1J9TA

Crystal structure of nitrite soaked reduced h255n afnir
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA02
1JXDA 1SHXA 1BYOA 3OM3B 2FQDA 4HAKA 3V9CA 2GHZA 2W88A 3CG8A 4DP9X 1GS7A 5AFAA 2I7OA 3ASNB 3DKHA 3CVDA 5B1BB 1NINA 4Q89A 2VW6A 1JZEA 1WS8A 6PCYA 3PPSA 4G72B 2IDQA 1L9TA 3QJTB 4E9QA 3OMIB 1IBZA 1JZIA 2XLLA 1OV8A 3JT2A 1SJMA 4YSRA 2PPFA 4DPCX 4E9TA 3HB3B 2GBAA 2H47C 2TSBA 4N8UA 2VM4A 4ENZA 3BVDB 3FQ1A 5D4IA 2XUWA 3UGEA 1NTDA 2W8CA 1ASOA 4HHWA 3FSZA 2B3IA 3CDZA 3JTBA 4G7QB 2GIMA 2YXVA 3RYMA 3SBPA 2PPEA 2FQFA 1A8ZA 1AOZA 2WSDA 2YAEA 2EILB 2LLNA 1F56A 4Q8BA 1SF5A 1R1CA 2PPAA 1ZIBA 2HLEB 3FSVA 5I6PA 2FT7A 3DTUB 5B7MA 1FA4A 1ILUA 2UXVA 5B1JC 1GS8A 2OJ1A 2WO2B 1IUZA 3T9WA 3NSYA 1GS6X 4HCGA 2YXWA 4HALA 2H5UA 4JHUA 2Q5BA 2N0MA 2P80A 2GI0A 2YAFA 2B08A 2ZONA 2UX6A 1PNCA 4BK5C 3FU7B 4YVUA 1ASQA 4G70B 4FAAB 1ASPA 2PP9A 4YSEA 5I26A 3C75A 1CURA 5I5IA 2UXTA 4KO6A 4G71B 2VN3A 2XXGA 1EHKB 1XMEB 3PAUA 5B1AB 4KO5A 3MBWB 3WI9A 1E5ZA 4YSUA 2PP8A 1AZUA 1W8EA 5I6NA 3X1GA 3WNJA 3NJMA 4BWWA 2BP0B 2FQGA 3FSWA 5AZUA 4E9YA 3V9EA 4G7SB 1ET8A 5D4HA 2CCWA 3EH5B 3NT0A 1AR1B 2XYBA 2YQBA 1GSKA 1FWXA 4AKOA 1A65A 3GYRA 1MZYA 1ADWA 1BQ5A 3S3DB 1BXUA 2XX1A 3FPYA 1NIEA 2BO0A 2VMJA 2DYSB 1GR7A 2VSKB 3AG2B 1ET7A 1KGYE 1J9QA 2CBPA 4KNUA 3FQ2A 3PXLA 1JZJA 1GW0A 3MX0B 1TU2A 2BZCA 1XB6A 2YAPA 5I5MA 2BWIA 1OE1A 3BQVA 1BAWA 4QLWA 2IH8A 4NERA 3PAZA 1TKWA 3H4HA 1WA2X 4F2EA 2J56A 2BWDA 2BW4A 2IDUA 3IEAA 2UXGA 2HRHA 4HCIA 3NSFA 4TXVB 5B1KA 2PCFA 3T6VA 1KYAA 3UAEA 2XU9A 5I6KA 2GB2A 3KW7A 1NIFA 5B7EA 4X4KA 4A2FA 3T6XA 3FU9A 4YSOA 4CSZA 1BXAA 1KBWA 1SDDB 2BZ7A 3NJLA 4M4RB 1JZGA 4NAJA 3NP3A 4A67A 4GXFA 2JFCA 1L9RA 2FT6A 5EHFA 4AKPA 1WA0X 4BXSV 1AZCA 3NSCA 2HRGA 5B7FA 2HXAA 5PAZA 9PCYA 3GXUB 4JKNA 4BXVA 2IWFA 1V55B 1SHWA 2JXMA 3IBOA 5I6OA 7PCYA 5I6MA 1QHQA 1RCYA 1KV7A 2ZXWB 4A2HA 1L9PA 2J57A 1PZBA 4DPAX 3EH3B 5F7AA 4M3HA 4DP1X 4W1TA 1ETJA 2BP8A 2CALA 2HX8A 2IDFA 3FYEB 4E9SA 5I6LA 2UXFA 1ZDSA 2IDSA 3WNIA 3ABGA 3ABMB 2YARA 3TASA 1L9QA 1PZAA 4HIPA 1NPJA 1OOWA 1AACA 2PCYA 4P5SA 2OCCB 2AFNA 1BEXA 5A7EA 1PCSA 3NJNA 1ZPUA 1CYXA 2XVBA 1B3IA 2GC4C 1AZRA 1X9RA 5I28A 3EH4B 4GP8B 1GY2A 4HCFA 2EIKB 2IDTA 4BWTA 3U25A 1JZFA 1WAEA 2X87A 4E9RA 2DWSA 2XX0A 2H3XC 5IY5B 4YL4A 1KBVA 2QDVA 3UABA 1DYZA 2ZWNA 2QDWA 3AG3B 5TK4A 4E9WA 3OMAB 2VSMB 3IN0A 3UAAA 3PLYA 1JVLA 3PAVA 2Y1AA 3FT0A 4A68A 3EF4A 3N2JA 7PAZA 3FYIB 4EF3A 1PLCA 3X1EA 1AZNA 1OCCB 2FQEA 1PZCA 2VW4A 3FPXA 3AG4B 3WKPA 1T5KA 3X2QB 2R7EB 5D4JA 2MTAA 5PCYA 4DP5X 2IAAC 2PPDA 3WKQA 1CUOA 2IWEA 2CUAA 4L0PB 1NWPA 2CJ3A 3CVBA 1AG0A 1SFDA 2DY2A 2Q9OA 1ZDQA 1ET5A 1PAZA 2EIJB 5B1JA 5FC9A 4YVNA 4KNTA 2XV0A 3NP4A 1M56B 1AANA 1URIA 4GP4B 2RACA 4K9JA 4YSSA 1BQRA 4AKQA 2AVFA 3NJJA 5I5JA 3D12B 3GDCA 4PAZA 4FA7B 5LDUA 4AI7A 4QKTA 2HX9A 2HX7A 3NJFA 4YSCA 1OCOB 3ABKB 1JZHA 3AZUA 3CVCA 4BDVB 1V10A 1IC0A 4GYBA 1AIZA 2DYRB 1ID2A 1MG2C 1A4BA 1OCRB 1W6LA 2I85A 5ANHA 3T6WA 1AS7A 3OMNB 1BYPA 3FU8A 4YSPA 1PNDA 2BP8B 2YAQA 1CC3A 4YSDA 2PLTA 2VM3A 3KW8A 8PAZA 3S8FB 1SFHA 1NDTA 2OV0A 1SF3A 6PAZA 1GY1A 3ZDWA 1CYWA 1W6WA 3HEIB 3SBQA 1VLXA 1MZZA 1WA1X 4P5RA 3FS9A 2WO3B 1N70A 1E67A 1JXFA 1OE2A 1NIDA 1UATA 2MRYA 5F7BA 4A2GA 1E5YA 2XWZA 3DIVA 1IKOP 1PF3A 2FT8A 2IH9A 2AZUA 1IBYA 4DP2X 1NICA 4DP4X 1AAJA 3X1FA 2GC7C 1TEFA 1SDDA 2A3TA 3T6ZA 1BXVA 2P80D 3WIAA 4BWUA 1AS6A 3QQXA 3OD3A 1PMYA 2DV6A 2QPDB 1I53A 1ILSA 4CSPA 2YAMA 3TU6A 3NJIA 1MG3C 1ZIAA 1OCZB 4A66A 1PY0A 4YSTA 1FFTB 3AW5A 2J5WA 3NYKA 4A2DA 4MFHA 1AQ8A 1JERA 3TBCA 2FWLB 3S3CB 1E30A 3SBRA 1E65A 1TEGA 2NRDA 3ZIYA 4E9XA 1RZPA 4HZ1A 4JHVA 3WG7B 1RKRA 2X88A 4DP7X 3OQRA 4ZK8A 3H56A 3FU7A 4G7RB 4GP5B 3NJHA 1A3ZA 1KCBA 1JVOA 3IN2A 1SNRA 2AANA 1NWOA 1XB3A 1EZLA 2VW7A 3FQYA 4HHGA 4W9ZA 4AX3A 1A4CA 3QJQB 3PCYA 1WS7A 2DWTA 4BDVA 4YSQA 1J9SA 1NIAA 1PLBA 2GSMB 2AZAA 3NJKA 1QNIA 1MDAA 2FTAA 2XV3A 3QJRB 3S3BB 3IE9A 4KO7A 4N4YB 3ZX1A 4E9VA 1J5DA 1J9RA 1NPNA 2PP7A 3AG1B 4NB7A 2XV2A 1M9WA 1L9OA 3ERXA 1XB8A 3S8GB 4WTQA 4KOBA 1RZQA 3X1BA 2E86A 2QPEB 3SQRA 4RH4A 4UAHA 1AZBA 1HAWA 3CDZB 1KDIA 1OE3A 1QLEB 2HZHA 3T71A 4UF7C 1AS8A 5E9NA 1KCWA 1OF0A 5AKRA 3AY2A 4YSAA 2QT6A 3QJVB 1HFUA 2R7EA 5B3SB 3G5WA 4DP0X 2CAKA 3X1NA 3FSAA 3L45A 4DP8X 3EHBB 3CZUB 2ZOOA 3QJSB 4AZUA 2EIMB 4UANA 2Y69B 4KOCA 3NJGA 4A2EA 1NZRA 1PLAA 3ASOB 1J5CA 4F2FA 2BW5A 2TSAA 2YAHA 1A4AA 1V54B 1KDJA 1HAUA 4DP6X 2FNWA 4PCYA 1N68A 4KNSA 3ABLB 2EINB 4DPBX 2I7SA 1M57B 2XXFA 5TK2A 2IWKA 4KO9A 1JOIA 3H4FA 3ZBMA 4F7KA 3QPKA 3TBBA 1BQKA 1L9SA 3QJUB 2BHFA 4GY4A 1J9TA 2BP0A 3N55A 4WKXA 1AG6A 3UACA 1YLBB 1NIBA 3UADA 3TA4D 1JXGA 2UX7A 1X9UA 2J55A 2PPCA 1GYCA 2JKWA 1DZ0A 1ZV2A 2FJSA 2YAOA 3NSDA
chains in the Genus database with same CATH superfamily
