1JA8A

Kinetic analysis of product inhibition in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic analysis of product inhibition in human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Manganese Superoxide Dismutase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ja8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ja8A02
2QKAA 2QKCA 1QNMA 1LUWA 3EVKA 4X9QA 1N0JA 3KKYA 1BSMA 1ZLZA 5A9GA 1N0NA 3LSUA 1PL4A 3C3TA 1GN6A 3BFRA 1KKCA 1B06A 1PM9A 2CE4A 1IDSA 3RN4A 4F6EA 4BR6A 1ZUQA 3QVNA 1EN6A 1I08A 1VARA 1JA8A 3OT7A 2ADQB 4GUNA 1IXBA 1D5NA 2P4KA 1GN3A 3CEIA 1SZXA 4FFKA 1EN4A 1XDCA 1P7GA 1AP5A 1BT8A 1AR5A 3AK1A 1GN2A 1XUQA 3DC6A 1ZSPA 2AW9A 1EN5A 2ADPA 4C7UA 1WB8A 1AP6A 1VEWA 1Y67A 3AK3A 1JR9A 3DC5A 3MDSA 1ZTEA 1LUVA 3C3SA 2CDYA 1BS3A 1MA1A 1MSDA 1MMMA 3AK2A 4JYYA 4YIOA 1MNGA 1AR4A 1WB7A 5AG2A 4E4EA 1EM1A 1GN4A 1XILA 3IC9A 2RCVA 1IX9A 1I0HA 4YIPA 4JZ2A 3K9SA 3TJTA 1AVMA 2GDSA 4JZGA 1XREA
chains in the Genus database with same CATH superfamily
2OWOA 4MW3A 4JI3O 4JI1O 3SJBC 1TAEA 1FD9A 4X66O 4JF3A 3SGIA 2CK3G 2YI8A 3E89A 1YITV 5DN6G 4FLZA 3CXHF 3WG7C 5KMGA 1ZLZA 2AGAA 5IYZA 2JGUA 3HKDB 2UXBO 4IYIA 5IT9N 4WBNB 5IY5B 3RWRD 4MW8A 1H2MA 3NXSA 3OTFA 2DYSC 2RN9A 4UCRA 1OCRC 4FJCC 1WPBA 5KHIA 4PA9A 1L0NH 4DV1O 3RT3C 1KU9A 5LA6A 2HVKC 5FNVA 2WA4A 3BY6A 4DW1A 3U11A 1I5XA 3ZIAG 2ZNJA 1VQ6V 4PA7A 4LC1A 1SQQH 4JGSA 5HFMA 3CC2V 3M7MX 1ZSPA 4PV1B 3H1HH 3VBBA 3IJ4A 5B66Z 1J95A 1AILA 3DXRB 4B3MB 1T5EA 1JR9A 2UXXA 1HNWO 2JJ1G 5L3DA 4A5UB 2JS5A 5IY5C 5LOVB 2QM7A 4HAMA 4DK1A 5LXTA 1LNQA 4YY3B 5C93A 2BE3A 4CS4A 1R6NA 5AG2A 2W6JG 4CBCA 1H8EG 1IBKO 1QU7A 4DR2B 2GBOA 1OCZB 2RCVA 1QVFU 4AQYB 2UUAB 2JGDB 1PNLA 4EB6A 4BIZA 4WBNA 4HYOA 4MTOA 4LF5O 2JEUA 1KUQA 4B3RO 1G1XB 5JQGB 3GVMA 5EC1C 1AJQA 2KKWA 4PD4F 2E75B 4KP4A 4PHZA 2R9RB 4WFAV 2P7TC 3JSLA 4LF4O 1XNQO 3GWKC 5DM6V 4X64O 2P5OA 5EIBC 5JQGA 4L87A 2KQXA 4TV8B 3E35A 3RBZA 3ML0A 1UJWB 4X20B 4Q6GA 4F6EA 1FXHA 2R70A 1I08A 1KB9F 4DR4B 1KP2A 3I5DA 3ZX6A 4HNAB 3G6EV 3H9VA 2UXDO 1W2BU 3OMNB 1UPGA 4IT5A 4LR3A 4D6TH 3EXAA 2F23A 3ZBHA 1BT8A 4TWKA 2UXDB 2EZOA 3BCCH 1OCCC 2CUGA 1R6TA 2CGNA 4FFBB 3A8TA 1KC8W 4NXMO 2HLDG 2HHHO 4UB8Z 3KCYA 1KQSU 1JFFA 1QBZA 1MA1A 4EFEA 3SR2C 2LGQA 4K8ZA 5JH7A 5KHKA 1KD1W 2JDIG 1XNQB 4J42A 2BCCH 4Z1MG 3HKCB 2EIMC 4K35A 3OMIB 2XUMA 4IGGA 1V54B 5CB4A 4ICGA 4QE7A 2DYRC 4MVUA 5EZYB 3ASNB 2X6CA 4UB6Z 3ZHSA 1SC5B 4LFAB 4JI0B 5KA6A 5ITZB 4H13B 1XREA 2OTJV 3E8HA 3ZJZA 4K0KO 1MOFA 5B1AC 1N36O 4PDLA 4YJ2B 1MZFA 2A79B 5J9PC 5EIBD 3JARA 1N0JA 4LF8B 3WB1A 5L3GA 1GN6A 2ZT9B 4LWSB 2PUSA 4EB6B 1V55C 4U3JA 1PV0A 3P3NA 1E1QG 2Q7HA 4JI6O 4U3FH 4GX2A 3FB7C 4TV9B 5LHIA 2H8PC 3CYOA 1ZL8A 4DR6B 4GKKB 1XHXA 1YJ9V 2WSSG 1FXKB 5LMUB 4ABMA 1B6QA 2QWQB 5KA5A 2WAMA 3CCEV 2WPDG 1H2SB 1GO3F 1DLBA 1WN7A 5LGTA 3U0ZA 2P4VA 5F2VO 1BGYH 2PI4A 3SPIA 1S3JA 1N33O 1NS1A 3B4SA 3B77A 4PELA 2IJJA 1UFIA 5J2TB 2ARHA 4DV2B 3DC5A 2LJ2A 5L3CA 1HNXO 3OR6C 1E1RG 2CTWA 4DR5B 4JYYA 4PDMA 1MNGA 1AR4A 4X1IA 2BTQA 5EYPA 1SQGA 3CHXA 4LCUC 2Y4UA 1L0LH 4FZ0A 3K5LA 4BIUA 3OGCC 4P30A 1EFRG 4J9ZB 1HW7A 4X88A 3DTUB 4GX1A 1K7DA 2EBOA 1N32B 3QO7A 3K5OA 5FNVB 1O9HA 1XHZA 1P49A 3MHSC 2GTAA 4BAYA 4N21A 2JRIA 2CTRA 1VQ7V 3RYIB 5H2FZ 1SZTA 5CA1A 1O9GA 3KKYA 4I5SA 3RW0A 3WB2A 4YJ2A 5BMVB 2CE4A 4TOIA 1EN6A 1VIBA 1E79G 1I7FA 4KUMA 2QWOB 1EZJA 3JCZA 1PNKA 3CXCU 3LDCA 5KX5A 1VQKV 2ATKC 4ZHQA 3CCQV 3TCUA 1TA8A 4B3RB 2XAJA 2JVDA 2YXLA 2HG5C 2EIJC 3DSQA 2E76B 3WB0A 4PI0A 1BQ0A 3CCJV 1XUQA 3GWOA 2F4VB 4NXNO 1D2DA 2OIGA 1XEQA 3JALA 3E2EA 2UXNA 3OD4A 1ZWIC 3AK3A 2EIKC 1HNWB 1HWYA 2IJIA 3ZCCA 1IBKB 1NH2B 1AR1B 3PN1A 5EBWC 2X0LA 1N34O 1W0JG 3AG1C 2KB1A 3OGIB 1K9MW 1KMIZ 3RYFB 1M9NA 3ZN0A 2Q0OC 3L73H 4MTFA 5KHHA 1FFXA 3AG7A 2ZINA 3BA9A 1J5EO 4LH6A 4LF5B 3SJQC 4GKKO 4MS2A 2IJKA 2ZIMA 5GONB 2GDSA 3CP1A 1YJNV 4JZGA 2ODMA 4O4IB 4UVCA 5E79Z 5CN0A 1YIJV 4TV8A 2D3OW 1LR1A 4X65B 2QTOA 4WFEA 3K08A 2JS3A 4I55A 5IE9A 4I0XA 2ZM6B 3N2KA 3T4ZA 2X6BA 4TQFA 5A9GA 3JAKB 3RYIA 1B06A 1PM9A 4QNHB 3CS5A 4NTXA 3OAAG 4X66B 2DWEC 4I55B 1FS0G 5KLVH 2ITDC 3CC7V 4MVOA 3OEEG 1GAXA 