1JA8A

Kinetic analysis of product inhibition in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese Superoxide Dismutase
publication title Kinetic analysis of product inhibition in human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ja8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ja8A02
1AP5A 3RN4A 2QKCA 1EN4A 1EN6A 1GN3A 1N0NA 4JYYA 3KKYA 1GN4A 1XUQA 1EN5A 1AVMA 1XREA 2CDYA 1XILA 3C3SA 3BFRA 1ZLZA 1P7GA 1BSMA 1AR4A 1XDCA 4YIPA 4C7UA 4JZ2A 1KKCA 4FFKA 1LUWA 4BR6A 1SZXA 1I08A 1BS3A 1AP6A 1BT8A 1IX9A 1ZSPA 3AK3A 4E4EA 3IC9A 2QKAA 1ZUQA 1I0HA 1QNMA 3MDSA 2ADPA 1Y67A 1GN2A 1AR5A 3CEIA 4JZGA 3C3TA 2P4KA 2AW9A 2CE4A 3AK2A 1N0JA 3DC5A 1MA1A 1MNGA 1VARA 1PL4A 5AG2A 3TJTA 1IDSA 3K9SA 1MSDA 1JA8A 2GDSA 4YIOA 3DC6A 1ZTEA 2ADQB 3LSUA 1WB8A 4GUNA 1JR9A 1PM9A 1VEWA 1WB7A 3AK1A 1EM1A 1GN6A 1MMMA 4F6EA 1D5NA 3EVKA 3OT7A 1IXBA 2RCVA 4X9QA 5A9GA 3QVNA 1B06A 1LUVA
chains in the Genus database with same CATH superfamily
2ETNA 2ZINA 2QKCA 3E89A 4K0KB 3SJQC 1S0VA 4X66O 4MVSA 1KKDA 1VP7A 2A9HA 3CCEV 2CH7B 5B3SB 1P7GA 3X2QB 5BR8O 4TT3G 4NXNO 1FAFA 3TETA 1PP9H 1SKVA 3H1IH 5IY5C 5CBFA 4U3JB 2ZXWB 3TCUA 1VQ9V 4TV9B 3ZHUA 4YJ3B 4B3MO 3OR6C 2ODMA 3IC9A 3CCMV 1K7DA 4B7EA 1BQZA 2Y48A 2RQ6A 4CZZA 3H1KH 1R3JC 2BSKB 3MDSA 4IHJA 4DRXA 2ZM6B 4DR2B 2BE3A 4JZGA 4G2KA 1SRYA 3D36A 4X8AA 5HFMA 3E22A 4JASA 1E1QG 5IJ9B 5J9PC 4WBNA 2UUAB 3Q4HB 4BIZA 1Y4MA 3RGBA 1XBLA 4ZKIA 1JFFA 4UVCA 2Q7EA 3J81N 1JNBA 4KUMA 1SQFA 5IYCO 5H5NA 3BPZA 1SQBH 3SPJA 5JVDB 3B40A 4WF9V 4DR4B 4YXWG 4DR5B 3JYCA 5IY5B 4O2BB 5KUKA 4DW1A 1S72V 1RPRA 4PA6A 4PDRA 2DMXA 3ZX6A 1FXKC 3IC7A 1XI1A 3SYOA 4J80A 1JJ2U 1G6UA 1IXBA 1M5IA 4H0LB 5IWAO 1IBMB 4ZOLA 3OTOO 3RVZA 3QVNA 3OM3B 3ZHSA 1R6NA 3U10A 4WCEV 1L8DA 1GKFA 1N36B 2PI4A 1N0NA 4JYYA 4MVMA 2YIBA 3M99B 3JD0A 5J2UA 4ZBMA 3R66A 1JMKC 4GCZA 1SA0A 2JGDA 2A06H 4OXSA 4JAUA 4I4TA 2AXTZ 1WN7A 3U11A 3CJHB 3FYEB 1IJGA 3JD3A 1FJGB 3UQ8A 3LDDA 5E1AC 1Q82W 1L1FA 3K06A 2ZE6A 3NR7A 1AI5A 2VQFO 1KU9A 4H13B 1H38A 5KAIZ 4O4HA 1TGOA 2ZQMA 1FXKB 1MZFA 1MA1A 3QG5A 4MTOA 4LFCB 3H1LH 1OV9A 4JI2B 3BEHA 4TUYB 2RNBA 5EBLC 1IDSA 5BZBA 2ZCEA 4KHPB 2DWDC 2CTWA 2GUZA 1QQCA 1Y74A 3FAVA 3UO3A 4J9YB 2YI8A 1THZA 2DQ3A 3A0HZ 2JRIA 5GONB 2P7TC 1A32A 3P3NA 1JJOA 2GTAA 1QR8A 4Q6GA 1IBLB 5IJ0B 3I55V 3CPWU 1MABG 1R3LC 1Z2GA 5EK0A 5EIBD 3VQVA 1OJHA 3G6BA 3T4DA 4LF9B 4GKKO 3OR7C 4LFAO 2F23A 2Y4TA 3OD4A 4FLUA 2OTLV 3E8GA 5H6RA 1D5NA 3SJBC 4PA9A 4ZI7B 5FPRA 2PUSA 2QM8A 3G80A 4R6ZA 2LW1A 2HVJC 4JTDB 2Q67A 1Y66A 1GTOA 3KKYA 3ICXA 2CDYA 4DR1B 4DK0A 4G27B 1BCCH 2CH7A 1F23A 3M7MX 4OPHA 1VF7A 5DM6V 1YSCA 1FPOA 3ETQA 1K4DC 3H1HH 1XMQB 4ABMA 5B66Z 4U3JA 1BS3A 1MG1A 1ZSPA 1VQ4V 4TV9A 3OW2U 4YJ3A 1DF4A 3AG7A 5B1OA 1HWYA 1N32O 4DV6B 2F4VB 3ZN1A 1XQ8A 4QNHB 1CPYA 3GB7C 2BSKA 2Q73A 2ZM6O 2FB5A 4ICGA 2EZPA 4K8ZA 2OT5A 3CRMA 4PDVA 3JD1A 4FM1A 3JD4A 3DC5A 4ASUG 4JI7B 1QCEA 3S3XA 2NLJC 5IJ9A 3CMEV 1VF6C 2UUAO 3Q4HA 2R70A 3CCJV 2UXDO 1HW7A 2XNDG 2UUCB 2UXXA 4XDJA 5LL6Y 3WG7C 1OCOC 1XL6A 5JVDA 2B5UA 3SYQA 4O2BA 1JOYA 2R9AA 3MHSC 3ASNC 4NYKA 2BTOA 4X64B 2QKSA 3WB2A 3DXRB 3ZMZA 2W6IG 1NKDA 3P30A 3DGEA 5KMGB 3EXAA 2UUBB 3SPCA 1EN5A 5CMUA 4LCUC 1XREA 2VWJA 1WPBA 2EINC 4NR1A 4CH3A 1SQQH 3SPGA 3CS5A 3ZIAG 2RN9A 4LF5B 2LFSA 1S3JA 2Q0AA 1RM1C 1VIBA 1ZAUA 3CJHA 1F7YA 2OCCC 4YY3O 4FK5C 5CA1B 2QEXV 3CD6V 2Y0PA 3WG7B 4JI6B 3LSQA 1ZL8B 4X1IB 2P06A 3VQXA 2IJJA 1R73A 1V55B 3AG1C 1KB9F 4UB8Z 2LW7A 4DV5O 2ZE8A 3ASNB 3H01A 4DV7B 2HJDA 3LDCA 2AW9A 2HKOA 4CC5A 4UV8A 2V1DA 1K5QA 5LHGA 1FXKA 4NTWA 2NR5A 1KP2A 3ML0A 1CEZA 4AI8A 4UVBA 3NXSA 5KHJA 1PL4A 4JI2O 4TUYA 2QWOB 1N33B 2UXBB 5KHIA 1MSDA 2F66C 1XNQB 2EINB 1SETA 3E22B 1DF5A 5FPOA 5GONA 4DUYB 3DTUB 2WA3A 1P84F 2C2AA 1OZ0A 4FJCC 4BAYA 5IJ0A 1IBLO 1RM1B 4KP4A 2MW2B 2VQEB 5LMNO 1URFA 1R3KC 4RUEA 1I5XA 1QVGU 4NXMB 1YZBA 3OEHG 3QO5A 5IDJA 3E8HA 2JJ2G 4ZI7A 3B77A 1IBKO 3K79A 1VQ8V 3AG1B 1VQPV 3L9DA 2ITCC 1G1XB 4DV3O 3F7VC 5GTIZ 1I94B 1BHBA 2EZOA 1EN4A 1EN6A 1HDJA 3L75H 1Q6HA 1FS0G 4CH5A 4K3AA 3K5MA 2YIBD 4N23A 4AHCA 3P3PA 4JV5O 4H37A 1K8AW 1HNXO 3CCSV 2GV9A 2X6AA 