1J9TA

Crystal structure of nitrite soaked reduced h255n afnir
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA02
3AY2A 4DPCX 3WIAA 1E5YA 3G5WA 1KBVA 1PZBA 4FA7B 3PXLA 1BQRA 1A4CA 4NERA 2HZHA 2LLNA 2X87A 1CC3A 1W6LA 2EIKB 2A3TA 2EIJB 3WI9A 3OMAB 3PAVA 1PNDA 8PAZA 1JXGA 1OE3A 4QKTA 3X1GA 3T6VA 1NPJA 1GY1A 5E9NA 4DP9X 2BZCA 1OE2A 2QDVA 1OCRB 1MG3C 1X9RA 2PPDA 1EZLA 5AKRA 1GR7A 2DWSA 3EH5B 2H5UA 1WS7A 3ABKB 1A3ZA 3FU7A 4GP5B 5F7BA 1IKOP 2XV0A 3UACA 1GYCA 4E9VA 3QQXA 2E86A 1E30A 2YAOA 1MG2C 1SF5A 3X1BA 2TSAA 4TXVB 3WG7B 1AQ8A 2BP8B 4BDVB 4ENZA 2JKWA 2YXVA 2AFNA 1W8EA 3AZUA 3QJTB 3QPKA 4A66A 1BXUA 3ASNB 1AZBA 3U25A 2VW7A 3FYEB 2VW4A 2IWKA 1PLCA 1X9UA 3QJVB 2UXFA 3QJSB 4UANA 5ANHA 1ILSA 4DP6X 5I6KA 3AW5A 2YAHA 2AANA 1IBYA 2FT7A 2GI0A 4HHGA 1JXFA 1JERA 1M56B 2VM4A 3NP4A 1XB8A 4M3HA 4YSUA 1NWOA 1JOIA 2J56A 1TEGA 1M9WA 4E9SA 4YSEA 4NB7A 2Y1AA 1BXAA 1M57B 1J9SA 2GB2A 1PLBA 1J5CA 2DYSB 3S3CB 5B1JC 1RKRA 3V9CA 2UX7A 4P5RA 4BXSV 9PCYA 4G7RB 2HLEB 2WO2B 5D4IA 5PCYA 3NJIA 3OMIB 2YAEA 5LDUA 3NSFA 3NSCA 5AZUA 1NICA 5I6MA 2QPEB 1NIFA 3CVCA 1VLXA 2XYBA 2MRYA 1QLEB 2IDTA 2H47C 3CDZB 3HB3B 2BP0B 3NJMA 4KOCA 1PAZA 1TKWA 1GY2A 3ABMB 4E9TA 5B7MA 5FC9A 1XB6A 4G7QB 2HX9A 3MX0B 1GW0A 1E5ZA 3T6ZA 4JHVA 1MDAA 5EHFA 3FSWA 2AVFA 2ZONA 1AG0A 4NAJA 1PF3A 1N70A 1AS8A 4P5SA 2BWIA 5F7AA 2J55A 3ERXA 1WA0X 1AACA 3ABLB 3CVDA 2UXVA 1NIEA 5I5JA 1DZ0A 1PZCA 3TA4D 4GY4A 1UATA 1KBWA 3AG3B 3IN2A 1BYOA 2WSDA 1KCBA 3TU6A 4BK5C 1L9OA 4WTQA 4HZ1A 3ZX1A 1NPNA 1MZYA 1PZAA 2VW6A 4A2GA 3KW7A 1FFTB 2MTAA 4YSAA 2CCWA 1JZEA 4GYBA 2HRGA 2EIMB 2PP8A 2XV3A 4WKXA 1A8ZA 1NTDA 5I5IA 3X1FA 4G71B 1ASPA 4KNTA 2AZUA 1ZDQA 3H56A 2ZXWB 2UXTA 2YAMA 1IUZA 4KO5A 4JHUA 5D4HA 4AKOA 3IE9A 3HEIB 3PAZA 4HIPA 3EH3B 2YAQA 3PAUA 1PCSA 1GS7A 4K9JA 2P80D 2PPAA 3S8FB 4AI7A 3ZIYA 3IN0A 2IDFA 3FS9A 3GYRA 1NIDA 1J5DA 3NJNA 1OCZB 1JVLA 2PPEA 1B3IA 1IC0A 1A65A 4YSCA 3FYIB 3WKPA 2IAAC 4X4KA 1SDDB 4YSRA 2YXWA 2JXMA 2XWZA 3FT0A 1AS7A 3X1EA 1T5KA 3H4FA 3TBCA 2OCCB 2PP9A 4JKNA 1V54B 3ZDWA 1JXDA 1JZGA 2XU9A 2PCYA 2FQGA 2FWLB 1RZPA 1V55B 5I6OA 3DTUB 4W9ZA 3T6XA 2HX7A 4CSZA 3S3BB 2GC4C 3QJQB 4BWUA 1AZUA 1YLBB 2BP0A 2H3XC 4A2DA 3CZUB 3T9WA 1WA2X 2XX0A 4YSSA 4G70B 3AG1B 3IEAA 4F7KA 2IH8A 2VM3A 3ZBMA 1WA1X 3FSVA 1SJMA 3NJKA 3UADA 2I85A 1BEXA 2BW5A 2XXGA 4E9RA 1ZDSA 1J9TA 1ADWA 4PAZA 3BVDB 3SQRA 2GC7C 4HHWA 3UABA 2B08A 1KGYE 1PY0A 3FU7B 4A67A 4G72B 4BXVA 2VN3A 4Q8BA 4DPAX 2CJ3A 2VMJA 3EH4B 3FPYA 1NIBA 2FT6A 3FQ2A 3BQVA 1ZIAA 1A4BA 3FPXA 4CSPA 2J57A 2FT8A 3NJFA 5I6NA 3X1NA 4Q89A 3CG8A 1BYPA 3RYMA 1ILUA 2IDSA 3SBRA 2JFCA 2BHFA 3WNIA 1L9PA 2WO3B 2YQBA 5TK2A 1OF0A 1OCCB 2W8CA 1FA4A 1R1CA 4UAHA 4E9XA 1HAUA 1AAJA 3S8GB 1SHXA 2N0MA 3JT2A 3QJRB 4BWWA 2QPDB 1PMYA 7PAZA 2EILB 2CALA 1E67A 1KDJA 5I26A 1XMEB 3NJLA 4QLWA 5B1BB 5D4JA 4E9YA 1ZIBA 4A2HA 2YARA 1URIA 4KNSA 2HRHA 1AZCA 1SNRA 1JZHA 3MBWB 2I7OA 3GDCA 1AIZA 4RH4A 3OQRA 5TK4A 2PCFA 1ET7A 1SFHA 1JVOA 5I5MA 3D12B 4ZK8A 5I6PA 1XB3A 1SF3A 4FAAB 2PPFA 5I6LA 5B3SB 3EHBB 1I53A 2XUWA 4A68A 2GHZA 3FSZA 1DYZA 2XX1A 2OJ1A 4AX3A 4DP2X 4KOBA 4GP8B 4BWTA 1ET5A 2DWTA 4MFHA 1ASOA 4EF3A 1NIAA 3H4HA 6PAZA 6PCYA 2HX8A 4E9WA 3OM3B 4YSDA 1J9RA 1JZFA 4DP8X 1AR1B 1AOZA 3CVBA 5B1AB 2RACA 4YSPA 2NRDA 4YSQA 1AZRA 1CUOA 3AG4B 4YL4A 2W88A 1AANA 3AG2B 1JZJA 2BP8A 3ASOB 3NP3A 3NYKA 2DY2A 1OV8A 5B1JA 3SBQA 3DKHA 3WNJA 1AZNA 1F56A 4YVNA 1BXVA 3OMNB 2UXGA 1NINA 2VSMB 4DPBX 1AS6A 1QHQA 1SDDA 4N4YB 1RCYA 2XLLA 2X88A 2ZOOA 1GS8A 2CUAA 2Y69B 3FU9A 3TBBA 2FJSA 5I28A 3WKQA 1BQ5A 3T6WA 2GIMA 1FWXA 4HCIA 3FQYA 4YVUA 3FSAA 1OE1A 5B7FA 3SBPA 2CBPA 1NDTA 2J5WA 7PCYA 1L9SA 3KW8A 4AKPA 4E9QA 2YAFA 5A7EA 1EHKB 2PP7A 3NJHA 5IY5B 3UAAA 1L9RA 2FTAA 2IWFA 1WAEA 3T71A 4F2EA 1A4AA 2AZAA 1ZPUA 2GSMB 5AFAA 1QNIA 2VSKB 2TSBA 4KO7A 2YAPA 3NJGA 4HAKA 3PCYA 4W1TA 3X2QB 1SFDA 4YSTA 2I7SA 1E65A 1ETJA 4M4RB 1W6WA 3FU8A 4HCFA 3FQ1A 3OD3A 3ABGA 2XV2A 5PAZA 1WS8A 4N8UA 1BQKA 2EINB 3V9EA 3UGEA 1CYXA 2Q5BA 4AKQA 2IDQA 4PCYA 5B1KA 1L9TA 4DP0X 3NJJA 4KNUA 3IBOA 1KCWA 2BZ7A 2PPCA 1TU2A 4A2EA 2IH9A 1TEFA 1KDIA 3S3DB 1ZV2A 1GS6X 3EF4A 1ASQA 1HAWA 1ET8A 1NZRA 2GBAA 2QDWA 4L0PB 1IBZA 4YSOA 1SHWA 4BDVA 4F2FA 1KYAA 3N55A 4AZUA 4KO6A 4UF7C 5B7EA 2R7EB 2IWEA 3NSYA 1JZIA 3L45A 1MZZA 2CAKA 2R7EA 1L9QA 2UX6A 2DYRB 3DIVA 4DP5X 1RZQA 2QT6A 2IDUA 4KO9A 2B3IA 4GP4B 2Q9OA 1NWPA 2OV0A 3NSDA 1V10A 2PLTA 1J9QA 2HXAA 3N2JA 4DP4X 1KV7A 2ZWNA 3TASA 4A2FA 4DP7X 4HALA 3JTBA 3UAEA 2P80A 1PLAA 3GXUB 1CYWA 3QJUB 2BO0A 2FQFA 2FQEA 1OCOB 4HCGA 1OOWA 4DP1X 3PLYA 4G7SB 2XVBA 1CURA 1PNCA 3PPSA 2XXFA 1GSKA 1HFUA 2FQDA 2BW4A 3NT0A 4GXFA 1AG6A 3CDZA 1ID2A 2BWDA 1N68A 3C75A 2FNWA 1BAWA 2DV6A
chains in the Genus database with same CATH superfamily
