1JA8A

Kinetic analysis of product inhibition in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese Superoxide Dismutase
publication title Kinetic analysis of product inhibition in human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ja8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ja8A02
1LUWA 1PL4A 1D5NA 1WB8A 1JA8A 1LUVA 1GN2A 3DC5A 4JZGA 1VARA 1PM9A 4YIPA 3BFRA 3TJTA 3K9SA 1XDCA 1EN6A 1B06A 1AR4A 4GUNA 4BR6A 4JZ2A 1WB7A 1BT8A 1GN4A 1I0HA 1MNGA 5A9GA 2ADQB 1XUQA 1P7GA 1MMMA 1ZTEA 2GDSA 4F6EA 2CE4A 2ADPA 1EM1A 3RN4A 1XILA 1EN4A 4E4EA 1N0JA 1AR5A 2RCVA 3IC9A 1VEWA 1IX9A 1ZLZA 2QKCA 3OT7A 1GN3A 3MDSA 1Y67A 2CDYA 1MSDA 2AW9A 2P4KA 1AVMA 5AG2A 1ZSPA 3CEIA 1BS3A 1JR9A 1XREA 3C3SA 3AK1A 4C7UA 3LSUA 3DC6A 1GN6A 4JYYA 1BSMA 1I08A 1KKCA 3C3TA 4YIOA 2QKAA 4FFKA 1SZXA 4X9QA 1EN5A 1IXBA 3AK3A 1AP5A 1AP6A 3KKYA 1QNMA 1N0NA 1IDSA 3AK2A 3QVNA 3EVKA 1ZUQA 1MA1A
chains in the Genus database with same CATH superfamily
2WPDG 3ZRWB 1YXBA 3MHHC 2DYSB 2IW5A 4B3SO 3VQYA 1GN2A 1M9NA 5LXTB 1PM9A 4LF9B 5EIBD 1ROPA 2GSMB 1AILA 2NN4A 1JFFA 1N8RW 4DYLA 1VQLV 2NLJC 1W2BU 2YDEA 1YDXA 4GCZA 3FX7A 2KB1A 4P9PA 1YJNV 4DV0O 5FLXN 1HDJA 5BMVA 4F6EA 5LHIA 1XL4A 5D5PA 4PELA 1DK1A 3VBBA 3CCSV 2X6AA 1U96A 1OHHG 4LF7B 2IM9A 1HNWO 3RVYA 1YZBA 3CCQV 4DV4B 4B3RB 1KD1W 4ASUG 4DR5O 3CRAA 4JASA 3E22A 1XMOB 5IY5B 2ZM6B 5H6QA 4AQYB 1NR7A 2V1DA 4X66O 4Q20A 1IURA 4IYIA 5LBQA 4X20A 1VQ7V 5IE9A 2Y69B 4H37A 3G4SV 2WLHA 2XAGA 4DRXB 4X9QA 3ASOC 4YHHB 4JPRA 2Y0PA 3IGAC 5CA1B 4JV5O 1Q43A 2BE3A 4O2AA 5KA5A 3H9VA 2BSKA 2HR3A 4I5SA 2FKXA 1Q8IA 2EZPA 3AG2B 4CS3A 1V54C 2WA3A 1NQTA 3ASNC 3DC5A 3FB5C 3JARB 3EXAA 4QE7A 5LGUA 3QG5A 3A0HZ 3BPZA 4YY3B 2F95B 3GWKC 4Z1MG 2ADQB 2KQXA 4TV8B 2JDIG 2ZIOA 1XILA 2ZNJA 4LF5O 4AQYO 3CCLV 5CMUA 4RQFA 2DN9A 1THZA 1OCOB 4FFBA 1BL8A 2RDCA 5EC1C 2E75B 4NTYA 4DUZB 3VOUA 2XUMA 3UT5A 2B5UA 4QPKA 2O57A 2ZIMA 4LP8A 5KHHA 3J7AU 1BS3A 2ZE8A 2F1MA 4G27B 3PN1A 3H1JH 4JYYA 1HNXO 4NR1A 1SC5B 4YJ3B 1I08A 4HNAB 5H2FZ 5L3EA 4MSWC 2YICA 1R3JC 4MVRA 1WAZA 4LF4B 2OT5A 2W0XA 4CH5A 5IYZA 1Y6XA 2CGNA 3K58A 5ITZB 1Q7YW 4H0LB 1YITV 1G4YB 2AZ0A 2EULA 5K1PA 2HJFC 3ABUA 3CPWU 1TGOA 1VMGA 4E2LA 4NXMO 3OEEG 3X2QC 2F23A 4O4LA 4OGQB 1FXHA 5J2TB 3D3IA 4O4JB 1GAXA 4X1KA 1XNQO 1N33O 1D5NA 4DV2B 3BFRA 5HFLA 1AB3A 2DQ3A 2E5LB 2LO1A 4PD4F 3B77A 3ABLB 1BHBA 3IAYA 2WAMA 3WG7C 4EB6A 2QA4V 1NH2B 2XASA 2KG7A 2E3CA 4I9QA 4J11A 1EM1A 2ZXWC 2IU3A 4LFBB 3WB2A 3UO2A 4JI7B 3E8GA 2H3OA 4B3MO 3BCCH 3OR6C 1NBMG 1JFFB 2D2CB 3AG1C 4U3FH 5E1AC 1RSOA 3MDSA 1Y67A 3BAAA 1IBKB 2EJRA 3TK1A 3QF7A 1AI6A 3LUTB 4FZ0A 4LFAO 5BMVB 3F7VC 4MTOA 1N36B 4WFBV 1XREA 3T2MA 3TGUH 4CC6A 2UXDO 4C7UA 2WLKA 1FYJA 4L8JA 4GKJB 2EIMB 4K8ZA 3K57A 3M99B 1JX9A 4X1IA 4DW1A 4PA7A 1RM1C 4FM0A 4MVOA 3E22B 1F7YA 3BEHA 3RYHA 1NTZH 1S72V 3ZRXA 2R9AA 1I94O 4FLWA 1FPOA 2ITCC 4PA6A 4X20B 1XNRB 1KUQA 2L35A 3JAKA 3OUFA 3QVNA 5LHHA 1Q81W 4N21A 4HBNA 1MZEA 1K97A 1R1BA 5IJ0B 2YIAA 4GZRB 5KX5A 1GRJA 1GTOA 2FMLA 3D36C 1Y66A 1EN6A 1JOYA 2YC0A 1N34B 2UU9O 2EINB 2QR4A 1WN7A 1VIBA 4OX9B 3KZIZ 4O2AB 2JGDA 3APQA 4DR3B 2F66C 4DR4O 2BSKB 2JRIA 1Q86W 2CGOA 4HAMA 4RO2A 3VQWA 3BA9A 1FJGB 3RVZA 4E4EA 2IH1C 2WLMA 3LDDA 3ABKB 4UFZA 1M5IA 3LSSA 5FPOA 4DV1B 3P3NA 1ZLZA 2FB5A 1HNZO 4W4KA 4DK1A 4G2KA 2A0LA 2YI8A 1PP9H 5B3SB 1OCZB 1YTFB 2YEVB 1KP2A 1TUEB 1M93A 2CTWA 3J81N 4UCTA 3K04A 1K92A 3RYCB 3E8FA 3RGBA 3FB7C 1KKDA 3LSUA 3CMAV 5H9CA 4J41A 1Y76A 4FFBB 4IYHA 2G38A 2OTLV 3SYAA 1DF4A 2DJVA 3WFVA 1WLEA 4UXNA 4MVQA 1Z2GA 3TETA 3DTUB 5KHJA 4NB5A 3UT5B 5L3BA 1YF2A 3ABTA 2VQFO 4CS4A 4MVSA 2ZD9A 1XQ8A 2YS8A 3AEIA 4KUMA 5JJJB 1VQMV 2KSDA 2LQTA 3B40A 4OXSA 1MOFA 3OUSA 2K9PA 1BQZA 2Y4UA 1JMKC 1WPBA 4FZ1A 5CA0A 2XHBA 5IYZB 2ZT9B 4X64O 1H38A 2PZSA 1YJ9V 2W6IG 2PGGA 2QKSA 1UPGA 4IIJB 1AI5A 2ZR3A 5IYBO 2UUAB 1P7GA 3RFRA 1XMQB 1CXZB 1RFYA 1E79G 1G6UA 4J7JA 3CCUV 1HP8A 1K4DC 4DR6O 1RPRA 1AR5A 2LW1A 4O4HA 3HKDA 3LSQA 1S5LZ 3D36A 1NVPB 4XDKA 1J5EO 3U0ZA 4XDJA 5J9PC 1ZX3A 2EILB 3KCYA 2EJ7A 2P4KA 4FM2A 1IBLB 3QNEA 4Z2WA 2KG7B 1Y74A 4PDLA 5FL7G 3QO8A 3ZMUA 4JYBA 1IBMB 