1J9TA

Crystal structure of nitrite soaked reduced h255n afnir
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA02
2DYRB 2VSKB 2UXGA 2Y1AA 3FSWA 3NYKA 1A4AA 3ZX1A 4BWWA 4E9TA 3WKQA 4YSOA 1NIDA 2CCWA 1OCOB 4DPCX 1M56B 2QT6A 3NJMA 2CALA 1OE2A 2X87A 3QJVB 1EZLA 1SDDA 4RH4A 5D4IA 4YSTA 1M9WA 3FU8A 4BXSV 1SHWA 1HAUA 1WS7A 2DV6A 4L0PB 1KYAA 3NSDA 4KO7A 2X88A 5B7EA 3QPKA 1JXDA 4A2HA 2W8CA 3CDZB 4QKTA 3S3CB 2QPDB 3EH4B 1AS7A 2HX9A 2IDFA 2GHZA 4UF7C 1YLBB 2EINB 1XMEB 1A8ZA 4A2EA 1A3ZA 2IDUA 4G7RB 1L9OA 2PP8A 2AFNA 2DWTA 4ENZA 1NINA 3NJJA 3CDZA 1JZEA 1PZBA 1IUZA 2TSBA 1NIFA 2VMJA 3QJRB 3S3BB 4E9XA 4X4KA 2MTAA 5I6OA 4G71B 4PAZA 5EHFA 4GP8B 2HRHA 1OOWA 4HALA 4HIPA 4BWUA 1JVOA 3WNJA 1RCYA 3SBPA 2JXMA 4KO5A 2BW4A 1GYCA 4UANA 2XU9A 4KO6A 5ANHA 2ZOOA 2XV0A 4E9YA 1GS6X 1URIA 3AY2A 2Y69B 4YSQA 2IDQA 5B3SB 1NZRA 3EHBB 1J9RA 1XB3A 4KOBA 1GY2A 3EH5B 3ZIYA 2FWLB 3OMIB 4YVUA 2PPCA 1AAJA 1WA0X 3BQVA 3G5WA 1R1CA 4YSCA 4BK5C 1BXVA 1XB8A 2BWDA 2YAPA 2HRGA 1CYXA 2IAAC 3T6ZA 3WG7B 4YL4A 5PAZA 3JTBA 1AS8A 3FSZA 2W88A 3ERXA 1X9RA 2DY2A 2EILB 3MBWB 2DYSB 1KBVA 1DZ0A 2ZWNA 1RZPA 1L9SA 2GBAA 3ABMB 1AG0A 1KBWA 6PAZA 3V9CA 1MDAA 1PLAA 4KO9A 4KNUA 2WO2B 1KCBA 3T9WA 3ZDWA 2CJ3A 2PPAA 2AVFA 2UX7A 1MG3C 4CSZA 1HFUA 1NIBA 4AKQA 1NPJA 1DYZA 2FT7A 4DP8X 1EHKB 1N68A 1W6LA 3OMNB 3ABLB 2UXVA 4G7SB 1JVLA 3SQRA 1ETJA 4G70B 1GR7A 1OE3A 2IH9A 1KV7A 5AKRA 1UATA 4AX3A 2FQDA 3H4FA 5B1BB 3TU6A 2XV3A 1MZZA 4F7KA 4A2GA 2YAEA 1QLEB 4E9QA 4YSPA 1NTDA 1BYOA 3FPYA 3QQXA 2XXGA 3FYIB 1ZDQA 3QJSB 1ZIBA 1KDIA 2XV2A 5I5MA 1J5CA 1ILSA 3X1FA 1SDDB 2DWSA 2FNWA 1BYPA 1J5DA 1W6WA 4QLWA 2H47C 2I85A 4YSSA 1RZQA 2PLTA 3SBQA 2CAKA 5B1JC 1OV8A 3V9EA 2QPEB 4HHGA 4MFHA 1PZCA 3WI9A 4GP4B 1NICA 2NRDA 1WA2X 1SF3A 5AFAA 2ZONA 2FQFA 1OCRB 3UAEA 4A66A 1W8EA 2YAQA 2QDWA 3HB3B 3NJNA 1SFHA 3NJKA 3PXLA 3PLYA 4HAKA 1E5ZA 1BEXA 1E67A 1IKOP 1J9SA 3AG4B 1MG2C 2HX7A 2VW4A 1PY0A 3AZUA 2BZ7A 3GYRA 4JKNA 4CSPA 1TEGA 3IBOA 1NDTA 4DPBX 1GS8A 1PCSA 2GB2A 1AANA 4KNSA 2YAOA 1V55B 1M57B 2LLNA 2J57A 3CVCA 5B1KA 2P80A 2BZCA 1AZUA 3GXUB 3FS9A 7PAZA 2PCFA 3AG3B 4AKPA 3NP3A 2VM3A 3WNIA 4DP0X 1X9UA 2P80D 3WKPA 3JT2A 2PP9A 4W1TA 2GC4C 3HEIB 4A67A 4F2FA 1ZDSA 1E5YA 2OCCB 3FU9A 4M3HA 2XWZA 2J55A 1JXGA 3DKHA 4N4YB 1PNCA 3OQRA 1HAWA 4HCFA 2IDSA 5LDUA 2OV0A 3CVBA 5I6MA 1SFDA 5I6KA 2YXVA 1SNRA 1GY1A 1E30A 2GIMA 2VM4A 3GDCA 4F2EA 1B3IA 3NT0A 1BQ5A 5E9NA 2J56A 3MX0B 2TSAA 2XLLA 2EIMB 5F7BA 1AQ8A 2BP8B 1L9TA 1ASQA 4YVNA 3CVDA 3FQ2A 3TBCA 5I6PA 1AZBA 1ZV2A 1PLBA 3KW8A 3FPXA 3L45A 4KOCA 3C75A 1RKRA 1AG6A 2BP8A 4GY4A 1ID2A 4UAHA 3QJQB 4BDVA 3S8GB 1ET8A 4NERA 4Q89A 3SBRA 2Q5BA 3ABGA 3IN0A 3OMAB 3NSCA 1QNIA 2FQEA 2EIKB 1PZAA 2PP7A 1QHQA 1OCZB 3CZUB 3EH3B 3TA4D 2XX1A 1IBYA 2J5WA 2VW7A 2A3TA 5I5JA 2Q9OA 3T6VA 1NIAA 1CURA 3PAZA 2FJSA 4HCGA 1VLXA 3IN2A 4DP6X 4DPAX 2JFCA 1L9RA 1NWPA 1TKWA 4W9ZA 2EIJB 2AANA 3NJLA 5I5IA 3RYMA 1ET7A 1ZPUA 3IE9A 4FA7B 4WKXA 1F56A 2R7EB 4GXFA 2UXTA 1GS7A 1JZFA 3H56A 1CYWA 3TASA 3UACA 4WTQA 4P5SA 1V54B 2JKWA 1ILUA 5F7AA 2MRYA 2R7EA 4DP1X 2HZHA 3FU7B 3X1GA 5B7FA 4DP9X 2YQBA 2IWKA 1OE1A 2PPFA 2RACA 2PPDA 4PCYA 4TXVB 2FT6A 4JHVA 3FU7A 4Q8BA 2VSMB 2YXWA 3NSFA 4G72B 3PAUA 1OCCB 4K9JA 1L9PA 1TU2A 1PNDA 4YSUA 3NSYA 3NJHA 4AI7A 1PLCA 4GP5B 5B7MA 4E9WA 4N8UA 2XVBA 3TBBA 1A4CA 3NJGA 1ASPA 4HHWA 1BQRA 4E9SA 5I6NA 1WS8A 2E86A 4YSAA 5A7EA 4ZK8A 4A2FA 4DP2X 2YAHA 3CG8A 2IH8A 2BHFA 3NJFA 3WIAA 1KDJA 2BWIA 4DP5X 1AIZA 1ASOA 3KW7A 1BQKA 4E9VA 1NPNA 1A4BA 2B3IA 2BO0A 2GC7C 3PAVA 1FWXA 2YAFA 5PCYA 1FA4A 1JZIA 2UXFA 4AZUA 1CC3A 2FTAA 3FQYA 2IDTA 3T6XA 4M4RB 1SHXA 2YARA 3QJUB 2QDVA 2FT8A 1TEFA 4A2DA 1GSKA 4GYBA 2GI0A 4P5RA 1BXUA 1J9TA 3T71A 2CBPA 2FQGA 3NP4A 4G7QB 1IC0A 2HX8A 1JZJA 3D12B 1AACA 4A68A 5D4HA 4HZ1A 2I7OA 1WAEA 3ASNB 3X1EA 1AZRA 3S3DB 3NJIA 4DP7X 1V10A 9PCYA 3T6WA 5I28A 1XB6A 1PAZA 4BDVB 1JZHA 4YSRA 1JOIA 3ABKB 5TK2A 3AW5A 3UAAA 2H5UA 1L9QA 3X1BA 4NAJA 2PCYA 4FAAB 3S8FB 5AZUA 4HCIA 4BXVA 2XXFA 1NWOA 3X1NA 2XYBA 1AOZA 1IBZA 3X2QB 5TK4A 3EF4A 1WA1X 8PAZA 2AZAA 3BVDB 1BXAA 2OJ1A 1AR1B 1MZYA 1J9QA 3N55A 3AG1B 2AZUA 4YSDA 2BW5A 2I7SA 1I53A 3FQ1A 1KGYE 1JERA 1ZIAA 2VW6A 2BP0B 7PCYA 1PF3A 3OD3A 4KNTA 3FSAA 3PPSA 3UABA 3AG2B 3IEAA 4NB7A 5I26A 1N70A 2HXAA 1OF0A 2IWFA 4YSEA 3UADA 4EF3A 1AZCA 1PMYA 3FSVA 1SF5A 2XUWA 3UGEA 3QJTB 6PCYA 2GSMB 4E9RA 3FYEB 3PCYA 4BWTA 2H3XC 5IY5B 1JZGA 2BP0A 1AS6A 2XX0A 2B08A 1E65A 1FFTB 5D4JA 2WSDA 1T5KA 5I6LA 1SJMA 1BAWA 1JXFA 3FT0A 2VN3A 2IWEA 3U25A 1ET5A 1KCWA 1NIEA 1ADWA 3ZBMA 3N2JA 4JHUA 2ZXWB 2HLEB 5B1AB 1GW0A 1CUOA 3DTUB 3OM3B 3H4HA 3ASOB 2UX6A 2WO3B 2N0MA 2PPEA 5FC9A 5B1JA 1AZNA 3DIVA 1A65A 4AKOA 4DP4X 2YAMA 2CUAA
chains in the Genus database with same CATH superfamily