1TTRA 3AY2A 3IJ7A 3WIAA 5MI0C 3TT1H 1HQ4A 2IH1A 2M83A 1S9YA 3HA0A 4S1SH 4HEPA 3FN9A 4KJWC 3VG9B 4QD2E 4W9HC 2YQ2A 5CBEA 3BVNA 3ZE0B 4FP8H 1BF8A 4ANXA 4X8XA 5B4MC 5CLXA 4G3YL 2M26A 2NNAB 1LLAA 2CUMA 4P48A 3FKUS 4ELMF 1OE3A 1C7SA 1MREH 4R7LA 3NPSC 4H7VA 1I3VA 1NPJA 2WQXA 3OXSA 3AB0B 3AUVA 1LP9E 5HYJB 3RFRA 2DBLH 3O8XB 1MG3C 4W9DC 4Z7QE 1MW3A 3CN0A 4XPAL 5KBLA 4J3XA 3KPSB 2GITB 5HPMA 1N6VA 2H26A 1LK3H 1JZ7A 4KKAD 4FQQB 4B0MB 4AUUA 4BZ1A 4XVTH 3ISWA 4C56E 2E86A 5LGHL 2VDNH 3O8XA 3L6FA 3OKKA 5KYYB 5F6HJ 3RUGE 2DBLL 3H55A 4FMKA 4M8VA 2JKWA 2VR7A 2YA0A 4PGDB 3SKMB 3T6QC 4K4KA 1BD2B 2YN3A 2JIXB 3TBVA 3AXLB 1SYSA 2Y6SD 4ZAKB 4N85A 3TBWB 1GJUA 2DD8L 2EVFA 3ESPA 3RZWA 1MCCA 3K72B 3QULA 4NSKA 5C0BB 3TVMB 3CD4A 2O4EA 1AZZC 5GZNC 5I73C 2V9QA 1C12A 4MA8H 4RFNB 5MERB 4EUPA 5FUCE 1A3RL 2HUHA 4X7EC 5H35A 4K8RH 1M9WA 5KYWB 4NB7A 1M42A 3QARA 4BA0A 2AEWA 2DM2A 4UM9D 5FO7A 3FQRB 4IRSA 4KY2A 2EDOA 3VXRD 2G5RA 4EXKA 1OK8A 2D31A 3ETSA 3NJIA 3S37H 2X4SB 4NXKA 4UT9A 4MASA 3I9GL 4UB0L 1A3LL 4WUKH 4YLBA 2YPVA 4DF9A 2QPEB 4OR1A 2V2WB 2ZNWA 3NABL 3W9DA 4E9TA 1U8NA 2ZP9A 4KK9C 3GTTA 1QI5A 4XCYB 5E56A 3Q7JA 2R23B 4Y4FA 2VXUL 3VXRB 2F53B 4X9YA 4O2FB 1AJ7H 2KPWA 2XWDA 4HK0A 2OP4H 4MJ2A 2EYTB 3BGFC 4OFQA 2V2WA 3TEYA 3FZUD 4KH9A 1HOCA 4GKNA 1PD1A 1F5WA 4U1JB 5ICYB 4MD0A 2O6CA 3QHZL 4GRWE 4AIZA 1BQHG 1WWCA 5DHVB 4D94A 4GRWB 1ACZA 1GYWA 2QR0B 2XHNA 1KJ3L 3O6KH 5T1JA 3VX0A 5CU5A 2K7QA 2OL3B 5F72S 1X3DA 1REIA 1Q9WA 1VACA 1NGXB 3WL9B 3RWFA 4U1IA 1NUDA 5EO9A 3VCLB 4HQQH 2VERA 4TSCH 1U3NA 1U3HD 2XXCB 2ZKXA 2PO6B 1ZGLB 1I3GH 4HGWA 3BH8B 3GRWL 4R7XA 3MBXH 1JZDC 3HG1B 3OKYA 4FA8A 2HRPL 4PS4H 2GEEA 4FNTA 4KMQA 5FPIA 1BPVA 2ZXEB 4UDTA 4AKOA 4XOBA 4QT5A 1AD0B 2A6DB 2A73A 5IT2H 3T2NH 1J1OL 4HIPA 6TAAA 1LO2H 3LB6C 3HB3C 5DLLA 5CFHA 2H6UA 5CGYC 4ODXA 4PJ5B 3ATDA 3DJRA 1SJEB 3RPIA 4N25A 1E9QA 1EO5A 3RL1B 3U7YL 3QR2A 4FCHA 2CBMA 1NIDA 4MAUL 3FO2B 5AB2A 3T1WA 1UWGH 1C5DB 2JQAA 2AJ3B 4Z7UB 5FKPA 3QCTL 2C3WA 5CD5C 1QFOA 3GMRA 4PRAB 1CO1A 1GKOA 1N18A 4P2RE 4PJAE 15C8H 3UL4A 1EO8L 4F9LC 5IHBA 2CHWA 1JXDA 3ARZA 2UY7A 3VI4A 2QQLH 3PV7A 5FYKU 4FHBD 4Q6IC 1XF3B 3DNKA 4YK4C 3TEXA 1WZ1L 4BKLB 4TSCL 3LEYH 4QRRE 5SWSE 5MEOB 4K7PH 3TC9A 2YMXH 2FWOA 1TXKA 4C8XA 4Y7OC 4CSZA 3QQ4A 3S3BB 4G8EB 2R1WB 1ZT7A 1OHQA 3TNMA 1YAIA 5BZXA 4F7KA 3EYOB 1KXTB 1P84J 1MCLA 5AW2B 1E43A 2OMUB 1WC7A 3DO7A 3QZBA 2R0LH 1E8ZA 5E8EA 2GK0A 1IQWL 3WTUA 1MCEA 2NXZD 3DOIA 2XXGA 1GH7A 4XO4A 2ATPA 4HLJA 5EUOA 5FYLE 3DUSA 2FEDC 1OGPA 4KK8D 3SQRA 4PLJC 3RWGB 1AJ7L 2P28B 5F3HA 1R24B 1MIML 5FGBA 1S9XB 2IAMA 4XCCH 3FN3A 4F91B 3QUYC 4N22A 2CJ3A 3F7YB 1OARH 5C0FB 1A7OH 1Q1JL 1IRAY 2FT8A 4UQ2A 2DEXX 1RUKH 1EFXB 1S5HA 1E7UA 2K8QA 2YSSB 4NZUH 3T4AB 1Q1PA 4K3DH 5DUBB 1T2QH 1OCCB 2AGJH 1LP9A 1D5MA 1IEAA 2RMNA 3MN8A 4I5BB 3LPWA 3QQ3B 2P42B 2WBJB 1M71A 4NN5B 3A3YB 3PWPA 4Z7QF 2UWEF 3F7QA 1PMYA 3MRFA 4ZMZA 3SGKC 3OV6A 3JWNC 1OB0A 1MHPL 5I26A 2W0LA 3KJ4C 5D4JA 4ZOAA 2WN2A 4ZTEA 1K6QL 4JO1H 5E6ID 4PFEA 4HS6A 3O3AB 2NXZB 4I2XA 3W5NA 2AXFB 1L7TL 3F6JA 3GDCA 4LLMB 3ES6B 5TH2B 3VA2C 1KPVB 3NCCB 2H9GA 3GLAA 5DVNA 3V55A 1YAZA 3FUNA 1G6RH 3GXMA 4ZK8A 3E8UL 3GKWH 1XB3A 12E8H 2R56H 3HIZA 5ADPL 2C7FA 1DVZA 2XSKA 2YEZB 5C6PB 2FL5A 2XUWA 3CVHH 4A68A 1HE8A 3IJ8A 1J9CT 5E5LA 5GRYA 3O2VH 4JPWH 3BKJH 3F01A 3SPIA 4TF4A 2OJ1A 5DO8A 4H8VA 5T3XH 2WBJD 5FYKD 1JCVA 1M7IB 2NR6C 3JV4B 5GS2D 2F7PA 3FMGL 2JJTA 4XB7A 1AP2B 3HTLX 2C1OB 5HYJA 2I5YL 1N0LA 3RDJA 4CVZA 1JRHI 5IQ9B 4Y4KB 4JQIA 1OAZL 1AR1B 1PKQA 3L4XA 1RULH 2EO1A 4OKDA 4JO2L 4R96A 1CDBA 2CM5A 2B9AA 2ZWYA 3GM8A 4AYSA 3GMPA 3RWCA 1AQDA 1IJNA 3APDA 4DEUA 4WHTA 3ORJA 1SXNA 3H8NA 1O9WA 5L2JA 1YY9C 3BWAA 3D0VA 4XHJD 1AGFA 3Q48A 4ACPA 2ARJQ 2VDOH 1BXXA 3S34L 2CRYA 4N24A 3VI4F 1NDGB 1S8DA 2UXGA 4LBAA 1QTSA 5FB8A 1ZANH 1JPFA 1UD6A 4JM2A 3E8UH 3MZTA 5J3HD 4N4YB 4X7CC 1RCYA 1GS8A 4N6RB 2OZ4H 1AQKL 1J1XL 4Y4KC 3T04D 1OTUC 2EIZA 1BQ5A 4JZNB 1LE9A 5D7LA 2X0WA 2L7JA 2Q86A 2F15A 4GEIA 4FEIA 4OIAA 4JVPA 3P0VH 2GTZB 1SY6L 4LARH 4MCZA 4JFSA 4ONHB 1V7NL 3S35L 4E9QA 3VMPA 3BO8A 2W5PA 3M7OA 4S11A 1BVZA 1O6SA 3ZQXA 3WS3B 2QPUA 2FTAA 5HY9A 1T2JA 2ICEA 5HBBA 1D7DA 1ORQA 2ALAA 3ZXAC 4QR7A 4F2EA 4QTIH 2AV1A 3HRZA 3CSYA 3ARBD 1NMBH 2ZOWA 4HX1A 4KXAA 4ONOA 1HVXA 4NO2A 3WE1A 1U6AL 2NOYA 1XR8B 4MJ5B 4MNQE 1UGKA 4JZJB 5HHOE 3KWTA 4M7JH 3RGVD 2R8SL 1MJUL 4AYDC 1O7DE 3U0PB 5EF2A 2AJYH 1EK3A 5IWLA 3DURB 3IRZA 4KXZH 4PJGF 1FFQA 2VZ1A 1EGJL 4A2LA 1BQKA 5C3TA 4OSUH 1CYXA 3WE6B 4YLCA 3D0AA 4E41E 4PQXA 5C3LD 4AY0A 4OLYH 1SXSA 3UIZA 4F33B 1DVQA 3FFCA 2H6PA 3CLWA 3WDJA 2I9TB 2R83A 3V5HA 5J06A 4ZZFA 1TEFA 2QVMA 2YPLD 4LP8A 2AAAA 4PLKC 4XXCA 3SY6A 4MQTB 2CLRB 4WWPA 1UOVA 4FG4A 2NY2B 2N1TE 5D5MA 5DS8A 1AHWA 5ELIA 5F0LB 3NK3A 4F2FA 4KO6A 3UAFA 4OGXL 4JCLA 5D7JB 5INCB 1MZZA 5JO5B 1DSWA 2NNRA 2Y06H 1HTYA 1YJDL 2DYRB 3P9MB 3SDXF 3VGAC 4LSSL 4GKZB 5DMGD 3HC3H 3S88L 1RZ7H 2CLRA 1EUTA 3F7VB 4OVUA 4BZYA 5F89A 5KZCB 2K9UA 2OBGA 2DQCL 1CF8H 3BXNA 4XPHH 1R5IB 2YD9A 2Z65C 5F70A 3BAKA 5FB8B 3LKOA 2O5ZL 4PB9L 1AO7E 2K6YA 5DJZA 4LPVA 3TIDA 5I1KL 1HK6A 1KV7A 3IJ9A 4I0KA 4DP7X 1HS6A 3PWPD 4KHXH 2GPZA 4AE0A 2HT2C 3NMEA 2OXGA 4KZEL 4IK7A 3EZ8A 2ZX9A 3EAKA 3ZHKA 4JKKA 4L4VE 3VE0A 2J44A 1E3XA 2BY2A 2AJZA 4LU5L 5C08D 3ZYZA 1FIEA 3E8VA 4LPWA 4XXDA 1XCTB 3QGVA 3OAZH 4D9LL 5ESVB 2XKNB 4LXFA 4FZEL 