1JA9A

Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
b'SKPLAGKVALTTGAGRGIGRGIAIELGRRGASVVVNYGSSSKAAEEVVAELKKLGAQGVAIQADISKPSEVVALFDKAVSHFGGLDFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGGRIILTSSIAAVMTGIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAPGGYKGMPQEKIDEGLANMNPLKRIGYPADIGRAVSALCQEESEWINGQVIKLTGGGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,6,8-tetrahydroxynaphthalene reductase
molecule tags Oxidoreductase
source organism Magnaporthe grisea
publication title A structural account of substrate and inhibitor specificity differences between two naphthol reductases.
pubmed doi rcsb
total genus 100
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ja9A00
3NT4A 3H9QA 1PTJA 2RAFA 3ON5A 3KUXA 2EJWA 1DFIA 2ZJ1A 4UEJA 3NGXA 4J49A 2EF1A 1WXDA 4FPXA 1H6BA 3WGGA 4GMGA 1PJ2A 3WS7A 5JYEA 2V6GA 2PGDA 1PJBA 4WCDA 4BNFA 5IJZA 3AW9A 1DIRA 1I8TA 4YJGA 2W2KB 1V3VA 3K2EA 1ULSA 2FP4A 2IODA 2JFHA 4ALIA 5CDGA 4CV3A 3LZ6A 4HFRA 1WAMA 4UULA 3TDKA 5JY1A 5BSHA 5IDXA 1YBVA 1IPEA 4J4TA 3SJUA 1GY8A 3WX0A 5L3ZA 1R4NB 1YS4A 4NR0A 4XQCA 1IOLA 5IDYA 3ZH2A 3PLRA 4Y8VA 1U1IA 4MVJD 2EJVA 5TSDA 3L6OO 4R4JA 3GG2A 3MTGA 4E3ZA 1Q1NA 4NJMB 3RJ5A 1U7HA 5JNLA 1HF3A 2ET6A 1PGJA 2X86A 3M6IA 1GCOA 4J9UE 2YHUA 3PYMA 1KVQA 2VYVA 3MZ0A 5JS6A 2JD1A 2UVDA 2NU7A 2C2YA 4FGSA 1SEVA 4MVJG 4YCAA 2V7PA 3VDQA 2AQHA 2OBYA 3VTFA 3QVSA 2J6IA 4NHEA 1GEGA 3OA0A 1GADO 4HFNA 5TGDA 1I0ZA 4FDAA 3PHHA 3HZZA 5CEFA 1HLPA 1C14A 4I08A 5DF1A 2Y05A 3TQHA 1WZIA 4RDHA 3H3FA 2G0TA 3HWRA 4BNJA 4ALKA 4QT0A 3IS3A 2X5KO 3AFMA 3C85A 2NM0A 3ZCXA 1JWAB 2FSVA 4M86A 2ZQZA 1H94A 4HNGA 1U9JA 2PK3A 4G65A 4OSOA 3JQBA 4QTZA 4NZ9A 1KEPA 1WDLA 3AI3A 4II3A 2Z1NA 1P1IA 4FCCA 4XD2A 3K31A 4URFA 1KETA 1AHIA 3FR7A 3NT5A 4FFPA 3PJDA 4IY1A 1ONOA 3UF0A 5TLSA 3UOGA 1QSGA 1J49A 3A1NA 4TSKA 3A14A 2V6MA 2HO5A 4TKLA 3JV7A 2EGHA 3WICA 3TPCA 3WDSA 1SEPA 5JDCA 2BGKA 2Q1SA 3KVOA 2QYSA 5G4KA 2Y66A 2X22A 1MXFA 3R1IA 1AN9A 2EP7A 4OMUA 1YKFA 3E6AA 1TVEA 1X7DA 3DHNA 4E0BA 3PWZA 1HDXA 3DOOA 5A5EA 1DFHA 3L4BA 4XIJA 1EFKA 1QRRA 1UP6A 2NSDA 3H8VA 2SCUA 2X23A 1A72A 3O03A 4QECA 5JCJA 3W8FA 4BQPA 1A4UA 1T2DA 4JJFA 3JQFC 1PGPA 2WMDA 1VJ1A 2FR8A 4DPKA 5I7FA 4OH1A 3E5MA 1S7CA 4EJ0A 4MVJE 4IZHA 3AUUA 3WYEA 4J4BA 4XZ3A 4FB5A 4CQMB 4K6CA 2C82A 1E7RA 3QV1A 3UHAA 4A73A 3S2GA 4YT8A 4BB5A 3GK3A 1UP4A 1NHWA 1HSOA 4ZQHA 4F46A 3DHEA 3JYPA 4Q3BA 1G0NA 5CHEA 4Q3AA 3DMYA 1VKNA 4BNWA 3I4FA 1MX3A 5CPFA 2O3UA 1IPFA 2OFPA 3VVBA 4LRTB 4IDFA 1YBMA 3OM9A 4CV2A 3X2FA 1QYVA 1Q7GA 2ILTA 3O38A 3E1KA 1MV8A 3RUHA 2X9NA 2JHFA 3WWYA 4L4SA 1Q0QA 4P4GA 5I9NA 3E9NA 1J4AA 1CETA 1ZO8A 4RF5A 2B35A 2Y1EA 3MOGA 1H0KA 3MCVA 2VT2A 3GLQA 4KTVE 1K89A 5ITWA 1H2BA 1NP3A 3I9OA 4L0QA 5JLAA 1ZNQO 2J3KA 3SLGA 1ZK0A 1X7GA 1CEQA 3KM0A 3QA9A 3VOSA 1DBVO 3PEFA 4XJTA 5DCUA 3LT0A 4ZD6A 4A03A 1ZSVA 3ORFA 3IKTA 2I67A 4R54A 1LI4A 4AJ1A 4WK6A 1PGOA 2IEBA 3IAHA 4RDIA 4WKGA 2HRBA 4IJVA 1EZ4A 2J3JA 3WQRA 5G0SA 1NAHA 4OOFA 1K6JA 3L4BC 4EZBA 4KP7A 4ALJA 1A4IA 4DTIA 3FBTA 1E3JA 2NNLD 1OOEA 4JX8A 3LSYA 2O3RA 1E1NA 1GYPA 2X9GA 5TIIA 2I3GA 4QXMA 2Z95A 2FSSA 5AYVA 3ZDFA 3VZQA 4BNZA 4CQLB 3EVNA 1IE3A 1YRLA 3ENKA 3G49A 4XR9A 3H7AA 4IQGA 1MG0A 4M54A 3GVXA 3WNQA 3DDNA 1O89A 5GZ1A 1YWGO 1YOVB 3ZNPA 1BTOA 3MWDB 2EEZA 3H3JA 4DIFA 3ADPA 4GAEA 2HMUA 4IDDA 3W4IA 1PJLA 1FDTA 1YQDA 4W7HA 2X58A 1E92A 1VI2A 2E82A 2HRZA 4RZHA 1N1GA 3JQAD 5J23A 2NU8A 1E3LA 3K96A 3WGTA 1NX6A 5COQA 3KYCB 3D7LA 2JHGA 1B26A 3LC7O 1T26A 1XG5A 3DTTA 5F1OA 1BDMA 1IZ9A 1NXQA 3WOHA 3Q11A 4XDYA 1GUZA 3UH1A 1U3UA 4YJDA 4OKIA 3CIFA 4D46A 5BQFA 3RFVA 4PVCA 1WPQA 2P5YA 4OJNA 1UR5A 1V35A 2ZIZA 1ULUA 5T67A 1KOLA 2NQTA 2O3SA 2D1YA 2JD0A 1W8DA 4BVAA 3GA0A 1YE3A 5EJ2A 1C0IA 2X6TA 1U28A 2X0RA 4XYBA 4RVDA 1SBYA 3CZRA 3WNVA 3K73O 2BHLA 1ZZEA 2PA3A 4R1SA 4QX6A 4E21A 3AUAA 2AQKA 4BO5A 2IE0A 4HBGA 1DFGA 2DM6A 2P9CA 3HUDA 1CJCA 1LUAA 5H81A 5DBGA 1LRKA 3FPLA 4R3NA 4JP3A 2ZYAA 4NBTA 3LF1A 4BKQA 3DO5A 4TRRA 1CRWG 1SZJG 1ZMTA 3IMFA 4LVCA 1NFQA 2TMGA 1EBFA 1YL6A 2E48A 1I3KA 5IDWA 3S55A 3BHMA 1DC3A 2IXAA 2OORA 1P44A 3ZGYA 4OQYA 3AI2A 4J0EA 3GGGA 1E1LA 1ADBA 4CV1A 3SX2A 1QLJA 3W4KA 3RBVA 3GY0A 1YBAA 4ZU3A 3TWOA 1VE9A 2VHYA 5JCJD 4YDRA 4WNIA 1XIVA 4YTEA 2A92A 1XDWA 1MP0A 3O8QA 4TZKA 4WPGA 1HDCA 2R00C 2D2IA 4RVFA 3JD1A 1Y9AA 3LVFO 4C4OA 3HDQA 4MVJP 5ES3A 5C7LO 3KTDA 4CQMD 4DMMA 2IXBA 3TZCA 4RORA 1V0JA 4WEQA 3I83A 1HRDA 1M6WA 5AVOA 4GX0A 1NWHA 2B83A 1P33A 1WMBA 3P19A 5K6AC 3RC9A 5T8KC 2XPCA 4JBIA 1BMDA 1PL7A 4TVBA 1HT0A 2VHVA 2ZJ0A 4XR4A 3VVCA 2VTDA 3K30A 3M2PA 5JC8A 2AQ8A 2VOJA 1UXJA 3GVHA 1YB4A 1YONA 4B7CA 2HKIA 1XEAA 4FD3A 4QQRA 4AJKA 5JFOA 1ID1A 4Q3EA 2NVBA 1U8FO 4EEZA 2WJPA 1Y9EA 5IDQA 4CUZA 3B1KA 3CUKA 3AFNA 4N5LA 4E32A 1N9GB 1EMDA 4KWHA 1IB6A 1PQUA 5GY7A 4AVYA 1H9AA 2V65A 4B4VA 3C24A 3RKRA 1BWSA 3PRJA 1WDKA 5T6BA 5HBRA 4BMVA 3QW2A 9LDBA 5EQFA 2YY7A 2O3QA 4XYLA 3KLPX 1DDOA 1A71A 3CH6A 1NYTA 4YT2A 3JSAA 4WCFC 4GVXA 3KHUA 1Z7BA 2VUSA 1BVRA 5AXDA 4A27A 4D79A 1L1FA 4LN1A 4MIEA 4PCVA 4MKRA 4FJ2A 3TZ6A 1P1JA 3H4VA 4BO8A 3ASUA 4CUKA 5ENDA 4J1QA 1I3LA 3AU9A 3WJ7A 1GPDG 