NVY A;  1PJ7 A;  2NVT C;  1O2A A;  5JVO A;  1VJE A;  3HOY C;  4M1X A;  3GTP K;  1EFW A;  3V4G A;  2RGR A;  1WCM K;  1O26 A;  1Y1W K;  2XCO A;  3AD9 C;  1GE9 A;  1YCL A;  1K83 K;  2PMZ D;  4KMA A;  5IOT A;  1I3Q K;  5E68 A;  3S1Q K;  2JA6 C;  1IW7 A;  1JVI A;  4KDD A;  1XPP A;  3GTP A;  3H0G K;  4LOW A;  4C2M K;  3NUH A;  4GTF A;  4A3M C;  4XSZ A;  1K83 A;  3M3Y K;  1I3Q A;  1R9T C;  3JST A;  4WIL A;  4C3H C;  3GTM K;  1J98 A;  1ZYR A;  3EQL A;  1BS2 A;  3H0G A;  4A3E C;  4KM9 A;  4KN7 A;  3OPF A;  1O28 A;  1X31 C;  4YFK A;  3QX3 A;  1DCH A;  2O5I A;  3S2D K;  5CJ9 A;  5L46 A;  1VLO A;  2XCR B;  1ZVU A;  3GTM A;  3AQO A;  3FKI K;  1AB4 A;  2YU9 C;  1JOE A;  4C3J C;  1WOR A;  4OIR A;  4A3M K;  2A6H A;  2PHC B;  3I4M K;  4BLB A;  5FJ8 K;  4MEY A;  4C3H K;  2R7Z C;  1SMY A;  1WQG A;  3S14 K;  4A3E K;  4YFX A;  4A3J C;  3HOX C;  4A3G C;  2KWA A;  2CFA A;  1F7U A;  4X6A C;  1TWG C;  4NOI A;  2YU9 K;  1YNJ A;  4A3F C;  3VA7 A;  3HKZ L;  4GTD A;  3S1M C;  3S15 C;  1XZQ B;  2V6S A;  3GDZ A;  3TTG A;  5IYB C;  1WOP A;  1TWF K;  1O29 A;  2YU9 A;  3BP8 C;  2NVY C;  3AQP A;  1TWC C;  4OIP A;  2JA5 C;  4QJV A;  4BY1 C;  4KN4 A;  4KM8 A;  3LPX A;  1XXA A;  3T00 A;  2V6T A;  1TWG K;  3HOW K;  1Y1V C; 
#chains in the Genus database with same CATH homology
 1J6W A;  2FQT A;  4XCH A;  1JVI A;  1VGX A;  1JQW A;  1VH2 A;  1J6X A;  1JOE A;  1VJE A;  1INN A;  1YCL A;  2FQO A;  5E68 A;  1IE0 A;  1J6V A;  1J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...