3MROB 4GXFA 4FTVA 2YPLB 1TJIL 3CDZA 4JN2A 1NC4B 1L5GA 5IVZA 3EGXB 1XV8A 4DPCX 1SBBA 3HZYB 4FXKB 2J43A 3SE9L 4I48A 4LF3A 4LCWD 4HXAL 2XIBA 2AP2A 1D9KA 4UM9A 2NY1D 3L1OL 3L3JB 2OMTB 4IIZA 3ULVH 1ZKAA 4NERA 4AQ1B 1FO0H 2C1PA 5KS9A 1OGTB 2WY3B 1G1YA 5G55A 3GMOA 3O6FB 3OZKA 3QQ9C 3X1GA 1ERNA 1FVCB 1MAJA 4QO1B 3GSWA 4KZDL 5C8JA 5FGRA 4AGMA 3CBJB 2YIHA 3IGFA 3QWQB 5SWZA 4LAJH 5L8LB 1BAGA 2PMZA 3LH2L 5ETUB 2V7HA 4ZFOB 2OMYA 3PWPE 4PRPA 3L9RB 2B7DT 1G94A 4H8PA 2FD6H 3KL0A 4J3TA 2OTUA 5AB9A 1A3ZA 3MA9H 1ES0B 3VG0L 3VO0A 3MRCA 1NDGA 1S8DB 3RHWF 3UYRH 4GG8A 4XBPA 3FT1A 4XO3A 5HHPB 3X1BA 4HJJL 2GJ6D 3IFLH 4I0CC 3U4EA 1TZGL 3I3DA 4P8QA 5KAQG 1W15A 4PS7A 3TPUA 3AS1A 4GSXA 4EE2A 4H20H 1HINH 1L4IA 1AZBA 1KPRA 3U25A 2DS4A 2X05A 4W6WB 3QZNA 4GUPB 2QQKH 4PHXA 3IDXH 4AXWB 2UXFA 2K8MA 3G5XA 1RPKA 1TTGA 3HC4H 3MMEB 1I1AB 4BE5A 2PR9A 1RZGA 3K7UA 3V0VB 3UH8A 4L4VB 3VDBA 5I73B 2UZIL 4NPYA 5DF0A 2UY6A 3O3DA 4HEMA 4NN6C 4HPYL 2DAVA 3Q43A 4ODHH 4WWKA 3CE1A 2I07A 1AHKA 1L0YA 1ORSA 1RHHB 2NZ1A 3A6CL 3S3CB 5K9QI 2UX7A 4N0CC 3WEAA 3JVGA 4YXKL 2XVLA 3WFEL 4UTAH 4RGNC 1PFOA 2C34A 2JJSA 5EEUA 4IGBC 1T0MA 1JN6A 2BJML 2DJSA 4TUOA 4UV4H 4CA4A 2WLMA 1PAZA 1S7RB 4MKMA 2NYYC 2ZQKA 3G6JA 3LZFL 1GW0A 5IK3A 1UXLA 3T6ZA 4JHVA 4TTDC 5BOZG 2VMFA 2ZONA 1RZFH 4M7LH 4NAJA 5IHWA 4FX5A 4YHNA 3FT4A 1LK3L 5DD0L 4XNUH 1OHZA 3C8KA 5H2BB 5AVSB 1QA9A 4DQOH 4KTDL 1WAPA 3JTTB 1JHKH 5HDLA 4M1DH 4XN9A 2ENJA 1UATA 2APSA 5DHYA 1CF1A 2FCBA 2H2PD 3VSUA 3ZMEA 1KBWA 1Y1DA 2DQUL 4DK3A 2OCJA 4L4VD 4NJAH 2V4LA 5H8DA 2UUDH 2WLIB 1NPNA 1TPXB 3HHSA 3MV01 4HG4J 2D7TH 1GPOH 2A99A 5E0FA 3KWWB 4PD4K 4CVZB 1U8IA 2M2DA 1BBDH 5FAAA 3DYPA 4ODXB 2CBTA 4PJ5A 4RNRB 2NUTA 1VKXA 4C83B 2DQIH 4PJFB 3B9VA 1NCWH 4LSPL 2CUHA 4OGAC 3LRGA 1KBBA 1AD0A 5MI0B 3L3KB 2DF3A 1TZIB 2YD5A 4PRHB 2VUKA 4P05A 3RWGA 3E38A 2H1PH 3IETB 4C47A 2FNBA 5GQBA 5EN2A 5C0BD 3TVMD 4DCQA 5D4HA 1CGYA 4TNWF 4OLWH 5DDHB 3UTZA 1OT1A 1T89C 3NQKA 4GRMB 1CGWA 5J11C 2DLEA 4NZUL 2YR3A 2V17H 3GRWH 4KX7A 4WO4D 4HVBA 2XQBL 1QFWI 3T1FB 1JV5B 1U8KA 1CFNB 2JNZA 4LQFL 5JIHA 4NHUB 3RG1C 2DB8A 2IG2L 2CE6A 4JRYA 3RZCD 1RUAL 1SXCA 4X7SH 4B60A 4EXPX 1J5DA 5IM7B 4NM4H 2F53E 2WQRA 1UFUA 1IBHA 2EICA 3KLSA 2WCSA 4DFHA 3X14B 4JFHE 3OVUB 1DN2A 2R2EA 4YGAB 3OHXC 4K3JH 3ZZLA 3ZKXC 1QO3B 2NNCA 4RLDA 1WRFA 5F9OH 2Q7YA 3RUGB 3UTZB 3DO3A 3MLYL 1VZHA 2L3BA 3B2UC 3HMXA 1XF2B 1RK0A 2NY6D 4W9CC 1HIML 3BGMA 4WI7A 5LGJA 4AOFA 4BWUA 4NI6A 1Q38A 5GGRB 3LRKA 1GJIA 3BFOA 4EKXA 2W38A 3LQAC 4TUUA 4WKZA 4XCYA 3VXMA 3WMPA 2DWDA 4KKQA 2J6EH 2IH8A 5E00A 5EV7A 4HEPG 3QS3A 4TVPD 5FCUL 1AXTL 2EDEA 5EIVA 1KGCE 3GS7A 5D1ZC 2IAMB 5D7KE 3WO4C 3QIWC 1GHFH 3F7PC 2BH0A 1XF1A 4B97A 1HXKA 4W4OC 1TJMA 4ZSOA 1WUZA 1YN7A 4WY7H 3HHSB 3QQNA 1NAML 2R0ZL 3T0WA 1OEZW 1A7PL 2VRKA 3VFVA 4BFIA 3HE7B 1UM6H 4G72B 1Z9MA 4YDJA 4PBWD 3H9SA 4ANVA 3VD1A 4AGNA 3BUQA 1X5JA 4EUPB 2E7DA 4K8RL 2F08A 1K3ZA 1ZIAA 4YWGL 4NUPA 4DAGH 5IFAL 4PRHE 5FYJU 4N1CA 2XOTA 1FLRH 3CH1B 2Y5TA 4P46B 2WO3B 3Q3GB 4P2YA 1LNUA 2O5XL 2YQBA 3HE7D 4AEFA 1T66D 2DH2A 3PDDA 4QRTA 4GMSL 3ZE2B 4DN4H 1TVDA 4FZ8H 5LB1A 5CN3A 5FW8A 4NRYA 3D50A 4QOKA 4U7MA 2J8HA 4QRPB 3REWB 5F7EL 2X28A 2V2XB 3L2MA 1ZS8B 5F1NA 3EJCA 3L9YA 3W5MA 3DSFL 2W80C 3BLKA 3MGOA 4HD9A 4QLWA 2BFGA 4LIQH 3DDFA 1KLUB 3CZEA 1KXVC 1ZA3A 1DVFA 4O5LL 4A7SA 5D9SA 2MCAA 2WINA 4N2LA 1KCVL 4K0OA 1DSYA 1NMAH 1SYVB 1Q0XL 1H3GA 2A1WL 2BLFA 3L5HA 2IFFH 4X7FC 2PXYC 1E9QB 1H9VA 2HLFC 3O4LA 4OBSA 1LYQA 5BV7H 4ANUA 1R46A 3F58L 1A1NA 1TJGL 1INEL 4AV0A 4GBXB 1MIEL 4NRZA 2VLRA 3TBSB 1JWSA 1YCSA 1D9KD 7FABL 3HZKB 3RX8A 3IJSB 4ZUUA 1LE5B 3TGXA 1U92A 1PW3A 5FDYA 2IOIA 4DKDC 1MCRA 2YBRB 5IW6B 4FTVB 1IM3A 3ARXA 1J48A 4A7GF 5IW1A 2VR5A 2F7QA 4W4NA 3GI9L 4QNPE 3L4ZA 4N2CA 4DN4L 3VMOA 2EDDA 4RBPH 3B7TA 2LV4A 3SOBH 5JOFB 1YEIH 3D87B 3EDFA 1VSCA 1ZLVH 3VFTA 4QRPD 5I75C 2K1MA 5GJTH 4FTVD 5FF6A 1HEZA 3IM1A 4LCIL 1JZFA 2OKMA 2ZCKH 4LBEB 1HSAB 2B14A 4IU3A 1MCWM 4I1PA 2EXYC 4RX4A 2ICCA 5M95B 1W72L 1T1WA 3G6DL 2WIMA 4PGDA 2B2XH 2Y7SA 4X8JB 5DEFB 5BUAA 1S7VA 3IT8D 4PBDA 4EN3B 4YDVB 4J3OF 4LCIH 3V4LA 5EORH 3C5SB 3JBG7 2Z31D 3QDGD 1YEFH 3DHUA 4YK4B 5ADOH 3U1QA 1QHQA 1C8QA 4QRRB 1H6FA 4TOYH 5DD1L 5DUPH 2ZOLB 5CLZA 3EHBD 2H26B 2DQMA 2DLGA 2APBA 2X88A 1G7QB 4J3UA 3ET9F 1EBAA 1FL3A 2UYLA 3TBBA 3U83A 3W3BA 3VG0H 5DZNA 4KPHL 3WKQA 4FFYH 4AJ0A 2GCYB 3H7BA 2OMWA 3FQYA 4FXKA 2X4SA 4GRWF 5AOLA 1ML0A 1MHHB 1G9MH 1ZSHA 2Q8BL 5C7XH 2KMWA 2BY1A 1AHWC 1ZE3C 4H0HB 2LW3A 3IPBA 1NBVH 4RETB 4B5EA 5FDWA 2NCMA 4OF0A 4U4IA 3B2MA 4J39A 1FQ9C 2XRAH 5E08H 2G2RB 5IBLC 3BEVA 4JHZA 3PWLB 4B9GA 1NOAA 2CK0L 2VDKB 2GSGA 3IJYA 3P77A 5D4QA 4FQXB 1RPUA 2JF1A 4X7SL 2BNQE 1QFWL 3QW9A 4HFWB 3GMLA 3MHZA 4P9ML 3L2LA 3VQLA 4F9PA 1K5NA 3FRPB 3GIVB 1WP6A 5F1OB 5IOPA 1E65A 3RDTB 5C0JB 1UEYA 5KBNC 1ZY9A 4G1MA 4L23A 5CCGE 4KMTH 4AMKL 5KN5B 1G1OA 3HZVA 3ABGA 2XV2A 4MCYA 3GEWB 5AOKA 4UT6A 4OZHA 3QH3A 3MNDA 4OF3A 4WHYG 1MF2L 5F9AC 5KYYA 1YG9A 4JFED 4WENB 4LCUB 2PR4L 3D3VB 5IB3A 2VDRB 4D8OA 2YC1A 2V37A 1T6BX 1YQVH 3APFA 