3AM5A 1W4ZA 1ZXBA 1FDWA 4JJIA 4GVLA 4ILKA 1CWUA 2VZ0A 1MB4A 2H9IA 2PZLA 3O26A 3PPIA 3QY9A 2POQX 3ZNNA 1ZJYA 1N2SA 2GD1O 2IRWA 5DP1A 4G5HA 4HADA 1KVTA 4O6VA 2AXQA 2FOIA 2Q4EA 3EK2A 2GZ3A 4K26A 4MP6A 2FR0A 2DUWA 1Y7TA 3QRWA 4GSKA 1ZBQA 5CEEA 2EKQA 5B4UA 1NFFA 1I10A 3OFSA 1X7HA 4W9NA 1JVSA 4NBWA 4H3VA 5JAMA 1DXYA 5CDYA 1LSOA 1MLDA 1T2EA 3GPIA 1TLTA 2I3AA 1HSZA 3O4RA 3DZHA 4BGVA 4ND5A 3NKLA 1DLJA 2QQ5A 2YHIA 5ER9A 5F5NA 4FR5A 3T7EA 1D4FA 4RPHA 2QHXA 3U4HA 2OGUA 4R9RA 1XA0A 1C3VA 3D0OA 2O7QA 4RQUA 3NV9A 1SAYA 5JY6A 3HE3A 5MDHA 1AUPA 5ADHA 3WXBA 3ITDA 4CL3A 1QYCA 3JYOA 1P9LA 3EVTA 5I8ZA 1S6YA 4H16A 1WZEA 3RJ9A 4L9RA 5KIAA 1GTMA 1F0YA 4BO2A 3W1VA 2OO5A 4BNGA 4UUPA 3VZSA 1A5ZA 1EVIA 3DBHB 2WE7A 3LU1A 3LF2A 1RYEA 3ZHYA 2FPIA 1PZHA 1YOVA 3KYBA 4DC1A 1IULA 1T1SA 4MKXA 3KRTA 5CFZA 3GQVA 3G79A 3A06A 8LDHA 5G2OA 4HFMA 1HWYA 3N58A 3V1TC 1E5LA 2BD0A 3EYWA 2PV7A 2VNSA 1XHLA 3OEYA 4IDGA 4Z9XA 3U4IA 3RSHA 2XXJA 3OEWA 4TROA 3QIVA 1KYQA 3ZHXA 2GN8A 5DN9A 4QO8A 3CZMA 1HE2A 2Y1OA 1MFZA 4CM9D 5BSEA 3HB5X 4Z9YA 5DULA 1LLQA 3F4BA 2VZ9A 1U2GA 2AEFA 1U2DA 3PXXA 3FWNA 4HP8A 4ZRNA 2WYWA 1EE2A 2EW2A 2Y68A 2QG4A 4Z3DA 3SBOA 4EW6A 4J1SA 5BNTA 3F3SA 1ORRA 1Q7CA 5KNLA 4XA8A 4IJWA 3GVIA 3PZRA 4TRJA 3KO8A 3BXXA 4UVHA 4Z9FA 2PLAA 1ZKMA 3ZWNA 4WEOA 1LTHR 1LQUA 3BHIA 4IM7A 5JW6A 1J6UA 1VLLA 1R4MA 3RUDA 4J2HA 5HM8A 4ALNA 1A7AA 3JQGB 2OUIA 2VCYA 2C59A 2D5AA 1B8PA 4I5FA 3PGXA 3D4PA 5EESA 2RBEA 4CM1A 1G1AA 1ONPA 4CMKA 4FJ0A 1VKOA 4CODB 5KCZA 1XU7A 3ZWXA 5THQA 3ANLA 4M89A 4N54A 2R2GA 4JIGA 4R5HA 5COBA 3VPHA 4N5MA 5EERA 5IZCC 3AI1A 4NDNE 3A4VA 1TEHA 3PJFA 1ML3A 4UUOA 1ZK2A 3JQ9C 5U9CA 4L4XA 5ILOA 4CMBA 1R15A 5JDIC 4TMFA 5GMOA 3NAQA 5B1YA 1Z75A 4NNJA 2C54A 4CMEA 3PDUA 5ITVA 3EHEA 3JTMA 3MJ4A 1WMAA 1Y8QB 2PY6A 1EBUA 5U1PA 9LDTA 4PZCA 4YWJA 4Z3KA 3DAFA 4BO4A 4WLVA 1OC4A 3F5QA 3JQ8B 4HV4A 4YRDA 5ILGA 1V3TA 1YL5A 3OMLA 1E6WA 5IG2A 4EGFA 1XGKA 3H2ZA 1ONNA 3WGOA 3DC2A 3FBGA 3AWDA 1OZAA 2J5KA 2UV8A 1H9BA 1HDZA 1NTOA 3QVTA 3AOGA 2WDZA 2B5VA 2FPPA 5LCXA 3QWBA 1R12A 2EKPA 3U9LA 2I5PO 3WQSB 2W2LD 5ICMA 4RV9A 3IP3A 4PLTA 4QFDA 4YT4A 4LGVA 2ZTLA 4PG6A 1ZCJA 1CIVA 1NFRA 5HWSA 5DCWA 1LNQA 2GUGA 3GZNB 1PQPA 4FSHA 2Y1FA 2P2SA 2DPHA 2GN9A 3GNTA 3ZWOA 3ZHBA 2YHIB 4GL4A 1GL3A 3H5AA 3HG7A 3OBBA 4EITA 1PJ4A 1ZXLA 4D43A 4FIZA 3KLMX 3HFGA 2YW9A 2GNAA 1BVUA 2AW5A 1C0KA 3KSDO 3LYLA 4YQZA 4E5NA 5LDGA 4LMRA 3UUWA 4IDEA 5GZ6A 4BNVA 4PLWA 1D3AA 4MDHA 1UDCA 2XF8A 4DLBA 5B4TA 3I9JA 1QORA 3GZNA 3MEQA 1UJMA 1BXKA 4GX2A 2CF6A 1ADFA 3OJ0A 5LC1A 2TMDA 4HKTA 3TZHA 3JD0A 4C7JA 3GUYA 1R0SA 4A10A 4GLOA 3UFXA 1VSUA 3CMMA 5A1TA 4R01A 5KJEA 2VRCD 4CLRA 3ZI0A 2WE8A 2UDPA 3TSCA 4E2XA 1NVMB 1RM5A 1XR3A 4FW8A 4BNKA 2I9PA 3PHGA 4AJLA 5JAZA 5H83A 4PFJA 4FGWA 3FD8A 2UUPA 5DBIA 4B8WA 3KSZO 4JBHA 2E37A 2X5JO 1H5QA 4XWYA 2GCGA 1YJ8A 2HQ1A 3JQ8A 3UXYA 3HN2A 3WGZA 1TA4A 3JYNA 2YDXA 5CDUA 3X2EA 1Y8QA 3QWFA 2GF2A 4OKNA 1DC5A 1EK5A 1VSVA 2HCTA 2V6FA 1QG6A 2CVQA 1V3UA 3DR3A 3GFBA 3U4CA 5L9AA 3OF2A 4UEOA 2W2KA 4WLEA 1D1SA 4BUCA 1DPGA 2W4QA 4D0RA 4EUHA 3U09A 1BSVA 2HAEA 4Q3NA 3L77A 3JQ7B 3GRPA 2Q2WA 1HEUA 1LXCA 1PEDA 3TFOA 5JXWA 4NU5A 2V6BA 1MG5A 5CPBA 3V2UA 2NU9A 3D1LA 5KJ1A 1PSDA 2VNAA 3LK7A 1K2WA 4YXFA 3ZV5A 4PZEA 4DRYA 3VC7A 4W7IA 3RUAA 3DL2A 2PZJA 3JQGA 2O2SA 3RU7A 5JO0A 1ARZA 1HDOA 4R16A 4BNLA 5FI5A 1I5RA 1P1KA 3NT2A 3R0IA 3FTPA 4XJSA 5T8KA 4W4TA 5T64A 4YQYA 1NASA 2D5CA 1JN0A 2WD8A 1ZK3A 3F6YA 4D3DA 3RUCA 3WJAA 3PHLA 1A9ZA 4YJHB 3ETEA 5TJHA 1ZW1A 1LQTA 2VWQA 1CDOA 2JKVA 4OSPA 2PKQO 1B3BA 3NJ8A 4BNUA 5F1PA 2A94A 3OECA 4RVUA 5IN5A 4BV8A 2YV1A 1X0XA 4ND2A 4XQGA 2CDCA 4EJ6A 4GLLA 3AJRA 4BO3A 2WM3A 2IYPA 4NU6A 3D4OA 4M49A 2EG9A 4D45A 3WTBA 4CM8A 4XQ9A 1AE1A 1GQ2A 2HJRA 3D4NA 3JCZA 5KVQA 1VPDA 5L51A 3RCBA 1UH5A 4DUPA 1SOWA 2BGMA 1BW9B 4R51A 1UZLA 1NPDA 1ZVMA 4BB6A 3K9QO 1ISFA 1XYGA 1HZJA 3DZJA 3AM3A 1O0SA 4BMNA 4LK3A 3VDRA 5EINA 1L7DA 4FS3A 1QYXA 4KDFA 3ICCA 4PG4A 3K6JA 3ZWWA 5B4VA 3OIDA 1SOVA 4DLLA 3WIDA 2A4KA 3S8MA 3MWEB 2EKLA 3AY6A 2PNFA 4CLRB 1MFPA 4BO7A 4W82A 3DBHA 1EFLA 3I23A 4Z6KA 1UP7A 2GPTA 1RPNA 4PG8A 1MUUA 5DCYA 3CXRA 4R9SA 3D5TA 3W6UA 1LDGA 2VWPA 3C1TA 3WFIA 3IOYA 1C0LA 2YJZA 3GDGA 4RLHA 3PJGA 1MC5A 5DNAA 3KYDB 3TOXA 1T4DA 5JSFA 3I9MA 4ZQGA 3DZFA 4UREA 3OH8A 4O0LA 1YDEA 2P68A 4NBUA 3QSGA 2NADA 4INAA 2QX7A 3ZU3A 1UXKA 4ZN6A 5JE8A 4CR7A 1DJQA 4RO0A 3QVOA 4CJXA 4CR6A 3FNHA 3RU9A 4D7AA 3JQ6A 3ASVA 3PGJA 2C5AA 3Q9UA 4QEDA 3U5TA 2ZQYA 4GMFA 3C8MA 4AJOA 1Z74A 4RQTA 4J2OA 4NFYA 4E5PA 2AHRA 4AJPA 3QJ5A 1NNUA 1O5IA 1FJHA 2JCXA 1F8GA 1RWBA 1JTVA 4BHTA 3GH3A 3CEAA 1I33A 5DDIP 2G5CA 3GFGA 3AM4A 3IJPA 1VJTA 5EL0A 1UXIA 1HDRA 4YYZA 4ZVVA 5AXBA 1N5DA 5C37A 4B79A 2GO1A 1F17A 5A9SA 4B4OA 4WLFA 1FXSA 4I5DA 2NVWA 2UUOA 2VWGA 4A26A 5ENVA 3EW7A 2FHSA 1EEHA 4PZDA 4UVGA 4CMJA 4ZGWA 1ZUD1 3PI7A 4OXYA 3WB9A 4UVEA 5BNIA 1AHHA 3DMTA 1FMCA 5L4NA 3OJLA 4PGFA 4IDCA 2RH8A 1ZSYA 4I9NA 4MVJI 4BKOA 5A4DA 4F3YA 3GGPA 1RM4A 4B3IA 1TT5A 2WSBA 3FN4A 3IL2A 1J0XO 5DOVA 4OL9A 4GX5A 2W2LA 3WG9A 4DQUA 5KJCA 5KKAA 1LLUA 3INRA 4AJIA 1QXSA 3SC4A 2A35A 2QRKA 1EVJA 3ZV6A 3R3JA 3F1LA 2WYUA 