4BIOA 3RYHA 3K57A 3CC4V 1IVSA 2FL4A 2DWDC 3ZHQA 3CJHA 3TK1A 2EINB 4MTGA 3K59A 3T2MA 4WFHA 3ABLB 2YIDA 1AP5A 3G4SV 5B5EZ 3OEHG 2UUCO 4AILC 4XDLA 1SQVH 1PL0A 3JD3A 1VEWA 3D36C 1WP8A 4RUEA 1LUVA 4LNUB 4TT3G 5LMUO 5FPOA 1VQMV 4G27B 4FM0A 4X62O 1COWG 1M93A 2JK5C 2Y69B 3LSQA 4LF8O 3OMAB 4EFBA 3BVOA 4YJ3A 2F93B 1VF6A 4PA6A 2WLNA 4X1YB 2YS8A 4O4HA 4NXMB 4DUYO 1ZAUA 2WWWA 5LYJB 1XILA 3ABLC 1H8HG 2GV9A 4I50B 4Q20A 1QR8A 3IGAC 3M8AA 5C8YB 2Y4TA 1V54C 1DK1A 1YJWV 1GKFA 3JASA 1XQ8A 1VQOV 1Q3EA 2PI5A 1WAZA 2EJRA 5J2TA 3UT5A 4DV0B 2B1IA 3M99B 2QJ1A 4OPAA 5CMUA 1GMGA 1Q5OA 2DOSA 2Q68A 1K4CC 1H5WA 3QTCA 4O2BB 4DR7O 1WPXA 5GTIZ 1Z2GA 5EC2C 4CH4A 2IU3A 1SA0B 3TXSA 5CBFA 3BEHA 5KUKA 1QLEB 1NJIW 3APQA 2VQFB 1VMGA 3CCVV 2QGNA 4YHHB 1Y74A 4JYAB 5LOVA 1JJ2U 2LP7A 3VQWA 4I9QA 2ETNA 1TGOA 1IXMA 3VOUA 3CCMV 2N74A 1NI8A 3L75H 2YIBA 2ADPA 1RM1C 4DUYB 1WA8A 4I50A 3OTOB 4LF7B 2E5LO 3HKCA 2CGOA 3E22A 1BS3A 4EEQA 4I7ZB 1MMMA 4UCSA 4MVMA 5IDJA 2YSUB 2YXHA 2YI9A 5CBGA 3FKSG 2UUCB 2PGGA 3RVYA 4XBFA 1NTZH 4DW0A 4LFCO 1Q8IA 4WF9V 3VQXA 2P6JA 3ASOC 2WLKA 2EULA 2CH7B 4P9PA 4RUFA 1DF5A 1I0HA 4I9WA 1MG1A 1KBHA 4JZ2A 4O4LB 1XNRB 3ZEDA 2ZCEA 5LGUA 2QKCA 1XL4A 3RFRA 3VQYA 3G6BA 1VF6C 4RAIA 4DV4O 3CRQA 4F6RB 4X8AA 4QPKA 1H2LA 4UCOA 2B1GA 1F7YA 4YXWG 2WLIB 1N0NA 2QM8A 4DR2O 1H2GA 2QWRB 3OFNG 1IDSA 2UXBB 4JI1B 2E3CA 4J7JA 1KP3A 1OCRB 3ZHVA 4B3MO 2L6LA 4B3SB 4JI5O 5JCOC 1NH2D 2DMXA 4FLTA 3K06A 3G71V 2EIMB 1GN3A 2YIAA 1NVPB 3W7UA 2V1DA 3ZRWA 1VF7A 1Z5WA 1SZXA 4FFKA 4K0KB 1PNMA 4UXNA 3MAQA 1AR5A 3AK1A 1RP3B 3T1CA 2BOCC 4KHPB 3ABMB 1TVKB 2NLJC 1N34B 1CEZA 2B9ZA 1Y67A 2W0XA 2ZR3A 3SPCA 2ZXWB 2HJFC 1N8RW 5GTHZ 5H5NA 1VP7A 4DV1B 3KDRA 1AB3A 1YDXA 2ILMA 4ZIBA 5CA0A 1YHQV 5E1AC 2PYLA 4J41A 5CA3A 5ITZA 4DR6O 1M5IA 2H94A 1IJGA 4DUZO 3K5NA 4ZBMA 3QF7A 3FAVA 1EM1A 2YDEA 1THZA 1MZEA 4JI3B 4O4IA 1U96A 2NN4A 1QHTA 4O4JB 1W0KG 4D7SA 1FXKC 4DV5B 3K9SA 4I4TB 4ZI7A 4X65O 4BW5A 4LF9B 2QKAA 4FLYA 3QG5A 3H1JH 1Y6XA 3D8CA 3DXRA 4TUYA 3TGUH 2QEXV 4JI2O 2IW5A 1QVGU 4LF6O 4BR6A 2IH1C 1L1FA 4FK5C 2VQEB 2LW1A 4GKJB 3G67A 1FJGB 4CC6A 4JI4O 3CPWU 4JI8O 4JTCB 1N32O 4DR3B 3HPLC 1QLNA 1Q6UA 1V9PA 1W59A 3FB5C 1AI6A 1EN4A 3GB7C 3QO5A 2DYRB 2JGDA 1SQBH 1IBLO 1NTMH 5EK0A 3PJSK 2BTOA 1JFFB 1ZL8B 4FLVA 3VQVA 3N2KB 4P2ZA 3RYFA 3E8FA 5IYZB 5LP6B 3T1HO 1YCIA 2F66C 3OW2U 5CB4B 4YIOA 3B8NA 2PF4E 5CBHA 4LF4B 1WLEA 2D2CB 3JCUZ 3LNNA 1K33A 5B1NA 1F4NA 4AI8A 4E4EA 1XBLA 2EX3A 2OIEA 3JATA 1GRJA 4TQDA 4YIPA 2F95B 5IWAB 2DYSB 2V4DA 3UM7A 3ZMSA 4UCTA 1IBMB 4JAUA 2EIJB 3LSSA 4MT8A 1BCCH 5H9CA 2OCCB 4R7CA 4BW9A 1GH6A 5KX5B 4O2BA 2QE7G 3ZRXA 3ETGA 1WP7A 3O65A 1BSMA 4MVQA 2KG7A 4QE9A 3LSUA 1FKAO 3CRAA 1K5SA 4G2KA 1RFYA 1N36B 5JH7B 3BAAA 1FXVA 2DE0X 1HDJA 1RSOB 5KAFZ 4QGPA 1Y76B 4RQEA 1ROPA 1D5NA 2UU9B 1Z5VA 3ETDA 4DV7O 4F4LA 3UQ8A 1MABG 1H2KA 4NTYA 4CH5A 3AG3C 3JSNA 2FYUH 1TUBB 4WFGA 1GN2A 4JAVA 4J7ZA 4JYCA 1A32A 1Q43A 2OCCC 4XDJA 3E86A 1YVWA 5LMNB 2XHBA 4C7UA 3JASB 1AP6A 1R73A 5BR8O 4H37A 3QNEA 1J5EB 5L3BA 1SRYA 1GM9A 4J7KA 4JI6B 4X1IB 3KZIZ 4F6RA 2CDYA 2Z5UA 4LWSA 1IURA 3K03A 1S76D 5LYJA 2ZIOA 3BABA 4IL6Z 2PYJA 4HNAA 1OJHA 2K9PA 3SYPA 3CB2A 4X1KA 1DGSA 4DR1B 2QWNB 4P9OA 4R50A 4UV9A 2QTSA 1JOYA 3JD2A 1AVMA 3F5TA 4UUJC 2G38A 3C90A 3I56V 4DR7B 3D36A 5D5PA 5K1XA 1PP9H 3LUTB 3AG1B 4W4KA 3P30A 5LHHA 1FFXB 1SQFA 2VQFO 4PA4A 3WG7B 2NNUA 1M1KW 3EVKA 3CE2A 2Z3YA 4AHCA 5KAIZ 1NR1A 4MSWC 3OE7G 4JTDB 3E8GA 3BFRA 4B7KA 2XAQA 3O9OA 1JQ0A 1QCEA 2VQEO 3CCUV 3RYHB 2RDCA 1AI5A 4LF9O 4HZ3A 2F1MA 1CP9A 4GX0A 3G80A 1NKDA 1XMQO 1IXBA 3RYCB 5FLXN 4NR1A 3MHHC 2CTQA 4B7EA 1GM8A 3CEIA 3UO3A 4FVMA 1Q82W 4TV9A 3FB6C 1TVKA 2HHHB 2ZQMA 1YI2V 3THOA 1RPOA 2H3OA 2QKSA 5DECA 1WA8B 1JJOA 3DC6A 4AQYO 2UUAO 4LNUA 3A2FA 5TISZ 4ZKIA 1YSCA 4FZ1A 2A7WA 4JI4B 1BL8A 3ABMC 2VWKA 3CRCA 1K97A 3W7SA 1S5JA 3HKDA 2LO1A 3LDDA 4NB5A 3L72H 4J80A 2RNBA 1L8DA 2Q73A 3ETQA 3B09A 2AZ2A 5B1BB 3K58A 2YXYA 5LHGA 2UXCB 1R1BA 1SQPH 3KCXA 3X2QB 4OX9B 1PPJH 5B3SB 1Q81W 4CH6A 2LQTA 1B3QA 4H33A 3N2GA 1SERA 1URFA 4B3SO 4I0XB 1VF5B 2BOBC 1K4DC 1G8MA 1S5HC 4X1YA 3CMAV 4J9YB 1SA0A 1CXZB 1BE3H 