2N7SA 1HJCA 2CLVB 4MAYC 3ZDZF 2DIBA 5TQ2L 3LQAH 3MLRL 5I1JL 1CL7L 2X9YA 5EF1A 5D2LA 5DO2C 4GI9A 1CF8L 3O6FC 3TF4A 1DLHB 2RQEA 2AEQL 4AQZA 4P3DA 4FMVA 3GSOB 4R2GD 4PLOB 3K0WA 3TXAA 4MA7L 5KSUA 3U2SA 3FOMA 3MDJA 4L48A 5K39A 4DQOL 2VOTA 3DX1A 1LD9A 2VABB 4DGVL 1HZHL 2B3IA 5JIKA 4MD5B 4POUB 3J8F7 2GJZB 2PTTA 2GBTA 2RCSL 2OV0A 1EJOH 1AXSA 4FRWA 1MJ8L 1JBJA 2CZNA 3HAEA 4LCWE 5HI4C 2JCCF 3WN5A 2Z8RA 3N2JA 1ZA6A 3MBEA 4M43L 2OMVA 3WJJC 4N0UE 1I85C 1N4XL 2ZUQB 5FHBL 1R6VA 2CWRA 3BN9D 3EO1A 3RVXC 1F3JB 1G43A 2O6EA 2RQ8A 1B4LA 1FAIH 5CSGA 3D3VD 2V2TA 2R0KH 2DQGL 3PXHA 1AMXA 3L3OB 3NA9L 2GG1A 2Q76B 2HTLD 4K3GA 5IFHL 1OAQL 1HI6B 1SLWA 3ULUC 3NT0A 3G5YA 43CAB 4XWOD 2GUOA 2BVTA 3C75A 1NC2B 5B4MD 3CMOL 4ZJ9A 3VRIA 5D1ZA 1P5VB 1I3RA 4HV8B 4D9RD 1VCBC 1N0XL 3V52H 4B9CA 4MAYA 1OGAB 4RGND 5INDA 1FSKB 4PY7B 4N0FA 5KVFH 1NANH 2QQKL 5ICUA 3SDDB 4GQ9H 4MDIA 4XNAA 1ZSDB 4MHHI 5D7SL 5E1GA 4RGNB 1UXSB 3NJXA 5KVDL 1VGKB 3CFDB 4NCC1 1UWEL 5DA0B 3WFDH 3MYJA 4HWZA 3G04B 4I3RH 5JOPE 1P2CA 1C1EH 4OQ1A 3R8BB 1LTXA 1BCIA 1WS7A 3TWYA 3E2HC 1A2YB 1CD0A 5IUCA 3FCTB 3EYSH 4LPCA 4GIAA 3N3EA 2H3KA 3V0WL 3DTXA 5DT1L 3UACA 4EO5A 3A6BL 3P11L 3PV6A 3S5ZA 3THMH 2A83B 2YAOA 4PVNA 1FCCA 4RISL 4BFOA 1A6WH 4U3CA 2C1OA 3AS3A 4UQ2B 2R59A 2R29A 1CZ8H 4HIJB 4TXVB 5C0FA 1OCWH 3KCPA 2FZ3A 3SGKA 2DDQL 3OC5A 1PLGH 2IF7A 3D5OF 2YGOA 4XRCB 4ZBJA 4YX2L 4EI6A 3WU1A 1HCYA 3D25B 4ZMQA 4EI6B 4PTUB 1Z5LA 2Q76A 2IVFC 2YKKA 2YUXA 2PWFA 4L37A 5ANHA 4X5QA 4XN5A 5I6KA 1IGYA 3VNZA 3VXUA 2FT7A 2GI0A 5FUZL 3GJEA 3LN4B 5KSBA 4HXAH 4A55A 2Y2TA 1UYWL 4BSJA 4LASH 5HI5D 4M3HA 5DJAB 1HEHC 2J56A 1TQBC 3PABA 1JMXA 1MREL 4YSEA 3ZL4H 1UA6H 1ZRUA 3TH3T 4XAWL 2J6WA 1TJIH 2HG5A 2YPVH 4B9JA 2CPCA 2R1WA 5L7XL 3VI3E 4FZEH 1ZLDA 1PQZA 5B1JC 2WPGA 2AXGB 4ZMTA 5BRZE 1CPUA 1F6FB 2AW2A 2DQHL 2AEOA 4X4ME 4L9LB 2YRPA 5JPNC 1KACB 3SYOA 2UZIH 4OD2B 4NHCH 2XYBA 1ZE3H 3VI4B 2VLJA 2G0LA 3HC0B 4GAGL 3BRDA 1TKWA 3DX8B 2W91A 3MCKB 1NFIB 1XB6A 1B9KA 2FRGP 2QELA 4U6HA 5DO2D 2XI9A 4XNXL 4JPSA 3WFHA 1DDHB 2ALWA 2OPCA 4XNZB 3BQUB 1DANT 3FH5A 4P5SA 4I3GA 2CJTA 5D71L 1QBAA 1HINL 3ILQD 4K94H 1CG9A 4Q6IA 1H5BA 3PWJB 1QRKA 3OR7A 4QXGL 5D2NE 3CUPB 2FHBA 4WO0A 3WNMA 3WFDL 2WXKA 1KEMH 1PZCA 1R19A 1YEKH 3MLXH 5KSAC 1M3IA 2BIPA 3L4YA 1T3FA 1SEBB 4HS8L 4IBZA 4Z7WE 3MC0A 3DBXB 1AZVA 4WNSA 1GRWA 1CI5A 4U0QB 4F37K 1YNTA 5KN5A 5CGBA 4GMTH 4I77H 4CU8A 3WS6A 3IJEB 1BZ9B 5IEKA 3QUZC 3LNDA 1XD1A 3AACA 3PGCA 4JFDE 4QRSA 2O5YL 4ELDA 4G83A 5KJ4A 1B0IA 1OANA 2NY3C 3VYPA 4PWHA 4GT0A 4D9RE 4V1DD 1A7OL 4JFHD 4WU5A 2AJSH 5GRUH 4M5SA 3OX8A 4RDQF 5DI8B 2PTTB 1WGOA 3IAPA 1IVLA 3CK0L 4XI5D 4G6JH 2ENYA 1G7PA 4OUUA 5GISL 5BS0A 3EBAA 5GRJL 2Z7ZA 5K1NA 1R5VA 1E42A 1I82A 2VITB 1MHHA 3C9NB 4UQCA 1SN0A 1E2VA 4PJ8A 5FX3A 4PIBA 3SKOA 5B38G 1E3ZA 4PRIB 1HOCB 5C0AB 3LS5L 4PJAA 3GYRA 2Q3ZA 5HVHB 4JJ5B 1JVLA 1FI8C 1HC1A 5EU7C 5T3ZL 1UKQA 2CKBA 3H53A 4X5LA 5DZOA 4LAQH 1DVYA 3PNWA 2JXMA 3V8OA 2ED7A 3X1EA 2CDGB 1SDAB 4NNYB 3K6IA 4HHAA 3ECVA 4KJYB 3RJDA 3ZQ9A 3UPRB 2WTRA 4PJIA 1UKSA 1S78D 1U8QB 2ITDA 4XVUC 3ZKQD 1UWXK 1YECH 4M8QA 1I8AA 3DVNB 3HFMH 1F6LL 4PBVC 5C9JB 5C2BL 4U3HA 2E9JA 1KIPA 2WQSA 3FB8A 4AV5A 4PJDA 1NEZA 5CBAB 1T0PB 2VXVL 4BKSC 5I1KH 2AEQH 5KOVC 3ZJAA 5IB5B 4BFGA 3NEOA 1TF4A 4APQD 4PRHD 4QXTB 4A2DA 3ETBJ 3P69A 2ROYA 1CDJA 3FRPA 3GIVA 4X99B 1MCPH 4KI5E 1U2HA 5FFOA 1WA1X 4IRZL 4EIUA 3L1FA 3U7YH 4P49A 4E9RA 4QHMA 4RESB 2BS9A 3LZOA 5JOFA 1DDTA 4WO4B 3D1MC 4DP9X 2OFQA 1X5ZA 4QXWA 1F41A 1T4KA 5EFIA 3RVUC 4BFFA 1GZPB 1TTAA 2VE6B 1NSNH 2VNCA 3ZKSD 5C07A 4MB4A 2E4FA 5ACZB 1XF5B 3OJVC 3O3EB 4NO3A 2XKSA 4A6YH 4OZHE 5C0IB 1MFBL 2EXYD 5EWIL 4EBQL 2X2IA 5ABAA 3GBEA 4Y4HD 1FGNL 4WHCA 3VACA 3O2DH 4JG5A 1IAMA 4WK4B 1LO5B 1T7ZA 5BPPA 5HGBB 1X4ZA 2RIKA 3QZWB 1WBXB 3HI5L 4Q6YA 2H32H 2W8CA 4FQQA 3W9EB 1ZLUK 4XMKL 2CRZA 4FXGB 4HIIA 2HFGH 4PP1D 3V0FA 4TUJB 3BP4B 1LMKA 2BXZA 4BWWA 3U0WH 3UBFA 3SE3C 4P5MA 1INQB 1BIHA 1JP5A 4UQ9A 2KQNA 3TO4D 1XGQB 2YWYA 2D31B 3WHXB 5D70H 1LXMA 4BELD 2W0KA 1URIA 2W59A 1L3WA 3D33A 4QOKB 2E6JA 4XP9L 4ONFH 4ZXBC 4NENA 1JCKA 2ZCZA 3D39E 5C07E 1X5FA 2OP4L 1P4IH 2BSDA 2YD2A 3AWFA 3ZK0A 1UQSB 3EOTH 5I1LA 5GGSY 5FLVA 3N06B 1G9EA 1CFQB 4Y9BA 3V4UL 5IVXE 5EORL 5E7BA 3GDBA 1MAML 4QJ3B 3I9GH 1QFWM 1RMFL 2WK2A 3MRJB 2WZ0A 2ZXBA 4S1DC 4Z5RA 5I76A 1IIKA 3OKNB 1BHGA 2J71A 2GY7B 1TFHA 4DP2X 5JQHC 3E7JA 4WCYH 4LPXA 4K3DL 4IIQC 5HD8D 3PHQB 5E4OA 4ZXBB 4KY1L 2FIKB 1K5WA 4JM4H 1YEDA 2WP3T 3LNHA 2ZZUT 5E00B 5I75B 1KWGA 1T5WB 4PJ7E 4W68A 1TDQA 2F61A 1OXYA 5L0QC 1XGRB 3QORB 1MIMH 4BHUI 2NRDA 5IZ7A 1KYDA 2B1HL 1DQQB 4JRLA 4L8BA 3UTSA 4TL4A 4ZUTB 3SE8H 4G1EB 4PWJA 3SCMD 4PJ8B 3NZSA 3SKOB 1ROCA 2HVKA 1ZS8A 2IALB 3B9KD 4P46D 4WWKC 1TOXA 3MOAL 5DZJA 5E2JA 5F1NB 3IFPA 4YVNA 1SEQL 3WUWA 1BXVA 1RUMH 1NINA 1ZD6A 3SPVB 3LZNA 4LSUH 2R2HA 5AW1B 4ICWA 2GIYA 4ZD3H 1D5ZA 3IGLA 3T65B 2ZF8A 2Y2WA 4PW3A 3VD5A 3GSVB 3HHRB 4Y2DB 2Y5TB 2E9GA 2VSDA 2KKQA 4NBYB 2D0HA 4JM2C 5F7UA 3GB7A 3IDUA 4PJHA 2ADIB 3KPPA 1HQ4B 2IV8A 5HI4D 2OTPA 4Z8FH 5FOBA 1SHMA 