1QLEC 3SYCA 2B1GA 5F2VO 3ZMVA 3OFNG 2O57A 3K57A 3AEIA 3AK3A 4J41A 4DV6O 4U3FH 4JAVA 5FL7G 1B3QA 4U7NA 1W0KG 2JK5C 4OX9B 1H2MA 3JCZA 4J7ZA 3ZHVA 3T1YB 1PKXA 5CA3A 4X62O 1KUQA 3T1HB 1D2DA 4B08A 2P90A 4MW8A 4TQDA 2XT9A 4MSWC 1ZTEA 4W4LA 3K3WA 4NKGB 4GX0A 5D5QA 4EB6B 1QLEB 3L72H 1JR9A 1ORQC 1VEWA 1M90W 1ZX3A 5CN0A 1DK1A 3HB3B 5JQGB 5GTHZ 2IJIA 4UVAA 5B5EZ 4UCOA 5JJJB 4RQFA 4QGPA 1FFXB 2QSAA 3A2FA 4CS2A 3DXRA 1AJPA 3K0GA 1B06A 4XBFA 4DO2A 3LNMB 5KMGA 1YTFB 3IFXA 4DR6O 4MW3A 2QDOA 4LF6B 3W7TA 2RDCA 3F5WC 1XDCA 3BVOA 3T4ZA 5KHHA 1VF6A 2OIEA 3S3WA 4I7ZB 4DR3O 2W0FC 4FLXA 4DR7O 3G67A 4F6RB 3CYOA 3ASOC 1K92A 4R50A 1I08A 4PA7A 4FLTA 1JCHA 1AP6A 3CMAV 5CA1A 4LF4B 3UCSC 3VOUA 4TV8B 3CRAA 3LNNA 4O2AB 4JI6O 1ZL8A 4X1IA 1QNMA 1TAEA 5KX5B 2R72A 4JYBA 4JI0B 2DJVA 3E2EA 3E8BA 4P30A 4P9PA 4ZIBA 2ZR3A 1VQ7V 4UB6Z 5IE9A 5L3GA 1J5EB 5EBWC 2HFEC 2HHHB 4Z2WA 2CGOA 3ABKC 3KCYA 2E5LB 3SR2C 3AG4C 3SGIA 1ROPA 3E35A 3JSNA 1YHQV 2GSMB 3RWRD 2QR4A 1W59A 3WFVA 1AI4A 1WB8A 4JI3O 1DLBA 1IZ3A 3CE2A 2M6YA 1WJZA 3B8NA 3LSSA 1F51A 4X89A 3ASOB 2LQTA 3CHXA 4CS3A 2ZNIA 1OCZB 3CCRV 1XEQA 4UV9A 3D8CA 3CB2A 1EZJA 4X9QA 5A9GA 4AQYO 4HYOA 1WP8A 2AZ2A 2IJHA 3N2KB 3JSLA 1KC8W 1GMGA 3A8TA 1HNZO 2PGGA 1XILA 2QE7G 1AR4A 2IH1C 3T1CA 5LA6B 3ABKB 4YIPA 2XUMA 1T5EA 4LNUB 4JPRA 3AG4B 3RBZA 4B3TB 4LF7B 4OPAA 4CC6A 1K3EA 5GW7A 2UU9O 4FLYA 1Q43A 1K73W 4UCTA 5IT9N 3QTCA 5LBQA 5LHHA 1SESA 1WAZA 2LJ2A 2YIDA 2A3QA 1M57C 3RYFB 2Q8VA 3OGCC 5LYJB 4G28B 1O9HA 2JS5A 1KBHA 2XAHA 1EBOA 3T1YO 2WLIB 4MVUA 4B3SO 4YJ2B 2IU0A 1F4NA 3FYIB 5LGTA 3ETDA 1N4CA 3CCLV 1VQ6V 2HG5C 4CBCA 3T1HO 4FMTA 1PNMA 3SDLA 2ADQB 2CK3G 4YHHB 3RVYA 1K4CC 2Q6AA 2JDIG 1QHTA 3L73H 2X7RB 4EB6A 5LHIA 2A7WA 4FLWA 2XASA 1UJWB 2DOSA 5JQGA 2DYSC 4LBEC 3OEEG 4WFGA 2CUGA 3EVKA 4DK1A 4DV0B 1WA8B 1SQVH 3D3IA 2Z5UA 3SPIA 1FFXA 1N8RW 3UT5B 1LUVA 2P22C 5JJEB 1H2LA 1V9PA 1M57B 1GN3A 4X1KB 4QE7A 3ZS8C 1RFYA 5LXTB 3M8AA 4FZ1A 4GT1A 2KQXA 1R3IC 2A79B 3JD2A 3BFRA 4BIUA 4LF6O 2CTRA 1E1RG 3BY6A 2YXLA 3LDEA 4QPKA 2EBOA 3CRCA 3FX7A 1PNKA 4JZ2A 2GBOA 3QNEA 1FFTB 1H2KA 1LUWA 4X65B 5JJNB 4F6RA 2ZNJA 5DN6G 2ATKC 4PA4A 4IYIA 4E4EA 2ARHA 4K0KO 2QWPB 2ILMA 4TV8A 1RSOB 1ZUQA 4O2AA 3B8MA 4JTAB 2EIJB 3FKSG 2UXNA 3JAWB 3OMNB 3RFRA 3CC2V 1XNRB 2OTJV 5KX5A 1GN2A 4O4JB 2DYSB 3ETGA 4O4IB 2W6JG 3ZHTA 5JWPA 4QJFB 1XMOB 3THOA 1NTZH 2P4VA 2KSDA 3SPHA 2YIAA 2WWWA 3ZMUA 5C93A 5L3DA 5JH7B 2OWOA 1X4TA 2HP8A 1YJWV 3JCUZ 5LOVB 1PL0A 1Q86W 1W0JG 2K1EA 2E5LO 3HPLC 2GDSA 4DV1B 5LGNA 1KMIZ 1H8HG 4DR2O 1G8MA 4PJ0Z 3J7AU 4GUNA 5IYZB 1Q81W 1S5HC 2IJKA 2W0XA 4LF8B 2HVKC 4JYAB 1OCCC 2LO1A 4X1YB 1IXMA 5JCOA 1KECA 3OT7A 1PNLA 4PDLA 5A2QN 2HJFC 4J7JA 4UCUA 2QTOA 2X0LA 3HR0A 1SQGA 3FB5C 3RN4A 1TUBB 2QTSA 2Q69A 4DR4O 3K5LA 3OUFA 1V55C 1XUQA 2ZDIC 4DR5O 3N2KA 4JI8B 1PPJH 1WNSA 4NVPA 5L3BA 1ZLZA 3SYPA 2P5OA 1QVFU 3G71V 1MSWD 5LA6A 1WPXA 2ZD9A 1R1BA 4MVZA 3EHBB 4LNUA 1IBMO 4B3TO 1SZXA 4FM2A 2YI9A 2L35A 3MHHC 3I5DA 1N36O 3P32A 1O9GA 2CAZC 4L87A 4DV4B 1B6QA 2KKWA 1OCCB 3K58A 2RMKB 4MTFA 2DN9A 3L74H 5K1PA 4DV2B 2N05A 5BMVB 2YS8A 4PDMA 3RYFA 1VF5B 1BMFG 4BW9A 1FJGO 5DEDA 5LYJA 3QO7A 3JALB 2IH3C 2JVDA 4EEQA 3OE7G 2WLIA 3UO2A 3C90A 4YJ2A 1FYJA 1N34B 3N27A 1MZEA 3ABTA 4UXNA 2YSUB 2WLNA 5L3FA 3RW0A 4PI2A 1GM8A 3CX5F 3RYCB 1NVPB 4X66B 5KUMA 3N2GB 4Z1MG 4MT8A 2DYRB 2VWKA 4LFCO 3K0DA 1K33A 1BGYH 1Q6IA 5BR8B 1AJNA 4NXNB 1FXVA 5CA0B 4XDKA 4J10A 2GTSA 2EIKC 1SQPH 1NI8A 4JF3A 1YEWA 4UCRA 4W4KA 4JAAA 1WA8A 4KHPO 3FFQA 3KDRA 4D7TA 4EFEA 3UT5A 1YF2A 2JGUA 4J9ZB 1UPGA 4MTGA 4X1KA 1AVMA 5LXTA 2PYLA 1AROP 3G4SV 1TA8A 4UCSA 4LF9O 1BSMA 2N04A 1NR1A 1PV0A 3T2MA 4RAIA 3B09A 4UFZA 2B1IA 1UFIA 1BT8A 1NH2B 3ZHRA 1M9NA 1US6A 4B3RB 5LP6C 1NTMH 2YC0A 1D5AA 1GH6A 1RSOA 2QJ1A 2A0LA 1BHAA 2EIMC 4DR1O 2E76B 4MTXA 3JAWA 1COWG 2ITDC 1XNRO 3IGAC 5C8YB 1VQNV 4O4JA 3A0BZ 3F7YC 3W7UA 4O4IA 3RYIA 2EIKB 1XMOO 2ZKOA 1BE3H 3K5OA 1XMQO 4DYLA 1YXBA 5JH7A 2PYJA 2XAFA 4IGGA 2WLMA 3AG2C 4LFBB 1PD3A 2F4VO 5LOVA 4H33A 2JS3A 3OTOB 3VQYA 3O9OA 3B4SA 4GKJB 3FB8C 2N74A 4D7SA 1FKAO 5KHGA 3WU2Z 4GX1A 3LUTB 1WB7A 4JI7O 5IYZA 1BL8A 2ZIOA 2NNUA 