1JA8A

Kinetic analysis of product inhibition in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese Superoxide Dismutase
publication title Kinetic analysis of product inhibition in human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ja8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ja8A02
4YIPA 1P7GA 1PM9A 1QNMA 1ZTEA 2AW9A 1MNGA 1BT8A 4JZGA 1IDSA 1VARA 1Y67A 2ADPA 1AP5A 3TJTA 1GN4A 1EN5A 1GN6A 3C3TA 1PL4A 3AK2A 4JYYA 4E4EA 1LUWA 5AG2A 1LUVA 1N0NA 1I0HA 3QVNA 4C7UA 3DC6A 1JR9A 3CEIA 3AK3A 2QKCA 1MSDA 1IXBA 1ZSPA 1XDCA 2CE4A 1AR4A 3RN4A 3AK1A 1EN4A 2RCVA 4YIOA 3BFRA 3OT7A 1BSMA 1I08A 1ZLZA 1AP6A 1XILA 1WB8A 1WB7A 2CDYA 3C3SA 1EN6A 1IX9A 1XREA 4JZ2A 4X9QA 4F6EA 3DC5A 2GDSA 2ADQB 2P4KA 3MDSA 1KKCA 3IC9A 1MMMA 3KKYA 1XUQA 1AR5A 4FFKA 1MA1A 1GN2A 2QKAA 1BS3A 3EVKA 3LSUA 4BR6A 1JA8A 1GN3A 1AVMA 4GUNA 1SZXA 1N0JA 1D5NA 1EM1A 3K9SA 5A9GA 1VEWA 1ZUQA 1B06A
chains in the Genus database with same CATH superfamily
3B8NA 2OIGA 3K5MA 4DV5O 4GZRB 5KX5A 3WFVA 1F51A 2Y69C 1HNWB 4X62O 2VQFB 1QBZA 1GK9A 3CCVV 2YIBA 5GTHZ 1ORQC 3FX7A 4IIJA 1ROPA 3OEHG 3IFXA 2NR5A 3PJSK 3VQVA 4FFBA 3LDCA 4XDKA 1BHAA 1K5QA 2HJFC 4JYYA 1VQNV 3HPLC 5IYZA 1XNQB 4X88A 1DTOA 1K3EA 5EZYA 4QGPA 4X1KA 4H0LB 1XMOO 4U7OA 4UB6Z 1Q86W 1MSDA 1K92A 3RYFA 1N4CA 4DRXB 1IVSA 4JTDB 1F4NA 4GKJO 1OCCC 5DEDA 3A8TA 2QR4A 3ZMSA 4KXRA 1BSMA 3SPCA 1PNLA 1I94B 1D2DA 1YTFB 5EYPB 5KLVH 4O4LA 4H33A 1AP6A 2CGOA 3OR6C 1IBLO 2LGQA 3CHXA 2Y69B 2XAGA 3K3WA 5LHIA 1Q90D 3ZHQA 4BIUA 4MTFA 5CA3A 1MMMA 3KKYA 5H2FZ 2EILC 4H13B 3T1CA 5JQGB 4NXNB 5LHGA 3OMNB 3ZBHA 4O4IB 2WLLA 3CRCA 1GH6A 5KA6A 1Q3EA 2WLMA 2F1MA 4UVAA 1Q5OA 2XAHA 1AJNA 2DW4A 2E74B 3U11A 1FPOA 1HR0B 4DV5B 1XBLA 1VEWA 5KHHA 3N27A 3ZRWA 1AI6A 3F5TA 3ZJZA 5IJ0B 4B7KA 1G6UA 2LW1A 2ZINA 4WFAV 3CRRA 2RN9A 5GONA 2QWQB 4X65O 2B1IA 3M8AA 4YHHO 3WB2A 5GTIZ 1MNGA 2F23A 3JSLA 3T4DA 4JZGA 3CRQA 1AP5A 5CBFA 2N04A 1GN6A 3CX5F 4LFAO 4NVPA 2QM8A 1UFIA 2JEUA 4BIOA 2KB1A 2LQTA 2X6AA 3CCJV 4DV2O 4JYAB 2IH1C 3KCYA 1XMOB 4O4JB 2RNBA 1LNQA 2D2CB 4TV9B 4RQFA 2P5OA 3QTCA 4HNAA 2Q0OC 1JJ2U 1HNXB 2ZXWC 1AJQA 2Q67A 4OX9O 1GTOA 3E2EA 4NYKA 2YXYA 2WWWA 1W2BU 2HKOA 3BA9A 1NT2B 2XAFA 1E1QG 2QWOB 5FPRA 4FLVA 4YJ3B 1Q82W 4QJFB 5FPOA 2OCHA 2N05A 2QTOA 2CDYA 1FXHA 1QCEA 1X59A 3WB1A 3ASNC 3TXQA 3KDRA 3J7AU 5D5PA 4FFKA 1MA1A 3ZRXA 1P84F 3OMIB 4CS4A 3FAVA 5CA1B 2B9ZA 3FB6C 3T1HO 1ZWIC 3HKDA 4G2KA 3LSQA 1JA8A 2QJ1A 4RUEA 5EZYB 1L0NH 4FMTA 4TQFA 4IYHA 4KP4A 3ASOC 2Y0IA 1NI8A 1B06A 2Q0AA 4X65B 1M9NA 3K03A 3ZX6A 1GM8A 3APOA 3ZS8C 3SJCC 1FXKC 1VIBA 5KA5A 4LNUB 4ZI7B 2HEPA 4U7NA 3MAQA 5L3FA 1V55C 1R3IC 4D7TA 2VQEO 2PY5A 4I9WA 4FLXA 1L0LH 4CS2A 2DMXA 5EC2C 3M7MX 4O2AA 1NZ6A 3RYCB 3S3WA 1IBKO 1OCZC 1QU7A 1QR8A 4MW3A 4NXMB 4DV4O 4ZHQA 5B66Z 5DECA 5B3SC 4DR6B 2EIKB 1XDCA 1Q7YW 4OX9B 4O4HA 1E79G 4F6RA 4UCRA 1VF7A 1BGYH 3AK1A 3DGEA 2F4VB 2OTJV 4B3RO 5IY5C 3RWRD 3EXAA 2C2AA 4LF4O 1FFXA 2YC0A 3OMAB 1GRJA 2Q8VA 4LH7A 4MW8A 2A06H 3ZRWB 3P30A 2DYRB 3EHBB 1V55B 2YUAA 5LGTA 3HKEA 2ADQB 2P4KA 2DWDC 4DV7O 3AG7A 2PF4E 4EB6A 1URFA 1OZ0A 3KG2A 3T1HB 3WU2Z 1JFFA 5IWAB 4FLYA 3LSUA 1YVWA 4GX5A 2A9HA 1V9PA 2YXLA 1H8HG 1SQXH 5B3SB 4WFBV 1S5LZ 4TUYB 3ZN0A 5A9GA 3H1IH 2PTMA 1KQSU 1CXZB 3VOUA 1M57B 2EJ7A 4R8CA 1PM9A 1Y76A 4QIWF 4FZ1A 2Y48A 3K5NA 3J80N 4FLTA 3N2GA 4MT8A 3ZMZA 1Y67A 3TGUH 1Z2GA 2CH7B 2ZCEA 1RM1C 4X20B 3SPHA 1HDJA 3RVYA 1IBKB 1QVFU 5GW7A 4EKWA 3JALB 3RGBA 5KHGA 1F4MA 1GM9A 1LUVA 4LF8B 1SA0B 3G67A 4UVBA 1VQMV 3CCUV 5KUKA 1OHHG 2AHZA 2QEXV 3L72H 5B1OA 3FAVB 2Q4PA 2IH3C 2RCVA 4LF4B 2WA4A 1AR1B 1N34O 2QM4A 1SRYA 2M7WA 1I08A 2LGWA 3ABKB 1GO3F 2A3QA 5LL6Y 4LF5B 2OIEA 3QG5A 3B2EE 3E8FA 3OTFA 4DW0A 2LO1A 4DR3O 3Q4HB 3K79A 4TWKA 1XREA 4EFBA 3DTUB 3LSSA 1KD1W 4DV7B 2WPDG 1RPRA 1RM1B 5H6RA 3ETEA 1FFTB 4CH4A 1F23A 3ZRVA 4JI0B 2WLHA 4JV5O 4CS3A 1TVKA 1R3JC 2NN4A 4BR6A 1SETA 4O2AB 2ZIOA 1PV0A 4JAUA 3HKCA 1H2KA 1CPYA 2QE7G 3ABLC 1BL8A 2GBOA 2DQ3A 4UFZA 2UXXA 1T5EA 4LFBO 1Y4MA 1N36B 2AZ0A 4O4HB 2ITDC 4F6RB 3G71V 4DR1O 3BY6A 5LHHA 1QLEB 4IT5A 1BT8A 1FFXB 2B1GA 1IDSA 2L35A 2A0LA 4CC6A 1NJIW 