1JA9A

Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
SKPLAGKVALTTGAGRGIGRGIAIELGRRGASVVVNYGSSSKAAEEVVAELKKLGAQGVAIQADISKPSEVVALFDKAVSHFGGLDFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGGRIILTSSIAAVMTGIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAPGGYKGMPQEKIDEGLANMNPLKRIGYPADIGRAVSALCQEESEWINGQVIKLTGGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,6,8-tetrahydroxynaphthalene reductase
publication title A structural account of substrate and inhibitor specificity differences between two naphthol reductases.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Oxidoreductase
total genus 100
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ja9A00
3RFXA 3D1LA 2VHYA 3PEFA 4OQYA 4BNNA 1MLDA 2O4UX 4C7KA 3ZWNA 4YAGA 5IDQA 1HDXA 3LT0A 3RC1A 2HRBA 2NVUB 3LSYA 4HBGA 1C3VA 1CWUA 2GGSA 3GA0A 3JSAA 3MJTA 1YJQA 1EVZA 3AJRA 5T8KA 2WWRA 3PHJA 5JY1A 4RORA 4CV3A 4ZQEA 1EQUA 1Y9AA 3L4SO 3IS3A 2Y1GA 2VUUA 3KTDA 4XGIA 1ISHA 1M67A 2AE1A 3RUDA 4ND5A 1DC5A 1LJ8A 1YVEI 4CUKA 4AG3A 4MIEA 5GZ6A 4YB8A 3OQ6A 1MXHA 1Z7BA 2EKQA 1P31A 4I08A 4BKRA 2JKVA 4UVIA 4JJIA 2Z1NA 3GDOA 5TX7A 5A03A 2BH9A 2NUAA 5JLAA 4OQZA 3ONDA 1LTHR 1R0KA 2AQHA 5AXDA 3G0OA 5EINA 1ZO8A 3JQBA 1GFSA 1Y9EA 1VC2A 3BMCA 3MTJA 4Z0HO 4CMAA 4RVGA 3MWEB 1T2EA 3STHA 1EDZA 4FFPA 3HDQA 3IUPA 1GY8A 3RUAA 1Q1NA 5L9AA 4I5GA 1X13A 4BV9A 2EW2A 1IHYA 3ASUA 4FR5A 3OIGA 4XWYA 4XJSA 2DPHA 3W4JA 5KJEA 1H5QA 4PLFA 1PTJA 1U3VA 2IXBA 1LBEA 4WUVA 3AI1A 1QYDA 2F00A 3AOEA 4D3SA 2AG8A 4MJLA 3DHYA 2CUKA 1GUFA 2DVMA 4IIUA 3JQFA 3I9NA 3ZWBA 4J3FA 1GV1A 4CLDA 2AA3A 3UAGA 1NPTO 3FRJA 3S2FA 3VTFA 3OQBA 2C7VA 1PS9A 4YT8A 3BMOA 1HLPA 2ZTLA 3H9EO 1PR3A 4BNJA 3IIEA 4B8WA 1VPDA 5I7EA 2I9PA 1ENOA 4BV8A 4BGIA 2FZEA 1CIVA 1O89A 1QLHA 1LX6A 5ER6A 2A4KA 1OBFO 1ZVMA 2BELA 2JL1A 2R00A 4UVHA 4JK3A 4MO2A 5JC8A 1Q7BA 3Q9NA 2VT3A 1GAEO 1YOVB 1CETA 3KSUA 3RI3A 3HDHA 3ZW8A 4PZDA 3I6QA 4ZD6A 3SXPA 4FC6A 1I10A 3KB6A 1LUAA 4J91A 4ND3A 4WLEA 1E1NA 1Y6JA 3JD2A 3HG7A 4QSMA 2LDBA 5JSFA 4K1LA 1XQ6A 2I3AA 2QIOA 3KYDB 3ICCA 3BMCB 1U3WA 1X14A 2JHGA 2X4GA 1QV6A 5A3VA 1WWKA 4DL9A 5I7SA 4JBIA 2HK7A 4Q3NA 3BAZA 1KVQA 5JAZA 4TRJA 3U09A 3MJEA 1BXGA 4GX0A 2IODA 1GYRA 4WCFB 5JW6A 3JYOA 5DZSA 4GGOA 2ZIZA 3TDKA 2J5QA 2I67A 1TT7A 4Z0TA 2VHVA 4B3IA 3UCFA 1SB8A 5JFOA 3PJEA 2VRCD 5KVSA 1VE9A 3E6AA 3FNHA 3ON5A 4CM9D 2J3JA 4XKJA 1B15A 3JD1A 2JCYA 2DBVO 3H2ZA 5KVQA 1OZAA 2WYVA 4KDFA 4NJOA 3PPIA 5KVCA 3PTZA 3RBVA 5A9TA 3C7DB 1K3TA 1LDEA 1P1KA 2QG4A 3GY0A 4L4SA 4B7CA 1CYDA 1EVYA 3VPHA 3A28A 3WYBA 5L7YA 1P1RA 4Y6RA 3RROA 3U9LA 4UVGA 3A9WA 1H2HA 3W8DA 3EVTA 4ZRMA 4CM5A 1E6UA 3GH3A 4OMUA 5F1KA 3WWYA 4EYEA 1W73A 1MB4A 2NNLD 1XG5A 4M89A 4FB5A 3ZV5A 2C2YA 3I9MA 3E03A 5TJHA 1J49A 4BNFA 2EG9A 5G0WA 5JDCA 2V7PA 4FJ1A 1DIHA 4CM7A 1E3WA 1ML3A 2G82A 3DBVO 1NBOA 3L6EA 1GUZA 1SC6A 4K28A 1BTOA 3SJUA 1LLQA 2PV7A 2VCYA 3D5TA 1LC3A 1P3DA 1ZW1A 2DFVA 3DMTC 4J43A 3WQRA 4CMIA 5FWNA 5IXSA 2CMDA 1E3IA 1FDUA 4E33A 3BHJA 4BNLA 3DBRA 1B2LA 3WIDA 2XPCA 2C82A 3OJOA 2Q45A 3OICA 2IZ0A 4NIMA 3BMQA 3JQ9C 2CD9A 1I2CA 1PJCA 4YJGA 5KWEA 2PKQO 2X22A 3HN2A 2FR0A 5JYDA 3PI7A 1SMKA 4XQEA 4ALLA 3R6DA 2JD0A 4CODB 2VNSA 1D4FA 1RYEA 1T4BA 2DLDA 2W4QA 3AU8A 4L4XA 5DT9A 5LDHA 3KETA 2GASA 4B8ZA 1C1XA 4JJFA 2DU8A 4OYRA 2IXAA 3KOUA 4AL4A 3H3FA 1R37A 4J0EA 3CKYA 3IUSA 4YRBA 2UDPA 1G1AA 2VWPA 4DXHA 1Z82A 3Q6IA 3WFJA 2EJWA 4HKTA 4ILKA 4KOAA 4U6QA 1LI4A 1YO6A 5JY6A 5KTKA 4E5NA 1YQDA 3UUWA 2Q2VA 1NPYA 4TRMA 2JJYA 2J6IA 3BZUA 2GR9A 2BFPA 4YA6A 4ALJA 2EIHA 1QV7A 2C5AA 3DOJA 3HSKA 3WIEA 2WMDA 3I9KA 1QR6A 3LK7A 4HFRA 3L9XA 1VL0A 4A73A 1X7GA 3L6OO 5BQFA 1HDGO 1ISFA 2VRBA 2O7QA 1WPQA 1JA9A 2EP7A 3QRWA 5G4KA 6LDHA 2I99A 4R1SA 4Y9DA 5I7FA 3ZI0A 5K6AC 1AUPA 1M66A 2IYPA 3TN7A 4G81A 4MIYA 3KUXA 2SCUA 3M6IA 3W4KA 3NUGA 3NTOA 4PLWA 3GZ4A 5EN4A 4CMIB 1GDHA 1NQTA 3DBRB 1XEAA 4IDGA 1PJBA 4JBHA 3ZHZA 1B16A 3JD3A 3BYZA 3JCZA 2E4AA 4B4WA 2VRCA 2ILTA 3GUCA 3CE6A 1T2DA 4CM9A 3FTPA 2WD8A 1C0LA 3JQGA 4ND2A 4E2XA 4YVFA 4EZBA 4NHEA 4EJ6A 2OUIA 4RVUA 1F8FA 3H3JA 3GGOA 1GZ6A 3MJ4A 3VKUA 3HFSA 4P4NA 4M87A 4CQMA 1LXCA 1PJLA 1ZMTA 5DDIP 2GLXA 1M2WA 5T64A 4HV4A 1X7DA 2QRKA 3B6ZA 1B0AA 4O1MA 1PGOA 3ANMA 4NBVA 3DZGA 1LNQA 5JPIA 4AJLA 5A1TA 2JAHA 1QG6A 3BTSA 3FF4A 3IAHA 4DGSA 5CPFA 1YL7A 4ZQBA 1ZK1A 2ZATA 1QORA 2Y66A 3GRKA 1A4UA 4U5QA 3PP8A 5IZCA 4E4YA 2P9CA 2DBQA 2DBRA 3INTA 3JYQA 1PZEA 3DBHA 4ZA2A 4S3MA 1EFLA 2NM0A 1DIRA 1R12A 4PGFA 2Q50A 1WZEA 1E77A 1ULSA 3I5MA 3QVSA 4GL4A 5B12A 4K26A 4E0BA 3SJ7A 3QY9A 1XIVA 2O48X 1A5ZA 4YWJA 1E1MA 1BVUA 5I8ZA 4LRSB 4XYEA 3OEYA 4WLNA 1E3LA 1XHLA 3DB2A 4PLGA 2X5JO 3DFUA 4H7PA 5A05A 2Q2WA 1CRWG 1Y7TA 3PRJA 3ZW9A 4ZQGA 4J1QA 4KDEA 3ULKA 1BXKA 3H5AA 1KVUA 4CM3A 4E6PA 1VL8A 2E37A 1ULUA 1ZKMA 4B3HA 2V65A 3AUTA 1ZK4A 1JKIA 1QRRA 3EW7A 4XD2A 4E32A 1PQPA 3PZRA 3BTVA 1PGQA 3P5SA 4B7XA 4R3NA 2O2YA 2NADA 4CM1A 3RIHA 2AG5A 4GLOA 3RUEA 3RKUA 4R68A 5FI5A 3RUCA 3JQ7A 3GVXA 1Y8QA 2EHDA 1B14A 2JD1A 1D1SA 5CP8A 1NX6A 3GVHA 1GL3A 2WYWA 1DAOA 3I4CA 1ZSYA 5L4LA 2ZTUA 4PG6A 1NVTA 4CMGA 4XB1A 4CQMB 2BD0A 3IDSA 4DREA 3KBOA 1R15A 