1J9TA

Crystal structure of nitrite soaked reduced h255n afnir
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPNLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Alternate substrate binding modes to two mutant (D98N and H255N) forms of nitrite reductase from Alcaligenes faecalis S-6: structural model of a transient catalytic intermediate
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j9tA02
2EIMB 3QJRB 3NP3A 2VW6A 4BWWA 4YSPA 4CSPA 2BHFA 5E9NA 2R7EB 1A3ZA 3FQYA 3IE9A 3UAAA 4G7RB 4YVNA 3ZDWA 4A2EA 2PPDA 3TASA 2VSMB 3V9EA 3FSVA 3N55A 1OCCB 4NERA 1R1CA 4WKXA 5I5IA 1N68A 2GB2A 2OV0A 3X1BA 1XB6A 2VM4A 5B1AB 3NJNA 2VW4A 3H4HA 1JZJA 4E9RA 1OV8A 2HX8A 1EHKB 2UXFA 2RACA 2JKWA 3FU7B 3ASOB 3JT2A 4GP4B 4E9WA 1JOIA 4CSZA 2E86A 2ZOOA 2BP8A 4UANA 4KO6A 4DP1X 3GXUB 2UXVA 1OE1A 4KNUA 3AG1B 4X4KA 1JVLA 1SHXA 1SF5A 2BP0A 3T9WA 4GYBA 2YAEA 2XVBA 1SNRA 1NINA 2W8CA 2X87A 3PAZA 1ZDQA 2HX7A 1W8EA 2FT6A 3FPXA 2EILB 1PZCA 2GSMB 1ZIAA 1ZPUA 2QDWA 5I6MA 3ABKB 1QHQA 2AZUA 2ZXWB 4AI7A 4BWUA 1TKWA 3CVBA 4YSCA 3X1FA 1RCYA 4BXSV 2YAFA 5D4HA 3TBBA 4E9XA 2WO2B 2GI0A 3UAEA 3WI9A 5F7BA 1PY0A 2W88A 4HZ1A 3FPYA 2I7SA 2JFCA 4DP5X 4N8UA 4W9ZA 4JHUA 3FU7A 4PCYA 1M9WA 3OQRA 1OE3A 3FSAA 4AZUA 2OCCB 5TK4A 3CVDA 1W6WA 3KW7A 2WSDA 1X9RA 3PAUA 4GP5B 1QLEB 1AQ8A 4Q89A 5D4IA 1JXGA 1GSKA 2PP8A 3QJSB 1PZBA 4E9TA 2CUAA 2XWZA 2ZONA 4F2EA 2HLEB 3EH5B 3X1NA 1WA0X 3FQ2A 2EINB 2CJ3A 3FYIB 4YSOA 2BWIA 1SFHA 1PLBA 3TU6A 1NZRA 4A2DA 4KO9A 3NSCA 4BXVA 3GDCA 2IH8A 1QNIA 1SFDA 2PPCA 1PLCA 1NTDA 1BEXA 2VM3A 3ERXA 1AOZA 3T6ZA 3WIAA 1KBVA 2FQEA 2H47C 1AZRA 1CURA 3CDZB 3NSFA 1NIFA 2MRYA 1E5YA 4BWTA 1KDIA 1URIA 4KNSA 1IUZA 2XUWA 1L9RA 3NYKA 4GXFA 3AG2B 2IDQA 2AZAA 3CVCA 3PPSA 2XU9A 4YVUA 4YSTA 1WA1X 3QJTB 2IDTA 3X1EA 8PAZA 3AY2A 3QPKA 3T6XA 1E30A 3SBPA 2GHZA 4QKTA 1FFTB 1WAEA 1BYOA 5I5JA 1JVOA 2GBAA 4KO5A 3X1GA 1HAWA 2OJ1A 3ABLB 1CUOA 3EHBB 1BXVA 2FQDA 1WS7A 1XB3A 5B1KA 9PCYA 1AZBA 2Q5BA 1JZGA 1EZLA 1NIAA 3EH3B 1I53A 2TSAA 3U25A 1ZIBA 4DP7X 3AG4B 5B7EA 3S3CB 3D12B 3NJJA 1PF3A 5EHFA 1ASQA 1WA2X 7PCYA 1PNCA 3QQXA 1X9UA 2IAAC 3MX0B 5PAZA 2PPFA 1PMYA 2PCYA 1IBYA 3CDZA 2HZHA 1AG6A 2QT6A 4E9VA 3DIVA 1ASOA 4HAKA 2NRDA 1RZQA 2DWSA 2Y69B 1ZDSA 1FWXA 4A2HA 2DY2A 2Y1AA 3QJVB 4M4RB 1J5CA 1ETJA 4HCIA 3SQRA 2P80A 1J5DA 3ZX1A 3PLYA 2CAKA 2TSBA 4BDVB 3T6VA 3WNJA 4EF3A 3OMIB 5PCYA 1AZNA 2PPEA 4P5RA 2DV6A 2R7EA 2AVFA 2YAPA 3NJKA 1JZFA 1TU2A 1ET7A 3FYEB 2GC7C 4YL4A 2B3IA 3WKPA 3NJIA 5ANHA 1GS6X 3FSZA 4RH4A 1J9SA 1TEFA 1NPJA 1AS7A 1KGYE 1L9OA 4YSQA 2I7OA 1AZUA 5I26A 1OE2A 1PCSA 4BK5C 4QLWA 4E9QA 4YSEA 1AAJA 2IWKA 3HB3B 4HALA 1IKOP 2IWEA 1BXUA 3FSWA 4AKOA 2H5UA 4TXVB 3CG8A 3UGEA 2HX9A 1V55B 2X88A 3ABGA 4JHVA 2YXVA 4NB7A 4E9SA 2QPEB 4HCFA 1L9QA 1OF0A 3DTUB 3FU9A 1XB8A 1RZPA 1M57B 5LDUA 3ZIYA 1KCBA 2HXAA 1KBWA 1NWPA 1ASPA 1ADWA 1GYCA 2UX7A 4BDVA 5B3SB 4FA7B 2MTAA 2EIJB 1PNDA 3BQVA 2AFNA 3S8GB 3FT0A 1GY2A 1A65A 5I6NA 1AS6A 4YSUA 5I6PA 3IN2A 1SJMA 1IBZA 2P80D 1MZZA 2IH9A 1PLAA 1E67A 3S8FB 1A4CA 3TBCA 1J9RA 2BZCA 4JKNA 2FQGA 2YAOA 3JTBA 2PP7A 4YSSA 1F56A 1IC0A 3X2QB 2FNWA 2J5WA 1J9TA 5FC9A 2XLLA 3PAVA 4MFHA 1GY1A 5I6OA 3OMAB 1L9TA 1NIDA 3WNIA 5I28A 3T71A 1W6LA 3HEIB 1MG3C 1JZIA 3EH4B 5I5MA 5F7AA 6PCYA 2PP9A 1ET5A 2J57A 4DP8X 2BWDA 2DYRB 1E65A 1L9PA 2DYSB 1AIZA 1OCRB 4YSAA 1FA4A 2AANA 4DP9X 3UADA 2XX0A 4GP8B 2QDVA 4UAHA 1AACA 4HCGA 3BVDB 2UX6A 5B1BB 3S3BB 2BW4A 2FT7A 1T5KA 2J55A 2YAHA 4N4YB 3V9CA 1GS7A 2PLTA 1L9SA 4ZK8A 4G7QB 3UABA 1ILUA 2CALA 3L45A 3UACA 1TEGA 1ZV2A 4DPBX 3ASNB 1A8ZA 3NT0A 5A7EA 1BXAA 2XXGA 3OMNB 5B7FA 1MZYA 1HFUA 2IDSA 4DP0X 1GR7A 1NIBA 1OOWA 2VMJA 3CZUB 3AZUA 2VSKB 2XV3A 2PPAA 4DP4X 4A68A 4ENZA 2UXGA 1WS8A 4KOCA 3PXLA 3WG7B 4K9JA 1NDTA 1AR1B 1OCOB 5B7MA 2XV2A 4A2FA 4DPAX 4YSDA 2WO3B 3FQ1A 2A3TA 3WKQA 3NJHA 2EIKB 5AZUA 2XV0A 1BQ5A 1MG2C 2VW7A 1CYWA 3NSYA 1ID2A 1NICA 3OM3B 1AZCA 4NAJA 4AX3A 1JZHA 1PZAA 3DKHA 7PAZA 1PAZA 5I6LA 2BO0A 2FTAA 2GC4C 4HHWA 3RYMA 3QJUB 3SBQA 4AKQA 2Q9OA 3C75A 2FT8A 1VLXA 3IEAA 4KNTA 1JERA 3ABMB 4G70B 3NP4A 5D4JA 3T6WA 3MBWB 4M3HA 4A2GA 5B1JA 2YQBA 2UXTA 2BW5A 2YXWA 2FQFA 3ZBMA 1DYZA 3FS9A 1BQRA 1E5ZA 1ET8A 6PAZA 4DPCX 3N2JA 3OD3A 2YAQA 4DP6X 4PAZA 3KW8A 4KO7A 3NSDA 1BQKA 3H4FA 1MDAA 2DWTA 1KCWA 1JXDA 4GY4A 4DP2X 4G72B 5I6KA 2CCWA 3EF4A 2JXMA 5IY5B 1B3IA 4WTQA 1AG0A 1V54B 4P5SA 4YSRA 3S3DB 3IN0A 2I85A 1J9QA 1AS8A 3AG3B 2FWLB 1SDDB 1BAWA 1DZ0A 1GS8A 1SF3A 1NPNA 4KOBA 2CBPA 3NJGA 1GW0A 1NWOA 1V10A 2J56A 4A67A 2N0MA 4W1TA 4G7SB 4A66A 4E9YA 5TK2A 3NJMA 5B1JC 1ILSA 3FU8A 2QPDB 1XMEB 3GYRA 1KV7A 2BZ7A 2XXFA 2ZWNA 2IDFA 1JXFA 4G71B 2HRGA 4L0PB 1BYPA 4HHGA 2GIMA 1JZEA 5AFAA 2VN3A 1CC3A 1UATA 4AKPA 2HRHA 2XYBA 1A4BA 1A4AA 1KDJA 3SBRA 3NJFA 1HAUA 2BP8B 2H3XC 1OCZB 3TA4D 2YARA 1NIEA 2PCFA 3IBOA 2BP0B 2FJSA 1SHWA 2YAMA 4HIPA 4UF7C 5AKRA 1M56B 4F2FA 4Q8BA 3AW5A 2IDUA 3QJQB 3G5WA 2XX1A 4F7KA 1AANA 2B08A 3H56A 1YLBB 2LLNA 3PCYA 1CYXA 4FAAB 1RKRA 1SDDA 2IWFA 1N70A 3NJLA 1KYAA
chains in the Genus database with same CATH superfamily