1VQKV 4DV6O 3W7XA 3E35A 2IM9A 4J11A 4LC1A 1TAEA 2YI9A 4JF3A 4JI8B 4MTXA 3SYAA 1H2GA 1JVMA 3OTOB 3ZEDA 1JR9A 1KP2A 1CP9A 3BA8A 2Q69A 4IYIA 1HNWO 4OPHA 3HKBA 3ABLB 5A2QN 4DR2B 3A0BZ 4LP8A 4X8AA 4AQYO 1OV9A 3C90A 3BHPA 2NNUA 4ZBMA 2ILMA 5DN6G 1FYJA 1I5YA 3CRAA 2KKWA 4MVSA 5JCOC 1YI2V 5LA6B 4LWSA 5FL7G 4BWAA 2WLIA 1Y76B 1Z5WA 3CWBH 4ABMA 4I4TA 1H2LA 2RQ6A 3QO8A 1H2SB 3A0RA 1Q6HA 3E83A 4IL6Z 3CP1A 2Z3YA 4FK5C 3D36C 3H1JH 1BS3A 1K9MW 3CC7V 1H2MA 3LDEA 2X7RB 1FOUA 5LXTA 2HR3A 4LR3A 5H6QA 2OWOA 3CCMV 1AILA 1QQCA 4LFBB 3CXHF 2DYSB 1K33A 1Q6IA 2E3CA 2Q9LA 1BCCH 4DR5B 4Q6GA 2QKSA 4DR1B 2CTPA 2IJKA 4DW1A 1VF5B 2YS8A 5B1AB 5B1NA 1M1KW 2F43G 3FB5C 1BHBA 1KC8W 3OD4A 4NXNO 1QNMA 5L3DA 5KAIZ 4PDVA 1NH2B 3SYCA 1SS3A 2RDCA 4DV6B 5LGUA 1RSOA 4LFCO 5KHKA 2W0FC 1S72V 2EX3A 4E4EA 2R9IA 2Q7EA 4YY3O 4DUZB 4GLXA 4DR7B 4FLZA 1Y74A 1HR0O 4JTCB 4XDLA 3FYEB 3R65A 3RYHB 1FJGB 2VWKA 4PA7A 4AQYB 1KBHA 1TVKB 4W4KA 1NTMH 2CTWA 5DM6V 2XOKG 5L3BA 1AR4A 4WFGA 3E8GA 2QA4V 4PA4A 3CS5A 2ATKC 3OGCC 4U3JB 1U97A 2KG7A 1WB7A 2QGNA 4JYAO 1P7BA 5KUMA 1VP7A 2GUZB 3JAWA 1YF2A 2N74A 4WF9V 1WP8A 1TUBA 1H38A 2P22C 1M90W 4D7SA 1K4CC 2ZDIA 1N33O 3ZN1A 3O9OA 1HNXO 3W7UA 1NTZH 1M56B 1J5EB 4ZOLB 4EEQA 4P30A 1HWYA 1SQPH 4UB8Z 1W0JG 4FZ0A 5E79Z 2DN9A 1ZX3A 3U10A 2O57A 2HG5C 1JX9A 4R7CA 1K7DA 3L75H 3BPZA 2A79B 1WJZA 1CEZA 2QWRB 2XASA 5J2TB 1ZUQA 4LF9O 4WBNA 3K58A 3B8MA 4ZIBA 1WPBA 5LMUB 3CXCU 2JS3A 2BTQA 4LFCB 2Y4TA 4FM1A 5LOVB 4LF7B 1QHTA 1EN5A 4P9PA 3TXSA 3ZHRA 1GM7A 4LWSB 4YY3B 1VF6C 3FB7C 2IU0A 3ABUA 3N2KA 4NTXA 2Q73A 4PV1B 4QNHB 4I4TB 5CMUA 5J9PC 4DK0A 2QDOA 1WPXA 2OYQA 3CSXA 1I0HA 2UXBO 2JGUA 4I0XA 1RP3B 3JAMN 2CGNA 3OAAG 3E22A 4R6ZA 4MS2A 5LP6A 2R72A 5JJNB 5KMGA 1YHQV 2PYLA 1XILA 3CCQV 2H3OA 2AZ2A 4X1YB 3X2QB 5BMVB 2YEVB 1S5JA 2XAQA 3UT5B 1WA8B 3U0ZA 4NXMO 1N33B 1GMGA 2P4VA 4DR6O 4K3AA 2IJHA 4DV1B 1XUQA 1KU9A 2Y0PA 3L70H 5JWPA 2F4VO 4O2BB 2BSKA 4JAVA 3R66A 4Z1MG 2X0LA 3JATA 1ZL8B 2AGAA 1N0JA 5LBQA 5KX5B 1PL0A 4X1IA 4DV0B 5K1XA 4LF9B 1MOFA 2X6CA 5CBHA 2R70A 4N21A 4IIJB 2QWPB 4FFBB 4HAMA 2PGGA 3SYPA 5IYZB 1OJHA 5IWAO 4J9YB 1GN4A 2UXDB 2EIKC 2YDEA 3HB3B 4X1KB 4U3FH 2IW5A 3FFQA 2PI5A 4RWUA 3D3IA 2EIJB 5EIBD 4XDJA 3RYFB 1PD3A 3BCCH 2UXBB 4PD4F 2JK5C 2DYRC 2BE3A 4O4LB 1ZSPA 2DJVA 3H9VA 1VQ6V 1VQ7V 1FAFA 2MW2B 1G1XB 4YIOA 4N23A 3RW0A 1O9HA 4FVMA 1SZTA 2ZNJA 3K9AA 1B04A 1KB9F 3K0GA 4BAYA 1IJGA 4DV3B 3QO7A 4LF8O 4WBNB 2Y4UA 4JI4O 1NQTA 3FD9A 2FB5A 4E2LA 1MG1A 3JASA 5EBLC 1US6A 1XL6A 1R6TA 3MDSA 2WLLB 1KKCA 1EBOA 5IJ9A 1AR5A 2EJRA 1BZKA 3AG2C 2QKAA 1M57C 2A7WA 2AHYA 2XAJA 3RBZA 4FM0A 4LF5O 1AI5A 5HFMA 5JJJB 1NVPD 3RT3C 3D3QA 1AVMA 5ITZA 4FLWA 4PDRA 1D5NA 3L74H 1V54C 1JOYA 3K9SA 5GONB 4HYOA 1R3LC 1SQBH 3F7VC 3JARA 5FNVA 1BE3H 3WB0A 3BABA 4UUJC 4YIPA 2ODMA 1P7GA 2VRZA 4BIZA 2GTSA 1S0VA 1OCRC 1DLBA 4JI0O 1FKAO 2V1DA 4I50A 5KAFZ 4LF6O 5BZBA 2EINB 2ADPA 5KMGB 2BCCH 3O65A 4JPRA 5IE9A 1KUQA 1P49A 2PI4A 1NR7A 4HNAB 1D5AA 1TUEB 3AG2B 3ABKC 4DXWA 4YJ2A 1SESA 2UXCO 3QO5A 5EBMC 3P3NA 3CCLV 1SQQH 1N36O 1MSWD 4J9ZB 4UCTA 4UVCA 2XTAA 3F5WC 3ABMB 3K5LA 3AG1B 3K57A 4X66O 1A32A 2BSKB 4B3TO 1NTKH 1V54B 1NS1A 2CAZC 1PNKA 4J80A 5HFLA 3JCUZ 4QE9A 2XHBA 5JVDA 3DXRA 2LFRA 3UO3A 2VWJA 4TSFG 5CN0A 4X64B 1YITV 2H94A 1OCRB 4CH6A 4JI4B 5IT9N 4JI8O 1ZAUA 3SYOA 2EZOA 3OTOO 4JI7B 3JAKA 1JCHA 3HKDB 1J95A 3K08A 4DR2O 5IYCO 3E86A 5BY1A 5LMNO 3SGIA 4FM2A 3G80A 1QVGU 2DQ0A 1QLEC 1S76D 4B7EA 4WFFA 5F2VO 2UUCO 1SZXA 3JYCA 1R1BA 5J2UA 3A2FA 4TV8A 4UCOA 2E75B 2ARHA 3OR7C 2FYUH 5C93A 3UM7A 3SYQA 1R6NA 3OUSA 3I55V 2HVJC 4LF6B 3MHSC 3VQXA 4PJ0Z 5B1BB 2CTRA 1YJ9V 4MSWC 3GVMA 2ETNA 5LYJA 4K0KB 1RFYA 4B3MO 4ZHQB 5IDJA 2UXCB 3SDLA 4DR5O 4I55A 3G6EV 1JJOA 3T4ZA 4X66B 1KKDA 4B3TB 1M4UA 1E1RG 2CE4A 2Q6AA 1S77D 5L3EA 4P9OA 1MZEA 2LFSA 1OCOB 5ITZB 4PA9A 5EC1C 4R50A 1ZLZA 5KHJA 4DRXA 1Y6XA 3HKEB 3JARB 2Q68A 2OT5A 2Q7HA 4FJCC 4DUZO 3JD3A 4DR7O 4PI0A 3TCUA 2ZKOA 2E5LO 3T2MA 4EB6B 1Z5VA 5EYPA 4UV8A 1FJGO 1W0KG 1JFFB 1NKDA 4JI2B 2DYSC 3KZIZ 3MHHC 4LBEC 5LMNB 1AB3A 2ZE6A 4JI5B 2BTOA 3J81N 3DSQA 5CA0A 5B1AC 3ZMVA 2M6YA 3E89A 2UUCB 1XQ8A 5BR8B 