2F53E 1PX4A 1BYOA 1H3PL 4MD0B 2W88A 5LUMA 4JHBA 4R0LA 3ASNB 5E5RB 4YBLB 3MUGA 2DQDH 2VLKB 3V7MA 4IS6A 2K3HA 1QEWA 3BP5A 4XNBA 1WS8A 3C2SA 1TVBA 1ZT7B 1AGEA 3B9VA 4IIQA 4OZFG 1L9TA 4F37F 4XXDB 2X4PA 2DQEH 2LTQB 2ZIDA 4G8AC 1HHGB 4IRJC 1I1AB 5DMGC 4YSRA 2ZUXA 4AQEB 5DCCA 4N8UA 4NBYB 1ACYL 4D0DA 1T3FB 4HOXA 3CC5B 1JSYA 4IU2A 5C0AB 3GSXB 4JHWL 4OGXH 2NSXA 2XQBH 4FDWA 5HHOD 5CCKH 3C08H 4UI2A 5CF3A 4ZO9A 2JJSC 5IOKA 5INDA 3F5WA 2GIMA 2YUVA 4HFWB 5EG6C 2FQFA 2WQ8A 3CFKA 1U8NB 4KJQD 4N2GA 4Q58C 3JZYA 5EN2B 3TWYA 2C8NA 2F54D 4HIXL 1X7TA 3QFGA 2BSSB 3UL4A 1TFHA 3L4WA 1SVBA 2E7MA 2FT7A 4POUB 3FRPG 3DTUB 4XE0A 4HW6A 1Q9WA 2ZG2A 4A6YB 3S48A 2UXVA 5G4OA 3UTSA 3MRKB 1FSKB 1FIGL 2OJ1A 3QORB 3VFSA 4N25A 4QRBA 4PGEA 5ERWB 1A1MA 3AWEA 1SJHB 4X8JB 5IB4A 1A66A 2B08A 4LBAA 3TCTA 1F3RB 2OA9A 4EOWH 2ISDA 4DN4L 4I48B 3MGAA 4HUVB 1XR8B 4G6AD 1JZ5A 3K71A 1A7OL 1NGPL 5TGBA 4KO6A 4G71B 4O51B 5CN2A 2XXGA 3WIIH 4OI7A 4RZKA 1XWVA 2H6PB 1JN6B 2NY5C 5JHLA 4V1DE 5DHXB 3CVIH 5GS1A 5CP3H 3LS5H 4WSJA 1YEEL 4YSUA 5CZXD 2R8SL 4B3VA 3TZVC 2AK1H 2PR4H 3A3YB 2AEWA 3WNJA 1TQWA 4EBQH 1KTCA 2DLIA 3PGFL 3NVQA 3SY6A 3LNDA 4LHUA 3EO1B 2L7QA 1GHFL 1SEQL 1BV8A 1D7DA 2B59A 3RKDC 4KKCD 3KPRE 3APFA 3RWHA 4JO4H 5DK2B 3CIQA 5CBEB 4JFZL 4HIHA 1BZEA 3RPBA 4TNVF 5INCB 2ZUSA 1F90L 1O6VA 4FHJA 1EEZB 4UQ2A 3CLEL 4UOZA 2WKGA 1KXVC 3UAJA 1YEIH 1ZVSA 4KGJA 5TE4L 1JGEB 2J12B 3OKKB 4WW1A 5GGTA 3L7EA 1T21B 4RSYA 5IB1B 3SO5A 4JFFB 3SJVB 2CHWA 1UD2A 2VQ1A 3WNKA 5FDYA 5IM7B 5DD6B 1QUNB 2IIJA 2HFEA 1NCDH 4P4KA 4PJGB 1TENA 3ZTJG 4AQAB 5KVEH 5FGCB 1DVXA 1JRHH 5T1MB 3AB0B 3OR6B 1GPOL 4ZFFA 1DE4B 5B1KA 1O7SA 2PCFA 5F6IB 5I71B 1WBXB 2O5ZH 3TF7C 1E9PB 1FH2A 5GHWL 4FZEL 1T5WB 1E9QB 5DD3L 4Z3TA 3IVKB 4BZ2H 4X42A 4Y9GA 1RLBA 2MOGA 3QI9A 4L2LA 4FOMA 4WWKB 3U0WL 3VVVA 3KAAA 4NX0A 4YSOA 1KTLB 2ZOTA 1DO6A 3WUWA 4A63A 1JFQH 3BEVB 2D0FA 4IOFD 1WVZA 1P2CA 2DRUA 5ITFB 3IDYC 4PN6A 3KDMB 1F6FB 2DF3A 1QBLH 5FO7B 4MAYC 2Y7OA 1UM6L 3KL0A 4X6CF 5C0EA 3E6FB 3S4SA 2YPLD 2G3ZA 2BFVL 1AH1A 1AHMA 4MD5B 4H8UA 4WNSA 9PCYA 1NLDL 3J8F7 3MRMA 1J1XH 1HOEA 4OV6F 3GI9H 3O6LL 2YLKA 2BNQA 1MFCH 3HB3C 5FEBA 4QTFA 2YN5A 1WG3A 1YJDH 4GAJH 4RLDA 1L9PA 4FG2A 2DIJA 4H8PA 1EXUA 5D1ZB 4DP1X 3FTXA 3HHRB 1J7VR 1VACB 4S2SB 2BP8A 3S5ZA 3MRDB 3W9DA 3MRFB 1MFDL 4C56A 4ZAKA 4RFOL 5FKAB 4Y1AA 2PUQT 4KY2A 2ZKYA 4PJ7E 4RAVB 1WAAA 3K4ZA 1Y7VA 3L9YA 1G6RB 1I7RB 2BJMH 2Y1ZA 2R0ZL 4YDLB 5E8OA 3BUPA 3I85A 1U8KB 5KEZA 3U2IA 4XN2A 3LMJL 3HOGA 3TCLA 3ML8A 2DWEA 3DLQR 3EH4B 1UD5A 4UB0H 2R2BB 2O4EA 3SOBH 1DEEA 2BSEA 4QOKB 3UBXG 4Q74A 5SV4A 1D6VL 2F5AL 3OAYK 5JOEA 4PSRA 4YDJA 4ZTEA 2X2YA 3QQ9D 4HXAL 4UB0L 5C86A 3KPPB 3BVNA 4OCYL 4XZUB 5F7HA 4AYFA 1QBLL 4FYRA 3IDUA 2CIIB 2FEEI 3P4MB 3K72A 1U8HB 5IJKC 4ZUUA 2F1EA 2RQEA 1IKFH 3AFLA 4XH2A 3MOBH 2HVJA 3UX9B 2G0LA 3POHA 4UT6H 3ZE0E 4MJIB 4KZCA 4DKFH 1PKQA 3LHPL 4QPEA 3NIDB 1YEFH 2VLJE 4C4KT 4LLDA 2DY2A 1BOGA 3K8LA 3JV5A 3DV6A 1AZVA 5MI0B 4KNTA 3GIZL 3WJLA 5F0LB 1KCRL 4WI5A 1G7HA 3APMA 2CLRB 2WIMA 2X41A 3IAPA 4ISVA 4JFWA 4Z6AT 3HAEH 3JV6B 4Z5RB 4XP9H 2YUWA 3IGAB 4DKTA 5HJ3A 4GQPH 2R69A 2QTVA 3H9ZA 4KQ3H 1OP5H 4QWWC 4OCRL 2OP4L 5A6LA 4DQAA 4MB5A 4ZO7A 4FQPA 4KV5E 1VERA 4BQ6A 4OFDA 3ABKB 3SODB 1V10A 5GGUB 3ULUC 4Z76B 4MD4A 2JIXA 2XWRA 5CD3A 5TFSH 3CHSA 3O3DA 1H9VA 5E03A 1U8IA 1ID2A 1J05A 1MG2C 2BHZA 4YZFF 2YD1A 4UZSA 2YJLA 3QFJB 3HBGA 3T6WA 3K4AA 3OMNB 1HIML 4Q4IA 5LGJA 1LWRA 3BVVA 3MXVH 4LSVL 4LASL 1FZJA 4XB8A 3WFBL 5BRZB 1L6ZA 1BEYH 4OBRA 3ZO9A 2BS8A 3LRHA 4KKAD 4O2FA 5FM8A 1GY1A 1EZUA 1LNUB 1R4XA 1FGVH 4X6EA 1R5WB 3KWXA 5IEKB 1YNTF 5ECJE 1XH0A 5EPMB 3LD8C 3HEIB 4KFMA 1U91B 4UOJA 3KGTA 5B4MC 3OJDB 1E67A 3F01A 2FVNA 4Q6KA 5I0XA 1UATA 3WS3A 4CBPA 5HVFB 2FJHA 3M8OH 2QVMA 1XGPB 2ZOLB 3EOTH 4WHTB 5CEYA 5GRVK 3GB7B 4UINH 1CTOA 4DP2X 1KPVA 1QOKA 3DIFB 4P3WA 1BQHG 2VWEC 1GOGA 1RPUA 5D4QA 2R69L 4JZJA 3VFMA 2K6YA 1VEOA 4JFVA 4LOUD 3BVTA 1T1XB 3QWOB 4XVOA 1WT5A 2Y1YA 2R8SH 4F57L 4OKVA 5E9AA 2VOTA 3B7UX 1LDSA 2J8UE 4POZD 2JKXA 4K2UH 4JGUA 3PL6A 2AITA 1AQHA 1FZMA 4DK6A 4PHZA 3LVTA 3B3IB 4NNXA 2ZOWA 3V6OE 3WUWG 4Z78A 5EZPA 2FWLB 4JUTA 3PAYA 2ALWA 4OLZH 1UXSA 1NLBH 4UOW0 4W4NA 4JFDD 4Y4KC 3MA7B 2OTWA 3EJQA 3OJ2C 1NOLA 1JMXA 1LEGA 3PHOA 3WMSA 2EEFA 3ZTJH 1NFDA 4DP7X 2EE3A 1JNHB 4HKZB 3G5VB 3KLQA 4J6RL 1CI5A 3H56A 1U8QA 5HGAB 4IM8A 4M29A 3B6SA 3VW3H 3RHWF 3VX0A 5FCSH 3MBXH 4D9QE 4XC3L 5M95B 4TV3A 2VW7A 3BAEL 3PWPA 4N87A 2NY3C 4JFDB 1SQMA 3GTTA 2ADIB 4R8WL 3VXSB 4JRWA 4P46D 1P69B 2EXWD 5DYOB 1J9SA 3H55A 2X6CA 3GSVB 1GSMA 4XOCA 4M7LH 3MRQB 5GRZA 3RG1C 2AJZB 3K2KA 3X11B 4MS8C 3QJRB 2WXKA 3AQXA 1DVZA 2WQSA 1J9RA 4HKXB 4V1DD 1SMAA 3WO4C 3RFZC 3NPSC 1DQLL 1L9OA 1XFPA 2BMKB 2GABA 4A04A 5AW8B 4RGMC 4L3EA 2IF7A 3DRTB 3VXSD 4CVXA 2DIBA 3IDYB 5CP3A 5AW0B 5L0QC 3Q9PA 5HVGB 1BLNA 1BVLA 3BSHA 5FUCC 4P2QA 2VZ1A 1IGYB 1OF2B 4KI1A 3JV4A 1GAFL 4YLBA 4NN7B 2CDFA 2QSVA 5D71H 4U6VH 1ZPLA 2JIXD 1LK3L 5B1CA 3FSAA 1ZA6B 5MENE 4N2LA 2VDLH 2Y7MA 4KTYA 3JWNG 3P3TA 4JZOA 3REWA 2NTSP 2UYLA 5GGSA 2VL5A 4B5EA 3F6JA 4JPVH 1TCMA 2CD0A 2JI1A 5T1LD 5DJDA 4XB3A 3B2PA 3OGCA 1RVFH 3CFBB 4FXGC 4U1LB 3S36L 1I9IH 1A4AA 1HHKB 2ZNXA 3KPQA 5DVPA 5E9DE 4ZMPA 1DJWA 4NZJA 2C3VA 5AKTA 3PWUA 1MJJB 3D30A 2HVKB 1JF5A 3L5HA 1ZRUA 4XN5A 3QISA 4FI7A 3FO1B 4F7PA 2DL2A 3IXTB 2UZPA 3QC5X 3I6LE 5ISZE 3X13A 4Z95L 