1JA8A

Kinetic analysis of product inhibition in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic analysis of product inhibition in human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Manganese Superoxide Dismutase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ja8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ja8A02
1XDCA 1I08A 2AW9A 1QNMA 1AR5A 2ADQB 3RN4A 1EM1A 2CDYA 4GUNA 1N0JA 1ZSPA 4F6EA 1GN4A 1ZTEA 1AVMA 3AK1A 1GN3A 1SZXA 2QKAA 3DC5A 1EN6A 1KKCA 3OT7A 4BR6A 1BSMA 1GN2A 3AK2A 3C3TA 1AP6A 1BS3A 1ZLZA 1VEWA 1XUQA 1LUWA 1P7GA 1XREA 4YIOA 1N0NA 3K9SA 1XILA 3C3SA 1IXBA 1MNGA 2QKCA 4YIPA 1Y67A 2P4KA 3AK3A 3KKYA 3QVNA 3LSUA 2ADPA 1WB7A 1MMMA 3TJTA 1AR4A 1D5NA 1PL4A 1JR9A 1B06A 3EVKA 3DC6A 5A9GA 3MDSA 1IX9A 2CE4A 1EN4A 1IDSA 1BT8A 1WB8A 1ZUQA 1LUVA 1EN5A 3CEIA 1GN6A 1AP5A 4JYYA 4E4EA 2GDSA 4JZGA 3IC9A 1MA1A 1MSDA 1PM9A 4X9QA 1VARA 3BFRA 5AG2A 1JA8A 4C7UA 4FFKA 1I0HA 2RCVA 4JZ2A
chains in the Genus database with same CATH superfamily
2CTQA 4I5SA 5CBGA 4NB5A 1FFXA 3ZCCA 1M56B 4DUYB 2PYJA 3OUSA 4PI2A 1H5WA 1K4CC 1BL8A 1N0JA 2YI9A 3U11A 1ZSPA 1OCRB 3RGBA 4Q6GA 1VQOV 3SYQA 5L3EA 3RYIB 5LGNA 2QM8A 4P9PA 1GKFA 1M90W 3B8NA 1VMGA 1SZTA 3SDLA 3UO2A 2FL4A 4NXMB 4LH6A 3QNEA 4PHZA 1ZLZA 2VQFO 5IYZB 2BTOA 1GMGA 4KHPO 3OTOO 1H2LA 2LFSA 2JIZG 3F7VC 2GTSA 5L3DA 1FXHA 3A2FA 1ZL8A 4JI5B 2P22C 2YC0A 3CC2V 4FJCC 4DK0A 4PDLA 3ZHRA 3E8GA 1OCCB 3JD1A 4LF4B 1M93A 3G6EV 4K35A 4QPJA 3CCUV 1Q5OA 4G27B 4JV5O 1KQSU 4FLYA 4B3SB 3JASB 3HB3B 4PA7A 3HPLC 1OCOB 2EIKC 3CS5A 3JSNA 1O9HA 3G71V 1IX9A 1JX9A 4LF6B 5C8YB 4JAVA 4RUFA 1EN4A 1OCZB 5KAFZ 1IDSA 1Q8IA 3F5TA 4DR1B 1QU7A 2QJ1A 3CEIA 3ZN1A 5CB4A 2BTQA 1E1RG 3P32A 3L72H 1OJHA 4JI1B 1U97A 1UFIA 4GKJO 1WPXA 4LCUC 4X8AA 5KHHA 2AW9A 4P2ZA 4X64O 2ZE5A 4BW5A 5FLXN 4UCTA 2IJKA 5EYPA 4QGPA 2PY5A 3DXRA 4CZZA 1GN3A 3JD4A 4MVSA 2ZIMA 1L0NH 4X20B 2DYSC 1S3JA 2B9ZA 4O2AB 2ODMA 4FM2A 2CUGA 3C3TA 1JQ0A 3JAWB 3K0DA 4LF8O 1XUQA 3OE7G 2JVDA 1ENVA 3K79A 1H2KA 2JEXA 4TV8B 4DR1O 4QE9A 3HKBB 1KD1W 3JSLA 4LF9B 3CCEV 4EB6B 5BR8O 1SQFA 2F93B 4O2BA 4MVMA 4PA9A 1BZKA 1MG1A 4NTXA 1JPXA 2DQ3A 1DF4A 1Y6XA 1NJIW 2E5LB 2EX3A 2XOKG 2IU3A 1BGYH 4KXRA 1KUQA 2ZXWB 4O4LA 1SQQH 1FJGO 5JCOC 3ETDA 1BT8A 1ZUQA 1IVSA 5EBWC 2R72A 3SJQC 2P7TC 1V55B 1VF7A 1AP5A 1WN7A 2XAJA 5H5NA 3F7YC 1V9PA 4FPPA 1NVPD 5LYJB 2HHHB 2Q0OC 1PM9A 1EZVH 1IJGA 5B3SB 3E8BA 1VF5B 1VP7A 3FB7C 3QG5A 4JI3B 5LGTA 2A9HA 3E8HA 3IJ4A 4R8CA 4GX5A 1SERA 3RN4A 2OTJV 1U96A 1BCCH 1MZEA 1EM1A 1GK9A 4Z1VA 3HKEB 1GN4A 2VS0A 1IXMA 4NKGB 3RYFB 1SZXA 1IBKO 1YEWA 1NZ6A 5KMGA 5JH7B 3SPJA 1H38A 1AP6A 1NU1H 3Q4HB 3L70H 1H2GA 3T4DA 4I4TB 2QE7G 2F66C 1FXVA 1SQPH 4H13B 3AG1B 5IYDO 1N33O 2YEVA 1Y74A 1KU9A 2JGUA 5KA6A 4W4LA 1X4TA 1W59A 5J2UA 3BRCA 4JF3A 1Q86W 4OX9B 2P4KA 1F23A 3ZMSA 3K0GA 3LSUA 1SQVH 3ZN0A 4BWAA 2OIGA 1BQ0A 3K9AA 4ZBMA 1F4MA 5IJ0A 1XMOB 2Q7HA 2RMKB 5B5EZ 5L3CA 2ZINA 2GUZA 5LHIA 3IC7A 3CCJV 3ZRWA 1NR7A 4FFBB 1XNRO 4BAYA 1WAZA 2OCCC 3LDCA 4LFAB 4DV6O 4LF7B 1S5HC 2VQEO 1YITV 1KC8W 2FYUH 3HKCB 1PL0A 1ZWIC 4I55B 2JJ1G 3JCUZ 1K34A 1JMKC 2ITCC 3N2KB 1TUBB 2EJ7A 4J9YB 3SPCA 2EIJC 3G4SV 4DR2B 3D3IA 4FLZA 4B3SO 4DK1A 2UU9B 2QWRB 1COWG 3ABUA 1QR9A 4X1KB 2HJDA 4FZ1A 4LNUA 1SQXH 3AK1A 3JARB 4ZI7A 4FM1A 3SGIA 4JI7B 2OWOA 2KKWA 5IWAO 2DOSA 1Y76A 2WLMA 2ZE7A 4HBNA 1Q43A 4X1YA 5JCOA 2A3QA 2BSKB 4U3JB 3WU2Z 4EEQA 5JJEB 4WCEV 2UU9O 2HEPA 5IYCO 4J7ZA 2V4DA 2JK5C 3R66A 1F51A 1MZFA 1Q3EA 2UUCB 3SYCA 1R3KC 1WP7A 4DW0A 4IGGA 2OCCB 1AI5A 3AG3B 5E79Z 1YCIA 2JRIA 1YSCA 5IYZA 3G6BA 2AZ0A 1Q7YW 3FKSG 1P84F 3E2EA 2PZSA 2IM9A 4ZIBA 1JR9A 2P5OA 4PA6A 5B1OA 4WFGA 3S3XA 4PJ0Z 2ARHA 4DRXA 1XMQO 1KB9F 4CC5A 3ZRSA 4E2LA 1M5IA 4DV4O 1K8AW 1Z5WA 5BZBA 3UT5A 4J7JA 3BA9A 4JZGA 2UXCB 1RSOA 5LP6C 1R73A 3DXRB 3GWKC 3SR2C 5IJ0B 2LW7A 4X9QA 3K5MA 1VARA 4IYHA 5HFLA 3SPGA 2R9AA 2OIEA 1XDCA 2LGQA 4MTGA 4RO2A 1QNMA 2ZQMA 2Q5ZA 3CMEV 1M57C 1Y4MA 4J9ZB 4FZ0A 4DW1A 2DWDC 4J80A 4HYOA 2D3OW 4ZOLB 4TV9A 3W7UA 3CE2A 1AVMA 4I7ZB 1D5AA 3T2MA 2NNUA 3ZMZA 1F7YA 1KKDA 3RYIA 2RQ6A 2UUAB 5ITZB 1THZA 3UQ8A 1SRYA 2GBOA 4PI0A 3WFVA 