2DQFA 3DSFH 3QUXC 4M5SA 2C8NA 4XGZB 2QKIC 1MREL 4K7PX 4M93C 4AE0A 5CEZE 4UAOB 4Z9KB 4BWWA 5GRYA 3SCMA 3OXSB 3QDMA 1GHFH 2X53A 2WIIB 5DVNA 5EBWA 3MN8A 2CALA 3NFNA 5AUMA 1I1AA 5DI8A 4K3DL 3V4LA 4ZTPH 3EYUH 1R24B 4XGZA 5D4IA 3WXVH 4Q9QH 2GQHA 1GYWA 4KKBD 3JWDL 2DV6A 4RESB 2DQHL 3AREB 1URLA 1H6TA 1QASA 3D30A 3OXSA 4YUEH 3LB6D 4LNRB 3QPKA 2WIIA 4O4YH 4XB8A 5KVDL 3A23A 1X5IA 3RA7H 5I1CH 4XTRC 4M56A 5EU6E 3UAJC 3W9DB 1R24A 3L3JB 3HOGA 3JQOB 4LAQH 4A2EA 3AREA 4JVWA 1KIQA 2Y24A 4Y4KB 4XE0A 2J3SA 3MOBL 4LNRA 1D5RA 3IGFA 3A67H 4TTDC 1UOWA 4JRFA 5DRZB 3QJRB 5JA9A 1MFBH 3VD4A 5B39B 3WIFB 3W9DA 2WSKA 3L3JA 4XCCH 5CJQH 3HN8A 4ZMYA 1EZVY 1KN2L 4Y4KA 4XNXH 4HIPA 1TVBB 3NZHH 3SBPA 2AJZB 4HEPA 3VU2A 2FBOJ 1NC2B 5DRZA 1PFCA 5DJAB 1ZEAL 4M7JH 2XWCA 5B39A 3WTYA 5DWUL 3WIFA 4GXUM 2H8PB 3J7HA 1HKLH 1SXBA 4AJYV 1AO7D 2FK9A 1TVBA 15C8H 2APFA 4EZJA 2AJZA 3BESR 2V5TA 2C1OB 2XTJC 3EHBB 1NC2A 5DJAA 4HOXA 4JMXA 3EYOB 4HXBL 2H8PA 2H9GB 4YXLL 1UXLA 5AVUB 4XNUL 3APFA 2H32H 2YAPA 1UKSA 3JVFC 2C1OA 3RTQD 2E27L 3S5LG 3EJRA 1KXQE 1K8DB 4OVUA 5EOTB 4DGUA 2H9GA 2YSSB 3VH8B 1BAGA 2HVBA 1GTNA 2X0WA 4BEIA 5FYKD 4UQDA 4NM8H 3WLWD 1NL0H 3VRLF 1E43A 4XCEB 1T0MB 4I2XB 1K8DA 5EOTA 2YSSA 1HESA 3HRZB 1YEWA 3FN9A 3VH8A 4A37A 4KK8D 2C34A 2VLRD 1T0PB 4NQVB 2E5EA 4G6AD 4XNBA 1HFUA 4BGDA 4WEMB 3KBHE 4XCEA 1J8SA 4LSSH 2IANE 4XNYL 1FH5L 1KCVH 1T0MA 7FABH 4I2XA 5CINH 1OZUA 5AWNL 3HRZA 3IFNH 3KBPA 2DH3A 3N5AA 4MHHI 4NQVA 2ZE0A 4TUKH 1A6UH 3SKJL 2DL9A 1BBDL 5FW7A 1S3RA 2AEPH 1CU4L 2YHGA 4NRYB 5LVEA 1BYOA 1SXCA 3V8CA 2Y3NA 2YLKA 2P5WB 4JQXC 1KDIA 1MW2A 4BSWB 2NY3B 1TIUA 6CGTA 2ZX9A 2CRYA 2I85A 5ESQB 3S88H 3KPSB 4NRYA 4KXBA 5JW4M 1SUJA 2P5WA 4JANB 2ODHA 3SBWC 3OR7B 4KROB 4HOWA 1NICA 4BSWA 5IW1B 4M1GH 4BA8A 4YZFE 5AENA 1N0XL 5CJBA 3MV7D 4KNQA 5ESQA 2Y0SA 3KPSA 3SCMC 3K6SB 3TJHC 1R4XA 4JANA 1GZHA 2N59A 4B5EA 3OR7A 2Y23A 4MMZB 1NMAL 4AJ0A 1B88A 2JF1A 2X40A 3ARBD 2DZEA 1I1AC 3GDBA 3H9SB 3V0DA 5IW1A 2WWMD 2OSYA 3EYVB 1AGCB 1CK0H 2DLFL 4BZ2H 3GJEB 2XTJE 4JK0D 4UAOC 1PY0A 4KQ3L 3K6SA 1XTLA 2I25N 1NCAH 3T0WA 1LK3H 1YCSA 1QSEB 3IJ7A 3DJRA 4M5TA 4MMZA 2DTMH 2AS5M 2DJUA 3H9SA 2C3VB 3EYVA 4OKDA 2B3RA 1AGCA 2OL3B 4Q74A 4J3WA 1P6AB 3GJEA 2HAZA 3AREC 3K74B 5KJ4A 4URTB 4FADA 2RA1A 4HF5H 1VFAB 3DTXB 5E7FA 1QSEA 4JS7A 4MVBC 2F1EA 2C3VA 4ONOA 3PWUB 1T1ZB 4Y4KC 5E1QA 1D7CA 3FU9A 1VFAA 3DTXA 4ZO7A 5KJRL 5TF0A 1OT4A 2YWYA 3BP7B 3LPGA 3AGWA 4ZW6A 2OBGA 2P42B 3VXUE 2A9BA 1DQDL 2VSCA 3H55A 4MB3A 2IDSA 3PWUA 4NQDB 4PRHD 3RY5A 2ADJB 5IFAH 3TEXA 4EZLA 2YUZA 4OD1L 1ZGLP 1T1ZA 4DWHA 1FG2B 1NAKL 2UYLB 4K7PL 1Z5HA 2EEXA 3MVSA 3BP7A 5JTWA 3L3KB 3LN9A 3GKZA 3Q5TA 5E9NA 3MX0B 3OX8B 4NQDA 5AW2B 4RDBA 3S9DB 4KTYA 4OFQA 2XLLA 1EO8H 1JL8A 2ADJA 4AQEB 3CVHL 3MRDB 4NM4L 3QC6X 2VLME 4XPAL 1FG2A 1X5MA 2UYLA 1YEIL 2Q2LA 2C4FT 3QCVH 5DR5H 3GSQB 3EHBC 3L3KA 3MACH 5E94B 5DD6B 1ZVSB 3MX0A 3OX8A 4C4BA 2QGEA 4YAQB 1XR9B 3EYQD 4ZXBD 4P9HC 4AQEA 4NBZB 1AG6A 2VSDA 3MRDA 2J4WL 4I5BB 5DVOA 3GSQA 4FERA 5E94A 3BFWA 4G8EB 5DD6A 1ZVSA 3BUQA 3N44F 4XPFL 1YRKA 4CILA 2OSXA 2R56L 3ABGA 1XR9A 3QPQC 3Q13A 1OAKL 2BSBA 3P77B 1Z3RA 2X1WL 3ZHNA 2C4XA 4GAYB 5JHAA 1T2QH 1KJMA 4I5BA 1PZAA 3GBML 3QDME 4DO5A 3LPWA 2A4CA 4G8EA 4XCFL 2Z93B 3PL6B 2LABA 2VQTA 5L88H 1NIAA 4NO0B 2WSPA 1VLXA 5KYNA 1II4E 4WI2A 1P84K 4GKZB 4OI7A 3HRZC 3P77A 2AK4B 2ZD0A 3GSWB 5DEZA 4ZUTB 4GAYA 5D7SL 1RZFL 3WIHA 3QUZD 2A9NL 2YD7A 2CU9A 2EIEA 2WXOA 3QZMA 2XV6B 1FV1B 1ZSHA 5IEKB 2Z93A 2WUBL 3PL6A 2NY6B 4ZD3H 4M7KL 2UXTA 1FIEA 4NO0A 4UIKL 1DQLL 2Q8BL 1TTBA 2GI7A 4GKZA 4M7LH 1WZLA 1YEJH 2AK4A 3GSWA 3IJEB 2VDPH 5ALCL 4ZUTA 4AENB 1SN2A 5C0RL 4YDKH 1HU8A 1PLGH 3HVNA 5GIRB 4EBQH 4I9WD 4PVMA 5IOPB 1FV1A 3B8SA 4R3SB 5IEKA 2EYSB 4B3EA 4BFNA 3MLWL 5DJDB 3S96A 3X1GA 4DK6A 3IJEA 4PS4H 3N42F 4AENA 4DP9X 1IQWH 4GPVA 4IBZA 3IPFA 4A63A 3ZR6A 3OB8A 1CBJA 5EIIG 1A9BB 2NY3C 2WO4A 5GIRA 2OMBA 3II2A 4B9ZA 5IOPA 3GSOB 4R3SA 2EYSA 3BD4A 2BK8A 1UZGA 1JRHL 5DJDA 1BZOA 3GMLB 1GZHC 3OKLB 4PWFA 4YS4A 4KROC 5HHMB 3BFOA 3TZVB 5F3BB 1A9BA 4N8UA 3TBBA 1CGUA 3EOTL 3GSOA 4GQQA 4WCYL 2CSPA 2FD6H 3VAEA 2Y07L 4M9OA 1XBRA 4EMZA 3GMLA 1T0NB 1IGYB 3OKLA 1KB3A 3AQXA 3TZVA 4MMZC 5F3BA 2VC2H 5CKAA 2EO9A 4XI5D 2BCKB 2BXYA 3KD4A 5JNYB 1DQJB 2BNUB 3RU8H 1XGYL 2YAFA 1H3TA 4X9BA 3CX5J 3EJQA 2EDHA 1T0NA 1IGYA 4M48L 3QXUA 4DQOL 4XN7A 3GKWH 4UQ3B 5E0QA 4L2YA 4FLOA 5IQ9B 3WMQA 3UO1L 2BCKA 2QVKA 1MI5B 4M8UA 4YHIB 1BFOB 3LS5L 1DQJA 2BNUA 2VLKB 3MRKB 2DQEL 1NBQA 1CYGA 1EJ8A 3SE8L 2A6KB 2NY4B 1MVUB 4UQ3A 3T71A 2YOAA 1J11A 3PDOB 5IQ9A 1IC0A 1AACA 1MI5A 4YHIA 5GPRA 1BFOA 3I50L 1YJDH 1HCZA 2VLKA 1PY9A 3L9RB 1F02I 3MRKA 3Q6FB 5DJYB 3TH4T 5B38B 1IEHA 3UG5A 4PR5A 2A6KA 4I2XE 2G3XA 2WLHA 1MVUA 4MZRA 5DQJB 3HG1D 4H88L 4L05A 3PDOA 5M94B 3BH4A 3VD3A 3FUEA 4LPTA 1T03L 1TO5A 2YBGA 4PJEB 2Q1EA 1U91A 3L9RA 3Q6FA 4JFFD 5DJYA 4HCIA 5B38A 1XIWD 3SDXE 2AQ1A 1OAZL 2FHBA 3BWAB 1DJSA 3N3EA 1LO5B 4CVXB 2FLMA 4IEFB 5DQJA 3EF4A 2D0FA 3N43F 1CLVA 4N3TA 1HSBB 1OTSC 2E7LA 4PJEA 2I7SA 1MUJB 2VDMB 3MPCA 3R1GL 2VZOA 3BWAA 2QSCL 4KZEH 1LO5A 4GO9A 4CVXA 3A24A 3EDJA 4IEFA 5D2LB 5JHMA 1HSBA 2FGWH 4X6DB 1AZCA 4HUNB 1NBZB 2GSMB 1MUJA 1Q72L 2EJ1A 3AQZA 5IY5B 1AGEB 2JI1A 3OZKA 4GSDL 4KXDA 3OLEA 3KPSE 1IAIH 1P4BL 3HZYB 2ED9A 2L4OA 3C87A 4PU2A 5D2LA 3NZUA 2HT4C 3VXME 2DWDB 4S1DC 1MAJA 4X6DA 3D3VB 2GBTA 