1L9SA 4WUKL 3UTTD 3WTXA 2WQWA 1BZ7B 1MHPL 5T1DL 1G1OA 2O6DA 1CXHA 2IFFL 2G5RA 4LRNL 1OGAB 2BCKA 1BLIA 4WKXA 4JG0H 1HH9B 3UXFA 3MXWL 3EXJA 3C8DA 4PGCA 3UADA 4G8EB 3WTYA 1TVHB 5CZKA 3I75A 3L3KA 4X7FC 2YAOA 3E8UH 5D7LD 2IPKB 1D5XB 3M1BB 3FO2B 3CG8A 1IKFL 3WEXA 5C7XL 4GUPB 3QCVH 1YQVH 4JR9H 4MAYB 3TA3B 3L5IA 3U2SA 3QFJD 1SN2A 1ACZA 4G72B 3CAFA 3KJ6H 5LQBH 2IH3B 4PJ7A 3NPSB 4LFHD 1I7TA 4QYOA 5T3XE 1E4KA 3OKMB 4PJCB 3HB3B 3QIWC 5EBLB 4D3CL 5GZNA 2VN4A 3D39D 3UFIA 4AMKL 5T1DH 4WI2A 1V7ML 2P46B 1DBAH 1LE5A 3M88A 4KVCL 3BP6B 3GXNA 1PQZA 3FB8A 1CF8H 1LP9F 1RJYA 1WAPA 3H7BA 1K4CA 3I84A 1FORL 1G7IA 1MKFA 1QWNA 3BPLB 5I1DB 5HHQA 1A22B 4Y1TA 5C0IA 4BSWA 1AOZA 4JRYE 4PJHA 2WBJD 4GG6A 1KB9K 2ZD0A 1R1CA 1VFOA 1MCSA 5MENA 4V2BA 4K3EH 2R0KH 5L7XL 1FVDA 2AJSL 3IDIA 4CVZA 2VSCA 3EDFA 3NZ8A 5DJXB 1WCBA 4AQOA 4M7ZC 4ZW3A 4P4RB 1KB5L 3B3BA 1KB9J 4JCMA 3MQIA 4NN6B 3VI3A 2Z64C 2P5EB 1RFDH 3MJ6A 2VXUH 1RIVH 4RMTA 4XPTH 7CGTA 1U41A 4ODSL 1MREH 1YAZA 4GFTB 5DZVA 3CN2A 1OSPL 3S98A 3TBVA 2XC8A 1A7RL 4FEIA 1CG9B 1J8HE 2BVUA 1MHCA 3G5ZB 2YWYA 5EORL 3VXUB 3C75A 3RAJH 4HLEA 1SVZA 3LKRA 1ZV9A 3GFUA 2BH0A 1S8DB 1J8KA 2A6JB 3DK0A 5EZOH 1DJZA 2X4OB 4L4JA 5B8CA 1DR9A 5ENWB 1KJ2A 3N04A 5BRPA 2YPVL 3ILEA 5CJXC 3M7OA 2FLMA 4G6KH 2D7NA 4PS3A 3JQOB 5E1GA 3HKZA 1G4RA 3QUYD 4XP4H 3FSWA 5D7JA 3TZVD 1FVCB 3LH8A 4WI3A 4BGLA 3B9DA 5KSBF 3NCYS 5CGTA 2BOBA 4PRIE 3GYRA 3U4AA 2JTDA 2PYEB 1N8ZA 4NHUA 4B27A 1OP3K 1S7SA 2Y5TA 2BSTB 3D3VE 1Q38A 1XSOA 2GW5A 2Y1VA 3V4VA 4KPHL 4UQBA 5BVPH 4EI0A 4HQQL 1MCOH 3BCDA 4HS3A 1T04B 1WIPA 3OLEA 4NKQB 4X9FA 2NQ3A 3DIDA 4M7JL 1HSBB 3IYLW 4AT6B 3B2XA 3CLEH 3JWNE 4JREB 1CLYL 3KYOB 3QO0A 4JFPB 5IVXF 1GOHA 1IJ9A 3QUZC 4Z23A 3RZWA 3GSUA 1KEGH 3D51A 3MDJA 3MJ9A 3KYKL 1O6SB 1AJ7L 1P7KB 1ZMYA 2HRHA 4HV8A 5GS0D 5D70H 2HG0A 5ABDE 1JD7A 3QNXB 3ARYA 5C07D 2PR4L 4PCTA 4AMXA 4AW4A 4MS6A 5I6KA 1I7ZB 3O3EA 2L7EA 1NIFA 3MV9E 1MXGA 5FB8A 5HPMA 3K1KC 4H1LB 4MS8D 2BDNH 3SKMB 2PYFB 3WN5C 1MCRA 2C34A 3Q05A 2Y3NA 4YFDB 4FYQA 4QRPE 1P7QD 1S7VA 2BOCA 3F05A 3SJVE 5FYLE 5B39A 3JWNC 4NO3A 5C07B 3BWUF 2Y5QA 4NQCB 5ID0B 4R7XA 4K3GA 1YSOA 4BFFA 2I32A 5I30H 4R4BB 2M1KA 1OD9A 4JKNA 5I82A 1RJZA 1WZAA 3VDBA 2EECA 1ZXQA 2DQIL 1C16A 1QHQA 1X5YA 2DI7A 2GIXA 2XYCA 4HUNB 4MHHG 3ARUA 2OAAA 4FXTA 3WIFA 2VLMD 4XP5H 1U58A 3HC0A 1VEPA 1AQMA 4W1TA 1KMGA 2R9HD 1OZUA 2O61A 3TN0D 4NSKB 3S0PA 2MIZA 3F58H 3BESR 4MQTB 2BHYA 3DVNA 2VZTA 4FQIL 4P5SA 2HUEA 5ISZB 5MEND 1IKNA 2WZPD 3POCA 2PCXA 4F8LA 5SX4I 2VZUA 5TDOB 4ALAC 4GKNA 4FQHB 2O5YL 1IM9B 5F7MC 1PSKH 1DDHA 3VXTA 1CGTA 4LSQH 4BUQA 4KJPD 3VGGA 4D8PA 2VLRE 1L0YA 3LDBB 1O5DT 2I5YH 4PRDB 3IXAA 1WAEA 2X9ZA 2D7PA 2GSGA 3VXSE 4HOMA 1KCKA 3QXDB 1SLVA 3OAYH 4XAWL 1S7WA 4QY8A 1AKJD 3QYCA 4W6XB 3O9WD 1ADQH 2ARJA 4EIGB 4XBGB 5F9JA 3GKWL 4TSCH 3IN0A 4HGMA 3WE1A 3PLYA 2VH5H 3ZK0A 1G5AA 2WXFA 3EF4A 1DQVA 4XWGH 4XO3A 4WKZB 1YEGH 1AZNA 2PW1B 2I26N 2DQDL 3O3AB 1E27B 2YBRB 2X5PA 4J3VA 5E8DH 3MRRB 3GMQB 1IGTB 1L5GA 2W65A 2OKMA 4P2RA 3P54A 3D0VA 4R4NC 1CUOA 4AZ8A 4D9QD 1AG0A 1W72B 1DVFA 4FQCH 5CJOH 1UQSB 3FL7A 4RGMB 1TTAA 2RFXB 4YVNA 4LIQE 2X1OA 2V5SA 3RVTD 5LVEA 1M56B 1Z9MA 1X9QA 2DKSA 4GLRH 1MWAL 1X5GA 5IT2H 2X40A 1N64L 4AKQA 4LLQB 3BAYA 1LXMA 4JE0A 1MAKA 3D12B 3GDCA 4ODUB 1TZHA 4PS4H 5LDUA 2J72A 2RIKA 5C0RL 3B7RL 5DVKA 3A0OA 5J6GA 3TL5A 2VLKD 3K6OA 1E3XA 4Q6IA 2R51A 4MZ3A 5CILH 4J4PD 4MMYA 5DDHB 1M42A 2ERJC 2UZXA 2Z4QB 1MCNA 4LCYA 4MMZA 1I85A 1YYLL 3VTTA 5EEUA 2X2HA 3NRFA 3MRPA 2KHAA 1T6VN 5DD5L 5D7IB 1ITCA 5CLYA 4JFEA 1H5BA 1N0LA 3DVGB 4J8RB 5DEFB 3P73B 5EOCL 1S3KH 4NQVB 4LNRB 4ONHA 4PJFF 1TLKA 2HLFD 4Z3IA 1CE6B 4YBQD 4XR8C 2MPAH 2CRZA 4FQXD 3CQPA 3MUZ1 3T65B 4B6ZA 1TQTA 3MLWL 1MNUH 3QUMH 1DDTA 3MRHA 3V10A 5ITBL 2ZF9A 3V8CA 4RMSA 3CFUA 3UBGA 2VDNB 2Q7AA 4KI5F 1E5YA 4FXKB 4XGZB 3O4LB 5F7BA 2HLAB 1IKOP 1VPOH 4M9PA 1KJ2H 4TSAL 3HKFA 5I66A 3O6FA 4G6ML 4AEHL 1EHNA 2APSA 3ARBC 1AGBA 2Z92B 3VRJA 3L95B 1YRKA 4XNUH 4U1IA 1N9PA 2EXYD 2QQNL 3FQ4A 1R0AL 1YC7A 3FULA 4P5KB 1KWKA 1V3KA 3OD3A 4JBSA 1I53A 3LVEA 1KJ3H 2YA0A 3G6JE 4ICXA 4ZFOL 5MERB 2WZPA 4G7YH 5J12C 4A7GF 4EI5B 4QLRA 2R59A 5JYLA 1RZFH 1K8IB 1VFAB 3FQUB 2V3FA 1G9EA 1ORSB 3MOAL 4JM2F 2ICWB 4TVUA 1DUZA 1MFEL 3NFPB 3RWFA 1O0VA 3N0PB 3RVUD 1CBVH 4BFRA 5HGDB 2EH7L 3QI9D 4MJ5A 4YK4C 3SY0A 1TTGA 2LOEA 4MZ2A 1TZ8A 5MEQB 4G43B 1I8AA 2O5ZL 4Y19A 3IJHA 2BVQB 1MAJA 1PS3A 3H2WA 4G42A 3EADA 3SE4C 4IMKC 4R7DA 2K70A 1P1VA 3EFFB 2VDOH 5BNXD 1NEZA 3BAJA 1L3WA 2X53A 2VJXA 4W9ZA 2G4GA 5LKNA 5CMAB 2DQUH 2UUDK 3DI2B 4PJAA 4YSQA 2H2SD 3V7AE 1T03H 3FF8A 2CK0H 3LN9A 3X14A 4Z7UE 5K59E 1T80A 4GSDL 1M7UA 5JPMA 3SD2A 1ZS8B 5FHBH 4F7CA 5I73C 3AG1B 1QBAA 3MLZH 3RGVB 4X83A 1UD6A 3D2UB 3LQMA 3EW3B 5GIRB 5TF0A 5E94A 3RL1A 3RWGA 5K5YA 1KB3A 5DJAB 4HBCL 5HHVH 2RR3A 3NGBB 1NOFA 2PYEE 1CI3M 1KDIA 1ZA3A 5ESQB 3TBYB 4J6RH 3WIHH 5F7UA 3KHOA 3HS0B 4YHNB 4LCCC 3GXIA 1SXCA 3JWOC 1XCTA 3KYNB 4EKXA 4ZMLA 2ZXQA 5BVPL 3GTVA 3T0AA 1ZLWK 4G9FA 1IBHA 4CVWA 4NQTA 3S34L 1EBPA 4NO2B 4Y4HC 1HWHB 3VQLA 1NLBL 1F4YL 