3MLRL 2J25A 5SWZD 4PRBA 3X11B 2F19L 1SLXA 1YC8A 3VGDA 3ARBD 3HMWL 4ANKA 4F93B 1RUKH 3HR5B 4BE6A 4G7RB 3WFEL 3SJVE 1XCWA 2VUYA 3Q3GB 4A2EA 4UOQA 2GTZA 2B9AA 2BSBA 3PWPB 1IEAB 1HH6A 3PQYE 1HSAA 2NY0C 4LCCC 4WV1C 1QR4A 2HFFA 3HC3H 2VM4A 1KB5A 1HZHH 2XA8L 1Q9WA 1OTUC 3RVUD 1R5VA 2OCFD 1U6AL 3IDXH 5C08A 2NY3D 3CU1A 1WFTA 2Q1EA 2QR0B 3ECQA 2I5YL 1EK3A 3MBXH 4LSDA 3O8XC 1UQSB 4KO6A 4LPUA 3H3BC 2JJTA 4DP1X 2YEVB 1J05A 3HG1E 4ODBD 1TETH 1OAQL 4KNUA 4AVKA 5KJRL 3CDCA 2WNKA 5D6CA 2ZG1A 5C71A 3SKNB 4F8OA 2WMPB 3ELQA 4YDLB 2VLRD 3CZNA 4HPHA 1QKZH 2WXLA 4ZT1A 3P77A 5T1DL 2D7TL 4ODSH 3RWDA 4Q9CA 3FPXA 4NQVA 4UQDA 1B0RB 2XV6B 1T66D 2G75A 4NWUL 1BD2B 3D50A 4WEEA 2X44D 3QXAB 3TONA 4ZTPL 2F08A 3T8XB 5EU7C 2DQCH 1QO3A 2C5DC 2O5ZH 1B4LA 3BWAB 1AQKL 2WC7A 4H2AA 4KNQA 4L4VE 1II4E 4XCNA 1JXKA 2DRUA 1DQJA 2MFNA 1UYWH 3FHEA 4WU7A 5ACZA 5BVJA 4O51B 4L3ED 4AYFA 3QA3A 5T5NF 1U41A 5CP7A 4YN3A 1UEYA 3ATDA 3F2LA 4F57L 1KGXA 5LCVL 1WT5C 3UPCA 1DSWA 1QASA 4DZ8B 3VFRA 3N40P 4PRPD 1TZGH 3V4PA 2JSFA 1JGDB 1P69B 3RNQB 2G9HB 1ZWIB 3FT3B 4L8SC 5T1MB 1IZJA 2HLFD 2WB1A 2FO4A 2W1NA 3B9EA 3FT1A 2XWEA 3UZQA 1MSPA 4RFEB 5CSGA 4JZOB 2Y7QB 2FX8L 2CJ3A 3DXAE 1AP2A 2FD6L 2G2PA 2OKMA 3CFMA 4X9HA 5C0DB 3DPBA 3JWDH 3TBVB 2R2BB 1CF8L 4MXVE 1AKJA 1K4CA 2WIIA 4HDIA 2C1PA 4L4TB 3TEWA 3FT2B 1RVFL 2ZPKH 2CRZA 3M07A 2KZKA 3BSZA 3NCYS 3GDCA 2VDMB 3SCMC 1SFDA 1BVKB 1SM3H 3EOTL 4WIQA 3FAXA 4DQOL 1IT9L 2VXSL 3WIAA 1FDLL 5GJSL 2D4DA 4F37F 1PD1A 2UZXB 4NO5B 5AVRB 5DJCB 5G2NA 4IKJA 2GBTA 4BEIA 3A4AA 4I77L 2IDQA 1JPFB 3GMPB 5TDOB 3PNWA 2CA4A 2XT1B 1UWXH 1G94A 1XGTA 2X53A 3ZKXB 2PR4H 5CGYD 4ALAC 3E3QC 4UI2A 1BYOA 3BP4B 4UMGA 2GBAA 4AM0Q 1CFNB 2E3VA 5IWLA 3U4AA 4IBVA 2XG4B 2CO1A 5T1LA 5K9JL 4TQEH 3INUL 4R5VA 3W1ZA 4KQ3H 3K4AA 1IC5L 4G7YH 1XB3A 3JWDC 5MEQA 3QJFB 5T3XE 1N5YL 3CZFB 1UT9A 2HFGL 1E4WH 1MH5A 2VXVL 1LMKA 3KLKA 4OM0L 1DBBL 4EXKA 2NNRA 4V1DE 1Q4NX 3G6JE 3VNZA 4X6DA 3WN5A 1UC6A 1UKQA 2AGJL 1UKTA 3QQXA 3NZSA 2IAAC 5FOBA 3RWIA 3QK0A 2WLIA 3RNKB 4LIQH 1A3LL 2ZAIA 2RCSL 5AQ0A 5E6IC 2WXGA 1WFMA 3ZTCC 4XHJD 4WK2B 1SPDA 2NSXA 3UG3A 4CVXB 5F7DA 3HC2A 5J4MA 4BM7A 5IWLC 3ARFA 5AVUB 4N5ED 4ANWA 1TO4A 3VM5A 4FNSA 4NSKA 5L0QC 2EE2A 2VR7A 4K7FA 3LQAC 1MI5D 3U83A 5FYJE 2AK4A 4GRWB 3ZX1A 2GY7B 4Z7OB 3NCYP 3UEZA 4BDVB 3OMIB 1PZ3A 5J9PB 4F24A 2YJLA 3H9SB 4YBHA 5HPMB 2YAPA 3MV7B 1ITBB 2LAGB 3C6LA 4K23H 43CAB 3DHPA 3TJEH 3WN5C 1FJ1A 1ONQB 5I8EB 2FZ3A 4PJEA 4RX4A 3LEVL 4G42B 1LO0H 1TJGH 4BQ8A 3NJIA 2MHAB 2A4EA 5JXAH 1UM5H 2C9VA 2QADB 1JV5A 4J3BA 4NQCA 4PG9A 3KLLA 2FEDD 1BSIA 3VA6A 4ZXBB 1WIPA 2YPKA 4HUXA 5DURD 3TPUA 2LU5A 5EZOL 3LS5H 5FHBL 2A4ZA 3ARFC 4F7TA 2WLMA 2OK0L 4UTBL 2ILLA 3PAYA 2PUQT 1AGFA 2EDMA 5K9OB 5D4QA 3SE3C 1XD1A 2JTYA 3P69A 3BRDA 1KN4H 2YPVH 1Y18A 4XCCH 3BQUB 3RFRA 4R4ND 1CXLA 3QEGH 2EO7A 1M1XB 2IPUG 3EOAA 3KBFA 3ZDZF 5FM8A 1KCBA 1FBIH 3VXRD 4LRNL 4UAOB 4N0FB 3CFEB 2Y9RT 1BZOA 3B7TA 2W9DH 5K39B 5JR1H 4GKOA 4NC2B 1GY2A 2I9LB 1PZ5A 3I50L 4BKLA 3HPLA 4WDIB 4Y16A 3IN2A 3LD8C 1ZLSL 1NL0L 1UXMA 4FXKB 1EDHA 5CEYB 4F2MB 1F90L 4M6OH 3Q6FB 2ARJA 1YMME 1Z9OA 4X6CE 1ZHNB 3PL6C 1N0LB 3QQNA 1U8CA 4PVBA 2YAOA 2PP7A 2HJFB 4W81A 4PW3A 3LKPB 4H1LH 4KPHH 3W5MA 2IAMB 1IC0A 2IOMA 1HILA 1KPRB 5D1XD 5FGCE 4G80A 5LAPA 4KQ4H 2DLFH 3HHRB 3B8YA 2ZAHA 2WXMA 1T21B 4FMVA 4OLWL 4GKZB 1QSFB 1X7QA 3EH4B 5F9JA 1FQ9C 2VZ3A 1YY8B 2VABB 5IB3A 1ODAA 2DWYA 4LVOC 1S9XA 5LGHH 3RJDA 4JVWA 4IBYA 4X9FA 4PRHE 2AV7B 4I0PD 3TL5A 1TNNA 5E8EB 1S9WA 4XMZA 2R1YA 5J8OA 2HVJA 1TLMA 1ZA6B 1D3CA 2HRPH 3HNSH 1MJJB 4OZIB 5CHNA 5DRXA 5SX5K 4RETB 4JW3A 3B2UD 5E8OA 3ENEA 4O2FA 3S34L 1R33A 5BRZB 2WZ6A 4JFXB 1QPPA 2DD8L 2G4EA 4ZS6D 3GLAA 4NENA 2NYYD 2MQGA 5LDSA 2AV1A 1T5KA 2J55A 1ECZA 3EO1A 3KPMB 4L2LA 4PV1C 4AC4A 4M7ZB 5DC9B 3G08A 3BZ5A 3BEVA 2CDEB 5KG9B 2UVEA 3BEWA 3SE8L 1MCHA 4Y8AA 3BVNB 4HIHA 1HI6B 1A8ZA 3EYQC 3KXFD 4ZUVB 5DC0A 1MFEH 5K1NA 1ETZB 5K59E 4Y1SA 5DD1H 4MNHA 3NDYE 4J2XA 1HFUA 2E6QA 2OR9H 1U2CA 3CH8A 3DIDA 3VH8B 4I4WB 3TP4A 1NIBA 1U95A 4M5ZH 1M1SA 1VFBB 3AZUA 4Y4HA 1IKNC 3TT3H 1LO5A 3N44B 2JJWA 2EH8H 4LLDA 3FRUB 4M4PA 3T0EA 3U4EA 1JWUB 1UA3A 3PXLA 5AL0A 1F6LL 1OCOB 3ZUCA 4WFFE 5FUOL 3S0PA 1SOKA 5AYQA 4Y19E 3IFOA 4MB4A 3MJWA 4NCC2 1CXKA 2DBLL 2FGWH 3TBYB 1KWKA 1CYWA 4HEPG 1N3NB 2WNWA 1ID2A 4RWHA 1JAEA 2Z35B 1HL9A 2X4SA 4XTRD 3GLEA 2GJJA 5C97A 1FORL 2YGOA 2CQVA 4GINA 3UOAB 2V5MA 5ENWB 4TL5A 4Y5VA 2XG5A 3QJUB 1T2QH 4Z95H 1XIWD 1R47A 3I2CH 4M7KL 4UZGA 1BEYL 4BYHA 3UTTD 3FDWA 1S3KH 1IAOB 3H9ZA 4M03A 4MSWB 4Y4HC 4MXQC 4G70B 3EYUL 2PW2A 4AM0B 3WNMA 3QUZA 2MCPL 2E0PA 3PJNA 4G8GB 3PWJB 2AXHA 5T8IA 5EIIA 2CGZA 1ET8A 2F5AL 5IMMA 1T7VA 4PGEB 4LSPH 4X6FB 3VACA 3TURA 2Y7LA 1B90A 1B3JA 1E3XA 3M17A 1WZMA 3BUDA 1HQ4B 1D5MA 4TTDC 4FFZL 2VLKD 1GC1C 1IAMA 3LRMA 1K85A 3QXVA 1AQHA 5BZZA 1ZTXL 2DQMA 1RPKA 4I89A 1T4WA 1MRFL 5DMGC 3RWGA 2WVUA 1HZKA 3TV8A 5EU4A 1IC1A 2F54D 3VFOB 3A3YB 1FZMB 1JMXA 4XP5H 1YYCA 4Y5VC 4E41B 5JHLL 3FUNA 3BKJL 1W0WB 2OM5A 4P06A 3OWEA 3CSFA 3FO2B 4KKAC 1MELA 4YMPA 5DGRA 1NWOA 1C08A 2H32A 4PGDA 4PWJA 4PUBL 5HHPB 5JHDD 4GSQA 3O6FA 3VXUA 3HAEB 