4R7CA 1K97A 1MMMA 4X88A 4X1YA 3H1JH 1NS1A 1H2NA 1B04A 3ABMB 2RCVA 4OGQB 5LP6B 3ZRXA 1DGSA 2UUCO 3FB7C 4I0XB 1OCRC 5HFLA 2EIMB 2WLJA 4L8JA 1H5WA 2WLLB 2OYQA 1K5SA 1AP5A 2DE0X 1TUBA 3K03A 2M7WA 1YIJV 1NQTA 3OMIB 1YTFD 4LR3A 2GHYA 5DECA 3C3SA 4JI4B 2AGAA 4C7UA 2Q68A 4X64O 3JAKA 3AG2B 3CP1A 2IM9A 4I55B 1S5LZ 1FXHA 3CC4V 1XHZA 1HR0B 2EJ7A 2Y0IA 3GWOA 4K35A 2UUBO 2IW5A 4P9OA 4I50B 3EFFK 3J80N 2AZ0A 1Y67A 1HNWB 3MAQA 1NBMG 2Q4PA 3OUSA 1I5YA 4WFHA 3HKEB 5BMVA 4LF5O 5JCOC 3APQA 2Q7HA 1OCRB 5J2TB 2ZIMA 4LH6A 4GKKB 1OCZC 4LFAB 3JALA 1JPXA 3ZRWB 1Q3EA 2V7QG 4R8CA 3L70H 1IVSA 1L0NH 2V4DA 2ZDIA 3CRRA 1CP9A 4WFAV 4YIOA 4DW0A 5KLVH 1M56C 4IIJB 4HBNA 3RYCA 3TXSA 4IL6Z 4DV7O 3IAYA 2VRZA 3HKDA 3ZRVA 5CB4B 3N2GA 5EC1C 2XTAA 3OTFA 4FFBB 1YJ9V 5EYPB 1H2GA 3IJ4A 3W7XA 3PN1A 4F6EA 4PD4F 4QIWF 1N33O 2E75B 5CA0A 2QWQB 2UXBO 1P7BA 1QBZA 2QGNA 1XNQO 1GM9A 1VQLV 3ZMTA 1YITV 2Q9LA 2JEUA 4EFBA 1N32B 4DUYO 2QM7A 4X20A 1Y76B 2D2CB 2MK3A 1Z5WA 3K9AA 4MS2A 3RT3C 2VQEO 2X6BA 4NXMO 3CRQA 4JI1B 3A0RA 5KA5A 5KA6A 4IT5A 4GZRB 3SJAC 1LR1A 1VQKV 2FTKA 1M56B 4O4LB 1NU1H 1I94O 4FZ0A 2UXDB 4B3RO 3ETEA 2Z0AA 4D6TH 3DSQA 2L6LA 3APOA 1FD9A 2ADPA 3MD0A 2F95B 2EJRA 2FKXA 3CEIA 2EULA 2Q5ZA 1X59A 5C8YA 2D3OW 2DQ0A 5EZYB 1U96A 1K34A 5LGUA 3BA8A 3GVMA 5AG2A 1QLNA 1TUEB 4LFBO 5K1XA 3DC6A 1DTOA 4ZHQB 4GLXA 4OX9O 4GKJO 1KP3A 3ZBHA 3QO8A 2FL4A 3W7SA 4QPJA 2ZR2A 3HKCB 3CCUV 4J7KA 4KXRA 5B1BC 2H94A 1GN6A 3ZRSA 1SS3A 4Q20A 3STZC 1Q90D 2HEPA 3K59A 5LP6A 4YY3B 4I0XA 4LH7A 4PA3A 2FYUH 2WLLA 2WAMA 3D3QA 2YEVB 2F43G 2UXCB 2YUAA 2EIJC 1QU7A 2XOKG 2EX3A 1ZWIC 4DV5B 4BWAA 2PTMA 3HKBB 5EIBC 4PI0A 1SF9A 2F1MA 4JI4O 3JARB 1SZTA 1OHHG 4FFKA 3CXHF 2OIGA 1XHXA 4I55A 2KG7B 3BRCA 3SJCC 4JTCB 4F4LA 3CCVV 3ZJZA 1HR0O 2QKAA 2F93B 2OCHA 1I0HA 2XAGA 3H9VA 3ZEDA 5B1BB 5ITZB 2QWNB 4I50A 4U7OA 1NT2B 1FOUA 1RPOA 1HNWO 2HR3A 1W2BU 1K9MW 2CE4A 4HNAB 2PF4E 3HKEA 5D5PA 5LMNB 1HP8A 5FNVB 2DWEC 1VARA 5J2TA 1RP3B 4AILC 4NTXA 4J11A 4LF4O 3TJTA 1F4MA 3VBBA 4MVOA 3ZRWA 4WFBV 2WLKA 3OMAB 3TGUH 3UM7A 5H9CA 1IBKB 1S76D 1M1KW 4DV3B 1TVKB 4JI0O 4IIJA 3RYIB 3ZMSA 3JASB 1JX9A 3TK1A 1J5EO 2CTPA 1AI7A 3K04A 4PHZA 5CB4A 1EM1A 4MVRA 2HHHO 4FFBA 3SYAA 4JV5B 1HNXB 5EYPA 4DXWA 3ABUA 5B1NA 1WP7A 2XAQA 3RYHB 3JATB 4CS4A 4DUZB 2P67A 1SC5B 3BABA 5B1AC 4P2ZA 5EBMC 2P6JA 1GN4A 1GM7A 4RUFA 2IBZH 1Y76A 2BTQB 4CH4A 1L0LH 2ZE7A 1AB3A 4RWUA 3L71H 4Z1VA 2AHYA 1NZ6A 2IU3A 4JI1O 2BOCC 4LWSB 1QR9A 1KQSU 4J42A 2K9PA 2AHZA 1Q5OA 4I9WA 4X62B 4O4LA 2Y69C 2QM4A 4UUJC 3F5TA 4BIOA 4JI5B 1GRJA 3FD9A 1VQOV 2H8PC 1U97A 4JYCA 1AR5A 3JAKB 2WSSG 3OGIB 2P4KA 2WPDG 2DYRC 1N0JA 2YICA 4HZ3A 4LF7O 4TQFA 3CWBH 5EZYA 2XHBA 4K8XA 1KYOF 3QF7A 3CCQV 1Q8IA 5B1AB 5FLXN 5KHKA 2H3OA 3K9SA 2PY5A 1BQ0A 4TWKA 2DW4A 3STLC 3ZN0A 2WLHA 4ZHQA 4CH6A 3VQWA 4DR6B 2E3CA 2JIZG 2ZE5A 1ENVA 4TSFG 1Y6XA 1PM9A 3O65A 1XL4A 4A5UB 3HKCA 4I5SA 2LFRA 1V54C 1NVPD 2G38A 4EKWA 4TOIA 2X6CA 3D36C 4RQEA 2Y69B 2Z3YA 5LMUB 4DR3B 1Z5VA 4DR7B 2BCCH 4PELA 3I56V 1P49A 3BHPA 3HKDB 1AJQA 2FMLA 4YHHO 4B7KA 1OCOB 2YXHA 2YEVA 1JVMA 2UXCO 4BW5A 4LC1A 1KD1W 1XOUA 3FB6C 3R65A 5E79Z 2PZSA 2ZT9B 3HKBA 4MVQA 1YJNV 4NTYA 4DV0O 1KKCA 3JARA 4B3MB 3JAMN 4QE9A 1Q7YW 5BXZA 1IX9A 4N21A 4RO2A 1H8EG 2Q0OC 4X20B 2KG7A 1M93A 4GYCB 4IHJB 4DRXB 3AG3C 5IYBO 1J95A 1G4YB 1NH2D 3W7WA 1V54B 5ITZA 3WB1A 1YCIA 2CGNA 4I9QA 4JI3B 3ABLC 3AK2A 2NN4A 5KAFZ 4HNAA 4FIPC 4WBNB 1NJIW 5H2FZ 4X65O 2LGWA 3ZHQA 1GO3F 2OCCB 3E86A 5FNVA 1YI2V 2RJZA 5CBGA 1JFFB 3ABMC 2R9IA 4FLZA 1JA8A 2LP7A 3KG2A 3GWKC 4H44B 4XDLA 4GX5A 5L3EA 4AQYB 5BY1A 3CSXA 1TVKA 1LNQA 3BCCH 1SERA 1IURA 1HNZB 3JASA 3OAAG 1MOFA 5TISZ 5H6QA 1NTKH 1GAXA 4JGSA 4WFFA 4PV1B 1JQ0A 3CXCU 1NR7A 4IYHA 1P4RA 1VQ5V 1VMGA 5IWAB 1R6KA 1SQXH 3G6EV 4ZOLB 1WLEA 2E74B 3AG3B 3RYHA 2UU9B 3JATA 4DV1O 3WB0A 3ZCCA 4HAMA 4DUZO 3B2EE 1GK9A 2Q7GA 3ABLB 2BOBC 2R9RB 2PI5A 5J2UB 4LP8A 1AR1B 5L3CA 2QWRB 5CBHA 1SA0B 2JGDB 4LF8O 2HLDG 4JYAO 3CC7V 2YXYA 1M4UA 1BZKA 2BTQA 4I4TB 3PJSK 4E2LA 2QA4V 2WA4A 3TXQA 4LWSA 4BR6A 1EZVH 4FM0A 2EILC 4B3SB 1I7FA 4KFMA 1EFRG 4UCVA 2VQFB 2KB1A 1VQMV 4JI8O 4O4HB 4JI5O 2LGQA 2VS0A 3U0ZA 3KCXA 3C3TA 1MNGA 3E8FA 4GX2A 3K5NA 2JJ1G 5B3SC 3X2QC 3UKMA 3BAAA 2XAJA 2B9ZA 4FVMA 3E83A 1H2SB 5IYDO 1YDXA 1R6TA 2CTQA 2ZXWC 2GUZB 4DV4O 4FLVA 4WFEA 1Y74B 1AI6A 3FAVB 1E79G 1CXZB 3LSUA 1Q6UA 5EC2C 4DV2O 1AILA 1S5JA 3AK1A 4FPPA 1YVWA 4NB5A 2YDEA 2EILB 4KL1A 2Y4UA 1N34O 3BA9A 1S77D 3K08A 5LMUO 2JEXA 3KZIZ