3ZOAA 2Q6WB 4YR6B 3VFPB 2BY0A 4JQVA 4YC2B 4WEMB 3DRQA 5HYQA 3AQZA 3EOAB 4JS7A 2VIRA 1RMFH 3C8HA 3GS7A 3Q8AA 4ONFH 4GSQA 3NJGA 2BVYA 4J3BA 1HHHA 2XSKA 5L4IA 4HJ0C 5FO2A 5C0RH 2F8IA 4K9EH 5JIIA 1KDJA 3T77B 1PEWA 3BKJH 4I77H 1IEHA 1F11B 4IOSD 2EINB 2YD9A 1KZQA 1BBJB 1J11A 2HTLD 4KHXH 5KBDA 1M57B 2AABH 3D85D 2XRAL 3QEQA 4ZYKA 4PJ9D 4PY8I 3P9WB 5FDWB 4WI0B 1N0XL 4I13B 2V3DA 4YDZA 1SJXA 3QJUB 4MA7H 5DK0B 2Z8WC 5JW4Q 3L3GA 5ESVA 3P0VH 3FQNB 1DL7L 2PTVA 3HZKA 4HC1H 5I1GH 2NXZC 2WZ6A 4WI4A 2JXMB 3C60A 3C09C 1AG6A 4IRJA 3HG2A 1DTUA 1UZGA 3ME0B 2A74A 2NDFA 4OIIL 1QSFA 1NDMA 2NNRA 3SPJA 1P5VB 3QRBA 4YPGB 4XMUA 3SYQA 2WXQA 3VD5A 3TEZA 4XP6L 4K7PH 4GO8A 4E5XB 2FQDA 3QHZL 3VGEA 1SXZA 5T1KD 1GS7A 4XBEH 1IBDA 3NOIA 4ENED 3WJJC 1U0QA 2E8ZA 3DA0A 5AB0A 2Z1PA 2CLVB 4KI5C 1IGMH 3DURB 4PB0L 3F7YA 4X0NA 3T0EB 4N90D 2IDQA 4IYKA 4XVUD 4MB3A 5DURB 2MHAB 3FUFA 2D3VA 2KC0A 3MODL 1NFAA 3HFFA 2XVLA 3WCYA 1U93A 1OEZW 1WFOA 2CCLA 4U3SA 4OIFA 2HPOA 3NGBC 1AI1L 4OZIB 1HXMB 3IFPB 1TSRA 4CUCA 2Z9TA 3QGVA 3HMXL 3K80A 3RX7A 3T09A 2P28B 4PMEA 3TBSA 5DGQA 2B3IA 2AXWA 2GUYA 2GHWB 4PV8A 5IESL 3ESPA 1BIIA 3FCGA 5LCVH 3EYOB 2I07B 4U6YA 3W2DH 1IBGL 1IEAA 3HPJA 3MC0A 1ZVHA 3GSOB 4J28A 3GBML 1CFNB 2EUVA 4WFFD 5DC4B 2H26A 5CWSA 1PIGA 3GHEH 4I5BB 3FUIA 3L4YA 2V9UA 4YBQC 1JS4A 2ZX7A 2Y7LA 4GRWB 1P84K 1UEMA 4FQXC 4P06A 3JTSB 4TRPL 1M7DB 1Z9LA 3G08A 5E4IA 1GS8A 4H0HB 4AL8C 2OXHB 3GNML 3V5HA 4HCGA 1KCRH 5D9SA 1D6EA 2GBVA 4BFBD 3FQRB 2H5UA 3BIAX 3STLA 4PY8J 4ZNEA 4FFWD 4FL4C 1KJ2L 4HS6B 4C83B 3BAXA 2VJ8A 2X4NA 4DKFL 1ZHBA 4G80A 2ICEA 3CVHA 4E42B 1PLGL 3B2UC 2ZWSA 5BRZD 5LHDA 5AWNH 4GEJA 1AGFA 4TSBH 2GFBA 3DO7B 2O1AA 3DVFA 1CGSH 2BVOA 3ZHLA 4C56D 1BBDH 4HCRL 5MEOB 2FH8A 2J20A 4LFHG 3MROB 4U1MB 4Y1AD 2QPSA 2BP0B 4ZS7L 2UY7A 5A16B 4N1EA 5IMOB 4JGNA 5FCUL 5D4HA 3VRIB 1QO3A 4XMWA 1RD6A 5EUOE 5IFHL 3F00A 1MZYA 1BQ5A 2VQUA 3FOMA 3BFQG 3HG4A 2P8PA 1OXYA 5IKCA 3RILA 2VMJA 1ED3B 1RK1A 2DYSB 3GTNA 1E7VA 4XXCC 1VCAA 5A2BA 1EUUA 2D73A 5IW1B 2DJMA 3OV6A 1TU2B 1WISA 1AGDB 3QCUL 2D4DA 1MWOA 1I8IB 4FFVC 3BP5B 3RGVD 2CJUH 1JNNL 1M71B 3D4CA 5TPWH 3ULSB 4K8RD 1ZT7A 2A1WL 4UU9B 2CKBH 3H9SA 4N5EC 1ZK5A 4PV1C 4IK6A 4LVNB 1TJXA 3QA3B 3TIDB 3S2AA 3T6VA 1MI5E 4Z7NF 1T3FA 2JJWA 1IEBB 5DJ6B 3G6AB 3VFTB 5IROD 5JOFA 4X98A 2JF1A 1J0IA 5HGHA 3GK8L 2F74B 1IAKA 1QW9A 2VJ0A 4JJOA 1YPZE 2HG5A 4P5MA 3T6XA 4CSZA 1BXAA 3CHPA 1I1YB 2IH1B 3BD4A 5EZJA 4WSGA 4HG4K 5EIVA 3LEXB 2N01B 2OI9C 3DTDA 3Q8FA 5DO2D 1AIFB 1JK9A 2J8HA 3E0GA 3QS3A 4GBXC 4NN7C 2O72A 4PJAE 1ZXKA 1U92A 2BFVH 3HFMH 1XGTA 4W9CC 4YHYC 1MRDH 1A1NB 4XRCB 3ULUE 5BOPA 1JL8A 4PJBA 4M1GH 1U8OB 4I3RH 2YD8A 3QJZA 4P04A 1SHWA 4RGNC 2CR3A 2DTSA 5KVEL 5I1EH 5EO9A 1ECZA 1Q9OA 1Y6NR 4PIBA 4OLUH 4PREA 5BW7C 4MCZB 2K6WA 1N6QL 2NOYA 4HUVA 3DETD 2CALA 3QNYA 3FYEB 3NEEA 5TGBB 4KFZC 4S1QH 3ZKNC 1I3GH 4FG6D 3DX4A 3GMOB 3V4LA 4WFEE 4CC1A 2J88H 4BQCA 4PMFA 2EACA 2VDPH 3GMPA 1UOLA 1E6OH 3PWLA 4FLQA 4LHUB 1U2YA 2IEPA 1P4UA 1SJVA 4ELMF 3GRWA 4HCFA 4HFUL 4N68A 5AW3B 1JYXA 1DFBL 3VXPA 3CMOL 4KQ4H 3PIQA 4ZFGH 5CHNA 3GSRA 1WZLA 4BELD 4MA8L 5FUZH 1WIOA 4LSSL 3CFDA 5D2NC 5I8CA 3WTTA 1NGYA 5EIIG 2QSQA 3IDNB 5T1LB 5EOCH 3EGDB 1KXHA 2C9PA 3KD4A 2DQFA 1KPRB 1PDKB 4XHJD 2W9DL 2Y1AA 4NQDA 4F27A 4HZAA 4KK6D 5C2BH 4FMKA 2O6CA 1XXFC 1XCQA 3AADB 5IJCC 1PZCA 2OMZA 1AQDB 1VA9A 1UURA 4LF3B 4KMLB 3OR6A 1B6DA 1ID5I 1DLHB 5D4JA 1OB1A 1DE4A 1XZ0B 3IGLA 5BZDB 1F3DH 4UQAA 1RZKC 3BRFA 1C08B 3BT0A 2HRPL 2Q3ZA 3QDMA 1E9QA 2VDRB 4KMQA 4PCKA 5EN3A 5FW6A 3QH3A 2ZTBA 4DZBA 4EQ2A 4WWKA 4HISA 5AVSB 4F33B 1JPEA 2EIJB 3T0BA 1MWAH 3HS8A 5IT2L 5B1JA 2FEEL 4HFUH 4O02H 2DLFL 3VXRB 2K9UA 3FMGL 4NOBA 1MCWM 3BWSA 5ITFA 4D94A 3H0TA 2EH8H 2WBJA 3IMSA 3FSOA 4M6AA 2GJPA 3GMNA 3H9SD 3BSZL 3ZSTA 4IDLA 4N8VA 2X12A 5I1GL 4WNJA 5C3TA 3AZUA 3RIFF 4M43L 1HEHC 5F3BB 2XTSA 3QG6B 3W1ZA 1XF3A 2EO7A 4B96A 5DRNB 1A4KB 3UMTA 3C08L 1RJLB 5F0MB 2LTQC 4BKTC 2BNUA 3FU8A 2BP8B 1QFWH 1KTJA 1LLAA 5EOTA 3VI3E 3EJUA 3ZRCC 4NZTL 4RWHA 5I18L 5KYNA 3M7FB 5T5NF 3RIKA 3TO2A 2YD7A 4LK4A 4N2EA 4OU3A 4PLOB 1NGWA 1JPSL 4QHPA 3BH8B 1MVUA 4Y4FA 4ADIA 1V3JA 5E6UB 1H3PH 1IGIH 5D7JD 4OQTA 3TZVA 2B5IB 1HILB 4GAAA 3ILDA 4XO9A 4BKLA 3MFGB 4PGZA 1HDMB 3GSQB 4PRAB 2FT8A 4ODXB 5G55A 4AYDC 2V5MA 2WWKO 1ZY9A 3C5JB 2F0CA 3NDYE 4PRPB 5E6ZA 1JHLH 3SHSA 2X4TA 1I1FA 1BVNT 2EDOA 3LRLA 1D5BB 5FK9B 2P5ED 2CKNA 2Q3AA 4W9FC 4M8VA 4X7TB 3QWRD 1TETL 4EDWH 2CIIA 1D5IL 2PW2A 1TJHL 3KPSA 5HHVL 4AM0A 1E3ZA 4OLEA 5KJ7E 2YXMA 4NRZA 4U6HB 2PMZA 1MG3C 1CT8B 5TQ0L 1LWHA 2XCMC 5I9QC 2W81C 1RY7B 5IMKB 3ILQC 5CIPH 2WCSA 1M05B 2XBDA 1HXYA 2ZJSH 4ZMVA 2J5LB 3CSBA 3KXFE 4GQQA 4AYSA 1EJ6A 4JQIL 2EVJA 4XNZB 3GSNL 4QRTB 1YY8B 1E4KC 3SKNA 3FDWA 2L7UA 1BOGB 5E6IB 1CLVA 5L88H 5FWRA 2COQA 3O8XB 3UJJH 3QULA 4FTVD 3F7PC 3SKJH 3RWIA 1INEL 1G7HB 1LMKA 4R7NA 2JJSA 4N0UE 2KDGA 4ZK8A 2NZIA 3EO9L 3GLDA 4Z7QF 1A7PH 2BS71 3NJHA 1D9KC 3P4NB 4U0QB 4DF9A 5I1HH 4OZFB 3T08A 43C9A 1GKEA 1NWOA 1P4IL 3RI5K 1FNEB 2EUZA 4EIUA 1DCLA 4NZUL 1Q9KB 3S5LA 4JFXA 1JFQL 3RE0A 