1ZCRA 3VMNA 4YZFE 2EZ0D 2VRAA 4WI8A 1EMTL 3BPLC 1YVLA 2GIXA 4JFDA 2VAJA 3MCLL 3QT2A 4L3EB 5IY5B 5JW5A 1MN4A 3UAAA 5EU6A 1MSPA 1K8IB 1QRNB 4B7IA 1KTRL 2X4NB 3QUML 4DVRL 3OSVA 3SDAD 3W2DH 3CDGA 3BZFB 3WN6A 2ZX5A 1M2OA 4OGAD 4PGCA 4J6IA 9CGTA 5EEZA 2ED8A 1F42A 2RD0A 4OJEH 4W1TA 4L1DA 1MHPH 4CJ1A 2QBWA 4UUJB 4M4RB 4ONGL 2FH8A 4HISA 4JB9H 2AEIT 3AT8A 1DDHA 3BGMB 3INOA 5K5YA 5I30H 4XNQA 1WS8A 4F7PB 3FCUB 3MLPA 5DFWH 1A5FH 2EINB 4JREB 3MJWA 3LS4L 4WF7A 4QRPE 5FK9B 1IT9H 3C87A 1MLCB 3NJJA 4DP0X 3A67H 4PRDB 4L2LA 2WXNA 5IMOB 1E9OB 5CMAB 1KY7A 5AVRB 3RB5A 4LOUC 3WIFA 3MNWB 4XPBH 2ZD0A 4NZJA 4YHNB 1MDTA 5GGQL 3A24A 2J88L 3V5DB 3R06B 4RMTA 5E51A 2Z35B 1U2YA 3QDMA 2LGNA 5EN3A 3WKNA 4YDLB 5DMGC 5C07D 2VXQH 4L8CA 3FFOA 3Q8FA 2YRLA 4KWUA 4AENA 2TAAA 3L5WA 3QUGA 4F24A 2Z31B 3ARPA 2B5IB 5ABDE 1RSFA 2IDUA 3QHZH 5MENB 1UFGA 2EDFA 2OJZH 4G8GE 2YWZA 5FUOL 4OI9A 4PJ9A 4KPHH 2XZAH 5I18H 1NWPA 4FNUA 5EU3A 1U3ZA 3NVQA 3VXOB 4UBDC 2QVIA 1GIGH 4HCRH 3L3KA 4OF8A 2ZWNA 3TASA 4HPHA 2XZCH 4TSBL 1NCDH 2P49B 1PDKB 1I9EA 3PL6D 1BOGB 5F8QC 3BD5A 3MV7A 2XWBB 5EG6C 4Z7VA 3QJZA 1PBYA 4X4XA 5TQ0H 1A9BA 5F3BA 1G5GA 4DP1X 3G6DH 3KDMA 4AQEB 2VN4A 2JI2A 3QXDA 3CFKA 4K94C 4MVBC 1BMWA 1GTNA 3ALWA 3RIKA 5DS1A 4ENED 4FL4B 3GRGA 1R17A 1HNFA 2XJKA 4YLQT 3HUJA 3NCFB 2BVOB 2NQ3A 2P5WB 3QFDB 5E5RB 5F7DB 3G5WA 1NKRA 1KELL 4PW9A 3RDTD 4QHLB 3A23A 3PXLA 1YYCA 1E40A 2JKNA 5MEND 3EJYD 3SEPA 3ZU8A 4IBVA 3VB8A 2X87A 1S4IA 3RI5F 3H3PL 4B9IA 3QUMH 1C16B 1GPOL 5EBWB 4PRPB 4P2RB 5JIPA 2BIMA 4KDTC 1GY1A 4JFPA 2DQUH 4WU7A 5HYSG 3L48A 1EMTH 3BAEH 3WFBL 1OE2A 1FO0A 1X6NA 4PVBA 1P9MA 1UD5A 2XBTA 2FK9A 4MTMA 3GMOB 3O6FA 4MD4B 2IJ0C 4PRNB 3DC0A 4GRWH 4K7FB 2APTA 1P7QA 3TBYA 4LLDB 2A9NH 4OZIA 5DJ2B 3UJJH 4I18B 5ISZA 3L8QA 1MG2C 5IMLB 1KJ3H 3NIDB 2VZTA 1VGEH 1JL8A 3HOGA 3AQXA 5D2NC 3TNNB 2LHAA 4UT7H 3FU3A 3TYFB 4X5WB 1ZA6B 2MQCA 3MBEB 1MUJB 4CGUB 2WYIA 3PXJA 4LSQL 1SBSL 2BIOA 2IWKA 4LVOB 2P4AB 1EHXA 3D2UA 3PHOA 1ZV9A 5IOKA 1BX2A 5J7CC 3DRQA 1IGCL 2BNRD 1BJ8A 3VWJB 3PY9A 4X9BA 2OXGB 2R1XA 1M56B 1W0VB 1FHNA 5A3IC 3N40F 1NWOA 4TM9A 3KJ6L 4OJCA 5I71B 4QRBA 5D96C 1A3LH 1TJHL 2QADB 1DQTA 1A3QA 1LQSR 5CILL 3AQDA 2WXQA 3QRFM 2GB2A 4BFKA 1TVHB 3LNGA 3V8CA 4X0NA 2F54D 3HC4L 5LG6A 1A7QH 4C4UA 4NO0D 3V9CA 2OMYB 3OKMA 1NAMH 1TCMA 2FLMA 1SRDA 3OMIB 1JFQH 4LRNH 1PZ3A 4HSQA 2P5WE 3BPNB 1NICA 4ADIA 1VLXA 1FVCA 4OIFA 4L9LC 5JPNB 3T0DA 3F62A 3BLPX 2WZ6A 2WNXA 1MJ7H 4EN2A 4RQQB 1OGTA 3MOQA 1O5PA 3RY6C 1DQMH 2EDXA 1OSPH 4Y0GA 5F6HI 1Q4NX 2PWDA 3LSOB 3MOBL 3SYPA 4HJGB 1AS8A 2BWIA 4I89A 3QJXA 4L0ZA 4KQ4L 1NPUA 2P8LB 1AOHA 2C4FU 3CDFA 4UOQA 5IVNA 1G7HB 3NRQA 1ID5I 4KZDH 1DUZA 1KYUA 5GZND 3VYNA 3TU6A 5F0PB 1JDDA 4HZ1A 1EZSA 2GKIA 4M29A 2JE8A 4BHUA 1IE4A 4FQLL 1ZK5A 4HT1L 3QDJA 4IHOA 2HUEA 5HHVL 2CPUA 3BSHA 1N67A 4PN6A 3RVUD 2DLHA 4JHBA 5K59F 3GBNL 3GXDA 1A25A 5DJZB 1AGCA 4U31A 5TE7L 4POYA 3TEZA 2XTJC 3N43B 3QC5X 4FFVC 3TA3C 1M1SA 4J5VA 2Z6FA 4JR9L 1G7QA 3BXNB 4M6MH 2OJEA 4HWBH 5B3JF 5HY9B 2OW6A 5KVGE 1H6TA 1MXGA 1XXFC 4IBQA 5GIRB 5ESQA 4KO5A 2I26N 5DVPA 1I8MB 1AC0A 5E8NA 5CLYA 3BZEB 5GJSH 5FYKH 5JR1H 1JNLH 3QAZC 2KLSA 4DGIH 1PCSA 2CO2A 2XT1B 3C60A 1W9XA 3AITA 4JO8A 4MAYD 5IMKB 3S8FB 4G6KL 4AI7A 5HGDB 1KFAL 3HNTL 5CIPA 3TWCH 4K9EC 3NJNA 4EAEA 4KKZA 3U0TB 2PPEA 5JXEA 1LVEA 3OKLB 5E1HB 2HH0H 5A16B 3P2BA 1U8HA 1D5IL 4U1LB 2G4GA 3ZN6A 3T0EA 3H9SD 4Z7VE 5KVEL 5LCVA 1S46A 2BHYA 1CDIA 1NBZA 2X9WA 2F68X 3TV3L 3NK4A 2XU9A 4XP4L 1HEZB 3HC3L 4XVJL 2BMKB 4P04A 3F2LA 3R0NA 2XVGA 6CGTA 4O2EA 4JRXD 4WI3A 3NCMA 4U1GB 4FABL 3GI8L 1QLFA 2MH4A 4G43B 1G0DA 5LBSH 1U3HC 3QJQB 1CICB 1JPGA 1AZUA 2A77H 4LCWB 1OB1A 3CZUB 3QAZB 3GNMH 1V3KA 1R3JB 5F3FA 1M1XA 4ZNEE 4N2OA 4Y5YC 1WBZB 4ZYKA 4Y4KA 2WLLB 1GGTA 3GWJA 4HUWB 3U6XS 2HTLC 5EA0L 3NZ8A 1E4XH 3PWVA 2Y07H 1TU2B 2HJFA 3GJFH 2GC7C 2R4RH 1KGYE 1P7QB 1PY0A 3MRLA 3QNZA 2HFEA 3VH8G 1LO4H 3KMDA 2VR9A 3BFQG 4ZPVA 5JLZB 2Q86B 2XWXA 3C8HA 3BQVA 3VFPB 1A4BA 4CSPA 3RTQB 5D7EA 3K71A 3I6KA 3DROA 4FFZL 3V6BR 3ZTJH 1HHGA 3IDIB 4UZGA 3NSXA 3GF8A 1RZ8A 3K2IA 2VC2H 1VZGA 4Y4HA 4Y5VA 3TT3H 43C9A 2N3JA 3IAGC 2UWEA 2QPDB 4HIHB 1F00I 3UTOA 3BGFB 1E67A 4M48H 3T09A 1AGEB 5GZOC 4PRID 4F27A 4DTGH 3MLUH 1KZQA 4JANB 3VGHA 1QSFA 4FYSA 3S35H 5I1AA 5FV2A 3EFDL 4ODSL 4QHPA 1CLYL 1TVBB 3CZJA 4LO9A 3VFMB 3CLEL 3PGDA 3D4CA 2YD3A 1M71B 3UBXI 1TNNA 2MQ3A 5E2UL 4K2UL 2PUQT 3F64A 3KYNA 4PP2B 4Y2OB 4HUUA 4DIXA 3QI9B 3CFCH 5DUBA 3L3GB 1S9KC 4U1SB 3CFUA 1NKGA 4KRMB 2MKWA 3RI5K 1SLXA 4AJYV 3BJLA 4HW6A 4QRUA 1ECZA 2VDOL 2CO3A 2V3EA 3O4LE 3KPSE 3ECQA 3KM1A 4ECNA 4H8QA 3DPDA 3UEZA 1KBGH 1KT2A 4ZFQA 1E5CA 2ZX8A 3FT3B 1XIWB 1GKEA 2G60L 5E4IA 4WUUD 1I31A 2FWUA 1NAKH 3CZSA 5IMMA 3N85H 4P59H 1ACCA 2FHFA 2YEZA 4K3EL 1UA6L 1DQIA 3PP3H 4ZMOA 5LVEA 1BD2E 3C12A 2A74A 2XG5A 3KXFA 1NOFA 2Z9TA 2YPKB 3O2WH 4FFVD 4XWGL 3TA3D 5CJ5A 2VXTH 1KXTA 2RTTA 2IOOA 3QI9C 1QUNA 4YDZA 5E8PB 1QZNA 2KYIA 1AOZA 1QYGL 2GHWB 2RACA 3E2HB 1MEXL 1T5XB 5CSBA 1PL3A 5HYJE 2ZWKA 3QQ4B 4G42A 2ZKMX 4IS6B 4YUEH 3H42L 3NIGF 5ISZB 