3JUYA 3UC2A 4MZ3A 1NBZA 2H2SD 4UNVA 2ZCKL 3WDJA 5C70A 1AGEA 2MMXA 2WLNA 1HCVA 4M5YL 3ZBMA 3CD4A 3HZYA 4PTTB 2Q86B 3POCA 5CCGE 2CGZA 5DUPH 3MV9E 2WO3B 2DWDA 1HKFA 1ECZA 3PL6C 4IHOB 4ONGH 4X2UA 5FC9A 3D3VA 5AALA 3U82B 3I9AA 1JZ4A 1A65A 4AKOA 4TNWK 3RL1B 2WGNB 5DK0B 2VSKB 1CTOA 2Q86A 1OHQA 4PTTA 1J1OL 2XXCB 4JQIA 4G6ML 4NP4H 4BE6A 1QSEE 3QDJB 2NY6C 4IHOA 1B2WL 5DZ9A 2A0LD 4X6FB 3P3RA 4RIRB 4IS6B 3RL1A 3N6YA 5BS0E 5DK0A 1CD9B 4XX1E 1KMGA 4YSTA 3FU8A 1AVAA 2LTQB 2C7UB 4CGUB 5L9DH 4B3VA 3BKYH 4PWHA 1SQMA 1XV8A 2JQMA 3QDJA 1T1WB 4OFDA 3GLZA 4X6FA 4GQ9H 4PFEA 4RIRA 4IS6A 2IOMA 1XWVA 5CN3A 4NQCE 3Q48A 4H20H 2ZOKB 4UF7C 2C7UA 2HVKB 1MCCA 3LNEA 4FI6A 2DL2A 2NDGA 3BD3A 1L9OA 1T1WA 1AQKH 2CK0H 3MBXL 4L1HA 2NT1A 1XDTT 4ANUA 3V0EA 1OWRM 3TZVC 2JWYA 2ZOKA 5I6OA 1P1ZB 4DW2H 2JNZA 2HVKA 4WHDA 5L7XH 5B21A 1BX2B 2KPNA 1G6RB 5CU5A 3UPRB 3OPZL 4S2SB 1KJVB 5BRZD 4AE1A 3HNSL 3L95B 1L7IL 4WENB 2JE8A 1L0XA 4KO5A 3UIZA 3L5IA 2BW4A 1C5CH 1XXDC 1ID5I 1E90A 3KXFB 1BIIB 1E8ZA 1P1ZA 1KIUB 4YNYB 4ZMWA 1TVHB 2NY5C 4XBMA 1CG9B 2WANA 1UWXK 5I1HH 2WLJA 4Y9BA 4M6OH 1BX2A 2BMKB 1G6RA 3WLBB 3N42B 4S2SA 1KJVA 1BVZA 4MXWH 5IHLB 3L95A 5C08B 1J9RA 2WQRA 1JWUA 3LZFL 2P8MB 2Q3AA 4JO3L 1XO8A 4KK5D 4MCNA 4Y19E 4EN3D 3KXFA 4B9JA 1BIIA 2ILLA 4GG6B 1KIUA 4YNYA 4TVPL 4ORGB 1TVHA 3OWRA 1H3VA 1TO4A 3OC5A 3T3ME 2BMKA 3NA9L 3WLBA 4HMDA 4N2DA 4Z0BH 1C12B 3EUUA 3DARA 4U7KA 3LSOB 5C08A 2FDBP 2NY4C 4AQAB 2P8MA 3S4SB 1RJYB 2OQJA 4OCLC 2VDQB 4DH2A 5DD0H 4GG6A 2JCCF 4ORGA 1RZPA 1ZWIB 4RFEB 1L9SA 2HLFC 5B3JE 1DTUA 2GBAA 2EIZB 1BA9A 2ADFH 3IKCB 1C12A 3IDJB 4AQAA 3LSOA 4KKCC 3S4SA 1RJYA 2BS71 4WTZA 1YPZF 2AK4E 1RUPH 1RSFA 5D1QD 5AW9B 3RX5A 2PPAA 1LTXA 3PREA 5DS8B 1ZWIA 1E27B 4RFEA 2E7LC 3CQFA 4Q14A 3CZFB 5GGUB 2EIZA 1IU1A 3IKCA 3SGKA 3SPIA 5FFGA 3AAZB 3IDJA 2NY0D 3LXAA 1NEUA 1WP6A 1DYZA 5CILL 5DS1A 3F7YB 4DN4H 3MDJA 1DEEB 3ZUCA 2B1HH 5IW3A 4N22A 4RMQA 5DS8A 3HN3A 1W2KT 1E27A 1VF5C 5GGUA 3CZFA 2OZ4A 2FX8H 2HT3C 2X38A 4M6NH 3W56A 1N26A 2ZTBA 1WH0A 2NUTB 3AAZA 4JB9L 3SD5A 3X17A 5DHDA 5HDRA 3F7YA 1QLEB 2GK2A 1DEEA 4ENEC 1QAWA 3FL7A 1NTDA 3FHQA 4HFUH 1T7ZA 1VA9A 2WLZA 1JHTB 1TENA 2ESVD 1DVZA 2XWJB 2M1KA 4JY5H 4X4ME 1QHOA 3X13B 4Z7VB 2NUTA 3JWOL 1K6QH 2G2NA 2KZ1B 2VH5H 1RZQA 4H2CA 4YSSA 2P47B 5AW4B 3UROR 5HHME 1U8IB 3GBLA 1KCSH 3T0EB 2X89A 2YGNA 3P4NB 1JHTA 2XWJA 2OMNA 4MRCA 4NC1C 2YD9A 2YPLD 4XH2B 4Z7VA 1FLRH 5AFAA 1RAMA 4X5LA 1F1AA 1U8IA 5JOPE 4JO2L 3CCHB 3T0EA 3IRCA 1G1OA 2WXMA 3P4NA 1WIPA 2ZKXA 2WKOA 4XH2A 5C0CE 2CJUL 4OGAD 3E7JA 2JJWA 3LD8B 3CFCH 3H3KA 4C4KT 4QHKJ 2XQBL 1FIGL 3ESUF 3CCHA 3SJVE 4JO8A 2G9HB 1YYML 3GSNL 1IAIM 1DCLA 5L6YL 4NUGL 1MI5E 35C8H 4O2CB 2VLKE 4POZC 1FPTH 4MAUH 3RVWC 3RFZB 4N2HA 2LTQC 4F57L 3NIGF 1R5WB 9CGTA 3B9AA 5D8JH 3CU7A 5IW6B 2P80A 1BLIA 2G9HA 1OCWH 3FHAA 3IJ8A 1SDAB 2YXMA 4C57C 2RFXB 4O2CA 3RVVC 3RFZA 3V4PL 4HS8L 4YHOL 1EXHA 1EMTL 4QTFA 1QLFB 2XRAL 5ILTH 3SZKC 1R5WA 3HE6B 4Q6KA 2QADB 5IW6A 1AP2B 2D0GA 2RFXA 4LASH 1RULL 1EPFA 4PJEE 3G6DL 5GRJL 3QGVA 2ICWI 3ZW3A 3QK0A 3MGAA 1S9KC 3WEBA 1U95B 3QEUB 4P23B 1QLFA 4YHMH 4BCXA 1UYWL 1UD6A 3HE6A 5I6KA 2J7LA 4JFED 3V0IA 1AP2A 2QPUA 4ALAL 5EN2B 5LG6A 1S3KL 5SWSB 5TE7H 1DDHB 5E4OA 1DFBH 2QKSA 1U95A 3H3PL 3QEUA 3QWOB 4MB1A 4P23A 3I74A 1E5BA 4FLSA 1RUAL 1SN5A 2ZPKL 5D2LE 4ZS7L 1TFPA 3ZL2A 4LKCB 4X6DE 5EN2A 3LQAH 4IJTA 5SWSA 2F53B 1DDHA 2V17L 4QRQB 2NY1B 4LGPB 1RKRA 3QWOA 4K3GA 3QI9B 4NOFA 5CBAB 2D7NA 3SDAD 4LKCA 1N8ZB 4YFDB 2WWNA 5GRVL 5MHSE 3D3VE 2Y25A 4U3SB 1JV2B 4L3FA 1ZAGA 4QRQA 3TO2B 3QPXL 2YN5A 1JRHI 3V79C 3EO9L 4TSBH 3QI9A 3OZLA 1QNIA 2WYHA 3O6MH 5FOJA 5GSVB 5CBAA 2CKBH 3AACA 3SGKC 4K94C 1N8ZA 3CZUB 4U05A 5KG9B 2DKSA 5KYUB 4DQAA 4OT1H 4U3SA 4F5CA 4XMTA 1GCFA 1IRAY 1OGAD 1AMYA 3TO2A 4KRMB 2CM6A 1NCJA 4I3RH 3OHXB 2A9MH 2XBTA 5GSVA 5E2VL 3QDJE 1IBDA 4X98B 5KG9A 2J5LB 4BHUI 5KYUA 1U42A 1PKQE 6FABL 1DLHA 3CLFH 4TN9A 1CYWA 1GKEA 2MPAL 3OHXA 2V3FA 1A22B 4DEUA 1WFIA 4HWUA 3HAEG 4X98A 2WXNA 5F7AA 1AD9B 2JCCB 3KAAA 2NXZD 5AVXB 2BVPB 2F58H 5JUEL 1IZKA 3KDMB 3EW3B 2F19H 5IQMA 3IKKA 4WF7A 4DKTA 1UXSB 1NMBL 4E5XB 3C09B 3OB0K 4I13B 5F96L 2LOEA 5LCVL 3WFHB 1AD9A 3KYAA 2ALAA 2VWEC 2BVPA 3APDA 4JDTH 2CPCA 3Q2VA 3O41B 4OZFH 3T0EC 3GXNA 3KDMA 1D5IH 3CFNA 4LRNH 5CR1A 1UXSA 2COVD 4OGYH 4XP1L 3K6NA 2YIHA 4E5XA 5IOKA 5KZCD 4PJ5D 5TFSH 3WFHA 4BV1A 3QUYB 2NY2B 4Z3TA 5IJDC 2ISDA 3BH9B 1IE4A 1UD3A 3MXWH 1XSIA 3O41A 1TETH 4XPBH 3FUIA 1F8TH 3KXFE 4NFDA 3VXRE 3MLSH 4DP2X 1FYTB 1SEQH 2DEYX 1CO1A 2WKGA 2CBOA 5AKVA 2WPGA 1MY7A 4OZHE 1A4BA 4Y1AD 3QUYA 4MLIA 3LD8C 1O6TA 1CN4A 1TZAA 1M6OB 3DVFA 4GG6E 4J4PD 3S37X 1FYTA 3ILQC 1QFPA 3O3EB 3FQYA 3U6XS 2O61B 4P5KB 3L5HA 2IDTA 5HYJD 2X1XR 3ULVE 4JFHE 3RFZC 2W9LA 2WTOA 3TCLB 1T89A 4OF0A 1UD2A 5I0DA 1M6OA 3OKYA 2A4EA 4KK9D 3B5GA 3CN3A 3SOTA 4OLYL 3JWDC 1BXUA 4TUJB 2R29H 1JYNA 3O3EA 4XMLL 2O61A 2L04A 4P5KA 5I74B 4TNVK 3BN9D 2D2CC 4ZUSB 4JBSA 3D12B 1BJ1J 1JZJA 1WFMA 3EYSL 2MOGA 4HZ1A 1PQZB 1BZDA 5CKGA 2ZIDA 3TCLA 3L4ZA 3QORB 3HE6C 3NH7L 4AYBA 4XBPB 2QADC 2NY5H 