2RN9A 5L3FA 2HR3A 4JV5B 4XDLA 3ZX6A 3T1YO 2QM7A 5BXZA 3R65A 1BHBA 4JI4B 4JI4O 4UVCA 3BVOA 2MK3A 3C3SA 5B1NA 4JI8O 5JVDB 2ZE6A 2F23A 1S5LZ 2WLIA 3MAQA 4DV6B 3FAVA 3OD4A 5KX5B 1WLEA 2QKCA 5H2FZ 4HNAB 3ZJZA 2M7WA 1VF6A 1YI2V 4O4JA 3CCVV 3K03A 4FMTA 2EIJB 1VQ5V 4Z2WA 5CBFA 4IYIA 3OMAB 3T1HB 4KHPB 3IFXA 1FKAO 3JD3A 1XI1A 1WA8A 3ZRVA 4NXMO 5CMUA 4K8ZA 4LF7O 2YIBD 1NBMG 4LFBB 1JFFA 5GTHZ 1DLBA 3B40A 2LW1A 1P4RA 3ETEA 2G38A 3LNMB 3RVZA 2Q68A 2F4VO 4UCVA 4B3TB 4X65B 4MVUA 3DTUB 3CCLV 1XMOO 5FNVA 4RQFA 1OV9A 5DM6V 1NT2B 1ZL8B 4ABMA 1OCZC 4WFFA 1HW7A 2AHZA 3UO3A 4DV0B 3JAKA 4DV4B 5KMGB 2HVKC 2QDOA 1QBZA 5BY1A 2ADQB 2L35A 5IJ9B 5CA1B 4B3RB 2P06A 3O65A 4UCOA 1IBMO 5BMVA 1B3QA 4JI1O 1Z5VA 3AG1C 1YJ9V 3I56V 1BE3H 1VQ6V 4DYLA 3DSQA 2IU0A 2VWKA 1N32O 1PNLA 1D2DA 5IT9N 1QLEC 4TQFA 4DV3B 3B8MA 3GVMA 3OM3B 1VEWA 2N74A 1SETA 1XREA 5DECA 2P90A 3ZHTA 4R50A 1KECA 3RW0A 2QWNB 3K57A 4J42A 4EB6A 5L3GA 4GLXA 4LF4O 1R6TA 1L8DA 1G8MA 3J81N 3C90A 1NTMH 4CS2A 2HJFC 2GTAA 4AQYO 5DEDA 5H9CA 1LR1A 3TJTA 5FPRA 1M56C 1RP3B 3G67A 1HNWB 3FYIB 2R9IA 3EVKA 3SPHA 1JJ2U 3NXSA 3KCXA 1FPOA 3CD6V 1G4YB 3ZMUA 2DYSB 4JGSA 2N04A 4TOIA 5LA6A 3PJSK 4JI2B 3L74H 5IYBO 3ETQA 2L6LA 2XAQA 3DGEA 3H01A 1IBLB 2VWJA 2PGGA 3APOA 2QTOA 3K59A 2XHBA 1K33A 1E1QG 3CB2A 1NH2B 3RT3C 3CPWU 4RWUA 1DTOA 4L8JA 4YXWG 5CN0A 3BFRA 2W0FC 3JARA 4IIJB 1M57B 2IJHA 4FVMA 4WFBV 3OAAG 5JQGA 5B66Z 3H1JH 2BE3A 2YICA 2WPDG 2QGNA 3IAYA 4DR5B 2BSKA 4I50B 4U3FH 5KUMA 2JDIG 2VQFB 4MSWC 3TXQA 2N05A 4DR4O 1XNQB 4LF5B 2QM4A 2WAMA 1B04A 3X2QC 1R3JC 2DQ0A 2JJ2G 5JWPA 4O2BB 2WLJA 2ZCEA 1SESA 1I94B 1B6QA 2R9RB 4JTCB 4B7EA 1CPYA 4QNHB 1SA0A 3T1HO 4UFZA 2PI4A 4QPKA 3CRAA 2CTRA 4DV3O 3H9VA 2Q9LA 1MMMA 3A8TA 3QO7A 2B5UA 1QR8A 2PUSA 2YXHA 2XUMA 2Q7GA 1VQKV 4G2KA 4R7CA 4HZ3A 4PA3A 1K97A 2HG5C 1PPJH 3P3NA 2CTWA 1HNZO 1EN5A 4DV2B 4PV1B 1HNWO 2E3CA 4UUJC 5B3SC 1JCHA 3CSXA 2DWEC 2KG7B 1OCOC 1Y74B 4JI6O 1Q6IA 4ICGA 3P30A 3GWOA 2YIAA 2A7WA 3UKMA 4I55A 5ITZA 2E76B 3ASOB 2UXBO 5F2VO 2Y48A 3LDEA 3B77A 2ZXWC 1HP8A 3AG2B 4IL6Z 4P9OA 2EZPA 4WFAV 5EYPB 4B3MB 1XNQO 1R3IC 3KDRA 5LOVA 4F6EA 2F95B 1PNKA 3S3WA 3TCUA 4F6RB 4AI8A 3HR0A 3RYHA 1XL4A 2GUZB 4DUYO 4PELA 2IJJA 4DR5O 4FFBA 4DR2O 3AK2A 3N2GA 4BIZA 1IBMB 5TISZ 4U3JA 3ABMC 3SJCC 4NVPA 4YHHB 1TUEB 4WFEA 4J10A 2QWQB 2W6JG 3ETGA 2WLHA 1GH6A 2DN9A 1K5QA 1NH2D 2BOCC 1AJQA 2ITDC 3SYOA 1VQPV 4LF8B 2CGOA 2ZE8A 1WJZA 1Y67A 2M6YA 1HR0B 2X6BA 3JALB 5KHGA 4O4IB 2FB5A 3RYCB 1J5EO 3E89A 3E83A 4PDMA 3W7SA 5B1AC 4XDKA 4LNUB 2DYRC 5EBMC 1VQMV 4P30A 3HKDB 1S77D 1Z2GA 3W7XA 4DXWA 5CBHA 1GRJA 2EBOA 4MVQA 2H94A 5KHIA 3BCCH 2ZKOA 4BW9A 4AQYB 3EXAA 4X64B 3WB0A 2Q4PA 5KLVH 5LMNB 3AG2C 2OCHA 2ZR2A 1S72V 5BMVB 2RJZA 3M99B 1JA8A 3OR7C 4JZ2A 1I5YA 1ZAUA 3K3WA 3U0ZA 1A32A 4DUZB 1XOUA 5KHJA 3CYOA 4X1YB 1F4NA 3LSQA 3CHXA 3L71H 3SPIA 2ZIOA 4LF6O 2CDYA 5LHHA 2F43G 2XT9A 4YJ2B 1DK1A 5JJJB 3G80A 4LBEC 3OR6C 5LL6Y 4ZKIA 3MHSC 3T1CA 1SS3A 2QKAA 3OMNB 5D5PA 2GV9A 2EINC 1YTFD 2UUAO 1KKCA 3LNNA 2X6AA 1HNXB 3MD0A 4X62B 3EHBB 5IJ9A 2Y69C 4FLWA 2X0LA 3WB1A 3LDDA 4UV9A 1QVFU 3BEHA 1VQ9V 2B1GA 2CK3G 1N0NA 2UUCO 1YDXA 4R6ZA 5LOVB 2R70A 4EFBA 1WNSA 3APQA 1TVKA 3FD9A 1CEZA 1H2SB 1I94O 5LA6B 1TAEA 3J80N 3AEIA 3JD2A 2EZOA 3JAMN 3N2GB 4I9QA 2EINB 2QSAA 5KAIZ 2PTMA 2LO1A 1W2BU 4H37A 2QTSA 2Y0PA 3OGCC 4ZOLA 4TV9B 1JNBA 1N32B 2C2AA 1AJPA 1W0JG 4X1IB 1K7DA 1FXKC 1UJWB 3ABKB 4JAAA 5EZYA 2OTLV 2HKOA 3D36A 1MSWD 4JPRA 4I0XB 1AI7A 3UCSC 3BABA 1EZJA 2RDCA 4N23A 1FOUA 4L87A 3CRQA 5K1PA 4D6TH 1EFRG 2YUAA 3D3QA 2Q6AA 1I08A 3FB6C 2IH1C 4JYCA 5EC2C 1N36B 5EK0A 4N21A 1WA8B 1SA0B 2Q7EA 3E22B 2ZNIA 3CP1A 2Z3YA 3FFQA 2HP8A 3DC5A 2O57A 2WWWA 1KYOF 1VQ8V 1FXKA 4H44B 3ZHUA 3ZMVA 2LFRA 1I5XA 4DV7B 1K92A 2E5LO 3LSSA 3J7AU 2NLJC 4JTDB 3IGAC 2AZ2A 1SQBH 4PDVA 2D2CB 1Q6HA 4MTFA 1X59A 2PF4E 4GCZA 2JEUA 1HDJA 1PP9H 1XMQB 5J2TA 3QF7A 1GM9A 1IBKB 1AR4A 3JATB 4LFAO 3A0RA 4X89A 5H6QA 1QLEB 1R1BA 3NR7A 2ZT9B 4F4LA 5A9GA 5GONA 4YJ3B 2PI5A 1KP3A 3JD0A 1JJOA 2IBZH 1DGSA 1RM1C 3ASOC 3VQYA 1QHTA 1QQCA 5LP6B 4DUZO 4UCRA 4TSFG 4JYYA 4E4EA 2WLNA 5IDJA 3OFNG 1E79G 1MA1A 