chains in the Genus database with same CATH topology
1AP5A 3RN4A 2QKCA 1EN4A 1EN6A 1GN3A 1N0NA 4JYYA 3KKYA 1GN4A 1XUQA 1EN5A 1AVMA 1XREA 2CDYA 1XILA 3C3SA 3BFRA 1ZLZA 1P7GA 1BSMA 1AR4A 1XDCA 4YIPA 4C7UA 4JZ2A 1KKCA 4FFKA 1LUWA 4BR6A 1SZXA 1I08A 1BS3A 1AP6A 1BT8A 1IX9A 1ZSPA 3AK3A 4E4EA 3IC9A 2QKAA 1ZUQA 1I0HA 1QNMA 3MDSA 2ADPA 1Y67A 1GN2A 1AR5A 3CEIA 4JZGA 3C3TA 2P4KA 2AW9A 2CE4A 3AK2A 1N0JA 3DC5A 1MA1A 1MNGA 1VARA 1PL4A 5AG2A 3TJTA 1IDSA 3K9SA 1MSDA 1JA8A 2GDSA 4YIOA 3DC6A 1ZTEA 2ADQB 3LSUA 1WB8A 4GUNA 1JR9A 1PM9A 1VEWA 1WB7A 3AK1A 1EM1A 1GN6A 1MMMA 4F6EA 1D5NA 3EVKA 3OT7A 1IXBA 2RCVA 4X9QA 3KDRA 5A9GA 3QVNA 1B06A 1LUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP5 A;  3RN4 A;  2QKC A;  1EN4 A;  1EN6 A;  1GN3 A;  1N0N A;  4JYY A;  3KKY A;  1GN4 A;  1XUQ A;  1EN5 A;  1AVM A;  1XRE A;  2CDY A;  1XIL A;  3C3S A;  3BFR A;  1ZLZ A;  1P7G A;  1BSM A;  1AR4 A;  1XDC A;  4YIP A;  4C7U A;  4JZ2 A;  1KKC A;  4FFK A;  1LUW A;  4BR6 A;  1SZX A;  1I08 A;  1BS3 A;  1AP6 A;  1BT8 A;  1IX9 A;  1ZSP A;  3AK3 A;  4E4E A;  3IC9 A;  2QKA A;  1ZUQ A;  1I0H A;  1QNM A;  3MDS A;  2ADP A;  1Y67 A;  1GN2 A;  1AR5 A;  3CEI A;  4JZG A;  3C3T A;  2P4K A;  2AW9 A;  2CE4 A;  3AK2 A;  1N0J A;  3DC5 A;  1MA1 A;  1MNG A;  1VAR A;  1PL4 A;  5AG2 A;  3TJT A;  1IDS A;  3K9S A;  1MSD A;  1JA8 A;  2GDS A;  4YIO A;  3DC6 A;  1ZTE A;  2ADQ B;  3LSU A;  1WB8 A;  4GUN A;  1JR9 A;  1PM9 A;  1VEW A;  1WB7 A;  3AK1 A;  1EM1 A;  1GN6 A;  1MMM A;  4F6E A;  1D5N A;  3EVK A;  3OT7 A;  1IXB A;  2RCV A;  4X9Q A;  5A9G A;  3QVN A;  1B06 A;  1LUV A; 
#chains in the Genus database with same CATH topology
 2ETN A;  2ZIN A;  2QKC A;  3E89 A;  4K0K B;  3SJQ C;  1S0V A;  4X66 O;  4MVS A;  1KKD A;  1VP7 A;  2A9H A;  3CCE V;  2CH7 B;  5B3S B;  1P7G A;  3X2Q B;  5BR8 O;  4TT3 G;  4NXN O;  1FAF A;  3TET A;  1PP9 H;  1SKV A;  3H1I H;  5IY5 C;  5CBF A;  4U3J B;  2ZXW B;  3TCU A;  1VQ9 V;  4TV9 B;  3ZHU A;  4YJ3 B;  4B3M O;  3OR6 C;  2ODM A;  3IC9 A;  3CCM V;  1K7D A;  4B7E A;  1BQZ A;  2Y48 A;  2RQ6 A;  4CZZ A;  3H1K H;  1R3J C;  2BSK B;  3MDS A;  4IHJ A;  4DRX A;  2ZM6 B;  4DR2 B;  2BE3 A;  4JZG A;  4G2K A;  1SRY A;  3D36 A;  4X8A A;  5HFM A;  3E22 A;  4JAS A;  1E1Q G;  5IJ9 B;  5J9P C;  4WBN A;  2UUA B;  3Q4H B;  4BIZ A;  1Y4M A;  3RGB A;  1XBL A;  4ZKI A;  1JFF A;  4UVC A;  2Q7E A;  3J81 N;  1JNB A;  4KUM A;  1SQF A;  5IYC O;  5H5N A;  3BPZ A;  1SQB H;  3SPJ A;  5JVD B;  3B40 A;  4WF9 V;  4DR4 B;  4YXW G;  4DR5 B;  3JYC A;  5IY5 B;  4O2B B;  5KUK A;  4DW1 A;  1S72 V;  1RPR A;  4PA6 A;  4PDR A;  2DMX A;  3ZX6 A;  1FXK C;  3IC7 A;  1XI1 A;  3SYO A;  4J80 A;  1JJ2 U;  1G6U A;  1IXB A;  1M5I A;  4H0L B;  5IWA O;  1IBM B;  4ZOL A;  3OTO O;  3RVZ A;  3QVN A;  3OM3 B;  3ZHS A;  1R6N A;  3U10 A;  4WCE V;  1L8D A;  1GKF A;  1N36 B;  2PI4 A;  1N0N A;  4JYY A;  4MVM A;  2YIB A;  3M99 B;  3JD0 A;  5J2U A;  4ZBM A;  3R66 A;  1JMK C;  4GCZ A;  1SA0 A;  2JGD A;  2A06 H;  4OXS A;  4JAU A;  4I4T A;  2AXT Z;  1WN7 A;  3U11 A;  3CJH B;  3FYE B;  1IJG A;  3JD3 A;  1FJG B;  3UQ8 A;  3LDD A;  5E1A C;  1Q82 W;  1L1F A;  3K06 A;  2ZE6 A;  3NR7 A;  1AI5 A;  2VQF O;  1KU9 A;  4H13 B;  1H38 A;  5KAI Z;  4O4H A;  1TGO A;  2ZQM A;  1FXK B;  1MZF A;  1MA1 A;  3QG5 A;  4MTO A;  4LFC B;  3H1L H;  1OV9 A;  4JI2 B;  3BEH A;  4TUY B;  2RNB A;  5EBL C;  1IDS A;  5BZB A;  2ZCE A;  4KHP B;  2DWD C;  2CTW A;  2GUZ A;  1QQC A;  1Y74 A;  3FAV A;  3UO3 A;  4J9Y B;  2YI8 A;  1THZ A;  2DQ3 A;  3A0H Z;  2JRI A;  5GON B;  2P7T C;  1A32 A;  3P3N A;  1JJO A;  2GTA A;  1QR8 A;  4Q6G A;  1IBL B;  5IJ0 B;  3I55 V;  3CPW U;  1MAB G;  1R3L C;  1Z2G A;  5EK0 A;  5EIB D;  3VQV A;  1OJH A;  3G6B A;  3T4D A;  4LF9 B;  