1E4WH 5HHXL 4TUJA 2V5SA 3QW9A 4ZUSA 5CN2A 3KBEA 2Z31B 2VDKH 4G80B 4FCHA 4R26L 2H5UA 4DK5A 1PQZA 4PB9H 4F1ZA 4P23C 1RZGB 2PCYA 3IRZA 5B22A 4FAAB 3QORA 4XBPA 1N5YH 3M1OA 1BF2A 2GUOB 2E9WA 2CBMA 2GTWB 5CSZB 1X4XA 3X3GL 5IUSA 2M8XA 5FPIA 5A16B 1NFKA 2R2HB 2Z31A 1MZYA 2V7HB 3P11H 4G80A 4TQHA 3K6DA 3TTYA 3VSQA 1RZGA 5T8IA 1UQSB 3TGXA 3TWCL 1I3RB 4HPOL 4BINA 4HT1H 4ZOEA 1EXGA 5KAQG 3FSAA 2GUOA 2GTWA 3CVHB 1OAJA 3G5VB 1ZA3B 5CSZA 1N70A 2OYLA 4DIXA 5IROA 3QSKB 5C09B 2Q7NA 5A16A 1L3WA 2R2HA 2ZYRA 1PMYA 2V7HA 2NY1C 1J1XH 2XKSA 4Z7VE 4JFYB 1UQSA 1I3RA 3DGCR 3N0PB 4I77L 4ADIA 3QI9C 4IBVA 4WFGE 1TLKA 2VWEE 4JRXB 1MJ8L 3WMPA 3CVHA 1DVFB 3G5VA 1ZA3A 4ELMF 5C09A 2I9TB 3B2XA 1IGMH 4DGVL 3F8UB 4LQFH 2JMRA 4GQZA 2WP3O 1WYJA 1NIEA 4JY6B 3U0WL 4YHKH 3G7TA 4JRXA 5AQ0A 1DVFA 4WNJA 3BVNB 1KV3A 3T4YB 4U1NB 3T8XB 2CNZA 3FQNB 5D9SB 3MLRH 4M6MH 4CBPA 5C9KA 4FTVB 4WJG3 1CLZL 1FL5B 2ODIA 5CF3A 3OHXC 4JY6A 3JYCA 1KC5L 2WVVB 1P7QD 3US9A 1FQ9C 3BVNA 2J5LC 3NYKA 1VHPA 1TXKA 3T4YA 3FUNA 4U1NA 2KERA 3FQNA 5D9SA 5LBGA 1MRCL 3T8XA 1H5BB 3IWVA 2ZYIA 3NAAL 4FTVA 4KRLB 1FL5A 4R7NB 4RSYA 5C2UB 3ARFB 4FQ2H 1M7DB 3ESPA 4GI6A 2B39A 4GUQA 2DKMA 2F8OA 3HI6H 5GZNA 2FB4L 5KEZA 1MH5A 4DERA 1HCFX 4LGRB 3LPOA 3OKOB 3VI3B 1KCRH 2VDRL 3BP6B 1H5BA 4R4ND 4R7NA 2Y72A 3KLHD 2W8CA 4FG4A 4JQIH 2QPDB 1QTPA 3LIZL 4BH7B 1H8NA 4QRRB 3ARFA 3MKKA 1M7DA 2YPVL 3TA3B 5EO9B 3C09C 1SUHA 4WI9A 4LPXA 1XSOA 2EEDA 3OKOA 3VI3A 2AJSL 1J8HD 1E7UA 3BP6A 5SX5K 3KM1A 1TPXB 4IMLB 4BH7A 1U8NB 4QRRA 4KU1A 4QGTA 4MJJA 3TA3A 1DO5A 2VN6A 2WCPA 3HFML 5AOMA 5EO9A 4JNXA 4I48B 3DIDA 4S0TD 3HBPA 2NY2C 3HN5A 3QUYC 1A1OB 3RPKA 1JZ3A 1GIGL 4Z7UE 1ACYH 3H42L 3WNJA 2QQNH 4L8SB 2EDXA 1QKZH 4JG0L 3ZHKA 4IMLA 4UILL 1U8NA 2KS0A 5FUZH 2ZAGA 4NZTL 1A3RL 4I48A 4KO6A 1CICD 4KPHL 2W5PA 1A1OA 2VXTL 2ENJA 3BDYH 1T89C 3CHSA 3U1SH 5KVEE 4P2QB 4L8SA 1H15B 3TV3H 4ZMOA 4LPUA 4WNSA 3IBEA 4D0CB 4GH7B 4JZNB 1HT6A 2QQLH 3CBJB 2DQJH 1OD7A 2B16A 4Y2LA 3G5WA 3BPOC 4YHZL 3OAZH 1QSFB 2GIYA 5EN3A 2EDFA 1BXVA 3COOA 2EDMA 1BZQK 3S97C 4F5CE 5LXGH 1AQMA 4P2QA 4L8BB 5J6HB 1H15A 5GS0D 4D9RD 1AKJB 5AW6B 5C2BH 4D0CA 4JZNA 3NRPA 4M62H 5I74C 1EVTC 3F7RA 2ZAHA 2EUVA 2O6CA 1QSFA 5GRWA 2MCG1 3QORC 4Z7QE 5J6HA 5G4NA 4L8BA 1HSAB 1AKJA 1TCRB 2LU3A 2XWDA 1AFVL 2D0HA 1TTRA 2Z31C 3ESOA 4Y1SA 1QRND 3FT3B 1XFPA 1HSAA 5K33A 1C5DB 4H7VA 1XH0A 1TCRA 1WFNA 2BDNH 3AMKA 5IROC 3ULVH 2XBDA 2N3JA 1B0RB 1KTLB 5HP5A 4KK6D 2AJ3B 3S37L 1OP3K 4KJWD 3S5LA 3FT3A 5C6TH 2JLLA 1C5DA 1MZZA 1L7TH 3NCYP 1CLYH 3X3FH 4AM0Q 1B0RA 2XXGA 1KTLA 2VXUL 5EEVA 1NCCH 2AJ3A 3HZMB 1ZIBA 5IB2B 5HGAB 1SDDB 2DWSA 3FU5A 3RIFF 1BWMA 4NZRH 1DVFC 2OZ4H 2CPUA 3K4ZA 5FM5O 3DSNB 3TWYA 1CBVH 3HZMA 3L48A 1SMAA 2AW2A 3F7PC 1EHLH 2LAGB 5EORL 5IB2A 1WA2X 5HGAA 1G1KA 3SKNB 1DQIA 3CXDL 1JTOA 1PJWA 4JPIB 1VEOA 1FAIL 2AQ3A 3B7SA 3CTTA 1FYTE 1KB9K 3DSNA 1HX0A 1JMXA 1GGYA 4LOFA 1U4EA 3NACL 2XTLA 3NJKA 4TPRH 4W4NA 3TCTA 1HZLA 3ZO0A 3IDIB 3MODH 5I0ZA 2DMGA 4F8PA 2BSEA 3SKNA 4B9YA 5M95B 4GAGH 1CI3M 5GZNC 1V3LA 2J20A 4JPIA 2HX7A 4KRPB 2ZP0T 4HJ0C 1YEDB 1TDQA 2X09A 3TFKC 1H5BC 1IT9L 4K9EL 3IDIA 3IB4A 4YBQD 1SLVA 5J11B 3ARFC 3SOBH 4E68A 2Y22A 4YK4B 3UMTA 1CL7H 3DIFB 4KTDL 3IDYB 3SDXF 1YEDA 2VQUA 3CVCA 3N91A 5B1KA 3VYPA 2Q7YB 1BWWA 1BQSA 1EGJL 2RGSA 2WLMA 3P4LA 3TA3C 3VQ2C 3MNVB 5J56B 4BCYA 1QBMH 4L1LA 4KTEL 4L4TD 4KKLC 3HEIB 1RH8A 4ZS6D 1KPRB 2ZOWA 3LKPB 2H1PH 2J55A 3PY9A 2Q7YA 5KOVC 1TPXC 4WW1B 1WHPA 3RUGA 4BRVA 3MNVA 2VJXA 4DO4A 1T7VA 3ZDYF 4TQEH 2A83B 4R8WH 5I6MA 4RGOL 1KPRA 3LKPA 4ZAKD 1DQVA 1S7TB 2APWA 5K39B 1KZQA 4P4KD 5F2FA 4L8SC 2OJZL 4FHKA 4QI3A 3ZIMA 1LE9B 4WW1A 3MLUL 3VFWB 4TKWA 2NPLX 4ZW5A 3VQMA 2K6WA 2EIMB 3Q5YA 2A83A 5F7BA 1WDAA 1MNUL 3VJ6B 1L9TA 5C09E 1YG9A 1S7TA 4I1NB 4N8CL 4XPGL 2IXQB 5K39A 2C9XA 2P24B 5I19L 1LE9A 3VFWA 3KW8A 3CSBA 3MA9L 3P54A 4OCWL 1ZV5A 1KN4H 4JRXE 3UTPE 3VJ6A 3Q2LA 4FDWA 4UM9D 3V6BR 4TULH 3ZRSA 1B6UA 2IXQA 4PJ7E 2ORBL 4KKNA 1Q94B 2BNQB 4XT1C 4UAHA 4BDVA 4XMKL 4DGWC 4P46D 1XGUB 2P24A 5AW7B 5DMKB 2NR6A 4U33A 1X4YA 3LRLA 3SBRA 2VR5A 5FHAH 1H6UA 1MW1A 1TKWB 2QZQA 2X2UA 3GRWL 3NSCA 5E1AB 5HHVL 1ZLVH 5B4MD 3UTTE 1Q94A 2BNQA 2OMUB 3HC3L 4L9LB 5E2TL 1XGUA 3O81A 1BFVH 4FTVE 3KM2A 5DMKA 1KGXA 1FN4B 1F6LL 5JDJA 2LLLA 3IN2A 3U2SB 4IDJL 1NOAA 3GINA 2YQ2A 4EI0A 1TKWA 1UD4A 5E1AA 5KVEH 2H0PA 1HEZB 2F7QA 3AM8A 3G6AB 2OMUA 3R18A 4L9LA 4CAGA 3BP4B 1OPOA 3TM6A 3KPRB 3WFEL 3BW9B 1FN4A 4HJ1A 2HJFB 4YXLH 4UTAL 1XBDA 4JKKA 3U2SA 4B9GA 1HEZA 1EO5A 5ISZD 1JHKL 2E27H 3G6AA 1NBVL 4QEGA 3WY3A 3VI3E 3BP4A 4L3ED 4GQPH 3KPRA 3BW9A 4L37B 4M5ZH 3DMMD 3I6GB 2HJFA 3QZNA 2AJUL 1BMGA 5GGRY 1GPOH 3BPNC 3CFJB 1BQUA 2CO4A 3QNFA 1R3IH 3BDBA 4FL4B 4JRYB 4QUOA 4YEFA 3GJFB 3MRFB 4Q56A 2Y2YA 1XEUA 2FT6A 4L37A 2KDYA 4Q8BA 2OYKA 3I6GA 3B2VL 2P8LB 3N41B 1GVIA 1MFMA 3CFJA 4K5PA 4A04A 4JRYA 1KF9B 3BXNB 4FZ8L 3GJFA 3MRFA 3T3MF 4I3SL 3TBTB 2Z7WA 3NFSH 5D72L 2P8LA 4Y2DD 3PP4H 3QCUL 4LDCA 5F7YC 4DAGL 4GRWE 3ME0B 1CS6A 3QRFM 2Z4TA 4MS8C 2ZJSH 4HOZA 1OARL 3BXNA 4FG0A 4K3JH 5D2NC 1BBDH 1JNLH 