1ZSPA 3FAVA 1DTOA 5FNVB 4AHCA 5LP6C 4WFHA 1UJWB 1BSMA 3W7WA 1BQ0A 5HFMA 5JVDA 3RYIA 4YIOA 2Q67A 3CP1A 3HKEA 1XHZA 1PPJH 1RSOB 5LYJA 4JI5B 1P49A 2FTKA 3JCZA 1B04A 5KHIA 4I7ZB 2HG5C 1Q5OA 1SRYA 3CRQA 2DYRC 1F4MA 3L9DA 1W59A 4NXNO 4GX5A 3Q4HB 3L75H 4U3JA 2R9RB 1BGYH 2QM8A 3IC7A 2Q6AA 4X1IB 4DR2B 1VQ5V 2BOBC 5JH7B 1ZL8A 5BY1A 4R8CA 1GM8A 1H8HG 2OIEA 3DSQA 3K9SA 3RYHB 3T1YB 3FYEB 3P32A 1RPOA 3E83A 4K35A 4PDVA 1YVWA 3OTFA 3JD4A 3L73H 4MVMA 2UXBO 1QLEC 4FLYA 3E2EA 3CJHB 2XAFA 4ZI7B 4GT1A 4WFAV 4GKKB 1DLBA 3BY6A 2Q0OC 1FOUA 1M56C 1SQPH 2LW7A 4RUFA 3CMEV 1D5AA 4LR3A 1WPXA 4GX0A 2ZR2A 4ZOLA 4BIUA 2RCVA 3ZS8C 1X4TA 4FVMA 5KAIZ 3G71V 4LF8B 1MSDA 2EIJB 4JI2O 2JGDB 5DM6V 1YIJV 2B9ZA 3JAMN 4JAAA 4IT5A 4O4IA 4LF6O 2PF4E 3U10A 4JI8B 2ZE6A 1BMFG 3K9AA 3SPIA 1AJNA 1KYOF 5L3GA 3OR7C 2Q7HA 2UXCB 1E1RG 3CC4V 4D6TH 4K3AA 4JI1B 3U11A 2UUBB 2UUCO 3GVMA 1KB9F 2JK5C 2QKAA 1AI7A 3FKSG 4N23A 4P30A 4UUJC 1YHQV 4ZBMA 1VF6A 2IJIA 1BCCH 4PDRA 1OCCB 4NKGB 5LMNB 1QVGU 2ITDC 2ZDIC 5H5NA 3SPGA 2QM4A 4DR1O 4RAIA 2ETNA 3JD3A 5B1BB 4DUYB 2P22C 1WJZA 2XNDG 3EVKA 4XDLA 2CK3G 2Q7EA 4JI3O 2Q73A 5BR8O 2F4VB 3STLC 4TV9A 2HVKC 1PD3A 4LC1A 1MABG 1VARA 5LOVA 1VQNV 3G6EV 1XDCA 2IJHA 4LF9O 3SYPA 2DMXA 3CC2V 4DV6B 4DV3B 1FXKC 5IJ9A 4JI0B 1I7FA 4JF3A 4TSFG 1PNLA 3JD2A 2XAQA 2VQEB 3AG4B 3CRRA 2H8PC 3I56V 3E35A 3AG3B 1OV9A 4J7KA 2ZNIA 2YXHA 2WLIA 2W6JG 3CWBH 5KLVH 1TUBA 1QR8A 1JCHA 3K59A 1SETA 3IC9A 2VRZA 4I9WA 4PA4A 3D8CA 2HLDG 2X0LA 1Q90D 4LF7O 5EYPA 3ZMZA 4DV4O 4FLXA 4B3RO 2CUGA 1VQKV 2WWWA 2Z0AA 1BZKA 4R50A 1XMOO 4W4LA 1AVMA 4K0KB 1U97A 2ZM6O 3OTOB 2Y0IA 4QE9A 1XOUA 3BABA 4DV7B 3JCUZ 1SQGA 5LA6B 2OCHA 2HJDA 5EC2C 5FPRA 1JQ0A 4HYOA 3FD9A 1L0LH 1KKCA 4O4HB 1OCRB 3HKDB 5IWAB 3VQXA 4JI6B 3ZIAG 2RQ6A 4LFCB 4A5UB 4DV5B 1I5XA 2V7QG 1JJ2U 3GWOA 1V55B 1IXBA 3JASA 1Y74B 3OGCC 5J2UA 4PA3A 3FAVB 4YHHO 2JVDA 4IHJA 2QJ1A 4BW9A 5JVDB 3RYIB 1R6TA 3HKEB 2QTOA 3T1HB 4JI4B 3L72H 4YIPA 1T5EA 4DR7B 3EHBB 1URFA 1IVSA 4J42A 4PA9A 2DYSC 4CBCA 2DWEC 3SGIA 5JWPA 1MNGA 4KXRA 4YY3O 1KU9A 5GONA 1PNKA 4UVCA 5TISZ 4U3JB 3E8BA 3ZRVA 5C8YA 3QTCA 3RN4A 4Z1VA 4UCSA 3QO5A 4P9OA 3SJBC 4X62B 2CTQA 1VQOV 2W0FC 5JCOC 1ZL8B 2CAZC 3OMIB 1A32A 3RYFA 4JTAB 1NU1H 3GB7C 2JGUA 5B66Z 4PV1B 1EFRG 1KQSU 1G1XB 2VWJA 5EZYA 5LHGA 3A2FA 1F51A 4DUZO 1KP3A 2M7WA 3EFFK 1N4CA 5IY5C 3ML0A 1S0VA 2Q4PA 1NJIW 3R65A 3K0GA 5KMGA 3TXQA 4KHPB 4FMTA 5CN0A 4X89A 3S3WA 4RWUA 2Y69C 3H1HH 2P90A 3UM7A 3K5NA 4NVPA 4O4IB 4NTXA 1D2DA 4LF4O 4X8AA 5GTHZ 3H1KH 4MTGA 1I5YA 2LFSA 3G67A 3SYQA 2QWRB 1M57B 4O2BA 3LNMB 3T1CA 3RW0A 1H2SB 4UV9A 4DV2O 1SESA 2B1GA 2EIKB 2HFEC 4JYAB 5B1AB 2CTRA 2QDOA 2LP7A 4JGSA 5IDJA 2OTJV 1W0JG 1WB7A 1VF5B 2E5LO 1R3LC 3ABMB 3JSNA 1B3QA 1YCIA 1TA8A 1M90W 3S3XA 3THOA 4UB6Z 4BIOA 3FYIB 3L71H 3B4SA 3CB2A 1SA0A 1QHTA 3SR2C 2QTSA 1PL0A 4UCRA 4TV9B 1XL6A 2YI9A 4J7ZA 4LFBO 5LOVB 3IJ4A 1XEQA 3F7YC 4JI7O 2CH7A 3OEHG 3JATA 3ETGA 5IJ9B 3M7MX 1AI4A 3PJSK 2DOSA 4CH3A 2BTQA 1OCOC 4R7CA 5KA6A 2GUZA 3KDRA 1O9HA 1V9PA 1IBKO 3STZC 1UFIA 2HVJC 3ETDA 2AHZA 2OCCB 1AJQA 5LL6Y 2WLIB 1NKDA 3BRCA 2R9IA 4UVAA 1KC8W 2JEUA 3AK1A 1N36O 3K5MA 2ODMA 3DC6A 1M1KW 5JCOA 1TUBB 4FLTA 3CRCA 2PY5A 1SERA 1K3EA 1P7BA 4GKJO 1COWG 5EYPB 1Q3EA 3HB3B 1EBOA 4AILC 1SQXH 1EN5A 1GMGA 3ZHTA 5A2QN 5IYDO 1FKAO 4TT3G 4LWSA 4ZKIA 1O9GA 1H8EG 3JD1A 1CP9A 1IDSA 4ZIBA 4CC5A 1XNRO 1ZUQA 1MA1A 3W7XA 5CA3A 3E89A 3HR0A 4ZHQA 5GW7A 5IT9N 2HHHB 1K5QA 1GM9A 3UCSC 3ZMVA 5LMUB 4I0XA 2P7TC 4WBNA 1FFXA 2OWOA 2HP8A 3JASB 4NTWA 1VQPV 1Z5VA 4MVUA 4JZ2A 4LNUA 2B1IA 1BT8A 2HKOA 4LH7A 1N34O 3FFQA 1GK9A 4OX9O 2XAHA 3UO3A 4DRXA 2Q9LA 4WFEA 4DR3O 3ABLC 3BHPA 3B8NA 4X65B 1N32B 4BAYA 1R73A 1QQCA 4H33A 3CXHF 1MSWD 2X7RB 1FJGO 2VS0A 3B09A 1DF5A 1J95A 4UV8A 4GLXA 3FB6C 5CB4A 2N04A 1IX9A 4NYKA 4ICGA 2QKCA 2PUSA 4B3TB 4DV1O 2BOCC 3UQ8A 2QEXV 5JJEB 3E86A 3J80N 4O4LB 5C8YB 1HR0B 4X1KB 2YUAA 1NS1A 2YIDA 3ETEA 3JD0A 3RYFB 1JVMA 3ASOB 3C3TA 4F6RA 3AG7A 4IL6Z 3BVOA 3K79A 2RN9A 4EB6B 1B6QA 4PI2A 4I55A 2EIMC 5EZYB 4EKWA 3SJQC 3KCXA 2GTAA 3KKYA 3ZHRA 1IZ3A 2Q8VA 3D3QA 3OD4A 2Z5UA 1V54B 1FAFA 3ASNB 3N27A 4B3SB 2DW4A 