4WTWA 4LNRB 2AK4B 3IFOA 4AT6A 5BJTA 1NBQA 4H8HA 1WVZA 1E9OA 4FQJL 3VI4E 1ETB1 2QGBA 4KRPB 3FQ4A 4HH9B 1F56A 4E42B 4L3CA 2XIIA 4QOKE 3MRQB 1TSHA 5FECA 1N6QH 1EEQA 4P5TC 1ZHLA 1D5XB 5F6IB 4ZX3A 4U1KA 1IC7H 3ILQC 4XPHL 3D08A 1UOKA 1S5HB 3FU9A 4N5ED 4YDLC 3T4AA 4AL8L 1IMHC 3QNXA 5BO1H 4UQIM 3BZ4A 3TO4B 4PJEE 3N1GC 4LEXL 2R4SH 32C2B 1HSBB 5IVXB 1KTDA 3FT9A 1SVBA 4GEJA 2DYPD 4I2XE 4ODTH 3E3QE 2BIQA 3VH8A 3QEQB 2GJ6A 2N56A 4FG2A 3RWEB 4WEMB 1WWWX 2HWZH 5DFTA 3FB6B 5SX4H 4E2OA 4Z0BH 2V33A 5EU6B 3KLAB 5IBUG 4DGWC 1BZ7B 1TZOA 2J5LC 2X4QB 4ALAC 1BP3B 4DKEL 4F92B 4RZCB 1T2QL 4WV1B 1THAA 2QEJA 2VSKB 2VR6A 3AWGA 5F6IC 3HLAA 1N6QL 1F1AA 4RMVA 4F1SA 1XVSA 3QUHA 1U8LB 1YY9D 1ZWIA 4NGHL 3UO8B 3OD3A 3B7RL 1WGVA 1OD7A 2P1YA 5D7LD 5EC2B 1BLIA 4G6AD 3WIHA 5E6SB 3IMVA 2EVGA 2Q7NA 1WF5A 3BJ91 1DBBH 1QYGH 1I9JH 3MYZA 2WYTA 4FNRA 4D7PA 3ARYA 4L5FE 1E4HA 2J1ZA 1ODAA 1RJZB 4HJTA 2EYTA 3ESNA 2BOCA 2WV3A 3ARDA 5GS1B 4YDKH 2P52A 3FOLA 3MLVH 1VA9A 5I1EL 1YNKH 1XZ0B 4B9FA 4NT6A 1JPSL 2VQ4A 4Y2DC 3EJZD 5DJ8A 1ED3A 3S36X 5LLIC 1IL1A 3N85L 4P59L 1HAWA 4BDVA 3WBDA 4P3WA 4OW6A 4L8CB 1VADB 2R7EB 4IBUA 4KHTH 4A7GA 3AREB 2ZPKL 1ESOA 4LFHD 4MWFB 4XPGH 4FFWC 1F4XH 4K15A 4N9OB 5G2NA 4LGPB 1I1AA 3QG7L 2BCKB 3RVWC 3O11A 3CZLA 4R6UA 1J1XH 4O02A 3WXVL 4O02H 1O7VA 3UDWC 1HL4A 2VZSA 2VN6A 2MCMA 1XCQA 5JQ6H 3ARED 1J9QA 3UYOD 2EKJA 5ID1B 1FIGL 1X5MA 2KS0A 3BH8A 4WEEA 4AIEA 3RVVD 1T83C 5H35B 2RA1A 3BGAA 2BC4B 3TF7C 3N42B 2P80A 2Y2YA 4IRSD 1IZKA 5JHMA 4PWFA 2VAAA 3MUGA 4AVJA 3GT6A 3PQYA 4GG8B 3UMTA 1IEBB 1MF2H 5ITBL 3ARUA 1RIHH 1PNCA 3NFPB 4JS7A 1CURA 4M48L 1E5UI 2FBRA 4PV1C 4G5ZH 1YEHL 2ZUWA 4HETA 1JWUB 2OYMA 5F7NC 4NZ8A 5K1VA 2LTQB 4GOSA 5KJRL 3L4WA 2QVTA 5ANME 1OSYA 3EYQD 4PIRF 3TESA 2WBXA 4DGYH 1HL5A 1DANU 4PGBA 3EDDA 1JPTL 5IQ7L 3OZLA 2C1PB 4P07A 3BKJL 3X13B 1GGBH 1JXGA 3P3YA 4NKMA 4QKTA 5GZNA 3SGEI 3QXVA 4P3CL 5EPMA 4UTCA 3GMMB 2BS8A 5E9NA 3O6KL 1PEWA 1SDYA 4M62L 1P4LA 3IDMA 1S7QB 1DBMH 4WNQA 3SE6A 3X17A 3O0RL 2ZYHA 3GGWA 3MXWH 2WMPB 4XTRC 2XWEA 5D7KD 2KL6A 5DJYB 3KYOB 1B4RA 4TNGA 1PIFA 2HVKB 5C07B 5BVJB 1R3HB 1ZPLA 3AUWB 1GGIL 1MCOH 3QQXA 3S97C 1E30A 3QRGH 4ILDA 2KUTA 3NGBC 2NY0D 2BVQB 5I8OH 3QUMA 4K9EH 3IKCA 3N91A 2H45A 4HPOL 1OM3L 1DJXA 3LXCA 3EYUL 4NSKB 5CP7B 1B9ZA 3DXAB 1OP4A 2TRHA 3BP5A 3IU3B 3LKOB 3FB7A 3PU7A 5AD0B 3UTPD 5DC4B 3RQ3A 1W16A 1YYML 4S1QH 4RA0C 3HS8A 1NCBL 3VJ6B 1EXUB 3FTVA 2OMZA 1ILSA 1H0DA 3E6FA 4IU2B 4GUQA 4AVIA 1BM3H 4FG0A 4PLNC 1JK8A 3Q1EA 2FBJL 4KKRA 4MDRA 3II3A 4FQCH 3DXAD 4GRLA 4XPFL 1Q1JH 5GSRA 4HOZA 5C0RH 1QW9A 2Y7LA 3MRDB 3GSUB 3NFSH 4Z7NF 3U6RB 3D6GA 3FTWA 3N41F 1A6PA 1DVTA 3OLIA 4WV1C 1PD0A 5K33A 1BXAA 2CDGA 1ONQA 4NNYA 3VFNB 5IV2B 3NBNA 1S9VA 5GJSL 2YA1A 2CO6A 5HYEA 3GINA 4YJZL 2VJXA 2RH0A 3HUJF 3LKQA 5E4EC 3NFNA 3KNBB 3MLWH 2BVEA 1KCUL 3QA3A 3GXPA 3NSCA 5BVJA 1JF1B 2NQCA 2JJUA 2EH8H 1P6AB 5SX4I 2OQJB 2H0JA 4FQXD 1FFPB 1GY2A 3WENA 5C0DB 4OZFB 4G7QB 1VEMA 4X7TB 5HJ3B 1FNAA 1UJTA 2V8LA 3EJQA 2IEPA 3GHPA 3RBSA 1ETZA 4EN3C 1B4JL 3U0PA 1BJMA 5I0WA 4Q52A 2IFFL 4NQTA 4TPRH 2A1WH 4RSYA 5CINL 3ECBB 4C56A 4FQLH 2J8UA 5IEHB 4WU5B 2WQ8A 1WA0X 5D1ZI 3ABLB 3WN5C 3QIBA 2QZQA 4JQIH 1NIEA 3QZPA 3WLBA 1F2XK 1XGTB 5I0VA 4GY4A 1Z9PA 2BNRB 1A6VL 3VWJD 3FU6A 1L6PA 3IDJA 4R4ND 5GS0L 1DBKL 1Q9KA 3MV9E 3GZPA 5ESAB 1XGYL 2VW6A 5AZEH 5I1GL 1E0OB 3VXSA 3OL2A 5JHDA 1T20B 4A7UA 5D93C 1TNMA 1Z2KA 3A6OA 2JKLA 3UJTH 5B8CB 1JZEA 1XF5A 1RPQA 1PX4A 1T3FB 4TVPH 5C1MB 5E9AA 1DVSA 1J8HD 1GZPA 2VE6A 1HKLL 3PL6A 1EEYA 3UG3A 1DL7L 2AABH 3ELAT 3AXIA 1CE6A 4EUPH 5IFAH 1FRGL 1AE6L 4N0YH 4B96A 4Q0XH 3IKKA 4G9DB 2R29H 5AL0A 2WLYA 4IEFA 3UTTB 1PX3A 1KIQA 2R69L 1WIPA 2Y9RT 2R51A 4PJXB 2D2CC 4X8GA 2GTWB 2UXTA 5LBVA 1UACH 3PDGA 4HF5L 4ETQA 1CK0H 1JGEA 2VC2B 2KC0A 3BAXA 5FM5O 5K1JA 4MZ3A 3UO1H 4PJGB 1UOLA 3M1BB 5AW0B 1TFPA 3KYMB 3Q2CA 5F1SA 5IB5A 3BWAB 4JE4B 4OD2A 1VB9A 2W9DL 3KYAA 5D93B 3EJJX 3DA0A 5F1IB 2A9CA 5CCKL 2Y6TE 4M8QB 4XVUD 3QUXB 2I9LA 3SDDD 2PF6A 4M1GH 2VDKL 1A6UH 1HHJB 1KB5B 2H2PC 4KJYA 2JKJA 2B1OA 3H4FA 2D7PA 3CVIL 2Y5QA 5JMRA 1JHTA 2VQUA 4NWTH 1VRSA 3GHBL 3STZA 1WEJL 5H94A 3RLSA 4XMPL 1Q9LA 3Q5TA 3HCVB 1G7MA 4FF9A 2ZCLH 3NCJH 2G3MA 1CBJA 4E5XA 5ENWA 4DW2L 4EQ2A 3C09C 4UBDD 5DRXB 2GC4C 1QW8A 1ZVYA 5LXGH 1CFSA 2ZOKB 3KPRA 1H3XA 3JWDC 5LO7A 3AG1B 1HXMB 5EOQH 3ZBMA 2H4EA 4JRYD 4U49A 3RZCA 5IFJB 4JAMA 1UZ6E 4FNSA 1J11A 2FATH 3VRLF 1ZWIB 3DV6A 2BSSB 3KEDA 4A6YA 2XTJB 4JUSA 3HZMA 3LV3A 2WNKA 2DI8A 2P5EE 3TZVA 4MZ2A 2IAMC 4EOWH 3QXAB 1L7IH 4MBRA 4CW1B 3DRTA 3BKMH 5LNEA 4HUMB 1P6FA 1ZK9A 1ZT4B 2B0SL 5HYSA 1NCAL 1IKFH 4Q8BA 4DPAX 2VMJA 5A6IA 2ATKA 4GXVL 2VLRD 3FQ2A 1VGKA 1OKEA 3CFDA 4ZS6C 4X83A 4HLZG 3NACH 1DJWA 1J5HA 2VLKE 3DVGB 4IRJB 4IYKA 2ERJC 1DVFD 3RTQC 2CDEB 3RNQB 4JRXE 3QQ3A 3QPQD 4IMLA 1N64H 2K0RA 4KI5C 1D5MB 1W8NA 2BVPB 2LU7A 3ATFA 5AW5B 2LAAA 7PAZA 3WXWL 5I8EA 4PUBH 1EFXA 1KDJA 5JUEH 3W0WE 5LCVH 1XMEB 2N59A 3NJLA 1SLVA 3DPBA 2V5TA 4I0PB 4WUUE 4LCYB 3D18B 1BIIA 4IMLB 3JUYA 2E59A 2YARA 1J5OH 4C4KT 2E47A 2FX7H 5D8JL 3ARBA 