1JA9A

Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
SKPLAGKVALTTGAGRGIGRGIAIELGRRGASVVVNYGSSSKAAEEVVAELKKLGAQGVAIQADISKPSEVVALFDKAVSHFGGLDFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGGRIILTSSIAAVMTGIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAPGGYKGMPQEKIDEGLANMNPLKRIGYPADIGRAVSALCQEESEWINGQVIKLTGGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural account of substrate and inhibitor specificity differences between two naphthol reductases.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Oxidoreductase
molecule keywords 1,3,6,8-tetrahydroxynaphthalene reductase
total genus 100
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ja9A00
1F06A 1LNQA 1AXEA 2PKQO 3I9KA 5H81A 2NU6A 4IDEA 4FPXA 3CPSA 3RKUA 4XKJA 3WJ7A 5IZCC 1NPTO 4RPJA 4NFSA 5I7SA 4OL9A 5L53A 1RPNA 4YTEA 1E3WA 1HTBA 1ZK1A 3ZW9A 4E5YA 3GDGA 3DOJA 3E9MA 2PD6A 2YUTA 4UVDA 5L7TA 1IULA 2V6BA 3EW7A 1IB6A 3VH1A 2BFMA 3K6JA 1JAYA 4L76A 4DVJA 4EBFA 2G0TA 3PIIA 5I9LA 1ZNQO 4JROA 3RVDA 1OAAA 1CDOA 4L8VA 5K9ZA 4U6SA 1JWAB 1O5IA 1EDOA 5T8KA 3WR5A 3LT2A 4ROSA 3JYPA 1U3TA 1LDYA 4R68A 2OP0A 1G0OA 1PZFA 2R6JA 3ZV5A 4U8GA 3G3EA 1RM5A 2PA3A 3R3SA 4MVJF 4PRLA 5DULA 4AJ4A 3IMFA 3M1LA 3GHHA 1QYXA 1DRWA 1PGOA 3QWFA 5IN4A 4LMPA 4BO4A 3C1OA 4NDNE 4RQUA 3SLKA 3M2PA 1ZXBA 3H7AA 4JBGA 5TS3A 3BTUA 1HE5A 1I3KA 3DMTA 3PFWO 1CQJA 3DXFA 3HZZA 2Q45A 4TKMA 4BNWA 4BB6A 1I2ZA 3EY4A 5KJ1A 2AW5A 4JX8A 5CDUA 4BGEA 4BUCA 3K92A 4KUGA 1LA2A 2Q1TA 5JCJA 1P77A 1ML3A 3FBGA 2JJYA 1EFLA 3NRCA 4YJFB 4QFDA 4B4UA 1I5RA 3T4EA 4CUZA 1PJBA 1PZGA 1KVRA 1LX6A 3WFIA 1DSSG 3OM9A 5KVCA 2PGDA 3NGLA 4P4LA 3PHLA 2DBVO 4RGBA 3VH2A 4HXYA 5H82A 4B79A 4A03A 1WZEA 2ZB3A 1PL6A 2YHIB 1FDSA 4E6PA 3VOSA 3OSUA 5JS6A 3I52A 3A4VA 2O2YA 3HB4X 4J1QA 2HMUA 1YBAA 2H1SA 3W1VA 4BNLA 4RL6A 4XB1A 3MCVA 2YY7A 3JYOA 1U5AA 4R54A 4BNVA 3WIEA 4BQPA 2AEMA 1U8XX 3B20A 3W8DA 2EGGA 1FDVA 1XEAA 1QSGA 1XKQA 5EQFA 3VPSA 3OECA 2O3UA 4RQTA 4ZA2A 4JNKA 3PHIA 3H8VA 2VRCA 1KS9A 1DHRA 2QYSA 1U4SA 4HP8A 2Z1MA 1VJ0A 2C7GA 1B3RA 4BO5A 4MJLA 2B0JA 3CKYA 5DN9A 1UXIA 1QRRA 3GOHA 4E5PA 4BS9A 1IPFA 3LVFO 4WNIA 2VQ3A 2GO1A 4Y8VA 3BMQB 2V6MA 1M76A 4A27A 1PJ2A 2ZATA 3GFBA 3W6ZA 1JAXA 7ADHA 3CIFA 4IMRA 1SAYA 3O03A 3ORFA 3H9JA 3GQVA 4CV3A 4CMJA 1LBEA 5HTOA 3RBZA 4ALKA 2DKNA 2J5RA 3JQEA 4E32A 1HT0A 3JYQA 5HA5A 5FWNA 1LDEA 1BXZA 3GF4A 1WMAA 4JBIA 5EINA 5CEJA 4O63O 3WQSB 2AXQA 1E7YA 1EUZA 1QXSA 3G49A 5DBIA 1ZJZA 4M86A 4BNNA 4B3JA 5JCXA 4PLGA 4B7XA 5A3JA 4U7WA 3AI1A 1LLQA 3QV1A 4FJ0A 4NI5A 4R5MA 3FSRA 3GDOA 1HLPA 3MJEA 4Z6KA 1HRDA 3FNHA 4ZRNA 1GADO 1NBOA 3AI3A 1MUUA 3I9LA 5T57A 4GX1A 5T6BA 4OXNA 2C59A 2AE1A 3ETEA 2LDXA 3H65A 3WLEA 3QP9A 1GYQA 4CM3A 4F6LA 5JY1A 1ENOA 2V6GA 4E31A 4WPGA 4YT5A 3BXXA 1P45A 4QSMA 4RVUA 1ENYA 3GEDA 4GBJA 3VKVA 1NQAO 5A04A 4WCFB 3L77A 4HFJA 1P1FA 1FMCA 1K6JA 2C5AA 5T64A 3GK3A 4MDHA 3NKLA 5JAZA 3FF4A 3BMOB 5CDGA 1B14A 3PYXA 3WNVA 5IXSA 4XR9A 4IIVA 5A02A 3EUWA 2Y0EA 5TJHA 6ADHA 3U4IA 4TKLA 2PK3A 3EAGA 3QA9A 4EW6A 1I36A 4E33A 1CEQA 4Q3BA 4IJWA 2Q3EA 3E1KA 3IDSA 4NFYA 5C5IA 5I9NA 1XU7A 4WLUA 3VAZA 1OOEA 2D59A 3WQQA 3X2FA 4BGVA 