5DBFA 3VPSA 2IZZA 1U3TA 4GI2A 5AQ1A 1LDYA 1T1RA 4IJKA 4PLGA 3IUPA 1CYDA 4Q3CA 1U3WA 2O2YA 3NEPX 5CEJA 3RUEA 5DOZA 3WR5A 2O4CA 3OP4A 4IBOA 1YQGA 4WLNA 4WUVA 5TF4A 1DIBA 1GAEO 1KVSA 4A7PA 3FWZA 2J5QA 2HDHA 4MO2A 1QP8A 4GBJA 1PQWA 3S1LA 2GLXA 1IHYA 4WOJA 3VH2A 1K5HA 3HDYA 4DPLA 1ZH8A 2I76A 1E5QA 3R3SA 2G76A 2R00A 3UN1A 2AG5A 2OP1A 1X15A 1LSSA 1XQ6A 3ZWBA 3PIDA 4FQ8A 4LVUA 1Q0LA 3VPXA 1KY4A 1W0CA 5AXCA 1KIFA 1U5AA 4ZQEA 1O8CA 1HYHA 3BMQA 4KUGA 5A3VA 4J9VA 1XU9A 3GN1A 2CVOA 4U5QA 3DEYX 3ZU5A 2D4AA 2GERA 1E7MA 4I8XA 5T5QA 3Q2IA 4FFRA 4NK5A 1CQIA 5IZCA 3LLVA 1OI7A 4ZQFA 1E6UA 1J5PA 2PZKA 2G17A 2RCYA 5LDHA 1WWKA 2UAGA 1DC6A 3SXPA 1LU9A 5ICSA 5KTKA 3U49A 4ZRMA 1LRJA 1LX6A 3WBBA 4BNTA 2HJSA 3DZKA 3M1LA 1N8KA 4FC6A 6ADHA 5JDIA 3CSDA 1EDOA 4MPDA 1KEWA 1E3SA 4XGNA 4JBGA 2C29D 1DOHA 1YQXA 2FZEA 3G1TA 4D42A 4DIBA 1P0FA 2PKQP 2ZYGA 4PLYA 1PL8A 2EIHA 3E82A 5A03A 1HE4A 2YV2A 4S3MA 4R1TA 3TN7A 2Q46A 3GNSA 1K6XA 4XDZA 2X0NA 4CM9A 3COSA 2BH9A 3GUCA 1PWZA 1U8XX 3RQSA 5IXSA 4CMIA 2Z1MA 4R68A 1GV1A 3LQFA 4RPGA 1SPXA 1P31A 1ADGA 3ONDA 4B4UA 4FOSA 3HDHA 3P2YA 1T2AA 1GCUA 2NUAA 1P77A 3GEDA 2NTJA 3H9UA 4RPKA 1DAPA 1B14A 1M66A 2J5RA 4NFHA 3RAJA 4F45A 4B3JA 2O3JA 3QVXA 4BKPA 2B5WA 2G1UA 2HSDA 3OHSX 1OMOA 1U4OA 4YAEA 2C07A 3RROA 3W8EA 4BO6A 4TRNA 3QWAA 1P45A 4FFLA 5CG2A 5K6AA 2RIRA 1X13A 4YRAA 4O5OA 1VJ0A 3KYCA 2VYNA 1LSJA 3BMNA 4HUJA 3OSUA 3KYDA 1E0DA 4E30A 1HDGO 3SJ7A 3GGOA 2Y67A 4OYRA 3UGKA 5KKCA 4FFOA 4E12A 1P1FA 1B8UA 1DIHA 2F1KA 4K6FA 1HL3A 4YT5A 3ZZNA 4ZICA 3G1UA 3H65A 1WLYA 1SCUA 4M8SA 2JAPA 4J91A 3S2IA 2D59A 2D0IA 4G2NA 4MP3A 4Y6RA 2I6TA 3RI3A 4GWKA 1C1DA 4BOYA 3EMKA 4KUEA 4AG3A 4NJOA 2CNBA 3TL2A 4TKMA 4IXWA 5EIOA 1VL8A 4GKBA 1JDJA 3UVEA 3PTZA 2VZ8A 4KMSA 4MIOA 4ZHSA 1QKIA 1TB4A 2ZB8A 3N74A 4AJJA 3DBLA 5HS4A 5ER6A 5JBIA 1DC4A 3EY4A 4BKRA 1BW9A 5BSFA 5CAEA 1E1MA 4UUMA 1Z82A 1LRLA 5I8WA 2DBQA 2C7VA 3K92A 3PIIA 1B3RA 3I4CA 3JQDA 3BMQB 2AQIA 4N7RA 4JLWA 4PLCA 1I3MA 2VUUA 2QW8A 2VYND 3F9IA 4ZJUA 2Y1CA 3ROKA 4PLVA 4CMGA 1EDZA 2AE1A 4ONEA 2BFMA 1HZZA 2O48X 3RC1A 1Y5RA 1T2CA 3VTZA 2CF5A 3ONEA 1Y1PA 1DIAA 3PLNA 4KWIA 3ZNOA 1KVUA 1DSSG 1FF9A 5EQDA 1NM5A 4PG7A 4GX1A 2CVZA 4YJHA 4NFSA 3FI9A 3WGIA 3NGLA 3GAFA 1U3VA 4L74A 1PWXA 2Y0DA 1LDMA 5TT1A 3A9WA 2HMTA 1GDHA 3NYWA 4FJ1A 8ADHA 3DOCA 1OBFO 2OHXA 2UYYA 1UZMA 4AJ4A 1W6UA 1PJTA 2LDXA 4CLOB 4XEHA 1K6IA 1M75A 2YV3A 2EHDA 3BMCA 4H15A 4NI5A 4OQZA 3EDMA 5KJ6A 1F06A 2AA3A 2BFPA 2CY0A 3HJAA 5TQVA 2CZCA 4CLDA 5IFLA 4PRKA 2DKNA 2VHWA 1XWFA 2EXXA 3PP8A 2QYTA 2ZK7A 1GR0A 1QMGA 2HUNA 2AMFA 2J3HA 3E8XA 2WYVA 1H2HA 3IC5A 2GASA 3Q6IA 3IKVA 3H9JA 2H5LA 4E2WA 3JQAA 3BIOA 1DRWA 2ZTVA 3UKOA 1PZEA 1XCBA 1MGOA 3F46A 4BL5A 4G81A 4HFJA 4MINA 1PR9A 3PFWO 4TWRA 5C3MA 3RFTA 3VKUA 3DONA 3DMTC 1YL7A 3K2BA 4E2YA 2IEDA 2WTBA 4BGUA 5FI3A 1HKUA 2DU8A 2OP0A 4YBZA 3BTVA 5I7SA 1VC2A 2AEMA 1OFGA 5BR7A 2PGJA 4DBVO 1NR7A 1A7KA 2JD2A 5G4KB 2B36A 1DHRA 2FRDA 4J6FA 3AK4A 4KOAA 4MVJH 5EPOA 2CSUA 1PJQA 4Q9NA 4XRRA 3I52A 3TF5A 4R1NA 3AOEC 5L45A 1V8BA 4Y6SA 1E77A 3PQFA 3TJRA 1KC3A 5A06A 3IDSA 3DWFA 3WMWA 2QZZA 2ZTUA 2D3TA 5MGBA 1JKIA 2Q4BA 3K8ZA 4IZIA 3WWZA 2AE2A 4IQ0A 1UUFA 3HSKA 2PZMA 4GSLA 3KSUA 3IP1A 4DPMA 5IN4A 2H6EA 1H93A 4NIMA 4U8GA 1NAIA 4MVJM 4OHUA 2IDZA 1B16A 3JQFA 2FR1A 4JGBA 1LC3A 1M6HA 1ZJZA 4BNMA 3S2EA 4U6SA 4Q39A 1FDUA 3GEMA 3ULKA 4AJEA 1G6KA 1GEEA 2AEJA 1UDAA 3H9EO 4CM7A 3FF4A 5BT9A 1JWBB 4QO7A 4LSWA 1FK8A 3FRJA 4XIYA 1KBZA 4D3SA 3B1FA 1MXHA 4YEDA 1PJCA 2GR9A 2W98A 2CD9A 4Q3DA 3KEQA 3VH3A 4NPCA 3L6DA 3DFZA 3EC7A 4KTTE 4WLUA 3GMDA 4UVDA 1DHTA 2RHRA 4RF4A 4BMSA 3ETDA 4E2ZA 3B1JA 2FY8A 2WD7A 1VL0A 5EMHA 4EJMA 1NR1A 4HX5A 4A2CA 4W6ZA 5HTOA 2A9FA 2CDBA 4O63O 3VH4A 1R0LA 2HLPA 2WD7B 4ALLA 2QZ9A 4L76A 3QWHA 4RPJA 4YA6A 4Y6PA 5JDCC 3ZWAA 4B7XA 1IZ0A 4XB2A 4NJMA 2XXBA 3M1AA 3SLKA 3U3XA 3JD2A 4NQZA 2HMWA 1X1EA 1R4NA 1RYDA 2IZ1A 1Q0HA 3I6IA 1F14A 3INGA 4P4LA 3Q3CA 1DRUA 5A9TA 1I36A 3STHA 3TZKA 2ZATA 1SO8A 3LLSA 3W4JA 7ADHA 3ETGA 1LC0A 4WOKA 4CM8B 1BGVA 1JAXA 4WCFA 1UDBA 2DC1A 4D44A 4Z0PA 1B15A 4YVFA 2HMVA 3HNPA 4PLHA 2PKRA 3ZV3A 1TXGA 3B20A 3V2HA 3GMSA 4NMHA 4NG5A 1SC6A 1BHSA 1R66A 1Q7BA 5COAA 2OXIA 3WSVA 4ESOA 4MIYA 1GYQA 4LSMA 4B3HA 3OJOA 3I9LA 4A0SA 1C1XA 3SVTA 3LT4A 4P4NA 1YH3A 3AOEA 1HE5A 4JJGA 4DA9A 2HMSA 1R0KA 2VWHA 2X0JA 3OQBA 5JC1A 3EZYA 4Y98A 2DQ4A 2W8ZA 4ITUA 2LDBA 1JU9A 3PDJA 2DFDA 4E4YA 3FNGA 3GN2A 1ZEMA 3EAGA 3IIEA 5IF3A 1N1EA 2DVMA 3C3XA 3HADA 4W99A 5HA5A 4PLPA 1BRMA 1XELA 3G3EA 3SEFA 5HS6A 3VPFA 2Q3EA 1PIWA 3MJCA 1Y8RB 4J90A 5G4LA 1EUDA 6LDHA 2BFAA 4E5MA 3JQ7A 4X54A 2FZWA 2CFCA 4ZQBA 2B4QA 4RJTA 1I01A 1JQBA 3U0BA 1NQ5A 1CQJA 1F12A 5JAQA 3T4XA 3L9WA 3V8BA 4J7CA 3VAZA 1MC4A 1QR6A 1OAAA 4ND1A 3DB2A 4RL6A 5TNXA 2DBZA 2PR2A 3PQEA 4QFCA 2VQ3A 4CM5A 3FHLA 4XX0A 3RD5A 5CP8A 1N7GA 1X1TA 1YGYA 3R6DA 2I66A 3HHPA 3ZHZA 1PS0A 1GFSA 3ANMA 3FCOA 4KZPA 4DC0A 5KOIA 1PU2A 4J43A 4YAIA 2HK7A 4DIOA 1SB8A 3LT1A 5CDSA 3D5QA 2BFOA 3UCFA 4GGOA 2B4RO 3BMCB 4YR9A 3H5RA 3KBOA 3F4LA 3PYXA 1LLDA 1ADCA 4OAQA 2X5OA 1H6CA 4OM8A 3KETA 4D3FA 4P8RA 4CMCA 2JFGA 1EVZA 5EN4A 4GGPA 4FC7A 3GC6A 1HE3A 