3DZBA 2FSSA 1P44A 3BMNA 1K2WA 4HFNA 4YACA 2PGDA 4NI5A 2RIRA 3KXDA 3M2TA 2O3UA 4NBRA 2YJZA 5I9LA 3JQEA 1Q2XA 4NMHA 2HMUA 1QYCA 2PZKA 2HMSA 3GEMA 1Z73A 1AHHA 1BHSA 4YJFB 4JP2A 3JYLA 3X2EA 2EXXA 2O3SA 1LSUA 2D0IA 3QP9A 3NT4A 1EK6A 1Y81A 3QW2A 1PJSA 1DPGA 2VN8A 1F14A 4FFNA 3OBBA 2GZ2A 5TS3A 2Y1EA 5B4UA 4U8GA 3D5QA 1DIAA 1HYEA 1N9GA 3D7LA 4OGWA 4R9RA 2J3IA 5L7WA 2VZ8A 2WE8A 2ZJ1A 3FPCA 4F3YA 5EQDA 1NNUA 1A27A 3LC1O 3SX2A 2EF1A 4TVOA 2P9EA 3B1KA 1SB9A 3AI3A 4XYMA 1HE4A 4OM8A 3UN1A 3WICA 1P0FA 4DPMA 3VDQA 2O3QA 3W8EA 1M76A 1RKXA 4R16A 1T2CA 1XR3A 3OIFA 1NQOA 5BSFA 2IEBA 3BXXA 9LDTA 3FTNA 4IXTA 2EGGA 1VRWA 2PR2A 4QECA 1SOWA 1IZ0A 1R4MA 3C7CB 4YAKA 2YFHA 5H82A 1L7DA 4FIZA 4BNKA 4KUEA 2P9GA 4CMEC 4K6CA 4E13A 3L0DA 5EIOA 5AXBA 4IS3A 1YH3A 3ZNQA 3CUKA 2WD7A 3QQPA 2I66A 1JVSA 4IJKA 3D0OA 3DC2A 1BGVA 3KEQA 3IMFA 4I9NA 2F1KA 4IQGA 2CF6A 4MVJD 2GN6A 1VJ1A 1J4AA 2BI8A 4OOEA 3BA1A 1AXGA 3PQDA 3I52A 3KVOA 1IZ9A 3D64A 2EV9A 4KTVE 2DAPA 1VSUA 3QJ5A 4OKIA 4IINA 5CDSA 3P2OA 4ZU3A 3AY3A 1LA2A 5DNAA 1I0ZA 5JYEA 2H5LA 1WW8A 4XR4A 2X5OA 3BTUA 3TZKA 1CQIA 2OBYA 2X0NA 3FWNA 1MUUA 3VZPA 1NVGA 1GU7A 1ZNQO 4ZICA 3O03A 2GYYA 3H9GA 3BIOA 2OBNA 3S2IA 3ZHYA 2ZCUA 2NU7A 2D1YA 4OH1A 4YYZA 4D0SA 3JQDA 1CQJA 3ZGYA 1ZUD1 2DFDA 1EUCA 2QZZA 6ADHA 1JW9B 3GG2A 2X0IA 5AYVA 1N9GB 1K89A 1ZK2A 5G4LA 4AJHA 2FSVA 2HRZA 4JX8A 2VYVD 4CQLA 3RC7A 4CV1A 1RYDA 1NQAO 5GZ1A 3GUYA 4OXKA 1R16A 4XQ9A 2NU8A 2AHRA 3D4PA 5U1PA 2EGHA 4B7UA 2OO5A 1QKIA 2C5EA 2RCYA 4UAGA 1O94A 1DOHA 3K73O 3OIDA 4M49A 3FN4A 5LCXA 1PJTA 5T6BA 2B4QA 2TMGA 1R4MB 2FPGA 3G17A 1DO8A 2J8ZA 5JO9A 2O3TA 2GSDA 3H65A 4BNHA 4UREA 1DRWA 1ZMOA 1NWCA 3ZWYA 1RM3A 1HE2A 2P4QA 3ZWWA 4N54A 4DLAA 3UXYA 1YJ8A 2GO1A 3HFGA 4BS9A 3N7UA 1GPDG 3TZ6A 4XCVA 2D5AA 2FR1A 2AW5A 1PWZA 4TZKA 1LDBA 4RF4A 5A04A 5A9SA 3OA2A 1T26A 3RJ5A 5A5EA 5IDXA 7ADHA 2B4TO 4QFDA 4BO9A 2W2KA 3SLKA 1GPJA 1QSGA 3FBTA 1UXGA 1I01A 4CV0A 4AJ2A 2BFAA 3WYCA 4NR0A 5A9RA 2X9VA 4TSKA 3NGLA 3VPSA 2VYND 4P4LA 1O0SA 1DEHA 4UEKA 3W8FA 2DC1A 4JP3A 4Q3DA 3RFTA 1XCBA 2D5CA 5IFLA 3WLEA 4FSHA 2AMFA 2HAEA 3PLNA 4BO6A 1LEHA 2JFFA 5CPBA 5TF4A 3UICA 3FI9A 3V5NA 5L53A 1OAAA 5J23A 4I5EA 2GRAA 4WCFC 5FEUA 2BRUA 5ICSA 1Q7CA 1Y1PA 5JS6A 4GX1A 1YBMA 3C3XA 3B70A 4UUMA 3AOGA 4M55A 3KYCA 2PY6A 1LLUA 4L0QA 2OXIA 3WGZA 4F45A 4Y6SA 1PJ2A 3NDRA 4DIFA 1WDMA 3UW3A 4ONEA 3KYBA 3NKLA 4IGFA 3OA0A 4RDHA 3D4NA 3VPXA 2WYUA 1N1EA 4B4UA 2Y99A 1HF3A 4J90A 1CERA 1O9BA 4IY1A 4XR9A 3ZHBA 1MG5A 1UP7A 3U4IA 5HRUA 4TWRA 3NAQA 3OJ0A 1E7SA 3JQ6A 4GMFA 2FR8A 4DRYA 4YT4A 4CM8B 1X0XA 3JQ8B 4FGWA 4GX5A 2G1UA 1ID1A 1MC4A 3IKVA 3GDGA 4GKBA 4KMSA 5CFZA 1HE3A 2OMEA 1TT5A 4GPD1 3WSWA 3KSZO 2D59A 4URFA 5A9SB 1DIBA 3H9JA 1U3UA 2PFGA 3AUAA 5IN4A 3ZZNA 3W6ZA 4OXYA 4D41A 2QYTA 1RWBA 3BHIA 4YPOA 3RVDA 2W2KB 3GGPA 5K9ZA 1XSEA 3W4IA 1M75A 3NX4A 3GNTA 2IZZA 5KJ6A 4XZ3A 1SNYA 3GVPA 1M6HA 2GPTA 1CJCA 4GI2A 3I23A 4DIBA 2G0TA 2DUWA 3C1AA 1B7GO 2YDYA 3B1FA 1U8FO 4JGBA 2VYVA 1HYGA 3TOZA 4J7CA 1HXHA 4R41A 4TKLA 4HXYA 4RQUA 4PG4A 3WGHA 2RBEA 4J2OA 5HS6A 4JXKA 4RL6A 2PKQP 4H15A 4WEQA 5JBIA 2XF8A 5DCUA 3NV9A 5HA5A 3RUIA 1NP3A 4CLOA 4HADA 1HE5A 2ZJ0A 2PWZA 2Q46A 4P4GA 1GQ2A 4UUOA 3WR5A 3V1UA 4EI2A 1M6WA 3AY6A 4OJNA 1X0VA 1JN0A 2I76A 2Q1SA 2PLAA 4GQAA 4XGNA 2ZB7A 4WNIA 3TL2A 4BO2A 2YQ4A 4YXFA 4LN1A 2IYOA 4EW6A 2AQKA 3V8BA 4CLRB 3K8ZA 1UH5A 3G1TA 1LRKA 2AQ8A 5H81A 3CPSA 4J2HA 4EJ0A 1YS4A 2BFOA 4FOOA 2D8AA 1UP4A 1L1FA 4LISA 3AI2A 4LMPA 1J0XO 3U0BA 3WYEA 4D42A 1PEDA 1U5CA 4NJMA 4CMHA 1IHXA 3F9IA 1UAGA 3PIDA 4NZ9A 4RO0A 4L74A 3ZWXA 3VVBA 3AWDA 3INRA 3RCBA 3K2EA 1KVRA 2JCVA 3MJVA 4QXMA 4Q3BA 2C07A 3PGJA 3GFGA 8LDHA 5ITVA 3O9ZA 2IEDA 3EY4A 1DIGA 1ZJZA 1ZK0A 3DTYA 1EBFA 5CDGA 2WDZA 4OXNA 3M1LA 3UVEA 3PDJA 1B8PA 1ZK3A 4R1TA 1ADCA 1HTBA 3NDIA 1GD1O 1JTVA 5IDWA 4MVJE 3U3XA 1YL5A 2X6TA 3KLMX 4IQ8A 3V2GA 4I8XA 2EEZA 4J1NA 4XQCA 3GOHA 1C1DA 1UDCA 4YDRA 3TPCA 4DA9A 1YB5A 2WEKA 4CMJA 5JAQA 3IL2A 4DYVA 1LU9A 3MEQA 5HBRA 1BXZA 3OSUA 2Y68A 2NTVA 4E12A 2YDXA 3TZCA 1ZEJA 1X1EA 4M1QA 9LDBA 4JN6B 1PZHA 3IC5A 3C1TA 4ND1A 3WBFA 5IDYA 2EKLA 1IOLA 1YE3A 4JBGA 3F6YA 4JROA 1NFFA 5KKCA 4RVHA 3VDRA 2FRDA 4EBFA 2G17A 2G5CA 2C59A 3HB5X 4NBTA 5DCYA 3JTMA 4WLFA 1YQXA 3WLFA 5JC1A 3FNGA 2RAFA 4ALIA 4ESOA 3E18A 1P45A 1I3KA 3R0IA 3UFXA 1PZFA 3GF4A 3OQ1A 1WP4A 3ZWOA 5KOIA 2QYSA 4QFCA 4TRRA 3ZU2A 2CVOA 3BMOB 3PJDA 2LDXA 3R3JA 5EESA 1D7OA 5A02A 1PS0A 2Y93A 2DUUA 4IJVA 4XDZA 1GYQA 4E30A 2PH5A 4YAEA 5I8WA 2DTDA 4HNGA 1H6DA 4IDCA 1K6IA 3LLVA 2CFCA 3A14A 4E31A 5JDIC 4FW8A 4YJDA 1YBAA 5ADHA 1ZEMA 5ES3A 4CR7A 2B36A 2YYYA 3VPFA 4DIOA 2PD6A 5CG1A 1C0PA 2OL4A 1U5AA 1ONOA 2WE7A 3INGA 1KVTA 7MDHA 3N58A 1RPNA 1I3MA 4KZPA 3CH6A 3WQSB 3S55A 3PHGA 1UXKA 1I5RA 5AVOA 3RAJA 3WOHA 1EUZA 2D2IA 3ITKA 4E5PA 1XGKA 2PZMA 1A4IA 1PJQA 1AXEA 1EVIA 3U4HA 4FFMA 2HUNA 2JAPA 3RU9A 2X5KO 1JU9A 4FCCA 3VH2A 4BQPA 2BFMA 3KSDO 1SBYA 1U7HA 4LGVA 4MVJM 1KETA 5DP2A 2EP5A 1BXGB 4P22A 3GN2A 2X0JA 1E7QA 5FFFA 1MGOA 3HWRA 3F1KA 4XDYA 1G6KA 5A3JA 2EJVA 4PLTA 2JCXA 4RVDA 1X7HA 1EQ2A 1H9BA 4FBGA 4I9UA 3WG9A 1HDOA 2J5RA 3V2UA 5A5FA 1Z74A 3GMSA 2NACA 