3PWPB 1CU4H 3TBTA 2CBTA 3NESA 3ZGHA 4LL4A 3MJ9H 1WCQA 2CO6B 2VDOH 1XGPB 3ME0A 2ZNXA 1FNFA 3IU4L 2EC9U 3HC2A 3REVB 5J11C 3GSNB 5C0AD 4Y4HD 1CD8A 4YK4C 3PWPA 1NCBL 3D85B 5IBLC 3IDYC 5BZZA 3QYCA 4GBXB 2OW7A 1TZ8A 2X41A 4FYQA 5F3HB 2CO6A 5IHUL 1XGPA 4P5RA 3BAWA 2X6BA 3DYPA 3DBXB 3LH8A 3QNXB 3REVA 3GSNA 1CE1L 1N0XH 2XZAH 4F8LA 4FI7A 3ZHLA 2P5EE 2WXFA 4NZDA 3D85A 1T83A 3NEXA 4Q52A 2O5ZH 4GBXA 5FHBH 5F3HA 1Q9WB 1O9WA 4HGWB 4AGMA 2L0DA 1JOIA 4XC3L 3V2AR 1AY1H 2DLFH 4OCSH 4ZMPA 4C8XA 5F7HA 4Z7IA 3DX2A 4H44C 3SODB 3V4PA 1Q9WA 1XH1A 4HGWA 1RU9H 4FA6A 2QHRL 2VNCA 2KYIA 3V0WL 5J1SC 4C55A 4YPJA 4Z78B 1LO4L 5EB9A 2O30A 4XN9A 4ZNEA 2CR3A 5E2WL 5I73B 3VVWA 5HDBF 3M7OA 5I8OL 4NRXB 5DD3L 3AG2B 4LOEA 3C60B 3KL5A 2NR6C 5E2UL 1Z2KA 3IGLA 1T66C 1BZEA 2EXYD 4Z78A 2XUWA 3ARGD 5JXAL 4E9RA 4E42B 2IO5A 2EEAA 1JF5A 3FYEB 3I6LE 4JFSA 1JZGA 4NRXA 2DI7A 3LHPL 5HI5C 3C60A 4BA0A 2D7TH 4KVNH 5IESL 2F54B 1CWVA 4GO6B 4B6ZA 4E42A 1NAKH 1G7HB 4K7PH 3QJZA 4MYPA 2R0WH 3AM8C 1BEYL 4YX2L 4F8OA 1HI6B 3D25B 4L9LC 3QUHA 1F0LA 1TSHA 2WZ0A 3ZE1F 1NBCA 5D2NE 2R51A 1ODUA 2D4FA 1IGFL 1G7HA 1MFCL 2IFGA 3AS2A 3TO4D 3WEXB 4F9LA 1ZK5A 2HRLA 1AI1L 3MRRB 4XCNB 1UZ6E 4J27A 1HI6A 3FSWA 3D25A 1NUGA 3RVTD 5ITBL 3F84A 4YSOA 1ZT4B 4WEUD 1A6WL 4DPCX 4KGLA 3IGKA 2AC0A 3NJMA 2J4WH 3MRRA 1P7BA 4RMRA 4XCNA 4OD2B 1CQYA 3RWIB 5DVKA 5D7LB 1NFDE 4AYDC 3O11B 4L0PB 1KYAA 3NSDA 4AEEA 5CP3A 2RTTA 3LNGA 1OAKH 4AEFA 1ZT4A 4LL1A 4K5LA 4FRWA 3RUGE 3MFGB 3U6RB 1NKGA 1XF4B 2JJVA 4K3HA 2LVEA 3RL2B 4FFYL 4FL4C 2WAHA 4OD2A 3DOHA 4PRAB 3RWIA 1MQKH 5D7LA 1A3ZA 3O11A 1QSZA 3I9GH 3JWOC 3RNKB 2GTQA 3G5XA 3NJJA 5D7SH 1XF4A 2J8OA 3U6RA 4A2MA 4ZQTA 5KSAB 1IKFL 3RWCB 1J0YA 4K15A 5HDOA 3RL2A 2A9NH 3CMOL 4PRAA 4Z0XB 2WUBH 4RBPH 1FG9C 1OLLA 2Z3FA 3KWTA 1T2JA 2HRHA 3LNIA 1DQLH 3HZVB 3LRHA 2Q8BH 1ADQL 3RNKA 5C0RH 3GXTA 5LCVA 2VAJA 3CZKA 4FFWD 4KAQL 1FVCB 1X5GA 5KSAA 3RWCA 5F1KC 3QIWD 1CR9L 1PL3A 2FEEL 3VFOB 3GMOB 2YD0A 3KCWA 5ANHA 4Z0XA 5KS9B 3MOQA 2OTUA 3SQOH 3TT1H 5GZOA 4N68A 4FHJA 3MLWH 3HZVA 4P2YA 1CPUA 3U9WA 1FVCA 1U2CA 2OK0L 3EH5B 1YAIA 3ECVA 3LKRB 1MXGA 3VFOA 3GMOA 4U3XA 4TVPE 3RWDB 5KS9A 1UUSA 4UQEA 2BNQE 3DHUA 3F7LA 1T83C 1MCQA 4U31A 1PW3A 4GBXC 2P28B 4PLJC 4IQHA 2K1MA 1VFOA 4UT9A 1JGUH 3I84A 1RP9A 3LKRA 1OM3H 3STLB 3EOTH 2BSCA 4NAMA 3RWDA 4AVIA 1C8PA 1DN0B 3A6BL 4GRWH 4JM4L 4HW6A 2UVEA 3U6XA 1BF8A 3K8MA 4ODXB 4JG5A 4NUJB 1YYCA 4FCAA 1P4IL 4NNXB 1CFVL 3KR3L 4LLQB 3STLA 3T2NH 5T3XH 1TEYA 3F58L 3BQUD 1LO2H 1DN0A 2IG2L 2ATPB 3KPRE 4DQOH 1V3KA 2CH8A 1IM3D 5KJ7E 2B59B 2EZ0D 3G9AB 3FAWA 1T4KA 1N68A 4ODXA 4FKEA 4G9FB 4NUJA 4NNXA 4QGYA 1GC1L 2CDEA 3CXHK 4G7SB 3GJFK 4LLQA 3NTCH 4ALAC 3NCMA 4Z7NF 3CFKB 1OP9A 1CLCA 1KJ2L 3M8OL 2P7TB 2ATPA 2F53D 3NIFB 1YEGH 2HN7B 2UWEB 4GMTH 4LSDA 2MEJB 3SE8H 5ACLA 5C6WH 1Q38A 5I73C 3ATDA 1MFVA 2B59A 4KUCF 4V11A 1TTGA 3L5JA 2PYEB 5KBDA 3RWEB 4G9FA 3N1GC 4E9QA 3C60C 2X5PA 4KKRA 3QEGH 1F4WL 4JRYE 5CIPA 3NCJH 4KQ4H 1QTYT 1ZE3H 3ZTDC 3CFKA 2P7TA 2HN7A 2UWEA 2IBZX 2VXQH 1TJGH 1SVBA 3SY6A 4OZHF 4F58H 2FNWA 4BQBA 2BIQA 4H88H 1W6WA 2PYEA 4NNPL 4QLWA 3RWEA 2BVTA 1XCTB 4LCWB 3HVDA 3B34A 2FO4B 5T5FH 4LEXH 3P3UA 1NM4A 4HGMA 3V9EA 4QHMB 5IIEB 4RISH 1OAZH 4I8DA 4A6YH 1L6ZA 1CVRA 4F9LC 5AYUH 3ULVF 1AE6L 1QOKA 5FR3A 3EJZD 1XCTA 4LCWA 4FLRA 2FO4A 2CO1A 3FF7A 1CTNA 2V7NB 2QDWA 3ARDB 1DSFH 4FGMA 3R1GH 3AITA 4QHMA 5IIEA 5HDBB 3FTVA 4CL7A 3PWPE 2YJLA 2DQUH 2ZXBA 1XD1A 4NN7B 4DKFH 1FYHB 1D9KD 5I5RA 3QHFL 1EQWA 2V9TA 4HIQA 1THCA 3RGVD 2V7NA 2ZWYA 3ARDA 3GI9L 1Q72H 3THML 2G9KA 2GB2A 5A6LA 4MJ6A 3K1DA 4ABWA 2WWOA 4LCUB 4JE0A 3QUML 3HB3D 2DM7A 3FW6A 1X4ZA 4IBYA 4UUJB 1U3HB 2I07B 4UQCA 2QBWA 4RRPA 3CSGA 4L23A 5HJGA 4M5YH 4AKPA 2VDRB 4LCUA 1BCIA 5IFHH 3Q2NA 1ZT1B 1KBGL 4JFOB 4RZCB 4PRPD 3RWFB 1DBAL 4H0IA 2W95A 1RZKL 4UUJA 2I07A 3S36X 3VYOA 4BK4A 2PF6A 5CMAB 2F1AA 5IGXL 5KSAC 5F70A 4P2CG 5F7FA 3MI6A 3AS1A 1D2OA 1ZT1A 4JFOA 1M05B 3LIZA 4RZCA 3RWFA 3MRLB 1DN2A 1PD1A 4RFOH 2YPVA 2H4EA 2YUWA 2N4IA 4X8GA 5GZOC 1F3JB 1D7FA 4WI6A 2GIMA 1U8PB 2XKNB 5IFJB 5C1MB 1R33A 5CMAA 1XMWA 5I1GH 2J71A 3WY1A 2L7UA 1NUFA 4E9LA 1OD9A 2YGVA 4UV7H 3H1ZA 3U7YL 1M05A 3GZQA 3MRLA 1U8LB 3TYGL 2BSTB 3X11B 1F3JA 5GRVK 2GG1A 2XZCL 1CIUA 2DWYA 4HU2A 1U8PA 2ZKYA 4PBVC 4ZNCD 5CCKL 5IFJA 4N86A 2WTRB 4G6KH 2E8YA 4AK1A 3DI2B 4NPJA 3QZLA 4R5XA 2ZAIA 3BT0A 4ZMNA 1U8LA 1DQMH 2BSTA 1N4XL 3X11A 5BVPL 5JIHA 5HGHB 1ACZA 3DO3A 5E6SB 5T1LD 2WTRA 3FOLB 4NNYA 1L0PA 1YNTB 2ICWJ 4JPKL 4MS6A 2WBWB 3UBXG 1DLFH 3DX3A 1TTUA 1E4XL 2ZYSA 1VEMA 2BSDA 3NBNA 2YD2A 5HGHA 1XEDA 1OCZB 1N10A 2XX1A 3FOLA 1VCAA 4FNRA 4ZFFB 1YNTA 1ZANL 3O0RL 2K78A 2DM3A 1HCYA 4XVUC 3B9KB 3K4DA 1Z0NA 3T6VA 5DJ0B 2FJSA 3FZUC 1S9WB 2F7RA 3ML8A 3RZWA 2Z7UA 1IL1A 1VENA 4GAJH 2BY2A 3UYRH 4W9ZA 1ET7A 4QTHB 5C0BE 4FX5A 1T5XB 3B9KA 4TVPH 4XB7A 1XX9C 5DJ0A 4O02B 4M4PA 1IM9D 1S9WA 4EAEA 3NA9H 1MCKA 1HOEA 1IGIL 4PS8A 5IJVB 5D7LE 1KGCE 1LM8V 1EVUA 4HZLB 3GQFA 1WQVT 1ORSB 4QTHA 4U1JB 1N3NB 3D08A 3BAKA 4X6CF 1T5XA 1ZOXA 3L7FB 5A2IH 4O02A 4Z7UF 3B2DC 2NZ9D 1WZ1H 