3DZIA 4IJUA 4N18A 3JQEA 3LC1O 2Z5LA 1P74A 2YQ4A 3DAGA 3GPDG 1ZSNA 1YB1A 1P0CA 1YO6A 4CLXA 3PHJA 3MJSA 1NHGA 4RGBA 3ST7A 1GU7A 3C1OA 4BNYA 5U4QA 4U0KA 1QYDA 1QYWA 1HYGA 3VHRA 3FNFA 4B8ZA 4F6LA 2BLLA 4GKVA 1N7HA 3D3WB 5DP2A 3PHIA 3EGOA 4TZTA 3OQ6A 4YPOA 3NTQA 3CKYA 1NPTO 2JCVA 4DQXA 3MOIA 3E9QA 4FN4A 4WCFB 1ENZA 2NVUA 3DZGA 4UUNA 1T25A 2DTDA 1GZ6A 4PVDA 5IAAA 2ZKLA 1BXGA 5THKA 2Y99A 1P1RA 5A3JA 1ZMOA 3MJTA 1E1KA 3F47A 4BNXA 1XQ1A 4NH4A 4W9NC 4J0FA 1KC1A 2C5EA 1LDNA 1IYZA 3JD4A 3GHYA 5A04A 2Y1DA 2JL1A 3P7MA 4MOWA 3V1UA 4XYMA 4CV0A 3Q0EA 2BF7A 2HK9A 3L07A 1C1DB 1NQOA 2HK8A 2Q49A 3RC7A 1FDVA 2DTXA 1B2LA 1KEVA 1O6ZA 4XCVA 4MKZA 4PRLA 4JXKA 3CMCO 1EQUA 2O3TA 1IUKA 2BGLA 1PS8A 1HXHA 3T4EA 1GYRA 5A5FA 2GDZA 1Z73A 4M1QA 4YB8A 1PGQA 3FPCA 2DUUA 4JK3A 2O23A 4E5KA 3DOJA 1ENYA 3AU8A 1NPYA 3OICA 3ONFA 3ROQA 5FWNA 4CMEC 3GVCA 1Y6JA 3ZWVA 3RUFA 2C2XA 5DT9A 3Q1LA 3I5MA 2YUTA 1B8VA 1LEHA 1BG6A 2NTNA 2P5UA 3PFFA 4WNCA 1JVBA 4XB1A 3ENNA 2ZTMA 5KVCA 3I3OA 4UEKA 2B69A 5F3RA 4BIIA 4K28A 4J16A 4QSMA 3F1KA 2EV9A 2NV6A 4ROSA 5G0UA 3DAPA 1N9GA 1DO8A 4A5OA 5F5LA 5AOVA 5FEUA 4ID9A 1TT7A 2RH4A 4MVJA 3PVZA 4BO9A 1R4MB 1DEHA 3DXFA 3FNEA 3H5NA 2FMUA 3IUSA 1NVTA 3ANNA 3BMOB 1U4SA 4RF3A 3HQ4O 3W8DA 1JKFA 4IINA 4R1UA 5I9LA 4MVJF 5HRUA 1KEUA 3FSRA 1KY5A 3UW3A 2EW8A 4J1NA 4E6PA 3C7AA 1MA0A 1KERA 5BSGA 4F6CA 5L95A 1E7SA 1N92A 3MJVA 2DT5A 4DMLA 5JYDA 4DLAA 5FF9A 2OBNA 4YAJA 3O9ZA 3EUWA 3JQAB 5K9ZA 4LCEA 1K3TA 2PH5A 4XGIA 2ZB3A 2ZYDA 4IDBA 3SC6A 3I9KA 3WYBA 4JNKA 4RLSA 1KS9A 4GQAA 1DIGA 3VPGA 3W6ZA 3D64A 4IQ8A 2PD3A 4JCOA 2ZB7A 4IS3A 2FN7A 1B7GO 1ISGA 4CLHA 4O59O 3ROMA 2NU6A 1YJQA 4BNIA 3JQCA 2W90A 1M76A 3D3EA 2QRJA 4LMPA 4PIVA 4BO0A 4CLOA 4CUJA 4HXYA 3KXDA 2PH3A 1ZK1A 3P2OA 3ZV4A 1TI7A 2DBRA 3TNLA 3GG9A 2JFFA 1B0AA 1P3DA 1RJWA 1ZK4A 1SMKA 1V6AA 3VKVA 3U62A 3BYZA 4DYVA 4GH5A 3E18A 3M2TA 1E3EA 1GZ4A 1O94A 3UCEA 1GUFA 4BNHA 1WDMA 2E6UX 5TRTA 2Y0EA 1Y5MA 4CM3A 1XKQA 1I2ZA 3IQDB 3G0OA 4YAGA 3NX4A 2R6JA 3RFXA 3UCXA 1ENPA 1E3WB 4M55A 2CUKA 1DAOA 2VHZA 4IXTA 1WNTA 3WSWA 3FTNA 2Q2QA 4GWGA 4IMPA 5AXAA 2G82A 4RVSA 5FFFA 2EP5A 1A27A 3DBRA 5L53A 3GEGA 4B7UA 1Z45A 5BNFA 5G0WA 3OIGA 1I24A 3P5SA 1X14A 4I9UA 4M87A 2NACA 1GUYA 1FDSA 3CPSA 3KOUA 5B37A 3C7CB 3RC2A 2EERA 3WYCA 3QHAA 5FYDA 2Y1GA 5JAIA 3PWSA 5JMPA 4CM4A 1JAYA 4U0JA 3ZWYA 4FOOA 4HNHA 2YDYA 5I7VA 1TT5B 2B37A 1AXGA 1GQYA 3DBLB 2OZPA 3B6ZA 1NQAO 1GPJA 1U5CA 2X8LA 3I1JA 3VZPA 1I3NA 3NTRA 3JD3A 3DBVO 2DFVA 4HWKA 3UICA 1X0VA 1D1TA 4YACA 4LW8A 3ADOA 4J7XA 4R41A 4DVJA 3MTJA 3NJ4A 4MJLA 2C0CA 4YJFA 1QV7A 2P9GA 1AXEA 4IGEA 3CINA 2GN6A 4XKJA 4CPDA 3NTOA 4XYEA 4O1MA 5A9SB 1EUCA 4ND3A 2Q45A 2NWQA 4R5MA 3GAZA 3Q9NA 5JO9A 4DGSA 3H6KA 1ISJA 1ENOA 1RM3A 1IHXA 3BMNB 1HDYA 2D8AA 3L9XA 3V5NA 1ZEJA 2Q99A 1PZFA 3BHJA 4OGWA 4CQLA 3KEOA 4K1LA 4ND4A 4U6QA 4NBRA 1A9YA 2YYYA 4CLEA 5A02A 4NBVA 3OA2A 3OIFA 4PN3A 2NVUB 4ZA2A 1R6DA 4IDAA 3E9MA 1R16A 3LT2A 1LLCA 4AICA 4DREA 3WGYA 4NK4A 4AJHA 1D8AA 1HYEA 1PL6A 1T2FA 3N7UA 3GDFA 3QQPA 3DBRB 2NLOA 2BELA 2PGLA 3WGQA 3BTUA 4WGGA 1GD1O 1I2CA 4XGKA 1F8FA 1I2BA 3JQ9A 3HB4X 3WGHA 2VT3A 1BDBA 4CMIB 4DBZA 1UAYA 1VM6A 4TQGA 4I5GA 3NDIA 4BKUA 3DFUA 1GV0A 2Q2VA 2P4QA 3AUTA 1VL6A 1ISMA 3NDRA 2GYYA 1O95A 4I9HA 4BO1A 2PD6A 4RCVA 2VOEA 2PFGA 3L6EA 3OETA 4JP2A 4DQVA 3V1YA 5IZ4A 3I9NA 3JYQA 3ZW9A 2JAHA 4E13A 2YQ5A 2PWZA 3ZNQA 5L40A 4TVOA 5GZ3A 4BNNA 4IGFA 1V9LA 5TC4A 4L8VA 3GF4A 3PYLA 3HN7A 4E5YA 2OL4A 5C5IA 3FR8A 2XAAA 1IY8A 3O8QB 3U4DA 4GPD1 2P91A 5JPIA 2IYOA 4Z0HO 3VH1A 1UXGA 1Z7EA 3ICPA 2CMDA 1QV6A 2BRUA 2I65A 1GQQA 1GZ3A 2C7GA 3C1AA 3JQBC 4KQWA 4UVIA 4J4HA 3DHYA 2BI7A 1YDWA 1NBOA 4CQMA 3Q2KA 2FWMX 4LRSB 4BGIA 1UAGA 4OO3A 3QWIA 2Q50A 2X9VA 3T7CA 1PZGA 4IPTA 4AL4A 2Q1WA 1PGNA 3WIEA 1JKJA 2FPGA 4CR8A 1PR3A 1XLTA 3VZRA 5KJFA 5C7OO 1RM0A 2EGGA 4L73A 3PWKA 1WVGA 4J7UA 3RUIA 5L4LA 3HDJA 3BMOA 2E49A 4XQEA 1C0PA 3DZBA 3HFSA 2GZ1A 4HY3A 1LJ8A 4R3WA 3ZWMA 3G17A 1YXMA 1L7EA 2PD4A 1SNYA 3E03A 5L7TA 3GR6A 3BTSA 1UZNA 5CDTA 3ZN2A 2F00A 1T4BA 3ZU2A 4XRGA 1LDBA 2JCYA 1ISIA 1WW8A 3PZBA 1AGNA 1LDEA 1M2WA 3LC2O 4JN6B 1E3IA 1WP4A 1C1XB 4PLFA 3QE3A 4FFNA 2WEKA 3PQDA 1DLIA 2YZ7A 4EI2A 3PJEA 1U7TA 1UXHA 1HTBA 1E7QA 2H1SA 4CL8A 1IL0A 1CF2O 5L4SA 1EQ2A 3GRKA 4LCJA 3ROPA 4C7KA 4RPLA 2PTGA 4J3FA 3B70A 5JCXA 4D41A 4TRMA 2VHXA 3WFJA 3ZWPA 3CE6A 3IJRA 1JW9B 2DAPA 1BXZA 1T24A 3BA1A 4K9DA 5KVSA 5C7IO 3RIHA 4N5NA 2NTVA 4Y9DA 4XYGA 1D7OA 4RVGA 2VTEA 2VYVD 2VRBA 2I99A 5IXYA 1LA2A 2J8ZA 4IIVA 2ZCVA 4OXNA 2BI8A 4L4RA 5TT0A 1SB9A 4EEXA 5B12A 4AJNA 3GT0A 3LDHA 4II2A 4EUFA 5K0ZA 1PJSA 3E5RA 2H63A 2J3IA 4EDFA 5I7EA 1YVEI 3EZLA 4YJFB 1H6DA 2XOXA 3ZW8A 2GRAA 2NQ8A 4PG5A 1PS9A 3RVDA 4EYEA 3AY7A 4DL9A 4DYDA 1P1HA 2EWMA 3ZU4A 2YFHA 3WQQA 3V2GA 2VUTA 1E7YA 1ZIDA 1I32A 4I1IA 4WJZA 3TL3A 2P9EA 4CM6A 5F1KA 4FFMA 5G0VA 3DQPA 2ZCUA 4UAGA 3NRCA 3ITKA 4E31A 3BAZA 3H9GA 1ISHA 4CM4B 2RHCA 4BGEA 1BXGB 2Q1UA 1ZFNA 3AUSA 5TX7A 4WASA 3D3WA 1O9BA 1QLHA 2ZB4A 3OJEA 2E4AA 3AY3A 4OXKA 4YJGB 3TRIA 5L7WA 5JMWA 3BTOA 4QUKA 1VRWA 1CERA 4DXHA 4ALMA 2DBVO 4IUYA 1PX0A 1Q2XA 2O7SA 3OQ1A 5G0TA 3RBXA 1K0UA 2GSDA 