2LQTA 3OTOB 3RFRA 3JYCA 4DV1O 3FAVB 1KP2A 4GX2A 4X1IA 3OTFA 4EFEA 3BAAA 1N34O 5CA0B 2F4VB 1RPRA 3K5OA 4UB6Z 4O4JB 5IY5B 4TUYB 3BPZA 4JYBA 4I0XA 3D8CA 3VQVA 4IHJB 2DJVA 4GKKB 1NR1A 2ETNA 1ZTEA 3RBZA 3T1YB 2UXXA 2EJRA 4JAUA 5LHGA 2ILMA 2W0XA 1BSMA 4YY3O 1S0VA 3ML0A 1P49A 3RWRD 1WP8A 3CJHB 2CH7B 2IW5A 2P67A 5KA5A 2XAGA 1XILA 4GKKO 1S76D 3B4SA 5JVDA 4U7OA 1L1FA 3EFFK 2HFEC 5JQGB 5KUKA 5KHKA 2XASA 1FXKB 4LFBO 1XNRB 3FB8C 4NYKA 4GX0A 3ASNB 3H1IH 2FTKA 3CCMV 4UXNA 1LNQA 5LXTB 2K1EA 3N27A 4O4HB 4AHCA 1Y66A 4CS3A 3ZEDA 4KFMA 3MHHC 3E86A 1PL4A 2JS3A 2CTPA 1RPOA 4QIWF 1BHAA 2UXCO 5J9PC 3ABMB 3ABTA 2Z0AA 4DR3B 1RM1B 4ZHQB 1OZ0A 5D5QA 4LR3A 2CE4A 4EKWA 5BR8B 5HFMA 3CCQV 3I55V 1HNZB 4O4IA 2EILB 1LUVA 1M4UA 5J2TB 3A0HZ 3E35A 1VQLV 4K0KB 4JTAB 3KG2A 1XHZA 1QCEA 3JATA 3ZRXA 4TWKA 4KL1A 4LFCO 3D36C 4DR6B 2YXYA 1RFYA 1MSDA 1K5SA 4PA4A 2Y4TA 1I0HA 4X66O 1BQZA 5DN6G 2UUBB 3B2EE 4UVAA 1AR5A 5CA1A 3CMAV 3JASA 3WG7B 1VIBA 3ZIAG 3K5LA 4A5UB 4CH3A 1J95A 4K0KO 1N34B 1R6KA 5LMNO 3A0BZ 4FLVA 1EN6A 4AILC 1ZX3A 2HLDG 1N4CA 5FL7G 4I9WA 4MVZA 2MW2B 4TUYA 2Q8VA 2E75B 1SF9A 2KG7A 1ROPA 4CC6A 1VQNV 1QLNA 4D7SA 3OEHG 1NTKH 3FX7A 4RQEA 1Q82W 2WLLA 1IXBA 2UXDO 1GAXA 2LJ2A 4KUMA 3AG4C 4IIJA 1SQGA 3AG4B 2W6IG 1URFA 5A2QN 4JI0B 4YIPA 3QVNA 3LUTB 5EIBD 2ADPA 2Y0IA 2WSSG 1FFXB 1YZBA 1NVPB 1FAFA 2DYRB 1CP9A 4NTYA 4I50A 4J11A 1YVWA 5FPOA 2ATKC 4WBNA 3CRCA 3VOUA 2FMLA 4UVBA 3ZHVA 1G6UA 2QWOB 5EBLC 1YIJV 1R3LC 3X2QB 3I5DA 2ZDIA 3BHPA 1GN6A 5LXTA 4B08A 4B7KA 1Q81W 2A79B 4ASUG 3ZHQA 4X65O 3RVYA 2VQEB 2AXTZ 1J5EB 3GB7C 2YIDA 3ZS8C 1K4DC 1M9NA 3KCYA 1FJGB 2BCCH 1G1XB 3P3PA 3SJBC 4FFKA 2XAHA 4BIOA 2XNDG 3CCSV 1GO3F 2A06H 1AR1B 2GHYA 3RYCA 3OW2U 3K04A 4JI0O 4FIPC 2V1DA 4W4KA 2YSUB 3L9DA 4YJ2A 1EBOA 4JI6B 5GTIZ 3K5NA 2UXNA 2XAFA 2YDEA 3HKDA 1H8EG 2Y69B 1MABG 1N8RW 2V7QG 5LBQA 1VQ4V 3CXHF 3L75H 1O9GA 1IZ3A 1NKDA 3OT7A 4LF9O 1V54C 4BR6A 4LWSA 4LP8A 4UB8Z 5IY5C 1PKXA 3CRRA 1BS3A 4WF9V 4XDJA 5B1BB 2QA4V 1LUWA 4B3MO 4I4TA 2EULA 4UV8A 3AG7A 4OGQB 4DR7O 3QO5A 3WG7C 3ABLB 1BMFG 4B3RO 5EIBC 4JASA 5J2UB 2XTAA 2JGDA 3AK3A 2P4VA 3STZC 3K08A 1V54B 3E8FA 1YF2A 2UUBO 2QR4A 4J41A 1WB7A 4X66B 1XQ8A 2PYLA 4DV0O 3UM7A 2H3OA 4H0LB 4DV2O 1AROP 1NS1A 2AHYA 2ZDIC 4F6RA 2ZM6O 4UCUA 5C8YA 2RNBA 3U10A 1HWYA 1WB8A 4JI3O 1N33B 3ZMTA 2KQXA 3SJAC 5LMUO 2FKXA 3VQWA 4DR3O 4QJFB 2QWPB 2YEVB 4IHJA 4QE7A 1KMIZ 4TV8A 3W7WA 4TQDA 1XEQA 1YJNV 3H1HH 1US6A 2RCVA 2H8PC 3CCRV 1PNMA 3CXCU 5LP6A 4DR7B 2Q67A 3H1LH 4MVRA 1TGOA 1Q6UA 3ICXA 3RYHB 1XHXA 3T4ZA 1NTZH 4D7TA 4DO2A 4O4LB 4CH6A 5EZYB 1GN2A 3ZBHA 1FS0G 3TK1A 5EC1C 3JAWA 2HHHO 1ORQC 2EIMC 2A0LA 1FYJA 4DV1B 1DF5A 4DV5O 3JCZA 2YS8A 3K58A 1XL6A 4JI8B 4B3TO 5LYJA 3HKBA 3TETA 5LMUB 1CXZB 4NR1A 1K73W 4Q20A 1TA8A 1TUBA 3JALA 5JH7A 4FM0A 3OEEG 3Q4HA 4CH4A 3OGIB 4CBCA 5CB4B 4DV5B 4UCSA 4MW3A 4HAMA 2UXDB 1UPGA 1KBHA 2B1IA 1N36O 1VF6C 3HKEA 4OPHA 4ZI7B 1Q90D 4K8XA 2KB1A 4X88A 3FYEB 4DRXB 4JI2O 2X6CA 4FLTA 4MVOA 2K9PA 1SKVA 2WA4A 3L73H 3CRMA 2OYQA 4RAIA 4GZRB 5K1XA 3M7MX 2CAZC 3UT5B 4TT3G 3E22A 3OUFA 4LFCB 4DR6O 1FFTB 3H1KH 2QKSA 1VQ7V 1TVKB 2Q69A 5L3BA 4X20A 2Y4UA 3CC4V 1GM8A 4O2AA 3SYAA 3K06A 5LGUA 3QTCA 5H6RA 2DE0X 2Q0AA 4MTXA 3CWBH 3WB2A 2KSDA 2ZNJA 5GONB 3M8AA 3VQXA 1OCRC 5GW7A 5CA3A 3KZIZ 4KP4A 2YXLA 2IJIA 1FD9A 4DV7O 2WLKA 2WA3A 1H8HG 3O9OA 2DW4A 4MTOA 5IWAB 2QEXV 2HVJC 4MT8A 1P7GA 1OCCC 1PV0A 2Z5UA 4YJ3A 1HNXO 2CGNA 5KX5A 2E74B 4U7NA 2NN4A 5CA0A 3N2KA 2VRZA 4H33A 4NXNO 3THOA 3CX5F 4PD4F 3TXSA 4MS2A 4JI7O 1D5NA 1W0KG 5IE9A 4K3AA 2YIBA 1PD3A 3DC6A 1AI4A 1I7FA 3BA8A 5B1AB 4ZHQA 1IBLO 4NTWA 1AILA 1S5JA 1R6NA 4LF5O 1Y76B 1AJNA 3CC7V 1YHQV 4OXSA 3ABLC 5C93A 3ABKC 2GDSA 1K9MW 4Z1MG 2IH3C 2EIKB 5FNVB 1H2NA 4WBNB 5B1BC 1NI8A 1HR0O 2Q73A 1JVMA 2ZD9A 3RYFA 1JOYA 1V55C 3JAKB 1MOFA 3QO8A 4X62O 2UXBB 2AGAA 4DR4B 5E1AC 3B09A 3CJHA 4OX9O 3FB5C 2CH7A 4O4HA 4GUNA 2ZM6B 4MW8A 4FLXA 4GYCB 2EIMB 1L0LH 4PDRA 2BOBC 1JFFB 4YY3B 2JS5A 3ZHSA 4CH5A 2EILC 1P7BA 3TGUH 2JGDB 2OT5A 4GX1A 4RUEA 4FK5C 2NR5A 1OHHG 4GT1A 3W7TA 1M1KW 4JYAB 1T5EA 1GM7A 4YIOA 3K9SA 4FLUA 2LP7A 2WLLB 1YTFB 4LC1A 4NXNB 1MNGA 3ASNC 1YXBA 1WPBA 1QVGU 1IURA 1H2MA 1AI6A 4LWSB 1SC5B 3OMIB 3KKYA 1YJWV 2GSMB 4IT5A 3ZRWB 1NQTA 3VBBA 2BTQB 2F1MA 2P6JA 3STLC 2DMXA 1B06A 4XBFA 3MDSA 2WLIB 5JJNB 3HKCA 3AG3C 4HNAA 4GKJB 1XBLA 1K3EA 1GTOA 2ZR3A 1AB3A 3F5WC 4G28B 2LGWA 2X7RB 4BIUA 4JI5O 1RSOB 4LH7A 2YI8A 4JYAO 4X1KA 3IC9A 4WFHA 3PN1A 4CS4A 4J7KA 5AG2A 3BY6A 3SYPA 4C7UA 4YHHO 4OPAA