1ZWIC 4HZ3A 3ZEDA 1SQBH 1TVKA 3O65A 3R66A 4F4LA 2N05A 3TXSA 1YEWA 2M6YA 1YI2V 4YJ3A 4QGPA 4HNAA 2JJ1G 2AHYA 1GN4A 3LNNA 1K8AW 4DV0B 2AXTZ 5A9GA 2EINC 2GDSA 4O2BB 2UUAO 2ADPA 5ITZA 3ZHVA 1XMQO 3K5OA 3W7SA 1Q82W 1EN4A 1XBLA 5KAFZ 1M4UA 1NH2D 3SPHA 1HNWB 4H44B 5CBHA 4DR5B 4JYCA 3ABKC 2QSAA 2CDYA 4YJ2A 2Q69A 2X6CA 1S76D 4X66B 3JAKB 3N2GA 1IBLO 5B3SC 4D7SA 2IBZH 1OCZC 2PI5A 4JAVA 2A79B 1PNMA 3DXRA 2D3OW 1IBMO 5KX5B 2Y4TA 2IJJA 3CX5F 2CH7B 4Q6GA 4DXWA 4PHZA 4WCEV 5L3CA 4TWKA 4QIWF 4FFKA 2BTQB 2GUZB 4JI5O 5BZBA 4CS2A 4JV5B 3AK3A 1K7DA 4TOIA 3X2QB 3ZN1A 3ZHUA 1GM7A 2ZCEA 1CEZA 3CE2A 3AK2A 3B2EE 3ZBHA 5CBFA 4K8XA 3ZMSA 4TQFA 5CBGA 3TJTA 1NTMH 2QWNB 5EBMC 4DR2O 3SYCA 2P4VA 1WP8A 3WG7B 1IXMA 3K08A 2JEXA 4B7KA 3RWRD 4UCUA 1OJHA 3T1YO 4LWSB 2BCCH 2E74B 2PYLA 2A9HA 2ZXWB 4BW5A 2QWPB 1H2MA 4LH6A 1Y76B 1L0NH 5LP6A 4J10A 4LF5B 1SQFA 4PI0A 1VQ8V 4ZHQB 1SQQH 1F23A 3AG1B 4GKKO 4I0XB 4WBNB 2MW2B 1FFXB 3K03A 4G28B 1VEWA 4U7OA 4LNUB 3ZHSA 2P06A 3ZX6A 2LJ2A 5IJ0A 3BA8A 1WA8A 3T4ZA 4LF8O 1K4CC 1LNQA 5AG2A 3MD0A 1WNSA 2ZINA 2EILC 4GX2A 3C3SA 4MVZA 3HPLC 1HNXB 1PV0A 4I4TA 5CA0B 1XI1A 1YTFD 1JPXA 4JI8O 1LR1A 1RM1B 3SPCA 3ETQA 5B1NA 5EBWC 4UCOA 5CB4B 5LGNA 2UXCO 2IH3C 3HKBA 2XAJA 4KFMA 2QWQB 4JI1O 2UUBO 1SZXA 4FLVA 1FD9A 3W7TA 3G80A 2Z3YA 1VQ9V 5B1OA 1L1FA 3P3PA 5F2VO 1W0KG 5JJNB 1VQ4V 1US6A 3K5LA 3CRMA 5LMNO 4NXMB 2LFRA 3K3WA 1XNQB 1N33B 2HEPA 2YEVA 4DUYO 3N2KA 2Q5ZA 3JAWA 2QWOB 1LUWA 3CSXA 4F6RB 1WB8A 3F5WC 2GHYA 3P30A 2AGAA 4JZGA 3RYCA 1GO3F 2F4VO 3CXCU 4I55B 5DN6G 2P6JA 2P67A 4LBEC 4X88A 1AR4A 4GUNA 1NTKH 3DGEA 3CD6V 3K06A 5JQGA 4DV6O 4DV3O 3WB0A 3NR7A 4JI0O 1QLNA 2VQEO 4OPAA 2Y48A 1P4RA 4L87A 3A0RA 4J9ZB 5LYJB 4FPPA 2A7WA 1YJWV 4MW8A 4B3MB 1TVKB 1SZTA 1L8DA 2XT9A 4AI8A 3OFNG 1XHXA 2RNBA 4B08A 2Q68A 2ZDIA 4R6ZA 2FL4A 4LFAB 3QO7A 2ZQMA 3ZRSA 1NVPD 3WB1A 2UXDB 3I55V 2EIJC 4QNHB 1E1QG 4IIJA 4K0KO 3LDEA 3CC7V 3OTOO 1S5JA 2PYJA 4UVBA 4DV7O 1KECA 3ICXA 4PJ0Z 4FIPC 2A06H 3MAQA 1S5HC 3KG2A 4MT8A 1FXKA 3FB8C 5IWAO 4YJ2B 4JI6O 4MTXA 1I94B 1H2KA 4LFCO 3N2GB 4TUYA 4DV5O 2ARHA 3OM3B 1AR1B 4U7NA 1K73W 1AP6A 1QNMA 3JALA 4UB8Z 4CH6A 3H1LH 3DXRB 2QGNA 4RQEA 3C90A 1BE3H 1OCCC 4ZOLB 3SYOA 4EFEA 5L3FA 4I50A 2EZOA 1VQ6V 2YXYA 3RT3C 1VP7A 1K5SA 1PL4A 2ILMA 2WLLA 5B1BC 4JTDB 2YXLA 3SJCC 3MHSC 4MW3A 5FNVA 3IFXA 2UU9B 3T1HO 2JJ2G 4JI4O 4WFFA 4DR7O 1ENVA 2MK3A 1SF9A 4DR4B 1I0HA 2LGWA 3A0BZ 1HWYA 1MMMA 4J80A 2FYUH 2CE4A 3O9OA 1Z5WA 2DWDC 2ZKOA 4X1YA 2EX3A 3AG4C 1QBZA 5BXZA 3AG3C 4RUEA 2PTMA 3Q4HA 3CCJV 3AG2C 4CH4A 4X62O 1N0JA 3OW2U 2P5OA 4EFBA 1HNZB 5EK0A 1RP3B 2C2AA 2R72A 1FS0G 2A3QA 3ZJZA 3OT7A 1Q6HA 3K0DA 4XBFA 5JH7A 5H6RA 3E8HA 2ATKC 3W7UA 4WFGA 5LP6B 2YIBD 5DEDA 5L3DA 1FFTB 2V4DA 5GTIZ 1GN6A 3LDCA 3HKCA 4J9YB 3CJHA 3ZRWA 4ZI7A 3CCMV 4KHPO 2XTAA 2GV9A 4IGGA 2WLJA 5LGTA 5C93A 5IYCO 2DYRB 2VQFB 5LXTA 1MZFA 1WA8B 1NZ6A 5B5EZ 4JAUA 1OCRC 3CYOA 1SS3A 3L70H 1H5WA 4D7TA 1R3IC 4EEQA 1JNBA 2RJZA 2YSUB 2AZ2A 2JS5A 2Q7GA 2YIBA 5KHKA 2L6LA 1Q6IA 4I4TB 1V55C 3CHXA 5E79Z 3T4DA 3CCVV 5KHGA 1VF7A 3JYCA 4FLUA 3HKBB 3CCEV 3L74H 1LUVA 3OMAB 5KUMA 4X64B 1KMIZ 1NT2B 4DW0A 3F5TA 1K33A 1GH6A 3G6BA 2XOKG 1SKVA 4KP4A 4JYAO 1QLEB 1PKXA 4DO2A 4QPJA 3RBZA 4FK5C 3SPJA 4BWAA 1M56B 1XUQA 1ZTEA 2R70A 3N2KB 3OMNB 3JAWB 2WSSG 4DR6B 2PI4A 4H13B 2RMKB 1R6NA 1WP7A 1J5EB 3OAAG 1K34A 4B7EA 3ZCCA 1QVFU 1DGSA 3UKMA 5J2UB 2VWKA 1H2LA 4LCUC 5JQGB 1GKFA 2NNUA 4IHJB 1CPYA 4BIZA 5CA1A 3APOA 1SQVH 2H94A 1JR9A 3CCRV 1AROP 1EZVH 1YSCA 3TCUA 4DK0A 1S77D 1S3JA 1R3KC 1NI8A 2Q0AA 3OE7G 1G8MA 1IJGA 1Q6UA 4QJFB 4YXWG 4PDMA 3JARA 1HW7A 5GONB 5EBLC 2OIGA 3H1IH 2WA4A 4NXNB 1OZ0A 2NR5A 2QM7A 1AJPA 2F93B 3WU2Z 4GYCB 1R6KA 1N0NA 1QR9A 4WF9V 1EZJA 4TV8A 1BHAA 2LGQA 2X6BA 4P2ZA 3OGIB 5K1XA 4FLZA 5D5QA 1JA8A 5EIBC 1FXKB 1M57C 2QE7G 4MS2A 4JTCB 2HHHO 5LA6A 1B06A 5LMUO 4TUYB 3ZHQA 4FM1A 4BR6A 3CS5A 3JALB 2EIKC 2UXBB 1VF6C 5B1AC 2IU0A 5KMGB 1P84F 2GTSA 3A8TA 2K1EA 2ZE7A 2UXNA 4I50B 3ABMC 1JJOA 1ZAUA 2WLLB 3SDLA 3JSLA 4X65O 1N32O 1FXVA 4FJCC 1NR1A 1ORQC 1K9MW 2KKWA 4MTFA 2WLNA 1F4NA 1QU7A 3H01A 3NXSA 1MG1A 4JI2B 2N74A 1GN3A 2JS3A 3I5DA 4LF6B 2AW9A 4B3TO 2UXXA 3SJAC 3ZMTA 4ABMA 2ZE5A 4UCVA 2EBOA 3B8MA 3CEIA 1H2GA 4X1YB 2DE0X 1X59A 2F43G 4GX1A 1HR0O 2DQ0A 2UUCB 2OCCC 5J2TA 4O4JA 3ZN0A 4CZZA 4KL1A 1Y4MA 1KBHA 2IJKA 1TAEA 1SA0B 1QCEA 4DR1B 5DECA 1AP5A 2BTOA 1H2NA 5KUKA 3M8AA 2JIZG 3VQVA 2E76B 2OYQA 4JI3B 4OPHA 3JATB 2GBOA 5BR8B 3HKCB 2CTPA 4TQDA