2XOKG 3CWBH 5EBLC 1SESA 2XNDG 5BXZA 2DQ0A 2P67A 2DN9A 3K3WA 2GUZB 5IJ9B 4FMTA 1HNXB 5LP6C 4U7OA 2C2AA 2Z0AA 4MTXA 3K9AA 5JVDB 3ZRWB 1SF9A 4DV2O 2PY5A 5L3FA 1N4CA 4XDKA 3ASOB 3IFXA 1R3KC 4LFAO 1AJPA 2ADQB 3B40A 1S5LZ 2Q5ZA 4WFBV 2EINC 4GLXA 3TETA 1HR0O 3JATB 2JIZG 2RMKB 2QR4A 2K1EA 2JJ2G 1XDCA 3CSXA 4B3TB 3L70H 3HKBB 3F7YC 3H1LH 2WLLA 1XNRO 5IWAO 1DF4A 2UUBO 3BHPA 3CRRA 3L71H 1XOUA 1Q6IA 2PZSA 3OR7C 1M56C 2DW4A 2YEVB 3BRCA 3K0DA 1YXBA 1Q7YW 4BWAA 5BMVA 4O4LA 1M57B 3CRMA 4UCVA 4KL1A 3S3WA 3EHBB 5KHJA 5A2QN 4PI2A 2Y0IA 1R3LC 3ABTA 4KFMA 2YICA 2X6AA 2M7WA 3CMEV 2ZKOA 4DXWA 3ZN1A 1AI4A 1YZBA 2WLMA 4U7NA 5IYDO 1TUBA 2BSKA 3SJAC 2AZ0A 4IIJB 5B1AB 4DV6B 2FMLA 1QNMA 4JPRA 3ZHTA 1I5YA 4MVSA 1LUWA 4OPHA 1IBMO 3T1YO 1CPYA 1XI1A 3WU2Z 1G6UA 3ZMVA 4TSFG 2XAHA 3W7WA 1RSOA 2AXTZ 4DRXB 4DO2A 5JWPA 4E2LA 1AI7A 1VARA 4L8JA 2XTAA 3ZRVA 2IBZH 1Q86W 3I55V 3WFVA 4DV5O 4GYCB 1GTOA 2WLHA 1FYJA 2P4KA 5J2UA 4JASA 1IZ3A 1XL6A 3MD0A 1S77D 3E8BA 3T1HB 1FAFA 1B04A 1NTKH 2PTMA 2M6YA 3AG2C 3W7TA 1TUEB 1YF2A 2MW2B 4FM2A 1R3IC 5LP6A 2R9AA 1NZ6A 5LBQA 2GHYA 1EN5A 2HEPA 2Y69C 4GT1A 3HKEB 3SYAA 2EILC 2E74B 3K5MA 5EBMC 3IAYA 3HR0A 5LA6B 5L3EA 3ABUA 3FAVB 1P7BA 5FPRA 2YC0A 4FLXA 2WLLB 3S3XA 2QM4A 3D3IA 5GW7A 3SJCC 4GKJO 5H6QA 4D7TA 3T1YB 1F51A 3A0HZ 1F4MA 2P22C 4JI7B 2L35A 3AEIA 4PA3A 3BA8A 3K04A 2Q69A 4CS3A 1V55B 1Y74B 2DQ3A 2UUBB 4O2AB 1X4TA 4JI5B 5LXTB 2CH7A 1BZKA 3STLC 2MK3A 4PDVA 1SKVA 1S72V 4TUYB 4FLWA 4DV6O 1VQNV 1DTOA 3ZS8C 1K92A 1H38A 4IIJA 3FFQA 2IJHA 2ZM6O 1Y66A 1KKCA 2P90A 4GZRB 3E22B 2XAFA 1NT2B 1I94B 2R9IA 4I4TA 4ZI7B 4R8CA 1I94O 3B2EE 1K3EA 1NQTA 1BHAA 3SPJA 4ZOLB 4FIPC 1JCHA 3D3QA 3AG4C 3OT7A 1N33B 1YEWA 3HB3B 4DV4B 1K5QA 2A9HA 4DR5O 1S0VA 4X62B 4QJFB 3J81N 3SPHA 2ZE5A 1HNZB 2AHYA 4QPJA 1P7GA 4JI7O 2WLJA 4DV3O 5GONA 1HNZO 1BMFG 2WA3A 4OGQB 1R6KA 2KSDA 2OCHA 2HR3A 3ICXA 3JAWA 5CA1B 2O57A 2HP8A 3MDSA 3CCSV 2BTQB 2ZD9A 3FYIB 1RPRA 2WLIA 2FTKA 2ZDIC 4JAAA 5EYPB 1OHHG 2EILB 3W7XA 2GUZA 1MSDA 4QIWF 1G4YB 2AHZA 3P32A 4X1KB 1U97A 4UFZA 4JV5B 4NVPA 3UO2A 5IYBO 1H2NA 4O4JA 3RYCA 1M90W 5H6RA 5DEDA 1YTFD 1PKXA 3HKEA 2OYQA 1P4RA 3QO8A 2Q4PA 2XASA 1YTFB 2F43G 4B08A 3FX7A 3L74H 3AG4B 1QQCA 3CCRV 1OCCB 3UKMA 3JAKA 2UXCO 3A0RA 4MVRA 2JEXA 3RVZA 4NTWA 4X9QA 2W6IG 2VS0A 2HFEC 2YEVA 1PL4A 3DGEA 2IH3C 5JJEB 5LL6Y 4FM1A 1QR9A 2LFRA 3ABKB 3NR7A 3JARB 4ZHQB 3QVNA 2RQ6A 3R66A 3ZMTA 1FOUA 4K3AA 3R65A 2N04A 2Q7GA 3U10A 2GSMB 2F4VO 2QSAA 4DR1O 3Q4HB 2LGWA 1R3JC 4UVBA 1X59A 4DYLA 1JPXA 4X89A 4GX5A 3SYOA 4LFBO 1M4UA 4EKWA 4HBNA 5BY1A 4JV5O 3CX5F 2V7QG 4WFFA 2CAZC 2QA4V 1XMOB 1K34A 1Y76A 3SDLA 4LFBB 3IC7A 4Z2WA 1K73W 1KYOF 3C3SA 3SPGA 1VQ8V 1OCOB 2EIKB 3JAWB 3ZRSA 1JMKC 2B5UA 3JAMN 1ZX3A 5JVDA 4JTAB 4CZZA 4DR4O 4DV3B 1NU1H 3BPZA 2GTSA 3N2GB 2VWJA 3CJHB 3F7VC 2Q9LA 1RM1B 2LFSA 4KHPO 4WCEV 3HKBA 3LNMB 3TJTA 1AJNA 2ZDIA 2Q6AA 4J11A 5B1OA 2QWPB 2N05A 5K1PA 3ZMUA 5KHGA 1SETA 3SYCA 1WNSA 1HR0B 3ZMZA 2VRZA 3J7AU 4DV7B 4DUZB 4FFBA 3UCSC 4YY3O 2ZE6A 2Y48A 3C3TA 4LH7A 3RGBA 1EZVH 3KG2A 5J2UB 1ZUQA 2FKXA 3H1IH 4CC5A 5D5QA 4UCUA 3X2QC 1KKDA 4O4HB 5IYCO 1JA8A 5BR8B 1OCZC 2ITCC 5B1BC 2Q8VA 2ZNIA 2NR5A 3FB8C 4N23A 5IJ0B 4NYKA 2XAGA 3H1KH 5EZYA 3E83A 3L9DA 1VQ5V 4B3TO 4K8XA 4ASUG 5C8YA 3FD9A 1NVPD 1ORQC 3EFFK 2AW9A 2OTLV 2YUAA 1JVMA 1WB8A 1Q6HA 1P84F 4GCZA 4W4LA 4Z1VA 1MSWD 2R72A 2A06H 2Y0PA 4LFCB 3Q4HA 1KECA 3N27A 4CH3A 4DK0A 1XMOO 3JALB 1AROP 4DRXA 2UU9O 1OCOC 3JD1A 4RQFA 4FPPA 3JD0A 2ZE7A 1WB7A 3FYEB 4FLUA 2A3QA 2E5LB 4UV8A 4ZOLA 1US6A 4O2AA 3JD4A 3P3PA 3STZC 2BSKB 3B8MA 1GN4A 3IC9A 1ENVA 2IU0A 4JI0O 4OXSA 5JJNB 4MVZA 4PJ0Z 4H0LB 1WJZA 1OV9A 2IM9A 4RO2A 5LGNA 4JI8B 1SS3A 1D5AA 3ASNC 3UT5B 5KMGB 2RJZA 1GM7A 5B3SC 2EZPA 1JX9A 3AG3B 1FPOA 1VQ9V 1HP8A 1SQXH 4IYHA 1PD3A 4G28B 3JYCA 4DV0O 1VQPV 3AG2B 1FJGO 3TXQA 3CD6V 2ZXWC 4IHJA 2W0FC 5CA0B 1Q90D 4OX9O 4LF6B 3ETEA 5JCOA 3RN4A 3OUSA 4PDRA 5JJJB 4H44B 4R6ZA 5BZBA 1VQ4V 5HFLA 1Y4MA 2QDOA 4KXRA 4CS2A 4GUNA 1JNBA 2A0LA 1FFTB 2HVJC 2LW7A 4U3JB 4NXNB 5FL7G 2Q0AA 2X7RB 2CTPA 1NBMG 3T4DA 3CCLV 3OTOO 1K8AW 4LF7O 1BQZA 3APOA 5IJ9A 1NR7A 4NKGB 2FB5A 3SYQA 3H01A 4YHHO 2OT5A 1FXKA 5IJ0A 3J80N 4YJ3B 4UVAA 1VQLV 4DR3O 3OUFA 1XMQB 2HKOA 3LDEA 1IBLB 1ZTEA 2P06A 2KG7B 4J10A 4JYAO 3K0GA 3ZHRA 2YIBD 4JYBA 3OM3B 2Q67A 2XT9A 3AK2A 5LMNO 2HJDA 4RWUA 1BHBA 2ZR2A 1GK9A 3ABKC 3F5WC 1QLEC 3ZHUA 2DJVA 2EJ7A 1OZ0A 4JI2B 1EBOA 3A0BZ 1M57C 1IX9A 4X64B 2ZE8A 1F23A 4IHJB 3K79A 5KUMA 1M56B 2Q7EA 4X20A 4LP8A 4LBEC