1R0LA 4CLHA 3K9QO 4EJ0A 4B3IA 4I5GA 2Y1CA 3SC4A 5A9SA 1KIFA 2VZ8A 2B4QA 3NJ8A 3VVCA 3GPDG 4Z0HO 2OBYA 3GFGA 4OGWA 3PPIA 2FPIA 3A06A 1FDTA 2JHFA 1ISIA 2PD4A 1NFQA 1ZEJA 3K2BA 4H3VA 1NWHA 1DAPA 1PS9A 1EMDA 1VL8A 1VL0A 1ORRA 4M89A 3D3EA 2E6UX 1SEPA 4WUVA 4OKIA 2EP5A 4ILKA 2SCUA 1PGJA 4TROA 1QG6A 1WNTA 3IJPA 4GKBA 4ZD6A 3HDHA 3VDQA 1B3BA 4ALJA 3S8MA 3DR3A 1F12A 2GN8A 3C3XA 1PJTA 3DBHB 4U6QA 3H4VA 3LZ6A 4RO0A 2HMSA 3GNQA 4RVDA 3KVOA 1ZUD1 2JD0A 2ZQYA 4PLHA 2DTDA 2X86A 2BELA 2C0CA 4GL4A 4RV9A 2UAGA 1P9LA 2I76A 2DPGA 4N7RA 2FMUA 1GAEO 4CMKA 3MJSA 2C29D 5L7WA 4L4RA 3ZNQA 4L4SA 3GVHA 1VM6A 4E30A 2GPTA 2CVOA 2F00A 3IQDB 1Q0QA 5T5QA 1YE3A 2VHXA 1P0CA 5I7EA 1U3WA 2C5EA 3V1YA 3MZ0A 3TOXA 3NT4A 3K2EA 5FI3A 4F46A 4YAIA 2FY8A 3FPCA 4ND5A 5CDSA 4TMFA 1XCBA 2BD0A 3JQGA 4ITUA 2EP7A 4N5LA 3ZWWA 4FFPA 1R15A 5AXDA 2HQ1A 2C07A 1QV7A 3TDKA 4BO6A 4D46A 3AFNA 3LC2O 3DFUA 2IE0A 2VHWA 1E92A 5DP1A 1QP8A 1E3WB 4IQ0A 3JD0A 4JGBA 3W8FA 1V3UA 2GGSA 5TLSA 4H7PA 3ONFA 3ZGYA 2EF1A 2EV9A 3GVXA 1UXGA 5C7OO 4PG7A 3AY7A 3HNPA 4CV0A 1YWGO 1A27A 4Z3KA 2P91A 2CDBA 5DF1A 3ZNNA 5I7FA 2YFQA 2Z5LA 4NBTA 3ASVA 1I24A 2A35A 2FSSA 3LU1A 1DC3A 5EESA 4K6CA 1G6KA 4FBGA 4A73A 5KVSA 1YVEI 4E0BA 5BNIA 4KP7A 2PTGA 4OIMA 3DTTA 2G17A 1DIAA 4LRSB 5DNAA 1Y81A 4XX0A 3PDJA 1ONPA 4RVSA 2TMDA 1CETA 2JFHA 1OBFO 4ZRMA 2DFVA 2EW8A 5I8WA 1A7AA 2D5CA 3FR7A 4P4NA 1XG5A 1Y8RA 3OIDA 3S2EA 4EUEA 2DBRA 5B4UA 2AQ8A 4EGFA 4Y6PA 3DAFA 3RCBA 1A7KA 3FRJA 4PLTA 4E12A 3NJ4A 4R1UA 5DCYA 2QG4A 3ZWMA 5A06A 4TRMA 3TNLA 4MIOA 4GLLA 2J3IA 4YJGB 3V1TC 3WICA 3GZNB 3JD4A 5IF3A 4G5HA 1PJSA 4CL8A 5BSHA 3SVTA 1VKNA 2YDYA 1YOVA 4G81A 4MVJE 2Q4EA 4DPLA 2EHDA 3F9IA 4CMAA 3GEGA 4IQGA 1ADBA 1TT5A 3E8XA 4I1IA 1GZ6A 3K31A 5B37A 1IZ9A 1YL7A 4ZN6A 3LDHA 4BNZA 2GSDA 1HXHA 2G5CA 2O3RA 4J3FA 3OEWA 3I9OA 1MXHA 2ZTMA 1X7HA 3SBOA 1GUZA 1QKIA 3GA0A 2Y99A 1KY5A 5EN4A 4PFJA 4CLRB 4YAKA 3TZQA 3FNFA 4DQUA 2VYND 8ADHA 1I0ZA 3FNEA 2EERA 1ADCA 3AOEC 3ZHZA 4FCCA 4N5NA 3FTPA 2W2LD 5L3ZA 2HMTA 4DMMA 4Z9FA 4I5EA 5I9MA 3RIHA 1E1MA 3S2IA 1TVEA 2AHRA 4UEJA 2Q49A 4NR0A 3CH6A 3SXPA 1K6IA 3KYBA 4R1NA 1MGOA 1K6XA 5K6AC 3ICPA 4XGKA 1C1DA 5IJZA 4NH4A 4DREA 4E3ZA 1U9JA 3BTSA 4D3SA 3MJVA 4TRRA 1C1XB 1DFGA 2CSUA 3DOCA 1LSUA 1ZO8A 4YQZA 2LDBA 1ZBQA 1K3TA 3QJ5A 3ADPA 2VNSA 3H9EO 3NDRA 4E5KA 3TWOA 1LEHA 2D0IA 5AYVA 4WEOA 2DQ4A 5G4KB 3ZV4A 4RCVA 2Y68A 1V9LA 3ITKA 1KC3A 4QECA 4QX6A 2EKQA 2HMWA 3OQ6A 3JQ7A 1AGNA 1E7WA 3JQAA 1BW9A 3KTDA 2P4HX 3PIDA 2PZLA 2O7SA 1IL0A 3S1LA 1MLDA 3WIDA 3RQSA 3IL2A 1NR7A 1NTOA 3CMCO 1CQIA 8LDHA 5L4SA 3IIEA 4YJGA 4UVIA 4UEKA 5ENVA 2BMAA 4FR5A 1DOHA 3ZI0A 4D3DA 3BMCA 4XB2A 1SOVA 3AFMA 4Z0PA 3ROQA 3VPXA 1MFZA 2CMDA 3BMQA 1XHLA 3GNSA 3KEQA 3WBFA 4R41A 1Q7GA 2C82A 5HRUA 3Q6IA 4YT2A 3PLNA 1R12A 3KZVA 4FQ8A 2IXAA 4E2ZA 5K6AA 2PZKA 2AQKA 1HDOA 4IINA 1A4IA 2NUAA 4YEDA 5BQFA 4XDZA 2D1YA 3A14A 4RVGA 1E77A 2DM6A 4MIYA 3JD1A 2WM3A 3U49A 5DBGA 5C37A 3RKRA 2I9PA 4CJXA 3Q2KA 3I9NA 3RFXA 2Q2VA 4RF4A 4BNKA 1BG6A 2X22A 4NZ9A 3PYLA 4FFLA 4UVHA 1H2BA 2OHXA 3I6QA 3NAQA 1EK5A 1HE3A 2DPHA 3BMNB 2EJWA 1HEUA 3U4DA 1IY8A 1GQQA 4OHUA 4BNIA 1U7TA 2QHXA 1WLYA 1X13A 1E1NA 