5E99L 1S7QA 4K5MA 4YQXH 4BGDA 1PLBA 4Z76A 2GSMB 3N5AA 4A39A 4X4XA 1M7IA 3LPPA 2BNQE 2A83A 4MNQD 3MGTA 1MDAA 3MO1B 3BH4A 1NBQA 5DD3H 2NUTA 1NGQH 5ANMB 4YWGL 4HS8L 1CLOH 3DPDA 1FGNH 2GCYB 1SDAB 3OJMB 1Q9LB 4Y8DC 3VXQB 3R18A 4PGBB 1ND0B 2WO4A 3GXMA 1KLFA 3QZWG 4UTBA 2FYYA 3CHOA 2X1WL 4GB9A 5EEXA 1CJYA 1YEWA 4H88L 2XDHA 3LXUX 1WC7B 2D7QA 4NUMA 5AKRA 1MRFL 5BXFA 2VLJB 5GRWA 5A2KH 1J5OH 2ADFH 3QIBB 3T0DA 3V6ZB 4PJCF 5GRXG 1R3KB 3D18A 1XGPA 4PSPA 3NRPA 2G75B 4QHNA 1TG8A 2HKHH 1XGUA 2WANA 4Y4HD 1YMHB 3NIFB 3EHBB 4YQXL 1I85C 3DIFA 2SODB 2AQ1A 3LPFA 1DFBH 4HULB 3TIEA 4YHIB 3PP4L 5HYEA 1Q0XL 3HMWH 2Q8BH 5I74B 1QRKA 2VMCA 2NY6C 4JN2A 3PL6B 5JQIB 3HI6H 1HHIA 3ABLB 1C5DA 3U1SL 5DJYB 4U7KA 5HYIA 4HSAC 5DVOA 3ULAB 3BT2L 2EABA 4AJ0A 2E75C 2DZEA 3N0AA 1FLRH 1OM3H 2XIBA 1BZQK 4X80L 3ZBMA 2OMYA 1T6WA 1KIUA 4H88H 2H9GB 4W6YB 3UTZB 2AMUA 4XVSL 3HG1E 3VD1A 1LEGB 3X3FL 2ZG3A 3OX8B 3QJOA 1OQOA 4PH8A 5EC2B 3UJIL 4ZW5A 5K9JL 4AENB 1QVOB 3ZJAA 3QEUA 3QQ4B 3B6SB 5BVJA 3QIUB 2P5WD 1LO5A 2NXYD 5AW5B 3ARPA 5KSUA 1LEKB 1TFPA 2PABA 2EDFA 1MCPH 5HHOA 5JIPA 4LMQI 5K39A 2AC0A 4W4OC 1ZE3C 4N1HB 4PVMA 4J4PA 3O4LE 3BRDA 3GSVA 3QNZB 5CUSH 4NWUL 5EBMA 2AJZA 3MN8A 3PWJA 2BC4A 3EYUH 3GBNL 4H26A 1LO2L 2VLRA 3P02A 1P0SE 1KJMB 3LOWA 4JFED 4LGRB 3FU5A 1KTDB 3T4AC 5DWUH 2NUPA 2C9SA 4DJMA 2YHGA 2HKFH 2FJUB 4B97A 2BWQA 4MNHB 2XWBB 5D7LB 3W82A 2C7UB 1RUAL 3L5WA 5BJTA 1RPKA 3US0A 2XHNA 3HN5A 1QFWL 5F93C 4P2QB 3D48R 3U46A 1A8ZA 5B39G 3JV4B 4FCHA 4EDWL 2QELA 4MNQA 5FYJL 4F2ME 2FBRA 3HZYA 1INQA 3HE6D 2X89D 1ILUA 1L7IH 3INOA 1L9NA 3L17A 3BPCB 1C7SA 3REWB 2AJ3A 4H5SA 1G0DA 1IUZA 3GBMH 3P3UA 3I02A 4QJ4B 1AXSB 1MCCA 5D7JC 3TV3L 1NKGA 2BHUA 2L3BA 3ARGC 1B0GB 5DJCB 1PNCA 4W9GC 4JDVA 5BV7C 3HNVL 4M6NH 2X4QB 4IRSD 3FOLB 4MB1A 4ZMTA 1HOCA 1SUJA 1AD0A 1KNOA 2WW8A 4RSVA 5I26A 4PJIF 1IAMA 5I5IA 1HU8A 4ZPVA 4WGKA 2J8UB 3DROB 1XMEB 5DVLA 2E7LC 2NSQA 4NHCH 2KKQA 1KYFA 3PV7A 3REVB 4PLJD 2OSLA 4F93B 2D7TL 1BJ8A 3U9WA 5B38A 4QHUA 1OVZA 4BWWA 1BZ7A 4GW1B 2NYZA 4UUJB 4Z7OF 2ZSWA 4IRSB 1S9YA 1A6VL 2BCKB 5I30L 3WNOA 4M48L 4ERSL 3R06A 1HH9A 4BH8B 4UV7H 1FYHB 3MV8E 4GIPD 4XCYA 5E8PB 1UFGA 2DICA 2AK4A 4QTIL 1VGKB 5TFSL 3Q5YA 1OB0A 4WENB 3VD2A 1S5HA 1XGQB 3FQ2A 4ZNCD 1Z0MA 4HJJL 3TA3A 2B2XL 4L4TE 1Q1JH 3QP3A 2YAPA 3O6MH 1G7QB 1KIPA 2MKLC 2B2XH 5HXMA 4L29A 4EI5D 5HYSB 4L3FA 1QFUL 4CMMB 3A6CL 1OPGH 1VIWA 3OKMA 4PJCA 3ZT5A 1Q1PA 3HN3A 3TV3H 5EBLA 2BX5A 1G87A 2AQSA 1KYAA 5EF2A 4OFPA 3V4PB 5KG9B 4RQQA 1I9JH 2LAGB 2WXHA 1LEIA 4YXKL 5ICZB 1CFVL 3WOVA 5JHAA 2FHFA 1RZKL 1KT2B 4X4KA 1LE5B 2ED7A 4IBUA 4Z3JA 2P5WA 5AYUH 1PQZB 4ANVA 1RJYB 1S7XB 4WY7L 4M4RB 3UPRA 2R83A 1K4CB 4ONFL 5AB1A 1UC6A 3IRCA 3SOTA 2HFFA 1KTRL 2SEBB 1YPZA 1GW6A 5F7FA 4JDEA 3ZR6A 2DBLH 3BHBB 5MENB 5E1IA 4BXSV 3L3IB 4TKWA 4BZ2A 3F04A 4KMTL 1DJHA 1FVDB 2A7BA 2HXAA 3T4YB 2CO6B 1NAMB 1QLEH 3S34H 5DJXA 4Y2DB 4C4BA 1IM9D 3FZUD 5JW5A 3VI3B 5IK3B 3BZFA 1LO3L 4FNUA 2E6PA 4JJ5A 1MRDL 4J1UB 1RCYA 1WPCA 3LYRA 5KOMC 2XN9A 3EH3B 4FEMA 4QRAA 1RZJC 1S3RA 3LKRB 4G5ZL 5D6CB 1J86A 1NBZA 1U4EA 3BIKB 4YNYB 4G9DB 2YARA 1JF1A 5GS1C 2X4OA 1KXTA 1YY9C 5B8CB 3C5ZD 4NKMB 1U6AH 1AGCB 5ENWA 1U8LB 3LS4H 4UT9L 3VGDA 4OFVA 4N0UB 1WWCA 3CU1A 4FX5A 4M62H 1MLCB 1Z5HA 3ETSA 1OM3L 2AW2A 2OK0L 3KBPA 4JFYB 1FVCA 4CN1A 3CC5A 4IU2B 5HDRA 2BOBB 2YOAA 5AAMA 5H4ZA 3IMTA 5DRWB 4M62L 1OSZB 2F53D 2R1WB 3D50A 4WUUA 2Y5EA 2FATH 3ZT7A 4E9RA 4PJFE 1UB6B 2DWSA 5EIIB 3CFCH 3T2NL 1ETB1 5IY5B 2WLYA 5INDB 1N4XH 4UM8B 4M00A 2BINA 1FUNA 1BMZA 4M9OA 4BK5A 3WAKA 4RA0C 4WHYG 2EICA 4A37A 2NZ9C 1HINH 3DTXA 4AVKA 5KS9A 2PWDA 4PRIB 4Y5VA 3L3HB 5J1SC 3FYIB 2YQGA 1AQKL 4PJDA 2FZ3B 2H1PL 2P49B 1WRFA 1T5KA 3U4EA 4ZDHB 3WFHA 4U7SA 1P7KA 4HV8B 4J3OH 2JJTC 4XPTL 2VR3A 3RWDA 4AK2A 3N6YA 2XVKA 5FWQA 4V33A 4APQC 2ZF8A 3QXTA 2HMIC 1A2YB 1NGZA 4FKKA 1OP9A 5G2NA 4LSPL 1I1AC 5DI8A 1SXAA 3B37A 4RDBA 4X6BB 2XACC 5FB8B 4U1KB 1ET5A 1VFUA 4H1LA 4PJ5E 4Z77B 4NGHH 5AOJA 2ENPA 4I48A 2OYLA 5KUMA 4ZMNA 5C7XH 5EU6E 4CC4A 5JYMA 1OK0A 4OJDH 2YGVA 1H5BC 4XNUL 1AANA 1RUML 5F8RC 2XJKA 4K9JA 4ZQTA 4YSSA 4HPHA 2NMSA 2IXQB 3ESUF 5T3ZH 3KLHC 3W57A 1S9WA 2IBGA 4AQ1B 5DUPL 3L08A 2HJKA 3ARED 5IIEB 2JI2A 2YEZB 4PWJA 4K94L 4ZFZA 2ZX8A 2D9CA 3BPNC 4XCEB 4B9YA 5FPIA 2B59B 1W0WB 2FJFB 3RWHB 4TUOB 3VFVA 1OCRB 3FBQA 3KEDA 4JKKA 4UQ2B 5I1JL 2FGZA 1U58B 1SXNA 4HP5A 1HJBC 1M2OA 4WW1B 2CDEB 5D7IE 2VABB 1SF3A 1R24A 2V3EA 1OM9A 1CZ8H 1QSEE 3DVNB 4JFFA 3TFBA 2NY6B 3ZDWA 3DBXA 3TJEH 2ZAIA 5DD6A 3TC9A 4X5WB 2XBZA 5DSCB 1ZEAH 2Z7ZA 3GSNH 3NEXA 4KK5D 4FQLH 2HFGL 4JZNA 1IM9A 5FA4B 1CK0H 3WAJA 1DDHB 1NIDA 1WWAX 2V8MA 3T8XA 4A2GA 4PLJC 1T5WA 5CCGE 1Y0LA 1A6ZB 1OTSD 3L2NA 4LVOC 5T8IA 4NJAH 4EVNB 2A73A 2XN9D 4ICWA 2YXFA 1IGML 4P2OD 4HK0B 3QXDA 1S7WB 1SDYA 1EFXA 3X1FA 1KTLA 4PU2A 1UJ3A 3WLWC 1MSPA 1ZTXE 4G7VL 3TGXA 1PMYA 5FGBA 1UM4H 3EJSA 2WXGA 3WJJA 3ZE2B 2AERT 3TU6A 2PW1A 4FNRA 1Y1DA 3GI9L 2VXQA 2E8YA 3V0VB 1MFAL 3NYKA 1G1KA 3OXRA 1IM3A 3NSJA 3KGRA 4MD5A 4RAHA 5EV7A 5D96B 3W0WE 4L9LB 3MRMB 1H19A 4H44C 1C5BH 3UH8A 