3KG5A 1A4JB 2IWKA 4QHPA 8FABB 3KZ8A 3D8MA 5IJVA 4HZLA 2Q20A 5BPPA 3SDDB 3L17A 1ORSA 4LSVL 4U1JA 2X4RB 2OAAA 4PCYA 1N3NA 4PLKD 2X9WA 1WVZA 2J21A 3L7FA 3CZLA 3HS8A 3L81A 2R2CA 1A4JA 1G0DA 8FABA 3HAEB 4XAKE 3WBDA 5CILH 3UX9B 5DFTA 3SDDA 1BW8A 4W9IC 2X4RA 1HE7A 2EABA 5IQ7L 2E7CA 1CDGA 3ARDC 4ZBJA 4ZPVA 4JKPL 3HAEA 4PV8A 5KS9E 3EYFB 5AAWA 4NN7C 3SDCA 2JJTA 4C47A 2OULB 2Y6SD 5HTSA 1JGLH 2H6OA 4YR6B 5EOCL 4Z7QF 5FYKL 2I60L 4PJXE 3SD2A 3D05A 3EYFA 3JWOH 1WSST 4MNQE 1NGQL 4JHBA 4YR6A 4KZ0A 1ULVA 2MNJB 1J18A 4JW3A 4B27A 2ROYA 5DEJA 1XL6A 4WW2F 3NABL 3Q1SH 3ZE2B 4XB3A 2QVIA 3P3YA 1GCYA 2OYPA 1SYVB 5EU3B 3E8UH 4APQD 5DUMH 2OW6A 4JO2H 4XC1L 3QA3B 3CBRA 3SGDI 4DP7X 4XAWH 4I1PA 4JKMA 3DECA 1CFQB 1IEAB 1UG9A 3L7EB 5IT2L 1A21A 3ABKB 4LDOB 4HWEL 4MJ2A 1SYVA 5EU3A 1GGIL 1ZLDA 4UDTB 3STZB 3D4ZA 3QEQB 4KDWA 3V10A 3S8FB 3RZCD 3QA3A 3PABB 4PM1A 4G9FE 5E5MB 2DICA 5L6YH 3WNPA 3MUUA 4LGSB 1V7ML 1CFQA 1IEAA 3L7EA 1GMIA 3HRPA 3BAXA 3BVDB 2DMKA 4RX4A 1NM9A 2BIMA 4L3CB 4MA3B 4AGNA 1R9FA 3SEPA 4UDTA 4P49A 3QEQA 4M00A 3ARWA 3LH9A 4QXGL 4LCYB 5SWZE 2JTDA 3PABA 4FQ1L 2BP0B 2J1YA 5E5MA 3QQ9C 3PPSA 1Q0XL 1QSFD 5ID1B 3B6SB 5I26A 3UJIL 1BV8A 2I5YH 1RV6X 2VITB 3IMRA 2BNRE 3GMRB 4HS8H 3V4PH 4YHOH 3WAJA 4L3CA 1SF5A 3N0AA 3BKML 4KJQD 3RDJA 1W72L 4LCYA 2G5RA 3MXVL 3VGEA 4BWTA 2BP0A 3AS3A 4EIZC 4GI8A 5ID1A 3B6SA 2V5MA 3G6DH 5GRJH 5TGBB 5FV2A 3S36L 2VITA 3GMRA 3BKJL 3OAYH 2J1ZA 1ZHKB 3VWJB 1ZLEA 1H3GA 1XF1A 4TQ8A 4M1DL 3H6AA 5EULV 4IRZL 2CD0A 3T4AB 2HLEB 5TGBA 3ZKNC 3B9KC 5H8DA 3T8MA 4UZSA 3OXRB 2VZ3A 3VXPB 1ZHKA 3VWJA 1OSYA 1I75A 1RUAH 4J39A 3PXJA 4TTGA 5ALBL 4JM2F 1A7PL 1NPUA 2PW2B 1JP5A 1EEQA 1E4HA 3T4AA 4B60A 1CE6B 1IFRA 3GRWA 2VZUA 3DUHA 3UH8A 1DJHA 3OXRA 4WAFA 4OGXL 5CJ5A 3VXPA 3QS3A 4GUCA 3BKCH 1EZLA 2PW2A 5I9QC 1WTGT 1M9WA 3FTXA 4PLNC 1CE6A 1JGIA 2FATH 3P0YL 5C9JB 3HI5H 3MJGX 4FKHA 3CNKA 4J1UB 5B7EA 5D7IF 3EO9H 4QKTA 3NRFA 4Y2NA 4GS7B 2COQA 3RY4A 3SDDC 3UTQB 5C9JA 1KIPB 3KJ4B 4DZ8B 4PJFB 1TOXA 4J1UA 1FNSL 2DWTA 4LARH 4WY7L 1SEBB 2TSBA 2Y7LA 3CN0A 4YFEA 3SDCC 1A6ZA 1VFBB 2CGRH 2MTPA 1MCDA 2JJTC 5EHFA 3ROOB 1KIPA 2VXVL 4DZ8A 4PJFA 4U3CA 4PHZA 4PJ7F 2MPAH 2DYPD 2XG5B 2BSRB 4KRPD 1KGWA 1SEBA 3A21A 2F61A 2GSGB 1VSCA 5A40E 5TE6H 2ZF9A 4E9YA 4LP5A 1VFBA 1YMME 3PP3K 4S11A 3ROOA 2XTJD 4IKIA 4K71B 5JUEH 2XG5A 2BSRA 1RZ7L 4A7QA 4W93A 1GY2A 3I02B 2DDQH 1FC1A 3MJ6A 1O6SB 2GSGA 5F9JB 5F96H 2FWLB 4XZ4A 3SPHA 4FLQA 1WC7B 2A6DB 4K9EC 4YSCA 4KJPD 5D55A 3QUKB 3ILDA 5EC1B 3GWJA 4YO0B 3I02A 3V9FA 5F9JA 1O6SA 2SODB 4V2CB 4NQEB 1WC7A 2A6DA 4K5NA 3GSRB 3QUKA 5EC1A 4TUOB 4YO0A 5DRNB 4DKDC 1GOGA 1B2YA 5C86A 2WO2B 2DB8A 5GJTL 4KMTL 1KCUH 5A3ID 1QTSA 2FRGP 3GSRA 2K6ZA 2J1WA 4X7CC 4TUOA 5DRNA 5MENB 4CSZA 3CFEB 3HS0B 4ADGA 4P8QA 3UTSB 5IVNA 4PD4K 4UINH 4BM7A 4F3FB 5DO8A 1FFRA 4WW2B 3BAYA 2VLMD 4KVCH 1TZHA 3BGFC 5MENA 4G5ZL 2E6QA 3CFEA 3HS0A 5DEGB 1A1MA 1W80A 2EEBA 2NX5B 2Y9RT 1T1XB 1YN6B 1I1FB 3EYSH 4FKKA 3UBGA 3UTSA 4LE8A 4GRWF 2ED6A 4F3FA 1AZZC 3EJUA 5H37A 5JYMA 2APTA 3NH7H 4YXHH 4QRPB 5HHXH 4H40A 4FG2A 2N56A 5DDHB 1BGXL 2AGJH 5DEGA 2FYYB 3O4LE 1S4IA 4XWOD 1D5BA 2NX5A 1TQBB 1T1XA 1YN6A 1I1FA 2WQSA 4ZRGA 4IBWA 4LFHG 4N2LA 2V4LA 4HHGA 3VWJC 1RIUL 4Z3EA 1EJOH 4QRPA 5CIPH 2FJHB 5DDHA 1GXEA 2FYYA 3T4AC 1CGVA 3U9PL 5E95B 4LSPL 3FMGH 3MJ8B 3PGDB 1SFHA 3CFMA 3IRPX 4XO8A 2GJZB 5SX4I 1U58B 5GISH 2FJHA 2V8MA 3GB7B 3WEMA 5JLZB 1L9NA 3RVUC 3QIBB 2WTPA 2WXQA 3K0YA 4HUVA 3QJOA 3MJ8A 4JGNA 3AZUA 3PGDA 3UGUA 4F27A 3PHSA 4I77H 4YN3A 2GJZA 4Y5VB 5IREA 1Q1PA 1U58A 2V3EA 4EXKA 1MJ8H 1WD9A 1MCBA 5JLZA 3GB7A 4ZOBA 3HHMA 1I9IL 5D1XD 4XVJL 4HJJL 4NS0A 4D0DB 4DGVH 5GS1B 1X5XA 2GY7B 4MA1B 3KWXA 5D71L 4FYSA 1UA6L 3O6LL 4JPQA 3T5WA 2H6UA 4A1RA 4Y5VA 5AB0A 4RGNB 1J48A 1LILA 5E99H 2ENQA 4GS7C 2CHXA 3F7KA 4AGOA 4XN2A 1UXWB 3MUHL 4ONHB 4PJHF 5I1LB 4D0DA 4AMKH 2Y7MA 3BLBA 5GS1A 5L4FA 2GC4C 3BAJA 3KJ4C 2OLDA 5TPWH 4F2FA 2JQAA 1BSIA 1E5YA 3DX0A 2Q10A 1SGKA 1OB1A 4UB0L 3H9YA 3T6QC 3QEQE 4DVRH 1BQLL 1HAWA 2B2XL 1UXWA 3QHTC 1K5NB 3GS0A 4ONHA 5L2KE 3BWSA 3CVBA 4ODTH 5I1LA 3RVXC 1WE5A 2F2HA 1B9ZA 5IF0B 3G08B 1N2RB 3WENA 2D03H 1B3IA 2DAVA 4WLCA 1IC4L 5DK3A 1BVOA 3HG5A 2J56A 4KITB 1UM4H 4YOKA 3N06B 5JHDB 1K5NA 5J3HD 3IJSB 4QYOB 2X3BA 3CLWA 1CI5A 5D7IB 2R15A 3BVXA 2BP8B 3DYMA 4K71C 3AXIA 5HI3C 2XXMB 3G08A 3HLKA 2OYMA 4G8AC 4PJIF 3D06A 5IF0A 4LCIH 1N2RA 5GGSY 1DQKA 2YPKA 1ADQA 3JZYA 1ZV2A 3K91A 5JHDA 2HMIC 3IJSA 2DM4A 4QYOA 5MI0B 2UVFA 4UT6L 3UTZB 2BP8A 1TCMA 3QIUD 2XIDA 3QJQB 3DUUB 3CIQA 2A7BA 3HFMH 3RRQA 2HWZL 4Y89A 2FX7L 4X9YA 3C8HA 1MSPA 5C07E 3UTZA 1GIGH 2WW8A 1ZV9A 2X10A 5CU9A 5JR1L 4YE0A 4JG0H 2B4CH 4HX1B 1NA8A 4UILH 3DUUA 1IC5H 1NFDF 1RPKA 2K3HA 2A3TA 1BLNB 1A3RH 1VCBC 3HG4A 5I5JA 4ZMAT 4FMFA 5EZIL 3TOPA 1ICTA 4MJID 5KVFL 3P30L 2FEJA 5JXED 3CLEL 3WD5L 5JW3L 4POUB 3STBA 4HX1A 3G9VA 2HTLC 5KANG 1BLNA 4UOZA 4GXFA 2EH8L 3BWUC 4U6VL 1K2DA 3DBSA 1DBJH 2J6WA 2OMVB 3DPBA 1HYRC 4LB8A 2DF3A 1B0GB 4G7VL 5C97A 1I1RA 2FEDD 1KJ2B 2HTKC 4FZEH 4NZUH 1DJZA 2GY5A 3WTUA 3E9UA 4PIRF 3L4YA 