chains in the Genus database with same CATH topology
2QKAA 2QKCA 1QNMA 1LUWA 3EVKA 4X9QA 1N0JA 3KKYA 1BSMA 1ZLZA 5A9GA 1N0NA 3LSUA 1PL4A 3C3TA 1GN6A 3BFRA 1KKCA 1B06A 1PM9A 2CE4A 1IDSA 3RN4A 4F6EA 4BR6A 1ZUQA 3QVNA 1EN6A 1I08A 1VARA 1JA8A 3OT7A 2ADQB 4GUNA 1IXBA 1D5NA 2P4KA 1GN3A 3CEIA 1SZXA 4FFKA 1EN4A 1XDCA 1P7GA 1AP5A 1BT8A 1AR5A 3AK1A 1GN2A 1XUQA 3DC6A 1ZSPA 2AW9A 1EN5A 2ADPA 4C7UA 1WB8A 1AP6A 1VEWA 1Y67A 3AK3A 1JR9A 3DC5A 3MDSA 1ZTEA 1LUVA 3KDRA 3C3SA 2CDYA 1BS3A 1MA1A 1MSDA 1MMMA 3AK2A 4JYYA 4YIOA 1MNGA 1AR4A 1WB7A 5AG2A 4E4EA 1EM1A 1GN4A 1XILA 3IC9A 2RCVA 1IX9A 1I0HA 4YIPA 4JZ2A 3K9SA 3TJTA 1AVMA 2GDSA 4JZGA 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKA A;  2QKC A;  1QNM A;  1LUW A;  3EVK A;  4X9Q A;  1N0J A;  3KKY A;  1BSM A;  1ZLZ A;  5A9G A;  1N0N A;  3LSU A;  1PL4 A;  3C3T A;  1GN6 A;  3BFR A;  1KKC A;  1B06 A;  1PM9 A;  2CE4 A;  1IDS A;  3RN4 A;  4F6E A;  4BR6 A;  1ZUQ A;  3QVN A;  1EN6 A;  1I08 A;  1VAR A;  1JA8 A;  3OT7 A;  2ADQ B;  4GUN A;  1IXB A;  1D5N A;  2P4K A;  1GN3 A;  3CEI A;  1SZX A;  4FFK A;  1EN4 A;  1XDC A;  1P7G A;  1AP5 A;  1BT8 A;  1AR5 A;  3AK1 A;  1GN2 A;  1XUQ A;  3DC6 A;  1ZSP A;  2AW9 A;  1EN5 A;  2ADP A;  4C7U A;  1WB8 A;  1AP6 A;  1VEW A;  1Y67 A;  3AK3 A;  1JR9 A;  3DC5 A;  3MDS A;  1ZTE A;  1LUV A;  3C3S A;  2CDY A;  1BS3 A;  1MA1 A;  1MSD A;  1MMM A;  3AK2 A;  4JYY A;  4YIO A;  1MNG A;  1AR4 A;  1WB7 A;  5AG2 A;  4E4E A;  1EM1 A;  1GN4 A;  1XIL A;  3IC9 A;  2RCV A;  1IX9 A;  1I0H A;  4YIP A;  4JZ2 A;  3K9S A;  3TJT A;  1AVM A;  2GDS A;  4JZG A;  1XRE A; 
#chains in the Genus database with same CATH topology
 2OWO A;  4MW3 A;  4JI3 O;  4JI1 O;  3SJB C;  1TAE A;  1FD9 A;  4X66 O;  4JF3 A;  3SGI A;  2CK3 G;  2YI8 A;  3E89 A;  1YIT V;  5DN6 G;  4FLZ A;  3CXH F;  3WG7 C;  5KMG A;  1ZLZ A;  2AGA A;  5IYZ A;  2JGU A;  3HKD B;  2UXB O;  4IYI A;  5IT9 N;  4WBN B;  5IY5 B;  3RWR D;  4MW8 A;  1H2M A;  3NXS A;  3OTF A;  2DYS C;  2RN9 A;  4UCR A;  1OCR C;  4FJC C;  1WPB A;  5KHI A;  4PA9 A;  1L0N H;  4DV1 O;  3RT3 C;  1KU9 A;  5LA6 A;  2HVK C;  5FNV A;  2WA4 A;  3BY6 A;  4DW1 A;  3U11 A;  1I5X A;  3ZIA G;  2ZNJ A;  1VQ6 V;  4PA7 A;  4LC1 A;  1SQQ H;  4JGS A;  5HFM A;  3CC2 V;  3M7M X;  1ZSP A;  4PV1 B;  3H1H H;  3VBB A;  3IJ4 A;  5B66 Z;  1J95 A;  1AIL A;  3DXR B;  4B3M B;  1T5E A;  1JR9 A;  2UXX A;  1HNW O;  2JJ1 G;  5L3D A;  4A5U B;  2JS5 A;  5IY5 C;  5LOV B;  2QM7 A;  4HAM A;  4DK1 A;  5LXT A;  1LNQ A;  4YY3 B;  5C93 A;  2BE3 A;  4CS4 A;  1R6N A;  5AG2 A;  2W6J G;  4CBC A;  1H8E G;  1IBK O;  1QU7 A;  4DR2 B;  2GBO A;  1OCZ B;  2RCV A;  1QVF U;  4AQY B;  2UUA B;  2JGD B;  1PNL A;  4EB6 A;  4BIZ A;  4WBN A;  4HYO A;  4MTO A;  4LF5 O;  2JEU A;  1KUQ A;  4B3R O;  1G1X B;  5JQG B;  3GVM A;  5EC1 C;  1AJQ A;  2KKW A;  4PD4 F;  2E75 B;  4KP4 A;  4PHZ A;  2R9R B;  4WFA V;  2P7T C;  3JSL A;  4LF4 O;  1XNQ O;  3GWK C;  5DM6 V;  4X64 O;  2P5O A;  5EIB C;  5JQG A;  4L87 A;  2KQX A;  4TV8 B;  3E35 A;  3RBZ A;  3ML0 A;  1UJW B;  4X20 B;  4Q6G A;  4F6E A;  1FXH A;  2R70 A;  1I08 A;  1KB9 F;  4DR4 B;  1KP2 A;  3I5D A;  3ZX6 A;  4HNA B;  3G6E V;  3H9V A;  2UXD O;  1W2B U;  3OMN B;  1UPG A;  4IT5 A;  4LR3 A;  4D6T H;  3EXA A;  2F23 A;  3ZBH A;  1BT8 A;  4TWK A;  2UXD B;  2EZO A;  3BCC H;  1OCC C;  2CUG A;  1R6T A;  2CGN A;  4FFB B;  3A8T A;  1KC8 W;  4NXM O;  2HLD G;  2HHH O;  4UB8 Z;  3KCY A;  1KQS U;  1JFF A;  1QBZ A;  1MA1 A;  4EFE A;  3SR2 C;  2LGQ A;  4K8Z A;  5JH7 A;  5KHK A;  1KD1 W;  2JDI G;  1XNQ B;  4J42 A;  2BCC H;  4Z1M G;  3HKC B;  2EIM C;  4K35 A;  3OMI B;  2XUM A;  4IGG A;  1V54 B;  5CB4 A;  4ICG A;  4QE7 A;  2DYR C;  4MVU A;  5EZY B;  3ASN B;  2X6C A;  