3QVWA 1M67A 3GNQA 3KB6A 2DPGA 2QIOA 3RKUA 1JA9A 2YFQA 1Y81A 1YB5A 3DTYA 1DJNA 1E3WA 4JQCA 2JJYA 4IIUA 3WBFA 1NVGA 3WLEA 1DB3A 1LBEA 3GDOA 2DTEA 7MDHA 4WE3A 1R37A 4CMHA 4WECA 4P38A 2X7HA 3CTMA 4PLZA 4MP8A 3GOHA 1EUZA 5TS3A 4YAKA 1KVRA 2QRLA 1NQTA 2B0JA 2VN8A 3A28A 2GGSA 4Z0TA 4I5EA 1RKXA 5KWEA 4OIMA 3TOZA 4JROA 1HLDA 4R69A 4H7PA 5KVVA 1EK6A 2Y93A 3GZ4A 2C20A 3JYLA 3MJEA 5DZSA 3UAGA 3PK0A 3NDJA 1G0OA 2OMEA 1NWCA 3C7DB 2DLDA 4L75A 3TZQA 2CDAA 3ABIA 2O4UX 3WTCA 4IS2A 3S2FA 4LISA 1EVYA 1EE9A 4CMAA 3K5PA 2VRCA 1LSUA 4RVHA 2BKAA 4FBGA 3TFQA 5L7YA 1H6AA 4IMRA 4BV9A 4EBFA 5F21A 3I6QA 5TJ9A 5T57A 2BMAA 2X0IA 3INTA 4S1VA 4WLOA 3ZWCA 4KQXA 1W73A 4RF2A 1JLLA 4B4WA 2AG8A 3L0DA 2Y0CA 3RASA 3E48A 1OC2A 1DRVA 3QP9A 2X1HA 2P4HX 4OOEA 1Z6ZA 5H82A 4EUEA 1HETA 5A9RA 2GZ2A 3F5SA 4U7WA 4AFNA 2IZ0A 3GHHA 4KDEA 3QLJA 2O50A 5CG1A 2GN4A 1PJ3A 3RWBA 1Y8RA 2X4GA 4D0SA 1E6EA 4Y67A 4BQRA 4AJ2A 1XSEA 4DWVA 2B4TO 3KZVA 4BS9A 5I9MA 2HU2A 2Q1TA 5A05A 3H2SA 3OJFA 2WWRA 3RBZA 1E7WA 3NUGA 4RZIA 4YRBA 3GVPA 4J1TA 4KUHA 1I30A 3BZUA 2OOSA 3WLFA 4E33A 3KV3O 3WMXA 3L4SO 4P22A
chains in the Genus database with same CATH superfamily
1V7PC 1AS3A 4GT1A 1K97A 1IXZA 2FB9A 3ESBA 2RAFA 3IUNA 3HEBA 1DFIA 2ZJ1A 4UEJA 3SE0A 3EMVA 3RJTA 4RXTA 4UASA 2LCIA 1NMXA 4ZVOA 1XTBA 2IDKA 3ORQA 1VFPA 3KCNA 4ZT3A 5A71A 1PJ2A 2V1UA 2B2CA 5JYEA 1FZTA 3EIQA 3R6GA 1TU0A 5CFOA 3RKSA 2GS9A 1VYTA 1WDWB 4N0QA 4V0OA 5E6SB 3BD7A 5A5DA 2Y1XA 2I6FA 3AW9A 1I8TA 2R44A 1MAHA 3B1ZA 2QRVA 2ZU6A 4H1HA 1LZLA 1YE8A 4AZ0B 3K2EA 1XO1A 2FP4A 2JFHA 1LV8A 4CV3A 4HFRA 1DQNA 1ODIA 2WM9B 1KU6A 3QPVA 4RBNA 5F7JA 2W70A 3HP4A 4HDAA 3TDKA 1REQA 2YOFA 4DJFC 2WJVA 5JY1A 4G4JA 4ESHA 5IRCD 1TAQA 3ZK7A 4L85A 3OG9A 2O8DB 4MWDA 1WHSB 1W75A 2VQEB 1H5UA 4EKDA 1WL8A 4A15A 5IDYA 3R4CA 2ABWA 4XVQA 2GETA 1YAJA 3L7NA 2JAUA 2Q5QA 3IH5A 1XVLA 3L6OO 1L5MA 2NZ8A 3A6DA 2ZJ2A 3CZ5A 3MTGA 4R4JA 3RVJA 4BECA 1HF3A 2OZVA 4KFUA 3WL7A 4OD0A 1O5TA 4HB2A 4NICA 1PGJA 3JWPA 4J9UE 4JVOA 2YHUA 3E05A 3PYMA 1KVQA 2HZBA 3DL0A 4M0LA 4EX6A 1AG9A 3K4HA 5B58T 1H9CA 1X94A 4ZO7A 4PNPA 2NU7A 2CHUA 1QX3A 5AW0A 1IC6A 1T9BA 1FUUA 2BDUA 4TWJA 3P0FA 1NW4A 3H0EA 2B92A 3IOCA 4O02B 4C43A 3NEJA 1K4MA 2V7PA 4YCAA 3M82A 3VDQA 4NHEA 1GEGA 3OA0A 4OI4A 1GADO 1TJPB 4RHEA 4RENA 3UK2A 5CUQA 3CHYA 3OCWA 3E0QA 3R3ZA 2YC4C 3VHQA 1WR8A 4Q24A 3PHHA 1SQGA 3AHEA 4ZOBA 2WJJA 4MUIA 1WZIA 4RDHA 3H3FA 2G0TA 2OAQ1 4GG1A 4RK4A 3EZGA 4ALKA 4MUEA 5JZMA 2ZBFA 3BIXA 5K01A 4LBVA 4RH0A 4GBMA 1JWAB 1MDBA 1NUQA 4WY5A 5HP4A 4GE0A 2Y27A 4N9WA 4XARA 4OYHA 1M34E 5J1SB 1GDDA 4G65A 2PK3A 1SU8A 1Q6ZA 2PKCA 2BFEB 2HSWA 3R5FA 4QTZA 5CFLA 1RJ9B 3FTFA 3E3MA 2FX2A 2FCAA 4MRNA 3JASA 3LRTA 3GRVA 1PZMA 3HP1A 1PV1A 1KK1A 3H7IA 1UC5B 4MJ3A 4FCCA 4C2TA 1PFGA 1AJEA 1KETA 1AHIA 3NT5A 3AILA 1S02A 3PJDA 4IY1A 4HQNA 3RIEA 2WLSA 5TLSA 1YZLA 2ZUUA 4OXRA 4F1WA 1L8AA 1VGQA 1J49A 4MCIA 2XMPA 4E46A 2HO5A 3ZXYA 3OX3A 3CZQA 3F8TA 3WICA 1ZZGA 4ZHQB 1YCGA 1ZI8A 3I2KA 1HFJA 3L7BA 2NXWA 1J0BA 2IU0A 1Q3TA 2X22A 1V1JA 2FPRA 4HDMB 4F5ZA 1AN9A 1VHQA 4AKTA 2V59A 1ULTA 1TVEA 2NO5A 1LBIA 3DHNA 1PBTA 3S81A 4BUZA 2X19A 4NV0A 4FLMA 3X1MA 1XZIA 3DOOA 3UK1A 2IY9A 4XIJA 4YRRA 5CBPA 1QIHA 1QRRA 1G6OA 1Y5IA 4K40A 4NJEA 3CLTC 3PDHA 2SCUA 1N9ZA 2UXDB 1OH5A 3IBGA 4RYLA 3U48A 2QP9X 2Y6VA 4X41A 2JHAA 4DF3A 2FEMA 5ALVA 2I87A 5I7FA 4DPKA 1M1NA 3KT6A 3O82A 4EJ0A 1DXQA 3DUFA 3ZVKA 3V2IA 4FB5A 4K6CA 2QE6A 1E7RA 1K98A 4NZPA 3GLSA 2PGIA 4Q4HB 4ZDWA 3OLYA 4P3YA 5JHHB 4BB5A 4W5HA 4Q16A 1OBHA 4BATA 2HDOA 2JVJA 2QVCA 3I04M 3GEPA 1I3OA 1OBCA 1G0NA 3TEFA 5EKUA 1DO0A 3IP6A 1Y1SA 2WIFA 3DMYA 4OHVA 4AF8A 5CURA 2J3MA 2EWVA 3FYDA 5JNUA 5EFZA 3IEVA 2WC1A 2O3UA 4AMGA 3BBLA 3KZCA 2VDLB 3TEJA 4RELA 3OM9A 4BP1A 1YZYA 1Q7GA 2ILTA 4FDLA 3JWEA 1VSTA 4KXUA 3ADCA 3E1KA 1MV8A 1W87A 3QH4A 4LAFA 2X9NA 1D2GA 1TGVA 4WZBA 1JDNA 1P8AA 5AKKA 2ZSIA 4D3XA 4DZTA 3L0SA 4ADSG 1TVMA 3G0DA 1PTKA 1QH0A 4BVJA 3CLSD 4RF5A 5DGDA 1L1EA 2F43A 2OB2A 4FYHA 1NF8A 2WJIA 5DHQA 2ODBA 3MCVA 1NG9A 5KNBH 4R2WA 4EB0A 3LX5A 5C35A 5JLAA 3PLAE 3MM4A 5DTRA 5FO0A 3ZY3A 1ZK0A 1XHEA 2ISCA 3SX4A 3Q7SA 3VOSA 1MMFB 4DZRA 1T4MA 4XSHA 3RSGA 4HATA 2WPDD 3K6KA 1Y7IA 3LT0A 3MT9A 2Z2IA 2B34A 3ORFA 5JYCA 1VGVA 4AJ1A 1WCWA 3GJ7A 4RDIA 1QIEA 2WWXA 2ST1A 3GGCA 1G8SA 3DEZA 3V9AA 3QE9Y 4IJVA 2F4VB 1ECFA 2RCNA 3BQMB 3C6ZA 3K8QA 3QKRA 1AKEA 4Y9UA 5ECYA 1HH4A 3UH0A 2PSFA 3QVMA 5G0SA 2RARA 2MMCA 1Z39A 3DTNA 2ZZNA 3WKEA 2J0EA 1K92A 3KJXA 1E3JA 4QUAA 2IH2A 2GA8A 4YJ2A 3LHDA 2GAOA 2I4MA 4HHEA 4ZI5A 5D2CA 3OTIA 3ZBTA 4EWLA 1PFWA 1ZUNB 2DLNA 4QXMA 3OCYA 1F5SA 3WLJA 2FFJA 2Z95A 3HKBB 4DCPA 3Q15C 4EQ6A 2FSSA 4CL2A 3QEMA 4HS9A 2RK3A 3IESA 4QODA 4MPTA 3V6MA 4JI2B 3A4YA 1Q77A 1A1SA 3EVNA 3GJXC 3SQLA 2FWRA 3C4QA 5EE3A 3WWOA 1PWEA 4XR9A 1US8A 4FCWA 3H7AA 4AY4A 2PE5A 1V96A 5KTNA 1CZKA 5GZ1A 1O89A 5IYZB 1DQYA 1EHYA 3BIWA 2XUOA 4HYTA 4DIFA 5ALRA 1DP4A 2OZKA 1E20A 4TKUA 1CZHA 4X97A 4F8EA 4OSEA 4XUGB 2A1TR 2HMUA 4ABTA 1SCUB 1FVHA 3IA2A 4H4EA 1BCRB 3W4IA 1E1YA 2M6KA 2WF7A 1PJLA 2HU8A 3O1HB 4JENA 4KDRA 4Z1MD 1YQDA 2YFKA 3BSWA 1HNNA 1THMA 4ED9A 1XTQA 3ZYCA 2K5UA 2MSDB 2REQA 2X58A 