2BH9A 2RAFA 5IDYA 3F4LA 1UAYA 3I6IA 2VYVD 1LDGA 2IZ1A 1H6DA 2H5LA 4KDEA 1SB9A 4YRBA 1Y1PA 4DC1A 2BLLA 1MA0A 4E21A 1RYDA 2UYYA 1NWCA 4MVJG 1E5LA 4R3WA 3C24A 2I3AA 3FPLA 3H5RA 3PWSA 3WS7A 3RBVA 4W7HA 3MTGA 4W7IA 1N8KA 2JKVA 4IJVA 1ISGA 3DDNA 3OH8A 1LLDA 1ENPA 2TMGA 2BGKA 3RUDA 1PTJA 1EEHA 3GAZA 1YKFA 3D3WB 1ISFA 1UZNA 1HSZA 1HDCA 4XJSA 2ZJ0A 3RFVA 1KEUA 2FSVA 2O4UX 3H9UA 2B4TO 1NVGA 5LDGA 3AUUA 1VE9A 1VRWA 4CMIA 4FW8A 4YACA 1TXGA 1I32A 4CL3A 1ZSVA 5BSEA 5JMWA 4NJMA 5A5EA 2ZYGA 4FIZA 3BAZA 3N58A 3D4OA 4O5OA 4MPDA 4E2XA 3KLMX 4CLRA 1ZCJA 3AI2A 3KBOA 5JNLA 1L7EA 3QVOA 1Q0LA 4D41A 3HFSA 3BTVA 2BHLA 3GHYA 3TZ6A 1EUCA 2RHRA 2DC1A 3GR6A 4BO8A 5IDQA 3L6EA 1ZW1A 3C1TA 3NDJA 3ZW8A 5CHEA 1HKUA 1GEGA 4UVGA 3EGOA 5A1TA 3OIFA 2C2XA 4Q3CA 3JQ9A 4RPGA 2PWZA 3ICCA 4IS2A 4JP2A 1BVUA 1D7OA 1DB3A 5CG2A 2NQ8A 5JCJD 4Q39A 5IZ4A 4AL4A 5T8KC 1MG5A 2EIHA 3PWZA 1JW9B 5JYEA 3AY6A 1F8GA 1WAMA 1JKIA 2GCGA 5B4TA 2Y93A 4AJPA 4J4HA 3H9QA 3GN2A 5AOVA 4DMLA 2X58A 2YQ5A 3E82A 2P9CA 4J43A 5KKAA 3C1AA 3QRWA 3GVPA 4TZTA 1G0NA 3TFOA 4MVJH 3QVWA 4RPLA 4UAGA 1HL3A 3RUCA 4FGWA 4YA6A 4LVCA 3UCXA 2IZ0A 1P33A 2OOSA 3GC6A 1YDWA 3WTCA 1QLHA 3UKOA 2Y66A 4QTZA 4FJ2A 3KOUA 2G82A 2O3TA 2X6TA 1Y5RA 4BNTA 4W9NC 2O3SA 2XXBA 2RH4A 2WD7B 4AJKA 2GZ2A 4ZQBA 4LVUA 1D8AA 3OEYA 4B7CA 1UZLA 2ZTUA 3VHRA 5I7VA 4E13A 2ZJ1A 4A2CA 3ZWYA 1V3TA 2WYWA 4GMGA 3K30A 3F6YA 3PVZA 2IDZA 4JJIA 1MFPA 1T26A 1M2WA 1X15A 4YJHB 2VNAA 4PZEA 3COSA 4KUEA 2UV8A 1ISJA 1AN9A 2B36A 4FFRA 3P2OA 2DUWA 4U0KA 1ULUA 1PWZA 1YB1A 3QWBA 1YBMA 4FN4A 3FHLA 1DRVA 1YGYA 1PJCA 4EUHA 4II3A 1F17A 5HS6A 2OUIA 3I5MA 1FK8A 2OP1A 4FDAA 4A5OA 1Y6JA 2VWQA 4WLEA 1JQBA 3ZZNA 3GMDA 3MTJA 4DIFA 4J16A 4LCEA 4OO3A 3EYWA 1KOLA 3QWHA 3E9NA 1S7CA 1PEDA 3DBLB 1R4NB 3VVBA 2IEDA 3U4CA 3GMSA 1CF2O 1EBUA 1NAIA 1IHYA 3GLQA 3PQDA 2FPGA 4TZKA 4CLDA 5EERA 4BO7A 1DFIA 3JSAA 1EBFA 4L0QA 4OXKA 2P9GA 3FCOA 4NPCA 3WB9A 1B2LA 2FWMX 4DGSA 1RKXA 3LF1A 3LSYA 2JAHA 2OO5A 4Y67A 4CQMA 4MINA 1WPQA 3AOGA 5ADHA 1NVMB 4FGSA 1XQ6A 1Y8RB 4AJNA 2C54A 1ZSNA 5G0WA 1UXHA 4MVJA 3WGTA 4KOAA 5T67A 2BGMA 4J91A 4RLSA 3RC2A 4AJLA 3INGA 4HX5A 3T7CA 4XGIA 1PR3A 1JA9A 1B8PA 1JWBB 2I99A 1EFKA 3CE6A 4BKQA 2J3JA 3DZHA 5L51A 3DBRB 4FJ1A 3FWZA 2AEJA 4BNJA 3C8MA 3CZMA 4MP6A 3NDIA 3I83A 4UULA 5HWSA 2NVUA 1XQ1A 1PJLA 4P22A 1YH3A 3KRTA 4LN1A 5COQA 5AQ1A 1BXGA 3KEOA 1H2HA 1R37A 5EPOA 2VTDA 3G1TA 3DZGA 1E3IA 5G2OA 2PGJA 3OA2A 4JXKA 4KUHA 2HDHA 3L4SO 1K5HA 3W8EA 4LCJA 5G0VA 3O4RA 1NYTA 1YJ8A 2NACA 3JQ7B 1KVUA 1UP4A 3KUXA 2CNBA 2J8ZA 5F21A 5KVQA 3VZSA 1O8CA 1P31A 4A10A 3HUDA 3LC7O 1DPGA 2W2KB 1H0KA 3IC5A 2J3HA 4B4OA 5IAAA 4I9UA 1G1AA 3HJAA 1MP0A 1DLIA 2PKRA 3M1AA 4WLFA 1GQ2A 3UUWA 3B1JA 4HWKA 4K28A 4CM9A 1U4OA 2V65A 1WWKA 2YJZA 1N9GB 3KYDA 4BKUA 4CQLA 3DWFA 2YV3A 2VWHA 3IAHA 3RSHA 5KJEA 1DXYA 3IKVA 4OOFA 1DIHA 3EVTA 5U4QA 1Q2XA 5ITVA 2JFGA 3FNGA 1MC5A 2GNAA 3UW3A 3RU7A 2EGHA 3KYCB 5GY7A 1T2CA 1A5ZA 1T4DA 4BMSA 4WE3A 1LLUA 3BHMA 2AQIA 2VUTA 3PWKA 4IUYA 2RHCA 4E5MA 5JAMA 3ZCXA 1VLLA 3G79A 2IZZA 1HDGO 4I9HA 3KYCA 3SJUA 1LUAA 3DQPA 4HKTA 1E6WA 4B4WA 3DZKA 1XSEA 4E4YA 4BV9A 1MG0A 2Z1NA 3QSGA 2W2LA 2HCTA 