chains in the Genus database with same CATH topology
1XDCA 1I08A 2AW9A 1QNMA 1AR5A 2ADQB 3RN4A 1EM1A 2CDYA 4GUNA 1N0JA 3KDRA 1ZSPA 4F6EA 1GN4A 1ZTEA 1AVMA 3AK1A 1GN3A 1SZXA 2QKAA 3DC5A 1EN6A 1KKCA 3OT7A 4BR6A 1BSMA 1GN2A 3AK2A 3C3TA 1AP6A 1BS3A 1ZLZA 1VEWA 1XUQA 1LUWA 1P7GA 1XREA 4YIOA 1N0NA 3K9SA 1XILA 3C3SA 1IXBA 1MNGA 2QKCA 4YIPA 1Y67A 2P4KA 3AK3A 3KKYA 3QVNA 3LSUA 2ADPA 1WB7A 1MMMA 3TJTA 1AR4A 1D5NA 1PL4A 1JR9A 1B06A 3EVKA 3DC6A 5A9GA 3MDSA 1IX9A 2CE4A 1EN4A 1IDSA 1BT8A 1WB8A 1ZUQA 1LUVA 1EN5A 3CEIA 1GN6A 1AP5A 4JYYA 4E4EA 2GDSA 4JZGA 3IC9A 1MA1A 1MSDA 1PM9A 4X9QA 1VARA 3BFRA 5AG2A 1JA8A 4C7UA 4FFKA 1I0HA 2RCVA 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDC A;  1I08 A;  2AW9 A;  1QNM A;  1AR5 A;  2ADQ B;  3RN4 A;  1EM1 A;  2CDY A;  4GUN A;  1N0J A;  1ZSP A;  4F6E A;  1GN4 A;  1ZTE A;  1AVM A;  3AK1 A;  1GN3 A;  1SZX A;  2QKA A;  3DC5 A;  1EN6 A;  1KKC A;  3OT7 A;  4BR6 A;  1BSM A;  1GN2 A;  3AK2 A;  3C3T A;  1AP6 A;  1BS3 A;  1ZLZ A;  1VEW A;  1XUQ A;  1LUW A;  1P7G A;  1XRE A;  4YIO A;  1N0N A;  3K9S A;  1XIL A;  3C3S A;  1IXB A;  1MNG A;  2QKC A;  4YIP A;  1Y67 A;  2P4K A;  3AK3 A;  3KKY A;  3QVN A;  3LSU A;  2ADP A;  1WB7 A;  1MMM A;  3TJT A;  1AR4 A;  1D5N A;  1PL4 A;  1JR9 A;  1B06 A;  3EVK A;  3DC6 A;  5A9G A;  3MDS A;  1IX9 A;  2CE4 A;  1EN4 A;  1IDS A;  1BT8 A;  1WB8 A;  1ZUQ A;  1LUV A;  1EN5 A;  3CEI A;  1GN6 A;  1AP5 A;  4JYY A;  4E4E A;  2GDS A;  4JZG A;  3IC9 A;  1MA1 A;  1MSD A;  1PM9 A;  4X9Q A;  1VAR A;  3BFR A;  5AG2 A;  1JA8 A;  4C7U A;  4FFK A;  1I0H A;  2RCV A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 2CTQ A;  4I5S A;  5CBG A;  4NB5 A;  1FFX A;  3ZCC A;  1M56 B;  4DUY B;  2PYJ A;  3OUS A;  4PI2 A;  1H5W A;  1K4C C;  1BL8 A;  1N0J A;  2YI9 A;  3U11 A;  1ZSP A;  1OCR B;  3RGB A;  4Q6G A;  1VQO V;  3SYQ A;  5L3E A;  3RYI B;  5LGN A;  2QM8 A;  4P9P A;  1GKF A;  1M90 W;  3B8N A;  1VMG A;  1SZT A;  3SDL A;  3UO2 A;  2FL4 A;  4NXM B;  4LH6 A;  3QNE A;  4PHZ A;  1ZLZ A;  2VQF O;  5IYZ B;  2BTO A;  1GMG A;  4KHP O;  3OTO O;  1H2L A;  2LFS A;  2JIZ G;  3F7V C;  2GTS A;  5L3D A;  1FXH A;  3A2F A;  1ZL8 A;  4JI5 B;  2P22 C;  2YC0 A;  3CC2 V;  4FJC C;  4DK0 A;  4PDL A;  3ZHR A;  3E8G A;  1OCC B;  3JD1 A;  4LF4 B;  1M93 A;  3G6E V;  4K35 A;  4QPJ A;  3CCU V;  1Q5O A;  4G27 B;  4JV5 O;  1KQS U;  4FLY A;  4B3S B;  3JAS B;  3HB3 B;  4PA7 A;  3HPL C;  1OCO B;  2EIK C;  3CS5 A;  3JSN A;  1O9H A;  3G71 V;  1IX9 A;  1JX9 A;  4LF6 B;  5C8Y B;  4JAV A;  4RUF A;  1EN4 A;  1OCZ B;  5KAF Z;  1IDS A;  1Q8I A;  3F5T A;  4DR1 B;  1QU7 A;  2QJ1 A;  3CEI A;  3ZN1 A;  5CB4 A;  2BTQ A;  1E1R G;  3P32 A;  3L72 H;  1OJH A;  4JI1 B;  1U97 A;  1UFI A;  4GKJ O;  1WPX A;  4LCU C;  4X8A A;  5KHH A;  2AW9 A;  4P2Z A;  4X64 O;  2ZE5 A;  4BW5 A;  5FLX N;  4UCT A;  2IJK A;  5EYP A;  4QGP A;  2PY5 A;  3DXR A;  4CZZ A;  1GN3 A;  3JD4 A;  4MVS A;  2ZIM A;  1L0N H;  4X20 B;  2DYS C;  1S3J A;  2B9Z A;  4O2A B;  2ODM A;  4FM2 A;  2CUG A;  3C3T A;  1JQ0 A;  3JAW B;  3K0D A;  4LF8 O;  1XUQ A;  3OE7 G;  2JVD A;  1ENV A;  3K79 A;  1H2K A;  2JEX A;  4TV8 B;  4DR1 O;  4QE9 A;  3HKB B;  1KD1 W;  3JSL A;  4LF9 B;  3CCE V;  4EB6 B;  5BR8 O;  1SQF A;  2F93 B;  4O2B A;  4MVM A;  4PA9 A;  1BZK A;  1MG1 A;  4NTX A;  1JPX A;  2DQ3 A;  1DF4 A;  1Y6X A;  1NJI W;  2E5L B;  2EX3 A;  2XOK G;  2IU3 A;  1BGY H;  4KXR A;  1KUQ A;  2ZXW B;  4O4L A;  1SQQ H;  1FJG O;  5JCO C;  3ETD A;  1BT8 A;  1ZUQ A;  1IVS A;  5EBW C;  2R72 A;  3SJQ C;  2P7T C;  1V55 B;  1VF7 A;  1AP5 A;  1WN7 A;  2XAJ A;  5H5N A;  3F7Y C;  1V9P A;  4FPP A;  1NVP D;  5LYJ B;  2HHH B;  2Q0O C;  1PM9 A;  1EZV H;  1IJG A;  5B3S B;  3E8B A;  1VF5 