4JN2B 2OMVA 4G6FD 2YA1A 2EDNA 4HIXL 1B0GA 4G3YL 3V4VH 4Z7OB 2PPFA 4I89A 4TSAL 4PJFE 2Q8AL 2C4FU 2F54D 1KJ2A 3ULAB 1IBHA 2CA4A 3F7VB 3QRLA 1TQBC 3DROB 3HC0B 1V5JA 2R59A 4JN2A 3D4GA 4JO4H 1AXSB 4J6IA 4PJCB 3B83A 4HEPG 3TN0D 1C16B 1OT2A 1PLCA 2MKWA 4DFHA 1OAYH 2DIBA 2ZYHA 3F7VA 3MV9D 3NCYS 1MOEA 5IVXB 2E86A 3DROA 3HC0A 4GXVL 4OBSA 4U7MA 1AXSA 4PJCA 2QHLA 4IRSB 3O9WB 1YEHL 5D96B 4F9PA 4DUXA 1C16A 4BKSC 2DJSA 3GS7A 1MIML 3PQYE 4KX9A 4E9VA 2VDLL 4L3AA 4FYRA 5IBTL 3OG6B 1JPGB 3OKMB 5IVXA 1Y0LB 4XVSL 1CC3A 1LO3H 4IRSA 1SY6L 3O9WA 2DQCH 4OZGB 1UHVA 4Y5VC 5BS0D 1R3HB 5F0LB 1I8LA 4LSRH 1INDL 1OP5H 1JPGA 5GS1C 3OKMA 3QUMB 4MA1C 3GIZL 1Y0LA 2CNYA 3C5SB 4OLUH 4ZO6A 2EXSA 4OZGA 1L4IA 1R3HA 3WHXA 5LHDA 2GITB 4A68A 1FAIH 4CN4A 2C3XA 3ATFA 3QUMA 2RQEA 4YLQT 1MPAH 1MFEL 2R4RL 1V10A 3C5SA 3T6WA 2XFGB 4L29A 4W68A 4WKZB 2EVHA 3LX9A 1R75A 2GITA 2ZKWA 4OGQC 1OGSA 3BPLB 4I0PB 1QG3A 5HBBA 2GFBB 5DT1L 2XYBA 5K9JL 3UTSE 3Q05A 3VDCA 5BUAA 3UG3A 4WKZA 2AZAA 1BXXA 3KWVA 1AR1B 2BHYA 4PJAE 3WE6B 1IKNA 1HH9B 2F08A 3BUBA 4I0PA 3O8XB 2NX5E 2ALWA 2HRPL 3N1MC 1EGJH 2VKXA 4NB7A 3I2CL 5ES4B 1OF0A 4Y19D 4OTXL 3EJJX 4HP5A 3RKPA 3WE6A 3QJTB 1GZQB 1FO0B 3LCYA 3MYZA 4PLOB 4XN5A 1HH9A 5MI0C 4MSWB 1MF2H 4JFZL 3O8XA 4PRID 3VB9A 4OCMC 2PO6B 2R0KL 1GGBL 5H4YA 5D4JA 3UJTL 1F4AA 1T5KA 3G5YB 3MJ7B 5GHWH 2XG4B 2ZX6A 4BIKA 3FT0A 4OLVH 4M7ZB 1GZQA 2E9JA 4MSWA 3GUTB 1USZA 3RB7A 1ADWA 5E1GA 4M1CD 2PO6A 4HH8A 4I85A 1G9MH 4HC1L 3MLUH 4PB0H 3MMEB 3OM3B 3ZL4L 1WIUA 5AB9A 3G5YA 3MJ7A 3U36B 1EH9A 3O6FD 2E74C 2ZCLL 2IPUK 3L3HB 2YAMA 1IIKA 4XPGH 3GUTA 1I1AB 4PIBA 3WS3B 1NUDA 1YDPB 4YDIL 5BO1H 5I19H 3LYRA 2VMDA 3MMEA 4OF7A 4BBWA 3U36A 1MEXL 3WKQA 2QSQA 1H3UA 2OXGB 4OCYH 3PHQB 43CAB 3FFCD 3DYOA 3L3HA 4KUZL 2VR4A 3FJTA 4IK7A 4MMYB 4N2FA 3RX7A 1GC1C 2JKJA 2XOTA 1FE8H 4XMKH 3WS3A 1YDPA 2LU5A 1DVQA 4X5WB 3BN3B 5TQ2L 4BXSV 4F8NA 5IQOA 1KWGA 3QCTH 1XL4A 2WCGA 3T04D 4OJDH 2Q7AA 5GGSB 1DUZB 4U1SA 2OXGA 5F7EL 4XX1G 4RFNB 2X88A 4HUUB 3MRHB 43CAA 4K3EL 4MMYA 2OMWB 5I1JH 2ZOLB 4JM0A 3HC3H 4KRNA 2QGCA 4LL9A 3ZT7A 1YLBB 4X5WA 1U30A 1PGRB 5FCSH 5GGSA 1R0AL 1DUZA 3NDZE 2AFNA 2OSWA 2CUIA 4HUUA 3MRHA 1WWAX 4PWJA 3WKNA 3D4CA 1TJIL 1AO7B 1IUZA 2OMWA 5E08L 3JWNG 4W70A 5CN1A 3HHRB 2ZOLA 4ZTOH 4F9PC 2MTAA 1FLTX 3UERA 3CFTA 4KMLB 3E3QC 4UTAH 1NKRA 2DLIA 4HALA 5JOPD 3D18B 4YWGL 1YEFH 2O6PA 1AO7A 1IBGL 1MRFH 5D96C 4IRSC 3O9WC 4P06A 1NBVH 2BY3A 4ES9A 4JG1L 5I15H 2UZYB 5C0CD 3LKOB 1NAML 1I8LC 2ICCA 1I9RH 2XV0A 4JFQB 3RTQB 3D0AA 4LMQI 2KQMA 4FQPA 4NBYB 3SJVD 3D18A 1PZ5B 2NY7H 1U3HD 3NCEB 5BJTB 3FTGB 2UZYA 1WUZA 3LKOA 3QO1B 3RTQA 4LSTH 4JFQA 4E41E 5E8NB 12E8H 2P5PA 2HFGH 4JAMB 4PHXA 2YD3A 3G04B 3OSKA 3U2JA 2EO1A 2X1OA 1PZ5A 1JGVH 1E2ZA 1ZS2A 1G7JB 1MCPH 2EADA 2VLRB 3D33A 1IAOB 5BJTA 3FTGA 2F5BL 3MBWB 3QO1A 1HIMH 2JI3A 5CGYD 1CMOA 1UKTA 3ETSA 4NCC2 5E8NA 4WFFD 5CZKA 5KYWB 4JAMA 4N26A 5GRUL 5CR8A 3G04A 5DLMH 1SJXA 4HBCL 1P6WA 3IF1B 4IOSD 2W07B 4I9XA 1G7JA 1RZKC 2VLRA 3O3UN 1IAOA 2HFEB 4GLRH 4YXKL 3ARVA 3MBWA 2AJYL 1BAFL 3ZN6A 1QFHA 3B3BA 1C5BL 3BPLC 1UM6H 5HJBA 5KYWA 1IKNC 4YFLI 3ETBJ 4I0PC 3L4CA 3RI5K 2VLLB 3EGSB 3IF1A 5MP6L 2FT7A 2W07A 3AJ7A 3EFDL 3GT6A 1UGNA 2HFEA 1JHLL 1O5DT 4P2OD 4A7GF 1AR1C 2HT2D 1R6VA 1OPGL 5EF3A 4Z77B 1HHIB 4JPWL 2L7EA 5HPOA 3O8XC 2VLLA 3EGSA 2Y36L 5DQDH 2OXHB 2XJLA 5FV1L 1CE1H 3AVEA 4WWKD 4DT2A 5LWYH 2YGOA 1RY7B 4Z7OE 4ZQKB 1KTBA 3B9EA 2VCOA 2CO3A 2EC9T 2TRHA 1ZDQA 1B0WA 4PY7B 5CP7A 3SDYL 3MV7B 4Z77A 1HHIA 2PWEA 5JQ6H 4XP9L 5DJZB 1TZGH 2OXHA 2PO6C 5IM7B 3WY4A 1W72B 4W9FC 2H47C 1T20B 3S34H 3QP3A 1PVHA 3ARBB 2PLTA 4PJCE 4ZQKA 4OLEA 5GS2H 2YK1L 1OV8A 2Y7SA 2HJLB 4M7ZC 4PJXF 4PY7A 3MV7A 2JELH 1L5GA 3RIAK 3E3QE 4QOKE 5FGCB 1R5IB 3AXLB 4HJUA 1T5WA 5DJZA 5IVXE 4AL8L 5IM7A 3V0WH 1W72A 4KDTA 1MCIA 1F86A 1T20A 3QDGB 2HVJA 1TJMA 1HWWA 3ARBA 3LDBB 1NH6A 4XXWA 3UJJL 2VMEA 1FL6B 3MLVL 5AKSA 2HJLA 4KKBC 5E2WH 3ZTJG 4GB9A 1R5IA 3AXLA 4N1HB 4N0CD 1BIHA 1X6NA 1ZHBB 3LB6C 3MUGB 4XNZC 4ZDHB 1X5ZA 3GNMH 1OAQL 1I8UA 4BFRA 4PW4A 4IRZA 4OZGE 5JXAH 1FL6A 3CZSA 5AYTA 1U4FA 5C8JB 3OWEA 1FRGH 1V55B 4RWHA 3ZSSA 1ZHBA 3MUGA 3LHPH 4MHHG 4ZDHA 2OMYB 2BRRL 2J57A 2PW1B 4F1SA 1S7RB 4PRHB 1WFUA 4RFNC 1EZVX 1NFIB 5C8JA 4J2QA 1Y07A 3SGEH 2GVYA 1F58L 1X9UA 3F3HA 3WKPA 2OMYA 2MIZA 2PP9A 3I9PA 1PYWB 2PW1A 2VOTA 5E8EB 1S7RA 1IGFH 3B43A 4PRHA 1NFIA 1N6UA 4AVJA 4LBEB 5BOZG 1AI1H 5BVJB 5DC9B 3B2MA 4JGUA 1MFAL 1RP8A 3E2HB 1WBYB 4KUCD 1W16A 1PYWA 4N3UA 4U2ZA 4DGIL 4D9LH 4L2LA 5E8EA 4R9HA 4P2RD 5FYJD 5LBSL 4HJSA 4ZXBB 3UYPB 3VXRD 2B0SH 2JB6B 4LBEA 5BVJA 1VB9A 4O00A 4MDIB 1GW6A 3DXAE 2G3ZA 4FD0A 3VX0A 2TSAA 5DA4A 2X1QA 1WBYA 3BFQG 4L8DB 3RTQC 1BG1A 1I31A 3H53A 3FO0H 3MRIB 3FUFA 3EG9B 3TBCA 3UYPA 2JB6A 4ZXBA 2DH2A 2IC2A 4FFYH 3WFBH 3BSGA 4GOSA 2Z8RA 3AADB 4MDIA 4OI9A 3VWKD 5I1DB 2MWCA 3ULVD 4JFHD 5E0FA 4L8DA 3WLWC 2AXFB 3UDWA 3MRIA 3VNZA 3DWTA 3KS0J 2W0LA 3EG9A 3KHOA 2WC7A 1LDPH 3CMOH 4KK8C 3WNMA 4Q89A 1JE6A 4K5MA 4RSVA 5I1DA 2YGPA 3PIQB 4G6AC 4N2CA 3TX4A 3QUZB 4I3GA 1G7QB 5F9WB 3IDXH 1L6XA 