3OJ0A 5FI5A 5CEEA 1IUKA 3NV9A 2A4KA 3FD8A 3SLGA 4BNMA 3F46A 4JIGA 4WCDA 5JAQA 2E48A 1S6YA 3VH3A 4AJEA 4Y98A 1H6BA 3IP3A 4FSHA 1UDBA 1YBVA 3JQ6A 3QE3A 4Q3AA 4HADA 1BWSA 1TT7A 3EC7A 4OOEA 3ZU2A 1SNYA 3NGXA 1Y9EA 3FN4A 4XQGA 4NBRA 1ISHA 3C7CB 4G65A 3TPCA 4BMVA 2Q46A 4YRDA 4A26A 5FEUA 2NQTA 3JQDA 1AE1A 3TJRA 3PGXA 1XR3A 1R4MB 3P7MA 1Y5MA 1UR5A 2W90A 2X5KO 4O6VA 3F5SA 4RDIA 3WG9A 3ZWXA 1QLJA 4MVJD 3L6DA 5DCUA 5EJ2A 3H6KA 2NLOA 4RPKA 3STHA 4BNUA 3KB6A 1PWXA 3RUHA 5G0UA 5JDIA 2Y1OA 4O59O 5JW6A 4HFMA 2EW2A 1LSOA 1PQUA 1X1TA 4RVFA 4GX0A 4TSKA 4JP3A 4F3YA 5TNXA 5JLAA 4ALLA 4BO1A 3SJ7A 4I08A 1TB4A 1BDBA 4E2WA 2O7QA 3KSZO 4RF3A 3O8QB 3H5AA 2QRLA 3RJ5A 4DQVA 3MOGA 2CVZA 3AK4A 4QQRA 1W4ZA 4UUOA 1B8VA 1EVJA 3PDUA 3AUSA 4K1LA 1A9ZA 5LC1A 3V5NA 3DZJA 2EWMA 3PLRA 5JDCA 2R2GA 4QO8A 4I5DA 3AW9A 4XJTA 3RU9A 3EVNA 4BOYA 4ESOA 2A94A 2VHYA 1AXGA 2V6FA 3PEFA 4LGVA 1NFFA 1U5CA 3ZU5A 2PZJA 5DBFA 2VZ9A 4EI2A 3ONDA 1E7QA 1V0JA 2B5VA 1OC2A 3D4PA 4UUMA 3AOEA 3GG9A 4B8ZA 4BNHA 3DHEA 2FZEA 2WTBA 1I8TA 3GZ4A 4LW8A 1EZ4A 1D4FA 1X7DA 3GN1A 1HE4A 2H9IA 3CMMA 3RAJA 3NTQA 1XDWA 2JCVA 2IRWA 1PGQA 4OMUA 5KCZA 1CIVA 4GVLA 1PSDA 1OMOA 5A5FA 2D5AA 1Z7BA 1HZZA 5ICSA 4CV1A 3DBRA 4D79A 3G17A 1DJQA 2FPPA 2NVBA 3OICA 4HFRA 4CLEA 9LDTA 3EZLA 3OIGA 3HDQA 4Y9DA 4MO2A 3JQAD 5ITWA 2EEZA 2AG8A 4BO0A 1Z73A 4P4GA 5JO0A 4EEXA 2QYTA 3I3OA 4XA8A 5L4NA 3V2GA 3GUYA 5CDTA 5B1YA 5AXCA 3L0DA 1RYEA 2GN4A 1YJQA 1YB5A 3UCFA 5L9AA 1E5QA 1E6UA 3QLJA 2CF5A 1A72A 1IE3A 1W73A 3ZN2A 3U09A 3GVIA 4PLWA 1LSJA 3H9GA 5BNTA 4YCAA 3E5RA 3RWBA 4DPMA 5K0ZA 2AEFA 3TN7A 3TL2A 1IYZA 4BO2A 1GFSA 3GT0A 4ZQGA 4CM7A 1FXSA 2FP4A 4BIIA 1P1IA 1GYRA 4M1QA 4BMNA 4CQMB 4FFNA 3OF2A 2J5KA 4WGGA 3DHYA 1NVTA 1ZIDA 1C3VA 1MX3A 2XXJA 1BXGB 1LXCA 1JDJA 4CM1A 3K8ZA 3Q11A 2P68A 4YXFA 1MC4A 1WMBA 2BFPA 3ZWCA 4PG4A 1E0DA 2DVMA 4J2OA 1OFGA 5U9CA 1XLTA 3DO5A 2P5YA 4NNJA 3CTMA 5BNFA 1O9BA 2X0NA 4NG5A 4PG8A 4CM4B 3NUGA 1A9YA 2IEBA 4IDGA 1JKFA 4GSLA 3HN7A 1B15A 4D3FA 1O89A 4EZBA 4R4JA 4ZQFA 3WXBA 2BKAA 5GMOA 5ICMA 3DZIA 4TWRA 1XU9A 5DOZA 4IIUA 1NR1A 4YWJA 5TSDA 4BKOA 1VL6A 3OJLA 2HO5A 3ROPA 2I65A 4YAGA 3RI3A 5IG2A 3K73O 2BF7A 2PH3A 4EYEA 1R16A 3D1LA 4NHEA 4CMCA 1WW8A 4YDRA 5TGDA 4MKRA 4GAEA 2CFCA 1ZK3A 2E4AA 2NWQA 4PG6A 2CZCA 4DYDA 1QV6A 2YYYA 2DAPA 2X5JO 3KO8A 3KYDB 3RC9A 4DBVO 4LSWA 4CMBA 1NXQA 3WSVA 3FR8A 2GN9A 3Q9NA 1HLDA 1PGNA 1I3NA 5TRTA 3RC7A 1SO8A 1DC4A 3UGKA 1P3DA 2BFAA 2DUUA 2HAEA 4ND2A 4ID9A 1U2GA 2PZMA 5TX7A 1P1HA 2W2KA 4D43A 4NBUA 4IS3A 1MB4A 4UREA 1J6UA 4ZQEA 3RC1A 3ZWAA 1M75A 1X7GA 3FTNA 3ULKA 3CEAA 1PZHA 1UP6A 2Y1GA 5CPBA 1LDNA 3ANLA 4DLBA 2ZK7A 1ULSA 3BMNA 3JYLA 4ONEA 2Q1UA 4J7UA 1D1SA 1LRKA 4D7AA 1E3JA 3ETDA 5A3VA 5KJCA 2ZYDA 3OJOA 3E9QA 1DBVO 1LDMA 4R1TA 3H2SA 5CP8A 2I67A 3R6DA 2BFOA 3DAGA 1H6AA 4NBVA 2NVUB 1LC3A 4PZCA 5EL0A 3WGGA 1U7HA 5JC8A 2J3KA 4MVJP 4AJOA 1IHXA 1BRMA 4AJIA 2I66A 3IUPA 3ON5A 5FFFA 4CUJA 1Z74A 2E49A 5IN5A 1I33A 3PJDA 3PJGA 4JBHA 2PFGA 3MWDB 1K0UA 1O0SA 5AVOA 4DBZA 3TZHA 1T2EA 1SBYA 1ZXLA 3JQBC 2HK8A 3G1UA 3LQFA 2ZB4A 2HRBA 1LI4A 3Q2IA 3TSCA 2DTXA 3RFTA 4Q9NA 2PKQP 4NJMB 3ABIA 5DCWA 3ZDFA 3F4BA 3U3XA 3JQFC 4AFNA 4AJJA 1W8DA 2H6EA 2YV2A 3WYBA 3K96A 4BO3A 1U3VA 1WDMA 2YDXA 1QYDA 3HB5X 4J49A 5IDXA 1C0IA 1H6CA 1LJ8A 1LQUA 2GERA 4J9UE 2X5OA 4N54A 3UICA 1O95A 2F1KA 4GVXA 3D3WA 3S2FA 5KJ6A 1EE2A 3AM5A 3SX2A 4BNXA 4KQXA 2JCXA 3ZV3A 1JTVA 1T1RA 1PIWA 2W98A 3RASA 3V1UA 1DIGA 4CR8A 4IZIA 4R9SA 3KV3O 4XCVA 4EJMA 3WSWA 2NU7A 4CM6A 1X0XA 3AM4A 3GGOA 1HDXA 1L1FA 1KVTA 3ANNA 3O8QA 2ZKLA 4IXWA 3Q3CA 3UHAA 2BI8A 1C1XA 2E37A 3OQ1A 3PTZA 1LC0A 4LISA 4ZVVA 2GUGA 4IJKA 3RUAA 4AJHA 9LDBA 2YV1A 3KLPX 3DTYA 2Y1DA 1QMGA 5JAIA 1QR6A 1C1DB 1N5DA 5JFOA 3CINA 3VTFA 2VWPA 4J7XA 1SOWA 1NQOA 3HSKA 1Y9AA 3JQ8A 4DRYA 1F14A 1NHWA 4NIMA 4CMHA 5L4LA 2XAAA 2GZ3A 2QQ5A 3ZWVA 2Q1SA 2NTVA 1RWBA 1HYGA 4P38A 3ZU3A 3GRKA 5CFZA 4A7PA 3WGIA 4NK4A 1GR0A 4YPOA 3N7UA 4EJ6A 3EDMA 3FBTA 2X0IA 2FOIA 3QVTA 4NFHA 5HBRA 1CRWG 5I8ZA 4NMHA 3EK2A 2VOJA 2D8AA 3VC7A 5G0TA 2Y1FA 1D3AA 1PQWA 4ZU3A 3DMTC 5CG1A 5KTKA 3JQAB 2NVWA 3KSUA 1V8BA 2QIOA 1IOLA 1OZAA 1Z6ZA 3WWZA 4B7UA 4S1VA 4O0LA 2GF2A 4OQYA 4TVBA 3DHNA 2Q50A 3IJRA 5CPFA 2BGLA 1RM4A 3JQFA 4UUNA 5DT9A 3I1JA 4CR7A 3H3FA 2AE2A 4D0SA 4L75A 1OC4A 3BIOA 3H3JA 5F5LA 4Q3NA 3TRIA 1UH5A 5B4VA 2YW9A 4W6ZA 1NX6A 4J0EA 1F0YA 1R4NA 3ZHYA 2C20A 4RF5A 4EEZA 3KSDO 5C7IO 2D2IA 3RBXA 4JK3A 3X2EA 3DONA 1MV8A 1GV1A 3ZV6A 2ET6A 2VHVA 3D4NA 4KZPA 3OETA 3W4IA 3PQFA 4PCVA 1KBZA 1R0KA 1SZJG 2RBEA 5JE8A 2I5PO 4DIBA 4TRNA 1NHGA 3O9ZA 2NU8A 3WTBA 1UJMA 5DP2A 3AU8A 1T24A 3ITDA 5IZCA 4DXHA 1K89A 3B70A 5DZSA 1ZFNA 3PGJA 1PJ3A 4W4TA 3PJEA 3FI9A 3D0OA 3LLVA 4O1MA 4HNHA 1BDMA 5L95A 1KEPA 1T2DA 2P4QA 4A0SA 3V2HA 2QX7A 4BNYA 1I3LA 1P74A 2RIRA 4RF2A 5KIAA 4CQMD 4IDAA 4FFMA 2NSDA 3WMWA 3P2YA 2DT5A 1V6AA 2J5QA 4C4OA 3HQ4O 1MXFA 4RDHA 2WE7A 2D3TA 4YRAA 3QVSA 4WKGA 4DLAA 3B1FA 4G2NA 1ZK4A 2DTEA 3I9JA 2QW8A 2O2SA 3WWYA 4WASA 4AG3A 3C7AA 2UUOA 1AHHA 1Z45A 3JQCA 4NBWA 5FF9A 1ONNA 3I23A 1TLTA 1A71A 3D7LA 4K9DA 4L73A 3JCZA 1GCOA 2B4RO 3DBVO 2GRAA 4I8XA 5A03A 1ENZA 4UEOA 4OH1A 5C3MA 3OHSX 1V35A 4II2A 1FF9A 2E82A 2Y67A 1I2BA 4GPD1 4GGOA 1NNUA 4PLCA 2ZTLA 1P1JA 1VJTA 4LK3A 1ZKMA 4K26A 2R00C 3KM0A 1EE9A 3A9WA 1H94A 2WMDA 1BMDA 3BYZA 3INRA 3OJEA 1NFRA 2PH5A 2EXXA 2UVDA 3ROMA 3VKUA 3PP8A 4R01A 2VUSA 1XYGA 3F3SA 4GX2A 3FWNA 4RORA 4FOOA 4I5FA 4FC6A 3ANMA 4GWGA 1N1GA 3SC6A 4KQWA 2FR0A 4BO9A 1GU7A 1DFHA 1JLLA 3LT1A 3B6ZA 4CLOA 4EUFA 5TQVA 2HU2A 1CJCA 4ALMA 1NAHA 1ZJYA 2JCYA 3ASUA 3DZFA 1GDHA 4C7KA 2Q1WA 4XEHA 3GH3A 2BRUA 4WNCA 5COBA 4DTIA 2VUUA 4YB8A 1A4UA 1LTHR 4IJUA 3L9WA 4R1SA 3BHIA 2NV6A 2QZ9A 1EDZA 3E5MA 4TQGA 1E7MA 4GH5A 1F8FA 2DLDA 1PS8A 4BB5A 4BKPA 1XWFA 1ZK2A 5JMPA 4J1NA 5KOIA 3JYNA 2ZB8A 2WJPA 1E6EA 1X0VA 2GASA 2O4CA 4WECA 5HS4A 1Z7EA 5THQA 3KETA 3CUKA 1Y7TA 3UH1A 6LDHA 3VPHA 3ZWPA 1I30A 1BSVA 4J7CA 4XZ3A 4CM8B 4CPDA 1UP7A 3OJFA 5H83A 1GEEA 3HE3A 2FZWA 4IBOA 4OYRA 4GSKA 3DFZA 2JFFA 4OSPA 5KNLA 5A9RA 3GVCA 1ADFA 3MJTA 4IY1A 1ZEMA 5ER6A 3IOYA 5TT1A 4XQ9A 4HUJA 5A05A 5KWEA 2FRDA 3JD2A 1HDYA 1XGKA 1BVRA 2FR1A 2NTNA 3WNQA 3U0BA 4WLOA 4N5MA 4RVHA 1YL6A 4ALNA 3WGYA 3L9XA 3RJ9A 1DO8A 4HY3A 1CWUA 2JD1A 4JN6B 3ADOA 1N7HA 1QORA 3T4XA 1XELA 5L45A 3E03A 3HADA 3M6IA 4W99A 1V3VA 2FR8A 1K2WA 1J5PA 