chains in the Genus database with same CATH topology
1LUWA 1PL4A 1D5NA 1WB8A 1JA8A 1LUVA 1GN2A 3DC5A 4JZGA 1VARA 1PM9A 4YIPA 3BFRA 3TJTA 3K9SA 1XDCA 1EN6A 1B06A 1AR4A 4GUNA 4BR6A 4JZ2A 1WB7A 1BT8A 1GN4A 1I0HA 1MNGA 5A9GA 2ADQB 1XUQA 1P7GA 1MMMA 1ZTEA 2GDSA 4F6EA 2CE4A 2ADPA 1EM1A 3RN4A 1XILA 1EN4A 4E4EA 1N0JA 1AR5A 2RCVA 3IC9A 1VEWA 1IX9A 1ZLZA 2QKCA 3OT7A 1GN3A 3MDSA 1Y67A 2CDYA 1MSDA 2AW9A 2P4KA 3KDRA 1AVMA 5AG2A 1ZSPA 3CEIA 1BS3A 1JR9A 1XREA 3C3SA 3AK1A 4C7UA 3LSUA 3DC6A 1GN6A 4JYYA 1BSMA 1I08A 1KKCA 3C3TA 4YIOA 2QKAA 4FFKA 1SZXA 4X9QA 1EN5A 1IXBA 3AK3A 1AP5A 1AP6A 3KKYA 1QNMA 1N0NA 1IDSA 3AK2A 3QVNA 3EVKA 1ZUQA 1MA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUW A;  1PL4 A;  1D5N A;  1WB8 A;  1JA8 A;  1LUV A;  1GN2 A;  3DC5 A;  4JZG A;  1VAR A;  1PM9 A;  4YIP A;  3BFR A;  3TJT A;  3K9S A;  1XDC A;  1EN6 A;  1B06 A;  1AR4 A;  4GUN A;  4BR6 A;  4JZ2 A;  1WB7 A;  1BT8 A;  1GN4 A;  1I0H A;  1MNG A;  5A9G A;  2ADQ B;  1XUQ A;  1P7G A;  1MMM A;  1ZTE A;  2GDS A;  4F6E A;  2CE4 A;  2ADP A;  1EM1 A;  3RN4 A;  1XIL A;  1EN4 A;  4E4E A;  1N0J A;  1AR5 A;  2RCV A;  3IC9 A;  1VEW A;  1IX9 A;  1ZLZ A;  2QKC A;  3OT7 A;  1GN3 A;  3MDS A;  1Y67 A;  2CDY A;  1MSD A;  2AW9 A;  2P4K A;  1AVM A;  5AG2 A;  1ZSP A;  3CEI A;  1BS3 A;  1JR9 A;  1XRE A;  3C3S A;  3AK1 A;  4C7U A;  3LSU A;  3DC6 A;  1GN6 A;  4JYY A;  1BSM A;  1I08 A;  1KKC A;  3C3T A;  4YIO A;  2QKA A;  4FFK A;  1SZX A;  4X9Q A;  1EN5 A;  1IXB A;  3AK3 A;  1AP5 A;  1AP6 A;  3KKY A;  1QNM A;  1N0N A;  1IDS A;  3AK2 A;  3QVN A;  3EVK A;  1ZUQ A;  1MA1 A; 
#chains in the Genus database with same CATH topology
 2WPD G;  3ZRW B;  1YXB A;  3MHH C;  2DYS B;  2IW5 A;  4B3S O;  3VQY A;  1GN2 A;  1M9N A;  5LXT B;  1PM9 A;  4LF9 B;  5EIB D;  1ROP A;  2GSM B;  1AIL A;  2NN4 A;  1JFF A;  1N8R W;  4DYL A;  1VQL V;  2NLJ C;  1W2B U;  2YDE A;  1YDX A;  4GCZ A;  3FX7 A;  2KB1 A;  4P9P A;  1YJN V;  4DV0 O;  5FLX N;  1HDJ A;  5BMV A;  4F6E A;  5LHI A;  1XL4 A;  5D5P A;  4PEL A;  1DK1 A;  3VBB A;  3CCS V;  2X6A A;  1U96 A;  1OHH G;  4LF7 B;  2IM9 A;  1HNW O;  3RVY A;  1YZB A;  3CCQ V;  4DV4 B;  4B3R B;  1KD1 W;  4ASU G;  4DR5 O;  3CRA A;  4JAS A;  3E22 A;  1XMO B;  5IY5 B;  2ZM6 B;  5H6Q A;  4AQY B;  1NR7 A;  2V1D A;  4X66 O;  4Q20 A;  1IUR A;  4IYI A;  5LBQ A;  4X20 A;  1VQ7 V;  5IE9 A;  2Y69 B;  4H37 A;  3G4S V;  2WLH A;  2XAG A;  4DRX B;  4X9Q A;  3ASO C;  4YHH B;  4JPR A;  2Y0P A;  3IGA C;  5CA1 B;  4JV5 O;  1Q43 A;  2BE3 A;  4O2A A;  5KA5 A;  3H9V A;  2BSK A;  2HR3 A;  4I5S A;  2FKX A;  1Q8I A;  2EZP A;  3AG2 B;  4CS3 A;  1V54 C;  2WA3 A;  1NQT A;  3ASN C;  3DC5 A;  3FB5 C;  3JAR B;  3EXA A;  4QE7 A;  5LGU A;  3QG5 A;  3A0H Z;  3BPZ A;  4YY3 B;  2F95 B;  3GWK C;  4Z1M G;  2ADQ B;  2KQX A;  4TV8 B;  2JDI G;  2ZIO A;  1XIL A;  2ZNJ A;  4LF5 O;  4AQY O;  3CCL V;  5CMU A;  4RQF A;  2DN9 A;  1THZ A;  1OCO B;  4FFB A;  1BL8 A;  2RDC A;  5EC1 C;  2E75 B;  4NTY A;  4DUZ B;  3VOU A;  2XUM A;  3UT5 A;  2B5U A;  4QPK A;  2O57 A;  2ZIM A;  4LP8 A;  5KHH A;  3J7A U;  1BS3 A;  2ZE8 A;  2F1M A;  4G27 B;  3PN1 A;  3H1J H;  4JYY A;  1HNX O;  4NR1 A;  1SC5 B;  4YJ3 B;  1I08 A;  4HNA B;  5H2F Z;  5L3E A;  4MSW C;  2YIC A;  1R3J C;  4MVR A;  1WAZ A;  4LF4 B;  2OT5 A;  2W0X A;  4CH5 A;  5IYZ A;  1Y6X A;  2CGN A;  3K58 A;  5ITZ B;  1Q7Y W;  4H0L B;  1YIT V;  1G4Y B;  2AZ0 A;  2EUL A;  5K1P A;  2HJF C;  3ABU A;  3CPW U;  1TGO A;  1VMG A;  4E2L A;  4NXM O;  3OEE G;  3X2Q C;  2F23 A;  4O4L A;  4OGQ B;  1FXH A;  5J2T B;  3D3I A;  4O4J B;  1GAX A;  4X1K A;  1XNQ O;  1N33 O;  1D5N A;  4DV2 B;  3BFR A;  5HFL A;  1AB3 A;  2DQ3 A;  2E5L B;  2LO1 A;  4PD4 F;  3B77 A;  3ABL B;  1BHB A;  3IAY A;  2WAM A;  