5TDNB 4HLJA 3U1QA 2JNZA 3NN8A 3MOQA 3UIZA 3CN3A 4NM4L 5AENA 5E5MB 4MX7B 3GDBA 1WHOA 2OTUB 1FVDA 3DGCR 4L29A 2FR4A 1YJDH 5SX4I 2FIKB 2FBJH 2WV3A 2YXMA 1KELH 5AOIA 3ARRA 3GS7A 4PP1D 3FL7A 3BKYL 1JFHA 4JO8A 4APXB 3NPZB 4NI3A 2B39A 5DS8A 3F7LA 3AQYA 1XD0A 5HHXL 4OV5B 3P11L 4QRRA 4UU9A 3IMUA 2G2RB 1HN1A 2NSQA 3QUYB 4U6HB 1G6RA 4Y7MA 2BP0B 3UYOD 1Z9LA 3QDGA 2RALA 2LW3A 4RA3A 1N4XH 5ERWB 2PXYA 4MJ5A 2BNQB 4PB0L 3H56A 3TVMA 5E7BA 3ZO9A 2F2HA 3PCYA 5AYTA 4P4RA 1F2XK 4XPAH 5KN5B 3U30C 1R4XA 5D9SB 2VW6A 3EBGA 3IYLW 2R7EB 4O9HH 4QCIA 1NC4D 4UV4H 1CYGA 1T83A 2JF1A 4Y2NA 4APQC 1CD9B 1GGCL 1I85A 1MNUH 1RHFA 5DJDA 2YN5A 1DVFA 1L0PA 2WQAA 4TUJB 5DRNA 3N55A 5F72S 3LEXA 2P5WE 3UZEC 4NPKA 3GJFH 3MRIB 2HLAA 1IKFH 2WWMD 2GCYA 2W95A 1QR1B 1A9EB 1OAZL 2PWEA 1KACB 1Z9MA 1MCKA 1MQKH 4FABL 2N59A 1NUFA 5GS2D 5IFJA 3PU7A 1XF4A 1MREH 3P4NA 4LK4A 1MWAL 3TVMC 4X83A 4D9LL 3T3ME 2CR3A 3ZDZB 3EFDH 1SEQH 3MREB 4KI5E 1J1XL 3CHPA 3HBZA 4QRTA 4MXWH 5I17A 5KSBF 1YEIH 2X7LA 1SNRA 3LEYL 3QQ4A 4U1HB 1MIML 3O6ML 2OA9A 2O6EA 5CP3A 1FYTD 3O45B 1XF5B 1T83C 3D0LB 4Z7UB 3GBNL 5C7XH 4WTZA 1PCXA 4H8PA 1U0QA 1I85C 1HTYA 4JZJA 2NUTB 2FB4L 1VPOH 1FFNB 1JYXA 5CWSB 3OKMB 1EAJA 1NMBL 1N19A 2K9FB 3KPLB 3MRMB 1BECA 2O93L 4LOUC 5BS0B 2CPUA 4XRCB 4GXVH 4NNYA 4ZO6A 1EPFA 3ULSA 5F7KC 4OBSA 2F53A 5TE4H 5IW6B 3BPCB 2FX9H 5IP4A 3WI9A 3B9KD 5KTEL 4WFGE 3B1UA 1TTGA 2DEWX 5DMKB 1KLFA 4PJ8B 2E56A 1QAWA 4GW4A 1E7VA 4Z0XB 1DP0A 4G5AA 3L3JB 2AJ3B 4HFWA 5TK4A 2XPYA 1MCPH 4D94A 3TJHC 2HG5A 3II3A 4FC3E 2ERJB 3CC5A 3BP7B 4AMWA 4EUPA 3PAUA 1QSEB 2EAEA 1AXTH 4JUTA 4JZJC 4P2RE 1D5ZA 1CK0H 2WANA 3K1KC 1PZBA 1J8HE 5HJBA 1GIGH 5CEXB 3IDIB 5DLML 5I0YA 1I7TA 3GXTA 2DBJA 3LZFH 4UT9A 4OH2A 3DX0A 4XPGH 3L9YA 4AW4A 4W9HC 2IBBA 4YFLF 4LASH 2D31B 1SFHA 4QAWA 5GSVA 3LXUX 5EF0A 3FB5B 4Q74A 3EG9B 5HHOE 1AR2A 4HSAC 3KGTA 2DIAA 4QRBA 4X7EC 2EDFA 3UJJH 1CU4H 4R90L 2FJHA 4BXVA 4PU2A 4JM2D 3IPFA 2VRAA 4KRPB 2OAAA 2PWHA 3FO9B 15C8H 4U1GB 3MUGB 4FX5A 3FT4B 2OI9B 2GK2A 2K8MA 4JFFD 2R0LL 3LIZL 4GFXA 4ZTOL 2M83A 4TVPH 4CADA 1NAMH 2AK1H 5IF0A 4XPFH 4HJJL 4BWTA 3FCBA 4UQEA 1SZNA 4ZNCD 1R3LB 4Y5XC 1P7HL 4PJDF 5HVHC 4NRYB 2ZF9A 2J71A 1S8DB 3QDMB 5F9DC 5FO7B 2DWEA 1FH2A 4AZ8A 1OW0C 3APCA 4ZRGA 1E2ZA 1DQML 3T1FB 4GUCA 4FZ8L 2NX5D 3ZHFA 4EZJA 2FYYA 4M43L 1HAWA 3GI8L 3PP3K 1JFQL 4GUPA 1JPSL 4NUGH 4HKBB 4U1JB 4FTVB 4QXTB 3EHBB 4AENB 4HV8B 1UB5A 3FHAA 1NKGA 3LTVA 4GQRA 4NC1C 5KS9E 3D4GA 2AJVL 2X89D 4HYTB 4F15C 4ELDA 4M1GH 2ZYHA 2NDGA 5BZDB 1PF3A 2WIMA 5D1QA 4ZJ9A 4HWBA 3IT8D 5BV7L 4TUKL 4UOW0 1RV6X 4L1LA 1VAHA 1XSOA 4JO2L 4XMTA 2PPFA 1EEYA 3QH3A 4H20L 1AG6A 2XACC 4HS8H 4I9XA 1LWHA 1CICB 4XE0A 2E9IA 3C6SB 4HOWA 5DD6A 4AQ8C 5GZOC 3AC0A 2DWSA 5HY9A 2BIOA 2QSCH 2Z1KA 4YIQB 3NTCL 1I7RB 2HKHL 4OSUH 1I3RB 3HRZA 3SKMA 3CFDB 3GTNA 4AE0A 5DSCB 2IANB 1SOSA 1PZSA 1NBZA 2BSTA 5EBLB 3MUZ1 3PYCA 1MW1A 2JCCF 2JXMB 2VC2B 4FNQA 1LVEA 3WFDH 2R1XB 4OCYH 3Q0HA 3S35X 3LZLA 1MQ8A 3RL1A 2E76C 4MNQE 4L8BB 4RAUB 4FA8A 5TF1H 3FSZA 4S11A 5AB0A 5KAQG 5LBSL 2J3SA 4YSQA 1L9OA 5C0FA 4W6YB 4JRYB 2AKRB 5IQ7H 4TLTA 3ZSSA 5GISH 5I5RA 3MX0A 4UUJB 4NP4L 3H0TB 5J1AB 5C0JB 1IKOP 1IGFH 2IBZX 4QHKJ 2ZAGA 1MVFA 3HRZC 4JPIB 3TNNA 4D9RE 3C9NA 3UGEA 1U92B 4C56E 2IWGA 2ZCKL 5E2WL 4XODA 4E9SA 3T3PE 2ZXGA 3IAPA 5IROC 4Y2DD 4XN1A 1BLNB 1ZT7B 1G7LB 3B37A 2AMGA 1NCJA 3QI9B 4ACPA 3FONB 4XBGA 1GYCA 4TNWK 1NOLA 3CBKB 5D7HA 5B3SB 3U46B 3ETBF 1KYFA 4XWOD 3OG6B 5E9DB 3VXSA 2YLHA 3ECWA 3GMNA 4HUNB 2X6UA 2KT6A 1Z3GH 2CO6A 2LFEA 4PJ5B 3GBML 4UILL 3FQTB 2AQRA 3F7VB 2NT1A 4KDVA 3FUMA 5F89B 1PJ9A 4OZFB 3OZ9H 4MNGB 1P9MC 4I2XB 3V7AG 4PREA 4ENEC 1J9RA 3IGFA 4KTYA 4MDRA 5C07E 4HKJA 5MENA 4ZSOE 4HF5H 4YHKL 3LKRB 4OTXH 3RTQB 1CR9L 1ETB1 3SYAA 1QLEH 3U9UB 2X6MA 3WTUA 3EO9H 3GMMB 1N26A 4OF6A 3KR3H 3EGXA 3KLSA 3C5ZD 4KDTA 3K2UH 4QXWA 3NH7L 4Q14A 3KLAB 4AQAB 3UBGA 2HT3D 3K2IA 5F7AA 3SDCB 4HUVB 5IMLB 3QO0A 5DZPA 5HYIA 4BE5A 2Z4QB 2YA0A 1XCTA 4ODWA 4G3YH 2Z4TA 3IE4A 1CGYA 5C0AB 3N42B 3WUWG 3WXWL 3ZK0A 4CUCA 4ZD3H 4YHOH 4HEME 2UYLB 3MRNA 4YUEH 1BXXA 4PLNC 1Y6NR 1SQ2N 2Y24A 5E2VH 5JPMA 3OAZK 2W80C 5TQ0H 1ULVA 1BP3B 2IQAA 3HFMH 5KANG 2O26U 3GZPA 4PJXA 1KMGA 4V11A 1AO7D 5HYQB 2F6AA 3OB8A 1D9KA 4TQPA 3RZCB 3V9CA 4Y1AE 3TF4A 2OTPA 1ILUA 1MJUL 5CJQH 4JRXB 3TX4A 1IE4A 3L45A 1T04A 3L4UA 4XN9A 4A1RA 4MJIB 4Z78B 1MAML 2ADGA 3KL5A 1HNGA 1T5XB 4MMYB 1FNSH 1SXZA 3AS3A 3V6ZA 1DUYB 1KPVA 2WN3A 1HHJA 3G9VA 4LP5A 3A6CL 4KGLA 1KOAA 4MHHG 5E6YA 1RFDL 3JV4A 3VUAA 1ORQA 3LVTA 4AT6B 2X3AA 4I1RA 4YDIL 3FTYA 4IRSA 1A3RL 4J12A 4J3TA 5D2NA 5LCVA 3VXNA 4CNIB 1KWGA 1ORSA 2XV3A 5E2UL 3DOHA 3P3SA 3BPOB 3QDJE 3RVXC 3LZRA 3SKOA 2CHDA 5JPMC 3BVUA 4ERSH 2DQUH 4DUVA 1OCWL 2CHNA 3BO8A 1AY1H 3NEXA 2IIJA 2A3TA 4OJYA 2QELA 1R3KA 3DJ9A 2OMVA 4DGUA 5F1SA 2HVKA 3WY4A 4XP9L 4AX3A 3SDXB 1JPTL 4R84A 1PZAA 5D1ZC 2NY0D 4CRPA 1X7SA 1IBBA 3P0YH 4Y2OB 4B9KC 2BO0A 5HYSG 1G7IB 1X5HA 1BDYA 1LO2L 3MRHA 1P7QD 1YNTB 3QULB 4NZFA 1DBJL 3RX7A 1ZT4A 2ZE0A 4IU2B 3WL9B 1OTUD 1C5BH 1IFGA 4AKQA 2DEYX 5BUGA 4N9OB 2ZICA 3P3UA 3VSQA 4X4XB 2DLGA 1A1OA 5AUMA 3O8XD 