1M6HA 2P2SA 1C0PA 3E18A 4M54A 4RJTA 1Q7CA 1UDCA 3ZH2A 4FD3A 3UAGA 2DFDA 1HSOA 2HLPA 4YR9A 4L9RA 4CLOB 1GUFA 2EJVA 3NTOA 1GCUA 2PR2A 1AHIA 5MGBA 1WDKA 1EQUA 1C14A 2ZQZA 4XIYA 2NM0A 2VTEA 1I10A 1Y8QB 1WP4A 1GD1O 3ZWOA 1ZZEA 3AUAA 4J90A 4XIJA 3NT5A 2ZIZA 4FOSA 4M8SA 5B12A 4IZHA 4YT8A 1GPDG 3ROKA 4OKNA 1DAOA 1KEVA 2O48X 4QT0A 1T1SA 2HK7A 1C0LA 2PD3A 2W8ZA 5U1PA 3HHPA 1QYWA 3HDJA 4D0RA 3MJCA 4Y6SA 4GMFA 4PLPA 2P5UA 1U3UA 4J1SA 4CR6A 4XYBA 2Q2WA 2VT2A 3RROA 1XA0A 4KWIA 2B37A 3OA0A 1H5QA 1SMKA 3PK0A 4CUKA 1U8FO 4IDFA 1BW9B 4KTVE 2WSBA 5FYDA 4XYLA 2OL4A 3CSDA 5EMHA 3LF2A 4CLXA 4XGNA 2POQX 4WCFA 1E3LA 1HZJA 2OMEA 4IGEA 1SPXA 5TC4A 2X4GA 4ZHSA 1WVGA 2YHIA 3IUSA 1E7SA 4WOKA 4PLFA 1E1LA 2O23A 3GAFA 2IODA 2Y0DA 3A1NA 3DL2A 4HNGA 3RD5A 3WGZA 1UAGA 5COAA 2QRJA 1SC6A 5LCXA 1LSSA 1PJQA 2DU8A 2WDZA 5AXAA 4H15A 4PLZA 4XWYA 5JBIA 4WLVA 1GZ4A 1HDRA 4M87A 1DJNA 4IDBA 3QWAA 1GY8A 4RPHA 3ZNPA 2Y05A 2OGUA 4B4VA 4GQAA 4IQ8A 1GV0A 1M67A 2WEKA 3DZBA 4KDFA 2X8LA 4WLNA 3VTZA 3TOZA 3S2GA 4YVFA 4JJFA 3WYCA 4PVCA 3R1IA 1AUPA 3H5NA 2X0RA 3R3JA 4MKXA 3ZWNA 3LLSA 4BVAA 4BGUA 3U62A 2JAPA 4INAA 4QXMA 3JTMA 4FB5A 3P19A 2C7VA 4LSMA 2R00A 1D1TA 3IS3A 3PZBA 3DMYA 3WGOA 2YFHA 1Q7BA 2Y1EA 2YZ7A 3VZPA 1E3EA 4RZIA 3ZWBA 4CQLB 4BNGA 2JD2A 3E48A 1Q0HA 2CUKA 2X23A 4NU5A 4JLWA 3OFSA 4CM8A 4FS3A 3OBBA 3AU9A 2HJSA 1JU9A 1KVSA 2AMFA 1CERA 2ZCVA 5BT9A 1VC2A 5JDCC 1EVYA 1W0CA 1VPDA 4H16A 4Z0TA 4DQXA 1ARZA 3QQPA 5JDIC 4IPTA 3QW2A 1DC6A 1HETA 4DUPA 4ZQHA 3P5SA 1BTOA 3UCEA 3UFXA 2NTJA 4M55A 5GZ3A 3VDRA 3NYWA 3L4BA 4PVDA 5THKA 5GZ6A 1WZIA 3N74A 3VZRA 5IDWA 5F3RA 4BV8A 2YHUA 3JQ9C 2V7PA 4AICA 3RUFA 4DIOA 2IYPA 1YOVB 4QFCA 1FDUA 3CZRA 4UUPA 2AQHA 1N2SA 1GL3A 1T2FA 5MDHA 3DBLA 3GZNA 3W4JA 1NM5A 5GZ1A 5CEFA 1I01A 4AVYA 2GR9A 1KETA 3I9MA 5DDIP 1CYDA 3O26A 3PZRA 4L74A 2CVQA 5ENDA 3QY9A 5F1KA 3TQHA 1VJ1A 5JYDA 1ID1A 1H9BA 2OFPA 1FDWA 2WE8A 4ND3A 1WXDA 5G0SA 2CD9A 4JCOA 4LRTB 4BQRA 4B3HA 1YB4A 1R6DA 2B5WA 2QZZA 1QYVA 2WWRA 2B83A 4WJZA 1H93A 1ZVMA 2PLAA 1HWYA 3DB2A 5EIOA 4BNFA 1LRLA 2Y0CA 3VPGA 4DPKA 1Z75A 1KC1A 2HMVA 5TF4A 4NQZA 5AXBA 4B8WA 4F45A 4UVEA 1UDAA 4I9NA 1XIVA 2GD1O 3DC2A 3EMKA 3Q1LA 1ZMOA 1J0XO 1X1EA 3DAPA 1X14A 4J4BA 2VHZA 2O3JA 1PGPA 3V8BA 5TIIA 2I6TA 1DEHA 3F47A 4PG5A 4Y6RA 4K6FA 2QRKA 3AJRA 4XDYA 4J0FA 4BGIA 3NX4A 4RLHA 1U1IA 3U5TA 3PJFA 4FFOA 2GLXA 2JL1A 3QWIA 3ZU4A 3E6AA 1LLCA 2DBZA 1N1EA 2AA3A 4YJDA 2OXIA 2ZB7A 2XPCA 1T4BA 4YT4A 3UN1A 3UXYA 3PXXA 1R66A 2A9FA 4DA9A 5JXWA 4WK6A 3WOHA 5KVVA 1DIBA 5BSGA 3DOOA 2GN6A 1NASA 1GTMA 4HV4A 4TVOA 1UZMA 4YJHA 3JQGB 1YO6A 2Z95A 3AM3A 4Z9XA 5JC1A 3IP1A 4Q3DA 3C85A 3WGQA 2DBQA 5G4LA 5A4DA 5ILGA 4HBGA 4D44A 4PLYA 3WJAA 1WDLA 2VWGA 3TZCA 2CY0A 3I4FA 3KHUA 1ISMA 1DC5A 3DEYX 4YQYA 4DL9A 4U0JA 4WCFC 1QYCA 3BTOA 1ZSYA 4J4TA 5CDYA 1HF3A 4AJ2A 3O38A 3ZHXA 3QIVA 3TF5A 4URFA 2A92A 2PV7A 1PR9A 2VYVA 3LYLA 1P1KA 4ND4A 4EITA 1JN0A 4GGPA 3KXDA 4PGFA 3JQ8B 3WMXA 3BMCB 3OP4A 1B26A 4E5NA 5ILOA 3PYMA 4EDFA 2W4QA 2PNFA 3TZKA 1GYPA 3BZUA 3GRPA 3GPIA 1SCUA 4MKZA 2HKIA 2X9GA 4R9RA 1YDEA 5A9SB 5BSFA 1U28A 3WLFA 5F5NA 5TT0A 5JPIA 4CMEC 4QUKA 4CV2A 1E7RA 5F1PA 2JHGA 4IM7A 