4UB6 Z;  3ZHS A;  1SC5 B;  4LFA B;  4JI0 B;  5KA6 A;  5ITZ B;  4H13 B;  1XRE A;  2OTJ V;  3E8H A;  3ZJZ A;  4K0K O;  1MOF A;  5B1A C;  1N36 O;  4PDL A;  4YJ2 B;  1MZF A;  2A79 B;  5J9P C;  5EIB D;  3JAR A;  1N0J A;  4LF8 B;  3WB1 A;  5L3G A;  1GN6 A;  2ZT9 B;  4LWS B;  2PUS A;  4EB6 B;  1V55 C;  4U3J A;  1PV0 A;  3P3N A;  1E1Q G;  2Q7H A;  4JI6 O;  4U3F H;  4GX2 A;  3FB7 C;  4TV9 B;  5LHI A;  2H8P C;  3CYO A;  1ZL8 A;  4DR6 B;  4GKK B;  1XHX A;  1YJ9 V;  2WSS G;  1FXK B;  5LMU B;  4ABM A;  1B6Q A;  2QWQ B;  5KA5 A;  2WAM A;  3CCE V;  2WPD G;  1H2S B;  1GO3 F;  1DLB A;  1WN7 A;  5LGT A;  3U0Z A;  2P4V A;  5F2V O;  1BGY H;  2PI4 A;  3SPI A;  1S3J A;  1N33 O;  1NS1 A;  3B4S A;  3B77 A;  4PEL A;  2IJJ A;  1UFI A;  5J2T B;  2ARH A;  4DV2 B;  3DC5 A;  2LJ2 A;  5L3C A;  1HNX O;  3OR6 C;  1E1R G;  2CTW A;  4DR5 B;  4JYY A;  4PDM A;  1MNG A;  1AR4 A;  4X1I A;  2BTQ A;  5EYP A;  1SQG A;  3CHX A;  4LCU C;  2Y4U A;  1L0L H;  4FZ0 A;  3K5L A;  4BIU A;  3OGC C;  4P30 A;  1EFR G;  4J9Z B;  1HW7 A;  4X88 A;  3DTU B;  4GX1 A;  1K7D A;  2EBO A;  1N32 B;  3QO7 A;  3K5O A;  5FNV B;  1O9H A;  1XHZ A;  1P49 A;  3MHS C;  2GTA A;  4BAY A;  4N21 A;  2JRI A;  2CTR A;  1VQ7 V;  3RYI B;  5H2F Z;  1SZT A;  5CA1 A;  1O9G A;  3KKY A;  4I5S A;  3RW0 A;  3WB2 A;  4YJ2 A;  5BMV B;  2CE4 A;  4TOI A;  1EN6 A;  1VIB A;  1E79 G;  1I7F A;  4KUM A;  2QWO B;  1EZJ A;  3JCZ A;  1PNK A;  3CXC U;  3LDC A;  5KX5 A;  1VQK V;  2ATK C;  4ZHQ A;  3CCQ V;  3TCU A;  1TA8 A;  4B3R B;  2XAJ A;  2JVD A;  2YXL A;  2HG5 C;  2EIJ C;  3DSQ A;  2E76 B;  3WB0 A;  4PI0 A;  1BQ0 A;  3CCJ V;  1XUQ A;  3GWO A;  2F4V B;  4NXN O;  1D2D A;  2OIG A;  1XEQ A;  3JAL A;  3E2E A;  2UXN A;  3OD4 A;  1ZWI C;  3AK3 A;  2EIK C;  1HNW B;  1HWY A;  2IJI A;  3ZCC A;  1IBK B;  1NH2 B;  1AR1 B;  3PN1 A;  5EBW C;  2X0L A;  1N34 O;  1W0J G;  3AG1 C;  2KB1 A;  3OGI B;  1K9M W;  1KMI Z;  3RYF B;  1M9N A;  3ZN0 A;  2Q0O C;  3L73 H;  4MTF A;  5KHH A;  1FFX A;  3AG7 A;  2ZIN A;  3BA9 A;  1J5E O;  4LH6 A;  4LF5 B;  3SJQ C;  4GKK O;  4MS2 A;  2IJK A;  2ZIM A;  5GON B;  2GDS A;  3CP1 A;  1YJN V;  4JZG A;  2ODM A;  4O4I B;  4UVC A;  5E79 Z;  5CN0 A;  1YIJ V;  4TV8 A;  2D3O W;  1LR1 A;  4X65 B;  2QTO A;  4WFE A;  3K08 A;  2JS3 A;  4I55 A;  5IE9 A;  4I0X A;  2ZM6 B;  3N2K A;  3T4Z A;  2X6B A;  4TQF A;  5A9G A;  3JAK B;  3RYI A;  1B06 A;  1PM9 A;  4QNH B;  3CS5 A;  4NTX A;  3OAA G;  4X66 B;  2DWE C;  4I55 B;  1FS0 G;  5KLV H;  2ITD C;  3CC7 V;  4MVO A;  3OEE G;  1GAX A;  4BIO A;  3RYH A;  3K57 A;  3CC4 V;  1IVS A;  2FL4 A;  2DWD C;  3ZHQ A;  3CJH A;  3TK1 A;  2EIN B;  4MTG A;  3K59 A;  3T2M A;  4WFH A;  3ABL B;  2YID A;  1AP5 A;  3G4S V;  5B5E Z;  3OEH G;  2UUC O;  4AIL C;  4XDL A;  1SQV H;  1PL0 A;  3JD3 A;  1VEW A;  3D36 C;  1WP8 A;  4RUE A;  1LUV A;  4LNU B;  4TT3 G;  5LMU O;  5FPO A;  1VQM V;  4G27 B;  4FM0 A;  4X62 O;  1COW G;  1M93 A;  2JK5 C;  2Y69 B;  3LSQ A;  4LF8 O;  3OMA B;  4EFB A;  3BVO A;  4YJ3 A;  2F93 B;  1VF6 A;  4PA6 A;  2WLN A;  4X1Y B;  2YS8 A;  4O4H A;  4NXM B;  4DUY O;  1ZAU A;  2WWW A;  5LYJ B;  1XIL A;  3ABL C;  1H8H G;  2GV9 A;  4I50 B;  4Q20 A;  1QR8 A;  3IGA C;  3M8A A;  5C8Y B;  2Y4T A;  1V54 C;  1DK1 A;  1YJW V;  1GKF A;  3JAS A;  1XQ8 A;  1VQO V;  1Q3E A;  2PI5 A;  1WAZ A;  2EJR A;  5J2T A;  3UT5 A;  4DV0 B;  2B1I A;  3M99 B;  2QJ1 A;  4OPA A;  5CMU A;  1GMG A;  1Q5O A;  2DOS A;  2Q68 A;  1K4C C;  1H5W A;  3QTC A;  4O2B B;  4DR7 O;  1WPX A;  5GTI Z;  1Z2G A;  5EC2 C;  4CH4 A;  2IU3 A;  1SA0 B;  3TXS A;  5CBF A;  3BEH A;  5KUK A;  1QLE B;  1NJI W;  3APQ A;  2VQF B;  1VMG A;  3CCV V;  2QGN A;  4YHH B;  1Y74 A;  4JYA B;  5LOV A;  1JJ2 U;  2LP7 A;  3VQW A;  4I9Q A;  2ETN A;  1TGO A;  1IXM A;  3VOU A;  3CCM V;  2N74 A;  1NI8 A;  3L75 H;  2YIB A;  2ADP A;  1RM1 C;  4DUY B;  1WA8 A;  4I50 A;  3OTO B;  4LF7 B;  2E5L O;  3HKC A;  2CGO A;  3E22 A;  1BS3 A;  4EEQ A;  4I7Z B;  1MMM A;  4UCS A;  4MVM A;  5IDJ A;  2YSU B;  2YXH A;  2YI9 A;  5CBG A;  3FKS G;  2UUC B;  2PGG A;  3RVY A;  4XBF A;  1NTZ H;  4DW0 A;  4LFC O;  1Q8I A;  4WF9 V;  3VQX A;  2P6J A;  3ASO C;  2WLK A;  2EUL A;  2CH7 B;  4P9P A;  4RUF A;  1DF5 A;  1I0H A;  4I9W A;  1MG1 A;  1KBH A;  4JZ2 A;  4O4L B;  1XNR B;  3ZED A;  2ZCE A;  5LGU A;  2QKC A;  1XL4 A;  3RFR A;  3VQY A;  3G6B A;  1VF6 C;  4RAI A;  4DV4 O;  3CRQ A;  4F6R B;  4X8A A;  4QPK A;  1H2L A;  4UCO A;  2B1G A;  1F7Y A;  4YXW G;  2WLI B;  1N0N A;  2QM8 A;  4DR2 O;  1H2G A;  2QWR B;  3OFN G;  1IDS A;  2UXB B;  4JI1 B;  2E3C A;  4J7J A;  1KP3 A;  1OCR B;  3ZHV A;  4B3M O;  2L6L A;  4B3S B;  4JI5 O;  5JCO C;  1NH2 D;  2DMX A;  4FLT A;  3K06 A;  3G71 V;  2EIM B;  1GN3 A;  2YIA A;  1NVP B;  3W7U A;  2V1D A;  3ZRW A;  1VF7 A;  1Z5W A;  1SZX A;  4FFK A;  4K0K B;  1PNM A;  4UXN A;  3MAQ A;  1AR5 A;  3AK1 A;  1RP3 B;  3T1C A;  2BOC C;  4KHP B;  3ABM B;  1TVK B;  2NLJ C;  1N34 B;  1CEZ A;  2B9Z A;  1Y67 A;  2W0X A;  2ZR3 A;  3SPC A;  2ZXW B;  2HJF C;  1N8R W;  5GTH Z;  5H5N A;  1VP7 A;  4DV1 B;  3KDR A;  1AB3 A;  1YDX A;  2ILM A;  4ZIB A;  5CA0 A;  1YHQ V;  5E1A C;  2PYL A;  4J41 A;  5CA3 A;  5ITZ A;  4DR6 O;  1M5I A;  2H94 A;  1IJG A;  4DUZ O;  3K5N A;  4ZBM A;  3QF7 A;  3FAV A;  1EM1 A;  2YDE A;  1THZ A;  1MZE A;  4JI3 B;  4O4I A;  1U96 A;  2NN4 A;  1QHT A;  4O4J B;  1W0K G;  4D7S A;  1FXK C;  4DV5 B;  3K9S A;  4I4T B;  4ZI7 A;  4X65 O;  4BW5 A;  4LF9 B;  2QKA A;  4FLY A;  3QG5 A;  3H1J H;  1Y6X A;  3D8C A;  3DXR A;  4TUY A;  3TGU H;  2QEX V;  4JI2 O;  2IW5 A;  1QVG U;  4LF6 O;  4BR6 A;  2IH1 C;  1L1F A;  4FK5 C;  2VQE B;  2LW1 A;  4GKJ B;  3G67 A;  1FJG B;  4CC6 A;  4JI4 O;  3CPW U;  4JI8 O;  4JTC B;  1N32 O;  4DR3 B;  3HPL C;  1QLN A;  1Q6U A;  1V9P A;  1W59 A;  3FB5 C;  1AI6 A;  1EN4 A;  3GB7 C;  3QO5 A;  2DYR B;  2JGD A;  1SQB H;  1IBL O;  1NTM H;  5EK0 A;  3PJS K;  2BTO A;  1JFF B;  1ZL8 B;  4FLV A;  3VQV A;  3N2K B;  4P2Z A;  3RYF A;  3E8F A;  5IYZ B;  5LP6 B;  3T1H O;  1YCI A;  2F66 C;  3OW2 U;  5CB4 B;  4YIO A;  3B8N A;  2PF4 E;  5CBH A;  4LF4 B;  1WLE A;  2D2C B;  3JCU Z;  3LNN A;  1K33 A;  5B1N A;  1F4N A;  4AI8 A;  4E4E A;  1XBL A;  2EX3 A;  2OIE A;  3JAT A;  1GRJ A;  4TQD A;  4YIP A;  2F95 B;  5IWA B;  2DYS B;  2V4D A;  3UM7 A;  3ZMS A;  4UCT A;  1IBM B;  4JAU A;  2EIJ B;  3LSS A;  4MT8 A;  1BCC H;  5H9C A;  2OCC B;  4R7C A;  4BW9 A;  1GH6 A;  5KX5 B;  4O2B A;  2QE7 G;  3ZRX A;  3ETG A;  1WP7 A;  3O65 A;  1BSM A;  4MVQ A;  2KG7 A;  4QE9 A;  3LSU A;  1FKA O;  3CRA A;  1K5S A;  4G2K A;  1RFY A;  1N36 B;  5JH7 B;  3BAA A;  1FXV A;  2DE0 X;  1HDJ A;  1RSO B;  5KAF Z;  4QGP A;  1Y76 B;  4RQE A;  1ROP A;  1D5N A;  2UU9 B;  1Z5V A;  3ETD A;  4DV7 O;  4F4L A;  3UQ8 A;  1MAB G;  1H2K A;  4NTY A;  4CH5 A;  3AG3 C;  3JSN A;  2FYU H;  1TUB B;  4WFG A;  1GN2 A;  4JAV A;  4J7Z A;  4JYC A;  1A32 A;  1Q43 A;  2OCC C;  4XDJ A;  3E86 A;  1YVW A;  5LMN B;  2XHB A;  4C7U A;  3JAS B;  1AP6 A;  1R73 A;  5BR8 O;  4H37 A;  3QNE A;  1J5E B;  5L3B A;  1SRY A;  1GM9 A;  4J7K A;  4JI6 B;  4X1I B;  3KZI Z;  4F6R A;  2CDY A;  2Z5U A;  4LWS A;  1IUR A;  3K03 A;  1S76 D;  5LYJ A;  2ZIO A;  3BAB A;  4IL6 Z;  2PYJ A;  4HNA A;  1OJH A;  2K9P A;  3SYP A;  3CB2 A;  4X1K A;  1DGS A;  4DR1 B;  2QWN B;  4P9O A;  4R50 A;  4UV9 A;  2QTS A;  1JOY A;  3JD2 A;  1AVM A;  3F5T A;  4UUJ C;  2G38 A;  3C90 A;  3I56 V;  4DR7 B;  3D36 A;  5D5P A;  5K1X A;  1PP9 H;  3LUT B;  3AG1 B;  4W4K A;  3P30 A;  5LHH A;  1FFX B;  1SQF A;  2VQF O;  4PA4 A;  3WG7 B;  2NNU A;  1M1K W;  3EVK A;  3CE2 A;  2Z3Y A;  4AHC A;  5KAI Z;  1NR1 A;  4MSW C;  3OE7 G;  4JTD B;  3E8G A;  3BFR A;  4B7K A;  2XAQ A;  3O9O A;  1JQ0 A;  1QCE A;  2VQE O;  3CCU V;  3RYH B;  2RDC A;  1AI5 A;  4LF9 O;  4HZ3 A;  2F1M A;  1CP9 A;  4GX0 A;  3G80 A;  1NKD A;  1XMQ O;  1IXB A;  3RYC B;  5FLX N;  4NR1 A;  3MHH C;  2CTQ A;  4B7E A;  1GM8 A;  3CEI A;  3UO3 A;  4FVM A;  1Q82 W;  4TV9 A;  3FB6 C;  1TVK A;  2HHH B;  2ZQM A;  1YI2 V;  3THO A;  1RPO A;  2H3O A;  2QKS A;  5DEC A;  1WA8 B;  1JJO A;  3DC6 A;  4AQY O;  2UUA O;  4LNU A;  3A2F A;  5TIS Z;  4ZKI A;  1YSC A;  4FZ1 A;  2A7W A;  4JI4 