B;  1VP7 A;  3FB7 C;  3QG5 A;  4JI3 B;  5LGT A;  2A9H A;  3E8H A;  3IJ4 A;  4R8C A;  4GX5 A;  1SER A;  3RN4 A;  2OTJ V;  1U96 A;  1BCC H;  1MZE A;  1EM1 A;  1GK9 A;  4Z1V A;  3HKE B;  1GN4 A;  2VS0 A;  1IXM A;  4NKG B;  3RYF B;  1SZX A;  1IBK O;  1YEW A;  1NZ6 A;  5KMG A;  5JH7 B;  3SPJ A;  1H38 A;  1AP6 A;  1NU1 H;  3Q4H B;  3L70 H;  1H2G A;  3T4D A;  4I4T B;  2QE7 G;  2F66 C;  1FXV A;  1SQP H;  4H13 B;  3AG1 B;  5IYD O;  1N33 O;  2YEV A;  1Y74 A;  1KU9 A;  2JGU A;  5KA6 A;  4W4L A;  1X4T A;  1W59 A;  5J2U A;  3BRC A;  4JF3 A;  1Q86 W;  4OX9 B;  2P4K A;  1F23 A;  3ZMS A;  3K0G A;  3LSU A;  1SQV H;  3ZN0 A;  4BWA A;  2OIG A;  1BQ0 A;  3K9A A;  4ZBM A;  1F4M A;  5IJ0 A;  1XMO B;  2Q7H A;  2RMK B;  5B5E Z;  5L3C A;  2ZIN A;  2GUZ A;  5LHI A;  3IC7 A;  3CCJ V;  3ZRW A;  1NR7 A;  4FFB B;  1XNR O;  4BAY A;  1WAZ A;  2OCC C;  3LDC A;  4LFA B;  4DV6 O;  4LF7 B;  1S5H C;  2VQE O;  1YIT V;  1KC8 W;  2FYU H;  3HKC B;  1PL0 A;  1ZWI C;  4I55 B;  2JJ1 G;  3JCU Z;  1K34 A;  1JMK C;  2ITC C;  3N2K B;  1TUB B;  2EJ7 A;  4J9Y B;  3SPC A;  2EIJ C;  3G4S V;  4DR2 B;  3D3I A;  4FLZ A;  4B3S O;  4DK1 A;  2UU9 B;  2QWR B;  1COW G;  3ABU A;  1QR9 A;  4X1K B;  2HJD A;  4FZ1 A;  4LNU A;  1SQX H;  3AK1 A;  3JAR B;  4ZI7 A;  4FM1 A;  3SGI A;  4JI7 B;  2OWO A;  2KKW A;  5IWA O;  2DOS A;  1Y76 A;  2WLM A;  2ZE7 A;  4HBN A;  1Q43 A;  4X1Y A;  5JCO A;  2A3Q A;  2BSK B;  4U3J B;  3WU2 Z;  4EEQ A;  5JJE B;  4WCE V;  2UU9 O;  2HEP A;  5IYC O;  4J7Z A;  2V4D A;  2JK5 C;  3R66 A;  1F51 A;  1MZF A;  1Q3E A;  2UUC B;  3SYC A;  1R3K C;  1WP7 A;  4DW0 A;  4IGG A;  2OCC B;  1AI5 A;  3AG3 B;  5E79 Z;  1YCI A;  2JRI A;  1YSC A;  5IYZ A;  3G6B A;  2AZ0 A;  1Q7Y W;  3FKS G;  1P84 F;  3E2E A;  2PZS A;  2IM9 A;  4ZIB A;  1JR9 A;  2P5O A;  4PA6 A;  5B1O A;  4WFG A;  3S3X A;  4PJ0 Z;  2ARH A;  4DRX A;  1XMQ O;  1KB9 F;  4CC5 A;  3ZRS A;  4E2L A;  1M5I A;  4DV4 O;  1K8A W;  1Z5W A;  5BZB A;  3UT5 A;  4J7J A;  3BA9 A;  4JZG A;  2UXC B;  1RSO A;  5LP6 C;  1R73 A;  3DXR B;  3GWK C;  3SR2 C;  5IJ0 B;  2LW7 A;  4X9Q A;  3K5M A;  1VAR A;  4IYH A;  5HFL A;  3SPG A;  2R9A A;  2OIE A;  1XDC A;  2LGQ A;  4MTG A;  4RO2 A;  1QNM A;  2ZQM A;  2Q5Z A;  3CME V;  1M57 C;  1Y4M A;  4J9Z B;  4FZ0 A;  4DW1 A;  2DWD C;  4J80 A;  4HYO A;  2D3O W;  4ZOL B;  4TV9 A;  3W7U A;  3CE2 A;  1AVM A;  4I7Z B;  1D5A A;  3T2M A;  2NNU A;  3ZMZ A;  1F7Y A;  1KKD A;  3RYI A;  2RQ6 A;  2UUA B;  5ITZ B;  1THZ A;  3UQ8 A;  1SRY A;  2GBO A;  4PI0 A;  3WFV A;  2RN9 A;  5L3F A;  2HR3 A;  4JV5 B;  4XDL A;  3ZX6 A;  3T1Y O;  2QM7 A;  5BXZ A;  3R65 A;  1BHB A;  4JI4 B;  4JI4 O;  4UVC A;  3BVO A;  2MK3 A;  3C3S A;  5B1N A;  4JI8 O;  5JVD B;  2ZE6 A;  2F23 A;  1S5L Z;  2WLI A;  3MAQ A;  4DV6 B;  3FAV A;  3OD4 A;  5KX5 B;  1WLE A;  2QKC A;  5H2F Z;  4HNA B;  3ZJZ A;  2M7W A;  1VF6 A;  1YI2 V;  4O4J A;  3CCV V;  3K03 A;  4FMT A;  2EIJ B;  1VQ5 V;  4Z2W A;  5CBF A;  4IYI A;  3OMA B;  3T1H B;  4KHP B;  3IFX A;  1FKA O;  3JD3 A;  1XI1 A;  1WA8 A;  3ZRV A;  4NXM O;  5CMU A;  4K8Z A;  4LF7 O;  2YIB D;  1NBM G;  4LFB B;  1JFF A;  5GTH Z;  1DLB A;  3B40 A;  2LW1 A;  1P4R A;  3ETE A;  2G38 A;  3LNM B;  3RVZ A;  2Q68 A;  2F4V O;  4UCV A;  4B3T B;  4X65 B;  4MVU A;  3DTU B;  3CCL V;  1XMO O;  5FNV A;  4RQF A;  1OV9 A;  5DM6 V;  1NT2 B;  1ZL8 B;  4ABM A;  1OCZ C;  4WFF A;  1HW7 A;  2AHZ A;  3UO3 A;  4DV0 B;  3JAK A;  4DV4 B;  5KMG B;  2HVK C;  2QDO A;  1QBZ A;  5BY1 A;  2ADQ B;  2L35 A;  5IJ9 B;  5CA1 B;  4B3R B;  2P06 A;  3O65 A;  4UCO A;  1IBM O;  5BMV A;  1B3Q A;  4JI1 O;  1Z5V A;  3AG1 C;  1YJ9 V;  3I56 V;  1BE3 H;  1VQ6 V;  4DYL A;  3DSQ A;  2IU0 A;  2VWK A;  1N32 O;  1PNL A;  1D2D A;  5IT9 N;  1QLE C;  4TQF A;  4DV3 B;  3B8M A;  3GVM A;  3OM3 B;  1VEW A;  2N74 A;  1SET A;  1XRE A;  5DEC A;  2P90 A;  3ZHT A;  4R50 A;  1KEC A;  3RW0 A;  2QWN B;  3K57 A;  4J42 A;  4EB6 A;  5L3G A;  4GLX A;  4LF4 O;  1R6T A;  1L8D A;  1G8M A;  3J81 N;  3C90 A;  1NTM H;  4CS2 A;  2HJF C;  2GTA A;  4AQY O;  5DED A;  5H9C A;  1LR1 A;  3TJT A;  