1U21A 5ITFA 4HUVB 3IXTA 2FSEB 4RH4A 3QCUL 1GC1L 2WVVB 5BW7C 5D7HA 2FUQA 3LVEA 4F7CA 2DKUA 4UILH 4PJIE 1GSMA 2FGWH 2Z8VC 1ZT4A 1F3JA 2ZCLL 3NCJL 2VISA 2Y36L 4LK4A 4F58L 5E1AB 3CC5B 1DR9A 3BKCH 1KXVA 1ZT7B 2XWJA 3BVWA 5I19L 4FJZA 2MFNA 2YRBA 1RUQH 4NYLA 5HVGB 2WYZA 1UT9A 1OSZB 3LH9A 5BRZB 3QE5A 4TTDD 3W37A 1I8KA 4WAFA 1E4XI 1WYJA 5C6TL 5GGQH 2ZOKA 1XIWA 3KPRB 5BRQA 4NHUA 4R5TA 4PG9B 1KZYA 4P57A 5KSVA 5EO0B 3NRPA 2EIEA 1E90A 3C2SA 3QSKB 4YHMH 4EDWL 1KFGA 1BWWA 5JA8B 2BSRB 3S6CA 3ULUL 1IV8A 1CUOA 1RJYA 2AQ2A 2A83A 4M9PA 1ZLUH 4GT7A 1KMGA 4DVBA 4NKOA 4X6DF 4MSWB 1JHLH 3GSNH 2NQDA 4JB9L 1RIHL 3C5JA 4R3SB 3QQDB 1YDPB 1R5WA 1JRHH 4WHYH 4NQQA 3AAZA 5M94B 4V1DB 2WP3O 3IF1A 2GYSA 3QUYB 4G11A 4HIEB 1SUHA 1MCJA 5I28A 3IJHB 3V5KB 4CMMA 4G9FE 3WLWC 5IOPB 2D7OA 1FWXA 3QXTA 2IPUG 2PO6A 3I9PA 1ZGLA 3AREC 1XH3A 3WNLA 3KW8A 3CPLA 1BSIA 1BBJB 1I1FA 4R84A 2QGCA 3DROB 4YS4A 1HWHB 2IWFA 4CDGC 2IPKA 3QO1A 2VDPL 2VWEC 4WI4A 3ZLQC 1YEEH 2NUPB 4RFEB 5AKSA 3FO9A 1HXMA 3OAUL 2J25A 1F13A 5F8RC 3JUZA 3M07A 1QVOB 4FLQA 1PG7L 2GI7A 5D6DA 4JGNA 3D52A 3HBGA 3E80A 4J4PA 4WIQA 3LZLA 2B1AH 4ZAKC 4F8QA 3TO2A 3ZL2A 1PYWA 2FYYA 5GS0C 3MXVL 3AM8C 4NLAA 4B3VA 2ZOTA 2EABA 1J18A 1BFOB 3J2PA 1LK2A 2HPTA 2JV6A 4QRRA 4HKJB 1Y0LA 4ZUWA 1T89A 3B6SA 1R3JA 1U8NB 4J6RH 4LU5H 2W07A 1HJBC 2IDQA 2IBZX 4DUVA 1RJLB 3G5ZB 1FVDB 1QQDA 3CSPA 3T77A 1ZXKA 1HDMA 5I82A 5LBGA 1KCWA 1DUYA 3WS6C 4KI5D 4KAQH 5D1XE 3I02A 3QIWD 3UZQB 5ISZD 3CCHB 1RZIB 1Q94B 2AKRA 3JXAA 2E6PA 1J0YA 1QMUA 3BUBA 5DQ9A 5A2BA 2QDWA 4YSOA 5GGRY 1EUUA 2DQTH 5EIIB 1JGEB 1S7XA 2OZ4A 3CZFB 4KUCD 3K8LA 1JZIA 3V0DA 2F19H 1JZ2A 4XODA 4XMXA 1OO2A 1QI3A 4XT1C 5H4YA 1A7RL 3L5XH 3RGVA 2YD7A 2LT9A 2E27L 5TDOA 2P8MA 1WZAA 1GYVA 3MLZL 5AB0A 2PLTA 3LHAA 2XA8L 3B7YA 4ZS7L 3T3MB 1SYSB 3CZGA 3S36L 1FE8L 3QIUA 1GVIA 2E75C 3E6FB 4M5YH 3ILDA 4HXBL 2OULB 4HALA 4WW2C 3JTBA 1RD6A 3QJUB 5HDQL 4HUXB 4PD4J 5FWQA 4BK4A 1DBML 2DEWX 3E6HA 1OPGL 2F74B 5F7HA 1OOWA 3IGAA 3G6AA 4KTGA 2BSBA 4NQCB 2G2PA 3QFJD 4IOSA 2P7TB 5AB1A 1FC2D 5C09B 4U33A 5H37H 2FQDA 3BVXA 3QDJE 4FQXA 2DWYA 5ANMA 3ZDZB 1LEIA 5HHQA 1JPTH 4EUPG 4XMTA 1CBVH 3BEVB 3IMTA 2HVJA 5JDJA 2PYFB 1F4WH 1JUFA 1Y18A 2FIRT 3R19A 1RZKH 3L5JA 4MYWB 5DJ6A 5JDSB 1DUZB 1AFVL 2IGLA 4LIQE 3HS0C 4D3CL 1MPAL 1NJ9B 2PW2B 1IGJA 1S7SA 2D9CA 1DBJH 1MVYA 4P5TB 2EIKB 4KROB 3APMA 4Z18A 1HH9A 2RHEA 4OLXL 5I1HH 3Q06A 4LCCA 4NP9A 3PAVA 3P0YL 4NUQA 5GZOD 4JDVA 4JG1L 5EPMB 3MU3A 4NKMB 2JK5A 3FONB 4A63A 1ND0B 3FTGB 4JZOB 4OF6A 3II1A 2F7RA 4ODVL 2ZKHL 3KM2A 3MO1A 4X5XA 1UURA 3I2CH 5JW4M 1RH8A 4OM1L 5GSVA 4OV5B 2EH7L 4P23D 3P2DA 1W91A 3Q6FB 4HK3N 2DQTL 2GTQA 1HHHB 3P30H 4YHPB 3U7WH 5C71A 1JGUL 3EJPA 2KLRA 3WXVH 4HDIA 2PTVA 2B9BA 3WG7B 3VJ6A 4KQ3H 3ULUD 1KBKA 5DMIH 5T5FA 2J72A 4JJOA 1W8EA 4A66A 4YHIB 2FX8H 5EC1B 3EGSB 4IJ3C 4B5ZA 4JDEA 4ORGA 3PHAA 4PB0L 5DD3H 3HR6A 2BC4A 3QJSB 1BX2B 2R9HD 2CH8A 1MJJA 3VU1A 5I1HL 2IADB 1ACYL 3RPKA 5E9DE 4OJYA 2WHVA 3VW3L 4X6CF 1IBGL 1YEJL 1MUJA 2YK1H 3ZKXB 3F7LA 1WBYB 2APWA 3D69B 3HBQA 4TLKA 3GK8L 2CM6A 4M9OA 2QSCL 5CM1A 5FO9B 4M8RA 2Y1AA 5DQJB 3QUKA 3ML9A 4MJID 2DIJA 1CBVL 3HNSH 4HOWA 5I2IA 3MUJA 1N8ZB 2X4TA 3UC0L 3DIFB 3BP7B 5HGAA 2JLLA 4NQXB 3OR6B 1KB5H 3NSFA 1GCFA 5AZUA 4AQ8C 3ULUF 2IDTA 3FT2B 4ZTPL 2X2JA 1MRCL 1OPGH 3ARDB 4WFED 1RLWA 5JYMA 3D85D 2B39A 3V7AG 3DIDA 4N5EC 1QR1B 2DRUA 1WO2A 4JFPB 4WU7B 5HHXH 1MVUA 3LJ3A 3P4MB 4OZ4B 4F7TB 2PW1B 4PJEB 1WWBX 5TE6L 3TYGH 1UKTA 4MXWL 2DLFH 4JY5L 2C3VA 1BZDA 3GSQA 1QABA 1SXBA 3M17B 2NUTB 3GM0A 4OIBA 4QMEA 3P4OB 3V9FA 4R26H 4UM8B 4AV4A 3AFLA 4A2GA 2VDNB 2O6PA 2X4PA 5A2JH 4NZRH 2WXHA 1J0JA 2GABA 4GYBA 3CQQA 5C86A 4GKOA 3ILPA 1Y07A 1WDAA 3VFVB 2JH2A 5AYUH 2EIMB 4WKXA 3NIGB 4H8WL 4ZSOB 2X4RB 4S1RH 4AC4A 4LKXB 3CZNA 4Y7MA 5IHLB 3W38A 5AVTB 1OAUH 4U6XB 1BOGA 3QXUA 4WEUD 5MP6L 2KI6A 3MLTA 1NANI 3QRBA 4XC3H 4HWUA 3X11A 1CR9H 3IDYB 3X12A 5DCCA 3KXFE 3ZL4L 3US0A 2NMSA 3P02A 4GSDH 2LVEA 4G8FB 3BN9C 4JKPH 5EBLA 4QTHA 4Z6AT 4F57L 3V4VL 3AGWA 2QGDA 4JREC 3BVVA 3EG9B 4YH6A 3UCRA 2AF2A 1CFMA 3HS0B 1TETL 1GC1H 2P43B 5DD3L 2OCCB 4FQ2L 2PP9A 5DFVC 4FFZA 4RGMB 5EIIG 1E27B 3ZDWA 5L2KA 3C60D 1J88A 2FX8L 2PCFB 2FWLB 5KW9L 2HT4C 3P0GB 3FUDA 1QFUH 3ISYA 3L1EA 3VYOA 2ODHA 4FA6A 2R0WH 2NYKA 4PJDF 3IBEA 4JFVA 4F15B 3CSFA 5BQ7B 2AJVH 1FG2B 4LLVB 1JDAA 5E9DA 2H3XC 1UXWB 1M05A 1WITA 2PN5A 4NCDA 4YSSA 2E7HA 1O9ZA 3IMRA 3L3OC 3P30L 5EO1B 2BIHA 3B4NA 5CU9A 3CQPA 1IAII 5EN2B 3RKDC 1MFVA 2I85A 5LNDA 2IV9A 4TRPH 2BW5A 1IM9A 3B3IA 3MJ9L 1D7CA 2A6IB 2JTYA 1IC1A 3US9A 3S5YA 2VLKB 3MNZB 3P3TA 1UZGA 1FH5L 4LRNL 1ES0A 1FSKC 4URKA 3Q1SL 1GZHC 3MFFA 5SWQA 2A9BA 4JG0H 5HYQB 2XY2A 3DARA 3Q9PA 1NIBA 3AS2A 4BE6A 3MBXL 3NZUA 1JK9B 4MMXA 3FPXA 1KPUA 2K3HA 2VRQA 2AQSA 4ODUA 4W9IC 3T2LA 4DZ8B 5I15L 3DOSA 3GSNB 4RRPA 1ZHNA 4HWBA 1AYRA 3RU8L 4J28A 3KPQA 1F4YL 2IDSA 2YD1A 2XC8A 3SBRA 1MFEL 5FYLL 5TE4L 1KULA 1BVNT 4NKQB 5D1XA 3T0BA 4U3SA 4DK5A 4MKTA 4E9XA 1V5JA 5D55A 1NFKA 3B9AA 2MPAH 3IFOB 1QSEB 4JFZH 2VZUA 5AW3B 1X44A 1GOHA 1NCUA 1OAQH 2UWEB 