1LLDA 2ZTMA 3RBXA 4IMRA 1MXFA 2HO5A 4QQRA 1E3EA 2GZ3A 3KM0A 2CSUA 5FI3A 3AFNA 3EMKA 5DP1A 4DTIA 4Z9FA 3H9UA 3RU7A 4C4OA 4XQGA 5CHEA 1H6AA 2OFPA 5DBIA 4ID9A 3F1LA 3LC2O 3FR8A 4PVCA 1LSSA 3RASA 1XA0A 2VOEA 1VKNA 1NR7A 2Q1UA 2EW8A 3K5PA 1YL6A 1A9ZA 1YB1A 1E3WB 5COAA 1NM5A 4AICA 2CDBA 3WTCA 3ZDFA 5ENDA 1OFGA 5COBA 2QRLA 2YW9A 4CLEA 2HQ1A 1DJNA 4W6ZA 1WLYA 1ADFA 4LVUA 2X1HA 3ZV6A 1WMBA 2Z95A 3UH1A 4XB2A 1B3BA 5F5LA 1LDYA 2VWHA 5GMOA 2DPGA 3Q3CA 1HDYA 1HZJA 3DZHA 5ENVA 1E6EA 1T24A 4B4VA 5C5IA 1KEWA 3BMQB 2EERA 3DOOA 4TZTA 3BTOA 2E6UX 4YJGB 2E48A 1V0JA 3NGXA 1EE2A 3ZV3A 4DYDA 2H6EA 5ILOA 3DL2A 1O95A 3DFZA 4BO7A 3O4RA 1I8TA 4S1VA 1NHGA 5EJ2A 2J5KA 2PH3A 5BNFA 3H8VA 3DMTA 4DC0A 2VWGA 4IM7A 1GZ3A 1VL6A 1O5IA 1BRMA 1FDSA 4D79A 3VZQA 1C1XB 1UAYA 1V3TA 3HJAA 4W82A 5K0ZA 3L07A 3PJGA 2Q1WA 2PA3A 3Q2KA 2X23A 5T57A 1K6JA 2VWQA 3CMMA 5FYDA 1ADGA 3E1KA 3JQ9A 5F3RA 1ZIDA 1T2AA 2HK9A 3EK2A 4D3FA 1UP6A 2J3KA 3P7MA 1GZ4A 4HP8A 2AEFA 3GLQA 4X54A 4J1TA 4R4JA 4ZQHA 2ZB4A 5T67A 4AJ1A 1NTOA 2C0CA 4R5MA 5IZ4A 3EAGA 1U28A 3AY7A 3VZSA 1ISJA 2CNBA 4BO1A 4DWVA 1N1GA 1JKFA 3H5NA 1HEUA 2B4RO 3U49A 4ROSA 1F12A 4BNYA 5G4KB 3OECA 3E5RA 1QLJA 1DFHA 4RCVA 4RV9A 1H6CA 1KERA 3WS7A 4RJTA 1MX3A 4BVAA 4PG7A 2PGLA 1TVEA 1B3RA 1RM4A 3KO8A 3V2HA 3C85A 3A4VA 4PZCA 2ZB3A 4AJJA 5C7OO 2Q3EA 2ET6A 1NHWA 4KUGA 4C7JA 3PWZA 1GCOA 3AU9A 5HTOA 1I32A 4R1UA 5EPOA 1U4SA 4IS2A 2P68A 2NU9A 3IJRA 4Z0PA 3U4CA 3ROQA 2AXQA 4YTEA 3C7AA 1PL8A 3JYNA 3PQEA 2FMUA 2VUSA 1QYXA 3JQGB 4MP3A 5K6AA 4ZGWA 3ZU4A 1FXSA 3K9QO 3WTBA 4ZHSA 4E2WA 2YV2A 3GEGA 5H83A 1VM6A 4OHUA 4CM4A 1HDZA 2H9IA 3O26A 2AEJA 1L7EA 3GVIA 4MOWA 3O38A 1EMDA 2HU2A 4CUJA 1TA4A 4F6LA 5TLSA 4NFHA 1BDBA 3PYMA 3LT1A 4JCOA 3ZWCA 1PGPA 2PTGA 3SC4A 2O23A 3H6KA 3NEPX 3GG9A 3ENNA 3O8QA 2DTEA 4W4TA 4XYGA 1E5QA 2GUGA 3PHIA 2YZ7A 4LCJA 4OO3A 1KBZA 3TZQA 4A2CA 1H94A 2Z5LA 1JLLA 3NDJA 4LMRA 3WJ7A 4J4TA 2TMDA 3DBHB 1WMAA 3ABIA 3F47A 1A7KA 4FN4A 3FNEA 3DZFA 1T1SA 3AFMA 2VHZA 1K5HA 1P74A 4XGKA 5TT0A 3JQAD 1K6XA 3RC2A 5L95A 1LC0A 4A5OA 2GZ1A 1ISGA 4BB5A 3NJ8A 1I2ZA 2AQIA 1JDJA 3T7EA 1WXDA 3K92A 2A9FA 1NR1A 3QSGA 3I6IA 3H9QA 3LQFA 3TNLA 2Z1MA 3HN7A 4RPKA 5F1PA 1SPXA 5B1YA 5KJ1A 1FDVA 3LF1A 1E92A 3ZWAA 1W0CA 1DHRA 3MJCA 4HY3A 1B8UA 4BNGA 2CDCA 2NSDA 3E82A 1AN9A 3TZHA 4M54A 4BNMA 5TRTA 1PL6A 3P19A 4GBJA 3COSA 5AXAA 2FN7A 3K2BA 4WLUA 2JFGA 4Z3KA 1AE1A 3GNSA 5DCWA 2W2LD 4YRDA 3RQSA 1PQWA 2QW8A 3LLSA 4PLYA 2B37A 4XYBA 5ER9A 3GR6A 2H1SA 1C0KA 2UAGA 1P1FA 5TGDA 1Z7EA 1MA0A 2Q4EA 3PHLA 4LVCA 4KWIA 4EDFA 1N7GA 4L75A 3JQ7B 3GAFA 3GZNA 5LDGA 3VKVA 1Y8QB 1PSDA 5JMPA 3PWSA 3NT2A 2UYYA 3QWAA 1I24A 2YV3A 2XXBA 3F4BA 1PZGA 3OHSX 3TSCA 3W1VA 5CDUA 3L4BC 4W9NC 2V6BA 4W7HA 1N5DA 2A92A 3BMNB 1IY8A 5AXCA 4J0FA 2CVZA 3O8QB 3PYXA 2NQTA 2C29D 3RKRA 2DKNA 2AEMA 3HB4X 1MFZA 1KY5A 4WNCA 4GVLA 1VSVA 3WBBA 1KEPA 2PK3A 4J9UE 1V35A 2V6MA 4II2A 2PD3A 1F06A 2X58A 4Q9NA 2HMVA 2PKRA 5DOZA 2IDZA 1A71A 4ZJUA 5JMWA 3GN1A 1YRLA 2RHCA 1EDOA 5B4VA 1NYTA 4NK4A 1R0SA 2Y05A 1KS9A 3QE3A 1GV0A 4B4OA 4KTTE 1DHTA 2XAAA 3T4XA 4WCDA 4II3A 1U2DA 3FHLA 1GADO 3DQPA 3MJSA 4ITUA 4FFOA 4BGEA 1PU2A 5JCJD 3FBGA 3GMDA 3NTRA 3DMYA 3MWDB 4ZN6A 1KIFA 4A7PA 3PVZA 4DMLA 3QWFA 2PGJA 3S1LA 3S2GA 3I83A 3HHPA 1VJ0A 3OMLA 1BVRA 1Y5MA 3IP3A 5TT1A 4Z6KA 3RUHA 1T4DA 4DC1A 2P5YA 2QHXA 3ZNNA 4CL3A 2QQ5A 4U0KA 3WQQA 4G5HA 3P2YA 1LQUA 1LSOA 3SBOA 2GN9A 1HZZA 1LQTA 4BL5A 4IZIA 1YDEA 4YRAA 1UXJA 1E3SA 1LDMA 2DM6A 5EQFA 1R66A 2HMTA 2WD7B 2BGMA 5G0VA 1P0CA 5T8KC 3UOGA 3C8MA 2HLPA 4WOJA 4YEDA 4NQZA 3WGGA 4XIYA 4XRGA 3ADOA 1QYWA 4TVBA 2P4HX 4AJ4A 3WSVA 4YQZA 1EE9A 3JQAA 4RQTA 1HYHA 1EUDA 4MKRA 3AM4A 5G0UA 1Z6ZA 3UGKA 4IDDA 2C20A 1QYVA 4CJXA 5BSEA 3CXRA 4IDFA 1I3NA 1TI7A 2WSBA 4L4RA 4LW8A 4CMEA 4BMNA 5CAEA 5KNLA 2GN4A 1R0LA 4EEZA 1GCUA 5EMHA 5C3MA 4NBWA 2NLOA 3VH1A 1E7WA 1YBVA 2ZTVA 3JQBC 1Q0QA 4E5MA 1YB4A 1JAXA 5ITWA 3ZWVA 2O3JA 4UEOA 1ORRA 5L4NA 5U4QA 4TRNA 2W2LA 1U8XX 5JAIA 3C24A 3GAZA 4W7IA 3WNVA 1XKQA 4L8VA 4NNJA 4DBZA 2YUTA 3GC6A 1NXQA 4CMKA 4CQLB 3ETEA 3EYWA 4E3ZA 1DB3A 1S7CA 3AOEC 1UXIA 4JJGA 5KJFA 3DZJA 3JD0A 1ISIA 4Z9YA 4ND4A 1I36A 3JQFC 5BR7A 3WGIA 3MOGA 4MVJA 3DEYX 4E21A 1RM5A 1X1TA 2O4CA 4YQYA 4D0RA 2ZKLA 4PCVA 5G2OA 4D46A 3GPIA 1LLCA 1U9JA 2CF5A 4CL8A 1DRUA 3VTZA 2BKAA 1DC6A 1VLLA 5THKA 4O0LA 3AM3A 4YAIA 3EUWA 5EL0A 4H16A 1GQQA 1KYQA 4N5LA 5A4DA 4CM6A 5HWSA 3UKOA 1GR0A 4IPTA 2A94A 3K31A 2HKIA 4MIOA 2RH4A 5IG2A 2E82A 3E5MA 2DBZA 2R00C 2NWQA 2D3TA 1YXMA 4OOFA 1IYZA 2V6FA 2X0RA 2FY8A 5IAAA 1ZCJA 4GGPA 4P8RA 4A03A 3TFOA 4CR8A 1XU9A 3K96A 1HSZA 3ROKA 4ALKA 2CZCA 2DQ4A 5L4SA 1BSVA 5JCJA 1Y8RA 1AHIA 2Y1OA 1YGYA 5F5NA 3CIFA 3E9QA 4ZVVA 4N7RA 5C7LO 1Y5RA 4D7AA 2GERA 3I4FA 4AJNA 3GQVA 4L73A 1JVBA 4HX5A 4NFYA 1XDWA 1Z45A 4WLVA 2FOIA 3W6UA 1F0YA 1E5LA 1YOVA 2B69A 1E0DA 2B83A 4OIMA 4HWKA 4WE3A 2I65A 3PGXA 3C1OA 1KEVA 4UULA 1SEVA 3GVCA 1DFGA 5GZ3A 3ZNOA 3SC6A 4CV2A 4B79A 4PLPA 2Q1TA 2Q49A 1H2BA 3CZMA 3WX0A 4ALNA 2VNAA 3KYCB 3VH4A 4BNXA 3T4EA 3KYDA 3U4DA 1DXYA 3ZN2A 4BOYA 2Q4BA 3OEWA 4F6CA 1N8KA 4E2YA 4RGBA 3HADA 3SVTA 1NASA 5LC1A 3I9OA 4BNZA 1SCUA 1F8GA 