3WG7 C;  4EB6 A;  2QA4 V;  1NH2 B;  2XAS A;  2KG7 A;  2E3C A;  4I9Q A;  4J11 A;  1EM1 A;  2ZXW C;  2IU3 A;  4LFB B;  3WB2 A;  3UO2 A;  4JI7 B;  3E8G A;  2H3O A;  4B3M O;  3BCC H;  3OR6 C;  1NBM G;  1JFF B;  2D2C B;  3AG1 C;  4U3F H;  5E1A C;  1RSO A;  3MDS A;  1Y67 A;  3BAA A;  1IBK B;  2EJR A;  3TK1 A;  3QF7 A;  1AI6 A;  3LUT B;  4FZ0 A;  4LFA O;  5BMV B;  3F7V C;  4MTO A;  1N36 B;  4WFB V;  1XRE A;  3T2M A;  3TGU H;  4CC6 A;  2UXD O;  4C7U A;  2WLK A;  1FYJ A;  4L8J A;  4GKJ B;  2EIM B;  4K8Z A;  3K57 A;  3M99 B;  1JX9 A;  4X1I A;  4DW1 A;  4PA7 A;  1RM1 C;  4FM0 A;  4MVO A;  3E22 B;  1F7Y A;  3BEH A;  3RYH A;  1NTZ H;  1S72 V;  3ZRX A;  2R9A A;  1I94 O;  4FLW A;  1FPO A;  2ITC C;  4PA6 A;  4X20 B;  1XNR B;  1KUQ A;  2L35 A;  3JAK A;  3OUF A;  3QVN A;  5LHH A;  1Q81 W;  4N21 A;  4HBN A;  1MZE A;  1K97 A;  1R1B A;  5IJ0 B;  2YIA A;  4GZR B;  5KX5 A;  1GRJ A;  1GTO A;  2FML A;  3D36 C;  1Y66 A;  1EN6 A;  1JOY A;  2YC0 A;  1N34 B;  2UU9 O;  2EIN B;  2QR4 A;  1WN7 A;  1VIB A;  4OX9 B;  3KZI Z;  4O2A B;  2JGD A;  3APQ A;  4DR3 B;  2F66 C;  4DR4 O;  2BSK B;  2JRI A;  1Q86 W;  2CGO A;  4HAM A;  4RO2 A;  3VQW A;  3BA9 A;  1FJG B;  3RVZ A;  4E4E A;  2IH1 C;  2WLM A;  3LDD A;  3ABK B;  4UFZ A;  1M5I A;  3LSS A;  5FPO A;  4DV1 B;  3P3N A;  1ZLZ A;  2FB5 A;  1HNZ O;  4W4K A;  4DK1 A;  4G2K A;  2A0L A;  2YI8 A;  1PP9 H;  5B3S B;  1OCZ B;  1YTF B;  2YEV B;  1KP2 A;  1TUE B;  1M93 A;  2CTW A;  3J81 N;  4UCT A;  3K04 A;  1K92 A;  3RYC B;  3E8F A;  3RGB A;  3FB7 C;  1KKD A;  3LSU A;  3CMA V;  5H9C A;  4J41 A;  1Y76 A;  4FFB B;  4IYH A;  2G38 A;  2OTL V;  3SYA A;  1DF4 A;  2DJV A;  3WFV A;  1WLE A;  4UXN A;  4MVQ A;  1Z2G A;  3TET A;  3DTU B;  5KHJ A;  4NB5 A;  3UT5 B;  5L3B A;  1YF2 A;  3ABT A;  2VQF O;  4CS4 A;  4MVS A;  2ZD9 A;  1XQ8 A;  2YS8 A;  3AEI A;  4KUM A;  5JJJ B;  1VQM V;  2KSD A;  2LQT A;  3B40 A;  4OXS A;  1MOF A;  3OUS A;  2K9P A;  1BQZ A;  2Y4U A;  1JMK C;  1WPB A;  4FZ1 A;  5CA0 A;  2XHB A;  5IYZ B;  2ZT9 B;  4X64 O;  1H38 A;  2PZS A;  1YJ9 V;  2W6I G;  2PGG A;  2QKS A;  1UPG A;  4IIJ B;  1AI5 A;  2ZR3 A;  5IYB O;  2UUA B;  1P7G A;  3RFR A;  1XMQ B;  1CXZ B;  1RFY A;  1E79 G;  1G6U A;  4J7J A;  3CCU V;  1HP8 A;  1K4D C;  4DR6 O;  1RPR A;  1AR5 A;  2LW1 A;  4O4H A;  3HKD A;  3LSQ A;  1S5L Z;  3D36 A;  1NVP B;  4XDK A;  1J5E O;  3U0Z A;  4XDJ A;  5J9P C;  1ZX3 A;  2EIL B;  3KCY A;  2EJ7 A;  2P4K A;  4FM2 A;  1IBL B;  3QNE A;  4Z2W A;  2KG7 B;  1Y74 A;  4PDL A;  5FL7 G;  3QO8 A;  3ZMU A;  4JYB A;  1IBM B;  1ZSP A;  3FAV A;  1DTO A;  5FNV B;  4AHC A;  5LP6 C;  4WFH A;  1UJW B;  1BSM A;  3W7W A;  1BQ0 A;  5HFM A;  5JVD A;  3RYI A;  4YIO A;  2Q67 A;  3CP1 A;  3HKE A;  1XHZ A;  1PPJ H;  1RSO B;  5LYJ A;  4JI5 B;  1P49 A;  2FTK A;  3JCZ A;  1B04 A;  5KHI A;  4I7Z B;  2HG5 C;  1Q5O A;  1SRY A;  3CRQ A;  2DYR C;  1F4M A;  3L9D A;  1W59 A;  4NXN O;  4GX5 A;  3Q4H B;  3L75 H;  4U3J A;  2R9R B;  1BGY H;  2QM8 A;  3IC7 A;  2Q6A A;  4X1I B;  4DR2 B;  1VQ5 V;  2BOB C;  5JH7 B;  1ZL8 A;  5BY1 A;  4R8C A;  1GM8 A;  1H8H G;  2OIE A;  3DSQ A;  3K9S A;  3RYH B;  3T1Y B;  3FYE B;  3P32 A;  1RPO A;  3E83 A;  4K35 A;  4PDV A;  1YVW A;  3OTF A;  3JD4 A;  3L73 H;  4MVM A;  2UXB O;  1QLE C;  4FLY A;  3E2E A;  3CJH B;  2XAF A;  4ZI7 B;  4GT1 A;  4WFA V;  4GKK B;  1DLB A;  3BY6 A;  2Q0O C;  1FOU A;  1M56 C;  1SQP H;  2LW7 A;  4RUF A;  3CME V;  1D5A A;  4LR3 A;  1WPX A;  4GX0 A;  2ZR2 A;  4ZOL A;  4BIU A;  2RCV A;  3ZS8 C;  1X4T A;  4FVM A;  5KAI Z;  3G71 V;  4LF8 B;  1MSD A;  2EIJ B;  4JI2 O;  2JGD B;  5DM6 V;  1YIJ V;  2B9Z A;  3JAM N;  4JAA A;  4IT5 A;  4O4I A;  4LF6 O;  2PF4 E;  3U10 A;  4JI8 B;  2ZE6 A;  1BMF G;  3K9A A;  3SPI A;  1AJN A;  1KYO F;  5L3G A;  3OR7 C;  2Q7H A;  2UXC B;  1E1R G;  3CC4 V;  4D6T H;  4K3A A;  4JI1 B;  3U11 A;  2UUB B;  2UUC O;  3GVM A;  1KB9 F;  2JK5 C;  2QKA A;  1AI7 A;  3FKS G;  4N23 A;  4P30 A;  4UUJ C;  1YHQ V;  4ZBM A;  1VF6 A;  2IJI A;  1BCC H;  4PDR A;  1OCC B;  4NKG B;  5LMN B;  1QVG U;  2ITD C;  2ZDI C;  5H5N