4GKK O;  3OR7 C;  4LFA O;  2F23 A;  2Y4T A;  3OD4 A;  4FLU A;  2OTL V;  3E8G A;  5H6R A;  1D5N A;  3SJB C;  4PA9 A;  4ZI7 B;  5FPR A;  2PUS A;  2QM8 A;  3G80 A;  4R6Z A;  2LW1 A;  2HVJ C;  4JTD B;  2Q67 A;  1Y66 A;  1GTO A;  3KKY A;  3ICX A;  2CDY A;  4DR1 B;  4DK0 A;  4G27 B;  1BCC H;  2CH7 A;  1F23 A;  3M7M X;  4OPH A;  1VF7 A;  5DM6 V;  1YSC A;  1FPO A;  3ETQ A;  1K4D C;  3H1H H;  1XMQ B;  4ABM A;  5B66 Z;  4U3J A;  1BS3 A;  1MG1 A;  1ZSP A;  1VQ4 V;  4TV9 A;  3OW2 U;  4YJ3 A;  1DF4 A;  3AG7 A;  5B1O A;  1HWY A;  1N32 O;  4DV6 B;  2F4V B;  3ZN1 A;  1XQ8 A;  4QNH B;  1CPY A;  3GB7 C;  2BSK A;  2Q73 A;  2ZM6 O;  2FB5 A;  4ICG A;  2EZP A;  4K8Z A;  2OT5 A;  3CRM A;  4PDV A;  3JD1 A;  4FM1 A;  3JD4 A;  3DC5 A;  4ASU G;  4JI7 B;  1QCE A;  3S3X A;  2NLJ C;  5IJ9 A;  3CME V;  1VF6 C;  2UUA O;  3Q4H A;  2R70 A;  3CCJ V;  2UXD O;  1HW7 A;  2XND G;  2UUC B;  2UXX A;  4XDJ A;  5LL6 Y;  3WG7 C;  1OCO C;  1XL6 A;  5JVD A;  2B5U A;  3SYQ A;  4O2B A;  1JOY A;  2R9A A;  3MHS C;  3ASN C;  4NYK A;  2BTO A;  4X64 B;  2QKS A;  3WB2 A;  3DXR B;  3ZMZ A;  2W6I G;  1NKD A;  3P30 A;  3DGE A;  5KMG B;  3EXA A;  2UUB B;  3SPC A;  1EN5 A;  5CMU A;  4LCU C;  1XRE A;  2VWJ A;  1WPB A;  2EIN C;  4NR1 A;  4CH3 A;  1SQQ H;  3SPG A;  3CS5 A;  3ZIA G;  2RN9 A;  4LF5 B;  2LFS A;  1S3J A;  2Q0A A;  1RM1 C;  1VIB A;  1ZAU A;  3CJH A;  1F7Y A;  2OCC C;  4YY3 O;  4FK5 C;  5CA1 B;  2QEX V;  3CD6 V;  2Y0P A;  3WG7 B;  4JI6 B;  3LSQ A;  1ZL8 B;  4X1I B;  2P06 A;  3VQX A;  2IJJ A;  1R73 A;  1V55 B;  3AG1 C;  1KB9 F;  4UB8 Z;  2LW7 A;  4DV5 O;  2ZE8 A;  3ASN B;  3H01 A;  4DV7 B;  2HJD A;  3LDC A;  2AW9 A;  2HKO A;  4CC5 A;  4UV8 A;  2V1D A;  1K5Q A;  5LHG A;  1FXK A;  4NTW A;  2NR5 A;  1KP2 A;  3ML0 A;  1CEZ A;  4AI8 A;  4UVB A;  3NXS A;  5KHJ A;  1PL4 A;  4JI2 O;  4TUY A;  2QWO B;  1N33 B;  2UXB B;  5KHI A;  1MSD A;  2F66 C;  1XNQ B;  2EIN B;  1SET A;  3E22 B;  1DF5 A;  5FPO A;  5GON A;  4DUY B;  3DTU B;  2WA3 A;  1P84 F;  2C2A A;  1OZ0 A;  4FJC C;  4BAY A;  5IJ0 A;  1IBL O;  1RM1 B;  4KP4 A;  2MW2 B;  2VQE B;  5LMN O;  1URF A;  1R3K C;  4RUE A;  1I5X A;  1QVG U;  4NXM B;  1YZB A;  3OEH G;  3QO5 A;  5IDJ A;  3E8H A;  2JJ2 G;  4ZI7 A;  3B77 A;  1IBK O;  3K79 A;  1VQ8 V;  3AG1 B;  1VQP V;  3L9D A;  2ITC C;  1G1X B;  4DV3 O;  3F7V C;  5GTI Z;  1I94 B;  1BHB A;  2EZO A;  1EN4 A;  1EN6 A;  1HDJ A;  3L75 H;  1Q6H A;  1FS0 G;  4CH5 A;  4K3A A;  3K5M A;  2YIB D;  4N23 A;  4AHC A;  3P3P A;  4JV5 O;  4H37 A;  1K8A W;  1HNX O;  3CCS V;  2GV9 A;  2X6A A;  1QLE C;  3SYC A;  2B1G A;  5F2V O;  3ZMV A;  3OFN G;  2O57 A;  3K57 A;  3AEI A;  3AK3 A;  4J41 A;  4DV6 O;  4U3F H;  4JAV A;  5FL7 G;  1B3Q A;  4U7N A;  1W0K G;  2JK5 C;  4OX9 B;  1H2M A;  3JCZ A;  4J7Z A;  3ZHV A;  3T1Y B;  1PKX A;  5CA3 A;  4X62 O;  1KUQ A;  3T1H B;  1D2D A;  4B08 A;  2P90 A;  4MW8 A;  4TQD A;  2XT9 A;  4MSW C;  1ZTE A;  4W4L A;  3K3W A;  4NKG B;  4GX0 A;  5D5Q A;  4EB6 B;  1QLE B;  3L72 H;  1JR9 A;  1ORQ C;  1VEW A;  1M90 W;  1ZX3 A;  5CN0 A;  1DK1 A;  3HB3 B;  5JQG B;  5GTH Z;  2IJI A;  4UVA A;  5B5E Z;  4UCO A;  5JJJ B;  4RQF A;  4QGP A;  1FFX B;  2QSA A;  3A2F A;  4CS2 A;  3DXR A;  1AJP A;  3K0G A;  1B06 A;  4XBF A;  4DO2 A;  3LNM B;  5KMG A;  1YTF B;  3IFX A;  4DR6 O;  4MW3 A;  2QDO A;  4LF6 B;  3W7T A;  2RDC A;  3F5W C;  1XDC A;  3BVO A;  3T4Z A;  5KHH A;  1VF6 A;  2OIE A;  3S3W A;  4I7Z B;  4DR3 O;  2W0F C;  4FLX A;  4DR7 O;  3G67 A;  4F6R B;  3CYO A;  3ASO C;  1K92 A;  4R50 A;  1I08 A;  4PA7 A;  4FLT A;  1JCH A;  1AP6 A;  3CMA V;  5CA1 A;  4LF4 B;  3UCS C;  3VOU A;  4TV8 B;  3CRA A;  3LNN A;  4O2A B;  4JI6 O;  1ZL8 A;  4X1I A;  1QNM A;  1TAE A;  5KX5 B;  2R72 A;  4JYB A;  4JI0 B;  2DJV A;  3E2E A;  3E8B A;  4P30 A;  4P9P A;  4ZIB A;  2ZR3 A;  1VQ7 V;  4UB6 Z;  5IE9 A;  5L3G A;  1J5E B;  5EBW C;  2HFE C;  2HHH B;  4Z2W A;  2CGO A;  3ABK C;  3KCY A;  2E5L B;  3SR2 C;  3AG4 C;  3SGI A;  1ROP A;  3E35 A;  3JSN A;  1YHQ V;  2GSM B;  3RWR D;  2QR4 A;  1W59 A;  3WFV A;  1AI4 A;  1WB8 A;  4JI3 O;  1DLB