1XQ1A 2BMAA 1KEUA 4AJOA 3A06A 4H3VA 5F21A 4WCFA 4JLWA 3DWFA 3Q0EA 3K6JA 4RLHA 4D43A 4NU5A 3VHRA 4NBUA 5IN5A 2GF2A 1DBVO 5DULA 2BI7A 1U4OA 1SZJG 2EKPA 2OP1A 4KQWA 1N2SA 2GN8A 2VYNA 5I7VA 1TT5B 2OORA 2FHSA 1WDLA 3F5QA 5DBFA 1J6UA 4DLLA 1UDAA 2Y0EA 4LK3A 5JDCC 1Q0LA 4Y98A 3QLJA 3ZU3A 4BHTA 5COQA 3X2FA 4J7XA 4RZIA 1NAIA 5BNIA 3H2SA 4A27A 1OC4A 2CVQA 1ISMA 3PK0A 1ZH8A 2BGKA 3DTTA 3OP4A 4D45A 3HUDA 3DR3A 1PL7A 4D44A 1Y8RB 3NJ4A 3H4VA 1XYGA 4FPXA 3TRIA 3AM5A 4QX6A 4NFSA 3CEAA 5CEFA 2GD1O 4RPHA 1N7HA 4RVFA 4MP6A 3ZWPA 4IZHA 4Q39A 5JCXA 4PVDA 1G0OA 3QWBA 2I3GA 4BUCA 4EEXA 1MP0A 3RD5A 1PS8A 4CMBA 4ALMA 2BHLA 4BO8A 4CLOB 2ZB8A 3I9JA 3LU1A 3E8XA 1PWXA 4JNKA 3GNQA 3HQ4O 3ZU5A 1W4ZA 1H6BA 3Q2IA 4FGSA 4EJMA 4U6SA 4R9SA 4BKQA 3G1UA 4E2ZA 3ITDA 3ZHXA 4GAEA 1W6UA 2D4AA 1UZMA 1E3JA 3EGOA 3PYLA 4BNVA 1UXHA 1JAYA 3TOXA 1JQBA 4UUPA 2I6TA 3LZ6A 1E7YA 4MVJI 4IDAA 1SO8A 4J4HA 3PZBA 2HK8A 1ZFNA 2ZCVA 3NT5A 1HLDA 4YAJA 1HRDA 3HZZA 4PLVA 4NJMB 1EFKA 5TC4A 3GK3A 4OAQA 2Y0DA 4NU6A 3Q9UA 4KWHA 3WMWA 3U5TA 5JO0A 2FPIA 4L76A 4AFNA 4YT2A 4RF5A 1SEPA 3VC7A 4IIVA 3ZNPA 5AQ1A 4XYLA 5HS4A 3F5SA 3ETGA 1ENZA 1KY4A 5JE8A 4BKOA 3D3EA 1NFRA 2UVDA 3MTGA 1WVGA 4Y6PA 3PLRA 4RPGA 2B5WA 2QZ9A 3LT2A 5GY7A 1EK5A 2OGUA 5BT9A 4BB6A 2Y1DA 2JHFA 4CQMD 1OI7A 3FCOA 4N5MA 4WKGA 1U2GA 4LSMA 1HT0A 4RDIA 3AW9A 1DRVA 4HNHA 4UUNA 3RC9A 3ADPA 3DZKA 4CUZA 4WJZA 3NRCA 1V6AA 3ANLA 4DPKA 3DHEA 3L9WA 1C1DB 1UR5A 1BWSA 2YQ5A 4N5NA 3RFVA 1GUYA 4JIGA 4U0JA 5I9MA 4A26A 3VH3A 1ENYA 3AUUA 4MKXA 4PLCA 4RF2A 4N18A 3ORFA 1PJ3A 4YCAA 1U1IA 1DC3A 4BO4A 1J5PA 1P1IA 4I9HA 4KUHA 1FK8A 1GTMA 2VQ3A 2P5UA 4M86A 1I33A 2WTBA 1FJHA 3VOSA 2ZQYA 4KQXA 1N92A 4GKVA 2O3RA 2V6GA 1BW9A 1E6WA 3LF2A 3G79A 1UDBA 2B35A 4PZEA 1PGNA 1LDGA 5IZCC 4LSWA 3M2PA 2HJSA 2DTXA 1E7RA 2YFQA 4FD3A 3KLPX 5B37A 1U7TA 3GHHA 5BNTA 2P91A 2POQX 4HFMA 5F1OA 1HDRA 1PJ4A 4G2NA 3VPGA 3H7AA 1QMGA 3DHNA 5KCZA 1YWGO 2BF7A 3PWKA 1SAYA 3DO5A 3G3EA 3ONFA 4OL9A 3QHAA 4BMSA 4B3JA 3VAZA 1FDWA 5BSGA 3MOIA 4BO3A 3QVWA 4CR6A 2NQ8A 1E7MA 3FD8A 1A72A 4NG5A 3BHMA 5JNLA 4KP7A 3Q1LA 3T7CA 3QWHA 4Z3DA 1NVMB 4XRRA 2ZQZA 4PG8A 1A7AA 3FSRA 4QO7A 4DQVA 3IP1A 1OC2A 4QTZA 4GSKA 4BNUA 2R6JA 4J7UA 5KVVA 1JWBB 2Y0CA 1ZZEA 2W98A 5JDIA 3VZRA 4RPLA 4QUKA 4MKZA 5DBGA 5CDYA 4PRLA 3JV7A 1NWHA 2B5VA 3E9MA 2W8ZA 4R1NA 4R5HA 5C37A 4AVYA 1ZSVA 3CMCO 3ROPA 4FC7A 4MPDA 3DAFA 4BNIA 3JYPA 4DBVO 4EUEA 4GMGA 2O2SA 3NTQA 4GVXA 3KRTA 3I9LA 1RM0A 3UF0A 4PG5A 3NYWA 2UUPA 1IPEA 4UVEA 4A0SA 3R3SA 5CEEA 1BW9B 2RHRA 5CEJA 2X86A 4Y67A 1EEHA 2OOSA 1I2BA 4NK5A 3RWBA 1BMDA 4F46A 5I9NA 2IRWA 4QO8A 3FPLA 2GDZA 3S8MA 1MV8A 4UEJA 5L51A 2OHXA 3LC7O 4TKMA 4TQGA 5IJZA 4FOSA 1UZLA 3HE3A 4AJPA 1T25A 4AJEA 3WB9A 3E9NA 4E5YA 4PLZA 1FF9A 2XXJA 1ZXLA 4J16A 1UZNA 4RVSA 1Q0HA 4QEDA 3EVNA 4I1IA 3JQCA 1P33A 2BGLA 3CZRA 3GFBA 1P1HA 4GLLA 1Z75A 3ANNA 3OM9A 4J6FA 1DLJA 4YT5A 4CLHA 1D3AA 2X7HA 1V3UA 3QV1A 4P38A 4YJFA 4XJTA 2VOJA 1MG0A 5DF1A 1EZ4A 1LDNA 3MZ0A 4HFJA 2UV8A 1QXSA 4DVJA 2Y67A 1H9AA 2HSDA 3QVXA 4Q3CA 5DOVA 4UVDA 1HSOA 3ENKA 3QIVA 4MINA 4D3DA 4FDAA 4I5FA 3ZV4A 4R51A 1CF2O 3CTMA 4Y8VA 4XEHA 3OETA 4J4BA 5FF9A 4WPGA 4BKUA 2VHXA 4WLOA 4IBOA 1IB6A 1P1JA 1YKFA 1RJWA 2VT2A 4NDNE 3GHYA 4WOKA 1ZBQA 3TWOA 3WMXA 4BNWA 2X8LA 1A9YA 5TJ9A 2PD4A 1FMCA 2YHIA 3TQHA 1OMOA 4K6FA 4YBZA 1ZJYA 1TXGA 3KHUA 3WNQA 4A10A 3SLGA 1C0IA 3F4LA 2RH8A 3FR7A 4I5DA 3GGGA 2YV1A 2P2SA 4IDEA 4R54A 4WGGA 5EERA 3UHAA 2PZLA 4BKPA 5HM8A 4IQ0A 1H0KA 2NTNA 3SEFA 3WDSA 4FJ2A 4CLXA 4NPCA 4O6VA 2BLLA 1T1RA 4IUYA 3CINA 4BGVA 2EWMA 3G49A 3L6DA 5G0TA 3VVCA 4R69A 4YJHA 3DXFA 5TNXA 4G65A 4DLBA 5ICMA 1B26A 3OJFA 3KV3O 4Z9XA 4DMMA 1TEHA 1IL0A 2X9GA 2I5PO 1C14A 3IOYA 1MC5A 4J9VA 4IJUA 4YR9A 3DOCA 4TMFA 1VKOA 4RF3A 4FFLA 1WNTA 1F17A 4CMCA 4IGEA 1DAPA 1CDOA 2JD2A 4GH5A 5L3ZA 3N74A 3OFSA 3B1JA 5THQA 3LVFO 3M1AA 5T5QA 1BDMA 1S6YA 3EDMA 4BIIA 3TL3A 3PJFA 2PZJA 5JAMA 1OOEA 4FJ0A 5IXYA 1KC1A 3QVOA 4EITA 5JXWA 2IZ1A 2WM3A 1XLTA 1B8VA 1V8BA 3A1NA 1HDCA 2YY7A 1P77A 2C2XA 3QWIA 2VZ0A 4MVJP 4BMVA 2NU6A 1PIWA 1I3LA 4GSLA 1GEEA 1YONA 1LRLA 2C54A 1KC3A 4GWKA 4DUPA 2HDHA 4CM4B 2ZYGA 4Q3EA 2E49A 3EC7A 3ZWMA 2G76A 1DLIA 1YQGA 1EVJA 3PXXA 4OKNA 5KIAA 1O6ZA 2VHWA 4AJIA 1O8CA 1XU7A 2YHIB 4IXWA 4E5KA 1K0UA 1E1LA 1VJTA 2CDAA 2VUTA 4DQUA 1IE3A 2B0JA 4U7WA 4OSPA 4IDBA 2IE0A 2FWMX 3OF2A 4M8SA 4BGUA 2HMWA 5TQVA 2DT5A 4XX0A 2ZK7A 1GYPA 3JD4A 1WZIA 4DQXA 1DJQA 2Y1CA 4FQ8A 1X15A 3DBLA 3GRPA 5ILGA 4EUHA 4EUFA 2JFHA 2W90A 3UCEA 1LRJA 5C7IO 3PFWO 4DPLA 3LYLA 8ADHA 4YJHB 5MDHA 1D8AA 1HL3A 3HDJA 3KZVA 3OH8A 4MVJG 3WWZA 5TIIA 3AUSA 3PQFA 3WFIA 2NTJA 4W99A 4K9DA 2OZPA 1KOLA 2ZYDA 2VTEA 1DSSG 1IULA 1D1TA 1NFQA 3EZYA 4PRKA 4MP8A 3EHEA 3ASVA 5KKAA 3EZLA 4OSOA 4GWGA 1DC4A 3R1IA 4MVJH 4O59O 1UUFA 2FPPA 5IF3A 4NH4A 3AK4A 3U62A 2QX7A 3D4OA 3DAPA 3ICPA 1HETA 5TSDA 1ZXBA 1KVSA 3B20A 5KJCA 4INAA 3WGQA 1EBUA 2CY0A 3ETDA 2OP0A 3PFFA 2O7SA 2O50A 3WJAA 1PX0A 5U9CA 2Q2QA 2X9NA 4BQRA 3QVTA 4ZQFA 3S2EA 5A06A 2NVBA 1ADBA 3GEDA 4Q3AA 2Q99A 1G0NA 2J3HA 2NV6A 1SOVA 1VI2A 4IJWA 3K30A 4O5OA 3D3WA 4WEOA 3WGOA 3F3SA 3I3OA 1I30A 1IPFA 3GT0A 3V1YA 