5F8QC 3FFOA 3QEQA 25C8H 2OXGB 2UY6B 4O00A 5G55A 4TULL 5DFAA 4UQ2B 3RGVB 4PJHF 4LSSL 2B8OT 4P5KB 3W56A 2AEQL 2KLSA 2X1OA 4K2UH 3TTYA 5J11C 2EC9T 4P48A 5DRZB 3MVSA 5ICZA 4HU2A 3TFKC 4M8VA 4ABQA 1BQKA 2JK5A 4BELD 4Z7NE 4TKWA 2IPKB 2Z8VC 4GY4A 4NRXB 4YPGA 5L2JA 2YGPA 3CK0H 3EF4A 3O9WB 3U4BL 3FTXA 3BIBX 4G43A 3VTMA 4AEIL 5D7SH 1HDMB 2EUWA 2O5YL 1E8YA 3K71B 1BAWA 3WD5H 2B59B 3RJOA 3ZHNA 3WIHA 4R4FH 3RWFA 4WHCA 1IX2A 4NLHA 5D7IB 4LHJB 1I7ZA 2QGBA 5LGYA 1YNLH 1PAMA 1MY5A 2VT0A 2GQHA 1JHKL 5F6HI 4ZDHA 5SWSA 1TZIB 2Q8BL 1ZA3A 3UBFA 1F3JA 3QJHB 5B3JE 1NFDB 5FA4B 4K71C 2R69A 3TWCL 5C8JA 4W9DC 3W9EA 1BYPA 4KV5F 3MBWA 3H2PA 3FUJA 2MKLC 4DTGH 1MVUA 3OKDB 2VJ0A 1G7HA 2J8UE 1QBBA 3VG9B 3I6KB 4L4JA 3U6XS 3REVB 2R0ZH 4ZFOA 5EV7A 3T77B 2YKLH 4ANVA 3ARGA 5ISZA 3FO1B 3MNVB 4PV8B 5GGUA 1MHPL 1BZ7B 1HINL 1RZGA 4QYOB 5JO5B 1GGTA 4AY0A 2A9DA 5HHNA 4XNQA 2F68X 2N1TE 3HBGA 3CHSA 4Q8BA 3KH4A 3KGSA 4QHNB 1AANA 3QNYB 4QRQB 2ATPA 3VRJA 4ZUUB 3CQQA 4LPWA 2AJSH 4D0DA 4C54A 3QORA 4LSRH 3N91A 2Z9TA 3SCMD 4PS4L 2XCMC 3V4VA 2O6DA 3HB3C 4DZBB 1KCSL 5DK0A 5JW4R 4PTUA 5J6GA 5IEKA 5C6TL 2DJSA 5IOPB 3OXRB 5FV1L 3DX9A 5JIDA 2WSPA 1TVBA 3D5OF 1R3HA 2AF2A 5DF0A 3ZTJG 5E1IA 4EZKA 4GAFB 4UTBA 1HHHA 5F1NB 2ROYA 1H5BB 2HFEA 3ARGC 4NP9A 4R3SB 5AWNL 2HX8A 1RY7B 4PJIB 1DQQB 1AGDA 4RWYH 2R2HB 4MRCA 5DD0H 2Q76B 5LO7A 1BQHA 5IEHA 4R7VA 1U8JB 1K8IB 1AKJD 1G6VK 2K6YA 3MO1B 1JNHB 4WJ5B 1KYOJ 1HSBA 3PABA 5F97E 5F0PB 4W9JC 2L3BA 2CR0A 4BSVB 3P73B 5JHBA 1I4FB 1M2OA 3CFQA 5FHAL 3KVPA 2E7HA 4D3CH 3LN5B 4QRUA 2VN5A 3K2MC 3KPSA 2WUBH 1QABA 4LCIL 2OYPA 1ZK5A 5JQHC 1YO4A 5EZJB 1EGJA 3RGHA 2VDLL 3MA9H 1PZCA 4CILA 4OD2A 5FPIA 3QG7L 4PR5B 3WO4C 5FA3B 1A7PL 4IHOB 1DBAH 1ED3A 4WEMB 1SHMA 2BDNH 1C1EL 1IJ9A 3KXFB 1YEGL 3OHXB 1PVHA 5E6ID 3L3DB 2AQ3A 1G9EA 1IBGL 1RCYA 1U58B 1FVCA 2H9GA 5DEGA 1C8QA 2WO2B 4FG0A 3LNHA 2VERN 1OGPA 1QTSA 4LCYA 1XZ0B 3Q7JA 3MOAL 2JB5L 4XXCA 2QVIA 5GGQL 3NBNA 2DTMH 1F45A 4OLZL 1A6AA 2H26B 4Z3HA 2ZOWA 3NA4A 5FYLL 2XA3A 3HNTH 4IRJC 3STBA 1R0AL 1NEZG 2WUCL 3OQRA 3FSAA 4AZUA 3TEZA 3UO1H 2P5EA 3CVDA 1H3TA 4HWNA 3UJTL 3T2PA 5KVGL 1DUZB 4RNRB 4GP5B 2R59A 1AD9B 4Q6IB 3FC8A 3GO1L 2LTQC 2CUAA 2XN0A 4WU5B 5GQBA 2QQLH 5MP6H 3RUGE 2YRPA 2YRLA 3QUMB 3VWKA 5HYJB 5J12B 1MRDH 2R56L 2G0KA 1AGBA 3MV8A 3QNXA 3HE7B 4NZRL 4L4TE 5CO1A 4YZFF 1GGYA 1KLUA 5HGBB 3UPRA 4GG6F 1JZ5A 1X7TA 4EQ3A 1GVIA 2NQ3A 4O02B 2QLVB 4F8TA 4NKOA 3ARFD 4KY2A 1FL6A 1NZRA 2OTWB 3MNWB 1W72B 1PY4A 5I16B 3DOSB 3GSNH 4IRZH 2H0FA 4LGRB 5EH1A 2AK4D 4XAKE 4HIIA 2QMKA 1O75A 2ZOLB 5GJTL 3TO2A 3F12A 1CE6A 1W15A 1KF9B 2GFBA 3PGFL 2OJZL 4FMKA 4JHAL 3KH3A 4W93A 5E00A 5H94A 5T3ZL 1JHLH 4HISA 3C6LD 1BJ8A 1UOKA 1URIA 2CDFA 3EJPA 1QNZH 3NYKA 5HGDB 3MRKA 4RX4D 5DU7A 5IQ9B 2EDYA 1DCLA 2C3GA 5IVXF 4NQCD 2EDRA 4NKMA 4GUQA 2EC9U 1TJIH 3V95A 4IGBB 4WW2B 5J0BA 5FKAA 2GHZA 4CL7A 1KEGH 1R46A 3SGJA 2N56A 4R5TA 4AVHA 1PG7X 4K55A 2GITA 5BZWB 2VDRL 3D4ZA 3FOMA 4J3SA 4OD3H 5D5ME 2XWBA 3GGWA 3KPRB 2FQDA 3PL6D 3ALXA 3B1TA 5GIRA 3D7PA 4DEUA 4P3DA 3PGCA 3AACA 5GS0H 3FQWA 4UV7H 4KXZI 4EI5B 4PJ7F 1F2QA 4YDJB 5E8NA 3RDTA 5C0BA 1I8IB 4RMWA 1F4HA 1HIML 3ARXA 3HC0B 3R7RA 4HUWA 4F8QA 3DNKA 1CD1B 1EO8L 1U8HA 2OPCA 3ML9A 4RDQF 5DFWH 1CL7H 4J3WA 1PNCA 2OSYA 4AMXA 3KZ8A 1PMYA 2PCYA 5DUPH 1P4UA 4BZ2L 4KX9A 4J6RL 3K46A 5AW3B 1XH3A 1VCAA 2MPAH 3DIVA 5C2BH 3HMXA 1P6AB 2ZX8A 2VQ1B 4IK6A 5CZXD 4X8JB 1QLFB 1VACA 2VLJE 3TESA 4Z7OE 1JBJA 4JQIH 1VERA 2FEEI 4AE1A 3I02A 5FLUA 3H9SE 1DEDA 3V6BR 1EDYA 4NZUL 1GGIH 3HHSA 3PLYA 1SMAA 1F97A 3D30A 3I6GA 4L23A 4DN4L 3NZHH 5IW1A 4H5SB 5DJ8A 1NC4B 5CEZD 4NT6B 1P5UC 3NJKA 4F7EB 3OLIA 4YGAB 1X5XA 4PB9L 4JPQA 2C4FT 2B3IA 3EYQD 5DHYB 3EKCA 2JJSC 3BPLC 3G5XB 3BZ4B 4A04A 3Q8BA 5ESVB 5C9KA 1U8QA 4HUMB 2G5BA 5IBTL 4KROC 2PTTB 1FSKC 2Y07L 1NM4A 2P44B 3CVHH 4MMZB 3WOVA 1LDPL 3V79C 5L7XL 3L9BA 3CH1B 4HC1L 3C5SB 4JFZH 2IWKA 1YDPA 4QPEA 3ZRCC 4LLMB 4OGXH 3P4OB 5JOEA 5EEWA 5ACMA 5EEXA 1WWWX 3KYKH 4AKOA 1BM3H 4X80H 5DEFB 3QS3A 4JJ5B 2X1PA 4PV9B 1O5PA 4XMLL 2CXKA 5CGMA 1EV2E 1G7JB 5K5YA 1FV1B 1NWPA 1W2KT 4CAGA 1OAXL 1S7SA 1MFDH 4TSBH 4TUOA 1YEKH 3Q48A 5J7CC 4HZAA 2RA1A 4F2ME 1T1ZB 2Z92B 2OJEA 3DSNB 3P3TA 4QOKB 4OZGB 3VWJA 2HJKA 5JLZB 3WFHA 1UXLA 3LCYA 4UYPA 4LLUB 1PGRB 4MYPA 4MXQD 4JO4H 2XZQH 3BUTA 1IBZA 2DH2A 2Y36H 2VIRB 1MZZA 2EXWC 3ETBJ 4FQCL 5H8DA 4X6BA 1OAYH 1RZKL 4LL1A 3EBHA 2A38A 2FQGA 1FE8L 3RB5A 4FMFA 2Z6FA 4YSSA 3NESA 5AZ2L 4S1RH 4MA1C 4TTDD 2R0WH 3EJSA 3ZLQC 2XLLA 4JHBA 3KNBA 4FFTA 3FQUB 5G4OA 4FQJL 5DJ0B 5IQMA 3GSQB 4XP4L 3NQKA 1Q9OB 1WJ3A 5CIPH 2WZ5A 5DYOB 4Q9BA 1MWAA 1W6LA 4OGYH 5DMGD 2DIJA 4DAGL 3QG6A 2A83A 4RGMC 5F7FA 2V3DA 2PP9A 1HYRC 2D73A 3E1ZA 3II1A 4XGZB 2J57A 5FK9A 5FF6A 1IM3B 5CCJA 3OAUH 1HEZB 1BW8A 1LWJA 4AGLA 1E4KC 4K73A 2AANA 4KKAD 4MJ2A 3KPQB 5JYMA 1WV7T 3ZTEA 1GYWA 2D0FA 5C0IA 1QLRA 2ZSWA 2UZIH 2B4CH 1A7OH 1QFOA 1JS4A 1IM9A 4X7SH 3S88H 4I48A 3NCCB 5GSRA 1CG9B 4XO8A 3V0FA 4YE4H 3ZVVA 5ES4B 2UX6A 1D7FA 1G0XA 3QIUB 3S3BB 2C9PA 4XXDA 5DS1A 1OGTA 4UT6A 2NY2B 2HWZH 4P5MA 3N9GH 5EO9A 1NDMB 5HHOA 4B7LA 2NQDA 1P4BL 