3GROA 1VI2A 3M33A 3ZQKA 2ORVA 1M8PA 3FMFA 2NU8A 3K96A 2YWHA 3SXUB 2D06A 3KYCB 3X1DA 3LRPA 4OP1A 2HA2A 3D7LA 2JHGA 1T26A 3O4GA 2JGLA 1BYUA 1T5TA 3DTTA 3HPRA 4G0QA 4I55A 4J94A 2Q9CA 4R40A 3RVBA 3S2YA 4EHJA 2VS1A 3UMMA 2R11A 1IZ9A 2ACWA 3D3JA 5AK5A 3RAFC 3FKJA 4HEA6 1MQ9A 4MQEA 4MGZR 4WKPA 1ZH6A 3ZTWA 3FNBA 2EBFX 3M6LA 4EF4A 4OKIA 3ROGA 2VYQA 4J75A 2I2BA 3NOXA 1WPQA 4P82A 4UE2A 3FMGA 3ICQB 5CCBA 1UR5A 1G8KA 1I2MA 5H8WA 1XL1A 4HTFB 3B7PA 5T67A 2G7ZA 3KR9A 1MQSA 1W8DA 2VPXA 3EZNA 4WY2A 2DZDA 2P9TA 2DE0X 2V3CC 1NVDA 5KMGB 3RSLA 1UM8A 2X0RA 2OOKA 3IERA 4JMLA 4RVDA 3BD6A 1QK3A 3CZRA 2DHCA 3VA7A 3G2OA 1EFVA 1ZZEA 4QX6A 4OLHA 1M2VB 2AQKA 4JVMA 1POXA 4AQYB 1EG2A 2Z6AA 2GCPA 2DM6A 2WILA 4K9NA 1Y3CE 2P9CA 2ODQA 3LWBA 5ALFA 1E9SA 2G9NA 5DBGA 4DG8A 1DQSA 5AP9A 1DTWA 2FEXA 3GNLA 1BMTA 1V5GA 5GJBA 5EHXA 2ZYAA 4KHPB 3LF1A 1Z4JA 4WXEA 5JH7F 4W5QA 1YZTA 1LLFA 2EIXA 4TRRA 5EP3A 4C5CA 1SZJG 1JB9A 2B25A 2ZRHA 1NFQA 2TMGA 1VG1A 3OEHD 3R6LA 3U31A 4DNQA 3MWEA 2RH5A 1WD5A 2WAMA 3F90A 4LVOA 4NVRA 1X1DA 1R6VA 1DC3A 1E8NA 2H2DA 1ZVKA 4RK6A 4M9QA 4DJDC 3CRZA 4OQYA 4QYIB 3RS9A 1J8VA 1L7QA 2F4NA 1GGHA 2XCTB 2B1RA 5DK6A 3GGGA 3BCRA 1DTSA 4FZJA 1NQXA 1KZ9A 4H08A 1QLJA 2D74A 3BX1A 3GO4A 1OAOA 3RBVA 1YBAA 3TYXA 3W4KA 1RXVA 4G1FA 3K70C 2PLRA 5JECA 3TTSA 5HQ3A 3TWOA 4IDNA 4MCJA 4FMPA 3K1AB 2N0SA 2CMHA 1V2GA 4FNGA 5FAXA 5JCJD 3GUHA 5BWNA 4H77A 2REBA 3OEHA 1NKVA 4X45A 4BLSA 4J6EA 2JFNA 4PAOA 3FHTA 3GJ8A 2XGSA 1NW8A 3IHWA 3K0KA 2GCIA 3PQ2A 1P6QA 4XLLA 4AXXA 2C8JA 4JI4B 3FY4A 2CL0X 3JD1A 1D6JA 1DMRA 1Y9AA 4C4OA 1KRWA 3GRZA 3C3CA 4U2GA 3A7EA 1CC1S 2KB0A 4MW6A 1B0UA 1JQ5A 2HA6A 2NNWB 1V4NA 1Q3KA 1SRRA 1VKHA 1YJCA 2XJ9A 3AUFA 1CJMA 4LNUB 4G5SA 4LXHA 3TZCA 1FFDA 1KQPA 2YV4A 2QMZA 3K0AA 2Z8YA 7AT1A 4GX0A 1NWHA 1KF0A 4Y2XA 5F2NA 5LDDC 5T8KC 3UENA 3CO5A 4EY4A 1W9MA 2JGKA 3QMWA 2Q8PA 2XCLA 3LHSA 4D9FA 4YAOA 2ZYRA 5BMVB 5LJIA 1GGVA 2GXAA 3VVCA 3ND9A 4NEQA 4YMIA 1XB2A 5JC8A 1WMDA 2F1IA 3WL6A 3GAAA 2NUTA 1UXJA 5CK4A 3T41A 4HN4B 3E1SA 1YB4A 2O6HA 1LPSA 1N2JA 2IQ5A 4MWCA 3RREA 3O7WA 1SKUA 3DW1X 2XOKD 1BEZA 1AIPA 1ID1A 1UBHS 3ETCA 4WIAA 4U7JA 1CDDA 4U2BA 4K6GA 1Y9EA 3UT5A 1P1CA 4CIAA 4CUZA 3LPAA 2XWSA 2APJA 3CUKA 1IK6A 1N6RA 3U3OA 1RAEA 1FQOA 1IQRA 1N9GB 3AEUA 2YWBA 4AG6A 4KWHA 5JR3A 1ESNA 4DR1B 1GTRA 4CT5A 1Z2OX 4KK4A 4XM0A 4W8HA 5EA2A 1NQWA 2PZGA 2PZBA 1M7GA 3E3AA 4DR2B 3U7FB 1TTPB 3UHOA 4B4VA 3KKNA 2AC2A 3K0HA 1E4EB 3C24A 2JS7A 2YMLA 1DARA 1MDFA 4J0DA 5T6BA 4AYTA 3C7KA 4BMVA 3GCXA 2R1VA 2W6IA 1KNXA 4TUYA 2EFEB 1IXKA 1C80A 1CUBA 1QQ7A 2O3QA 3UHJA 1DDOA 1KAOA 3V1KA 3A7DA 1A71A 4G0NA 4ASUD 4D9BA 3CH6A 4YDQA 4P93A 3B5IA 3F8SA 3ERCA 1NYTA 3FPSA 3JSAA 3L8HA 1R9NA 1IHPA 3A3PA 3AHJA 4MA5A 2FGKA 1Z7BA 4FBMA 4A27A 2O14A 3TW6A 1EAYA 4D79A 3BEOA 3WLIA 1L1FA 1S2MA 5K3EA 4MKRA 1YJAA 2PX0A 4FJ2A 3ADKA 4Q00A 2WF9A 3ZR4B 2QL7A 4XPIA 4UBOA 3TB6A 2HDWA 3B51X 2BM1A 3GCGA 1SVLA 3OZSA 4KX3A 2QRGA 3VSEA 5KYVA 4DMCA 2DHQA 2AD1A 4WNAB 1FDWA 1THTA 3ABZA 4JFRA 1MO4A 4JJIA 2C4HA 4ILKA 4WHMA 4YRJA 1E9AA 2GM3A 1CWUA 4QOSA 1U8AA 2VZ0A 1E1QD 2BAGA 2PZLA 3PPIA 3CRW1 1EP9A 1SIBE 1ZJYA 3A3NA 2WUVA 5TR9A 1SA0B 4OQPA 3ZXXA 2A5DA 1T2UA 1KAGA 1KOFA 3BJZA 3RVPA 3CWZA 2G63A 2ZE7A 1KVTA 4CIDA 4J76A 3FG9A 4KCGA 1N7IA 1W59A 3SJBA 4LRXA 2I2FA 3NHZA 5HMLA 1FSPA 3LBNA 2FR0A 1MRNA 5BN4B 1LH0A 1BIFA 3BK7A 2GAFA 1ZBQA 3CJTA 4GSKA 3W5VA 3GLUA 1SHLA 3LFUA 4DLYA 1NFFA 1EIWA 1I10A 1YR2A 3QU9A 5FA6A 1ZNYA 2VXBA 3C3DA 4BX2A 1K7YA 2RBKA 1FMJA 3LCUA 5EXDA 1RXEA 2IHZA 3NR2A 4NBWA 1ZNXA 5K45A 4C4PA 3B9RA 3S8EA 3IQWA 5B2ZA 1TLTA 2I3AA 3V4PB 5LN1A 1E18A 3OMXA 2C4NA 1GIAA 4JS0A 5EJMA 5EIAA 3SMQA 421PA 2FQYA 4ND5A 4JP1A 1UPBA 1IK4A 4EL0A 4RPHA 2QHXA 4RJJA 1T4GA 4R9RA 1QHNA 5B6IA 3KP1A 3WL3A 3NV9A 4BQQA 3MERA 2IXTA 1QGDA 4FYXA 4PZPA 5ADHA 3FDJA 3R3VA 3WXBA 3Q8KA 1M1UA 3RYIB 4R31A 3GWZA 1RVV1 4EF5A 4HWPA 4YIHA 1CKEA 1QYCA 3JYOA 4KNVA 1P9LA 3EVTA 4OU4A 4EGAA 3SZGA 2R68A 5F78A 2HV8A 3JALA 4L9RA 3LYUA 1XUOA 1RWVA 2CLKB 4KR7A 2RHBA 3W1VA 3HS3A 4KXMA 4K6MA 4Q01A 2CL6X 2NT4A 5KQPA 1XLUA 2QTVB 3U2QA 4LXYA 1UZUA 3ANXA 4G4SP 1BXRA 2XUQA 4G0VA 4BX9A 2UVPB 5JPDA 1UBJS 1PZHA 1ZI9A 2MINA 3T5DA 1JLRA 1YOVA 2JHPA 2VFAA 3COVA 1IULA 2WMNB 3MCAA 4UHJA 1B74A 3KRTA 5CFZA 5JH7A 3GQVA 2BKXA 5CIWA 5M7EA 2GI4A 4ROTA 5F4BA 5DI3A 2WT4A 5G2OA 3HWSA 3W6OA 1TIBA 2C1EA 2VF4X 4OUDB 1E5LA 2BD0A 5I5EA 2BEKA 1JGTA 2VNSA 2Z5VA 1QZUA 4P08A 1APBA 1H2RS 3U4IA 1RC0A 3SR3A 4YRFA 3ZHCA 1FXWA 3M5CA 5BSWA 1THGA 1RPJA 1KYQA 1QRDA 3DMRA 4D5EA 5JNVA 4DV1B 3LT5A 5DN9A 1GZ5A 4D9IA 4QO8A 2JVIA 3G7NA 4ZVSA 3ZIDA 1FSSA 8MHTA 4EY7A 1XNHA 2B7BA 1L7VC 3RS4A 1MFZA 5BSEA 2PWPA 5HW0A 5DULA 2VZ9A 1NVAA 4O4JA 4P7JA 4F0JA 4A0RA 1ZOIA 3FWNA 2Q8NA 2WYWA 3HLKA 1EE2A 1QK5A 2Y68A 1Z5VA 2BR4A 1SZPA 3SBOA 5AK0A 2W2OA 5K0LA 4J16A 1VMEA 2WG0A 1VI6A 4JOSA 4W1SA 2VJLA 5P21A 3W77A 1HFKA 1U2EA 4XA8A 2D1TA 1P6UA 3BXXA 1H85A 1VP3A 3S28A 3EQ6A 1KZ1A 1QBKC 3NTLA 4B3XA 2QUJA 3ZWNA 1WHTA 3M3HA 1LQUA 3B7WA 3QBJA 5M3BA 2IHVA 3HUTA 3EEYA 5A4AA 4MPRA 1FU8A 1ZGBA 2B99A 5HM8A 1KQOA 4ALNA 1G5TA 3JQGB 5DXJA 2D5AA 3EVZA 3LP5A 1B8PA 4EKNB 2KHZA 3KT8A 3SS9X 