A;  3SPG A;  2QM4 A;  4DR1 O;  4RAI A;  2ETN A;  3JD3 A;  5B1B B;  4DUY B;  2P22 C;  1WJZ A;  2XND G;  3EVK A;  4XDL A;  2CK3 G;  2Q7E A;  4JI3 O;  2Q73 A;  5BR8 O;  2F4V B;  3STL C;  4TV9 A;  2HVK C;  1PD3 A;  4LC1 A;  1MAB G;  1VAR A;  5LOV A;  1VQN V;  3G6E V;  1XDC A;  2IJH A;  4LF9 O;  3SYP A;  2DMX A;  3CC2 V;  4DV6 B;  4DV3 B;  1FXK C;  5IJ9 A;  4JI0 B;  1I7F A;  4JF3 A;  4TSF G;  1PNL A;  3JD2 A;  2XAQ A;  2VQE B;  3AG4 B;  3CRR A;  2H8P C;  3I56 V;  3E35 A;  3AG3 B;  1OV9 A;  4J7K A;  2ZNI A;  2YXH A;  2WLI A;  2W6J G;  3CWB H;  5KLV H;  1TUB A;  1QR8 A;  1JCH A;  3K59 A;  1SET A;  3IC9 A;  2VRZ A;  4I9W A;  4PA4 A;  3D8C A;  2HLD G;  2X0L A;  1Q90 D;  4LF7 O;  5EYP A;  3ZMZ A;  4DV4 O;  4FLX A;  4B3R O;  2CUG A;  1VQK V;  2WWW A;  2Z0A A;  1BZK A;  4R50 A;  1XMO O;  4W4L A;  1AVM A;  4K0K B;  1U97 A;  2ZM6 O;  3OTO B;  2Y0I A;  4QE9 A;  1XOU A;  3BAB A;  4DV7 B;  3JCU Z;  1SQG A;  5LA6 B;  2OCH A;  2HJD A;  5EC2 C;  5FPR A;  1JQ0 A;  4HYO A;  3FD9 A;  1L0L H;  1KKC A;  4O4H B;  1OCR B;  3HKD B;  5IWA B;  3VQX A;  4JI6 B;  3ZIA G;  2RQ6 A;  4LFC B;  4A5U B;  4DV5 B;  1I5X A;  2V7Q G;  1JJ2 U;  3GWO A;  1V55 B;  1IXB A;  3JAS A;  1Y74 B;  3OGC C;  5J2U A;  4PA3 A;  3FAV B;  4YHH O;  2JVD A;  4IHJ A;  2QJ1 A;  4BW9 A;  5JVD B;  3RYI B;  1R6T A;  3HKE B;  2QTO A;  3T1H B;  4JI4 B;  3L72 H;  4YIP A;  1T5E A;  4DR7 B;  3EHB B;  1URF A;  1IVS A;  4J42 A;  4PA9 A;  2DYS C;  4CBC A;  2DWE C;  3SGI A;  5JWP A;  1MNG A;  4KXR A;  4YY3 O;  1KU9 A;  5GON A;  1PNK A;  4UVC A;  5TIS Z;  4U3J B;  3E8B A;  3ZRV A;  5C8Y A;  3QTC A;  3RN4 A;  4Z1V A;  4UCS A;  3QO5 A;  4P9O A;  3SJB C;  4X62 B;  2CTQ A;  1VQO V;  2W0F C;  5JCO C;  1ZL8 B;  2CAZ C;  3OMI B;  1A32 A;  3RYF A;  4JTA B;  1NU1 H;  3GB7 C;  2JGU A;  5B66 Z;  4PV1 B;  1EFR G;  1KQS U;  1G1X B;  2VWJ A;  5EZY A;  5LHG A;  3A2F A;  1F51 A;  4DUZ O;  1KP3 A;  2M7W A;  3EFF K;  1N4C A;  5IY5 C;  3ML0 A;  1S0V A;  2Q4P A;  1NJI W;  3R65 A;  3K0G A;  5KMG A;  3TXQ A;  4KHP B;  4FMT A;  5CN0 A;  4X89 A;  3S3W A;  4RWU A;  2Y69 C;  3H1H H;  2P90 A;  3UM7 A;  3K5N A;  4NVP A;  4O4I B;  4NTX A;  1D2D A;  4LF4 O;  4X8A A;  5GTH Z;  3H1K H;  4MTG A;  1I5Y A;  2LFS A;  3G67 A;  3SYQ A;  2QWR B;  1M57 B;  4O2B A;  3LNM B;  3T1C A;  3RW0 A;  1H2S B;  4UV9 A;  4DV2 O;  1SES A;  2B1G A;  2EIK B;  2HFE C;  4JYA B;  5B1A B;  2CTR A;  2QDO A;  2LP7 A;  4JGS A;  5IDJ A;  2OTJ V;  1W0J G;  1WB7 A;  1VF5 B;  2E5L O;  1R3L C;  3ABM B;  3JSN A;  1B3Q A;  1YCI A;  1TA8 A;  1M90 W;  3S3X A;  3THO A;  4UB6 Z;  4BIO A;  3FYI B;  3L71 H;  3B4S A;  3CB2 A;  1SA0 A;  1QHT A;  3SR2 C;  2QTS A;  1PL0 A;  4UCR A;  4TV9 B;  1XL6 A;  2YI9 A;  4J7Z A;  4LFB O;  5LOV B;  3IJ4 A;  1XEQ A;  3F7Y C;  4JI7 O;  2CH7 A;  3OEH G;  3JAT A;  3ETG A;  5IJ9 B;  3M7M X;  1AI4 A;  3PJS K;  2DOS A;  4CH3 A;  2BTQ A;  1OCO C;  4R7C A;  5KA6 A;  2GUZ A;  3KDR A;  1O9H A;  1V9P A;  1IBK O;  3STZ C;  1UFI A;  2HVJ C;  3ETD A;  2AHZ A;  2OCC B;  1AJQ A;  5LL6 Y;  2WLI B;  1NKD A;  3BRC A;  2R9I A;  4UVA A;  1KC8 W;  2JEU A;  3AK1 A;  1N36 O;  3K5M A;  2ODM A;  3DC6 A;  1M1K W;  5JCO A;  1TUB B;  4FLT A;  3CRC A;  2PY5 A;  1SER A;  1K3E A;  1P7B A;  4GKJ O;  1COW G;  5EYP B;  1Q3E A;  3HB3 B;  1EBO A;  4AIL C;  1SQX H;  1EN5 A;  1GMG A;  3ZHT A;  5A2Q N;  5IYD O;  1FKA O;  4TT3 G;  4LWS A;  4ZKI A;  1O9G A;  1H8E G;  3JD1 A;  1CP9 A;  1IDS A;  4ZIB A;  4CC5 A;  1XNR O;  1ZUQ A;  1MA1 A;  3W7X A;  5CA3 A;  3E89 A;  3HR0 A;  4ZHQ A;  5GW7 A;  5IT9 N;  2HHH B;  1K5Q A;  1GM9 A;  3UCS C;  3ZMV A;  5LMU B;  4I0X A;  2P7T C;  4WBN A;  1FFX A;  2OWO A;  2HP8 A;  3JAS B;  4NTW A;  1VQP V;  1Z5V A;  4MVU A;  4JZ2 A;  4LNU A;  2B1I A;  1BT8 A;  2HKO A;  4LH7 A;  1N34 O;  3FFQ A;  1GK9 A;  4OX9 O;  2XAH A;  3UO3 A;  4DRX A;  2Q9L A;  4WFE A;  4DR3 O;  3ABL C;  3BHP A;  3B8N A;  4X65 B;  1N32 B;  4BAY A;  1R73 A;  1QQC A;  4H33 A;  3CXH F;  1MSW D;  2X7R B;  1FJG O;  2VS0 A;  3B09 A;  1DF5 A;  1J95 A;  4UV8 A;  4GLX A;  3FB6 C;  5CB4 A;  