1MCNA 1Q8MA 1TEGA 3GNMH 3FTVA 4LOVA 2KLRA 3ASNB 1WO2A 4KRLB 4MHHI 3EUDA 5CILL 1NCIA 4ESKA 1WFIA 5TDPB 3O2DH 1JNLH 5I19L 3NJVA 4ZMZA 1MZYA 1PIGA 3N06B 1U4FA 2Y5TA 4G7VL 3JWNC 3ECVA 1D2OA 1OPGL 2XPGB 4POZC 2ENYA 3I75B 1S5HB 5GS1B 1ADQH 3MV01 1WS8A 3HC4H 3APDA 3QIWA 1J11A 2I07B 4JJOA 3VXUD 5CJOH 3WG7B 1Q0EA 4N0UB 1LK2B 5B7MA 3LH8A 2X2YA 3UJIH 3FQ1A 3K8KA 1WBZB 4L3CA 1ZV9A 5AW6B 5M94B 1A6VL 4LE8A 5D7LD 2O72A 4PBVC 4APQD 4OCRL 3GMLB 2EYSA 1DDHA 5IJVB 3F05A 4GG6B 2AJXL 4JY5H 3QR1A 1NMCC 1UACH 4WKZB 2JCCA 4Z5RA 3GRWL 3IRCA 1TYRA 5JPNB 2Z31C 4A7GF 1J18A 5DT1H 1E9QB 3EGSA 4K3EL 8CGTA 4G8GE 3X13A 2JIXA 1DSYA 4LAJH 2G60H 1RJZB 2NW2B 5AAMA 3TVMD 1RK1A 1ZGLP 1F42A 2EUXA 4XOCA 4BHUI 1DYZA 3GXDA 1VZIA 1AI1H 4P4KA 3I9PA 1RPQA 3QWRD 4GQZA 4O2EB 5C7ZA 1KJ2H 2F1AA 3LY6A 5KOMC 1ZS8B 1CXIA 3BSZH 4EKJA 4E41E 5EOCH 3A6BL 2WXNA 2BXYA 4UBDC 2Y5QA 4M62H 2Q2EB 2DQJH 1C16A 3DRQB 4OQ1A 1NAKH 3IETA 3R06B 5D93C 1Y07A 4LOUD 3HFFA 4F3FA 3BUYB 2DKSA 5BW7C 4O4YL 2BY1A 2IH3A 4QF1A 4K7PX 1TG8A 4U3HA 3RWEA 5FO2A 5J6SA 3DROB 4X4ME 4PJ7B 4Y4HD 5DXWA 4EI0A 5CD3B 3HLAA 5AAMC 1ERNA 4A7SA 2B9BA 1YPZA 4HS3B 3MRQA 3EOYG 2XFGB 1CFVL 2HUHA 2QPDB 3QFGA 3E6FA 2C4FU 4YJZL 2J88H 3BMWA 4OJCA 5EN3A 2ZKHL 5DRWA 4FL4B 3F7RA 2V7HB 3TJHD 4NQQA 3EH2A 3VGFA 1N2RB 4TL4A 4WSKA 2VZ1A 5FV2A 3IU3A 1RULL 3FBKA 4N3UA 3L5WB 3MV9B 2VMEA 1H3UA 5IHZA 1MCOL 2Q86A 3OKLA 1HKFA 1ROWA 3RWJB 2GUYA 3VFTB 2WQRA 5CZVH 4AG4L 1QPKA 1NUNB 4OJFH 2X4RB 5HGHB 1O6SA 3OKEB 5MEOA 2F7PA 2F53D 2KKQA 2XY2A 4WI0B 3IFPB 4JFEE 4TMPA 4DERA 3AS2A 5H4ZA 2B08A 4IHBA 2CO3A 3BRFA 2WLLA 2LLNA 3BDXA 3TGXA 3VQMA 3QUXC 4R4BB 3QIBA 4KXCA 2VR4A 4JFQA 3MLTA 4M61B 4NUMA 5HDBF 3GXFA 2NW3B 1FVEB 4PI2A 5LBSA 2KQNA 5CD5C 2ZKWA 4YXLH 1AC6A 3Q44A 2W65B 1GMEA 1QYGH 4AV5A 5HTSA 5DZVA 5I9QC 1KXTA 1YRKA 2GB2A 5DHVA 1V8HA 3E8UL 1XXDC 4OF5A 2W9EH 3PRZA 3ZDZE 3UTQB 1OP5K 4LCWE 3AMKA 5EA0L 2ZOUA 4AQEB 3U6RB 1DL7H 1CB4A 2V2TB 2UXVA 1G7PB 1XTMA 1HJCA 1OANA 5DJYA 3EYSH 3B2VH 1ZEAH 3QIBC 3SO5A 3T2QA 4XBEL 3LRGA 1FCCA 4HMCA 4DKEL 1U8MA 2VXUL 3L7FB 4KX7A 1DVXA 4N8CH 5I75B 4K94C 2B5IB 5F9WC 5IGXH 1I9RH 2N1KA 4ZAKC 1XGPA 4B3EA 2GK0B 3OG4B 4Y4KB 5J13B 3LVEA 2FJGA 2AABH 5E99L 1DQTA 1YNKH 5E6SB 1PX8A 3AB0C 2CIIB 3ABKB 1NGQH 2IDCA 4FOMA 4WUUB 4EN3C 5BO1L 1LD9B 2YZ1A 1UH3A 2AEPL 1NCTA 1IAKA 1PJWA 2AQSA 5KYUB 5CZRA 3LS4L 3M86A 5GZOD 1HQRB 3NIGF 1BAGA 4U1MB 1KTRL 1L9NA 1UVQA 3IFLL 5HXMA 2DQEH 3KHOA 1INDH 2H6UA 2VRQA 2CKBB 1HXYB 1H3WM 1NCGA 2XQYG 4W9LC 5CSZA 1EZVX 4CA4A 3D39B 4GMSH 1U3NA 4U3SA 2LU3A 2YEQA 4PJHA 2WZPA 5DJAB 2AQ2A 2CBQA 3QCVH 1MFNA 4U1SB 2C9QA 4PLOB 5SV3A 4YHYB 1NJ9B 3KBEA 5D4IA 4Z7VF 1GSKA 5ICXA 3FULA 2BSSB 4MAYA 2XWZA 5LUMA 1EFXA 5H2BA 2X6AA 4JMNA 3DDFA 3RURA 4Q97A 1A66A 2CGRH 1CBVH 2VUOA 3FQ2A 3S37X 2V9QA 1NCAL 4ZMAT 3ZQWA 3SYCA 2YKKA 1GPOL 5JORA 1AHWA 4D7PA 1DBKL 2XN9A 1B0GB 2CDGA 1PQZB 4OZHF 5I1CH 2ZWLT 1MXGA 1P4IH 3BWUF 4WK0B 2KZ1B 2BOCB 2BJML 2WWOA 1UM4H 1DJSA 1G9NC 1C5DA 1EQWA 2VM3A 2WGNB 3DTDA 1VENA 4S1QL 1GHFH 2H45A 3U0PB 5IROD 3N1FC 4HUKB 4CMMB 4XB7A 3MJ6A 5EO1A 4XE5B 3SE6A 5DWPA 5B38B 3VFWA 1L3NA 3QWOA 1G5GA 2GTWB 5DUMH 1Z1WA 2F58H 1ZLEA 3GUFA 1DQDH 3ZDXF 5DCCA 3VE0A 2JKIS 3SJVD 4NPYB 5D7JC 1GYAA 3PQYD 2EEAA 3Q5TA 2OMUA 4JK0D 1ZVSA 5EF1A 3GSVB 3V0DA 4Q56A 3UTSB 4NO2A 1V5JA 3N43F 3ZUNC 1FNFA 1KIUA 4ENED 2NXZC 1HH9A 2FWOB 3D09A 1M42A 1EZLA 5C0CA 1G87A 4QTFA 2TSAA 5C0RL 3WMQA 1ZIBA 3S3CB 4IDLA 2XI9A 4GFTB 4JFPA 1NDGA 3LDBC 4NO3A 5LVEA 4HKZA 4LSVL 3X14A 5HGAA 3QQ3A 1X5IA 3QARA 4ZQTA 3WTYA 4L8SB 1FFPA 2DQDH 1EHLH 3FFDA 3NFPB 3RRQA 1HCZA 1CLZH 3TZVC 4IJTA 3VXSD 2WYIA 3BN3B 3MJ7A 3MUHL 4RAVB 4KAQH 3NPSC 3VGBA 4XHQA 4FQIH 1E9OA 1ZDSA 2R0KH 4DVRL 1OZUA 2IANE 3X3GH 1KENH 2WXFA 3DTXB 4M4RB 3HZYB 1J5CA 1IGYB 1ZVHA 3TA3B 2YPLA 4RMQA 5F1IB 4KTEL 3SCMB 3DVGA 2ZJSH 1PU0A 5DK2A 3UG5A 2OSLA 5K33A 3IDNA 4OUOA 1L7TH 2R4SH 1Q0YL 3IKCB 3JBG7 3K81A 5ECGA 5G4MA 5F0LB 1EUTA 4PY8J 4TTGA 2J20A 2DV6A 1OP3K 3S8WA 3VFVA 3HR5A 4OGZA 1MCLA 3EDFA 2BERA 1TT6A 3PWPA 3OAWA 5F6IC 5CUSH 4RRPM 3OX8B 1OARH 3AS1A 2P52A 5KVDL 1H6FA 3IVKA 1JF1B 2DQ6A 4M5SA 4DKFL 2NR6A 2YSSA 4V2CB 5IFHL 3ECUA 2EQDA 4N3TA 1FNGA 4KI1A 3RVXD 2QR0A 3QRGH 1UQSA 5TFSH 1GTFA 1INEL 2NY4B 2DI8A 3VI4F 1ZLVK 4HJUA 4GSRA 3DXAD 2AXGA 4DEPC 1V55B 3TYGH 2BRRH 3GB7B 3FFCA 4FNLL 1U8PB 2ETWA 3SKNA 5DVOA 2UZYB 4L37B 1JPST 2WMPA 2BSEA 2A9NH 5D1ZD 5E9DE 3AXHA 5EOQH 4DGYH 4EMZA 5HHME 2KC0A 3S96A 2X4NB 2WXRA 1F4YH 3PE9A 4P2YA 4A7QA 4LEBA 1IGJB 4X6EB 1BD2A 2BIPA 1IRAY 2ZUYA 4TPRL 1NEZB 1Q9KB 3QUKB 4MNGE 3T8XA 4I2XE 4JG0H 3S35L 1PLAA 3BWAA 1G6RH 4XNYL 1WRFA 4FCAA 2VDOH 4DETA 1D5XA 1MWOA 2I26N 1G9MH 1V3JA 2CUHA 1F56A 4YBQC 3GIZH 1ZTXE 3TFKD 2FNWA 3HCVB 1J9TA 3LX9A 2JKLA 2UZPA 2APWA 3CSTA 3P9MA 2ICEB 4I7ZC 1XR9B 4YDLC 4ADGA 4N90E 1DLHB 4HXAH 3ZE0F 1OSEA 4G6JL 5C0AE 2G0LA 2I25N 5GGTL 2DYPA 5T3XD 4ZZFA 1JGDA 2A6IB 4N28A 3RNQA 5J1TC 1P1VA 3W2DL 1T1YB 1S7QA 3ATAA 3BAXA 3BE1L 2R39A 2X4UB 4GAJH 4LEXH 4PBWD 3VX1A 4JZOA 2Y7QA 2F7RA 2Q3AA 4UM9D 4TQIA 3K6FA 1LO4H 4NRZB 4WFEE 3M6DA 4ABUA 4HCGA 3EFOB 5GS3A 4W9EC 