5FPR A;  1M56 C;  1RP3 B;  3G67 A;  1HNW B;  3FYI B;  2R9I A;  3EVK A;  3SPH A;  1JJ2 U;  3NXS A;  3KCX A;  1FPO A;  3CD6 V;  1G4Y B;  3ZMU A;  2DYS B;  4JGS A;  2N04 A;  4TOI A;  5LA6 A;  3PJS K;  4JI2 B;  3L74 H;  5IYB O;  3ETQ A;  2L6L A;  2XAQ A;  3DGE A;  3H01 A;  1IBL B;  2VWJ A;  2PGG A;  3APO A;  2QTO A;  3K59 A;  2XHB A;  1K33 A;  1E1Q G;  3CB2 A;  1NH2 B;  3RT3 C;  3CPW U;  4RWU A;  1DTO A;  4L8J A;  4YXW G;  5CN0 A;  3BFR A;  2W0F C;  3JAR A;  4IIJ B;  1M57 B;  2IJH A;  4FVM A;  4WFB V;  3OAA G;  5JQG A;  5B66 Z;  3H1J H;  2BE3 A;  2YIC A;  2WPD G;  2QGN A;  3IAY A;  4DR5 B;  2BSK A;  4I50 B;  4U3F H;  5KUM A;  2JDI G;  2VQF B;  4MSW C;  3TXQ A;  2N05 A;  4DR4 O;  1XNQ B;  4LF5 B;  2QM4 A;  2WAM A;  1B04 A;  3X2Q C;  1R3J C;  2DQ0 A;  2JJ2 G;  5JWP A;  4O2B B;  2WLJ A;  2ZCE A;  1SES A;  1I94 B;  1B6Q A;  2R9R B;  4JTC B;  4B7E A;  1CPY A;  4QNH B;  1SA0 A;  3T1H O;  4UFZ A;  2PI4 A;  4QPK A;  3CRA A;  2CTR A;  4DV3 O;  3H9V A;  2Q9L A;  1MMM A;  3A8T A;  3QO7 A;  2B5U A;  1QR8 A;  2PUS A;  2YXH A;  2XUM A;  2Q7G A;  1VQK V;  4G2K A;  4R7C A;  4HZ3 A;  4PA3 A;  1K97 A;  2HG5 C;  1PPJ H;  3P3N A;  2CTW A;  1HNZ O;  1EN5 A;  4DV2 B;  4PV1 B;  1HNW O;  2E3C A;  4UUJ C;  5B3S C;  1JCH A;  3CSX A;  2DWE C;  2KG7 B;  1OCO C;  1Y74 B;  4JI6 O;  1Q6I A;  4ICG A;  3P30 A;  3GWO A;  2YIA A;  2A7W A;  3UKM A;  4I55 A;  5ITZ A;  2E76 B;  3ASO B;  2UXB O;  5F2V O;  2Y48 A;  3LDE A;  3B77 A;  2ZXW C;  1HP8 A;  3AG2 B;  4IL6 Z;  4P9O A;  2EZP A;  4WFA V;  5EYP B;  4B3M B;  1XNQ O;  1R3I C;  3KDR A;  5LOV A;  4F6E A;  2F95 B;  1PNK A;  3S3W A;  3TCU A;  4F6R B;  4AI8 A;  3HR0 A;  3RYH A;  1XL4 A;  2GUZ B;  4DUY O;  4PEL A;  2IJJ A;  4DR5 O;  4FFB A;  4DR2 O;  3AK2 A;  3N2G A;  4BIZ A;  1IBM B;  5TIS Z;  4U3J A;  3ABM C;  3SJC C;  4NVP A;  4YHH B;  1TUE B;  4WFE A;  4J10 A;  2QWQ B;  2W6J G;  3ETG A;  2WLH A;  1GH6 A;  2DN9 A;  1K5Q A;  1NH2 D;  2BOC C;  1AJQ A;  2ITD C;  3SYO A;  1VQP V;  4LF8 B;  2CGO A;  2ZE8 A;  1WJZ A;  1Y67 A;  2M6Y A;  1HR0 B;  2X6B A;  3JAL B;  5KHG A;  4O4I B;  2FB5 A;  3RYC B;  1J5E O;  3E89 A;  3E83 A;  4PDM A;  3W7S A;  5B1A C;  4XDK A;  4LNU B;  2DYR C;  5EBM C;  1VQM V;  4P30 A;  3HKD B;  1S77 D;  1Z2G A;  3W7X A;  4DXW A;  5CBH A;  1GRJ A;  2EBO A;  4MVQ A;  2H94 A;  5KHI A;  3BCC H;  2ZKO A;  4BW9 A;  4AQY B;  3EXA A;  4X64 B;  3WB0 A;  2Q4P A;  5KLV H;  5LMN B;  3AG2 C;  2OCH A;  2ZR2 A;  1S72 V;  5BMV B;  2RJZ A;  3M99 B;  1JA8 A;  3OR7 C;  4JZ2 A;  1I5Y A;  1ZAU A;  3K3W A;  3U0Z A;  1A32 A;  4DUZ B;  1XOU A;  5KHJ A;  3CYO A;  4X1Y B;  1F4N A;  3LSQ A;  3CHX A;  3L71 H;  3SPI A;  2ZIO A;  4LF6 O;  2CDY A;  5LHH A;  2F43 G;  2XT9 A;  4YJ2 B;  1DK1 A;  5JJJ B;  3G80 A;  4LBE C;  3OR6 C;  5LL6 Y;  4ZKI A;  3MHS C;  3T1C A;  1SS3 A;  2QKA A;  3OMN B;  5D5P A;  2GV9 A;  2EIN C;  1YTF D;  2UUA O;  1KKC A;  3LNN A;  2X6A A;  1HNX B;  3MD0 A;  4X62 B;  3EHB B;  5IJ9 A;  2Y69 C;  4FLW A;  2X0L A;  3WB1 A;  3LDD A;  4UV9 A;  1QVF U;  3BEH A;  1VQ9 V;  2B1G A;  2CK3 G;  1N0N A;  2UUC O;  1YDX A;  4R6Z A;  5LOV B;  2R70 A;  4EFB A;  1WNS A;  3APQ A;  1TVK A;  3FD9 A;  1CEZ A;  1H2S B;  1I94 O;  5LA6 B;  1TAE A;  3J80 N;  3AEI A;  3JD2 A;  2EZO A;  3JAM N;  3N2G B;  4I9Q A;  2EIN B;  2QSA A;  5KAI Z;  2PTM A;  2LO1 A;  1W2B U;  4H37 A;  2QTS A;  2Y0P A;  3OGC C;  4ZOL A;  4TV9 B;  1JNB A;  1N32 B;  2C2A A;  1AJP A;  1W0J G;  4X1I B;  1K7D A;  1FXK C;  1UJW B;  3ABK B;  4JAA A;  5EZY A;  2OTL V;  2HKO A;  3D36 A;  1MSW D;  4JPR A;  4I0X B;  1AI7 A;  3UCS C;  3BAB A;  1EZJ A;  2RDC A;  4N23 A;  1FOU A;  4L87 A;  3CRQ A;  5K1P A;  4D6T H;  1EFR G;  2YUA A;  3D3Q A;  2Q6A A;  1I08 A;  3FB6 C;  2IH1 C;  4JYC A;  5EC2 C;  1N36 B;  5EK0 A;  4N21 A;  1WA8 B;  1SA0 B;  2Q7E A;  3E22 B;  2ZNI A;  3CP1 A;  2Z3Y A;  3FFQ A;  2HP8 A;  3DC5 A;  2O57 A;  2WWW A;  1KYO F;  1VQ8 V;  1FXK A;  4H44 B;  3ZHU A;  3ZMV A;  2LFR A;  1I5X A;  4DV7 B;  1K92 A;  2E5L O;  3LSS A;  3J7A U;  2NLJ C;  4JTD B;  3IGA C;  2AZ2 A;  1SQB H;  