1WDKA 3GZNB 3I1JA 1ONPA 1XWFA 1QP8A 4FFRA 4J49A 3RSHA 2FP4A 2VZ9A 4JQCA 4WECA 5L40A 3PHHA 5DN9A 1UJMA 5MGBA 3ZH2A 3UCXA 4WK6A 1R4NA 1V9LA 5B4TA 1ONNA 4BO0A 2PNFA 3HNPA 4PLHA 3TJRA 4QT0A 3WGYA 2H63A 1MFPA 4R01A 3Q11A 1XELA 4O63O 1DDOA 3MCVA 1GEGA 1GQYA 3CSDA 4ZRNA 4TROA 2YHUA 2VTDA 3ONEA 3FWZA 4L9RA 1NPDA 2A35A 2GCGA 3IQDB 2QRJA 3L77A 3WGTA 1TLTA 2NVUA 3DBLB 1CEQA 1JKJA 2HJRA 3RBZA 4AJKA 1ARZA 5BSHA 4CM8A 2NVWA 3JQ8A 4HUJA 1Q7GA 2R2GA 3OJEA 2AE2A 3LT4A 2FZWA 1U3TA 4RZHA 2ZYAA 3L4BA 3IKTA 4W9NA 3PDUA 3TFQA 3PIIA 2GNAA 2XOXA 3ROMA 4MDHA 1T2FA 3OJLA 3ZCXA 4XIJA 3QA9A 4LCEA 2WJPA 5L7TA 3F46A 4PN3A 1ENPA 4GX2A 3DDNA 1JWAB 1PQUA 3FNFA 1BG6A 1TB4A 4MVJF 3RUFA 1PGJA 1R6DA 2Y1FA 3KEOA 4J1SA 3ST7A 4PIVA 1HKUA 1YDWA 5CG2A 1W8DA 2HCTA 1NAHA 4BNTA 3WXBA 5AOVA 3DAGA 3DZIA 4IMPA 4WASA 2C7GA 3GPDG 5L45A 4FS3A 4LRTB 3RJ9A 4RPJA 4PFJA 3IJPA 3D3WB 1FDTA 4RLSA 1WAMA 3DONA 3E48A 3TF5A 1H93A 4R3WA 4BO5A 1V3VA 3LDHA 1AGNA 1E1KA 4XA8A 1P9LA 3GDFA 4EGFA 1R4NB 1ZSNA 4CPDA 3V1TC 1IUKA 4CLRA 3H5RA 1PR9A 1HWYA 3JQAB 5CDTA 1NQ5A 2UUOA 3HDYA 1LSJA 5G0SA 1DFIA
chains in the Genus database with same CATH superfamily
2PL3A 3D1LA 3G8BA 1Z2EA 5KTRA 1JJAA 2PMFA 3I53A 1ZGGA 4OQYA 3CH4B 2X2EA 2LVBA 2O4UX 4PXAA 4PHCA 3DUFB 3QG5A 2XX3A 5H16A 3ZWNA 5HK9A 3V1NA 1D2NA 2JLCA 4LYYA 1G98A 3D4IA 2GGSA 1M6EX 4K9PA 3MJTA 4OVKA 1JR3E 3A6KA 3UV7A 1N5RA 4QBIA 5GTDA 3AJRA 3MT9A 5AJTA 1AKWA 3C5HA 3PHJA 4PYQA 4RORA 4X1IA 2AD5A 3PC7A 1CDDA 1YV9A 2Y6UA 4JUAA 1EQUA 1YKSA 1X6VA 2WJHA 2Y1GA 3QPWA 2GM4A 1M5TA 2J5BA 2OCBA 2DR0A 5D84A 2P30A 2YIDA 1L8OA 2HTEA 4HLCA 4EFDA 1NSYA 4IDNA 4P08A 4BQNA 3FVTA 4DQDA 1JAHA 1XZ8A 4JITA 5H02A 4YB8A 1L8XA 1VJRA 1VSBA 2PBZA 2AN5A 3HYTA 3WL8A 4X1KA 1CTQA 1A8UA 1IC6A 1XOIA 2JFZA 5IRCD 1P17A 3FTEA 3VHQA 5MN6A 2QX8A 2QD2A 3FMOB 3OOSA 4WCVA 5A03A 2P2ZA 2NUAA 1IOVA 4Z0NA 1XTTA 2O07A 3ONDA 3V42A 1BE1A 2J09A 2JJ2A 2QAJA 2I7DA 4JR2A 4DDVA 2FOLA 1Y9EA 3BMCA 4LE2A 5DK4A 3ZDDA 1QGUA 4TWBA 4FFPA 2OAQ1 1UFQA 3HDQA 2H5EA 1OR8A 3HCAA 4TSRA 2FCAA 1W5FA 1H4VB 1Q1NA 4GPAA 5L9AA 4DLKA 3OF5A 4ZT7A 1OLUA 1X13A 4BV9A 5D6NA 1D4AA 5KO2A 4OBWA 2XUDA 1XDZA 3UW1A 1ACJA 2DPHA 3HABA 4M1YA 5K3SA 5KYYB 3BXGA 4MUIA 2JIQA 4YGYA 1U3VA 2B8TA 4LQ4A 3FB4A 1E6LA 1URPA 3E2MA 1CFJA 5FUBA 3T5BA 2BE9A 4A0HA 2IXBA 1VE5A 2Q3JA 2ZIXA 2V97A 3TH5A 5FJIA 3VMFA 2GD0A 4DHWA 3HP4A 3BCRA 3HKEA 1DKRA 2CXUA 4MJLA 4OG2A 1DZ3A 5AOCA 3BCHA 4RK7A 1XZLA 1GUFA 1X2BA 2CUKA 3AKYA 1DBQA 3I9NA 3LA6A 3NBYC 1X80A 3PNQA 4IHQA 4JSRA 1E1DA 3N87A 2E5FA 4MPPA 4MQFB 3AHJA 4NL4H 4COOA 5IT4A 4ENVA 3TLBA 1WKCA 3UAGA 3FRJA 3GW8A 3S2FA 3VTFA 2DB3A 3KYJB 4FLFA 3OQBA 3ER9A 4DM7A 3N86A 3MLEA 2XUJA 4KACA 2BZGA 1HLPA 3KKZA 1UKAA 4ZVQA 4RD6A 5DWVA 1PR3A 2YINC 2Z57A 5K3BA 4X65B 4FYHA 4R81A 3WDMA 1CVLA 4U7DA 1IUNA 3ZY3A 3QYAA 4BV8A 5CNIA 3NEAA 5FL7A 4E5SA 2B6NA 4DIDA 3MWYW 4UNNA 4QWMA 4Y2UA 2X4LA 2Z1DA 3FPKA 5BR8B 1JECA 1LX6A 2G4CA 4IAOA 1ZVMA 4OQLA 4OQEA 3BH6A 3W34A 3Q9NA 1F6DA 1I5OA 3IVCA 1GAEO 1YOVB 3CH7A 3ZBQA 4LI0A 3ZW8A 1G6HA 1NC1A 2C2ZA 3LPDA 3HNRA 4ZT6A 3SS9X 4DSZA 4K9MA 5SYNA 4L5YA 1LTKA 1I7SB 1QMPA 2HN9A 5FIUA 1X8JA 5JS2A 2RC6A 4UEQA 3I76A 1Q1BA 1IJBA 1Y6JA 3CJQA 5D85A 2D1QA 1PJZA 4S1PA 2NG1A 4LNUB 4OUKX 4F38A 1XQ6A 1DARA 5FA5A 2EWWA 4B5LA 3H9BA 4JVMA 1XRPA 2IITA 2ZEJA 4LE1A 1VYVA 2BFEA 3BAZA 5HOEA 1KVQA 1S2OA 4TRJA 1JMVA 4KIGA 4EI7A 1NUSA 4GX0A 2AFHA 4HMQA 4JBXA 2X8BA 3U19A 4BZZA 1PR4A 3JYOA 5FULA 1QB8A 4NENB 1OKKA 2QT9A 2I67A 1TT7A 3AL2A 4F8EA 4RZQA 2QE7A 4B3IA 1GZ5A 3GMTA 4N49A 2OLJA 2BFDA 2OV8A 3AESB 3UK6A 5KVSA 2Z6UA 1N2BA 4RCZA 5EEGA 3BSWA 3IB3A 4JOBA 3AUXA 2HCJB 1SIWA 1B15A 2J0UB 2W43A 1BCRA 3H2ZA 1Q2UA 3IB6A 4YX9A 2WYVA 3U3DA 4LF5B 4IJ5A 3NWEA 3PPIA 1CNEA 3HA2A 5C9ZA 4OHMA 1VE3A 2QQFA 1PEAA 5KVCA 1K3TA 1LDEA 1PVVA 1P1KA 1KJ9A 1RLUA 1SXQA 4BMOB 1CYDA 2F3PA 3VPHA 1NT4A 5K8CA 1FSFA 4P5DA 1Z5GA 4QPPA 1XVVA 1TRKA 4Q4DA 4FCTA 5L7YA 3RROA 2H0AA 1US8A 3LC0A 4QJBA 3R23A 3A9WA 1LFDB 1P8JA 2H2IA 3RG8A 2PBLA 5F1KA 1IG0A 1L6RA 3I5AA 3R6WA 2OV6A 5FTNA 5BXYA 2NNLD 4M89A 4EPVA 2ID4A 4AN1A 4FB5A 2PRZA 1XZEA 3HXQA 3E03A 1A50B 3CG4A 1TIBA 1J49A 3W3AD 1BGXT 4BNFA 5KX5A 4D74A 2X6RA 5G0WA 1TJPB 2V7PA 2RHHA 5A62A 1DIHA 1F2VA 3E9RA 4BUJA 4CM7A 2Q0SA 2WDPA 3WLJA 2J9GA 3QUBA 4QDOA 2Q5OA 1O95C 3TTVA 1X1SA 3K1JA 3L6EA 4ZVTA 1SC6A 1YDMA 1KZHA 4BP3A 1UPCA 2D3WA 2FZVA 1I9CA 3DMTC 1K8ZB 3WQRA 4CMIA 5BVHB 4GOMD 1H0RA 3KOWA 4HQRA 4II7A 3W5UA 2CMDA 1FDUA 5FPKA 3QBVA 4BNLA 4J7AA 5ALQA 1Z2PX 2MDTA 1B2LA 5LNK1 3B7PA 1V1MA 2KHZA 2C82A 1F9EA 5CFLA 3C3JA 2VCHA 4Q66C 4X41A 2IZ0A 1N4DA 3P9KA 4JR1A 4LX8A 5CMLA 5EMJA 3VZBA 5KWJA 1TPZA 1XD9A 2NSYA 3EXEA 1PJCA 3FF1A 4KDRA 3EAQA 2OAEA 5HFNA 1SPBS 3GJTA 2NX2A 2D5BA 3MTEA 1TECE 3OOEA 1ST2A 3ZJ4A 2JDID 1E6KA 1P7WA 3GJRA 4D9FA 4MA5A 4NEQA 1SMKA 4PNPA 1IEXA 1C3XA 4J1TC 3VSEA 1LPNA 1NZJA 4CODB 3IAEA 2BHRA 1IQPA 4L4XA 4EB0A 2GEJA 2H57A 3AU8A 5LDHA 2GXAA 3HCNA 3ZK9A 2UYCA 2NYRA 1DS6A 1U28C 2OG2A 3ELDA 1VMEA 3PF8A 4Q1AA 2HZ7A 2DU8A 2L19A 2ZJZA 3KOUA 1O8BA 3VKHA 3V4OA 1SUCA 2REQA 4UZFA 3IUSA 5BN1A 5CA0B 1UWVA 2HRDA 1G1AA 4C6HA 3Q6IA 1VPVA 1PG0A 4KOAA 