4LSTL 3FT2A 3L7EA 3UBXG 1NLDH 4HIJB 4JRXE 1EMTH 4MJIE 3AGWA 1WZAA 1BVKA 3RHWK 4PTTB 3V5KA 3ULUE 1EVUA 2KERA 3RILA 4JY4B 1MFMA 3LXAA 4LAQH 5JZ7C 1FCGA 4ZTEA 5FYJD 4KMTL 1J0ZA 1CDHA 1BBDH 2IQ9L 4KJYA 4RRPA 5CBEB 4YHML 4ODTL 4KVNL 1X6LA 5B7FA 3CMGA 5KVFL 1JPFA 3GMPA 2YEZA 5TDOA 4F33B 4Q6YA 3AQZA 1IQDB 1LQBC 4IQHA 2CMRL 2YA2A 4OAWB 3E7JA 2J21A 2QHLA 3NRQA 1IGTB 2VB5A 2EKSB 2ZYSA 3RZWA 5LQBL 3BP4A 3VW3L 1E27B 5SWSD 4FG2A 3ZDYF 4QRPB 4ABVA 1IBHA 3UC0H 4Z7VB 1MCBA 2Q10A 5G5DB 5LG1A 3HB3D 3SDXE 1HOCA 3VDCA 4WSJA 3MJGX 1JDAA 1I9JH 2AI0H 1U36A 1NICA 2H6PB 3QJFA 3CZFA 3GEFA 4RMRA 2APXA 1NCCH 3H42L 4Y2LA 5ALCL 4AH2A 5JOFB 2GABA 5ITBH 3SGDH 3MCG1 4OUUB 4N0YL 1DFBL 2BIQA 2PNDA 4NUQA 4N6QA 5I1JH 1WQVT 1A7RH 2MCG1 4U1NB 4OZHB 5ANMB 3ARGD 3IMVA 4WI3A 4EUPH 5ISZD 5I73B 4X9IA 1HNYA 2MSPA 4ELKA 1Q1JL 1S7RA 1WFJA 5CM1A 3GTTA 3CPUA 3GTVA 1ANUA 4Z76B 3ZKXC 1IGIH 1JVKA 5SWQB 3S36H 3ZHDA 4PJDE 4OVVA 1UGKA 2Y7OA 4QHUB 4FQ2L 3R1GL 1M05B 3BKCL 3FOLB 4X0NA 2MQ0A 5MI0B 1JWMB 2W92A 4LNRB 3DYOA 4J1UA 2ZXBA 1ZPLA 4ODXB 3PS6A 5K69A 3SKJH 2WKLA 1BV8A 1XH1A 1H3PH 4G72B 3CGTA 4DT2A 1CDBA 2CCWA 2BVQB 3B6SA 4ZS7L 3L3GA 5HPMA 2ED9A 3MV7A 5T1KB 4H1LB 1AG0A 2X6CA 4P5SA 2LOEA 43CAA 2OW6A 3PHQA 3N43B 5I8EA 2R29A 2YBRA 3D9AL 4P9HH 4G42A 2H6OA 2YFOA 2MHAA 5D2LF 4P5TB 2QZ5A 2CBPA 3NJGA 1DEEA 3U4KA 4HFUL 4XMUA 4HPOL 4I3RL 3K72B 4ZXBA 3H54A 4F58L 1XMEB 1OY3B 4YHLH 1XGRB 2HFTA 1AOHA 1CDUA 5CJ8A 4IRJD 1SVCP 1CCZA 1ZHBB 5DMIH 5K9OA 4BZ2A 2VTFA 1QFPA 3HW7A 3HBPA 2CCVA 5FM5M 2GJ6E 4U3XA 4C47A 2VN3A 5AVSB 4F7MB 1DQIA 2AJZB 3BIKB 4OM1H 3T4AB 4AGMA 2BVYA 3AM8A 1T2XA 1ZLUH 1A1MA 4NZDA 5EULV 2F5BL 5DJXA 5EU6B 1TTCA 2BNRB 2AQTA 2XWTB 3I6LE 1FO0L 4PRNB 3NFNB 3ESOA 2QADC 3K0WA 4WI9A 5K39A 5G4NA 3KYAA 1E43A 4IBWA 1LTXA 3E8VA 4LDLB 2I9LA 4YHZH 1TYJA 5L88H 4M48H 1U8LA 4PD4J 4P9HC 4ZXBC 5A2FA 3N50A 4WDIA 2WOBA 5FKPB 2WGXA 4JCLA 3QXDB 5CEYA 4FXKA 4I3SL 1A47A 3JV6A 3NP3A 1XV8A 3Q6FA 4M02A 1ZHNA 3DV4B 3O3AA 2OZNA 5E9NA 3KWUA 2EADA 3SPIA 3WIIH 3PV6B 3MLYL 1N5AA 4ZUSB 1BHGA 4LPTA 5HD8C 3LKPA 2CBMA 4PRIB 1BVZA 1KPRA 2BFGA 4GO8A 3UAJA 4KKZA 3BQUC 4RQQB 5CINL 4AL8L 3JWOL 2DMBA 4WFFD 2D9CA 2PO6B 1R1CA 3MLZH 4M5TA 4PJIE 4WKXA 2V3FA 4GKZA 4H8WH 1UXWB 1QSFA 4UAOC 3SODB 4U7KA 1ES0A 4E9WA 2DMKA 2X1WL 1QVOB 4IKIA 2NNAA 5IG7B 2ZOOA 4M9OA 3STLA 5DUJA 5KVEE 4XNAA 1JZ8A 4IBZA 4MWFB 4ZMOA 2HSIA 3E0GA 2XN2A 3G5YB 2IALB 3HI5H 4DO6A 4HJIA 3UMNA 5ADPL 1BFVH 3QZBA 4X4KA 1IB5A 1ZA6A 4NKDB 3RA7H 2QVMA 1H9DA 1SVBA 3Q8FA 4FXKC 4G9DB 4WWKB 4KX8A 4OZIA 1E5AA 1K4DA 1QFUL 4H13C 4OFDA 4UYQA 1QRNB 3MLVL 4XAWH 3VA2C 1XF2A 5EC1B 5BRZA 1EXUB 1F58H 2GBUA 1Q72L 4L1HA 2IAMC 4RISL 4IIQB 3KPMA 2Z34A 4KZEL 5I6MA 3BFWA 3EYFB 2DQGL 3ARDB 4BWUA 1WSST 3U9PL 1HI6A 2KI6A 1LILA 3LIUA 4ZUVA 2Y23A 4ZQKB 1ETZA 1PSKH 5HDRA 1ND0B 2VITB 3SE9H 3FU3A 3VXOA 5AAWA 2BFVH 5LKNA 4A7GA 1TQSA 2RMNA 3VH8A 3CPLA 3AWFA 4C83A 1E5CA 4H8WC 4JO1L 6TAAA 1VFBA 4XN8A 3MLRH 4U6XB 3EAKA 5E1AB 2YOCA 3ZKNC 1TCRB 2F19H 3FRUA 5TTRA 1JWUA 1CO1A 2BP3A 3WFEH 5DO2C 2OCCB 4PP2B 2MPVA 4XMKL 4YHNA 3DK0A 5CFAA 5HYJE 3L4ZA 3P2DA 3TBYA 4LPCA 1JYNA 1N3NA 4OFYA 1KGUA 3NRFA 2EE3A 4GW1B 2XA8H 4M7ZC 4HCRL 2FWUA 1P7BA 3GHPA 1RHHB 2VDPB 3CZSA 1UZ8B 3GIVB 2I9TA 3AABA 1H19A 3SOBL 4Y4FB 3BP5B 5IMKA 2I5YH 4KROD 5ENWA 5I8OL 1NC2A 1OF2A 2BHYA 2EIBA 2WWNA 1WWCA 3ZT5A 4WHYH 3VFGL 1IAOA 1NGXB 3RGBA 3LRKA 3PIQB 3FMGL 5K9QG 3OLGA 1FIGL 2MQ3A 2PPCA 4GBXC 4FYRA 4G8GA 3MGTB 1CT8A 4KFMA 1AZRA 1MDTA 3VXME 4MDJB 3OSKA 4X6FA 4Y8DC 5DC2A 4PGEA 2ZX9A 2ADJA 3VRLF 3V6FA 1GW6A 1HQ4A 4XVOA 5DI8A 4NWUH 1CGWA 2EJ1A 3VG0L 4FNUA 4XMXA 1DDTA 1FC1A 3HG2A 4O5LL 3UDWC 4Z9KB 1IC4H 3B7RL 1QUNB 3BVWA 2ZOTA 1KULA 4WRLA 1MCRA 4NQDA 5CSBA 1AQKH 3VFOA 3L81A 3CIQA 5F71A 2EXWD 1P1ZB 3FO2A 4NQEB 4PJBF 1CUOA 1JMZA 5IK3B 3UTOA 5L2KE 1ZE3H 5F0JB 1YQ2A 1ZHLB 3FCGA 4Q2ZB 4F57H 5HHPA 2XIIA 3MA7B 3BUQA 1JK9A 3GRWA 2Q5BA 5IJBC 1NIAA 3HAEA 3EH3B 4E68A 2A6DB 5TDNA 3MMEB 2LFGA 3HZMB 2X6VA 4J4PA 5J5EA 1E6JL 5E5MA 1AXIB 4MX7A 4OZ4A 3R19A 5ECJE 4Z7WF 2Y6SC 1KEMH 1ZVYA 2JJVA 1H6EA 1XCQB 4PJFB 4JAMB 1I8MB 4JFDE 4AGPA 2A99A 1JGVL 3D3VE 4ELMF 4OCMC 4KRNA 3S5LA 2FD6H 4NIYE 1DJWA 1DJXA 4ZFZB 1E3FA 3HZKA 3MYZA 1CF8H 3MFGB 3BUPA 3PV7A 2UWEA 2DH3A 1XSIA 2P26A 3NZ8B 1DVYA 2BLFA 3OPZL 32C2B 4U4IA 3TBWA 3O4LA 5A43C 2WW8A 1ETJA 5ERWA 3VI3B 2BNQA 3EOTH 1KPUA 4DQOH 1IT9H 2VXSH 4LDOB 3M1BB 1FDLH 5CLWA 3GLDA 3K4DA 4GRLB 5E6UB 5GJSH 2TSBA 5GRUL 3P2BA 2E7LA 5D9SA 2E4FA 1ZE3C 3WNOA 4WFGD 4K5NA 2E4TA 1PDKB 2R7EA 1BFSA 1TSHA 2C7FA 1OWRM 3KPOB 4I77H 4XH2B 4RIRA 3QS2A 3LXBA 2D03L 4H8QA 3G6AB 3DVNB 3A23A 3VD9A 1FPTL 3BZFB 3GD1C 3ZQ9A 4LQFL 4XVJL 4DFHA 2MNWA 5CZKA 3MRIA 4PG2C 3KJ4C 5B8CA 3EYOB 1QR1A 1S6NA 4P2RD 1A9EA 3N1PC 3MR9B 3QUYC 3MLPA 4GAGL 4POZD 4QLWA 4OD1L 1J8HD 2NZIA 7CGTA 4YSEA 5JHAA 3OL2A 1MW2A 5K9JH 3INUH 1BGXL 2DZEA 1OK8A 3K6SA 1IM9D 2NUPA 4H25A 1QUPA 2G3NA 2VXVH 4OM0H 1DBBH 3MREA 1IC7L 3IGAB 43C9B 4L8DB 4X4ZA 5F0MB 5HHOD 1M7UA 3FU9A 2AGJH 3VFUB 1JGEA 1XF5A 3KS0J 3O45A 4NO0B 3D0LA 4Z7UA 5FYKE 1CD8A 2JVUA 1RZPA 4FNPA 4J2QA 3RJQB 4RESB 