4PDV A;  2D2C B;  1Q6H A;  4MTF A;  1X59 A;  2PF4 E;  4GCZ A;  2JEU A;  1HDJ A;  1PP9 H;  1XMQ B;  5J2T A;  3QF7 A;  1GM9 A;  1IBK B;  1AR4 A;  3JAT B;  4LFA O;  3A0R A;  4X89 A;  5H6Q A;  1QLE B;  1R1B A;  3NR7 A;  2ZT9 B;  4F4L A;  5A9G A;  5GON A;  4YJ3 B;  2PI5 A;  1KP3 A;  3JD0 A;  1JJO A;  2IBZ H;  1DGS A;  1RM1 C;  3ASO C;  3VQY A;  1QHT A;  1QQC A;  5LP6 B;  4DUZ O;  4UCR A;  4TSF G;  4JYY A;  4E4E A;  2WLN A;  5IDJ A;  3OFN G;  1E79 G;  1MA1 A;  2LQT A;  3OTO B;  3RFR A;  3JYC A;  4DV1 O;  3FAV B;  1KP2 A;  4GX2 A;  4X1I A;  3OTF A;  4EFE A;  3BAA A;  1N34 O;  5CA0 B;  2F4V B;  1RPR A;  3K5O A;  4UB6 Z;  4O4J B;  5IY5 B;  4TUY B;  3BPZ A;  4JYB A;  4I0X A;  3D8C A;  3VQV A;  4IHJ B;  2DJV A;  4GKK B;  1NR1 A;  2ETN A;  1ZTE A;  3RBZ A;  3T1Y B;  2UXX A;  2EJR A;  4JAU A;  5LHG A;  2ILM A;  2W0X A;  1BSM A;  4YY3 O;  1S0V A;  3ML0 A;  1P49 A;  3RWR D;  1WP8 A;  3CJH B;  2CH7 B;  2IW5 A;  2P67 A;  5KA5 A;  2XAG A;  1XIL A;  4GKK O;  1S76 D;  3B4S A;  5JVD A;  4U7O A;  1L1F A;  3EFF K;  2HFE C;  5JQG B;  5KUK A;  5KHK A;  2XAS A;  1FXK B;  4LFB O;  1XNR B;  3FB8 C;  4NYK A;  4GX0 A;  3ASN B;  3H1I H;  2FTK A;  3CCM V;  4UXN A;  1LNQ A;  5LXT B;  2K1E A;  3N27 A;  4O4H B;  4AHC A;  1Y66 A;  4CS3 A;  3ZED A;  4KFM A;  3MHH C;  3E86 A;  1PL4 A;  2JS3 A;  2CTP A;  1RPO A;  4QIW F;  1BHA A;  2UXC O;  5J9P C;  3ABM B;  3ABT A;  2Z0A A;  4DR3 B;  1RM1 B;  4ZHQ B;  1OZ0 A;  5D5Q A;  4LR3 A;  2CE4 A;  4EKW A;  5BR8 B;  5HFM A;  3CCQ V;  3I55 V;  1HNZ B;  4O4I A;  2EIL B;  1LUV A;  1M4U A;  5J2T B;  3A0H Z;  3E35 A;  1VQL V;  4K0K B;  4JTA B;  3KG2 A;  1XHZ A;  1QCE A;  3JAT A;  3ZRX A;  4TWK A;  4KL1 A;  4LFC O;  3D36 C;  4DR6 B;  2YXY A;  1RFY A;  1MSD A;  1K5S A;  4PA4 A;  2Y4T A;  1I0H A;  4X66 O;  1BQZ A;  5DN6 G;  2UUB B;  3B2E E;  4UVA A;  1AR5 A;  5CA1 A;  3CMA V;  3JAS A;  3WG7 B;  1VIB A;  3ZIA G;  3K5L A;  4A5U B;  4CH3 A;  1J95 A;  4K0K O;  1N34 B;  1R6K A;  5LMN O;  3A0B Z;  4FLV A;  1EN6 A;  4AIL C;  1ZX3 A;  2HLD G;  1N4C A;  5FL7 G;  4I9W A;  4MVZ A;  2MW2 B;  4TUY A;  2Q8V A;  2E75 B;  1SF9 A;  2KG7 A;  1ROP A;  4CC6 A;  1VQN V;  1QLN A;  4D7S A;  3OEH G;  1NTK H;  3FX7 A;  4RQE A;  1Q82 W;  2WLL A;  1IXB A;  2UXD O;  1GAX A;  2LJ2 A;  4KUM A;  3AG4 C;  4IIJ A;  1SQG A;  3AG4 B;  2W6I G;  1URF A;  5A2Q N;  4JI0 B;  4YIP A;  3QVN A;  3LUT B;  5EIB D;  2ADP A;  2Y0I A;  2WSS G;  1FFX B;  1YZB A;  1NVP B;  1FAF A;  2DYR B;  1CP9 A;  4NTY A;  4I50 A;  4J11 A;  1YVW A;  5FPO A;  2ATK C;  4WBN A;  3CRC A;  3VOU A;  2FML A;  4UVB A;  3ZHV A;  1G6U A;  2QWO B;  5EBL C;  1YIJ V;  1R3L C;  3X2Q B;  3I5D A;  2ZDI A;  3BHP A;  1GN6 A;  5LXT A;  4B08 A;  4B7K A;  1Q81 W;  2A79 B;  4ASU G;  3ZHQ A;  4X65 O;  3RVY A;  2VQE B;  2AXT Z;  1J5E B;  3GB7 C;  2YID A;  3ZS8 C;  1K4D C;  1M9N A;  3KCY A;  1FJG B;  2BCC H;  1G1X B;  3P3P A;  3SJB C;  4FFK A;  2XAH A;  4BIO A;  2XND G;  3CCS V;  1GO3 F;  2A06 H;  1AR1 B;  2GHY A;  3RYC A;  3OW2 U;  3K04 A;  4JI0 O;  4FIP C;  2V1D A;  4W4K A;  2YSU B;  3L9D A;  4YJ2 A;  1EBO A;  4JI6 B;  5GTI Z;  3K5N A;  2UXN A;  2XAF A;  2YDE A;  3HKD A;  1H8E G;  2Y69 B;  1MAB G;  1N8R W;  2V7Q G;  5LBQ A;  1VQ4 V;  3CXH F;  3L75 H;  1O9G A;  1IZ3 A;  1NKD A;  3OT7 A;  4LF9 O;  1V54 C;  4BR6 A;  4LWS A;  4LP8 A;  4UB8 Z;  5IY5 C;  1PKX A;  3CRR A;  1BS3 A;  4WF9 V;  4XDJ A;  5B1B B;  2QA4 V;  1LUW A;  4B3M O;  4I4T A;  2EUL A;  4UV8 A;  3AG7 A;  4OGQ B;  4DR7 O;  3QO5 A;  3WG7 C;  3ABL B;  1BMF G;  4B3R O;  5EIB C;  4JAS A;  5J2U B;  2XTA A;  2JGD A;  3AK3 A;  2P4V A;  3STZ C;  3K08 A;  1V54 B;  3E8F A;  1YF2 A;  2UUB O;  2QR4 A;  4J41 A;  1WB7 A;  4X66 B;  1XQ8 A;  2PYL A;  4DV0 O;  3UM7 A;  2H3O A;  4H0L B;  4DV2 O;  1ARO P;  1NS1 A;  2AHY A;  2ZDI C;  4F6R A;  2ZM6 O;  4UCU A;  5C8Y A;  2RNB A;  3U10 A;  1HWY A;  1WB8 A;  4JI3 O;  1N33 B;  3ZMT A;  2KQX A;  3SJA C;  5LMU O;  2FKX A;  3VQW A;  4DR3 O;  4QJF B;  2QWP B;  2YEV B;  4IHJ A;  4QE7 A;  1KMI Z;  4TV8 A;  3W7W A;  4TQD A;  1XEQ A;  1YJN