B;  1BL8 A;  3ABM C;  2VWK A;  3CRC A;  1K97 A;  3W7S A;  1S5J A;  3HKD A;  2LO1 A;  3LDD A;  4NB5 A;  3L72 H;  4J80 A;  2RNB A;  1L8D A;  2Q73 A;  3ETQ A;  3B09 A;  2AZ2 A;  5B1B B;  3K58 A;  2YXY A;  5LHG A;  2UXC B;  1R1B A;  1SQP H;  3KCX A;  3X2Q B;  4OX9 B;  1PPJ H;  5B3S B;  1Q81 W;  4CH6 A;  2LQT A;  1B3Q A;  4H33 A;  3N2G A;  1SER A;  1URF A;  4B3S O;  4I0X B;  1VF5 B;  2BOB C;  1K4D C;  1G8M A;  1S5H C;  4X1Y A;  3CMA V;  4J9Y B;  1SA0 A;  1CXZ B;  1BE3 H;  2XOK G;  3CWB H;  5EBL C;  1SES A;  2XND G;  5BXZ A;  2DQ0 A;  2P67 A;  2DN9 A;  3K3W A;  2GUZ B;  5IJ9 B;  4FMT A;  1HNX B;  5LP6 C;  4U7O A;  2C2A A;  2Z0A A;  4MTX A;  3K9A A;  5JVD B;  3ZRW B;  1SF9 A;  4DV2 O;  2PY5 A;  5L3F A;  1N4C A;  4XDK A;  3ASO B;  3IFX A;  1R3K C;  4LFA O;  1AJP A;  2ADQ B;  3B40 A;  1S5L Z;  2Q5Z A;  4WFB V;  2EIN C;  4GLX A;  3TET A;  1HR0 O;  3JAT B;  2JIZ G;  2RMK B;  2QR4 A;  2K1E A;  2JJ2 G;  1XDC A;  3CSX A;  4B3T B;  3L70 H;  3HKB B;  3F7Y C;  3H1L H;  2WLL A;  1XNR O;  5IWA O;  1DF4 A;  2UUB O;  3BHP A;  3CRR A;  3L71 H;  1XOU A;  1Q6I A;  2PZS A;  3OR7 C;  1M56 C;  2DW4 A;  2YEV B;  3BRC A;  3K0D A;  1YXB A;  1Q7Y W;  4BWA A;  5BMV A;  4O4L A;  1M57 B;  3CRM A;  4UCV A;  4KL1 A;  3S3W A;  3EHB B;  5KHJ A;  5A2Q N;  4PI2 A;  2Y0I A;  1R3L C;  3ABT A;  4KFM A;  2YIC A;  2X6A A;  2M7W A;  3CME V;  2ZKO A;  4DXW A;  3ZN1 A;  1AI4 A;  1YZB A;  2WLM A;  4U7N A;  5IYD O;  1TUB A;  2BSK A;  3SJA C;  2AZ0 A;  4IIJ B;  5B1A B;  4DV6 B;  2FML A;  1QNM A;  4JPR A;  3ZHT A;  1I5Y A;  4MVS A;  1LUW A;  4OPH A;  1IBM O;  3T1Y O;  1CPY A;  1XI1 A;  3WU2 Z;  1G6U A;  3ZMV A;  4TSF G;  2XAH A;  3W7W A;  1RSO A;  2AXT Z;  4DRX B;  4DO2 A;  5JWP A;  4E2L A;  1AI7 A;  1VAR A;  4L8J A;  2XTA A;  3ZRV A;  2IBZ H;  1Q86 W;  3I55 V;  3WFV A;  4DV5 O;  4GYC B;  1GTO A;  2WLH A;  1FYJ A;  2P4K A;  5J2U A;  4JAS A;  1IZ3 A;  1XL6 A;  3MD0 A;  1S77 D;  3E8B A;  3T1H B;  1FAF A;  1B04 A;  1NTK H;  2PTM A;  2M6Y A;  3AG2 C;  3W7T A;  1TUE B;  1YF2 A;  2MW2 B;  4FM2 A;  1R3I C;  5LP6 A;  2R9A A;  1NZ6 A;  5LBQ A;  2GHY A;  1EN5 A;  2HEP A;  2Y69 C;  4GT1 A;  3HKE B;  3SYA A;  2EIL C;  2E74 B;  3K5M A;  5EBM C;  3IAY A;  3HR0 A;  5LA6 B;  5L3E A;  3ABU A;  3FAV B;  1P7B A;  5FPR A;  2YC0 A;  4FLX A;  2WLL B;  3S3X A;  2QM4 A;  3D3I A;  5GW7 A;  3SJC C;  4GKJ O;  5H6Q A;  4D7T A;  3T1Y B;  1F51 A;  3A0H Z;  1F4M A;  2P22 C;  4JI7 B;  2L35 A;  3AEI A;  4PA3 A;  3BA8 A;  3K04 A;  2Q69 A;  4CS3 A;  1V55 B;  1Y74 B;  2DQ3 A;  2UUB B;  4O2A B;  1X4T A;  4JI5 B;  5LXT B;  2CH7 A;  1BZK A;  3STL C;  2MK3 A;  4PDV A;  1SKV A;  1S72 V;  4TUY B;  4FLW A;  4DV6 O;  1VQN V;  1DTO A;  3ZS8 C;  1K92 A;  1H38 A;  4IIJ A;  3FFQ A;  2IJH A;  2ZM6 O;  1Y66 A;  1KKC A;  2P90 A;  4GZR B;  3E22 B;  2XAF A;  1NT2 B;  1I94 B;  2R9I A;  4I4T A;  4ZI7 B;  4R8C A;  1I94 O;  3B2E E;  1K3E A;  1NQT A;  1BHA A;  3SPJ A;  4ZOL B;  4FIP C;  1JCH A;  3D3Q A;  3AG4 C;  3OT7 A;  1N33 B;  1YEW A;  3HB3 B;  4DV4 B;  1K5Q A;  2A9H A;  4DR5 O;  1S0V A;  4X62 B;  4QJF B;  3J81 N;  3SPH A;  2ZE5 A;  1HNZ B;  2AHY A;  4QPJ A;  1P7G A;  4JI7 O;  2WLJ A;  4DV3 O;  5GON A;  1HNZ O;  1BMF G;  2WA3 A;  4OGQ B;  1R6K A;  2KSD A;  2OCH A;  2HR3 A;  3ICX A;  3JAW A;  5CA1 B;  2O57 A;  2HP8 A;  3MDS A;  3CCS V;  2BTQ B;  2ZD9 A;  3FYI B;  1RPR A;  2WLI A;  2FTK A;  2ZDI C;  4JAA A;  5EYP B;  1OHH G;  2EIL B;  3W7X A;  2GUZ A;  1MSD A;  4QIW F;  1G4Y B;  2AHZ A;  3P32 A;  4X1K B;  1U97 A;  4UFZ A;  4JV5 B;  4NVP A;  3UO2 A;  5IYB O;  1H2N A;  4O4J A;  3RYC A;  1M90 W;  5H6R A;  5DED A;  1YTF D;  1PKX A;  3HKE A;  2OYQ A;  1P4R A;  3QO8 A;  2Q4P A;  2XAS A;  1YTF B;  2F43 G;  4B08 A;  3FX7 A;  3L74 H;  3AG4 B;  1QQC A;  3CCR V;  1OCC B;  3UKM A;  3JAK A;  2UXC O;  3A0R A;  4MVR A;  2JEX A;  3RVZ A;  4NTW A;  4X9Q A;  2W6I G;  2VS0 A;  2HFE C;  2YEV A;  1PL4 A;  3DGE A;  2IH3 C;  5JJE B;  5LL6 Y;  4FM1 A;  1QR9 A;  2LFR A;  3ABK B;  3NR7 A;  3JAR B;  4ZHQ B;  3QVN A;  2RQ6 A;  3R66 A;  3ZMT A;  1FOU A;  