2N04 A;  1IX9 A;  4NYK A;  4ICG A;  2QKC A;  2PUS A;  4B3T B;  4DV1 O;  2BOC C;  3UQ8 A;  2QEX V;  5JJE B;  3E86 A;  3J80 N;  4O4L B;  5C8Y B;  1HR0 B;  4X1K B;  2YUA A;  1NS1 A;  2YID A;  3ETE A;  3JD0 A;  3RYF B;  1JVM A;  3ASO B;  3C3T A;  4F6R A;  3AG7 A;  4IL6 Z;  3BVO A;  3K79 A;  2RN9 A;  4EB6 B;  1B6Q A;  4PI2 A;  4I55 A;  2EIM C;  5EZY B;  4EKW A;  3SJQ C;  3KCX A;  2GTA A;  3KKY A;  3ZHR A;  1IZ3 A;  2Q8V A;  3D3Q A;  3OD4 A;  2Z5U A;  1V54 B;  1FAF A;  3ASN B;  3N27 A;  4B3S B;  2DW4 A;  1ZWI C;  4HZ3 A;  3ZED A;  1SQB H;  1TVK A;  3O65 A;  3R66 A;  4F4L A;  2N05 A;  3TXS A;  1YEW A;  2M6Y A;  1YI2 V;  4YJ3 A;  4QGP A;  4HNA A;  2JJ1 G;  2AHY A;  1GN4 A;  3LNN A;  1K8A W;  4DV0 B;  2AXT Z;  5A9G A;  2EIN C;  2GDS A;  4O2B B;  2UUA O;  2ADP A;  5ITZ A;  3ZHV A;  1XMQ O;  3K5O A;  3W7S A;  1Q82 W;  1EN4 A;  1XBL A;  5KAF Z;  1M4U A;  1NH2 D;  3SPH A;  1HNW B;  4H44 B;  5CBH A;  4DR5 B;  4JYC A;  3ABK C;  2QSA A;  2CDY A;  4YJ2 A;  2Q69 A;  2X6C A;  1S76 D;  4X66 B;  3JAK B;  3N2G A;  1IBL O;  5B3S C;  4D7S A;  2IBZ H;  1OCZ C;  2PI5 A;  4JAV A;  2A79 B;  1PNM A;  3DXR A;  2D3O W;  1IBM O;  5KX5 B;  2Y4T A;  2IJJ A;  3CX5 F;  2CH7 B;  4Q6G A;  4DXW A;  4PHZ A;  4WCE V;  5L3C A;  4TWK A;  4QIW F;  4FFK A;  2BTQ B;  2GUZ B;  4JI5 O;  5BZB A;  4CS2 A;  4JV5 B;  3AK3 A;  1K7D A;  4TOI A;  3X2Q B;  3ZN1 A;  3ZHU A;  1GM7 A;  2ZCE A;  1CEZ A;  3CE2 A;  3AK2 A;  3B2E E;  3ZBH A;  5CBF A;  4K8X A;  3ZMS A;  4TQF A;  5CBG A;  3TJT A;  1NTM H;  2QWN B;  5EBM C;  4DR2 O;  3SYC A;  2P4V A;  1WP8 A;  3WG7 B;  1IXM A;  3K08 A;  2JEX A;  4B7K A;  3RWR D;  4UCU A;  1OJH A;  3T1Y O;  4LWS B;  2BCC H;  2E74 B;  2PYL A;  2A9H A;  2ZXW B;  4BW5 A;  2QWP B;  1H2M A;  4LH6 A;  1Y76 B;  1L0N H;  5LP6 A;  4J10 A;  4LF5 B;  1SQF A;  4PI0 A;  1VQ8 V;  4ZHQ B;  1SQQ H;  1F23 A;  3AG1 B;  4GKK O;  4I0X B;  4WBN B;  2MW2 B;  1FFX B;  3K03 A;  4G28 B;  1VEW A;  4U7O A;  4LNU B;  3ZHS A;  2P06 A;  3ZX6 A;  2LJ2 A;  5IJ0 A;  3BA8 A;  1WA8 A;  3T4Z A;  4LF8 O;  1K4C C;  1LNQ A;  5AG2 A;  3MD0 A;  1WNS A;  2ZIN A;  2EIL C;  4GX2 A;  3C3S A;  4MVZ A;  3HPL C;  1HNX B;  1PV0 A;  4I4T A;  5CA0 B;  1XI1 A;  1YTF D;  1JPX A;  4JI8 O;  1LR1 A;  1RM1 B;  3SPC A;  3ETQ A;  5B1N A;  5EBW C;  4UCO A;  5CB4 B;  5LGN A;  2UXC O;  2IH3 C;  3HKB A;  2XAJ A;  4KFM A;  2QWQ B;  4JI1 O;  2UUB O;  1SZX A;  4FLV A;  1FD9 A;  3W7T A;  3G80 A;  2Z3Y A;  1VQ9 V;  5B1O A;  1L1F A;  3P3P A;  5F2V O;  1W0K G;  5JJN B;  1VQ4 V;  1US6 A;  3K5L A;  3CRM A;  5LMN O;  4NXM B;  2LFR A;  3K3W A;  1XNQ B;  1N33 B;  2HEP A;  2YEV A;  4DUY O;  3N2K A;  2Q5Z A;  3JAW A;  2QWO B;  1LUW A;  3CSX A;  4F6R B;  1WB8 A;  3F5W C;  2GHY A;  3P30 A;  2AGA A;  4JZG A;  3RYC A;  1GO3 F;  2F4V O;  3CXC U;  4I55 B;  5DN6 G;  2P6J A;  2P67 A;  4LBE C;  4X88 A;  1AR4 A;  4GUN A;  1NTK H;  3DGE A;  3CD6 V;  3K06 A;  5JQG A;  4DV6 O;  4DV3 O;  3WB0 A;  3NR7 A;  4JI0 O;  1QLN A;  2VQE O;  4OPA A;  2Y48 A;  1P4R A;  4L87 A;  3A0R A;  4J9Z B;  5LYJ B;  4FPP A;  2A7W A;  1YJW V;  4MW8 A;  4B3M B;  1TVK B;  1SZT A;  1L8D A;  2XT9 A;  4AI8 A;  3OFN G;  1XHX A;  2RNB A;  4B08 A;  2Q68 A;  2ZDI A;  4R6Z A;  2FL4 A;  4LFA B;  3QO7 A;  2ZQM A;  3ZRS A;  1NVP D;  3WB1 A;  2UXD B;  3I55 V;  2EIJ C;  4QNH B;  1E1Q G;  4IIJ A;  4K0K O;  3LDE A;  3CC7 V;  3OTO O;  1S5J A;  2PYJ A;  4UVB A;  4DV7 O;  1KEC A;  3ICX A;  4PJ0 Z;  4FIP C;  2A06 H;  3MAQ A;  1S5H C;  3KG2 A;  4MT8 A;  1FXK A;  3FB8 C;  5IWA O;  4YJ2 B;  4JI6 O;  4MTX A;  1I94 B;  1H2K A;  4LFC O;  3N2G B;  4TUY A;  4DV5 O;  2ARH A;  3OM3 B;  1AR1 B;  4U7N A;  1K73 W;  1AP6 A;  1QNM A;  3JAL A;  4UB8 Z;  4CH6 A;  3H1L H;  3DXR B;  2QGN A;  4RQE A;  3C90 A;  1BE3 H;  1OCC C;  4ZOL B;  3SYO A;  4EFE A;  5L3F A;  4I50 A;  2EZO A;  1VQ6 V;  2YXY A;  3RT3 C;  1VP7 A;  1K5S A;  1PL4 A;  2ILM A;  2WLL A;  5B1B C;  4JTD B;  2YXL A;  3SJC C;  3MHS C;  4MW3 A;  5FNV A;  3IFX A;  2UU9 B;  3T1H O;  2JJ2 G;  4JI4 O;  4WFF A;  4DR7 O;  1ENV A;  2MK3 A;  1SF9 A;  