4KTGA 3TH3T 1X4ZA 2NUTA 1F00I 4QOKE 3IU4H 2RCSH 2WKOA 3OB0H 1NGZB 3TYFA 3W0WE 3OKMA 4Z0BL 2Z31D 5D1ZI 3MRMA 1CFBA 3WLWC 5BS0A 5ILTL 4XRCA 4JN1H 2A77H 4UM8A 2HN7B 4HHAA 3EUUA 4LEOA 3WEOA 3TEXA 3BPCA 4Y9CA 5D70L 1A7BA 4AW7A 2V17H 5DEJA 2DPKA 5DMKA 1D5BB 3APFA 1HL8A 3DVFA 2DW5A 4ONFL 4Z0XA 3MRCB 4N0CC 3L3JA 1K6QH 5LWYH 2AJ3A 1JCVA 1MFAL 4XMPL 1SLUA 5I6OA 4P46B 3LEVH 1NBVL 4UBDD 5DWUL 2E47A 2OR8A 3FJTA 2VQTA 3VXTB 3BP7A 1QSEA 1MG3C 3J2PA 4FHKA 5ESQB 5JDSA 5BJTB 1ET5A 3F01A 5CEXA 2B14A 2YD3A 3IDIA 1TEYA 3DYPA 4K8RH 3S97C 1AIZA 5FHBH 3CSGA 4BKTC 1ZT1B 4DP9X 1X9QA 3V5DB 3U7YL 5H37A 3MKGA 2D31A 3ME0B 4F8LA 2X70A 5IJKA 4JFYB 4GUOA 3FB5A 4JQVC 3UBXI 4ZI8A 1V3LA 5CJXC 2QQNL 3AGVA 2X12A 4U7SA 1F18A 4UTCA 4PJ8C 5HGGS 5KYYB 4M3JA 2NY5L 3CQFA 1TUPA 2VN4A 5KBLA 4KY1L 4JFTA 2A6JB 2FEEL 3IF1B 2YUXA 1JXJA 1F41A 3MUGA 3FT4A 1WC7B 4LRNH 2Q87A 3I3BA 1I1FA 2ERJC 4X9GA 2OL3L 5FS5A 2ISDA 1R3LA 2Z93A 5E94A 5KSUB 1DBML 3D6GA 1KXQA 1S8DA 3QDMA 5FO7A 4IS6B 4YDVB 1CTNA 1GR7A 5B39B 1ZLSH 3RDJA 1F90H 2XXMB 1R5WB 4LT7A 4IMLA 2ESVA 5DZJA 4ENZA 2ZUVA 3T1FA 4P3WA 4PVLA 3BLKA 4K8RC 4Z8FH 5EUOF 1JK8B 3F64A 3SSGA 4KVCL 3O2VL 2FUTA 3SDYL 3WFCL 4HKBA 3QUXD 4FTVA 4JM2F 4QXTA 4U1JA 4AENA 3F6IA 1VSCA 2J1ZA 3UTZB 4JHWH 1A9BB 3S3JA 4YAQA 3DRTB 1JWSB 2K3HA 2XV0A 2ZP0T 2QVTA 4PGCB 4KRPC 4J3VA 5EFIA 3B3IB 5CD5D 4F9PC 3OM3B 4U1GC 4MKMA 5AZEL 5HJ3B 4YHPB 2P24B 2OI9C 5I0XA 4A7UA 3HG1B 4PFEA 2NY7L 2VMCA 4LPXA 2ZKXA 4D9RD 1KLGB 4HHWA 1C8PA 2FLBT 3JVFC 2V9TA 4ICXA 1HC1A 2Y1YA 1CICA 3C6SA 1M6UA 2AAVA 5F7WC 5KJ4A 3UBHA 5IVXE 3S34H 2VE6B 2YXWA 1X5ZA 2YN3A 3CNKA 1QW9A 2DD8H 2E27L 3BP6B 1I7RA 3EHBC 5IB4B 3QIBD 4DPCX 2VC2H 3EDJA 5KBDA 2YAQA 3HN8A 4WEBL 1JZ6A 3VI4A 3EZJB 4JFUA 4L4VB 4X5QA 4ZAKD 4NHCL 1G4RA 1JXDA 1KNOA 5SWZA 3SE8H 1X4XA 3LPGA 4PJCF 2JXMA 3RFZB 2Y1ZA 4WTQA 2R1XA 4PWEA 4PJ7E 1YUKB 4I18B 2E75C 4J3UA 2EKJA 3E80A 4E0RB 1WZKA 4E2OA 4L8BA 1LP9F 4GO9A 5FLVA 4AUJA 1J1OL 2O61B 4A67A 3B43A 3RY4A 4JRYA 1IVLA 2AKRA 4E9YA 3UTPD 3L08A 4Z7WB 3D48R 4UUJA 3GUTB 3H0TA 3HN5A 5KVGE 4MD4A 3SQBB 3DXAB 4JPIA 4IBQA 1OSZB 3D2UB 2EDOA 1JZEA 1AVAA 1I1RA 1U92A 5KZCB 1JGLL 4PSRA 2XYBA 4P2QB 3PDDA 1FORH 1HAUA 1NFKA 3TNMB 2PYEB 3F3HA 3O4OB 5D1ZB 1DVTA 1OCZB 3VD3A 4BD4A 4U2ZA 3T0DA 4M7KH 4N1HB 4HXBH 4DGIL 1F8TL 3WO3B 4MCNA 4Y1AD 1DHKA 3C09B 1TNMA 1Y0LB 3LNFA 4MJ6B 3U46A 3EYUH 2HRLA 5GRVK 2MCPH 1H0DB 4OZFH 5F1KC 1L6XA 3U1PA 1CGUA 5IB1B 3O6KL 4PJ5A 1T4KA 4U1KB 4U6TA 1S7XB 3FQTA 4JHZA 3F7VA 2RJMA 3HUJF 5F96L 4EDWH 1GGBH 2XSKA 4EZMA 2BVPB 1SYVB 5F89A 3KL3A 2BHFA 4FFZH 3LV3B 2VL5B 3U0TA 3O3UN 1GZQB 1TKWB 1I75A 3IDGA 3ILPB 1ZTXH 2X41A 3CFNA 3QDJD 2PPDA 1S7UB 1SHSA 1MRFH 1I3UA 3RX8A 2Z7ZA 3V9EA 4RGNB 4P3CL 4P0DA 5I8CA 3OLDA 4B9FA 1EFXD 1VB9A 1M2VB 4PRPA 2QSTA 4AQAA 5JHLH 1AJ7H 3KLAA 3QI9C 2VQUA 4XOBA 1EHKB 3SDCA 2JKWA 3JT2A 4GP4B 4V1DB 5D7JD 1UT1A 2PMZA 3G6JB 2R2EB 2E86A 2P1YA 2ZOKB 3UBXB 2Z4QA 1XBRA 2BP8A 4PUBH 1QQDB 1XGYL 5C0AA 1TQUA 4ZUWB 2P28B 4OB5L 4JM4L 3LJ3A 4IEFA 2P47B 3FH5A 1E2WA 1SF5A 2NXZD 4D0CA 4GYBA 1BFOB 5TH2B 4K71B 4W9IC 4X5PA 1GA2A 1SDYA 5DD5L 3BKYH 1LMIA 3RTQC 2HT2C 3DJRA 3ULUH 3AREB 5DD3L 4XZUA 3P11H 2QDWA 4PJ9B 3WIFB 4MJIA 3RAJH 3L3HA 3TZVD 4MMYA 3SDCC 1RJLB 3TCLB 1T89A 4NKQB 2NY1B 1GGUA 3MUY1 1BPLB 2VDQB 4PB0H 2O5NA 3GHBL 5EDXA 3D39E 4AT6A 3FPYA 5DTFB 1ZRUA 1A6WH 4PBXA 2EVGA 5B1CA 5JIQA 3EYVB 2GEQA 5AW8B 1KB5L 3PF2A 3B34A 5F93C 2EUZA 3VD2A 4K5PA 4FI7A 3TEUA 4Q89A 3LRHA 4LB8A 3RZCC 4WAFA 2HJLB 2GAZB 1OAZH 1SMOA 4BZYA 3MRBA 2ZONA 1UFUA 2ZSVB 4FABH 3TO4B 2YA1A 5CCGE 1G7IA 1BOGB 2ZWYA 4O58L 3IJSB 3MBXL 3ULUC 1T89C 2BWIA 1YNTA 3QULA 4M93B 1MWAH 2IBGA 4GQ9H 2EACA 4IU2A 4L1SA 3WL9A 4D9LH 1A6ZB 3OGOE 4ORGB 5I76A 1W0YT 4GJTB 5K9QI 3I9AA 1J1XH 3EOBB 3HA0A 1CL7I 1R5IA 3LEYH 5A16B 3NIFF 1SXNA 3O6MH 2OXGA 3BPOC 2B3RA 4O2CB 1QKZL 4UQ2A 3GBNH 3RGVA 4MA7H 3UZVB 3L9RB 4P5KA 2QKIB 1L6PA 4UINL 4ZOAA 3ZJAA 4NCDA 2FB4H 2OX5B 4XVUC 2BZDA 1E5YA 1YMMB 4X6CB 3TXAA 2GUOB 2LE9A 3PUCA 3K6IA 3PWPD 5I1AB 1MHHB 3LN4B 5DVNA 2DQCL 3O9WA 3Q1EA 2H1PH 4P2OB 1NGPL 1JRHH 1IIIA 3UTSE 4Z77B 1HDMA 5FGCB 1YEEL 4PHZA 1FL5B 3FH8A 3K71A 4KK5C 1UYWL 4KO5A 1LJMA 3PWNA 4F92B 5F44A 3S3PA 5D7IA 3V4PL 4ZUTB 1KTCA 3KWWB 2W60B 3POCA 3ZR5A 1TTAA 1O6VA 3C2AH 3E6HB 2GYSA 4R5XA 1TZIA 2V5YA 1JZGA 3O6LH 4MTMA 4QR7A 4YBQD 3RGVC 4PRHB 5HI3D 5IQLA 1NFDA 4DP7X 5FA4A 3ZGHA 3GXPA 3B9VA 3CU7A 2PWFA 1N64H 2E5EA 2BSED 4ALAL 3SGEI 4Z1PA 3LMJL 2VN7A 1P2CB 4LRIC 1JV2A 4DGVH 1I8UA 3C2SA 3L1OL 3I6KA 4M1DL 2CLZB 3NABL 3NK3A 3T77A 1NSNL 5TGBB 3JWDL 3VXRA 2LT9A 4EIZC 2VKXA 1OM9A 2BVEA 3FO1A 3MNVA 3QFJB 2BOBA 4PV8A 3ZMEA 5J06A 3PXJA 1BZ7A 4QYOA 3ZT7A 5JO5A 4W6XB 3PWLB 2ZPKL 4R90H 2L7UA 4KHXH 3VGAB 4HCIA 4QHNA 5F6HJ 3QNYA 4PJAA 5T33H 4PJCB 3O2WL 4QRQA 1IMHC 5CR1A 4YXHL 2RHEA 1N7ML 2CLVB 4MAZA 2R1WB 3ZZSA 4ZTOH 2R0LH 3LIZH 4DZBA 3D0VB 2J73A 1EANA 1BBJB 5ID0B 4PN6A 5SX5H 1UB6B 3K4ZA 1H3GA 2JQAA 1H15A 1WBYB 4LFHD 5IOPA 5D1XA 1BAFH 1JZFA 1KCLA 3OXRA 4LKXA 4OY9A 1RUQL 5EU5B 5ICYB 1QI5A 5JZ7D 1B2YA 3ZN6A 1RZ7L 4Y19B 3VG9C 4EZLA 1ICTA 1T0MB 1T0PB 1BIHA 