1QCCA 3EVGA 3QE2A 4V39A 5KTKA 2O8DB 3EIXA 3NHZA 1L7AA 4LJRA 3IVXA 3EF0A 1PFGA 1TK3A 2I62A 4OFWA 3ZIDA 1V8OA 3QKRA 4ZARA 5DASA 1S2GA 1ZNYA 4F12A 2GR9A 4ALJA 1WVMA 1HLFA 2WTAA 3VJMA 5JXHA 2J59A 3DFIA 3HSKA 1WF3A 3DF9A 4QEZA 4WESB 4D82A 1O7JA 5DM70 1MABB 3L9XA 4GXNA 4RHEA 5EWLA 3K9GA 3L6OO 3K0AB 5JBQA 2OFXA 5BQFA 1G38A 2ZYIA 1ISFA 1RVDA 3ZTTA 4E5DA 5JALA 2EP7A 3QRWA 4UTPA 1GN8A 4PIPA 4HEA6 5LB2A 5ADVA 2Q41A 1JLHA 3SSMA 4AK9A 2ATVA 4G8DA 3HYRA 5FORA 1RNLA 3TN7A 1EA7A 4INZA 4KITB 1QFYA 1B76A 3FYUC 4UM8B 3D8TA 3GFSA 2GDJA 2PR7A 2UYOA 3NUGA 2AZTA 1LJUA 1Y7IA 3BE5A 3NTOA 5EN4A 4ER6A 4ZVRA 1V96A 2ES4A 1BYIA 3LM8A 4MV0A 3DBRB 2H2GA 3JWHA 1XEAA 4IDGA 2C9OA 5E9WA 3ZHZA 2HI0A 1H8HA 2DSTA 3BYZA 3JCZA 1VCNA 4YV1A 4A8JC 1H2RS 3HU3A 4U2KA 3BMXA 5KYGA 4RESA 1U2TA 3I3SR 8ATCA 2WD8A 1C0LA 1GLGA 4RD4A 3KPUA 4KMRA 3N7TA 5IABA 4LDAA 3K9HA 2VKQA 2ODNA 2OUIA 2X6QA 5CCDA 1F8FA 2DPXA 1X8KA 3QUQA 4ARZA 1CY2A 1ORIA 5HR5A 4XOIA 5E6UA 1MDFA 4F8YA 3URMA 1AK9A 1GNQA 4IKOA 4LC1A 1BMQA 4H0FA 4M8LA 1ZMTA 2FX5A 3OKFA 1M2WA 3WJ2A 1X7DA 2QRKA 1EU1A 3O31A 4GL2A 1TU4A 1LNQA 3MYRA 1F0KA 3PE4A 5A1TA 1FW6A 2JAHA 1QF6A 1N5JA 1W36C 3FF4A 1U2RA 4PSDA 2VR1A 4ZQBA 1WUTA 1ZK1A 1QORA 1HPLA 1YDHA 4HAIA 2P3QA 5EKXA 2YVUA 2DBQA 4FFBA 5JD6A 2DBRA 3AV0B 1WA5A 2G71A 3JASB 4CFYA 1PZEA 1ZN2A 2GCPA 3PRYA 4I6GA 1EFLA 1DIRA 1ZN9A 4PWZA 5ESDA 4DM3A 1XXHE 4E3WA 5HQJA 1P9NA 4IIEA 3N8IA 3PFNA 1H66A 2KPOA 1L5WA 2GM3A 3BB4A 4HQLA 4M8NE 3QVSA 5EHGA 3OHPA 3EDCA 1N6OA 4K26A 4ND6A 4NMWA 1DOAA 2B1IA 2G5TA 1XMIA 3AR9A 4DYHA 5LXTB 3SJ7A 1KHTA 2IOQA 3AFIA 4L8FA 3IR5A 4C21A 4KE6A 1X1CA 4FNMA 2V7QD 4HT3B 5JNWA 5F9FA 3OEYA 4WLNA 2VJYA 4NJEB 3IQZA 5CB4A 2CYCA 5A05A 2XKKA 2QDXA 1LI5A 2O0LA 2AXEA 1J00A 1GCGA 2HT6A 3FM9A 4IIYA 2BBTA 4O4LF 3ZI4A 4KDEA 3VOTA 2V5UA 4BB0A 3FA2A 5EG5A 4HXGA 4CKBA 1VL8A 2E37A 1ULUA 1NX9A 1Z6AA 3MNFA 2Q3MA 3MTDA 4J03A 4NE2A 4RNDB 3U0VA 2XB6A 3AUTA 1IZYA 2H5JA 4NVRA 1WCYA 2O1XA 4QUGA 4NONA 4XD2A 2W6ZA 4KVGA 5ELLA 3VVMA 1WCWA 1FBNA 2HTFA 4BRSA 4F4UA 1FXWA 1XAGA 2IZ6A 2P2GA 2VEOA 1ZQ1A 3P5SA 2O2YA 1C30A 4R3NA 5K3FB 4A0RA 4UTRA 3IEMA 3RKUA 4R68A 2PJUA 2W6OA 4YC7A 3KEFA 2ZI6A 2BPOA 2G0NA 1Q6YA 3Q87B 1UDXA 3RUCA 3GVXA 4KPUA 3NO4A 4Z1MD 2EHDA 1B14A 3KZCA 3ZY2A 1GPUA 1D1SA 1ZH0A 2BP7A 2QU7A 2H3HA 4XUGB 5CP8A 4LRWA 3RU2A 2WYWA 4LRQA 4TV9B 5JVDF 3I4CA 1ZSYA 1NNSA 2C0PA 3F74A 3M1YA 3BE6A 3L8ZA 3NIFB 2BEWA 3IDSA 4XB1A 4CQMB 2H4ZA 5KWSA 2RI6A 1DV1A 1OYYA 3P96A 3PD7A 2HQSA 4BLOA 4B6OA 4NI5A 4WZZA 2RIRA 5CBPA 3UBMA 1ZI9A 5ESRA 3SP1A 2H7XA 2AK2A 3I30X 4PGGA 2YJZA 3L8HA 3WWDA 2FMFA 3BF8A 2RIPA 1O87A 3CRVA 4QGHA 1SA0B 2RGNC 4MJ3A 1V9SA 1TLFA 2ZI7A 3K16A 3FCCA 1Z5UA 4KV7A 1MOSA 3NALA 2EG5A 3PCXA 4OBXA 1F2UA 3EWIA 2DGDA 1MX5A 4YJFB 5J4YA 2IW1A 4R8KA 5TVKA 3T5TA 2RJ3A 5IHXA 1IN5A 1JFLA 1O57A 3T1VA 1GGVA 2IF2A 2QW0X 1JMYA 1QH8B 1FTWA 3BWBA 4M7OA 1N2XA 1EK6A 1FLNA 1Y81A 2V5VA 2Y4NA 4OHKA 4P9NA 3EVEA 4QM7A 4EFMA 3ZGLA 3H0KA 4PTLA 4FFNA 3OBBA 2GZ2A 2QRQA 3R6LA 1M8GA 5IBCA 2EFEB 5C18A 4OXXA 2Y1EA 5BUCA 3WMEA 5AVRA 2I7CA 4HZGA 2PPLA 3F2IA 3KOOA 5EE0A 1TD1A 5BORA 4FDUA 1W93A 1QO9A 2ACVA 3QKUA 1N0WA 2H52A 4J3NA 3ESAA 3VAAA 5EXPA 2J4FA 5H3LA 3DXXA 2VK1A 1T6ZA 3QU9A 3SZRA 3SX2A 1ZUHA 2HLDD 4QQ8A 4XYMA 1HE4A 1WS6A 3PV0A 4OM8A 1QS0A 3WICA 1MPTA 5TMEA 5BWOA 3V2IA 1AZTA 4PPQA 2GM5A 3GJ6A 3EULA 4KYVA 4R16A 3LW8A 2R84A 3OE7A 2AJ8A 2ZRLA 2PUHA 1SRQA 3W05A 1CJMA 5BSFA 4A2PA 3BXXA 3ASZA 3FTNA 1NBAA 3OKAA 2XNDD 5D7BA 2EGGA 1T43A 5EEHA 1ZM4A 1AKUA 1Z8FA 3BULA 1FTQA 2NUPA 1R4MA 3D8BA 2CJXA 2IDKA 3FY4A 1VBFA 3GA7A 3JRWA 4N8DA 4PBSA 2AR7A 3FFXA 3IP9A 4FYKA 5FV7A 3CLRD 2ECFA 4AY5A 2PZAA 1P2BA 1SK8A 2G09A 3L0DA 5AXBA 3UENA 1N78A 1EFAA 4IIJB 3RYFA 3U7QA 3NHBA 4HAYA 1CZNA 4BTEA 1JVSA 2FLKA 1WD7A 4DCJA 1RCUA 2GCOB 3PFGA 3EFOA 3V8VA 2C1ZA 4YIHA 1X7WA 2PEYA 3S44A 1M6VA 3CNHA 1T8TA 1VIVA 3THSA 3G2MA 4FDMA 1RHRA 1SHKA 2ZIWB 1K4KA 5KYUB 3W1WA 3BA1A 4HH3C 4H7EA 1NC3A 3I52A 4UMEA 1LBQA 3D64A 3LWZA 4NEGA 2VA8A 3E5NA 2HSJA 4IINA 1C81A 1LPBB 1UBRS 3PXGA 1I0ZA 2H5LA 2V0GA 4V02A 2YS6A 3BTUA 1ECJA 1ID8A 1CQIA 1N0HA 2OBYA 5TMBA 4B0PA 2NUBA 3SJBA 2D4HA 2HK6A 4JELA 1NVGA 3CLRC 3LJKA 4AMZA 1A97A 3O03A 4ESHA 4MQ6A 2VUIB 2XMSA 3H9GA 2PMBA 2XUQA 4PC1A 5ERXA 5CURA 1CNFA 4DMUB 4UKDA 2VS1A 2ZSUA 1A8QA 4GOLD 4MV7A 4YO7A 3AP3A 1Q1GA 3R3HA 4UU0A 2D1YA 3ZHYA 3ZQJA 2Y27A 4LF6B 4COKA 4PYOA 2OYSA 3DB1A 4YRTA 3I72A 4YYZA 1JU4A 2QN8A 3KOZA 1ZUD1 2DFDA 2CXHA 4AMGA 4U3JA 5EKTA 2I0FA 3OEEA 4HDKA 2ISSD 1LWOA 2X0IA 1Z8NA 4HLDA 3SHTA 2BDTA 2ONYA 4L27A 1N9GB 1ZK2A 4JLUA 4A5SA 2FSVA 3VU1A 4AKTA 1ZONA 2FEOA 1C7ZA 4QBGB 2VYVD 1Y8CA 4PAOA 4AZ3B 3FUCA 4YUYA 4CV1A 4C6TA 2ZG6A 4D98A 4OXKA 4RHCA 3EXHC 1X7XB 2FFBA 4DR1B 1Q14A 2AHRA 2EGUA 2H4WA 3W5SA 1Z4KA 1NSTA 1QKIA 1YQQA 2GN1A 2JEOA 4FYJA 4X94A 4D9MA 2Q4OA 1J0DA 3ROZA 2FGJA 4G56A 3ZYZA 8OHMA 3K0FB 2WRZA 2C7PA 2YMPA 4IKEA 3P1JA 5DW3A 1PEYA 3RIMA 1U63A 5T6BA 2EF0A 2FPKA 1Z38A 3G17A 1MJ5A 1XK7A 4LBWA 5JO9A 2HIAA 3H65A 4E14A 3GJ8A 5FI0B 4OHYA 4UREA 2CKDA 6YASA 1T0UA 3SNHA 1KI9A 3LCRA 5FXMA 1NWCA 2OYRA 3TAUA 4YECA 3ZWWA 4LDPA 3X44A 2GO1A 3HFGA 1X77A 