4DR4 B;  1I0H A;  2LGW A;  3A0B Z;  1HWY A;  1MMM A;  4J80 A;  2FYU H;  2CE4 A;  3O9O A;  1Z5W A;  2DWD C;  2ZKO A;  4X1Y A;  2EX3 A;  3AG4 C;  1QBZ A;  5BXZ A;  3AG3 C;  4RUE A;  2PTM A;  3Q4H A;  3CCJ V;  3AG2 C;  4CH4 A;  4X62 O;  1N0J A;  3OW2 U;  2P5O A;  4EFB A;  1HNZ B;  5EK0 A;  1RP3 B;  2C2A A;  2R72 A;  1FS0 G;  2A3Q A;  3ZJZ A;  3OT7 A;  1Q6H A;  3K0D A;  4XBF A;  5JH7 A;  5H6R A;  3E8H A;  2ATK C;  3W7U A;  4WFG A;  5LP6 B;  2YIB D;  5DED A;  5L3D A;  1FFT B;  2V4D A;  5GTI Z;  1GN6 A;  3LDC A;  3HKC A;  4J9Y B;  3CJH A;  3ZRW A;  4ZI7 A;  3CCM V;  4KHP O;  2XTA A;  2GV9 A;  4IGG A;  2WLJ A;  5LGT A;  5C93 A;  5IYC O;  2DYR B;  2VQF B;  5LXT A;  1MZF A;  1WA8 B;  1NZ6 A;  5B5E Z;  4JAU A;  1OCR C;  3CYO A;  1SS3 A;  3L70 H;  1H5W A;  4D7T A;  1R3I C;  4EEQ A;  1JNB A;  2RJZ A;  2YSU B;  2AZ2 A;  2JS5 A;  2Q7G A;  2YIB A;  5KHK A;  2L6L A;  1Q6I A;  4I4T B;  1V55 C;  3CHX A;  5E79 Z;  3T4D A;  3CCV V;  5KHG A;  1VF7 A;  3JYC A;  4FLU A;  3HKB B;  3CCE V;  3L74 H;  1LUV A;  3OMA B;  5KUM A;  4X64 B;  1KMI Z;  1NT2 B;  4DW0 A;  3F5T A;  1K33 A;  1GH6 A;  3G6B A;  2XOK G;  1SKV A;  4KP4 A;  4JYA O;  1QLE B;  1PKX A;  4DO2 A;  4QPJ A;  3RBZ A;  4FK5 C;  3SPJ A;  4BWA A;  1M56 B;  1XUQ A;  1ZTE A;  2R70 A;  3N2K B;  3OMN B;  3JAW B;  2WSS G;  4DR6 B;  2PI4 A;  4H13 B;  2RMK B;  1R6N A;  1WP7 A;  1J5E B;  3OAA G;  1K34 A;  4B7E A;  3ZCC A;  1QVF U;  1DGS A;  3UKM A;  5J2U B;  2VWK A;  1H2L A;  4LCU C;  5JQG B;  1GKF A;  2NNU A;  4IHJ B;  1CPY A;  4BIZ A;  5CA1 A;  3APO A;  1SQV H;  2H94 A;  1JR9 A;  3CCR V;  1ARO P;  1EZV H;  1YSC A;  3TCU A;  4DK0 A;  1S77 D;  1S3J A;  1R3K C;  1NI8 A;  2Q0A A;  3OE7 G;  1G8M A;  1IJG A;  1Q6U A;  4QJF B;  4YXW G;  4PDM A;  3JAR A;  1HW7 A;  5GON B;  5EBL C;  2OIG A;  3H1I H;  2WA4 A;  4NXN B;  1OZ0 A;  2NR5 A;  2QM7 A;  1AJP A;  2F93 B;  3WU2 Z;  4GYC B;  1R6K A;  1N0N A;  1QR9 A;  4WF9 V;  1EZJ A;  4TV8 A;  1BHA A;  2LGQ A;  2X6B A;  4P2Z A;  3OGI B;  5K1X A;  4FLZ A;  5D5Q A;  1JA8 A;  5EIB C;  1FXK B;  1M57 C;  2QE7 G;  4MS2 A;  4JTC B;  2HHH O;  5LA6 A;  1B06 A;  5LMU O;  4TUY B;  3ZHQ A;  4FM1 A;  4BR6 A;  3CS5 A;  3JAL B;  2EIK C;  2UXB B;  1VF6 C;  5B1A C;  2IU0 A;  5KMG B;  1P84 F;  2GTS A;  3A8T A;  2K1E A;  2ZE7 A;  2UXN A;  4I50 B;  3ABM C;  1JJO A;  1ZAU A;  2WLL B;  3SDL A;  3JSL A;  4X65 O;  1N32 O;  1FXV A;  4FJC C;  1NR1 A;  1ORQ C;  1K9M W;  2KKW A;  4MTF A;  2WLN A;  1F4N A;  1QU7 A;  3H01 A;  3NXS A;  1MG1 A;  4JI2 B;  2N74 A;  1GN3 A;  2JS3 A;  3I5D A;  4LF6 B;  2AW9 A;  4B3T O;  2UXX A;  3SJA C;  3ZMT A;  4ABM A;  2ZE5 A;  4UCV A;  2EBO A;  3B8M A;  3CEI A;  1H2G A;  4X1Y B;  2DE0 X;  1X59 A;  2F43 G;  4GX1 A;  1HR0 O;  2DQ0 A;  2UUC B;  2OCC C;  5J2T A;  4O4J A;  3ZN0 A;  4CZZ A;  4KL1 A;  1Y4M A;  1KBH A;  2IJK A;  1TAE A;  1SA0 B;  1QCE A;  4DR1 B;  5DEC A;  1AP5 A;  2BTO A;  1H2N A;  5KUK A;  3M8A A;  2JIZ G;  3VQV A;  2E76 B;  2OYQ A;  4JI3 B;  4OPH A;  3JAT B;  2GBO A;  5BR8 B;  3HKC B;  2CTP A;  4TQD A; 
#chains in the Genus database with same CATH homology
 1LUW A;  1PL4 A;  1D5N A;  1WB8 A;  1JA8 A;  1LUV A;  1GN2 A;  3DC5 A;  4JZG A;  1VAR A;  1PM9 A;  4YIP A;  3BFR A;  3TJT A;  3K9S A;  1XDC A;  1EN6 A;  1B06 A;  1AR4 A;  4GUN A;  4BR6 A;  4JZ2 A;  1WB7 A;  1BT8 A;  1GN4 A;  1I0H A;  1MNG A;  5A9G A;  2ADQ B;  1XUQ A;  1P7G A;  1MMM A;  1ZTE A;  2GDS A;  4F6E A;  2CE4 A;  2ADP A;  1EM1 A;  3RN4 A;  1XIL A;  1EN4 A;  4E4E A;  1N0J A;  1AR5 A;  2RCV A;  3IC9 A;  1VEW A;  1IX9 A;  1ZLZ A;  2QKC A;  3OT7 A;  1GN3 A;  3MDS A;  1Y67 A;  2CDY A;  1MSD A;  2AW9 A;  2P4K A;  3KDR A;  1AVM A;  5AG2 A;  1ZSP A;  3CEI A;  1BS3 A;  1JR9 A;  1XRE A;  3C3S A;  3AK1 A;  4C7U A;  3LSU A;  3DC6 A;  1GN6 A;  4JYY A;  1BSM A;  1I08 A;  1KKC A;  3C3T A;  4YIO A;  2QKA A;  4FFK A;  1SZX A;  4X9Q A;  1EN5 A;  1IXB A;  3AK3 A;  1AP5 A;  1AP6 A;  3KKY A;  1QNM A;  1N0N A;  1IDS A;  3AK2 A;  3QVN A;  3EVK A;  1ZUQ A;  1MA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...