A;  1IZ3 A;  3CE2 A;  2M6Y A;  1WJZ A;  3B8N A;  3LSS A;  1F51 A;  4X89 A;  3ASO B;  2LQT A;  3CHX A;  4CS3 A;  2ZNI A;  1OCZ B;  3CCR V;  1XEQ A;  4UV9 A;  3D8C A;  3CB2 A;  1EZJ A;  4X9Q A;  5A9G A;  4AQY O;  4HYO A;  1WP8 A;  2AZ2 A;  2IJH A;  3N2K B;  3JSL A;  1KC8 W;  1GMG A;  3A8T A;  1HNZ O;  2PGG A;  1XIL A;  2QE7 G;  1AR4 A;  2IH1 C;  3T1C A;  5LA6 B;  3ABK B;  4YIP A;  2XUM A;  1T5E A;  4LNU B;  4JPR A;  3AG4 B;  3RBZ A;  4B3T B;  4LF7 B;  4OPA A;  4CC6 A;  1K3E A;  5GW7 A;  2UU9 O;  4FLY A;  1Q43 A;  1K73 W;  4UCT A;  5IT9 N;  3QTC A;  5LBQ A;  5LHH A;  1SES A;  1WAZ A;  2LJ2 A;  2YID A;  2A3Q A;  1M57 C;  3RYF B;  2Q8V A;  3OGC C;  5LYJ B;  4G28 B;  1O9H A;  2JS5 A;  1KBH A;  2XAH A;  1EBO A;  3T1Y O;  2WLI B;  4MVU A;  4B3S O;  4YJ2 B;  2IU0 A;  1F4N A;  3FYI B;  5LGT A;  3ETD A;  1N4C A;  3CCL V;  1VQ6 V;  2HG5 C;  4CBC A;  3T1H O;  4FMT A;  1PNM A;  3SDL A;  2ADQ B;  2CK3 G;  4YHH B;  3RVY A;  1K4C C;  2Q6A A;  2JDI G;  1QHT A;  3L73 H;  2X7R B;  4EB6 A;  5LHI A;  2A7W A;  4FLW A;  2XAS A;  1UJW B;  2DOS A;  5JQG A;  2DYS C;  4LBE C;  3OEE G;  4WFG A;  2CUG A;  3EVK A;  4DK1 A;  4DV0 B;  1WA8 B;  1SQV H;  3D3I A;  2Z5U A;  3SPI A;  1FFX A;  1N8R W;  3UT5 B;  1LUV A;  2P22 C;  5JJE B;  1H2L A;  1V9P A;  1M57 B;  1GN3 A;  4X1K B;  4QE7 A;  3ZS8 C;  1RFY A;  5LXT B;  3M8A A;  4FZ1 A;  4GT1 A;  2KQX A;  1R3I C;  2A79 B;  3JD2 A;  3BFR A;  4BIU A;  4LF6 O;  2CTR A;  1E1R G;  3BY6 A;  2YXL A;  3LDE A;  4QPK A;  2EBO A;  3CRC A;  3FX7 A;  1PNK A;  4JZ2 A;  2GBO A;  3QNE A;  1FFT B;  1H2K A;  1LUW A;  4X65 B;  5JJN B;  4F6R A;  2ZNJ A;  5DN6 G;  2ATK C;  4PA4 A;  4IYI A;  4E4E A;  2ARH A;  4K0K O;  2QWP B;  2ILM A;  4TV8 A;  1RSO B;  1ZUQ A;  4O2A A;  3B8M A;  4JTA B;  2EIJ B;  3FKS G;  2UXN A;  3JAW B;  3OMN B;  3RFR A;  3CC2 V;  1XNR B;  2OTJ V;  5KX5 A;  1GN2 A;  4O4J B;  2DYS B;  3ETG A;  4O4I B;  2W6J G;  3ZHT A;  5JWP A;  4QJF B;  1XMO B;  3THO A;  1NTZ H;  2P4V A;  2KSD A;  3SPH A;  2YIA A;  2WWW A;  3ZMU A;  5C93 A;  5L3D A;  5JH7 B;  2OWO A;  1X4T A;  2HP8 A;  1YJW V;  3JCU Z;  5LOV B;  1PL0 A;  1Q86 W;  1W0J G;  2K1E A;  2E5L O;  3HPL C;  2GDS A;  4DV1 B;  5LGN A;  1KMI Z;  1H8H G;  4DR2 O;  1G8M A;  4PJ0 Z;  3J7A U;  4GUN A;  5IYZ B;  1Q81 W;  1S5H C;  2IJK A;  2W0X A;  4LF8 B;  2HVK C;  4JYA B;  1OCC C;  2LO1 A;  4X1Y B;  1IXM A;  5JCO A;  1KEC A;  3OT7 A;  1PNL A;  4PDL A;  5A2Q N;  2HJF C;  4J7J A;  4UCU A;  2QTO A;  2X0L A;  3HR0 A;  1SQG A;  3FB5 C;  3RN4 A;  1TUB B;  2QTS A;  2Q69 A;  4DR4 O;  3K5L A;  3OUF A;  1V55 C;  1XUQ A;  2ZDI C;  4DR5 O;  3N2K A;  4JI8 B;  1PPJ H;  1WNS A;  4NVP A;  5L3B A;  1ZLZ A;  3SYP A;  2P5O A;  1QVF U;  3G71 V;  1MSW D;  5LA6 A;  1WPX A;  2ZD9 A;  1R1B A;  4MVZ A;  3EHB B;  4LNU A;  1IBM O;  4B3T O;  1SZX A;  4FM2 A;  2YI9 A;  2L35 A;  3MHH C;  3I5D A;  1N36 O;  3P32 A;  1O9G A;  2CAZ C;  4L87 A;  4DV4 B;  1B6Q A;  2KKW A;  1OCC B;  3K58 A;  2RMK B;  4MTF A;  2DN9 A;  3L74 H;  5K1P A;  4DV2 B;  2N05 A;  5BMV B;  2YS8 A;  4PDM A;  3RYF A;  1VF5 B;  1BMF G;  4BW9 A;  1FJG O;  5DED A;  5LYJ A;  3QO7 A;  3JAL B;  2IH3 C;  2JVD A;  4EEQ A;  3OE7 G;  2WLI A;  3UO2 A;  3C90 A;  4YJ2 A;  1FYJ A;  1N34 B;  3N27 A;  1MZE A;  3ABT A;  4UXN A;  2YSU B;  2WLN A;  5L3F A;  3RW0 A;  4PI2 A;  1GM8 A;  3CX5 F;  3RYC B;  1NVP B;  4X66 B;  5KUM A;  3N2G B;  4Z1M G;  4MT8 A;  2DYR B;  2VWK A;  4LFC O;  3K0D A;  1K33 A;  1BGY H;  1Q6I A;  5BR8 B;  1AJN A;  4NXN B;  1FXV A;  5CA0 B;  4XDK A;  4J10 A;  2GTS A;  2EIK C;  1SQP H;  1NI8 A;  4JF3 A;  1YEW A;  4UCR A;  4W4K A;  4JAA A;  1WA8 A;  4KHP O;  3FFQ A;  3KDR A;  4D7T A;  4EFE A;  3UT5 A;  1YF2 A;  2JGU A;  4J9Z B;  1UPG A;  4MTG A;  4X1K A;  1AVM A;  5LXT A;  2PYL A;  1ARO P;  3G4S V;  1TA8 A;  4UCS A;  4LF9 O;  1BSM A;  2N04 A;  1NR1 A;  1PV0 A;  3T2M A;  4RAI A;  3B09 A;  4UFZ A;  2B1I A;  1UFI A;  1BT8 A;  1NH2 B;  3ZHR A;  1M9N A;  1US6 A;  4B3R B;  5LP6 C;  1NTM H;  2YC0 A;  1D5A A;  1GH6 A;  1RSO A;  2QJ1 A;  2A0L A;  1BHA A;  