2YOGA 3D4PA 5EESA 1U0NA 2RBEA 4CM1A 1OVMA 3K20A 4LJ9A 4RYDA 3C14C 5JEEA 3AF5A 5KCZA 3IR5A 1G16A 4OHZA 2PZFA 1WUHS 2IA5A 2AKEA 3H0CA 3RC3A 4PQFA 3ANLA 1BX0A 4LHWA 4C3ZA 5JT1A 5JANA 2VZEA 4GOJA 2L19A 1EKXA 5ILQA 3K70B 2P7IA 1ZD5A 3PJFA 4UUOA 3WHIA 3F6CA 3W5DA 1BKSB 5U9CA 1Q14A 2YY6A 3FCXA 5E3IA 2B8NA 3ELDA 3T3IA 1LI5A 3K4QA 1BHO1 2KQUA 2WJGA 4EI8A 4HVLA 1MX5A 4NNJA 5B1YA 4X6XA 4JYPA 4KIUA 5AVVA 2JG3A 2AC4A 1CEEA 1EBUA 4MW4A 4YWJA 3DAFA 1GZUA 1KMMA 1KI8A 1YQEA 2QGZA 4NYIR 4HV4A 1HZZC 4YRDA 5ILGA 3CVUA 1U7ZA 1V3TA 3EJ6A 4P2GA 1E6WA 1T8TA 4YROA 5IG2A 3AKZA 3SSAA 4EGFA 4ID3A 4A6PA 2Q0HA 3LQYA 3CCCA 2IBMA 4FEAA 4D3YA 2WNHA 1EGMB 1XYYA 3AWDA 3FJ1A 4QBTA 3THSA 2A9VA 1OZAA 2AD5A 4FGZA 2IH4A 2C57A 4NFLA 1H3NA 1H9BA 1AKMA 5HFAA 4P9NA 2CV0A 1ZC4A 2R85A 2WDZA 2XGMA 5LQRA 4J03A 5CGQB 1RI5A 2FPPA 1PLKA 1QHGA 1R12A 2EKPA 2H57A 2VXCA 1AMUA 2W2LD 221PA 1KYZA 2QP4A 4PLTA 5DBEX 1RQPA 4FZVA 1JIQA 3TRJA 4PG6A 3RPEA 1ZCJA 4EDHA 2AOWA 3D6AA 3Q5EA 3GQBB 3QFRA 3C7TA 4LQ4A 1UBFA 4MWZA 2JGEA 1VECA 1XF9A 1VJRA 3OHMA 5C18A 1J9GA 1NC1A 1SUSA 4P0TA 3A3YA 3ZHBA 5A5VA 4KXLA 3AR9A 5KYUB 1USGA 1GL3A 4JUCA 1QH8A 4Q1DA 4ISBA 4EITA 3A4LA 4YN3A 3NUQA 4FIZA 4LXXA 5TEWA 1ILEA 2ECFA 2YXLA 5B7PA 2AW5A 3KSDO 4WN9A 2BFBB 3NASA 3EZ7A 4E5NA 4LJYA 2GHIA 2QX6A 4IDEA 4JLVA 3A3KA 3L0BA 1D3AA 2WAOA 2XF8A 4YPFA 5DX0A 3PV0A 1F20A 4BNVA 4ZGGA 1WM1A 1KXZA 2V4MA 2ID4A 1UJMA 3MXTA 5FL7D 4GX2A 4RZ2A 3SSMA 3QGMA 3RNOA 4I4IA 2A5YB 3QPWA 1JG3A 3N28A 1X1QA 4HKTA 4JLOA 4A10A 3V4ZA 1SGWA 3UFXA 1VSUA 5IX8A 3UJNA 3V7WA 1MW8X 2G04A 1CY1A 3ESQA 1F9AA 5LP1A 1RAGA 2VP2A 2X76A 2RJOA 3PL1A 1X1SA 3HLTA 2GH1A 4ZARA 4I1PA 2UDPA 2AZ4A 2QTMA 2E87A 3KJNA 3P2IA 4L1KA 5IHXA 4UHDA 4K8OA 4FGJA 4Q18A 1X7YB 2C7BA 4MQ6A 5H83A 4D25A 2HF8A 4PFJA 4FGWA 3IXQA 2G25A 2MDTA 3KSZO 1F2UB 4ZI3A 3ZCUA 3U19A 3NG1A 1JJFA 2GCGA 4DBLC 3OX4A 1YJ8A 4LDQA 2OC9A 2XUJA 4BLVA 4F21A 2FDCA 3WLTA 1WXEA 4XX0B 1SVWA 3HN2A 1BEUB 1TA4A 1YQQA 3KHSA 4RADA 3S68A 6PFKA 2Q1XA 3X2EA 1M2HA 4DR7B 1PYDA 3QWFA 2GF2A 5A2GA 2QW0X 1G98A 2P65A 1OHHA 2QDXA 2ZJ7A 3DR3A 4M3NA 3V33A 1V48A 4DQ0A 4UBIA 2W2KA 1TAHA 1TM7E 5G41A 4MYSA 4BUCA 1C30B 3K1YA 1G8HA 2D1SA 5CLLA 1DEXA 3TQSA 4D0RA 4EUHA 5I8PA 2QLFA 2I6QA 3H05A 3RAPR 5C51B 3ZVRA 3WMGA 2Q2WA 4UCQA 2ATVA 1M2FA 2YR0A 3B2QA 4WVFA 3JVIA 5F35A 3ZEAA 2V6BA 1KSGA 4H1VA 2UZAA 3IYLW 4EHHA 4YCBA 5LQCA 3D1LA 3TLYA 3HO8A 3CURA 1PSDA 3RS8A 2QKYA 2BHTA 4R1LA 4I99A 3RR2A 1W2GA 3VC7A 3T5MA 3JU3A 2H9AA 4TS9A 4D8XA 2HC9A 2QPLA 3HGMA 1T0IA 4C2BA 3RU7A 5JO0A 1GTSA 4OIFA 1ARZA 1POWA 3CPEA 2OY0A 4MR9B 4R16A 1I5RA 1IXRC 2VUIB 1AB6A 4XJSA 3VHXA 1YIAA 1JJVA 4RWEA 3EXIB 1QB8A 1TO1E 5AOAA 1NASA 4HNRA 5CB4A 1RJGA 2JPDA 4DJJA 4X20B 3RUCA 3FKSD 3USZA 2AOUB 2VDWB 4ZV7A 1MNQA 4TMZA 3IBCA 4P7FA 3Q10A 3NJ8A 3MIIA 2A94A 3K5IA 4B7AA 3OECA 2GX6A 2YV1A 5IMSA 2GEKA 4LZOA 1ZVVA 1X0XA 4ND2A 4XQGA 5D8DA 2BTEA 3HY6A 3BB3A 2W4IA 4PO9A 3WZ2A 4EJ6A 4QOEA 1U9ZA 1SXQA 10MHA 3NHRA 4B43A 4Q7JB 5NULA 4XWKA 4D45A 3WTBA 1EVKA 1ZGJA 4XQ9A 3AKDA 4ER5A 1GQ2A 2JIDA 2ASVA 2HJRA 3D4NA 1D9ZA 2Z83A 4D9GA 1UH5A 2QPOA 3L84A 3T3NA 1WCV1 1SOWA 1W7AA 5I3ZA 4FT2A 1M2JA 3Q6NA 3DAOA 2GF0A 1NPDA 1ZVMA 2BY4A 1JBKA 9GPBA 2MSLA 3DZJA 3WKDA 1O0SA 4LK3A 2VT7A 5JROA 1L7DA 1NVXQ 1T3ZA 2IVFA 1WXXA 3K6JA 2QE7D 1J39A 3O4JA 4J16C 1SC4A 1ZM9A 5FQOA 3KSAC 1KO4A 2RGWA 1W9HA 3Q3HA 2X0DA 5FLEX 4DLLA 5FLXA 1WUTA 1Q5PA 1QFYA 1QZTA 3QENA 1FP4B 3AY6A 4QBFA 1WBBA 3KJGA 1AGXA 4I4TF 4BO7A 1QVRA 2OLJA 2VF8A 4WERA 3S44A 1EFLA 3I23A 4Z6KA 1UP7A 4M0KA 1MUUA 3CXRA 4R9SA 2IELA 1SXJD 2VPYA 3C3JA 3W6UA 4CDGA 4W9MC 3C1TA 1KEZA 4X1KB 3IOYA 1IWPB 1FNBA 2YJZA 3EGDB 4I5IA 4Y2HA 4M7OA 4YQEA 3J81k 3MAJA 3SMVA 1T4DA 4M22A 4B9AA 4ZQGA 1R6BX 5KWVA 3CFYA 1OT3A 5F9HA 4O0LA 3VJRA 1JEQA 1SUPA 4X3CA 1FRFS 4NBUA 4Q12A 3QSGA 3ONVA 3WDMA 1YFLA 3HVKA 1SVSA 1E6MA 1T0PA 4UBJA 1J90A 1DQPA 4CR7A 4GRIA 5IWCA 1FMFA 4E5VA 1DJQA 2O9JA 4QGFA 3QVOA 2BFBA 2Y9MB 1MO6A 2EYUA 3L93A 1WXGA 2F64A 3MSCA 3JQ6A 2QRHA 3NVMB 4P32A 1NBAA 3RU9A 1QKJA 1BE6A 3ASVA 1GPNA 3CF0A 1Y5LA 5HG0A 2NUAB 1Z8HA 3Q9UA 2ZQYA 2WHPA 4RQTA 3HB9A 2R62A 4J2OA 4E5PA 2ZJYA 3IEKA 3QFSA 4GKKB 1QFMA 3DGEC 1P7CA 1TMYA 1O5IA 2GKGA 3DLAA 4P4SB 4TTPA 3OEED 5BURA 1R0WA 5JQGB 3CLVA 4FBLA 4L9WA 2ZANA 4JKIA 4BHTA 3EX7C 4MARA 4LC1A 1WBDA 1H65A 4IGKA 4DJEC 1ADYA 4G5XA 2Q9AA 4E5SA 4G36A 1QGED 4XTRA 1VJTA 2LGJA 3CW9A 1Y9JA 2WUGA 3QYFA 4HAXA 1JFLA 2WT9A 1N5DA 4ZVVA 2PL1A 5C37A 4B79A 1FFXA 2GO1A 5K0JA 1F17A 5CDHA 3KHTA 3MGCA 4I5DA 2GN1A 1I80A 5DISB 2UUOA 1E1DA 3THYB 1W5EA 2XIJA 4WRRA 4F3CA 1X7WA 1QH1A 4H7JA 1DCMA 4A2PA 2XE6A 2FHSA 1EEHA 2QT1A 3D6TB 3CXUA 3L49A 2R65A 4N6GA 1ZUD1 1DAMA 1QO9A 1C50A 1JEJA 1T8RA 3IQHX 3MT0A 4KG7A 2NZYA 3JRWA 1ZN2A 2DPLA 3WB9A 5BNIA 4QQNA 1OB2A 1SHJA 2P4UA 3GRYA 3HXLA 4R9VA 3TJMA 4QASA 1NUSA 5HIJA 5DM70 3OJLA 1W4CA 2AS0A 2JKZA 3MG9A 3WWCA 4GUAA 4MVJI 1G7TA 4BKOA 4F12A 3WIUA 3R8FA 4G8JA 1FFAA 1UM9A 1CVRA 2DR0A 4G01B 5CTJA 4F3YA 1G3RA 2JFBA 2JEOA 3FN4A 2QXTA 3PRYA 4GOLD 3BRCA 3ILHA 2W2LA 3FI0A 3NM6B 3ACCA 4OL9A 4PXSA 5KKAA 2ZWMA 1LNSA 1SELA 1XVVA 1Y4SA 5CCXA 1GP2A 2QR2A 3SC4A 4BXOB 