3N7UA 5CLLA 3PEUA 2VPTA 1CEEA 2JLVA 2Y71A 4OQFA 2AW5A 1KEKA 1YFZA 3MRVA 4RF4A 2VBFA 5A04A 5EGNA 3OT1A 5WRFA 5A9SA 2O8FB 1V47A 3GEEA 1GAQA 2EZ8A 1OGYA 4FHZA 3RJ5A 1M0EA 4QPJC 1TUGA 4BO9A 3ER6A 4EG1A 3AYXB 4ZYVA 3JAMA 3V4LA 3FZQA 2VHUA 3WQHA 2ZRPA 1T9CA 1QSGA 2FPUA 5IWAB 3EE6A 3IV9A 4IXMA 2FPSA 1CUAA 3WYCA 1F48A 5NLLA 3DAOA 3VYTB 3NGLA 3VPSA 2VYND 1BJTA 4P4LA 4N03A 4OATA 1DEHA 4UEKA 2XWQA 5EIBD 2DC1A 4JP3A 4Q3DA 3RFTA 1N77A 1UAAA 2QMUA 1SVNA 4Z4FA 1U3CA 3R9IA 5K0JA 1AV7A 2VJLA 3O83A 1R1DA 3A3OA 5EHQA 1ACMA 4R0MA 1EUCB 2GYWA 1WVIA 2Q0XA 5FP0A 2ZZNA 4OLJA 1BHQ1 4M60A 5CPBA 1II8B 2ZU6A 4PU0A 5L53A 3HB1A 1AH2A 1OAAA 1VIDA 3OZCA 2R7KA 2I78A 3FMFA 2G7ZA 5AVTA 4PN7A 2ZPUA 1MR3F 3R7DA 3WK9A 4A6XA 3VJLA 4GYYA 5FEUA 5HJ2A 1Q7CA 1REQB 2OXCA 1IHPA 1YBMA 1ZGHA 2ZITA 2BY4A 4RGYA 2UZ1B 3JVEA 4UUMA 1Q0TA 1L0BA 3A4TA 3KYCA 4TQAA 2PY6A 1G8KA 4PV7A 3S1AA 1E2EA 2OORC 4C9BA 4F04A 1E9EA 5EIBC 2ZRJA 4G1VA 1PJ2A 3NDRA 3EMDA 5K20A 3ILYA 3WMFA 3FHJA 2YTZA 5CVCA 5IYZA 4C2TA 2AH5A 5B2EA 2WJ3A 1Z29A 3VPXA 4R0VA 1DCTA 1G5PA 4EPWA 2B98A 2FPGB 2JGJA 4P32A 5D3QA 1CERA 4IY1A 1W0KA 3KXLA 6CHYA 2JAWA 1YVDA 2WWVD 3N2ZB 1NBME 4OJMX 1MG5A 1UP7A 2EC5A 2JVJA 3PR1A 4TTPA 4YWHA 5BN4B 2CBGA 3VZCA 3Q7QA 5K0CA 5L3SB 1V16A 3UXMA 3OSZA 1AUVA 3HMQA 3EXFA 1T5LA 3H1GA 3KG2A 3QU5A 4DRYA 4P3NA 4E15A 4UUBA 3JQ8B 4FGWA 2B3TA 3FTFA 2G1UA 3IKVA 4YLGA 5CFZA 4OHFA 5G02A 2OMEA 3VX4A 3FOFC 1TT5A 4H2DA 2BIFA 2Q9BA 2ZWAA 3MWJA 1PRYA 3F7OA 1TCUA 1TUEA 1U3UA 3KK0A 1RMQA 2NUTA 4TS4A 4OXYA 5LZ2A 3MM4A 4D41A 3HDTA 1RRCA 2J0SA 3RVDA 2W2KB 2MCFA 5KTTA 2G28A 1YR7A 1ZXXA 4GR9A 1OT5A 1R18A 5IARA 4HJXA 1KQOA 3PGLA 1TK2A 1SNYA 1CJUC 1M6HA 1D6MA 1Y98A 2PSDA 4X61A 4KAXA 1UC8A 2JGFA 4GI2A 4KIJA 3I23A 1NA5A 4BMPB 3GLIE 3CUSA 2DUWA 1B7GO 3BIFA 4P4SB 1U8FO 1V7QA 4JGBA 1YR2A 3U3JA 4WGFA 2GVDC 1T0BA 4B17A 1FNDA 5IH7A 4KPYA 4TKLA 4XM2A 5TPWA 3CSUA 1TU3A 3HGMA 4ECAA 4HEA1 1AQJA 2XWPA 4RL6A 2G72A 4H15A 5EA2A 1JIKA 4C22A 4DCTA 4B8YA 4C1BA 2XA2A 3LK6A 4OQNA 2JIMA 4L9SA 4ZZ2A 2OC9A 4YRGA 1K4MA 1L8QA 2C00A 4HADA 4OFZA 2UUCB 2PSSA 5HCUA 1HE5A 2PWZA 4MYCA 4X5OA 4Z8XA 4EENA 1Y0BA 1V5IA 1J2RA 2I3BA 4TYYA 3CZ4A 1ZY2A 4Z4IA 5HIJA 3TSAA 4F7WA 3ASYA 4EI2A 5J9FA 2DR2A 3U39A 2MOKA 5CXXA 2PLAA 3B38A 5EJFA 2ZB7A 3VGPA 2JGKA 2YXBA 4H7DA 1ZJWA 2IYOA 4F72A 3TGLA 1XPOA 2AQKA 4WWHA 4NC9A 4CLRB 3K8ZA 3SXJA 1YHYA 3G1TA 2AQ8A 3EUAA 2IOFA 3JZIA 2XUAA 3LGAA 4Q4JA 4J2HA 1OA0A 2CNWD 3AV3A 3PWTA 3WLOA 8GPBA 3AVYA 3IQHX 3O2JA 1L1FA 1V5GA 2FFRA 1PQYA 1N6NA 4ZAYA 2YXNA 3O8NA 4HXFB 3OAAA 4LYJA 5GVRA 1G3MA 4HYTA 3HV2A 5JSKA 1M1XB 2BFWA 1NE7A 2PWPA 4RO0A 1ZUNB 3UV6A 1QYIA 4X6UA 4BQEA 1F1BA 3INRA 4C4PA 3RCBA 4D8YA 1FOEB 3K2EA 4DFDA 5AT1A 2YVQA 5CFQA 4Q3BA 1WXWA 4KBFA 1NKSA 2C07A 3BL5A 4C0AC 5G3ZA 1BROA 3QMVA 2PGIA 2IEDA 1V3QE 1NT2A 3EY4A 3KSMA 4GM1A 4AWAA 1L3IA 1U0RA 2WDZA 3PKZA 1OZGA 3SBXA 2F55A 4PR3A 2G9NA 3UVEA 4MB0A 1ZK3A 4KIFA 3TM5A 1OXBB 4F21A 1MF7A 3MPUA 2D0PB 3PSHA 1ORHA 1HTBA 2IHKA 2JK0A 3LBIA 4OD0A 3AZPA 1EESA 5ELXA 4K9KA 4G4GA 1VPWA 1CZRA 1UFOA 1Z0AA 3SE7A 3MMPA 4YXWD 2ZJ8A 1YL5A 4NOLA 4V0SA 1FVFA 4I8XA 3NPAA 4PO1A 5E4YA 4Q4HB 3CLUC 2EEZA 4DDTA 4OMFG 4XQCA 3ICEA 3GOHA 3R9XB 3HUUA 3W5JA 4YDRA 3EXAA 4OP3A 2D6FA 5FH9A 1RZRA 2X3YA 3IKLA 2QGZA 1PHPA 3HLYA 3LH5A 3MEQA 4RZ3A 2V54A 1L5RA 3T1HB 5CLGA 1L5FA 2AI1A 1C2YA 3OSUA 3DQZA 4E12A 3U56A 3GRVA 1HL7A 2YDXA 3BFPA 4MJ7A 4RSGA 4ZRDA 3TZCA 5CCBA 4M1QA 4JN6B 3G0HA 3KDSE 5ALTA 5CVTA 2O2CA 1Q91A 4CT5A 3WGMA 4H6WA 5IDYA 2EKLA 2QRMA 4JBGA 3F6YA 1RC0A 2GZRA 2Q0QA 1E98A 1NFFA 4RVHA 3VDRA 3V46A 1RDFA 5AKEA 2G5CA 1C8VB 2C59A 2P0AA 3NHSA 4NBTA 3LRPA 5C5EA 3DPSA 1CZHA 1ZD8A 4TSFD 3FNGA 3KALA 3LHIA 4I50B 4NP6A 3TUIC 3JPYA 2P6PA 1PZFA 2R6FA 5BN5B 3GLSA 3OQ1A 3Q7SA 1EB9A 3RSCA 1Y6ZA 3X1ZA 3LSTA 2CE2X 3SYLA 4JZKA 3ZU2A 2OCKA 3T54A 5KX5F 1D7OA 2W4MA 4XFKA 3JX9A 1PS0A 2ERCA 4IP0A 3C3KA 3DGFC 5FNVF 4D9NA 2PH5A 4MCAA 1AD2A 1J1ZA 4DJTA 1H6DA 4HNVA 4F9FA 5C8DA 4M9ZA 4BCCA 5B6JA 4CI0B 1DEKA 5JDIC 5FPQA 4QLAA 4HEQA 1M1YE 2JZCA 2A5DA 3I8XA 3W2EA 2PMCA 3FUTA 4CR7A 4WSOA 3EC1A 3FYCA 4JC8A 5EKDA 1VSQA 3VPFA 2HNBA 4JLDA 4ZXFA 1TU0A 1UM8A 4PW0A 1SM4A 3IVMA 3WADA 4JOCA 1ECCA 5CG1A 4CDRA 2M1ZA 2VQDA 3O4IA 1C0PA 3AW8A 5CVDA 2NYVA 3N8HA 2N42A 1F4VA 4N6NA 4LUCA 3TKYA 1I3MA 2C9CA 3IXMA 3RK1A 2XGOA 1EFTA 3FDJA 4KGXA 4ZDWA 4B48A 4FK8A 1UXKA 2ZPTX 3DTNA 4HO1X 3D6AA 3WOHA 3GT7A 3L0SA 2BZSA 3EOBI 5BSUA 5DX1A 3UHPA 4XWOA 1K92A 2C4KA 3VBEA 5J4VA 4FFMA 1IXKA 2HUNA 4B2YA 1IN7A 1E3QA 1WB6A 2JAPA 2XVAA 4BQPA 4L5BA 2PH7A 1RBMA 3FUUA 1UC9A 2H1WA 1U7HA 3L0ZA 3IQWA 4F1WA 2AFRA 4YP0A 3RH0A 5DP2A 1ZRMA 2EP5A 1BXGB 3DLCA 3HLTA 5I4IA 2X0JA 1SBHA 3GEPA 5AJXA 4E22A 3NIWA 4RXUA 1L1QA 2RHLA 4G0OA 5FFFA 2OM2A 3JXEA 3F1KA 3SR4A 1G6KA 4ZCQA 4DLPA 5BWBA 2ZS7A 4ZYWA 5CFOA 4HQOA 2V7BA 3QZUA 4S04A 1H9BA 1W5AA 2C4VA 1M0WA 1C41A 1XAJA 2F67A 4FZ5A 4I9UA 2JI9A 3N6VA 4J16C 3CPJB 1U0SY 4CDNA 5FOUA 1YZGA 3V2UA 3EZ7A 4CG2A 3BIJA 5DH9A 1Z74A 1SU6A 2H4HA 1LLDA 2ZTMA 2W6PA 3F7NA 2HO5A 4HWSA 3QQ5A 1TGVA 2FPOA 2GZ3A 2XAUA 3KM0A 1IU9A 1QIEA 2CSUA 1DI0A 3VYUB 4F4DA 2ZRAA 2FSGA 1I4LD 2VBCA 3AFNA 4RA6B 