2EIM C;  4DR1 O;  2E76 B;  4MTX A;  3JAW A;  1COW G;  2ITD C;  1XNR O;  3IGA C;  5C8Y B;  1VQN V;  4O4J A;  3A0B Z;  3F7Y C;  3W7U A;  4O4I A;  3RYI A;  2EIK B;  1XMO O;  2ZKO A;  1BE3 H;  3K5O A;  1XMQ O;  4DYL A;  1YXB A;  5JH7 A;  2PYJ A;  2XAF A;  4IGG A;  2WLM A;  3AG2 C;  4LFB B;  1PD3 A;  2F4V O;  5LOV A;  4H33 A;  2JS3 A;  3OTO B;  3VQY A;  3O9O A;  3B4S A;  4GKJ B;  3FB8 C;  2N74 A;  4D7S A;  1FKA O;  5KHG A;  3WU2 Z;  4GX1 A;  3LUT B;  1WB7 A;  4JI7 O;  5IYZ A;  1BL8 A;  2ZIO A;  2NNU A;  4R7C A;  1K97 A;  1MMM A;  4X88 A;  4X1Y A;  3H1J H;  1NS1 A;  1H2N A;  1B04 A;  3ABM B;  2RCV A;  4OGQ B;  5LP6 B;  3ZRX A;  1DGS A;  2UUC O;  3FB7 C;  4I0X B;  1OCR C;  5HFL A;  2EIM B;  2WLJ A;  4L8J A;  1H5W A;  2WLL B;  2OYQ A;  1K5S A;  1AP5 A;  2DE0 X;  1TUB A;  3K03 A;  2M7W A;  1YIJ V;  1NQT A;  3OMI B;  1YTF D;  4LR3 A;  2GHY A;  5DEC A;  3C3S A;  4JI4 B;  2AGA A;  4C7U A;  2Q68 A;  4X64 O;  3JAK A;  3AG2 B;  3CP1 A;  2IM9 A;  4I55 B;  1S5L Z;  1FXH A;  3CC4 V;  1XHZ A;  1HR0 B;  2EJ7 A;  2Y0I A;  3GWO A;  4K35 A;  2UUB O;  2IW5 A;  4P9O A;  4I50 B;  3EFF K;  3J80 N;  2AZ0 A;  1Y67 A;  1HNW B;  3MAQ A;  1NBM G;  2Q4P A;  3OUS A;  1I5Y A;  4WFH A;  3HKE B;  5BMV A;  4LF5 O;  5JCO C;  3APQ A;  2Q7H A;  1OCR B;  5J2T B;  2ZIM A;  4LH6 A;  4GKK B;  1OCZ C;  4LFA B;  3JAL A;  1JPX A;  3ZRW B;  1Q3E A;  2V7Q G;  4R8C A;  3L70 H;  1IVS A;  1L0N H;  2V4D A;  2ZDI A;  3CRR A;  1CP9 A;  4WFA V;  4YIO A;  4DW0 A;  5KLV H;  1M56 C;  4IIJ B;  4HBN A;  3RYC A;  3TXS A;  4IL6 Z;  4DV7 O;  3IAY A;  2VRZ A;  3HKD A;  3ZRV A;  5CB4 B;  3N2G A;  5EC1 C;  2XTA A;  3OTF A;  4FFB B;  1YJ9 V;  5EYP B;  1H2G A;  3IJ4 A;  3W7X A;  3PN1 A;  4F6E A;  4PD4 F;  4QIW F;  1N33 O;  2E75 B;  5CA0 A;  2QWQ B;  2UXB O;  1P7B A;  1QBZ A;  2QGN A;  1XNQ O;  1GM9 A;  1VQL V;  3ZMT A;  1YIT V;  2Q9L A;  2JEU A;  4EFB A;  1N32 B;  4DUY O;  2QM7 A;  4X20 A;  1Y76 B;  2D2C B;  2MK3 A;  1Z5W A;  3K9A A;  4MS2 A;  3RT3 C;  2VQE O;  2X6B A;  4NXM O;  3CRQ A;  4JI1 B;  3A0R A;  5KA5 A;  5KA6 A;  4IT5 A;  4GZR B;  3SJA C;  1LR1 A;  1VQK V;  2FTK A;  1M56 B;  4O4L B;  1NU1 H;  1I94 O;  4FZ0 A;  2UXD B;  4B3R O;  3ETE A;  2Z0A A;  4D6T H;  3DSQ A;  2L6L A;  3APO A;  1FD9 A;  2ADP A;  3MD0 A;  2F95 B;  2EJR A;  2FKX A;  3CEI A;  2EUL A;  2Q5Z A;  1X59 A;  5C8Y A;  2D3O W;  2DQ0 A;  5EZY B;  1U96 A;  1K34 A;  5LGU A;  3BA8 A;  3GVM A;  5AG2 A;  1QLN A;  1TUE B;  4LFB O;  5K1X A;  3DC6 A;  1DTO A;  4ZHQ B;  4GLX A;  4OX9 O;  4GKJ O;  1KP3 A;  3ZBH A;  3QO8 A;  2FL4 A;  3W7S A;  4QPJ A;  2ZR2 A;  3HKC B;  3CCU V;  4J7K A;  4KXR A;  5B1B C;  2H94 A;  1GN6 A;  3ZRS A;  1SS3 A;  4Q20 A;  3STZ C;  1Q90 D;  2HEP A;  3K59 A;  5LP6 A;  4YY3 B;  4I0X A;  4LH7 A;  4PA3 A;  2FYU H;  2WLL A;  2WAM A;  3D3Q A;  2YEV B;  2F43 G;  2UXC B;  2YUA A;  2EIJ C;  1QU7 A;  2XOK G;  2EX3 A;  1ZWI C;  4DV5 B;  4BWA A;  2PTM A;  3HKB B;  5EIB C;  4PI0 A;  1SF9 A;  2F1M A;  4JI4 O;  3JAR B;  1SZT A;  1OHH G;  4FFK A;  3CXH F;  2OIG A;  1XHX A;  4I55 A;  2KG7 B;  3BRC A;  3SJC C;  4JTC B;  4F4L A;  3CCV V;  3ZJZ A;  1HR0 O;  2QKA A;  2F93 B;  2OCH A;  1I0H A;  2XAG A;  3H9V A;  3ZED A;  5B1B B;  5ITZ B;  2QWN B;  4I50 A;  4U7O A;  1NT2 B;  1FOU A;  1RPO A;  1HNW O;  2HR3 A;  1W2B U;  1K9M W;  2CE4 A;  4HNA B;  2PF4 E;  3HKE A;  5D5P A;  5LMN B;  1HP8 A;  5FNV B;  2DWE C;  1VAR A;  5J2T A;  1RP3 B;  4AIL C;  4NTX A;  4J11 A;  4LF4 O;  3TJT A;  1F4M A;  3VBB A;  4MVO A;  3ZRW A;  4WFB V;  2WLK A;  3OMA B;  3TGU H;  3UM7 A;  5H9C A;  1IBK B;  1S76 D;  1M1K W;  4DV3 B;  1TVK B;  4JI0 O;  4IIJ A;  3RYI B;  3ZMS A;  3JAS B;  1JX9 A;  3TK1 A;  1J5E O;  2CTP A;  1AI7 A;  3K04 A;  4PHZ A;  5CB4 A;  1EM1 A;  4MVR A;  2HHH O;  4FFB A;  3SYA A;  4JV5 B;  1HNX B;  5EYP A;  4DXW A;  3ABU A;  5B1N A;  1WP7 A;  2XAQ A;  3RYH B;  3JAT B;  4CS4 A;  4DUZ B;  2P67 A;  1SC5 B;  3BAB A;  5B1A C;  4P2Z A;  5EBM C;  2P6J A;  1GN4 A;  1GM7 A;  4RUF A;  2IBZ H;  1Y76 A;  2BTQ B;  4CH4 A;  1L0L H;  2ZE7 A;  1AB3 A;  