2ZBVA 1YOBA 4IFBA 2JLSA 1EVJA 1OWMA 4YMTA 2G4CA 1M54A 2BUCA 4L5JA 2WYUA 4G4SO 4LOAA 1Q1ZA 3ABOB 3GLKA 1K9VF 1U3TA 4O1HA 5TGZA 2ZBUA 5EIBD 4EKIA 4OX9Y 2GBLA 2J9FA 3NDPA 5AW1A 4GU5A 4DSOA 1RFGE 1WPXA 4HI0E 3BGIA 2O4CA 3OUTA 3SPXA 1QDLB 1O57A 2ZWPA 1AHPA 5JJ5A 4WLNA 2BHNA 1R8YA 4N03A 3COZA 1KVSA 5EYPA 4M1WA 1XMQB 3PX2A 2YYZA 2AJ8A 3QU2A 1JHPA 4ZVTA 2BM0A 4MO2A 1QP8A 2KBEA 3WKCA 3COWA 3P94A 3S1LA 3VH2A 3GLTA 4ZCPA 4CKZA 2VJPA 2PUTA 4I8DA 5DB4A 1E5QA 2Q6LA 2R00A 1CR1A 1S8OA 1JJ7A 1COWA 1C1HA 1ISRA 2OP1A 5E1DA 2G08A 3LUFA 3S1AB 3T9DA 1WUIS 1ZD4A 2O5VA 3NHAA 1E9VA 1ZPDA 1Q0LA 3W5BA 2CXTA 2JIOA 1C8KA 2F9FA 2ICAA 2IOFA 2G40A 4ZQEA 1F1JA 1KMNA 4P3XA 4QXRA 4TV9B 4AW9A 1F9EA 4L2IA 4J9VA 4KN5A 4ZEXA 1G8GA 2EFGA 2GILA 2CVOA 3ROXA 3WLHA 2D4AA 3MTAA 3WADA 4EI7A 1Q2UA 1WLSA 1HE8B 1NLFA 2ZYIA 1RRKA 3LLVA 4ZQFA 5M2QA 1E6UA 1J5PA 3E70C 5E6UB 4WJLA 1ZR2A 3B2NA 5EQTA 1LU9A 4KQEA 1QQTA 3BCUA 4CKBB 3HP7A 1P6XA 1TJYA 2K2QB 3KKQA 2OFFA 4KITB 1HG1A 2FZ4A 1RDFA 1M3SA 2O52A 4MPDA 4O08A 3VNSA 4XGNA 5AK6A 1IB0A 4B46A 3ISTA 1G9TA 4JBGA 2C29D 3R5KA 4Z1OA 2EZUA 1DOHA 1YQXA 2FZEA 3MNFA 4U8HA 3G1TA 3QPDA 2JARA 3N2GA 4JQSA 1W36D 3HU1A 1PG2A 4KE7A 2DKFA 5SV2A 5EKDA 4LJLA 1NF9A 3K94A 3FYUB 4HQ0A 1HE4A 4JL8A 1T2VA 1UKYA 1Z33A 3TTUA 3U4GA 3V8MA 1KI6A 4KH0A 3OMWA 1TEXA 3FRIA 4DDTA 1PR0A 4XDZA 2X0NA 4M1YA 5BVHB 2VEOA 3GJTA 3K0EA 4HDSA 1U1EA 2QT9A 3RQSA 4W1RA 2FUG6 2GBFA 1P0PA 2VSXA 3GT4A 2ATXA 2Z1MA 2Q4TA 1NRJB 3QMVA 1GV1A 4LHZA 4MQLA 4ZO4A 4E7PA 2YC2C 3RU3A 1TVKA 3KVVA 3CH5A 7GPBA 3A2MA 1DWPA 5D51S 3BXPA 3AIKA 2VJKA 2ZRQA 3L40A 3ONDA 1NSFA 4PSDA 3PR2B 5AO9A 5IAJA 4FOSA 3OPMA 3L8EA 3HDHA 4ZAXA 1RZRD 4KQCA 2NSJA 3AQIA 4E7OA 2Q6VA 4QGBA 3R7FA 3KTFA 4GZ5A 1CULC 3RHFA 4M7PA 3O2JA 4DW8A 2DSNA 4GMKA 4IEIA 5HILA 3NHSA 2J5RA 2BR3A 2Y0PA 3PPXA 4HDQB 5AUPB 5FL7A 2BEUA 5E4TA 1ND6A 1OE0A 1HYQA 2O3JA 1M74A 1Z5OA 2VP0A 4IV5A 1CHDA 2DHDA 3OHSX 3VX3A 3HI6A 2AMLA 1WKBA 1YZVA 2N46A 1U4OA 2VP4A 2C07A 4KH1A 2XQVA 4WFKA 3QWAA 2ZJ3A 3BWVA 3I0ZA 1ZRHA 3LQ2A 4YRAA 3GLGA 1VJ0A 2CUNA 1OWOA 1HM5A 3G9QA 3RRNA 1LSJA 4FTWA 4HUJA 4N0DA 2P9QA 3WIVA 3ZE6A 2AX4A 1E0DA 4E30A 3OFJA 5BVHA 1SKYB 1K4YA 2WUWE 3OFKA 4QA9A 4TMVA 1AKWA 1EUCB 2PUJA 3HN6A 3LY8A 3IR6A 4EUSA 2XQIA 1P1FA 3EXAA 1DIHA 2D2VA 3M8KA 4FHCA 2ZW9A 4JX9A 4YT5A 4O25A 5JSYA 3G1UA 3WMFA 2VJDA 4F04A 1J00A 4J91A 3GT7A 3RI3A 3EDQA 5FWYB 3V8PA 1I5OA 1XTRA 4IZ6A 4KUEA 4YRQA 4KOEC 5LQKA 2CNOA 1FVXA 2G4LA 1B43A 2BI4A 1JNYA 1H3FA 3H1BA 5EIOA 1QDUA 3NXSA 3ZHUA 1HNWB 1JDJA 2OO3A 3P52A 2K7FA 3T7JA 3UVEA 3T06B 4LHXA 1S2OA 4UAUA 4HDOB 3N74A 4UDNA 1JIIA 5JBIA 1DC4A 3EY4A 1BW9A 4L3OA 5CAEA 3FHOA 3C8UA 4ZJZA 3V8EA 1LRLA 1TCAA 2H2GA 4BUJA 3UTCA 3WZMA 4KJXA 3PIRA 4KRXA 5I8WA 5INTA 2V7VA 2QXUA 5HIKA 1ZI6A 1B3RA 1IIRA 1MW9X 2CL7X 2G4VA 2O8VA 2VP3A 3HDGA 3JQDA 3PNKA 3SEAA 1E5VA 3L7DA 2AQIA 4G97A 1OV6A 2XBLA 4JLWA 3IMEA 4PLCA 2VYND 4TV9A 4ZJUA 1NSTA 4I66A 1CQZA 5DGTA 5LVAA 4JUBA 4N0EA 4WXHA 3SBXA 4CMGA 5IAOA 5TQ0B 2X15A 3QTBA 4P4TA 1T1GA 1P2GA 3K70D 2OYSA 4EO4A 1NUUA 3RC1A 2JCSA 1Y5RA 1T2CA 4ZPJA 1CEXA 4DCUA 1Y1PA 1DIAA 3PLNA 2TS1A 2X9QA 2WJZB 2ZI3A 4KWIA 4MI6A 3ZNOA 4PG7A 4GX1A 4CTKA 4OREX 4Q21A 2OXTA 4ZVKA 1ABBA 3NGLA 4TX1A 4C22A 1HORA 1U3VA 1KL7A 2CK3D 5EZYF 4EFMA 3B1VA 5L6MB 4U2EA 3TAHA 1PWXA 2A14A 4R9UC 5EYPB 1XAHA 1WUKS 3NIGB 4C0XA 4DTCA 4PTLA 3ONWA 2QUHA 3WAGA 3Q0TA 1L8OA 2I2CA 1FRVA 1X1CA 3HKEA 4RD1A 1NIJA 2D3WA 4CTJA 5KOHB 4DA4A 4QHYA 1E79D 3E81A 4TWAA 3W9BA 1ZKDA 4RAOA 4NCHA 1G6HA 2XVMA 4H18A 4HNVA 1RLJA 2IUTA 2Q7XA 1K6IA 2YV3A 4MRRA 4AMBA 1XTUA 2VQSA 1EYZA 2W2VA 3E3LA 4NI5A 1R4ZA 2BKLA 4QQ8A 3VUFA 3OLVA 2A1TS 1K0FA 1CR6A 1LI7A 3G9ZA 4CLDA 4JH0A 1TD9A 1BQEA 3H11B 1M1ZA 4TKZA 4U39A 2PMBA 5CTAA 4A8JC 2PVPA 3CB4A 2F2TA 4E4RA 4ETNA 1ZNZA 3CPHA 4P7KA 4FM9A 2OVFA 4CCWA 4F45A 2CVHA 3NORA 3E8XA 4LI3X 2FOXA 3ZD8A 4DYHA 2PLFA 3B7GA 5IARA 5JCOC 3LIPA 5B7NA 4KYVA 3BIOA 2QE7A 5LMZA 1KTVA 3QOXA 3SDSA 2ZTVA 2CW5A 4FWIB 1N3IA 2XEDA 3LP8A 2YWFA 1Z2NX 4HFJA 1CPYA 2XUKA 3W3AA 4RKEA 4EFKA 4QSHA 1LVHA 3KPWA 5CLIA 2XEXA 2IEDA 1UBCA 4OQ4A 3A0UA 4I3FA 4FZ5A 1BA2A 4Y2PA 1X7WB 2OP0A 3HABA 4PSUA 5HX7A 2E2WA 3IHTA 4NS4A 1OFGA 2PGJA 1CLEA 2XA2A 1FFXB 2J32A 5E1MA 4QJBA 5G4KB 2H2IA 3VYWA 3HVRA 5HKOA 2F17A 1CE8A 3PTAA 5T4HA 1GRRA 1SCIA 2W6JD 4Q9NA 2VR1A 4BB0A 1C2TA 1YU6A 1VZ3A 2BBTA 4V0SA 2EKBA 2XMQA 3WQBA 2OD9A 2XGJA 2EATA 3NQ41 2HYDA 3A9SA 4YALA 2TSYB 4P4SA 3O8BA 3WLLA 3TKAA 4D9KA 3RTDA 5FUVA 4NLLA 2QZZA 3P96A 2B0CA 4NOLA 4EL5A 3G9UA 2D3TA 4QDUA 5MGBA 2FKNA 2I8AA 2Q4BA 1KFBB 4QPJC 2PXHA 1N5LA 1P4HA 1Y34E 3B9PA 5LQSA 2ZJAA 1HNZB 4B2LA 2Z4TA 1VHLA 3UUFA 1ZP6A 4BRUA 1EGQA 3FF1A 5BV1A 2H6EA 4NIMA 1WVIA 4LHSA 3NHLA 3NHMA 1NAIA 4U8GA 5IWAB 3DE2X 5TY0A 3U7JA 2IDZA 2I55A 3JQFA 1V43A 2QBYB 1LC3A 1M6HA 4G1EB 4G0ZA 4ZI7B 5MGNA 1FDUA 4DDVA 4AJEA 1G6KA 1D7AA 2AEJA 3M4JA 4GMXA 4FYIA 3HO6A 5J1TB 3NDBB 1UPTA 2V54A 3FF4A 5BT9A 3SBEA 3KK0A 3FRJA 3K35A 2HU5A 2YIMA 2FSHA 2QIPA 3RFFA 2DP4E 2GR9A 9ATCA 3C2QA 2EX4A 1XXHA 5HJEA 4Q3DA 3IURA 3C6KA 2H29A 4NPCA 4KTTE 1WTAA 1Y9ZA 2DJIA 1K7EB 4BMSA 3ETDA 1A8PA 1C4OA 1L5OA 1JLMA 2WD7A 4C0JA