3RUEA 5L40A 1UXKA 4P8RA 4YAJA 4YAEA 2VCYA 4ZICA 3I4CA 1N7GA 1NQTA 4OXYA 1DLJA 5G4KA 1YXMA 3GNTA 4XYEA 4HFNA 5JY6A 1JKJA 3Q0EA 2P9EA 3ST7A 2EG9A 1YONA 2GZ1A 3NTRA 3QHAA 4IMPA 3AUTA 1ZH8A 1RM3A 3ENNA 5C7LO 4ZJUA 2BI7A 1I3MA 3CXRA 4JJGA 4Z3DA 5IFLA 1PL8A 4WEQA 1DHTA 3ETGA 3HG7A 4MP8A 3GGGA 4GX5A 4L4XA 1VSVA 3PHHA 2WYVA 3UF0A 3UVEA 3PQEA 1LQTA 3HN2A 2YQ4A 1FJHA 1KVQA 3ZHBA 3V2UA 2PGLA 4M49A 2HJRA 1ZMTA 1ZK0A 1O94A 1SB8A 3L6OO 3QVXA 3WDSA 3WYEA 4XRGA 4R16A 3JD3A 5A9TA 1E3SA 1BXKA 3LT0A 5ER9A 4DC0A 1P1RA 1VKOA 4D45A 2IYOA 3A28A 5JO9A 3EZYA 4E2YA 1GPJA 3L4BC 4R3NA 2OBNA 4AJ1A 3GDFA 1VSUA 4KWHA 4Q3EA 4XYGA 3WQRA 2X9NA 4CM9D 5LDHA 1NPYA 3Q9UA 4XQEA 1JVBA 1PZEA 4BHTA 3PI7A 4CMEA 4DLLA 1T25A 4QO7A 3OMLA 1N9GA 3WX0A 1NQ5A 1PJ4A 4KMSA 3TL3A 1IZ0A 4PZDA 1DDOA 1TEHA 2HUNA 1DIRA 2RCYA 5CAEA 5EQDA 4PRKA 5F1OA 5JSFA 4DWVA 2XF8A 2CDAA 4QEDA 3GY0A 1TI7A 1SEVA 2X7HA 1GQYA 2EKPA 3INTA 1HYEA 3NEPX 4WOJA 1N92A 3WGHA 1GUYA 2UUPA 3GGPA 3U9LA 4J9VA 3R0IA 3ONEA 3HWRA 4ND1A 4KTTE 3U4HA 2HK9A 1E1KA 4R51A 3EHEA 1YL5A 4C7JA 1J49A 1BHSA 2HRZA 4TRJA 2RH8A 1HE2A 1LDBA 3ZNOA 1B7GO 1O6ZA 4NK5A 2NADA 3D5TA 1HYHA 1I2CA 1OI7A 2OZPA 2VN8A 2ZTVA 4JQCA 4NJOA 4XD2A 5KJFA 4CMGA 2VRBA 1DRUA 2WD8A 2ZCUA 1B16A 3LK7A 3SEFA 1TA4A 1VI2A 3GUCA 1ADGA 4PIVA 4IGFA 1Y8QA 4R69A 4N18A 3MJ4A 2G76A 3UOGA 2EKLA 4YBZA 1B0AA 4OQZA 5ES3A 1LRJA 1C0KA 2B35A 3D5QA 1YS4A 5TJ9A 2VRCD 4CMIB 3MEQA 4MVJI 4XR4A 5L7YA 3BMOA 2GDZA 1HDZA 3VH4A 2NNLD 5BR7A 2PY6A 4YJFA 3VPFA 3PHGA 4J2HA 1LU9A 2O3QA 4XQCA 3W6UA 3JV7A 4D42A 4ALIA 4U5QA 4PN3A 4MOWA 3NT2A 1PS0A 2VOEA 2NU9A 4IXTA 2H63A 3AWDA 3LT4A 1P0FA 4PLVA 1J4AA 4R5HA 3TFQA 4CM5A 1YRLA 4MIEA 5HM8A 2GYYA 1YQXA 3S55A 4F6CA 1T2AA 2AG5A 4X54A 1KERA 1YQGA 2ZYAA 3L07A 4ZGWA 3IKTA 1ONOA 4OM8A 1BGVA 2Q4BA 4YYZA 3D64A 1YQDA 4GKVA 1KY4A 2C2YA 2O50A 1Q1NA 3BA1A 4W9NA 1PU2A 4RZHA 2HSDA 3HFGA 1P44A 3HDYA 3VZQA 3F1LA 4IDCA 2UDPA 3K5PA 1KYQA 2VT3A 3H2ZA 3MOIA 4W82A 1JVSA 3ENKA 4OSOA 4BL5A 4DYVA 3BHJA 1Z82A 3OQBA 2Q99A 1EVZA 1PL7A 1EK6A 1NPDA 1KEWA 2OORA 3W4KA 2ILTA 2VYNA 3PFFA 2X0JA 1W6UA 1B8UA 3B1KA 1UUFA 1L7DA 4CM4A 1RM0A 3M2TA 4IDDA 4FC7A 4LMRA 3WBBA 4XYMA 4Z9YA 1M6WA 2FN7A 1EVIA 1RJWA 4J1TA 2I3GA 2J6IA 2Q2QA 3C7DB 3DBHA 1PQPA 1NP3A 3AY3A 4GLOA 3PHJA 4CODB 2B69A 1IPEA 1EQ2A 2WYUA 3GEMA 4GI2A 3JQBA 3MWEB 2WD7A 3G0OA 3GG2A 4MVJM 4OJNA 3LC1O 5DOVA 4BKRA 7MDHA 1GZ3A 3RUIA 3WFJA 2FHSA 5KKCA 2X1HA 5J23A 4OAQA 5IXYA 3F5QA 1TT5B 3PRJA 2XOXA 1U2DA 1R4MA 4S3MA 1H9AA 1UXJA 2CDCA 1R0SA 1M66A 2IXBA 2VZ0A 4J6FA 2CF6A 2X9VA 2G1UA 4NU6A 1EUDA 3T7EA 3F1KA 4XRRA 4GWKA 2D4AA 4MP3A 1PX0A
chains in the Genus database with same CATH superfamily
4ZDIA 3HKDA 5A6SB 1GPKA 3LL7A 2JI4A 4HWGA 4L4ZA 4YMWA 4NFSA 5I7SA 1BCRA 2ZTSA 1U80A 5CURA 2RGGA 3UQYS 1E3WA 3BSWA 1ZGAA 3M6XA 5B1SA 1MF7A 1YQUA 3E9MA 3A0UA 3PGA1 3W6PA 4F2GA 2YY5A 3EXFB 1JG4A 1IULA 1Q6YA 2GRJA 4N1AA 3EW7A 2PM8A 3DBIA 4L2IA 3O3OB 3VH1A 3JATB 2BFMA 4L8LA 5AVXA 5HUHA 1UMDA 4EBFA 2G0TA 3MM4A 3PIIA 4JI7B 1VHLA 2WV7A 2J0SA 4JROA 2WF7A 1OAAA 1P72A 3MAJA 1N0HA 2DWUA 2DPXA 4MUXA 2WY2D 4UZEA 4L5AA 5D51S 2D2EA 1JWAB 3ID6C 5IP5A 4F9GA 8ATCA 1PUXA 