4RWU A;  3L71 H;  4Z1V A;  2AHY A;  1NZ6 A;  2IU3 A;  4JI1 O;  2BOC C;  4LWS B;  1QR9 A;  1KQS U;  4J42 A;  2K9P A;  2AHZ A;  1Q5O A;  4I9W A;  4X62 B;  4O4L A;  2Y69 C;  2QM4 A;  4UUJ C;  3F5T A;  4BIO A;  4JI5 B;  1GRJ A;  3FD9 A;  1VQO V;  2H8P C;  1U97 A;  4JYC A;  1AR5 A;  3JAK B;  2WSS G;  3OGI B;  2P4K A;  2WPD G;  2DYR C;  1N0J A;  2YIC A;  4HZ3 A;  4LF7 O;  4TQF A;  3CWB H;  5EZY A;  2XHB A;  4K8X A;  1KYO F;  3QF7 A;  3CCQ V;  1Q8I A;  5B1A B;  5FLX N;  5KHK A;  2H3O A;  3K9S A;  2PY5 A;  1BQ0 A;  4TWK A;  2DW4 A;  3STL C;  3ZN0 A;  2WLH A;  4ZHQ A;  4CH6 A;  3VQW A;  4DR6 B;  2E3C A;  2JIZ G;  2ZE5 A;  1ENV A;  4TSF G;  1Y6X A;  1PM9 A;  3O65 A;  1XL4 A;  4A5U B;  3HKC A;  4I5S A;  2LFR A;  1V54 C;  1NVP D;  2G38 A;  4EKW A;  4TOI A;  2X6C A;  3D36 C;  4RQE A;  2Y69 B;  2Z3Y A;  5LMU B;  4DR3 B;  1Z5V A;  4DR7 B;  2BCC H;  4PEL A;  3I56 V;  1P49 A;  3BHP A;  3HKD B;  1AJQ A;  2FML A;  4YHH O;  4B7K A;  1OCO B;  2YXH A;  2YEV A;  1JVM A;  2UXC O;  4BW5 A;  4LC1 A;  1KD1 W;  1XOU A;  3FB6 C;  3R65 A;  5E79 Z;  2PZS A;  2ZT9 B;  3HKB A;  4MVQ A;  1YJN V;  4NTY A;  4DV0 O;  1KKC A;  3JAR A;  4B3M B;  3JAM N;  4QE9 A;  1Q7Y W;  5BXZ A;  1IX9 A;  4N21 A;  4RO2 A;  1H8E G;  2Q0O C;  4X20 B;  2KG7 A;  1M93 A;  4GYC B;  4IHJ B;  4DRX B;  3AG3 C;  5IYB O;  1J95 A;  1G4Y B;  1NH2 D;  3W7W A;  1V54 B;  5ITZ A;  3WB1 A;  1YCI A;  2CGN A;  4I9Q A;  4JI3 B;  3ABL C;  3AK2 A;  2NN4 A;  5KAF Z;  4HNA A;  4FIP C;  4WBN B;  1NJI W;  5H2F Z;  4X65 O;  2LGW A;  3ZHQ A;  1GO3 F;  2OCC B;  3E86 A;  5FNV A;  1YI2 V;  2RJZ A;  5CBG A;  1JFF B;  3ABM C;  2R9I A;  4FLZ A;  1JA8 A;  2LP7 A;  3KG2 A;  3GWK C;  4H44 B;  4XDL A;  4GX5 A;  5L3E A;  4AQY B;  5BY1 A;  3CSX A;  1TVK A;  1LNQ A;  3BCC H;  1SER A;  1IUR A;  1HNZ B;  3JAS A;  3OAA G;  1MOF A;  5TIS Z;  5H6Q A;  1NTK H;  1GAX A;  4JGS A;  4WFF A;  4PV1 B;  1JQ0 A;  3CXC U;  1NR7 A;  4IYH A;  1P4R A;  1VQ5 V;  1VMG A;  5IWA B;  1R6K A;  1SQX H;  3G6E V;  4ZOL B;  1WLE A;  2E74 B;  3AG3 B;  3RYH A;  2UU9 B;  3JAT A;  4DV1 O;  3WB0 A;  3ZCC A;  4HAM A;  4DUZ O;  3B2E E;  1GK9 A;  2Q7G A;  3ABL B;  2BOB C;  2R9R B;  2PI5 A;  5J2U B;  4LP8 A;  1AR1 B;  5L3C A;  2QWR B;  5CBH A;  1SA0 B;  2JGD B;  4LF8 O;  2HLD G;  4JYA O;  3CC7 V;  2YXY A;  1M4U A;  1BZK A;  2BTQ A;  4I4T B;  3PJS K;  4E2L A;  2QA4 V;  2WA4 A;  3TXQ A;  4LWS A;  4BR6 A;  1EZV H;  4FM0 A;  2EIL C;  4B3S B;  1I7F A;  4KFM A;  1EFR G;  4UCV A;  2VQF B;  2KB1 A;  1VQM V;  4JI8 O;  4O4H B;  4JI5 O;  2LGQ A;  2VS0 A;  3U0Z A;  3KCX A;  3C3T A;  1MNG A;  3E8F A;  4GX2 A;  3K5N A;  2JJ1 G;  5B3S C;  3X2Q C;  3UKM A;  3BAA A;  2XAJ A;  2B9Z A;  4FVM A;  3E83 A;  1H2S B;  5IYD O;  1YDX A;  1R6T A;  2CTQ A;  2ZXW C;  2GUZ B;  4DV4 O;  4FLV A;  4WFE A;  1Y74 B;  1AI6 A;  3FAV B;  1E79 G;  1CXZ B;  3LSU A;  1Q6U A;  5EC2 C;  4DV2 O;  1AIL A;  1S5J A;  3AK1 A;  4FPP A;  1YVW A;  4NB5 A;  2YDE A;  2EIL B;  4KL1 A;  2Y4U A;  1N34 O;  3BA9 A;  1S77 D;  3K08 A;  5LMU O;  2JEX A;  3KZI Z; 
#chains in the Genus database with same CATH homology
 1AP5 A;  3RN4 A;  2QKC A;  1EN4 A;  1EN6 A;  1GN3 A;  1N0N A;  4JYY A;  3KKY A;  1GN4 A;  1XUQ A;  1EN5 A;  1AVM A;  1XRE A;  2CDY A;  1XIL A;  3C3S A;  3BFR A;  1ZLZ A;  1P7G A;  1BSM A;  1AR4 A;  1XDC A;  4YIP A;  4C7U A;  4JZ2 A;  1KKC A;  4FFK A;  1LUW A;  4BR6 A;  1SZX A;  1I08 A;  1BS3 A;  1AP6 A;  1BT8 A;  1IX9 A;  1ZSP A;  3AK3 A;  4E4E A;  3IC9 A;  2QKA A;  1ZUQ A;  1I0H A;  1QNM A;  3MDS A;  2ADP A;  1Y67 A;  1GN2 A;  1AR5 A;  3CEI A;  4JZG A;  3C3T A;  2P4K A;  2AW9 A;  2CE4 A;  3AK2 A;  1N0J A;  3DC5 A;  1MA1 A;  1MNG A;  1VAR A;  1PL4 A;  5AG2 A;  3TJT A;  1IDS A;  3K9S A;  1MSD A;  1JA8 A;  2GDS A;  4YIO A;  3DC6 A;  1ZTE A;  2ADQ B;  3LSU A;  1WB8 A;  4GUN A;  1JR9 A;  1PM9 A;  1VEW A;  1WB7 A;  3AK1 A;  1EM1 A;  1GN6 A;  1MMM A;  4F6E A;  1D5N A;  3EVK A;  3OT7 A;  1IXB A;  2RCV A;  4X9Q A;  3KDR A;  5A9G A;  3QVN A;  1B06 A;  1LUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...