3ZDXB 1JPSH 2A6DA 1N6UA 5GS3A 2NY4D 2B15A 2XQYK 3C5SB 4NJ9H 3BVWA 4HZ1A 1P1ZA 4U1NB 2XZAH 1SUHA 2RFXA 3MJ9L 4OZ4B 4CILA 5FHAH 3MFFB 1DJGA 3FTGA 3EGSA 1AE6L 5D1QA 4E36A 1GGBL 4YHYB 5M7QA 4Z7OE 4Q9CA 2AJYH 4RAVA 5C0CE 1S78C 4HXBL 4PTTA 5I0ZA 1I7RA 4WK2B 4PR5A 3US1A 1FFPA 1NOAA 3MBWA 3QJQB 5DDHA 5E2TL 1JRHL 3ARDB 4JVPA 4BFOA 1ZT4A 1A47A 3ZMRA 4JW3A 3EOBB 5IVXE 5T1KA 3D0LA 1FYTD 4P05A 3CFMA 1ETZA 3VA2C 2OW6A 3FK3A 4ORGB 5KAQF 5L4FA 4KO7A 4N4YB 4PP2A 1EAQA 3WKNA 4E9LA 3O81A 1E5CA 3HZVA 4GMSL 1M9WA 3WTSA 5EBWB 1IAIM 3BVNB 1PZ5A 2YIHA 2YRLA 5A2AA 4OUOA 3WEOA 3C6LA 4F57H 4NC1E 2G0KA 1HAWA 1E5AA 1M2VA 3F7VA 3P4MA 2WLIA 2EC8A 3DX0A 2IV9A 3QUKA 4CNIB 3AY2A 1FDLH 4K3HA 3V0HA 2HVJB 1EGJL 1PKQB 4YUEH 1RK0B 5E7BA 2J1XA 4LDOB 4PG9A 3VU1A 3L95A 4Z7VB 5MHSD 2R56H 1R5IA 3LKNA 1TITA 3WGUB 4D3CH 1ZSHA 4Z5RA 3ASOB 4AUYA 2A74C 4JFFD 4MAUL 2K7PA 4Q9RH 3GHPA 3O45A 3JWOL 3ISWA 1SM3H 4PCYA 1AO7D 1Q0XH 1ORQA 2DMKA 3QS2A 3FRUA 3JYCA 3JUYA 35C8H 1DUZB 1KLGB 4R5XA 4KO9A 4AGMA 3QDMD 2I9LB 5GRUL 4X9BA 3TBBA 4MA8H 5HGDA 1XR9A 3GF8A 1J9TA 2GUOB 3CMOH 4MQ7A 2WVTA 3QFJA 5MEQA 2CMRH 1ZLUH 4KJQC 3T3PF 3TPUA 3VGBA 3S4SG 1FZJB 5C92A 1E4JA 2R9HC 4NQED 4LRNH 3WTVA 1QFOA 2OJZH 3TTSA 1LTXA 3CJJA 4QAMB 4H0GA 1LNUA 3HNSL 2K3TA 2VL4A 4XVSH 2E7BA 1R5WA 3ROLB 1W91A 5FW8A 3LKPB 4J2XA 1MY7A 4WFHD 4PV9A 4QRFA 3DGDA 1G7JA 2ADGB 4N2OA 1HYSD 2B4CL 4LLMB 3GJFH 2FJHB 5F3HA 3UO8B 1XZWA 3FXIC 3QDJB 1QATA 5C8JB 3IJ8A 1H3WM 3M6DA 2CLZA 3RU8H 4AV4A 5CEYB 3MMEA 4BUGA 1HNFA 1OZTG 2IPTH 3CN3A 5DJ0B 1DQJA 1MIMH 4I3SL 4XXWC 1T22B 3BVDB 4JY4B 5GIRA 3HC4H 2C1OB 4QRRB 4N2AA 3OC5A 5D1QD 1E8ZA 3NPZB 2W8CA 3L54A 3BZDA 3RVWC 4RWYH 4OKVB 1B2YA 1MIML 1PD0A 3PV6A 1KF9B 5DFAA 4ODVL 2ZAGA 1XCTB 5DS1A 4C55A 4BSVA 3NCJL 4K73A 1FNGA 2C3WA 1ES0A 2A6KA 4NNXB 4Z7NE 3LN5B 3CDYA 2P24A 1YUHA 5EO1B 2GJZB 3O41B 3MCKB 1ZHLA 3ESMA 1IL1B 2A1WH 4AIZB 3MLYH 5E95B 5CGMA 1F3DJ 3DOHA 3FO0H 2OTWB 5DEZA 5DK3A 2XNAB 2VR4A 2YXWA 4JRFA 4YL9A 4BFIB 2P80A 2YAFA 2YPKA 2CK2A 3C6LD 4W9LC 1USZA 2V2XA 3HG1B 4LSDA 4GRMB 1CL7H 4JB9L 4QXWA 3VB8A 5EEZA 4N20A 5GSVB 2YMOA 1CURA 4LPXA 1NFDF 1G6RH 2HJFA 4K3DH 4Z9KB 1AP2B 1AHWB 4ZYKB 3NFSL 1CBJA 3Q2NA 5FDWA 5LQBL 1MJ8H 3Q48A 3MBXL 1ZTMA 3SDYH 3WXVL 2PO6D 1II4E 3R1GL 4CN4A 3T0EE 1YZZA 1JI1A 4BQBA 1OAQH 3ME0A 5FO8A 2YQBA 3VJ6A 4Y5YC 3EG9A 3N06B 1P5VA 1XDTT 4PJBE 5T33H 3R8QA 3U4BL 1KB5H 2R1XB 2ZE0A 4DFHA 2BO0A 2HJLB 4OFQA 1H3GA 4CVUA 4CVXB 5L88L 3E6HA 2OMUA 5DS8B 2G2RB 3NEOA 1BVOA 4LCWA 1IGYA 1OF2A 2CDFB 3BQVA 4NERA 3CH8A 5IHLB 3QR1A 2FIKA 1Z66A 4L9LC 4FZEH 3S96A 3VWKA 2BW4A 1CDBA 2F7OA 4NQDD 4JRXB 3JSSA 3NSFA 1CFVH 4EZJA 2UYLB 1QA9A 3GJFB 1U93B 3NA9H 4U3SB 1I4FA 4XMKH 4M6ML 2WLLA 1YEHH 4G82A 1HXMA 3RY6C 4NQEA 3V0IA 5B7EA 2LV4A 3A6CH 3HR5A 3O2WL 3DXAA 1GXEA 5KAQG 1EDYA 3RGHA 1HHKA 4KDTA 4G5AA 2B8OT 2JI3A 4M8UA 4OB5L 1H3XA 1CB4A 1GGCL 5IVZA 2JFCA 4XX1G 1S7TA 5CWSB 4I5BA 4YXHH 2PTUA 1DBJH 1JUFA 2Y06L 4GW4B 3ZXAC 2DQIH 1M7DA 5DTFB 2IANB 5PAZA 4NZ8A 3GC3A 4PTUA 4Z7QB 1OGAA 4JY6A 2QPUA 3IGUA 2W5PA 4HKBA 1ZGLM 2DLEA 3KPOB 5I6MA 43CAA 2C9XA 5DA4A 3MA9L 1EDHA 1X5AA 3RHWK 1FNAA 2DH3A 5F9DC 2IFFH 5FLVA 4M4PA 5IOPB 1XV8A 5GGQL 4E9SA 2UXFA 3FFCE 3D3VA 3MGOA 1ZLSL 4F1ZA 2APTA 4UM9A 3JWNH 2HRLA 2BDNL 2BM3A 3QQDA 3U30C 1QZ1A 5F1IA 3EJYC 3GPSA 3LSOA 1K5NA 1AKJA 5A7EA 4HUMB 5BS0E 1ZPUA 1CYXA 3LEVL 4H2AA 5DQDL 5I16A 4PJ7B 3RWEA 4Z7OB 1FL6A 2YBGA 4LCCB 4HSCX 1AR1C 2XRAH 2YZ1A 4G6JH 2QGDA 2MQ0A 4JLRB 3OZLA 4I0PB 5BZWB 4ANXA 2OYKA 2P8PB 4E0RB 3P3RA 1ED3A 1CE1H 1H6TA 1RK1B 5AQ0A 3U1PA 2ALAA 4F8TA 5DLML 1OHZA 2ZWNA 3ZT6A 5IW1A 4OZHA 4RAUA 3A4DA 4I8DA 1U3NA 5TE7H 3LNEA 1J0JA 3W0WB 1F8TL 2XVGA 1J8HA 3MOBL 3DX7A 5HVWA 4LAQL 3KL3A 3L4XA 5HHQB 1U30A 1M71A 3T3MF 2YWZA 4YDVB 2HWZH 3U4KA 2J6EL 4AVHA 1ZT1B 4HD9A 2FQEA 3HLAB 1YHPA 3DK2A 3MRIA 3ROOA 4HT1L 3K3QA 5C2BL 2DLHA 1WCBB 2C4XA 4JANA 4P4RA 4QAWA 5IV2B 1QPKA 5DJ6A 4PJIE 1P7QB 1UENA 4BJLA 3MV8A 4OIIH 1OGAE 3QIWB 3ZO0A 2XTLA 4I18C 4U4BA 1I1YA 5EZJB 2XA8L 5HYJE 3QE5A 3LEXA 4FADA 1BZDA 1GRWA 4AGLA 4KAQH 4KQ4L 3TO4B 3GD1C 3X17A 4AC2A 3H9YA 1KPUA 4CU7A 3P3YA 1A7RH 5D1QC 3INUH 3Q5TA 3BPLC 3IFNL 4ZFOB 5M94B 4RBPK 4AEEA 2XTJD 3HE6A 3RBGA 3M45A 1MEXH 4YSCA 2DQJL 2P8LB 5IFJB 4KY1L 3UG4A 1U8OA 3CVCA 3RWCA 5D7JB 3LEYL 3STZB 4FLRA 3X3FH 3RVXD 1ACYH 3P30L 2IDCA 2CRYA 2ZXEB 3GSNA 2D3JA 1S4IA 4KVNH 4HQQH 3O11A 4XMPH 5I6XB 2ICEC 1EO7A 4AEIL 1NL0L 3II1A 2BSTA 4YGVA 2UV3A 3PE9A 4URKA 1C1EL 2H6UA 5C0AE 3HHMA 4M3JA 3I9PA 1SFHA 3PQYB 2DEWX 3PUCA 3TNMA 1HIMH 3N1PC 4KUZH 2JCCB 1HVXA 3GMOA 1HSBA 2QHLA 5SX5H 4F2MA 1U3HB 1UZ6E 3FONA 1B0IA 1EUTA 3KYOA 5TD4A 5GGTL 3JVGA 4OM0L 1XH3A 4K3DL 1D2OA 1PG7L 2WXMA 3ECBB 4OM1L 5DEGA 1WFTA 4P5RA 3T3MB 1MHHA 1EJ8A 4R7VA 4PJAF 4I9WD 4ZMAT 3QORC 1QKZH 3QZWA 4GI9A 5C6TH 2OPCA 5JMOC 3BI9X 3PQYD 4AYEC 4IGBA 1QI4A 1DJSA 3LAFA 4BK8A 5EZLB 2BRRL 1OP3H 3ZE1F 1OTSC 1NGYB 1FG2B 5FHBL 2NY3D 2RB8A 5GHWH 1T1ZA 5C08D 5A1AA 3TA3D 1LK2A 3FN0L 1RZFL 2DV6A 4JEGB 2YD5A 1PJWA 2XFXB 4ODWA 3EJZC 3QHTC 1IFRA 4TQIA 4MCNA 2VNCA 3V55A 