4RH4A 3RWHB 1J9SA 5JOPD 2J6EL 3BCFA 1DQMH 3LQAL 4QGTA 5DDHB 1N0XH 4FZ8H 4WZ9A 1H5BA 1T6BX 2WLZA 4GKSB 3GI8H 5J57B 1JFQH 1JPSH 3L2MA 1E4JA 1HWGB 2VLMD 4PJIA 1DQQA 4ZPVB 4HZLB 1AAJA 2H3KA 1RI8A 3BFOA 1DO5A 3P54A 4HJGB 4KQ3L 4G7YL 4RSYA 1MJ8H 4I0PA 4U49A 2YRBA 1U8JA 2AJVH 2UUDK 2OZ4A 3FSWA 3MZTA 1A8JH 3MO1A 3P0VL 4L4TD 1JNHA 2HX9A 4Z6AT 2X88A 4JHVA 4WJ5A 4TUUA 4XCFL 4BSJA 4NLAA 4HCFA 1DE4B 4WVRA 4BSVA 2FYVA 1FO0A 3AADB 5BV7H 2N0KA 1E90A 4TUKH 1SY6A 3KDMB 3GSNB 2X38A 3LN5A 1NCBL 3MGOA 4GAYB 1CF1A 2HXAA 1KBWA 5EZJA 1SN0A 4LIQL 4XAKD 1MHEA 1L0XA 4NIKB 2WWKT 4PEEA 4G8FA 5FA3A 2C9XA 5LXVA 3JV0A 2ZCZA 5CKGA 1URLA 4XOAA 3KXFA 3MUJA 5AD0B 3NTCH 4PY7B 3L3DA 4JDEB 2XHNA 4P23B 4WQOA 4Y0GA 2CUIA 4HEPA 3CLFH 2OXHA 4D8OA 2BZCA 1SYSA 2XJKA 2P8LA 5MHSD 4CC0A 1CFQB 1VRSA 4A7VA 5GRVL 5C09B 4QTHB 3FN3A 1UEMA 2V9UA 3R0MA 4HK3J 4FE9A 1VF5C 5GRJL 4K9EH 4LNVA 1TJGL 2DJ4A 4RNRA 4RFNB 1UM5L 2WLJA 2W94A 1AD9A 3FK3A 2YQ3A 5FXCH 5BV7C 4UZUA 4WU5A 5JMOC 1L9PA 4C4BA 3LS5L 1K8DB 1MPAL 3OHXC 4NP4H 2KMWA 5DHVH 3HE7A 5HGBA 1W72H 1YMHB 3ARZA 3S48A 1XIWA 1PG7W 4B27A 5IB5B 2QDVA 3L4VA 3DJSA 3V4LA 2ITDB 3BH9B 3MAWA 2ZCKH 2IMMA 5E4OA 1GJWA 4HIEA 1L0YA 2WD0A 3O3BB 5E2WH 3LKNB 3MNWA 4G9FE 2W07B 1JZ3A 4AJYV 4XCCL 5I16A 3NIGE 4HGWB 4ZPTA 3QEGL 5AVVB 1L9SA 4H8HA 3MRPB 1CXFA 3IDUA 3OR7A 4G7QB 2D7MA 4RMVA 2ID5A 1A4KB 4X6DF 4KZDL 3H9SD 1WFOA 3QO1B 3MV7D 5JR1L 4NWTH 4Q6IC 3RIAF 2EVIA 5HGDA 3QQDB 5IQ9A 4ELMA 3GBMH 1OP4A 4K9EC 4LLVA 5C0EB 2IDSA 2QADD 4UILH 2R2CA 5J12C 4JFVA 1ML0A 4QRPE 3OGCA 4QO1A 4Z7VE 2DF3A 1LNUB 2OFQA 3DPDA 4I9WD 3HE7C 2Q7YB 1WLHA 5CEZL 2I27N 2P5WB 4Z3TA 2F7OA 2A1WL 1J0YA 4ZXBD 4U1LA 4BV1A 3UERA 3U79A 4HCRA 3Q13A 3WV0A 1A6TA 3CVHB 3KPRA 1B4TA 3QCTL 4N86A 3AU1B 2EDQA 5HD8D 3D25A 4MA1B 3NH7H 4K3JH 5H4YA 4OZHE 2ZT9C 4YDJA 5ANME 1GCFA 3KYNA 3T3MB 4FQLL 3RG1C 1I8IA 3BQUD 3G5VA 3HC0A 3QAZB 3VD7A 1CD1A 4PJEF 4WGKA 3L3KB 3BD5A 1RUAL 3ARUA 1E4XH 3WXWH 3MKKA 3NIFB 4QEGA 3C75A 3HJEA 3BPNC 1WAAF 5ADOL 3RVWC 4R97B 1V3KA 4IGBC 4W6WB 3IJHA 4UIKL 4WW2C 3TN0B 7TAAA 2VQ1A 2YHGA 5KBPA 5B1JA 1CZ8H 1OLLA 1QLFA 4H4NA 3ZDXE 3BXNB 4LU5L 4HK0B 2GVYA 1KGIA 3DURB 2EECA 3H8NA 5HYEA 4NZTH 1N8OE 1U8OB 5BOPA 5EBGA 4ZMXA 1MJUH 1K2DB 5JIMA 2V8LA 5DVPA 1RU9H 2IAMD 4EI5C 3N0PB 5F3HA 3A22A 4G6AC 4H5SA 1NC4A 4NT6A 2JKXA 1MFEL 1JI1A 4F7EA 5DD1L 3A6CH 3A4DA 1RFDH 1FRGL 1QSFD 4YDIH 5DHYA 3DX1A 1A3RH 2IGTA 2BSRA 4HSCX 5D7KE 3BZ4A 4E5XG 4KOBA 5CIPB 2A7BA 5E2UH 1HXMB 1ZAGA 2AXWA 1GC1L 1SLWA 4MMZA 5TK2A 2YMXL 5B1JC 4HOMA 1A5FH 2YC1B 4MJ4A 2GTZB 4QGYA 1HH6B 3ZKND 1HSAB 2D3JA 3BSHA 3S4SG 3P4OA 1T7WA 3MV11 4G71B 5DO2D 3S5YA 2HFFB 1Y1DA 4KMLB 1OB1B 5DEFA 5AFAA 1JPTH 2PR9A 5EU6E 1I9EA 4HJSA 2F18A 4JJ5A 5C08B 2BNRE 3JVGC 1U21A 4PV9A 3VTAA 1LO2H 2P42B 5FYKH 4LHUG 1GL4B 1DBJH 3GXMA 2WTRB 1G7JA 2VDNL 2ARJQ 1J05B 3I2CL 4DNLA 1FV1A 1UCTA 2D7NA 3PGDA 5I71B 4FKKA 1S3KL 2FJFB 5D6CB 4PYGA 3CVIL 4F2FA 4PJGF 4DJMA 3QJQB 2E6JA 3SB3A 4JGMA 1T1ZA 2Z92A 4QOKA 1WEJH 4OZGA 2YWZA 1YLBB 4MMZC 3P77B 5JLZA 4FFWC 4LLUA 1VZHA 4N2DA 4X7TA 1SDDA 4Q0XL 3RWDB 4NQVB 4U6VL 1CFMA 2EIMB 4IKKA 4GBXD 2G75B 4OCWL 4LOEA 3MU3A 3QZPA 2ITFA 5AALA 4HMEA 3GSXB 4PJ6A 3L4XA 4L0ZA 3OKNB 4FFYH 1CE1L 2Q20A 4FKHA 3U4BH 2DQTL 4AEIH 4N8PA 4OFYD 5KYNA 3FN0L 2OV0A 4KGJA 5KS9B 3X1BA 5ABDE 2O5YH 1DQJB 5DYOA 1Q9OA 3V0GA 3X3FL 5ACZB 3E2HB 4J28A 5BNXD 4LSQH 4JPKL 4CSZA 3QA3B 3KLQA 5CP7B 3FQ4A 4FNTA 2CWRA 3CX5J 3WJLC 1IM3A 1JHKH 3VD0A 1AYOA 2Q8BH 4FXGC 1JNNL 1HHGA 1QRNE 3GSWB 5AOLA 1BWWA 3VFRB 4PM1A 4NNXA 3T9WA 3TCTA 2EDDA 4G8GD 4W9GC 5IMOB 3OJDB 1CG9A 2FO4B 3PP3H 2MCMA 1A14L 1F1AA 2Y3AA 4JFSA 2Y6SD 2FL5B 3P1VA 3U1SL 1AP2B 1DVSA 2CO4A 4N2FA 1ZIAA 1ZPUA 5K1VA 3DGDA 4UNIA 2HKAA 3SBWA 4OT1L 4XC3L 4TRPL 1KJ2B 1MHPH 1HINH 3JT0A 4MQTB 2C1PB 2VLRE 1AE6L 5KSVB 1DN2A 3N41F 2CZNA 5HVGB 5TDPA 2GT9A 4E41D 2G3MA 3Q2WA 4FLHA 4QUOA 1PY0A 1UJ3A 3DX7B 1XEDA 2XPGA 2I7SA 4M8RA 4PS4H 3I75A 4MNQB 4GI9A 1KCSH 2IEPA 1LXMA 3FHQA 4M6AA 4O9HL 4ATWA 3G5ZA 2I07A 3WS6A 4PCTA 5KJ7E 4G8AC 4N0UA 1LK2A 5LAXB 2EZ0C 3M45A 1WBZA 3QIUC 3V8CA 4AK1A 4DH2A 2X89A 2G30A 2NY2C 2ZUXA 4H26B 1JXGA 1FH5L 4HGMA 5IJVA 1IKFL 4L3EE 2L0DA 3SBWC 3IWVA 5AWNH 5IM7B 1EFQA 4GI6A 4F80A 4C56B 4WKZA 1MQKL 4GG8A 4PGBB 4LGPB 4XO9A 4CC1A 4MZ3A 2DWXA 3WJMB 1G7MB 4XNDA 4HGKC 5MEQB 1BJ1J 3BHBB 3D07A 3L3OC 5JPNA 3QUYD 1MH5B 1E9QA 1LP9A 1NEPA 1WH0A 4M1CC 1XWVA 2IMNA 4AMKL 1RJZA 4JPVH 5GS1C 2NW2A 4F5CE 1YEIL 1NCUA 2DIEA 5ICUA 4NDMA 3RWIB 4LCIH 1S9YB 4B50A 2C8NA 4JFED 5IZ7A 2VDLH 5FECA 4O2EA 4ADIA 1PBYA 3QWNA 1P4LB 5KBMA 3SEPA 3ZDYE 1A7PH 2XVLA 1ZS8A 3WTSA 2ADIB 4KWUA 5F7DB 1HZLA 5E24E 1C1EH 3JXAA 5C07B 1YEGH 4ZSOB 1BMGA 3W82A 2YJQA 3SE4A 1IBGH 4FD0A 1I3GL 1WCBB 3DRQA 4NSKB 5TE4L 4EN3B 2EEBA 4YZWA 2PYFA 3R06A 1E30A 3SBPA 1AGCB 1FFTB 3B2DC 1S9KC 3MOAH 2JB5H 5GGQH 3QAQA 4OLZH 4KKLC 2X0WA 3DROA 2M8XA 4M5YL 5FYLH 3LHPL 3IXTB 3SHSA 1NANH 4XOEA 4QTIH 1MLBA 1R0AH 5E4EB 2VR3A 4HS3A 1T80A 1C5CL 4X4YB 2ZUUA 3FB8A 4LCWD 1I53A 3RU8L 5KVGH 4N0CD 2WVSA 4JDVB 2JKRM 3GO1H 3MPCA 5B4MC 2J72A 5IB2B 5TE7L 2CNZA 4HUXB 3TPUB 1N2RA