2QPSA 2MQGA 3NSJA 1JWMB 4PJCA 4QGTA 3S96A 3FTXA 2X42A 4CUCA 2Y1ZA 4KXBA 1UUNA 3F04A 4PJFF 2X7LA 3O6ML 4Y5VB 4E9YA 3T0EE 4LHUB 2CG9X 5ERWA 3ZT5A 4P9HH 1NDMA 1I1AD 4AQAB 1WT5A 2XKNA 4RBPK 3V0JA 2QKSA 1EHLH 4WWID 1TTUA 5KTEL 1S7WA 3RFZC 4NM8L 5I5MA 3T3PF 1YMME 5EU4A 2IXQB 4X6BB 1SF3A 3M45A 4FAAB 2W0FA 3MRLB 4N9GA 5I6LA 5CWSB 4KDTA 5B3SB 3TVMC 5TE4H 2Z93B 2FO4B 3S7GA 4GG6B 4NP4H 4YHYB 3IGAB 3WAKA 4EI5B 3ESVF 3K91A 2WXMA 1YEDB 2XX1A 3A0OA 3PIQA 5EZOH 4ZMPA 4OD1H 2YUWA 2WXPA 2XIDA 4IJTA 4J12A 5JW4Q 5TPWH 3OAWA 2VDQH 4GP8B 4YDIL 3DHPA 4KK9D 3EOYG 2MPVA 1NIAA 5FUCC 4N26A 2OI9C 4QIRA 4Z5RB 4Q0XL 4BQ9A 1AE6H 5JMOC 2QVFB 3FC8A 3OB8A 4PTTB 2VR4A 4I0PD 1NLDH 5D5MB 5DS8B 5G4MA 4NQSA 1CD1A 5I1AB 4YQXL 2BRRH 2OA9A 3VGBA 2Y4SA 4XBPB 4Q6KA 4JDVB 3D09A 3NP3A 3SGDH 2W9LA 4FXTA 5HDWA 4PJCE 3SZ6A 4IRJD 4LT7A 1FVEB 4FD0A 3NTCL 3ZE1B 4FHKA 3VDAA 3DVIA 4RAUB 1JI2A 1UD2A 2GBVA 3K71B 1SDDA 4P2QA 5F97E 3EGDB 3T5WA 2I32A 2J2ZA 1QSEE 1WJ3A 2CK0H 3MCYA 1WFUA 4HCRL 4JO3L 1Z5HA 3BT2H 4FXGA 3ARWA 2WLZA 2YD4A 5F9WB 4HFUH 4N0CD 2V0AA 4JCMA 2P7TA 2CBPA 3P3RA 1K2DB 3OHXA 3NCEB 3L3IB 3WKYA 4AKPA 4UM9B 3MRKA 5HGGS 3TN0B 4MXVE 1S2EA 1S9WB 3MV9B 1NH6A 3NJHA 1EQWA 2EH8L 4LKCB 3CVHA 3D9AL 4DKFL 2EEAA 4GG6A 1KCUH 1DQKA 2LLGA 4FERA 4BUGA 5IVZB 1L5GB 2WWOA 2NYYD 1A4AA 3TM6A 1WBZA 1UXMA 1Q0EA 4M1GL 4P2OA 2EYSA 4RAVB 4RDQG 2BRRL 1QNZH 4TQHA 4U4BA 4AC2A 3B2DC 3EUUA 1MH5B 2XZQL 1X5GA 3T3MF 2P8MB 2BVUA 3VB9A 3WJMB 3NFSL 2WWMC 4KKPA 4OB5L 4GW1B 2B59A 5HHNA 4A1RA 3ZVVA 3O41B 4PJXF 5E0QA 4B50A 3KE0A 3IFNL 3CDYA 3FU8A 5CS7A 4YHOL 1WHPA 3C2AH 2WTOA 2WUBH 1TZHB 4KFMA 1KGUA 1QBLH 1JPFB 1JNNL 3K4AA 2AKRB 3LKRA 4EDWH 4E5XG 4YHML 2P5ED 3BD3A 2ZCKL 1VERA 4OB5H 4QXUH 3ILEA 2OYKA 3KH3A 4AG4L 4LQ1A 5I9QB 1R4XA 3KVDD 1OF2B 1G4RA 2DQEH 4HD5A 4P2QE 2OK0L 2ZG3A 2EXTA 4N8CL 1NZRA 2Q1EA 4WI5A 1P7KA 2ZUUA 3T0XA 3GZQA 4L8SB 5B7EA 3T3ME 4AZUA 3ZZ1A 1UWYA 4MRCA 3D9AH 4DKFH 5GRZA 5KANG 2VM9A 5C0CE 1IM3D 1I9IL 5C0CB 1EVUA 4D0DB 1ZLSL 2G5BB 3UERA 2NTFA 1ZEAL 1Z3RA 4NKDA 3MFGB 3D51A 2O6DA 1QAWA 3M8OH 2EUXA 5EU4B 4PJ5D 3BIKA 1X4XA 4PP1C 1FDLL 1LDPL 1YO4A 3GXUB 5AVWB 1AKJB 1SHSA 1RERA 3UAEA 2FQFA 1I9RH 5KANI 2C9UA 3NTCH 2VN7A 2PO6D 3PP4H 3JVGC 1XR8A 4MJ5A 1SJVA 4X9IA 1IBGH 1YEJH 1EA9C 4R8WH 3NRFA 3QWOB 4PUBL 5F7EH 1GSKA 5L0QB 3ES6A 4WI9A 4OCWL 4TQEH 4PCKA 2BWDA 1N68A 1S3KL 5KSBE 1U8OA 1QASA 1XGUA 2DQDL 2MOVA 1A6ZB 2IGFL 4IIQA 4L1BA 3RILA 3CHRA 3ZZQA 3C5ZB 4XMZA 2X44D 1CMOA 4B9PA 1BG1A 1PG7W 5FM4A 8FABA 3TOPA 1HH6A 4NKIH 3MLSL 4X6CB 4ZUVA 1HZLA 3U82B 3OR7B 1DQLL 1CG9B 4Q6IB 2OTWA 3WI9A 1XXDC 8PAZA 4NKOB 2WKGA 3ARGC 5GGUA 4WUUB 2K7PA 5HYQA 3LKPB 4EOWL 1N5YH 3QO0B 2F8XC 3VFRB 2CNZA 1NFIA 1X9RA 1A7NH 3ZOAA 2VLKA 3MNZA 1PCXA 3AT9A 3IXAB 4MMZB 2IANB 2IQAA 3SDCB 4G80A 2AJXL 2C5DC 1G9NL 1IVTA 1MCSA 2R1XB 4BQCA 2XV0A 3QUZA 4P2OC 5BRZA 1UB6B 4JDZB 4J7RA 4MS6A 5JXEC 4WI0A 2CJUL 2OMBA 1AQDB 3EJRA 4KBPA 1JPSH 4EEEA 1N12A 4YR6A 1BF2A 5BZWA 4WFEE 2OJZL 1R34A 2CR6A 1DLFL 1T03L 2CR3A 3KS0H 4TS6A 2BP3A 4UM8A 4XH2B 4OGZA 3ASNB 4XMPH 3TNNA 2ITCA 4X6DA 3RWHB 3PDOA 3Q2WA 5HDRA 2XY1A 2XFXB 4ZFFA 2DQFA 2J21A 5A2IH 1PY9A 1R0AL 2ROXA 4HSAC 5FHAL 4MMYB 3H3KA 4KROD 2QGEA 4J4PC 3IMSA 1XF3A 1EEZA 1TCRA 2WJ7A 4MB1A 1RUPL 5B39A 3PWUB 5TF1H 5AAMC 2NPLX 3E0GA 3JWNG 1PZSA 1JD7A 2FZ3B 1I7TA 4YZWA 1GYUA 3TCXA 1MOEA 2WLJA 1F3RB 1A5FL 3QDJD 4PWIA 1BAFL 2W60A 5DSCA 5E8DL 2XACC 4Z76A 1U95B 3RA7L 1IARB 3CFQA 4H1LB 2H1PL 5DVMA 4AEHH 5JIQA 2A0LC 5C0GB 4N0YL 2WZAA 1COBA 1MAKA 2H47C 3F8UB 2BP0B 3HN5A 1O6VA 4AW7A 4N2BA 4Q7DA 5FC9A 2QJDA 2F0CA 2X6BA 3E3QC 4U05A 2O61A 2P5WA 3QFDA 5F7DA 1E9PA 3GSRA 3UJTL 3OJ2C 3LN5A 3WLWD 1PF3A 3K5SA 3EHBC 1YN6B 3QFJB 2YRZA 3CHOA 4N5UA 3W82A 2HTKC 1RK7A 3HMWH 3W0WD 4S0SD 2GY5A 2JI3A 3PRZA 3SBWA 2HKFL 1AIFB 3FB5A 3IDGA 4X7DC 1DZ0A 3QXAA 4HWNA 3QHFL 4XX1G 2IANE 4ERSH 4BZ1H 3ZKND 4P23B 4PV9A 5KW9H 2E46A 1LEGB 3SCMB 3I6LE 2BSSA 4QAWA 3ZX1A 5DD0H 2ZNXA 1PZ5B 5A3ID 4WSJA 5CINH 4PR5B 2C3VB 1NGWA 1EDQA 3LEXB 1YEGH 5C09E 4YSAA 1B4JH 4GINA 3OKOB 4GAJL 3ESOA 2DWEB 2PCPB 3Q5OA 4NPKA 2VGLM 1HHKA 1CGXA 4L8DB 2E76C 2PP8A 3Q2NA 3S4SB 4G7YH 5DRXA 1HHHA 3ARFD 4N2AA 4BYHA 4OCXH 3INUL 4MCMA 4KRLB 1ZLWH 4XWGH 2AQPA 1BQLL 3ZGHA 2D3VA 4KDWA 3B2VL 1ZVNA 4XBEH 1ZDQA 4Z3IA 2WO4A 1DCEA 1WC7B 5AW7B 3K6SB 3DO7B 1FNSL 1RQ5A 4MX7A 1IUZA 2AQ1A 5CJQL 3L5WB 1MKFA 3X11B 2I60H 3HPJB 4CVXB 1TENA 3DIFA 2W1NA 3PREA 4HPYH 2AI0H 2HJKA 2BDNH 4N3TA 1JXJA 5IB2B 3QUKB 2AK1L 1OCZB 5ALBL 1B3IA 2HFTA 2VO5A 1CS6A 3CFNA 3BAYA 2Q7AA 3FYIB 4IRSB 4GQQA 2B4CC 3ARGD 1WBYA 2NY7H 3D69A 3FQUB 4WCYL 3KYMA 1KTLA 1T4WA 3FT0A 3IS0X 2DN7A 1Z32X 2G2NA 1NCBH 3SPGA 3TBCA 4F2ME 5DK0B 4ZUSA 1QR4A 1QZ1A 2PCYA 2X4PB 4AW4A 2EO7A 5CJBA 2N7AA 3GC3A 4XX1E 1N26A 4CADB 4R2GC 3NDYE 2Z1KA 3AWEA 3PUUA 4Y1SA 3M17A 4JY5H 1D5RA 3KPLB 2JB5H 3D39A 1P4BL 1Z3GH 3U2JA 5HI5C 2F1BA 1VFUA 7CGTA 4PJCF 4OLVL 3BT0A 3RAJL 3EO0B 3IEAA 5E8DH 3RFZB 4HDIB 2X89A 1JZ5A 1G7IA 1CIDA 1UT1A 4XZUB 1RV6X 2X70A 1G1KA 1Y1UA 3R4RA 2C7UB 4XP9H 4JX0A 5CD3B 4CC0A 4IRZA 1T21A