5JQGA 2Q5ZA 2P7TC 5TISZ 3SJAC 1YSCA 4O4IA 1S5HC 1H2NA 3N2GB 3OGIB 3UKMA 4GKKB 3SPJA 1IXMA 1J5EO 3BRCA 2BOCC 2YI8A 5JVDB 3CE2A 4Q20A 4J42A 2F93B 5IJ0A 4B3MB 4X89A 2JJ1G 4MVZA 1EZVH 1S3JA 3ABTA 1YCIA 1SERA 1NR1A 2IJJA 2ZE8A 1HP8A 5AG2A 5JH7A 2V4DA 4MVQA 3DC6A 3PN1A 3K0DA 1AI7A 2GHYA 3ML0A 1YZBA 3CCSV 1SQGA 5LMUO 2HHHO 4H37A 4O4JA 1LR1A 2V7QG 1M93A 3BFRA 4YXWG 1KYOF 4LF7O 4TV9A 4CC5A 3M99B 2UU9B 1QR9A 3JD0A 1M56C 2QWNB 2QM7A 4DUYB 1JMKC 4B08A 4NTYA 5JJEB 5J2UB 2E5LB 1WB8A 1K34A 4Z1VA 2QTSA 4CZZA 3GWKC 3APQA 2FMLA 2BOBC 1PKXA 3DC5A 3CB2A 4RAIA 3ZHVA 4YJ3A 1GN2A 3IGAC 5LYJB 3HKCB 4JYBA 4K8ZA 1MZFA 2EULA 5L3CA 2D3OW 2WLNA 1IBMB 4KHPB 3FKSG 4NB5A 4I55B 2P6JA 4Z2WA 5CA1A 2ZM6B 4UCVA 4FLUA 4G28B 2WAMA 1NU1H 1O9GA 4DV1O 1KMIZ 2P06A 4PA6A 2LP7A 1B6QA 1ZTEA 4BW5A 2YIDA 2IU3A 1VARA 4FIPC 4DK1A 3G6BA 1PL4A 2UXNA 1L8DA 4FPPA 3CMAV 1VQLV 1LUWA 4LNUA 4ZI7A 4DV0O 3ZMUA 3D8CA 5CB4A 1AROP 3LNNA 1DF5A 1R73A 1SQVH 2DWEC 2KSDA 3HKBB 3OE7G 1I5XA 2RMKB 4DR4O 3BVOA 3X2QC 2ZE7A 2FL4A 2OCCC 1Q8IA 2CTQA 3ZRSA 2HHHB 3BAAA 3ZHUA 3RYCA 3JSNA 3THOA 5CA0B 2PUSA 3B4SA 2P90A 3S3XA 3RN4A 4EFEA 1EN4A 3A0HZ 4K35A 2UXDO 3BEHA 3OT7A 4L87A 4RUFA 4JI1B 2WLIB 1UPGA 3JD2A 3ETQA 3SR2C 3OM3B 2HP8A 4J41A 1WLEA 2WSSG 2F66C 3SJQC 3H01A 2K9PA 4MTGA 2RJZA 1OCCB 2GDSA 5LXTB 4I9QA 4CBCA 3P3PA 1HNZO 1FXKA 2IJIA 1M5IA 1YEWA 4X62B 2UUBO 2OCCB 1I7FA 3IAYA 5JH7B 5C8YA 4DV3O 2EIMC 2LJ2A 4GUNA 3AEIA 5E1AC 4QPJA 1VQ4V 2W6JG 1IURA 4J7ZA 1L1FA 3VQYA 3CCRV 2EILB 2EIJC 2L6LA 4XBFA 1TGOA 1RSOB 2ZDIC 4H44B 5IYBO 3T1YO 4TUYA 2DE0X 1BQZA 1YXBA 4ASUG 2AW9A 3F7YC 4GKJB 4PDLA 3TJTA 3ZIAG 1Y74B 2YICA 3H1LH 4OXSA 4WCEV 3CMEV 2ITCC 4G27B 1W59A 3C3TA 4GCZA 1K97A 1ENVA 1PPJH 1WAZA 2JDIG 3QF7A 4F4LA 4MVUA 1IBLB 4AHCA 4I7ZB 4DR4B 1N8RW 2CH7A 3AG3C 3K5OA 2JS5A 4X20A 3CC4V 3W7WA 3LDDA 3W7SA 3CC2V 2ZNIA 3JALA 3AK3A 2H8PC 2EIMB 4GX2A 2KG7B 1WN7A 2LW7A 1SA0A 1Y66A 3JAWB 3CJHA 4MVMA 3I56V 1TUBB 2HJDA 4UXNA 5H9CA 1VQ9V 1VQOV 4I5SA 3CRMA 4GX1A 4CH3A 4JZ2A 2ZXWB 4X9QA 3Q4HA 1FS0G 1IZ3A 2YIAA 4F6EA 1HNZB 4JI6O 3OEEG 3IC9A 3ZCCA 2UUBB 4YHHB 3ZMTA 1R6KA 4WFEA 1BMFG 1JPXA 2JGDA 1NBMG 5LP6C 3AG3B 5IYDO 4LH6A 4X64O 2FTKA 2YSUB 5CB4B 4LFAB 2EINC 3H1KH 2K1EA 4QPKA 4K8XA 4KFMA 1AJPA 4DV2B 3ASNB 1G4YB 4QE7A 3WG7C 2G38A 1THZA 2BTQB 2Q7GA 4JI7O 3T1YB 1EZJA 2ZIMA 4L8JA 4GX0A 3L73H 5L3GA 4IHJA 3B09A 1HW7A 3CPWU 1X4TA 2OTLV 3N2KB 3ABMC 4PDMA 3AG1C 1G8MA 4MTOA 1COWG 4BW9A 2JIZG 2MK3A 1AI4A 3AK2A 2CK3G 4DO2A 1EFRG 3ASOB 4GT1A 3VBBA 3SPGA 4JAAA 4HZ3A 4I0XB 4J7JA 1JQ0A 3QVNA 4AI8A 3E22B 5LP6B 1YDXA 1XNRO 1FXKB 4PHZA 2WLJA 2B5UA 3CEIA 2QKCA 1IXBA 3JD1A 3RVZA 2XUMA 3VQWA 2EBOA 3OW2U 5FLXN 4JI3O 5KHIA 2PYJA 5C8YB 3WG7B 5EBWC 1MABG 4K0KO 4UV9A 4TOIA 1OCZB 3JD4A 2P67A 3HR0A 1IX9A 4JI6B 2FKXA 4OGQB 2Z5UA 1SQFA 3JATB 5IY5B 5LA6A 1NH2D 2W6IG 4UCUA 3LUTB 1SKVA 4OPAA 4X1IB 1YIJV 1XOUA 2KQXA 4J7KA 2VQEB 5B1BC 4ZKIA 3ZHTA 2VS0A 1GN3A 2GTAA 2ZE5A 4NR1A 2ZQMA 1EM1A 4WFHA 1FXVA 1K4DC 1N32O 1QLNA 5D5QA 4P2ZA 4JI2O 2E76B 4JTAB 4DV4B 3FYIB 4B3SO 1KECA 4RQEA 4JI5O 4CH5A 3CJHB 3RYIA 3STLC 5EIBC 1XI1A 4PI2A 2NLJC 3AG4C 4B3RB 2EZPA 4HBNA 3L9DA 2ZR2A 5BR8O 1JNBA 5JCOA 3E8HA 1P4RA 1OCOC 1BQ0A 3SPIA 3B77A 2JRIA 1SF9A 1K8AW 1TA8A 3GB7C 1N0NA 1XNRB 1H8EG 4GKKO 2DOSA 3NXSA 2XT9A 5EK0A 3UCSC 1YTFD 2IBZH 3K04A 2JGDB 3IJ4A 3D36A 4JI3B 4JASA 2AXTZ 2WLKA 2HVKC 3RYHA 2ZT9B 1U96A 3CCEV 3JASB 1VQPV 1H5WA 1Q43A 5IJ9B 3C3SA 4PA3A 3AG4B 4U3JA 3K59A 3ETDA 5H5NA 1KP3A 4ICGA 1DK1A 3MD0A 1PP9H 4IHJB 4DYLA 3EFFK 2ZD9A 2GUZA 4MVOA 1WNSA 2UUAO 2YXHA 4AILC 2X6BA 2UU9O 3EVKA 5FNVB 4DUYO 4J10A 1K73W 1XHZA 3QNEA 4NKGB 1B3QA 1PNMA 3TK1A 1UJWB 2PZSA 3E8BA 3NR7A 3CYOA 2CUGA 4ZOLA 1VMGA 1N32B 2JJ2G 4RO2A 5CBGA 3RFRA 2F95B 2JVDA 4I50B 1GAXA 4B3SB 3H1HH 4D6TH 1XMQO 4GYCB 3GWOA 1XL4A 5B5EZ 4KUMA 5J2TA 3UO2A 4TT3G 4YJ2B 4LCUC 4NTWA 2VQFO 3L71H 1N34B 2ZR3A 1IBMO 3K06A 1YJNV 4KHPO 3W7TA 2JEXA 4DR3B 2XNDG 4UCSA 4MVRA 2ZM6O 1VQ8V 4IGGA 1NVPB 1SC5B 4TQDA 2WA3A 5BXZA 5LOVA 1F7YA 1XNQO 3I5DA 4C7UA 1YJWV 1WP7A 3KCXA 1XEQA 3DXRB 3OFNG 1DF4A 3FB8C 1GKFA 4KL1A 4JV5B 1FD9A 3STZC 1I94O 3ETGA 3JAKB 1XHXA 2Z0AA 3TETA 3CD6V 4PELA 2R9AA 3IC7A 2QSAA 3G4SV 2YIBD 1EN6A 2HFEC 1VQ5V 4JYCA 2R9RB 5LGNA 3LNMB 3RYIB 3JCZA 4X1YA 2UUAB 5BMVA 2YEVA 1Q81W 3UT5A 1WA8A 2GV9A 3SJBC 1K5SA 2W0XA 4JI1O 4TV8B 4JGSA 1RPOA 1VF6A 3UQ8A 1DGSA 1Q6UA 3OUFA 1R3KC 4O2BA 3ICXA 2GSMB 4A5UB 3B40A 3ZHSA 2HLDG 3P32A 5K1PA 1ZL8A 1XMQB 4W4LA