4Z9FA 1OX6A 2C8VA 4P5EA 2FW1A 4RSMA 1KYVA 2D2EA 5C8YB 4JUFA 1T5IA 2VLIA 2GZDA 3F1LA 4MA4A 3H05A 4MVWA 3KSAC 5CFRA 3LP5A 3UH0A 2ZUBA 3PQ8A 1IXSB 3HM2A 1LWNA 1VKNA 4KGVA 3PBKA 2M98A 2P5TB 3KTAA 2OB1A 1L6IA 2QLJA 2C2KA 1EHYA 3B5JA 4BVFA 3BQ9A 2AV6A 1NR7A 3S2YA 4DLRA 2Q1UA 1IUPA 3ICWA 1UKVY 3LFTA 4W7SA 4X71A 4U2GA 3R7WA 1PV2A 1XMJA 1YB1A 2B3DA 1XZCA 2QN6A 2WFLA 3ANSA 2DQZA 3BFXA 3KAPA 1NM5A 5TGTA 2JATA 3VR3D 3WWEA 1T9BA 1OFGA 1U80A 4RTRA 1MT0A 4DJAA 5T4HA 1RRVA 1RWVA 2MJLA 4FGUA 1T1GA 3U44A 4R1MA 1AK2A 3WP1B 2OLKA 1T5TA 2X1HA 3KKPA 3OKCA 4FYYA 4RVCA 2Z95A 3IO5A 2ADFA 1B3BA 5F9MA 4NARA 4EO7A 5JANA 4QVKA 2DPGA 3Q3CA 4JQYA 4AZ0A 1C4OA 1RXCA 4LBYA 3MA0A 3BMQB 1WMDA 4OYHA 2AOWA 3KWJA 3BTOA 4QGBA 2WY2D 4MPRA 5AW9A 4YJGB 4G1UC 2FQXA 2G7MC 4FYVA 1NP6A 4DYDA 3PUHA 3DL2A 1JHXA 4MQ4A 1GUAA 3DAHA 4HDRA 4MRNA 2C4UA 3DFZA 3GGSA 4S1VA 5EJ2A 3SHVA 4XVCA 3G85A 1XNRB 3AEQA 2ATCA 4YP5A 4BVBA 1UT8A 2VWGA 2ZR8A 2XECA 3QLEA 2BGTA 2BZ1A 4HS9A 3T1NA 1FDSA 2A0FA 5HMMA 3VC2A 3A9RA 1OSNA 2BFBB 5ARCA 3EVCA 2BYTA 2WABA 2WSLA 3PJGA 2F8MA 1QFZA 1YBFA 2PA3A 4Y9RA 4ZO4A 4Q7QA 5K8IA 1XL1A 4DSNA 2VWQA 3CMMA 3VU8A 1ADGA 3E1KA 3PX2A 3JQ9A 3CX7A 1N2CB 5FTWA 2A84A 3I2HA 1WV0A 4K9NA 1V7CA 1QC5B 4F5WA 5D87A 3T5DA 4E5VA 2J3KA 1Z06A 3BREA 4RH3A 1NIJA 4R7TA 2XNHA 4NCAA 1DQSA 2GESA 1OGIA 3FETA 4MRRA 2EU8A 4R4JA 4U2DA 4CETA 1LBSA 4I1SA 3KB1A 5T67A 4BCBA 5FWXB 2C0CA 2GBLA 1Q0SA 4Q9AA 4EELA 1I6KA 5IZ4A 3WZ2A 1Z4OA 5HJEA 2HQOA 2R86A 1JKXA 3H5NA 4MW7A 4DAEA 1HEUA 5CB4F 3I0ZA 3T6KA 1SRRA 5DLDA 4KRFA 2BMWA 5F7JA 4BNYA 3CGGA 2BN4A 4V0RA 3V3KA 5A1JA 2PE5A 3NHJA 3U7HB 2QPAA 3GPLA 1Q15A 9GPBA 2HW8A 1XLTC 5JRDS 3RHSA 1L7RA 4RCVA 4YJ3A 4QU9A 1J97A 1O97D 1ZRHA 2VBIA 2OV2A 3HCPA 3NFYA 4FMCB 2FF5A 4H1UA 4ACBA 4BZXA 4DNOA 1SUIA 1I7DA 5EIWA 4CNBA 3DL7A 1TVEA 4HZIA 3V2HA 1S2DA 1FXWF 2J3DA 4KE8A 5FYQA 2O54A 1FE8A 4PZCA 1LVUA 1CX9B 4MHSA 5C7OO 1E0JA 2XCOA 1DG3A 1OILA 3DM9B 2Y1KA 4KUGA 4C7JA 2JGLA 1YDGA 2ZWOA 3ZDQA 2X8JA 3AU9A 3LX6A 4CBVA 4BFTA 5H3HA 3IQIX 2NU9A 2FZ4A 1N2GA 4YTEA 3TEMA 1F8XA 3JYNA 3OUUA 4ZP1A 4HLUC 3QV2A 1NNEA 3Q3JB 4OUDA 1QYXA 5ALHA 3KPVA 3TX6A 2IP4A 5K6AA 3IPLA 4LXXA 4LA4A 1T1EA 4OEHA 1O97C 5DTJA 4DWJA 2ANCA 3K9NA 1PT5A 4E2WA 3HK2A 3AETA 2H8GA 1QQBA 2DH5A 4HQKA 4OHUA 4A82A 2FWNA 3ZR4B 4PPYA 4DBLE 3G0CA 2WC1A 3GRYA 5CM8B 5J2UF 3KU1A 1JEQA 2JLWA 2CHUA 3GU3A 3WRWA 1NVKA 4C0SA 4F6LA 2CV0A 2IS1A 2FWPA 3VGJA 3NC4A 4D4IA 1D0VA 4R1OA 4CI9A 4LOLA 3LT1A 4JCOA 5BSRA 3ZWCA 1PGPA 2IXGA 2ZRDA 2YKGA 4H3HB 3C3PA 4G0QA 3PFCA 3S7ZA 2WG1A 2FPRA 3ENNA 3C15C 4D92A 2A1IA 2WAOA 4XYGA 3FJ1A 3ORYA 3TTUA 3TVYA 1TM5E 3PXDA 1HI9A 3JWPA 4TL8A 2JJQA 4BPRA 2F9LA 4RC9A 1D0SA 1JHYA 2HCFA 4A6EA 2AD1A 2DX7A 1LBTA 4NBNA 3RYHB 2ZUCA 4FUQA 2A3RA 3DBHB 3WA6A 2GPYA 2O05A 2W6ID 1RADA 1E32A 3A3PA 4NDAA 4QTTB 1FQWA 1RYHA 4B32A 1T1SA 3NP9A 3UMMA 1PR1A 2VHZA 3RTAA 2SICE 3HB9A 3JQAD 1K6XA 4MITA 4KIUA 3AJ8A 4L2IB 2Z4RA 4G86A 3ZY6A 2CLMB 3B2EA 1M73E 4JBYA 2AQIA 1JDJA 2VK2A 3LE8A 3T7EA 1KOJA 3KKEA 2CLDX 5C34B 3QSGA 2CLKB 5KSOA 3AG5A 3ZW7A 3HN7A 4RPKA 4N48A 1A9XB 4ITVA 2GZSA 1JG2A 1FDVA 1XRNA 2A3NA 4KQFA 3EPKA 4HY3A 3MJCA 2X42A 5CM2Z 4WW0A 3ZDEA 2C4HA 4BNGA 3PL1A 1ZOPA 1QZ3A 2NSDA 2XRZA 1NTRA 2NVOA 4UZEA 3MK31 2IYYA 1THZA 2BSQA 2WFAA 5TRTA 1ZAKA 3DE0X 4MHTA 2FFHA 3COSA 3MTIA 2FN7A 4OYLA 4V1CB 5CIQA 3A05A 3VMMA 2RG1A 1TFUA 3GNSA 4XI9A 2HD4A 2ZWMA 2Q4DA 4IUDS 1ZC3A 5B6PA 1CY7A 3BICA 4NZYA 3RQSA 3I61A 1IEWA 2QW8A 2HDOA 3LLSA 2QVGA 3N5CA 3MCWA 5ER9A 1C9JA 4EBBA 2JHPA 3R76A 4B2PA 1P1FA 4I1VA 5TGDA 1Z7EA 2QTMA 3UK2A 3T7RA 1ZA2A 4Q93A 1MTZA 1OFTA 4EDFA 2QPLA 1NXVA 4DSAA 4L75A 3JQ7B 5BN3A 3GZNA 2G9RA 1Y8QB 3L49A 1MH1A 2QTWB 4NBLA 5CLHA 3U60B 5E8JA 1F0PA 2I6SA 4BLQA 3FCYA 4P84A 3T0FA 1R9NA 4K6KA 5K7SA 1SBTA 1N1MA 2G1PA 3FKSA 2EBFX 2Q6IA 2RGBA 4GZ5A 2X5XA 2PS9A 1N5DA 2XITA 4W7HA 1J1UA 2XYHA 4KN9S 1FVHA 1DG1G 4JLVA 2X3UA 5M5BA 5DTIA 3RFUA 1RQNA 2NQTA 3Q6MA 4BLVA 4PSKA 3RKRA 3AVUA 2DKNA 1W85A 2FN9A 2AEMA 1ZNZA 1R9JA 3C8ZA 3AF1A 2NSJA 3O1JC 1VSVA 3D59A 5I7AA 3WBBA 2BKLA 4JP5A 2V6MA 3W78A 1DOZA 4II2A 2VSNA 4WNAA 1XEXB 1O9GA 2Z4SA 4X63A 2PKRA 4M9CA 4LNHA 3KR9A 4I4CA 4Q47A 2WWXA 5JMWA 1A5AB 1XU4A 3NBXX 2IS2A 1NYTA 2PXCA 4NK4A 5IH3A 5I5EA 1LPMA 3F5MA 1R0SA 2Y05A 3M82A 1P61B 1SFRA 3QELA 4DLSA 4DV0B 3K70B 3BJEA 4QG7A 1V45E 4IKPA 3H5LA 1UBHS 3ILVA 4IR7A 2PUFA 1U2DA 1YZLA 1L5ZA 3CONA 1GADO 5D51S 3QEMB 3WLIA 3D3QA 3ILXA 5EZYA 1YB6A 4RKRA 1PU2A 3LWNA 1XJQA 4OV6B 1DT3A 2HV9A 2Y9MB 3GMDA 3JSXA 1EWRA 1SXJA 1DUVG 1YZKA 3DMYA 3MWDB 4NCHA 2HMAA 5AK6A 2AK3A 5DXAA 3UC5A 1EXNA 2OPBA 3FMPB 4G0VA 4DWOA 2PGJA 2LZ0A 4KAJA 4FDVA 5REQB 3S1LA 4DCOA 1MO2A 4WFKA 3OMLA 1VJ0A 2HHAA 1BVRA 3KUKA 3IP3A 4WT7A 1SVWA 2QHXA 4PGAA 3ZNNA 2CLHB 2QQ5A 2Q6KA 2VRNA 2ZAOA 5G3YA 3TTSA 1LQUA 3AKCA 1PV4A 2R48A 5MFZA 2RHJA 2VDRB 3A58B 2GN9A 1EXDA 1HZZA 1NJSA 1OU0A 1OX4A 3B78A 2Q6OA 1YDEA 3FMGA 5JD4A 1UXJA 1Z7GA 1LDMA 2JVKA 4CIDA 2Y76A 4HDQB 4I66A 1BFKA 4LWQA 1R66A 1ORTA 1A1SA 2XF2A 5EWMB 5GADl 4MEBA 3K8YA 3LOUA 4RIHA 1PW7A 1SOAA 1PAUA 1JHVA 3SF8B 3G7UA 2HLPA 3OD5A 3T38A 3VRHA 3NOVA 5DXJA 2BSXA 1X94A 4MMXB