4K3A A;  3R65 A;  2N04 A;  2Q7G A;  3U10 A;  2GSM B;  2F4V O;  2QSA A;  4DR1 O;  3Q4H B;  2LGW A;  1R3J C;  4UVB A;  1X59 A;  4DYL A;  1JPX A;  4X89 A;  4GX5 A;  3SYO A;  4LFB O;  1M4U A;  4EKW A;  4HBN A;  5BY1 A;  4JV5 O;  3CX5 F;  2V7Q G;  4WFF A;  2CAZ C;  2QA4 V;  1XMO B;  1K34 A;  1Y76 A;  3SDL A;  4LFB B;  3IC7 A;  4Z2W A;  1K73 W;  1KYO F;  3C3S A;  3SPG A;  1VQ8 V;  1OCO B;  2EIK B;  3JAW B;  3ZRS A;  1JMK C;  2B5U A;  3JAM N;  1ZX3 A;  5JVD A;  4JTA B;  4CZZ A;  4DR4 O;  4DV3 B;  1NU1 H;  3BPZ A;  2GTS A;  3N2G B;  2VWJ A;  3CJH B;  3F7V C;  2Q9L A;  1RM1 B;  2LFS A;  4KHP O;  4WCE V;  3HKB A;  3LNM B;  3TJT A;  1AJN A;  2ZDI A;  2Q6A A;  4J11 A;  5B1O A;  2QWP B;  2N05 A;  5K1P A;  3ZMU A;  5KHG A;  1SET A;  3SYC A;  1WNS A;  1HR0 B;  3ZMZ A;  2VRZ A;  3J7A U;  4DV7 B;  4DUZ B;  4FFB A;  3UCS C;  4YY3 O;  2ZE6 A;  2Y48 A;  3C3T A;  4LH7 A;  3RGB A;  1EZV H;  3KG2 A;  5J2U B;  1ZUQ A;  2FKX A;  3H1I H;  4CC5 A;  5D5Q A;  4UCU A;  3X2Q C;  1KKD A;  4O4H B;  5IYC O;  1JA8 A;  5BR8 B;  1OCZ C;  2ITC C;  5B1B C;  2Q8V A;  2ZNI A;  2NR5 A;  3FB8 C;  4N23 A;  5IJ0 B;  4NYK A;  2XAG A;  3H1K H;  5EZY A;  3E83 A;  3L9D A;  1VQ5 V;  4B3T O;  4K8X A;  4ASU G;  5C8Y A;  3FD9 A;  1NVP D;  1ORQ C;  3EFF K;  2AW9 A;  2OTL V;  2YUA A;  1JVM A;  1WB8 A;  1Q6H A;  1P84 F;  4GCZ A;  4W4L A;  4Z1V A;  1MSW D;  2R72 A;  2A06 H;  2Y0P A;  4LFC B;  3Q4H A;  1KEC A;  3N27 A;  4CH3 A;  4DK0 A;  1XMO O;  3JAL B;  1ARO P;  4DRX A;  2UU9 O;  1OCO C;  3JD1 A;  4RQF A;  4FPP A;  3JD0 A;  2ZE7 A;  1WB7 A;  3FYE B;  4FLU A;  2A3Q A;  2E5L B;  4UV8 A;  4ZOL A;  1US6 A;  4O2A A;  3JD4 A;  3P3P A;  3STZ C;  2BSK B;  3B8M A;  1GN4 A;  3IC9 A;  1ENV A;  2IU0 A;  4JI0 O;  4OXS A;  5JJN B;  4MVZ A;  4PJ0 Z;  4H0L B;  1WJZ A;  1OV9 A;  2IM9 A;  4RO2 A;  5LGN A;  4JI8 B;  1SS3 A;  1D5A A;  3ASN C;  3UT5 B;  5KMG B;  2RJZ A;  1GM7 A;  5B3S C;  2EZP A;  1JX9 A;  3AG3 B;  1FPO A;  1VQ9 V;  1HP8 A;  1SQX H;  4IYH A;  1PD3 A;  4G28 B;  3JYC A;  4DV0 O;  1VQP V;  3AG2 B;  1FJG O;  3TXQ A;  3CD6 V;  2ZXW C;  4IHJ A;  2W0F C;  5CA0 B;  1Q90 D;  4OX9 O;  4LF6 B;  3ETE A;  5JCO A;  3RN4 A;  3OUS A;  4PDR A;  5JJJ B;  4H44 B;  4R6Z A;  5BZB A;  1VQ4 V;  5HFL A;  1Y4M A;  2QDO A;  4KXR A;  4CS2 A;  4GUN A;  1JNB A;  2A0L A;  1FFT B;  2HVJ C;  2LW7 A;  4U3J B;  4NXN B;  5FL7 G;  2Q0A A;  2X7R B;  2CTP A;  1NBM G;  3T4D A;  3CCL V;  3OTO O;  1K8A W;  4LF7 O;  1BQZ A;  3APO A;  5IJ9 A;  1NR7 A;  4NKG B;  2FB5 A;  3SYQ A;  3H01 A;  4YHH O;  2OT5 A;  1FXK A;  5IJ0 A;  3J80 N;  4YJ3 B;  4UVA A;  1VQL V;  4DR3 O;  3OUF A;  1XMQ B;  2HKO A;  3LDE A;  1IBL B;  1ZTE A;  2P06 A;  2KG7 B;  4J10 A;  4JYA O;  3K0G A;  3ZHR A;  2YIB D;  4JYB A;  3OM3 B;  2Q67 A;  2XT9 A;  3AK2 A;  5LMN O;  2HJD A;  4RWU A;  1BHB A;  2ZR2 A;  1GK9 A;  3ABK C;  3F5W C;  1QLE C;  3ZHU A;  2DJV A;  2EJ7 A;  1OZ0 A;  4JI2 B;  1EBO A;  3A0B Z;  1M57 C;  1IX9 A;  4X64 B;  2ZE8 A;  1F23 A;  4IHJ B;  3K79 A;  5KUM A;  1M56 B;  2Q7E A;  4X20 A;  4LP8 A;  4LBE C; 
#chains in the Genus database with same CATH homology
 2QKA A;  2QKC A;  1QNM A;  1LUW A;  3EVK A;  4X9Q A;  1N0J A;  3KKY A;  1BSM A;  1ZLZ A;  5A9G A;  1N0N A;  3LSU A;  1PL4 A;  3C3T A;  1GN6 A;  3BFR A;  1KKC A;  1B06 A;  1PM9 A;  2CE4 A;  1IDS A;  3RN4 A;  4F6E A;  4BR6 A;  1ZUQ A;  3QVN A;  1EN6 A;  1I08 A;  1VAR A;  1JA8 A;  3OT7 A;  2ADQ B;  4GUN A;  1IXB A;  1D5N A;  2P4K A;  1GN3 A;  3CEI A;  1SZX A;  4FFK A;  1EN4 A;  1XDC A;  1P7G A;  1AP5 A;  1BT8 A;  1AR5 A;  3AK1 A;  1GN2 A;  1XUQ A;  3DC6 A;  1ZSP A;  2AW9 A;  1EN5 A;  2ADP A;  4C7U A;  1WB8 A;  1AP6 A;  1VEW A;  1Y67 A;  3AK3 A;  1JR9 A;  3DC5 A;  3MDS A;  1ZTE A;  1LUV A;  3KDR A;  3C3S A;  2CDY A;  1BS3 A;  1MA1 A;  1MSD A;  1MMM A;  3AK2 A;  4JYY A;  4YIO A;  1MNG A;  1AR4 A;  1WB7 A;  5AG2 A;  4E4E A;  1EM1 A;  1GN4 A;  1XIL A;  3IC9 A;  2RCV A;  1IX9 A;  1I0H A;  4YIP A;  4JZ2 A;  3K9S A;  3TJT A;  1AVM A;  2GDS A;  4JZG A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...