chains in the Genus database with same CATH topology
4YIPA 1P7GA 1PM9A 1QNMA 1ZTEA 2AW9A 1MNGA 1BT8A 4JZGA 1IDSA 1VARA 1Y67A 2ADPA 1AP5A 3TJTA 1GN4A 1EN5A 1GN6A 3C3TA 1PL4A 3AK2A 4JYYA 4E4EA 1LUWA 5AG2A 1LUVA 1N0NA 1I0HA 3QVNA 4C7UA 3DC6A 1JR9A 3CEIA 3AK3A 2QKCA 1MSDA 1IXBA 1ZSPA 1XDCA 2CE4A 1AR4A 3RN4A 3AK1A 1EN4A 2RCVA 4YIOA 3BFRA 3OT7A 1BSMA 1I08A 1ZLZA 1AP6A 1XILA 1WB8A 1WB7A 2CDYA 3C3SA 1EN6A 1IX9A 1XREA 4JZ2A 4X9QA 4F6EA 3DC5A 2GDSA 2ADQB 2P4KA 3MDSA 1KKCA 3IC9A 1MMMA 3KKYA 3KDRA 1XUQA 1AR5A 4FFKA 1MA1A 1GN2A 2QKAA 1BS3A 3EVKA 3LSUA 4BR6A 1JA8A 1GN3A 1AVMA 4GUNA 1SZXA 1N0JA 1D5NA 1EM1A 3K9SA 5A9GA 1VEWA 1ZUQA 1B06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIP A;  1P7G A;  1PM9 A;  1QNM A;  1ZTE A;  2AW9 A;  1MNG A;  1BT8 A;  4JZG A;  1IDS A;  1VAR A;  1Y67 A;  2ADP A;  1AP5 A;  3TJT A;  1GN4 A;  1EN5 A;  1GN6 A;  3C3T A;  1PL4 A;  3AK2 A;  4JYY A;  4E4E A;  1LUW A;  5AG2 A;  1LUV A;  1N0N A;  1I0H A;  3QVN A;  4C7U A;  3DC6 A;  1JR9 A;  3CEI A;  3AK3 A;  2QKC A;  1MSD A;  1IXB A;  1ZSP A;  1XDC A;  2CE4 A;  1AR4 A;  3RN4 A;  3AK1 A;  1EN4 A;  2RCV A;  4YIO A;  3BFR A;  3OT7 A;  1BSM A;  1I08 A;  1ZLZ A;  1AP6 A;  1XIL A;  1WB8 A;  1WB7 A;  2CDY A;  3C3S A;  1EN6 A;  1IX9 A;  1XRE A;  4JZ2 A;  4X9Q A;  4F6E A;  3DC5 A;  2GDS A;  2ADQ B;  2P4K A;  3MDS A;  1KKC A;  3IC9 A;  1MMM A;  3KKY A;  1XUQ A;  1AR5 A;  4FFK A;  1MA1 A;  1GN2 A;  2QKA A;  1BS3 A;  3EVK A;  3LSU A;  4BR6 A;  1JA8 A;  1GN3 A;  1AVM A;  4GUN A;  1SZX A;  1N0J A;  1D5N A;  1EM1 A;  3K9S A;  5A9G A;  1VEW A;  1ZUQ A;  1B06 A; 
#chains in the Genus database with same CATH topology
 3B8N A;  2OIG A;  3K5M A;  4DV5 O;  4GZR B;  5KX5 A;  3WFV A;  1F51 A;  2Y69 C;  1HNW B;  4X62 O;  2VQF B;  1QBZ A;  1GK9 A;  3CCV V;  2YIB A;  5GTH Z;  1ORQ C;  3FX7 A;  4IIJ A;  1ROP A;  3OEH G;  3IFX A;  2NR5 A;  3PJS K;  3VQV A;  4FFB A;  3LDC A;  4XDK A;  1BHA A;  1K5Q A;  2HJF C;  4JYY A;  1VQN V;  3HPL C;  5IYZ A;  1XNQ B;  4X88 A;  1DTO A;  1K3E A;  5EZY A;  4QGP A;  4X1K A;  4H0L B;  1XMO O;  4U7O A;  4UB6 Z;  1Q86 W;  1MSD A;  1K92 A;  3RYF A;  1N4C A;  4DRX B;  1IVS A;  4JTD B;  1F4N A;  4GKJ O;  1OCC C;  5DED A;  3A8T A;  2QR4 A;  3ZMS A;  4KXR A;  1BSM A;  3SPC A;  1PNL A;  1I94 B;  1D2D A;  1YTF B;  5EYP B;  5KLV H;  4O4L A;  4H33 A;  1AP6 A;  2CGO A;  3OR6 C;  1IBL O;  2LGQ A;  3CHX A;  2Y69 B;  2XAG A;  3K3W A;  5LHI A;  1Q90 D;  3ZHQ A;  4BIU A;  4MTF A;  5CA3 A;  1MMM A;  3KKY A;  5H2F Z;  2EIL C;  4H13 B;  3T1C A;  5JQG B;  4NXN B;  5LHG A;  3OMN B;  3ZBH A;  4O4I B;  2WLL A;  3CRC A;  1GH6 A;  5KA6 A;  1Q3E A;  2WLM A;  2F1M A;  4UVA A;  1Q5O A;  2XAH A;  1AJN A;  2DW4 A;  2E74 B;  3U11 A;  1FPO A;  1HR0 B;  4DV5 B;  1XBL A;  1VEW A;  5KHH A;  3N27 A;  3ZRW A;  1AI6 A;  3F5T A;  3ZJZ A;  5IJ0 B;  4B7K A;  1G6U A;  2LW1 A;  2ZIN A;  4WFA V;  3CRR A;  2RN9 A;  5GON A;  2QWQ B;  4X65 O;  2B1I A;  3M8A A;  4YHH O;  3WB2 A;  5GTI Z;  1MNG A;  2F23 A;  3JSL A;  3T4D A;  4JZG A;  3CRQ A;  1AP5 A;  5CBF A;  2N04 A;  1GN6 A;  3CX5 F;  4LFA O;  4NVP A;  2QM8 A;  1UFI A;  2JEU A;  4BIO A;  2KB1 A;  2LQT A;  2X6A A;  3CCJ V;  4DV2 O;  4JYA B;  2IH1 C;  3KCY A;  1XMO B;  4O4J B;  2RNB A;  1LNQ A;  2D2C B;  4TV9 B;  4RQF A;  2P5O A;  3QTC A;  4HNA A;  2Q0O C;  1JJ2 U;  1HNX B;  2ZXW C;  1AJQ A;  2Q67 A;  4OX9 O;  1GTO A;  3E2E A;  4NYK A;  2YXY A;  2WWW A;  1W2B U;  2HKO A;  3BA9 A;  1NT2 B;  2XAF A;  1E1Q G;  2QWO B;  5FPR A;  4FLV A;  4YJ3 B;  1Q82 W;  4QJF B;  5FPO A;  2OCH A;  2N05 A;  2QTO A;  2CDY A;  1FXH A;  1QCE A;  1X59 A;  3WB1 A;  3ASN C;  3TXQ A;  3KDR A;  3J7A U;  5D5P A;  4FFK A;  1MA1 A;  3ZRX A;  1P84 F;  3OMI B;  4CS4 A;  3FAV A;  