3E2HB 2E7DA 1QSVA 1OB1B 1XZ0A 4R4BA 1JPFB 3TP4A 3AXHA 4KKAC 1C08A 1RJZB 3VXUD 2VDRL 2WC7A 1WFNA 2VISB 3BKCL 2WYIA 4P48A 3UBXI 4J3WA 4IK7A 4XCCL 4NO0B 1Z9SA 1SBSL 2WTOA 2VLLA 3JWDC 5CEZD 1NMAH 2NT1A 2X9WA 3LB6C 3UERA 1WAAF 2CHDA 2OZNA 4YDIL 3N40F 4DVRH 1E2ZA 1Z5LB 1BFOB 3BSZA 3FT3A 5A2CA 4MKTA 4BZ1H 4GQZA 5IUSA 4CDGC 3FU7A 4H13C 3H0TB 1OANA 5IGXH 3SKJL 4FZ8H 5I1AA 1I8KB 5DUMH 3C9NA 2VUOA 3JWDH 3QDJE 4ODBD 1DQQA 5DHYB 2HPTA 2AK1L 2DJSA 2EYRA 3CFJB 3D2TA 1X44A 2ESVA 4PJCE 1WWWX 4FD0A 1T83C 1OLLA 1OAXH 2DWTA 1P6WA 2YEQA 1BCIA 2CO3A 3II2A 1FI8C 4FQHA 3SCMC 3WIIL 4F80A 4GRWH 4XT1C 4FA6A 3VMOA 2B1HL 4LCIL 5ICXA 3MJGX 4LPTA 4FFYA 4NP9A 3IJ7A 1KACB 4E9VA 2MCG1 1CU4L 3KWWB 3CHXA 4UMSA 4B53A 3N1FC 3ERXA 1BQUA 1WV7T 4CDHA 4HX1A 3SE9H 1MH5B 2KUTA 1I8MA 1RZQA 3KPLA 2DQTL 2M8XA 2X3CA 3TO2B 2HZHA 2P43B 3LV3B 3L3OB 1UKSA 2MNUA 1AY1L 4S1SH 5HY9B 3QXVA 3KYMB 5F97E 3GMQA 4FQ2L 3TZVB 3PP3H 1Z1WA 2W65B 4HC1L 1L5GB 1YEJL 5FGSA 3HNTH 4NZRH 3DWTA 3MTRA 1IZKA 1TQCC 4AK1A 5CLZA 1VB9A 2X42A 3ZUCA 4X6FB 4PRPA 1UH3A 4OFYD 2JKNA 3D85A 5F7EL 2GTQA 1P5UA 1T20A 2E0PA 2EIMB 1JZ2A 2O30A 2VITA 5T3ZD 4KHXL 5JNYA 4J2QA 4Z0BH 5C9JA 4NKOB 2AEOA 1E42A 2TSAA 2CZNA 2VSDA 2YAHA 5C0FA 5FOBA 3U83A 2IOOA 3VM5A 5CILL 3B9KB 1TZHB 4V2CB 3QZOA 3H54A 1A9EB 2EIZA 4H25A 4ZRGA 2AKRA 1BF8A 5B3NA 3QIWD 1ULVA 3DXAE 3FUJA 3GKWH 4TSCL 2KZKA 3VI4F 4JGMA 5E9DB 1A7QH 2UZXB 3WSQL 2F18A 5CFHA 1UA7A 1QD0A 2X4SB 3QPKA 3TTYA 2VXTH 3BSZH 4OGZA 1C12A 1EA9C 4RGOL 2ZWLT 4L8SB 1MEXL 2VAAB 3A22A 3U6RB 1KC5L 1N6VA 2WXLA 3ARBB 1H5BB 1N0LB 4J8RA 1OW0C 1UHVA 1JXGA 2UX7A 2J1WA 4KTEH 1U6AL 2OTUB 2XJLA 4X5QA 3CX2A 1J1XL 4FQ1L 4OZFA 3WJMA 4GSXA 5JOPD 4FYSA 4D0CB 1W72H 3MNZA 3MLXH 5LGHL 1JVKA 3F3HA 1PCXA 1WFMA 5B1BB 2VO8A 4OD2B 2ZP0T 4OLYL 1YMME 1M7IB 2V17L 2EKSB 1AXTH 3O3UN 3O9WB 4XBPB 5DFVD 2QJDA 3ARWA 2W60A 1FQ9C 1SHSA 1JZIA 3F7LA 3JVGC 1G9HA 2AI0H 4ZMZA 4ABWA 3MJ7B 3FUHA 2D7OA 2H47C 2Z92A 4YK4B 4AMWA 3GJEB 3P9LA 1NGPH 3OSVA 1Q4NX 3RVXC 4P5KA 5L8LB 5GGRB 4JKPL 4XNXL 4P3CH 1CLCA 2HYMA 4FG4A 3CZKA 7TAAA 5HYJA 1A1OA 4XVJH 1J5HA 4OAWB 4ZFGL 4MDIB 2O6FA 3PWPD 5SWZE 4WO4C 5BXFB 2OL3H 5C0CA 3DUUA 2JH2A 2L8AA 2WUCL 3MSPA 2LLNA 1RULL 1GOFA 4MCYA 1UM4L 1CXFA 3RWFB 3D39B 1SQ2N 3BWAB 5FECA 5J7CC 1G6VK 1FA4A 3FRPA 1DBBL 3BUIA 4K7PY 4XPFH 4MJ5B 3T4AA 5EU5B 3HN8A 4O02L 4CAGA 2WM0A 5I6XC 2WLHA 2F61A 3BUYA 2AJUH 3L4ZA 4JN1L 1UJTA 3QYMA 2NYKA 1DBBH 1MCOL 3TVMA 4NXKA 2ZONA 3LH2L 2KH2B 2F8OA 4M5SA 1ZGLB 3VXMA 5DMIH 1N67A 3DX3A 3CHQA 4J8QA 1YMMA 5DJ2A 4PJ5B 4LDLB 3EJJX 1YDPB 5K59F 1EHKB 2ODHA 3A23A 4CL7A 2QQNH 2C3GA 3EO0A 1DSWA 2Y6TE 3PAUA 5KYXA 1ML0A 3SDXB 1GCYA 4HIQA 4QJ5B 4RMVA 3UG5A 2HT3C 2ZUQB 3QPXL 4PPTA 4TVPE 5GZOA 4B50A 4ZSOB 1KIUB 1K5WA 3FCTB 4TNGA 1KIRB 5JPMB 3DECA 4OIBA 3MLRL 2YPVH 5AZUA 1IE5A 1C7TA 3RGVA 4HOZA 2E9BA 5K1NA 3OAUH 1S7RB 2VXSH 4YHKL 4DIXA 2DIEA 4P8QA 1QTSA 5AW2B 2AVGA 3WGVB 3OR7B 4J3XA 4MQSB 3S3DB 2F5BH 1RUKH 3L2MA 3OB8A 2VYRE 1QVOA 3F6IA 3HG5A 1B4LA 3V52H 3RVVC 2CBPA 3L7FB 3CZJA 3DSNB 2NX5B 3KYKH 2ZCLH 1MAMH 4JPWL 4AXWA 4KDVA 2BZCA 1DN0B 4I9WE 4I1RA 2BNRD 1KZYA 3HMXA 5IBTH 2IH8A 2Q1EA 4NO2A 3UGUA 1JV2B 2C1PA 2W9EL 3P1VA 4F2EA 4M6MH 4A7GA 3ARRA 4QHMB 5KSAA 1L4IA 3G6JF 4HLJA 2G30A 1IT9H 4BM7A 2VLRB 5IJKA 2GT9A 2LU5A 3FT1A 4WV1A 5DRXB 3DRQB 5TPWL 5HYQB 3RDTD 3OF6D 1GCFA 5D1XA 3WE6A 3ARFA 3P9MA 1GVIA 4XNZC 4KUCF 1A9BA 2GK0B 1N19A 5FYKE 2FBJL 5ITBH 1HCZA 1E9OA 4K07A 4N28A 3NQKA 3L5WB 4NYLA 3CQQA 3EAKA 1HZHL 4PJXF 4WO4B 5E2WL 2XN0A 1IAII 2OMVB 4JO1H 3IB4A 2R0LH 2YD3A 4ANUA 5EHFA 4EI6A 5KVFH 1U9KA 3QEQB 2ZOKB 1WTLA 4TOYH 3VXNA 3U0PA 1ZHKB 3PXHA 4EUPA 5EC1B 1HL9A 1TYJA 4H5SB 3ZTDC 3BD5A 3Q43A 3FQNA 3HZKB 1YN7A 5GZND 2JXMA 3KGUA 1XGRB 3B9KD 2FLRT 2A74B 5DJCA 4AJYV 4CW1B 3VG0H 1PZBA 1T2QL 4FCAA 4ZQKB 1HOCB 4XMTA 4LP4A 2QSTA 1KNOB 2BJML 3O0RH 2IDFA 5JXEC 3BQUB 3QCTH 3QEHB 5JW4R 4IKJA 5AUMB 1RUPH 1LQBC 5ILTL 1NPJA 2J1YA 2MNWA 4BKSC 3QUMB 1QTPA 2CLVA 1MFDH 5IMLA 3PDOB 4PG2C 1BEXA 3IJ9A 5CIPB 3H1ZA 2Y6SC 3OKDB 1BD2E 3HPLB 2GC4C 2IO5A 4UUJA 2K78A 3PWNB 4PJFA 2DH2A 1J88A 5HI5D 1JXJA 3E80A 3DX6A 4WEEA 2YR3A 1WJ3A 3V4PL 5EEYA 2Q10A 3RUGA 2ITCA 4CKQA 3KCPA 4LL9A 3TT3H 2PCPA 4HMEA 5LCVL 1PZ2A 3PS6A 3WS6A 3D4ZA 4YGAB 1VGKA 4OGQC 1QRND 1LO3H 3HI6L 2H0EA 3NIGB 2EH8L 4LOFA 4FL4B 4NKDB 4S0TD 3V6OC 4KHTL 5TK4A 3KR3H 3KXFB 1KLUB 1IEAB 2JCWA 4TQEH 4X8GA 7PAZA 4R96A 1RZJL 5GZOD 2EYTB 1BGXH 5AVRB 4D9RE 4TUKH 3AY4C 2VDLL 2EXTA 1H3UA 3BMWA 2GAZB 3QCVL 3FPXA 1MCHA 5BPPA 4IRZL 3IDXH 3QUYA 5E2UH 4TVPH 4NPYA 4QT5A 1M3JA 3GMRB 4PB0H 1UWFA 1LVEA 2KLSA 4NRYB 5C0JA 1D6EB 2A5UA 5FV2A 2ATKB 2CUAA 2DI9A 4HUCA 1HT6A 4K71B 5EU3A 3VFOA 1KBBA 2MTPA 3QJHB 4K7PL 4V1DB 5TDPA 3VCLB 1NCCL 4EIZC 1KB5B 4XP6H 4M4RA 4G1MA 4ALAL 4OJFH 5DZ9A 5BMFH 1IC5H 1U8PA 2D7TH 2OJEB 4DAGH 1FL3B 3FH7A 3PF2A 4GP4B 1PYWB 2CPCA 3T1FB 3IAGC 2ZUYA 3S3PA 4R5VA 3IFOA 2RAMA 5HD8D 5A7BA 1KCSH 2JSFA 3I50H 1P4LA 3BJLA 5FO9B 3QO1B 4XPHH 1QWUA 3GLAA 1BVKA 2Z8VC 4HPYL 2CO6A 3O9WC 3A47A 3TNNB 3UCQA 2UY7B 3RX8A 4QJ3B 5IMOA 3HUJE 