3K6FA 3OMAB 2AXFA 4PJDB 5LQBL 1FFPB 2DIJA 5F89B 4KAQH 3TONA 2FQEA 2NQDA 3GSUB 2G0KA 4IGBD 3IXAB 5L4IA 1A14H 2AKRB 1F1DA 4P5TD 3E9TA 1MCNA 2VW7A 5KBLA 4LOUD 3NVQA 2IEPA 3PIQA 2DPKA 4J6RL 5D5MF 3ZKQD 4BUGA 1I85A 1RQ5A 3QUZA 1G7QA 2YLHA 4PW9A 4ESKA 1IFGA 1GH7A 2PABA 4PJDA 4DOHB 1BZ8A 2LT9A 5H2BB 1FFPA 5F89A 5DJ2B 1N0LB 2NYYD 1NGWB 3IDUA 4H8WL 3S48A 3GSUA 3IXAA 5DVPA 3LKQB 2AKRA 1LXMA 5KTEL 2UZIH 5CJXA 4GI9A 4TSCL 2OCFD 1CF8L 4MD4B 1M7UA 3CFDB 5H2BA 4X80L 5DJ2A 1N0LA 1NGWA 4B9CA 5DMYA 3LKQA 4XNDA 1YUKB 3DHMA 1ILUA 1PIFA 3NPSB 1E9QB 2R0ZH 4WUKL 3T3PB 4D8PB 2FECI 1N5AB 3Q6GL 2ZUQB 2WVUA 4MD4A 2AV1B 3CFDA 3L54A 3ULUE 4ONFH 2AQ2A 2JLPA 4G82A 1MJ7L 1WGOA 4EI5D 4WFGD 5IB5B 2CLRB 4ZUWB 3MCG1 4LU5L 5DD5L 1E9QA 4Q4EA 3KR3H 4KDTC 4LEEA 3WGUB 2FLRT 5DSCA 3F58H 4D8PA 1AO7E 4OV6F 1N5AA 3ARBC 4XXWC 3TZVD 3TEUA 1KJ3L 2WWMC 1IC1A 1L9PA 2AV1A 2OL3L 3NIDE 5AKTA 5IB5A 3GMPB 2CLRA 3F00A 4ZUWA 4WVRA 1YEEH 1TUPA 1A4CA 1Z9OA 1G7LB 5FCUL 1GC1H 2PTUA 3ZOAA 4BFJA 2Y06H 4YHNB 3LDBC 1QO3B 4E9SA 3GHEL 1CGSL 1UCBL 2BIOA 2WY3B 4G6JL 4RWYL 4A2FA 2GSIB 4WWOA 4XRCB 3INUL 2WP3T 3BUPA 2OCJA 5GS0L 4ISVB 1S5IH 3KGRA 3GMPA 2Q3ZA 2WBJB 1HNFA 1G7LA 3HUJB 4QNPF 4U2YA 3QB7C 3BYYA 3CZGA 2VQ4A 1QO3A 2BSSB 1OAXH 4YHNA 4FEIA 1U36A 5FYKE 4PVLA 1MHPL 4OV5B 2GSIA 4XRCA 2VL5B 2LU4A 4M43H 1B4JL 1RLBA 3GRGA 5EH1A 2YRLA 2LR4A 4N25A 2R1XB 4QJ5B 5KW9H 4NNPH 1IO4C 1AMXA 2AJXL 4AY0A 1D2PA 3HUJA 4KI5E 4OKVB 1HZHL 3HG1B 4N90D 4NO2B 2QJDA 1HEHC 2BSSA 2VLRE 3TC9A 4A2DA 4NJ9L 2VL5A 4CNIB 2WQUA 5FUCC 4NWTH 1AE6H 1XIWB 3S4SG 5KVGH 4WTZG 1M4KA 3ESVF 4X9GA 4OF8A 5CUSL 1MAMH 5CFHA 3HG1A 4NO2A 1AC6A 2GHWB 4PP1D 1Q9OB 5D93B 4CC0A 2ITCB 3D07A 4AYFB 4CNIA 4A7SA 1DE4B 4L4VD 5IZ7A 4JFFA 1XIWA 4WUUD 3QWQB 1HQRA 4XP4H 5IR1B 1KG0A 2DQMA 3E2HC 4P5MB 4B97A 3VD0A 1Q9OA 2ITCA 3RJOA 1SMOA 4AYFA 4D9QE 1GTFA 1DE4A 3EYQC 4ZXBC 1ZGLM 5GJSL 5J4MA 3BI9X 5J8OA 3QT2A 2W9DL 3ARTA 3PWNB 4JUSA 4PJ9D 4XVTL 5ESVB 5IR1A 3LZRA 4FQIH 5LAXB 2NZ1A 4P5MA 4BRJA 2ADYA 3FQ1A 1A7RH 2K0RA 3UDWC 1AHMA 3LZNA 2ROXA 3TJEL 5KUKA 1CF1A 1QUNB 1HILB 4X0KA 5CGTA 1VJSA 2HXAA 2RB8A 5T33H 5AZ2H 1JIBA 2DMCA 3MV7E 4OB5L 1KBGH 3PWNA 5ESVA 1PPIA 4EQ2A 5LAXA 3US0A 4NQED 5SV3A 1QD0A 3A4AA 2ENSA 1NANH 4W9KC 5KYYB 4XPTL 2YZ1A 1QUNA 1HILA 2ZXAA 1E65A 3PV6B 1PZSA 1FBIL 4FN0A 5MEPB 3SGJA 2K7QA 5IQNA 4M9PA 2Z35B 5FGSA 5TH2B 1QNZL 1I85C 1SM3L 3QUZC 4NFBA 5F9WC 5CLYA 1ET5A 3L08A 4KBPA 1T6VN 4AITA 4NGHH 5D7KD 4EDXA 5KYYA 3PV6A 3TIDB 1GW0A 4PGJA 4ZOAA 3DTUB 4U3HA 5MEPA 4Q9RH 5HD8D 2N0MA 2Z35A 5CJXC 3OBAA 5MEND 3U7YH 2QTVA 1FGVH 4K55A 5TH2A 1AZNA 1OO2A 2ZUUA 2BFVL 4FJZA 4DP4X 3K2MC 3FRPB 3SE6A 5CCKH 5EOQL 2ED7A 3IPBA 2UXGA 1D3CA 1QFOA 3TIDA 1JN6B 5HDLA 3WHE0 5DRXB 1GL4B 2WXKA 3T08A 3ZKXB 2CHZA 5DQ9B 2GBVA 2Y5QA 3GHBH 3OJVC 4OF3A 5BVPH 3FRPA 3HJEA 2QT6A 2GK0B 2EDJA 3W3BA 4MQ7B 4BK8A 3A6CL 4RH4A 2X4OB 2KDGA 3D52A 3GZKA 4IKNA 4X9FA 4TOYL 3MOAH 1JN6A 3S5ZA 4PRHE 3NPSC 5DRXA 3MLXL 5FUCE 4HQQH 4NUMA 4MNGB 2YMXH 2I32A 5E70A 5DQ9A 3RLSA 2ZUQC 1E4XH 4WJ5B 4YJZL 2ZG1A 4D94A 4MQ7A 3RY6A 2X4OA 5BRZB 4PP2B 1PSKL 2VTFA 3BPCB 1ZANH 3T77B 4S1QL 4HD9A 3R4RA 4MNGA 4XI5C 4PJ8D 3WUZA 4WJ5A 1C8QA 1DBKL 1NIFA 4X83A 5BRZA 4PP2A 2GJPA 3BPCA 1WIOA 2RALA 4PAZA 2EE6A 1JD9A 1TJHH 3T77A 2BVOB 2J2ZB 3B2PA 5FIEA 1RMFL 3ZTNL 4H8HA 4EN3B 4M8RA 3QIBD 4QKXB 5BW7A 5FS5A 2EDRA 5IMMA 4X42A 5ERWB 5FM8A 4UNTA 2OP4L 4APXB 4LSQL 4QAWA 3SYPA 1YEKH 1MNNA 5J9PB 2BVOA 2J2ZA 2Y69B 4EN3A 2IDQA 2VDLB 4ZX5A 3ULUH 1XF5B 1U8MB 3C5XA 3TEWA 3ZIYA 2AITA 5ERWA 4LSVH 5EU7C 4APXA 1ZD6A 1AQDB 4XP6L 5CLTA 2Z64C 5J9PA 1I3GL 4X7SH 1JG9A 3S3PA 3WFZA 5IV2B 4OIAA 3MHZA 1SOXA 2VR6A 2WUCL 5D1QB 5GRXG 3ARYA 5C0FB 1KYOK 1XF5A 1F6AB 3ZE0E 1U8MA 2CWRA 1AS8A 2ZXQA 3D39E 1XIWC 3FB8B 3ABZA 1X9RA 4ICWA 4JM2D 4PJDE 1AQDA 5TJWK 5JOEA 2NY0B 3Q43A 1SY6A 1ZLWK 5IV2A 1JI2A 3SE4A 1FVDB 1C1EL 4QXUL 4W9EC 5D1QA 5D93C 1UOVA 5C0FA 4UTBH 1W8NA 3L3OB 1F6AA 3IMVA 3FB8A 4DOHE 1JDAA 2VM9A 4OCRL 3V0AC 2WJ5A 4R4FL 4XWGH 2P4AB 1FVDA 2I60H 3ZDZF 1FI8C 2IJ0C 1UWGH 4M8VA 3L3OA 5K9QI 2CE6A 1B0IA 2WBXA 2WBKA 4G9DB 5DMIL 4NT6B 4NQQA 3M88A 3WV0A 3H2WA 4GLRI 3SY0B 1NGQH 2RAMA 4MMXB 3TT3L 3WJMB 2E76C 1LEIB 3MREB 2AK1H 1SXNA 5HSFA 2ZSWB 3H4FA 3RHWK 3K7UA 1JUFB 4F7KA 2H2SC 3BZ5A 2ESVA 4G9DA 3SGJC 4NT6A 4JHWH 3ATBA 2YPLB 4HXAH 3D4YA 3SY0A 4JHAL 1VKXB 4ZMVA 1P2CB 4MMXA 3WJMA 4BQ6A 1EBPA 1XAUA 1LEIA 1LQBC 3MREA 3TBWB 2GJ6D 2ZSWA 3GSVB 3I3DA 3K81A 2DBLH 4GKOA 1JUFA 1J5DA 3Q8BA 4NAQA 5CJOL 4E5XG 2AEIT 4FQLL 1AJ7H 4PGDB 2YPLA 3BYTA 5CXPA 4Z95L 5I8CB 1GSMA 1P2CA 4OSUL 1VKXA 4F37F 1PZCA 1OP4A 3M1BB 1IGCH 1Z3GL 3TBWA 5ABZA 2A0LC 3GSVA 3UTTD 4MZIA 1LWRA 2E6PA 3MV11 4PN6A 4K8RH 3QWRD 1WAAF 4PGDA 5I1AB 2HUHA 4WHTB 4NI6A 4MBRA 5F0PB 2VLJD 1O0VA 1ANUA 1IMHC 5I8CA 2Z0BA 5F7DB 1QFWL 1EBAA 2NW3B 3TESA 2FYVA 1BEXA 2EDDA 4NKDB 1MKFA 5AW3B 4WQOA 4XMUA 4XXDB 1BPVA 3ROLB 3BAEL 3Q2WA 3L5XH 5I1AA 3ZKXC 4WHTA 2A1WH 1E8XA 1ES0B 1WFJA 4HC1A 5EU7E 2DLEA 2DQDH 4P48A 5F7DA 1PCSA 2NW3A 3OZ9L 1AANA 5HI4D 25C8H 4NKDA 3HG1E 3RY6C 4XXDA 4HWBH