5CA1 B;  2B9Z A;  3FB6 C;  3T1H O;  1ZWI C;  3HKD A;  4G2K A;  3LSQ A;  1JA8 A;  2QJ1 A;  4RUE A;  5EZY B;  1L0N H;  4FMT A;  4TQF A;  4IYH A;  4KP4 A;  3ASO C;  2Y0I A;  1NI8 A;  1B06 A;  2Q0A A;  4X65 B;  1M9N A;  3K03 A;  3ZX6 A;  1GM8 A;  3APO A;  3ZS8 C;  3SJC C;  1FXK C;  1VIB A;  5KA5 A;  4LNU B;  4ZI7 B;  2HEP A;  4U7N A;  3MAQ A;  5L3F A;  1V55 C;  1R3I C;  4D7T A;  2VQE O;  2PY5 A;  4I9W A;  4FLX A;  1L0L H;  4CS2 A;  2DMX A;  5EC2 C;  3M7M X;  4O2A A;  1NZ6 A;  3RYC B;  3S3W A;  1IBK O;  1OCZ C;  1QU7 A;  1QR8 A;  4MW3 A;  4NXM B;  4DV4 O;  4ZHQ A;  5B66 Z;  5DEC A;  5B3S C;  4DR6 B;  2EIK B;  1XDC A;  1Q7Y W;  4OX9 B;  4O4H A;  1E79 G;  4F6R A;  4UCR A;  1VF7 A;  1BGY H;  3AK1 A;  3DGE A;  2F4V B;  2OTJ V;  4B3R O;  5IY5 C;  3RWR D;  3EXA A;  2C2A A;  4LF4 O;  1FFX A;  2YC0 A;  3OMA B;  1GRJ A;  2Q8V A;  4LH7 A;  4MW8 A;  2A06 H;  3ZRW B;  3P30 A;  2DYR B;  3EHB B;  1V55 B;  2YUA A;  5LGT A;  3HKE A;  2ADQ B;  2P4K A;  2DWD C;  4DV7 O;  3AG7 A;  2PF4 E;  4EB6 A;  1URF A;  1OZ0 A;  3KG2 A;  3T1H B;  3WU2 Z;  1JFF A;  5IWA B;  4FLY A;  3LSU A;  1YVW A;  4GX5 A;  2A9H A;  1V9P A;  2YXL A;  1H8H G;  1SQX H;  5B3S B;  4WFB V;  1S5L Z;  4TUY B;  3ZN0 A;  5A9G A;  3H1I H;  2PTM A;  1KQS U;  1CXZ B;  3VOU A;  1M57 B;  2EJ7 A;  4R8C A;  1PM9 A;  1Y76 A;  4QIW F;  4FZ1 A;  2Y48 A;  3K5N A;  3J80 N;  4FLT A;  3N2G A;  4MT8 A;  3ZMZ A;  1Y67 A;  3TGU H;  1Z2G A;  2CH7 B;  2ZCE A;  1RM1 C;  4X20 B;  3SPH A;  1HDJ A;  3RVY A;  1IBK B;  1QVF U;  5GW7 A;  4EKW A;  3JAL B;  3RGB A;  5KHG A;  1F4M A;  1GM9 A;  1LUV A;  4LF8 B;  1SA0 B;  3G67 A;  4UVB A;  1VQM V;  3CCU V;  5KUK A;  1OHH G;  2AHZ A;  2QEX V;  3L72 H;  5B1O A;  3FAV B;  2Q4P A;  2IH3 C;  2RCV A;  4LF4 B;  2WA4 A;  1AR1 B;  1N34 O;  2QM4 A;  1SRY A;  2M7W A;  1I08 A;  2LGW A;  3ABK B;  1GO3 F;  2A3Q A;  5LL6 Y;  4LF5 B;  2OIE A;  3QG5 A;  3B2E E;  3E8F A;  3OTF A;  4DW0 A;  2LO1 A;  4DR3 O;  3Q4H B;  3K79 A;  4TWK A;  1XRE A;  4EFB A;  3DTU B;  3LSS A;  1KD1 W;  4DV7 B;  2WPD G;  1RPR A;  1RM1 B;  5H6R A;  3ETE A;  1FFT B;  4CH4 A;  1F23 A;  3ZRV A;  4JI0 B;  2WLH A;  4JV5 O;  4CS3 A;  1TVK A;  1R3J C;  2NN4 A;  4BR6 A;  1SET A;  4O2A B;  2ZIO A;  1PV0 A;  4JAU A;  3HKC A;  1H2K A;  1CPY A;  2QE7 G;  3ABL C;  1BL8 A;  2GBO A;  2DQ3 A;  4UFZ A;  2UXX A;  1T5E A;  4LFB O;  1Y4M A;  1N36 B;  2AZ0 A;  4O4H B;  2ITD C;  4F6R B;  3G71 V;  4DR1 O;  3BY6 A;  5LHH A;  1QLE B;  4IT5 A;  1BT8 A;  1FFX B;  2B1G A;  1IDS A;  2L35 A;  2A0L A;  4CC6 A;  1NJI W;  1VQK V;  4DV6 O;  3W7X A;  3E35 A;  2IM9 A;  4J11 A;  4LC1 A;  1TAE A;  2YI9 A;  4JF3 A;  4JI8 B;  4MTX A;  3SYA A;  1H2G A;  1JVM A;  3OTO B;  3ZED A;  1JR9 A;  1KP2 A;  1CP9 A;  3BA8 A;  2Q69 A;  4IYI A;  1HNW O;  4OPH A;  3HKB A;  3ABL B;  5A2Q N;  4DR2 B;  3A0B Z;  4LP8 A;  4X8A A;  4AQY O;  1OV9 A;  3C90 A;  3BHP A;  2NNU A;  4ZBM A;  2ILM A;  5DN6 G;  1FYJ A;  1I5Y A;  3CRA A;  2KKW A;  4MVS A;  5JCO C;  1YI2 V;  5LA6 B;  4LWS A;  5FL7 G;  4BWA A;  2WLI A;  1Y76 B;  1Z5W A;  3CWB H;  4ABM A;  4I4T A;  1H2L A;  2RQ6 A;  3QO8 A;  1H2S B;  3A0R A;  1Q6H A;  3E83 A;  4IL6 Z;  3CP1 A;  2Z3Y A;  4FK5 C;  3D36 C;  3H1J H;  1BS3 A;  1K9M W;  3CC7 V;  1H2M A;  3LDE A;  2X7R B;  1FOU A;  5LXT A;  2HR3 A;  4LR3 A;  5H6Q A;  2OWO A;  3CCM V;  1AIL A;  1QQC A;  4LFB B;  3CXH F;  2DYS B;  1K33 A;  1Q6I A;  2E3C A;  2Q9L A;  1BCC H;  4DR5 B;  4Q6G A;  2QKS A;  4DR1 B;  2CTP A;  2IJK A;  4DW1 A;  1VF5 B;  2YS8 A;  5B1A B;  5B1N A;  1M1K W;  2F43 G;  3FB5 C;  1BHB A;  1KC8 W;  3OD4 A;  4NXN O;  1QNM A;  5L3D A;  5KAI Z;  4PDV A;  1NH2 B;  3SYC A;  1SS3 A;  2RDC A;  4DV6 B;  5LGU A;  1RSO A;  4LFC O;  5KHK A;  2W0F C;  1S72 V;  2EX3 A;  4E4E A;  2R9I A;  2Q7E A;  4YY3 O;  4DUZ B;  4GLX A;  4DR7 B;  4FLZ A;  1Y74 A;  1HR0 O;  4JTC B;  4XDL A;  3FYE B;  3R65 A;  3RYH B;  1FJG B;  2VWK A;  4PA7 A;  4AQY B;  1KBH A;  1TVK B;  4W4K A;  1NTM H;  2CTW A;  5DM6 V;  2XOK G;  5L3B A;  1AR4 A;  4WFG A;  3E8G A;  2QA4 V;  4PA4 A;  3CS5 A;  2ATK