4D9RD 4L3EE 1A4JB 3VRIA 2YK1L 1SYSB 4QTIH 3B4NA 1QO3B 4IKLA 1KJVB 1KYDA 4NC0B 5DQ9B 3T6QC 1AIZA 1REIA 2VO5A 1GC1L 3CFEB 4LEOA 3BOVA 4JCLA 2P47B 2CU9A 1U3ZA 4LDCA 2UWEB 2XWJA 2BIOA 4M48H 1W15A 4ERSH 1KELL 2AV7A 2H0JA 15C8H 1I75A 2LU4A 3GEFA 3KW8A 4OM1H 1NDTA 1G4MA 3SDAA 5FGCE 3DV4A 4W68A 1U8LA 2YGOA 5EOCJ 4YDMA 3BUBA 1WO2A 2WVVA 5I0DA 4FNLL 1TZGH 1N5YH 3SBQA 3QWRA 2C9AA 2J43A 5BQDA 5DWPA 4NENB 4XN8A 1JXFA 1ZVYA 4FN0A 4FE9A 2QZQA 3ZN6A 2HT3D 1QW8A 4NN6C 1EMTL 2NQCA 3TX4A 3LPOA 4MJ6B 3MV7B 5A2FA 1AD9B 4PRHE 5EIIA 2FE0A 1IAKB 1BIHA 4P5MB 3QORD 4Z3EA 4EOWL 1LO4H 5MP6L 3EDJA 4CA4A 2EYSA 1P4BH 3RA7H 3WV0A 1P5UC 3UROR 2VDKH 3AXLB 3FTWA 4XNYL 3DTXB 5KS9B 3KVDD 3NFSH 2P1YA 3B1TA 4L0ZA 3AAZB 3CH1A 4IOFC 1QZNA 4G6FD 5FUOL 1JTOA 1ZIAA 3TA3C 1RUQH 2LAAA 2VGLM 3ARZA 4K94H 4MAYD 3U4EB 4TL5A 3IU4H 2FRGP 4XNYH 4B7IA 3QRGL 4F5CE 1DANT 1TOXA 3V0EA 1MCLA 4E68A 1RP9A 1A2YA 2CHZA 1NGZB 1JGVH 4LRIA 4WWKC 3AMLA 3SBRA 1TEGA 1X5LA 4GKOA 3BW9A 3BXNA 2BERA 2NNCA 4FYTA 4U1HB 1JCVA 5T3XH 3I74A 4Z77A 3BAIA 4IU3A 2CKBB 4HWBA 4IRSC 4MXVE 5GS0L 1Z2KA 3VD3A 5I18H 2YGPA 5B21A 2RQ8A 4PFEA 1IAIL 4C8XA 2K45A 1E28B 2QBWA 2B1OA 1TLMA 3VSQA 1EZVY 1MI5A 2R23B 1MUJB 1A4CA 2EXYC 4ZFZB 3PWLB 2IWGA 4XCEA 1F4AA 4M5ZH 4P2RD 1JHKH 2RCSL 4WUUE 5I5RA 2N56A 1JYWA 3NTCH 4HBQA 3KH3A 1BQLL 3NAAL 1H0DA 4KV5F 3OLIA 3II3A 1FC2D 4XI5C 2RJMA 4MNGE 4BFEA 1DVFD 1P9MC 3IM1A 4XCFH 5CAYB 2E6QA 12E8H 5I8EA 4OLWH 3IGKA 3CFDB 2R2CA 4KZDH 1QR1A 2YMXH 3S35L 3FQTB 4JRYA 5AB2A 4JZJC 2APXA 4RH4A 3OKOA 4QRUB 1YEJH 1BJ1H 1K9TA 1MHEB 1OE3A 2KQMA 3E8UL 4TULH 3PDGA 1F6AB 4PLKC 4ONOA 3VNYA 4PW4A 2NXZD 2VLKA 3AUWB 3MOQA 4WNQB 4YSAA 1PGRB 4X4YA 2ZXCA 4RISH 3KWUA 2OMTA 3OKLB 1YJDC 3LS4L 3RB7A 3MA9H 3A24A 3BE1H 4XXDA 5E2VL 2NY0C 1LP9E 3QQNA 4KRPD 3TT1H 2WTRA 1B9ZA 2FR4B 4NOFA 3VAEA 3QJSB 4J6IA 5GSRB 2Y69B 3L4TA 1O7VA 2AEQH 1B4JL 3FCUB 3TJHD 2ZQKA 1SY6L 1N12A 1J5CA 5AVYB 3DGGA 4G11A 3HZMA 1ESOA 5K9KB 3F5WB 1RXLA 4QHLA 3ZZLA 5HVHB 1SY6H 1ZWIA 4KKLD 5IEKA 1QLEL 3GMMA 2I7SA 4Q9RL 4AE0A 3IK2A 5E6RB 4MAUH 4FTVB 5DC0A 5F3BA 5IHWA 2XFGB 1T2XA 4H8WL 3R7RA 5GZOC 2BHFA 4HJSA 5GPRA 5GRJH 5E08H 3VFNB 2ED8A 1FCCA 3MRCB 3WHXB 3QORA 2EDYA 4RRPG 2JQAA 3KNBB 4U05A 3CK0H 2BNUB 4TOYL 1YLBB 5ERWA 4X8JA 4JFFE 4I0PD 5LB1A 3KHQA 3T3PE 2WNKA 4MA3A 3MREA 4PVLA 2FJSA 4QDGA 4EUPG 4JG0L 4XNAA 4LE8A 4FQCL 2DQ6A 4XNMB 3V9CA 2VN5A 5AL0A 2Y4SA 1MWAB 5GXBB 1I9IL 3ZZSA 2BY1A 3ARDA 2WMPA 1ZT4B 2G60L 1RZ8B 3FFCA 2Y7QA 3QVAA 2D31A 3OMIB 4NXSA 4JFQA 5FKPB 1B6UA 2VR6A 2XLLA 4LCWD 2X09A 4ODTH 2RHEA 4BH7A 5JMRA 1K72A 3HZVB 3WFEH 5FYKU 5FOJA 2IGTA 1I1FB 3EBAA 4P5TC 4N6QA 5KBPA 1PZ5B 2R39A 1XCWA 4APQB 3SDDC 4FABH 2GTZA 4Z3GA 2C4FU 4N6RA 4M8QA 1FAIH 2ZICA 4P2QE 2BVTA 1H8SA 1M2VB 3VI3F 4YAQA 1R3LA 3O3BA 4WEUD 4AM0B 1JGEA 4HGWB 4NRZB 2DDQL 4NC2B 3TO4D 1CR9L 1A6UL 4Y4HB 3GQFA 1U95B 4HPOH 5I0WA 1JZ8A 1HXYB 1UYWL 2OMBA 1O75A 3F7KA 1AMYA 1NBYB 4P4KB 2MKWA 1T7WA 1TNMA 3P30H 2R0WH 2HMID 4U3CA 4JCWA 4RGNE 2OCFD 1IIKA 4OJEH 5CN3A 1E4XH 4FKEA 4ZFFB 1MVYA 4RFEB 4Y16D 2WO2B 4BQ8A 4D7BA 2EE9A 2UWEF 1RIUH 3QULB 3EJTA 4XODA 4OZIE 4FNSA 4D7PA 4R7NB 4L1DA 5C08A 2V2TA 2XQ0A 2YPVA 5MEPA 4XVUC 4YFEA 1BREA 4XC1L 3L6FB 3N1MC 3P4NA 4XTRC 1KCVH 4RRPA 3O45B 3WMQA 4YHOH 1XQ4A 3SE3C 2AQRA 5LNGA 1JNJA 1D7FA 1ORQB 1HNYA 3VSVA 3VE0B 3BZ4B 1P4BL 3R19A 4MJ4A 2R69H 5FA3B 2EJ1A 4DQOH 3R4DA 5BOZG 5IR1B 1BPLB 1CDGA 2ZX9A 3TWCL 3BISA 4HJUA 3FMGH 5AVXB 3S4SB 4TLKA 4YIQA 1F5WA 2W9LA 1RUKL 2EXWC 1J8RA 3BAEH 3NJMA 4G9FE 2GUOA 1FHNA 4Y89A 1K3IA 4JRXD 3WFCL 1IGFL 5F7DB 1BBDL 4HCRH 4O58L 1VF5C 2CCWA 5D7HA 4OF3A 4BFNA 1LO4L 2ITFA 5MP6H 4F9LC 5E6IC 3U0TB 5SWQB 1A65A 3MLRH 4KX9A 5GISH 1F00I 4X7SL 2O26U 1A8JH 4UT6A 4PGBA 1FGVL 4M02A 5HGBA 4PGDB 1MDTA 1HWWA 3KVQA 2FHBA 3ROLA 1T7ZA 3W9DB 3KWTA 4IOSA 1DJXA 2HN7A 1FVEA 2F15A 4ZAKB 2FWSA 1D9KB 1GW0A 3AVEA 3MX0B 2XN9E 4J27A 4O00A 5C09D 2H1LM 3BKYL 1VKXA 4P46A 3AT9A 3RI5F 5I5MA 1KYUA 2V2WA 1G6RA 1HL5A 1CXIA 4IIZA 4JM4L 4OZGA 1TKWA 3FT4A 4ELME 2X44D 3H3BC 2F19L 1M1XB 2J8UF 2NZ1A 5E8OB 1NANH 2IDUA 1PD1A 5L2JA 4GKSB 1CBVL 1XGUB 2FUQA 4QIRA 5LLIC 1Z9OA 4Y5YA 4JN1H 3UZVA 3DX2A 4GIOA 2Y9RT 3TH3T 1DEEB 3BDXA 4QRRA 1QSFD 1FO0B 4O02B 3RNQA 3CZEA 3K6SA 5D70L 4YN3A 4KKZA 1CTMA 3HVDA 2VAJA 2ZPKL 4Y19E 1TQUA 4XZUA 2QSCL 2WGNB 2G5BA 3GSWA 4Y5VC 2QKIC 2GITA 4L05A 2WXIA 1GYAA 4JM2B 2NY1C 2EIDA 1FNGB 2A6KB 5F7KC 1ZSDA 4G8FA 4PJEA 1DCEA 5AZ2L 3KZ8A 1U8HA 5HI5C 2GTWB 2O6EA 3AACA 3NSCA 4X7DC 3RL2B 1B2WH 3O4OC 4XH2B 5FR3A 1CL7I 3I6KA 3ILPB 3C5ZA 2NY4C 3W39A 2IWFA 2XNAA 3B5GA 1JWUA 1ZAGA 3IBOA 4K7PX 3FH8A 4FNQA 7PCYA 2AJXH 5IVXB 2YD0A 3NABL 3VX1A 1VADA 4GRMA 2OLDA 2XKNA 5EF3A 3ULVD 2GK2A 4WK4B 3GRGA 3RPIB 3QEUB 3QQ4A 4M3HA 4ACTA 3D0AA 1FFQA 1LO5B 3QRLA 1MFUA 4TL4A 2ZKMX 1ZDSA 1CIUA 2IDSA 1AQKH 4R90H 3PGDA 5I1CL 4UDTB 2MOQA 1IGCL 3BCFA 3BP7A 1AP2A 1PY4A 2OL3B 5SWSA 2EO9A 4R84A 5KZCB 1G84A 3QNZA 5KSBB 2RALA 3U6XS 4OB5H 2JK5B 5HHXL 3NA9L 1WBYA 4Y16A 1FNFA 3N40P 1KJMA 3ARSA 2ZYHA 1NCBL 4PJ8B 1KEMH 3UO1L 2JIXB 1KTDA 1GY2A 4LLWA