V;  3H1H H;  1US6 A;  2RCV A;  2H8P C;  3CCR V;  1PNM A;  3CXC U;  5LP6 A;  4DR7 B;  2Q67 A;  3H1L H;  4MVR A;  1TGO A;  1Q6U A;  3ICX A;  3RYH B;  1XHX A;  3T4Z A;  1NTZ H;  4D7T A;  4DO2 A;  4O4L B;  4CH6 A;  5EZY B;  1GN2 A;  3ZBH A;  1FS0 G;  3TK1 A;  5EC1 C;  3JAW A;  2HHH O;  1ORQ C;  2EIM C;  2A0L A;  1FYJ A;  4DV1 B;  1DF5 A;  4DV5 O;  3JCZ A;  2YS8 A;  3K58 A;  1XL6 A;  4JI8 B;  4B3T O;  5LYJ A;  3HKB A;  3TET A;  5LMU B;  1CXZ B;  4NR1 A;  1K73 W;  4Q20 A;  1TA8 A;  1TUB A;  3JAL A;  5JH7 A;  4FM0 A;  3OEE G;  3Q4H A;  4CH4 A;  3OGI B;  4CBC A;  5CB4 B;  4DV5 B;  4UCS A;  4MW3 A;  4HAM A;  2UXD B;  1UPG A;  1KBH A;  2B1I A;  1N36 O;  1VF6 C;  3HKE A;  4OPH A;  4ZI7 B;  1Q90 D;  4K8X A;  2KB1 A;  4X88 A;  3FYE B;  4DRX B;  4JI2 O;  2X6C A;  4FLT A;  4MVO A;  2K9P A;  1SKV A;  2WA4 A;  3L73 H;  3CRM A;  2OYQ A;  4RAI A;  4GZR B;  5K1X A;  3M7M X;  2CAZ C;  3UT5 B;  4TT3 G;  3E22 A;  3OUF A;  4LFC B;  4DR6 O;  1FFT B;  3H1K H;  2QKS A;  1VQ7 V;  1TVK B;  2Q69 A;  5L3B A;  4X20 A;  2Y4U A;  3CC4 V;  1GM8 A;  4O2A A;  3SYA A;  3K06 A;  5LGU A;  3QTC A;  5H6R A;  2DE0 X;  2Q0A A;  4MTX A;  3CWB H;  3WB2 A;  2KSD A;  2ZNJ A;  5GON B;  3M8A A;  3VQX A;  1OCR C;  5GW7 A;  5CA3 A;  3KZI Z;  4KP4 A;  2YXL A;  2IJI A;  1FD9 A;  4DV7 O;  2WLK A;  2WA3 A;  1H8H G;  3O9O A;  2DW4 A;  4MTO A;  5IWA B;  2QEX V;  2HVJ C;  4MT8 A;  1P7G A;  1OCC C;  1PV0 A;  2Z5U A;  4YJ3 A;  1HNX O;  2CGN A;  5KX5 A;  2E74 B;  4U7N A;  2NN4 A;  5CA0 A;  3N2K A;  2VRZ A;  4H33 A;  4NXN O;  3THO A;  3CX5 F;  4PD4 F;  3TXS A;  4MS2 A;  4JI7 O;  1D5N A;  1W0K G;  5IE9 A;  4K3A A;  2YIB A;  1PD3 A;  3DC6 A;  1AI4 A;  1I7F A;  3BA8 A;  5B1A B;  4ZHQ A;  1IBL O;  4NTW A;  1AIL A;  1S5J A;  1R6N A;  4LF5 O;  1Y76 B;  1AJN A;  3CC7 V;  1YHQ V;  4OXS A;  3ABL C;  5C93 A;  3ABK C;  2GDS A;  1K9M W;  4Z1M G;  2IH3 C;  2EIK B;  5FNV B;  1H2N A;  4WBN B;  5B1B C;  1NI8 A;  1HR0 O;  2Q73 A;  1JVM A;  2ZD9 A;  3RYF A;  1JOY A;  1V55 C;  3JAK B;  1MOF A;  3QO8 A;  4X62 O;  2UXB B;  2AGA A;  4DR4 B;  5E1A C;  3B09 A;  3CJH A;  4OX9 O;  3FB5 C;  2CH7 A;  4O4H A;  4GUN A;  2ZM6 B;  4MW8 A;  4FLX A;  4GYC B;  2EIM B;  1L0L H;  4PDR A;  2BOB C;  1JFF B;  4YY3 B;  2JS5 A;  3ZHS A;  4CH5 A;  2EIL C;  1P7B A;  3TGU H;  2JGD B;  2OT5 A;  4GX1 A;  4RUE A;  4FK5 C;  2NR5 A;  1OHH G;  4GT1 A;  3W7T A;  1M1K W;  4JYA B;  1T5E A;  1GM7 A;  4YIO A;  3K9S A;  4FLU A;  2LP7 A;  2WLL B;  1YTF B;  4LC1 A;  4NXN B;  1MNG A;  3ASN C;  1YXB A;  1WPB A;  1QVG U;  1IUR A;  1H2M A;  1AI6 A;  4LWS B;  1SC5 B;  3OMI B;  3KKY A;  1YJW V;  2GSM B;  4IT5 A;  3ZRW B;  1NQT A;  3VBB A;  2BTQ B;  2F1M A;  2P6J A;  3STL C;  2DMX A;  1B06 A;  4XBF A;  3MDS A;  2WLI B;  5JJN B;  3HKC A;  3AG3 C;  4HNA A;  4GKJ B;  1XBL A;  1K3E A;  1GTO A;  2ZR3 A;  1AB3 A;  3F5W C;  4G28 B;  2LGW A;  2X7R B;  4BIU A;  4JI5 O;  1RSO B;  4LH7 A;  2YI8 A;  4JYA O;  4X1K A;  3IC9 A;  4WFH A;  3PN1 A;  4CS4 A;  4J7K A;  5AG2 A;  3BY6 A;  3SYP A;  4C7U A;  4YHH O;  4OPA A; 
#chains in the Genus database with same CATH homology
 1XDC A;  1I08 A;  2AW9 A;  1QNM A;  1AR5 A;  2ADQ B;  3RN4 A;  1EM1 A;  2CDY A;  4GUN A;  1N0J A;  3KDR A;  1ZSP A;  4F6E A;  1GN4 A;  1ZTE A;  1AVM A;  3AK1 A;  1GN3 A;  1SZX A;  2QKA A;  3DC5 A;  1EN6 A;  1KKC A;  3OT7 A;  4BR6 A;  1BSM A;  1GN2 A;  3AK2 A;  3C3T A;  1AP6 A;  1BS3 A;  1ZLZ A;  1VEW A;  1XUQ A;  1LUW A;  1P7G A;  1XRE A;  4YIO A;  1N0N A;  3K9S A;  1XIL A;  3C3S A;  1IXB A;  1MNG A;  2QKC A;  4YIP A;  1Y67 A;  2P4K A;  3AK3 A;  3KKY A;  3QVN A;  3LSU A;  2ADP A;  1WB7 A;  1MMM A;  3TJT A;  1AR4 A;  1D5N A;  1PL4 A;  1JR9 A;  1B06 A;  3EVK A;  3DC6 A;  5A9G A;  3MDS A;  1IX9 A;  2CE4 A;  1EN4 A;  1IDS A;  1BT8 A;  1WB8 A;  1ZUQ A;  1LUV A;  1EN5 A;  3CEI A;  1GN6 A;  1AP5 A;  4JYY A;  4E4E A;  2GDS A;  4JZG A;  3IC9 A;  1MA1 A;  1MSD A;  1PM9 A;  4X9Q A;  1VAR A;  3BFR A;  5AG2 A;  1JA8 A;  4C7U A;  4FFK A;  1I0H A;  2RCV A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...