C;  3OGC C;  4U3J B;  1U97 A;  2KG7 A;  1WB7 A;  2QGN A;  4JYA O;  1P7B A;  5KUM A;  1VP7 A;  2GUZ B;  3JAW A;  1YF2 A;  2N74 A;  4WF9 V;  1WP8 A;  1TUB A;  1H38 A;  2P22 C;  1M90 W;  4D7S A;  1K4C C;  2ZDI A;  1N33 O;  3ZN1 A;  3O9O A;  1HNX O;  3W7U A;  1NTZ H;  1M56 B;  1J5E B;  4ZOL B;  4EEQ A;  4P30 A;  1HWY A;  1SQP H;  4UB8 Z;  1W0J G;  4FZ0 A;  5E79 Z;  2DN9 A;  1ZX3 A;  3U10 A;  2O57 A;  2HG5 C;  1JX9 A;  4R7C A;  1K7D A;  3L75 H;  3BPZ A;  2A79 B;  1WJZ A;  1CEZ A;  2QWR B;  2XAS A;  5J2T B;  1ZUQ A;  4LF9 O;  4WBN A;  3K58 A;  3B8M A;  4ZIB A;  1WPB A;  5LMU B;  3CXC U;  2JS3 A;  2BTQ A;  4LFC B;  2Y4T A;  4FM1 A;  5LOV B;  4LF7 B;  1QHT A;  1EN5 A;  4P9P A;  3TXS A;  3ZHR A;  1GM7 A;  4LWS B;  4YY3 B;  1VF6 C;  3FB7 C;  2IU0 A;  3ABU A;  3N2K A;  4NTX A;  2Q73 A;  4PV1 B;  4QNH B;  4I4T B;  5CMU A;  5J9P C;  4DK0 A;  2QDO A;  1WPX A;  2OYQ A;  3CSX A;  1I0H A;  2UXB O;  2JGU A;  4I0X A;  1RP3 B;  3JAM N;  2CGN A;  3OAA G;  3E22 A;  4R6Z A;  4MS2 A;  5LP6 A;  2R72 A;  5JJN B;  5KMG A;  1YHQ V;  2PYL A;  1XIL A;  3CCQ V;  2H3O A;  2AZ2 A;  4X1Y B;  3X2Q B;  5BMV B;  2YEV B;  1S5J A;  2XAQ A;  3UT5 B;  1WA8 B;  3U0Z A;  4NXM O;  1N33 B;  1GMG A;  2P4V A;  4DR6 O;  4K3A A;  2IJH A;  4DV1 B;  1XUQ A;  1KU9 A;  2Y0P A;  3L70 H;  5JWP A;  2F4V O;  4O2B B;  2BSK A;  4JAV A;  3R66 A;  4Z1M G;  2X0L A;  3JAT A;  1ZL8 B;  2AGA A;  1N0J A;  5LBQ A;  5KX5 B;  1PL0 A;  4X1I A;  4DV0 B;  5K1X A;  4LF9 B;  1MOF A;  2X6C A;  5CBH A;  2R70 A;  4N21 A;  4IIJ B;  2QWP B;  4FFB B;  4HAM A;  2PGG A;  3SYP A;  5IYZ B;  1OJH A;  5IWA O;  4J9Y B;  1GN4 A;  2UXD B;  2EIK C;  2YDE A;  3HB3 B;  4X1K B;  4U3F H;  2IW5 A;  3FFQ A;  2PI5 A;  4RWU A;  3D3I A;  2EIJ B;  5EIB D;  4XDJ A;  3RYF B;  1PD3 A;  3BCC H;  2UXB B;  4PD4 F;  2JK5 C;  2DYR C;  2BE3 A;  4O4L B;  1ZSP A;  2DJV A;  3H9V A;  1VQ6 V;  1VQ7 V;  1FAF A;  2MW2 B;  1G1X B;  4YIO A;  4N23 A;  3RW0 A;  1O9H A;  4FVM A;  1SZT A;  2ZNJ A;  3K9A A;  1B04 A;  1KB9 F;  3K0G A;  4BAY A;  1IJG A;  4DV3 B;  3QO7 A;  4LF8 O;  4WBN B;  2Y4U A;  4JI4 O;  1NQT A;  3FD9 A;  2FB5 A;  4E2L A;  1MG1 A;  3JAS A;  5EBL C;  1US6 A;  1XL6 A;  1R6T A;  3MDS A;  2WLL B;  1KKC A;  1EBO A;  5IJ9 A;  1AR5 A;  2EJR A;  1BZK A;  3AG2 C;  2QKA A;  1M57 C;  2A7W A;  2AHY A;  2XAJ A;  3RBZ A;  4FM0 A;  4LF5 O;  1AI5 A;  5HFM A;  5JJJ B;  1NVP D;  3RT3 C;  3D3Q A;  1AVM A;  5ITZ A;  4FLW A;  4PDR A;  1D5N A;  3L74 H;  1V54 C;  1JOY A;  3K9S A;  5GON B;  4HYO A;  1R3L C;  1SQB H;  3F7V C;  3JAR A;  5FNV A;  1BE3 H;  3WB0 A;  3BAB A;  4UUJ C;  4YIP A;  2ODM A;  1P7G A;  2VRZ A;  4BIZ A;  2GTS A;  1S0V A;  1OCR C;  1DLB A;  4JI0 O;  1FKA O;  2V1D A;  4I50 A;  5KAF Z;  4LF6 O;  5BZB A;  2EIN B;  2ADP A;  5KMG B;  2BCC H;  3O65 A;  4JPR A;  5IE9 A;  1KUQ A;  1P49 A;  2PI4 A;  1NR7 A;  4HNA B;  1D5A A;  1TUE B;  3AG2 B;  3ABK C;  4DXW A;  4YJ2 A;  1SES A;  2UXC O;  3QO5 A;  5EBM C;  3P3N A;  3CCL V;  1SQQ H;  1N36 O;  1MSW D;  4J9Z B;  4UCT A;  4UVC A;  2XTA A;  3F5W C;  3ABM B;  3K5L A;  3AG1 B;  3K57 A;  4X66 O;  1A32 A;  2BSK B;  4B3T O;  1NTK H;  1V54 B;  1NS1 A;  2CAZ C;  1PNK A;  4J80 A;  5HFL A;  3JCU Z;  4QE9 A;  2XHB A;  5JVD A;  3DXR A;  2LFR A;  3UO3 A;  2VWJ A;  4TSF G;  5CN0 A;  4X64 B;  1YIT V;  2H94 A;  1OCR B;  4CH6 A;  4JI4 B;  5IT9 N;  4JI8 O;  1ZAU A;  3SYO A;  2EZO A;  3OTO O;  4JI7 B;  3JAK A;  1JCH A;  3HKD B;  1J95 A;  3K08 A;  4DR2 O;  5IYC O;  3E86 A;  5BY1 A;  5LMN O;  3SGI A;  4FM2 A;  3G80 A;  1QVG U;  2DQ0 A;  1QLE C;  1S76 D;  4B7E A;  4WFF A;  5F2V O;  2UUC O;  1SZX A;  3JYC A;  1R1B A;  5J2U A;  3A2F A;  4TV8 A;  4UCO A;  2E75 B;  2ARH A;  3OR7 C;  2FYU H;  5C93 A;  3UM7 A;  3SYQ A;  1R6N A;  3OUS A;  3I55 V;  2HVJ C;  4LF6 B;  3MHS C;  3VQX A;  4PJ0 Z;  5B1B B;  2CTR A;  1YJ9 V;  4MSW C;  3GVM A;  2ETN A;  5LYJ A;  4K0K B;  1RFY A;  4B3M O;  4ZHQ B;  5IDJ A;  2UXC B;  3SDL A;  4DR5 O;  4I55 A;  3G6E V;  1JJO A;  3T4Z A;  4X66 B;  1KKD A;  4B3T B;  1M4U A;  1E1R G;  2CE4 A;  2Q6A A;  1S77 D;  5L3E A;  4P9O A;  1MZE A;  2LFS A;  1OCO B;  5ITZ B;  4PA9 A;  5EC1 C;  4R50 A;  1ZLZ A;  5KHJ A;  4DRX A;  1Y6X A;  3HKE B;  3JAR B;  2Q68 A;  2OT5 A;  2Q7H A;  4FJC C;  4DUZ O;  3JD3 A;  4DR7 O;  4PI0 A;  3TCU A;  2ZKO A;  2E5L O;  3T2M A;  4EB6 B;  1Z5V A;  5EYP A;  4UV8 A;  1FJG O;  1W0K G;  1JFF B;  1NKD A;  4JI2 B;  2DYS C;  3KZI Z;  3MHH C;  4LBE C;  5LMN B;  1AB3 A;  2ZE6 A;  4JI5 B;  2BTO A;  3J81 N;  3DSQ A;  5CA0 A;  5B1A C;  3ZMV A;  2M6Y A;  3E89 A;  2UUC B;  1XQ8 A;  5BR8 B;  5JQG A;  2Q5Z A;  2P7T C;  5TIS Z;  3SJA C;  1YSC A;  4O4I A;  1S5H C;  1H2N A;  3N2G B;  3OGI B;  3UKM A;  4GKK B;  3SPJ A;  1IXM A;  1J5E O;  3BRC A;  2BOC C;  2YI8 A;  5JVD B;  3CE2 A;  4Q20 A;  4J42 A;  2F93 B;  5IJ0 A;  4B3M B;  4X89 A;  2JJ1 G;  4MVZ A;  1EZV H;  1S3J A;  3ABT A;  1YCI A;  1SER A;  1NR1 A;  2IJJ A;  2ZE8 A;  1HP8 A;  5AG2 A;  5JH7 A;  2V4D A;  4MVQ A;  3DC6 A;  3PN1 A;  3K0D A;  1AI7 A;  2GHY A;  3ML0 A;  1YZB A;  3CCS V;  1SQG A;  5LMU O;  2HHH O;  4H37 A;  4O4J A;  1LR1 A;  2V7Q G;  1M93 A;  3BFR A;  4YXW G;  1KYO F;  4LF7 O;  4TV9 A;  4CC5 A;  3M99 B;  2UU9 B;  1QR9 A;  3JD0 A;  1M56 C;  2QWN B;  2QM7 A;  4DUY B;  1JMK C;  4B08 A;  4NTY A;  5JJE B;  5J2U B;  2E5L B;  1WB8 A;  1K34 A;  4Z1V A;  2QTS A;  4CZZ A;  3GWK C;  3APQ A;  2FML A;  2BOB C;  1PKX A;  3DC5 A;  3CB2 A;  4RAI A;  3ZHV A;  4YJ3 A;  1GN2 A;  3IGA C;  5LYJ B;  3HKC B;  4JYB A;  4K8Z A;  1MZF A;  2EUL A;  5L3C A;  2D3O W;  2WLN A;  1IBM B;  4KHP B;  3FKS G;  4NB5 A;  4I55 B;  2P6J A;  4Z2W A;  5CA1 A;  2ZM6 B;  4UCV A;  4FLU A;  4G28 B;  2WAM A;  1NU1 H;  1O9G A;  4DV1 O;  1KMI Z;  2P06 A;  4PA6 A;  2LP7 A;  1B6Q A;  1ZTE A;  4BW5 A;  2YID A;  2IU3 A;  1VAR A;  4FIP C;  4DK1 A;  3G6B A;  1PL4 A;  2UXN A;  1L8D A;  4FPP A;  3CMA V;  1VQL V;  1LUW A;  4LNU A;  4ZI7 A;  4DV0 O;  3ZMU A;  3D8C A;  5CB4 A;  1ARO P;  3LNN A;  1DF5 A;  1R73 A;  1SQV H;  2DWE C;  2KSD A;  3HKB B;  3OE7 G;  1I5X A;  2RMK B;  4DR4 O;  3BVO A;  3X2Q C;  2ZE7 A;  2FL4 A;  2OCC C;  1Q8I A;  2CTQ A;  3ZRS A;  2HHH B;  3BAA A;  3ZHU A;  3RYC A;  3JSN A;  3THO A;  5CA0 B;  2PUS A;  3B4S A;  2P90 A;  3S3X A;  3RN4 A;  4EFE A;  1EN4 A;  3A0H Z;  4K35 A;  2UXD O;  3BEH A;  3OT7 A;  4L87 A;  4RUF A;  4JI1 B;  2WLI B;  1UPG A;  3JD2 A;  3ETQ A;  3SR2 C;  3OM3 B;  2HP8 A;  4J41 A;  1WLE A;  2WSS G;  2F66 C;  3SJQ C;  3H01 A;  2K9P A;  4MTG A;  2RJZ A;  1OCC B;  2GDS A;  5LXT B;  4I9Q A;  4CBC A;  3P3P A;  1HNZ O;  1FXK A;  2IJI A;  1M5I A;  1YEW A;  4X62 B;  2UUB O;  2OCC B;  1I7F A;  3IAY A;  5JH7 B;  5C8Y A;  4DV3 O;  2EIM C;  2LJ2 A;  4GUN A;  3AEI A;  5E1A C;  4QPJ A;  1VQ4 V;  2W6J G;  1IUR A;  4J7Z A;  1L1F A;  3VQY A;  3CCR V;  2EIL B;  2EIJ C;  2L6L A;  4XBF A;  1TGO A;  1RSO B;  2ZDI C;  4H44 B;  5IYB O;  3T1Y O;  4TUY A;  2DE0 X;  1BQZ A;  1YXB A;  4ASU G;  2AW9 A;  3F7Y C;  4GKJ B;  4PDL A;  3TJT A;  3ZIA G;  1Y74 B;  2YIC A;  3H1L H;  4OXS A;  4WCE V;  3CME V;  2ITC C;  4G27 B;  1W59 A;  3C3T A;  4GCZ A;  1K97 A;  1ENV A;  1PPJ H;  1WAZ A;  2JDI G;  3QF7 A;  4F4L A;  4MVU A;  1IBL B;  4AHC A;  4I7Z B;  4DR4 B;  1N8R W;  2CH7 A;  3AG3 C;  3K5O A;  2JS5 A;  4X20 A;  3CC4 V;  3W7W A;  3LDD A;  3W7S A;  3CC2 V;  2ZNI A;  3JAL A;  3AK3 A;  2H8P C;  2EIM B;  4GX2 A;  2KG7 B;  1WN7 A;  2LW7 A;  1SA0 A;  1Y66 A;  3JAW B;  3CJH A;  4MVM A;  3I56 V;  1TUB B;  2HJD A;  4UXN A;  5H9C A;  1VQ9 V;  1VQO V;  4I5S A;  3CRM A;  4GX1 A;  4CH3 A;  4JZ2 A;  2ZXW B;  4X9Q A;  3Q4H A;  1FS0 G;  1IZ3 A;  2YIA A;  4F6E A;  1HNZ B;  4JI6 O;  3OEE G;  3IC9 A;  3ZCC A;  2UUB B;  4YHH B;  3ZMT A;  1R6K A;  4WFE A;  1BMF G;  1JPX A;  2JGD A;  1NBM G;  5LP6 C;  3AG3 B;  5IYD O;  4LH6 A;  4X64 O;  2FTK A;  2YSU B;  5CB4 B;  4LFA B;  2EIN C;  3H1K H;  2K1E A;  4QPK A;  4K8X A;  4KFM A;  1AJP A;  4DV2 B;  3ASN B;  1G4Y B;  4QE7 A;  3WG7 C;  2G38 A;  1THZ A;  2BTQ B;  2Q7G A;  4JI7 O;  3T1Y B;  1EZJ A;  2ZIM A;  4L8J A;  4GX0 A;  3L73 H;  5L3G A;  4IHJ A;  3B09 A;  1HW7 A;  3CPW U;  1X4T A;  2OTL V;  3N2K B;  3ABM C;  4PDM A;  3AG1 C;  1G8M A;  4MTO A;  1COW G;  4BW9 A;  2JIZ G;  2MK3 A;  1AI4 A;  3AK2 A;  2CK3 G;  4DO2 A;  1EFR G;  3ASO B;  4GT1 A;  3VBB A;  3SPG A;  4JAA A;  4HZ3 A;  4I0X B;  4J7J A;  1JQ0 A;  3QVN A;  4AI8 A;  3E22 B;  5LP6 B;  1YDX A;  1XNR O;  1FXK B;  4PHZ A;  2WLJ A;  2B5U A;  3CEI A;  2QKC A;  1IXB A;  3JD1 A;  3RVZ A;  2XUM A;  3VQW A;  2EBO A;  3OW2 U;  5FLX N;  4JI3 O;  5KHI A;  2PYJ A;  5C8Y B;  3WG7 B;  5EBW C;  1MAB G;  4K0K O;  4UV9 A;  4TOI A;  1OCZ B;  3JD4 A;  2P67 A;  3HR0 A;  1IX9 A;  4JI6 B;  2FKX A;  4OGQ B;  2Z5U A;  1SQF A;  3JAT B;  5IY5 B;  5LA6 A;  1NH2 D;  2W6I G;  4UCU A;  3LUT B;  1SKV A;  4OPA A;  4X1I B;  1YIJ V;  1XOU A;  2KQX A;  4J7K A;  2VQE B;  5B1B C;  4ZKI A;  3ZHT A;  2VS0 A;  1GN3 A;  2GTA A;  2ZE5 A;  4NR1 A;  2ZQM A;  1EM1 A;  4WFH A;  1FXV A;  1K4D C;  1N32 O;  1QLN A;  5D5Q A;  4P2Z A;  4JI2 O;  2E76 B;  4JTA B;  4DV4 B;  3FYI B;  4B3S O;  1KEC A;  4RQE A;  4JI5 O;  4CH5 A;  3CJH B;  3RYI A;  3STL C;  5EIB C;  1XI1 A;  4PI2 A;  2NLJ C;  3AG4 C;  4B3R B;  2EZP A;  4HBN A;  3L9D A;  2ZR2 A;  5BR8 O;  1JNB A;  5JCO A;  3E8H A;  1P4R A;  1OCO C;  1BQ0 A;  3SPI A;  3B77 A;  2JRI A;  1SF9 A;  1K8A W;  1TA8 A;  3GB7 C;  1N0N A;  1XNR B;  1H8E G;  4GKK O;  2DOS A;  3NXS A;  2XT9 A;  5EK0 A;  3UCS C;  1YTF D;  2IBZ H;  3K04 A;  2JGD B;  3IJ4 A;  3D36 A;  4JI3 B;  4JAS A;  2AXT Z;  2WLK A;  2HVK C;  3RYH A;  2ZT9 B;  1U96 A;  3CCE V;  3JAS B;  1VQP V;  1H5W A;  1Q43 A;  5IJ9 B;  3C3S A;  4PA3 A;  3AG4 B;  4U3J A;  3K59 A;  3ETD A;  5H5N A;  1KP3 A;  4ICG A;  1DK1 A;  3MD0 A;  1PP9 H;  4IHJ B;  4DYL A;  3EFF K;  2ZD9 A;  2GUZ A;  4MVO A;  1WNS A;  2UUA O;  2YXH A;  4AIL C;  2X6B A;  2UU9 O;  3EVK A;  5FNV B;  4DUY O;  4J10 A;  1K73 W;  1XHZ A;  3QNE A;  4NKG B;  1B3Q A;  1PNM A;  3TK1 A;  1UJW B;  2PZS A;  3E8B A;  3NR7 A;  3CYO A;  2CUG A;  4ZOL A;  1VMG A;  1N32 B;  2JJ2 G;  4RO2 A;  5CBG A;  3RFR A;  2F95 B;  2JVD A;  4I50 B;  1GAX A;  4B3S B;  3H1H H;  4D6T H;  1XMQ O;  4GYC B;  3GWO A;  1XL4 A;  5B5E Z;  4KUM A;  5J2T A;  3UO2 A;  4TT3 G;  4YJ2 B;  4LCU C;  4NTW A;  2VQF O;  3L71 H;  1N34 B;  2ZR3 A;  1IBM O;  3K06 A;  1YJN V;  4KHP O;  3W7T A;  2JEX A;  4DR3 B;  2XND G;  4UCS A;  4MVR A;  2ZM6 O;  1VQ8 V;  4IGG A;  1NVP B;  1SC5 B;  4TQD A;  2WA3 A;  5BXZ A;  5LOV A;  1F7Y A;  1XNQ O;  3I5D A;  4C7U A;  1YJW V;  1WP7 A;  3KCX A;  1XEQ A;  3DXR B;  3OFN G;  1DF4 A;  3FB8 C;  1GKF A;  4KL1 A;  4JV5 B;  1FD9 A;  3STZ C;  1I94 O;  3ETG A;  3JAK B;  1XHX A;  2Z0A A;  3TET A;  3CD6 V;  4PEL A;  2R9A A;  3IC7 A;  2QSA A;  3G4S V;  2YIB D;  1EN6 A;  2HFE C;  1VQ5 V;  4JYC A;  2R9R B;  5LGN A;  3LNM B;  3RYI B;  3JCZ A;  4X1Y A;  2UUA B;  5BMV A;  2YEV A;  1Q81 W;  3UT5 A;  1WA8 A;  2GV9 A;  3SJB C;  1K5S A;  2W0X A;  4JI1 O;  4TV8 B;  4JGS A;  1RPO A;  1VF6 A;  3UQ8 A;  1DGS A;  1Q6U A;  3OUF A;  1R3K C;  4O2B A;  3ICX A;  2GSM B;  4A5U B;  3B40 A;  3ZHS A;  2HLD G;  3P32 A;  5K1P A;  1ZL8 A;  1XMQ B;  4W4L A; 
#chains in the Genus database with same CATH homology
 4YIP A;  1P7G A;  1PM9 A;  1QNM A;  1ZTE A;  2AW9 A;  1MNG A;  1BT8 A;  4JZG A;  1IDS A;  1VAR A;  1Y67 A;  2ADP A;  1AP5 A;  3TJT A;  1GN4 A;  1EN5 A;  1GN6 A;  3C3T A;  1PL4 A;  3AK2 A;  4JYY A;  4E4E A;  1LUW A;  5AG2 A;  1LUV A;  1N0N A;  1I0H A;  3QVN A;  4C7U A;  3DC6 A;  1JR9 A;  3CEI A;  3AK3 A;  2QKC A;  1MSD A;  1IXB A;  1ZSP A;  1XDC A;  2CE4 A;  1AR4 A;  3RN4 A;  3AK1 A;  1EN4 A;  2RCV A;  4YIO A;  3BFR A;  3OT7 A;  1BSM A;  1I08 A;  1ZLZ A;  1AP6 A;  1XIL A;  1WB8 A;  1WB7 A;  2CDY A;  3C3S A;  1EN6 A;  1IX9 A;  1XRE A;  4JZ2 A;  4X9Q A;  4F6E A;  3DC5 A;  2GDS A;  2ADQ B;  2P4K A;  3MDS A;  1KKC A;  3IC9 A;  1MMM A;  3KKY A;  3KDR A;  1XUQ A;  1AR5 A;  4FFK A;  1MA1 A;  1GN2 A;  2QKA A;  1BS3 A;  3EVK A;  3LSU A;  4BR6 A;  1JA8 A;  1GN3 A;  1AVM A;  4GUN A;  1SZX A;  1N0J A;  1D5N A;  1EM1 A;  3K9S A;  5A9G A;  1VEW A;  1ZUQ A;  1B06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...