3PBKA 3NVDA 1OHHD 2OV1A 4GKAA 2WFZA 1IHUA 2OP0A 4H0NA 3ZV5A 3R77A 1SWWA 2FEAA 4KH1A 3ZR4B 4ZIRA 1P80A 4IAOA 4DCCA 2IS4A 4JP1A 1H2XA 4MLCA 1VPVA 2MCFA 1WUKS 5HKKA 3WLKX 2DCUA 1ACLA 2IZ7A 5IF9A 2ZJ2A 4RDXA 121PA 1S2NA 3TG2A 1HE5A 2E4XA 2X3UA 2YV4A 3DMTA 1ZS9A 2ERYA 4CT4B 3ENWA 3EY4A 4P54A 4BLPA 2AW5A 2G09A 1MU0A 1JKJB 1CVIA 1A5SB 2GBPA 4P2BA 5BUSA 5IC4A 1ND5A 2ZJ3A 3M9XA 4PBTA 4KUGA 1LA2A 3ZQUA 1S2IA 2Q1TA 1DS6A 3JRWA 4OP1A 3F7TA 3FOAA 3P0JA 3VZDA 2WAYA 3A10A 1NY6A 3TDNA 3FBGA 1ML3A 2A67A 1FFXB 2JJMA 4L5BA 5JYCA 1EFLA 1P0PA 1JG2A 4YJFB 3PNYA 3IAUA 1C8VB 4TLBA 5DI9A 1I5RA 5G53C 1PJBA 3QU2A 5BR4A 4C22A 1LX6A 3U4QA 3TBFA 2Z56A 1P2SA 3AHIA 2XZLA 3B5JA 2PGDA 1J22A 3MJFA 1HT1E 3PUZA 2XRYA 3TQIA 2FUCA 3G6KA 3NVAA 3S8YA 3ISVA 1Q95A 3FPKA 5E0KB 4UMFA 1FDSA 1RC0A 2EJCA 4E6PA 2AS0A 1KOGA 2PSSA 4MV8A 1PFUA 1P0QA 2O2YA 4R7TA 4RA6B 4GVPA 4AULA 3QOWA 1KMIY 1CXZA 2Q41A 4Y9SA 5FBQB 3ADBA 4XB1A 1ZLYA 5ANRB 3JYOA 2PMBA 4R54A 1HUQA 1PWYE 3M4JA 1U8XX 3W2EA 3DV0A 1U0NA 2Z98A 1FDVA 1Q91A 1KOJA 1XEAA 2PTHA 5DHAA 1MAHA 3USES 3GP3A 4B2YA 1FFYA 5KWSA 2H11A 1S2OA 2O3UA 2JK1A 3IKJA 3A36A 4HQLA 4RK1A 4ZA2A 1KF0A 3W6OA 4AURA 4D9JA 4UTPA 1KEEA 3CR3C 3BJRA 4B3RB 2O2DA 2P5SA 3PHIA 3TLYA 1KAMA 1KK2A 2ASEA 2QYSA 1PD1A 1U4SA 4NMMA 1TQ8A 1G1MA 5CDFA 1HO3A 1W4AA 2Z1MA 1MOSA 2I2CA 4JB3A 5E4YA 2APJA 4CKYA 3TE6A 1B3RA 2G8LA 4LQ4A 4MJLA 3CKYA 4PRYA 1II0A 1QRRA 3GOHA 3AB3A 4HGYA 5DN9A 4JI1B 1HOXA 1CUHA 1CEYA 1H5NA 1C7IA 1WNFA 3ELDA 4WNIA 2RBKA 3Q5GA 4FZRA 1SUDA 5A3QA 3DTNA 4X1YB 2PUBA 1UEIA 2ZATA 3HPQA 4L9WA 1ETHA 4EJSA 3J80A 2HPAA 2Z08A 3TF5A 1E79D 4JOQA 1USWA 1CR0A 1GZVA 1FC0A 4TL8A 1UWKA 3GJ7A 2CFSA 3S7ZA 3RU2A 3PKJA 4CV3A 4CIAA 5T6MA 1N2IA 4PAWA 5K0JA 2O0MA 3RBZA 1KMHB 2V59A 3WSTA 3JQEA 3NIDB 1DBRA 4E32A 3ZD7A 3JYQA 5FWNA 1QGUA 3FMFA 2ZJFA 1WMAA 3E9CA 4HWSA 3NBXX 5FPQA 2HZ7A 4C0BA 4JBIA 4BV3A 1N34B 4WJKB 5LQMA 4JUFA 1E7YA 2LBPA 4OJYA 1EUZA 2H1FA 5DBIA 1U90A 1N9KA 1DARA 1TJ5A 4M86A 4PYOA 5LKAA 1KP3A 1RAIA 1I2AA 5A3JA 1NKTA 2V7BA 3DH0A 1IUOA 2GNPA 4F1JA 3NOXA 1GAWA 1UOPA 3KSBC 1N5KA 1WXFA 3LOPA 4QODA 2W43A 4RE5A 2FZ4A 1JYFA 2QUKA 1NBOA 2HXSA 3I9LA 1IXSB 4GX1A 1VCIA 3WGMA 2AE1A 1CCWA 3DEIA 2ZBEA 3GELA 2XNDD 1ODTC 1VLZA 1FP7A 2IQ5A 3JAWB 4P4SB 2UZAA 3D6AA 1M9NA 2H0QA 1BQ4A 1WB6A 5CFMA 3TBHA 1JBQA 1A98A 4CETA 1ZR4A 5ENZA 2PKYX 1QCZA 1XTUA 2CEAA 3OZFA 3VC3A 3QI2A 5JBNA 3GEDA 2B4YA 4OHCA 4HFJA 1P1FA 4LX8A 2ODQA 3CCCA 3Q7TA 3DQZA 1FMCA 3KELA 2C5AA 2R11A 3W5BA 3NJRA 3NKLA 3O4GA 5JAZA 4O2BA 1WA5A 1SHZA 2WWFA 1EYZA 3IILA 3WI7A 1NM5C 4NONA 4I50A 1B93A 1CZOA 3I45A 5TJHA 4A0FA 3PNOA 4ZYVA 3U4IA 2AI2A 2BEJA 1INLA 3FSJX 3Q9SA 4FIDA 5EHQA 1Q0SA 3EWIA 5H4GA 4LK2A 1W5AA 2DPYA 5H4HA 1I36A 3GFPA 1MDFA 1BHQ1 1IOWA 1X38A 2N1BA 4G01B 4MQ4A 1CEQA 5CJPA 5EQJB 1N6NA 4IJWA 3C70A 1XA4A 4MS4B 3D7NA 5CGZA 2N3ZA 3WFZA 5I9NA 1FRFS 1XU7A 2WWGA 2QUBA 3FA2A 4NNPA 3TLCA 3KT8A 4YHHB 3VAZA 1A2KC 3M6FA 1O96A 3WQQA 1MB3A 4BGVA 1DJOA 5EUBA 3TPZA 1NW7A 3ZHSA 3FWKA 2GAOA 3GPDG 4QULA 4MULA 4Z0HO 2BEVA 2IVFA 3A32A 4JHLA 2WU0A 3SYRA 4OGWA 1QHEA 1XZHA 3LQ4A 1HORA 2FPIA 1ORHA 2BW0A 1FDTA 4JZYA 2JHFA 4KIGA 3SFZA 1ZEJA 3KCQA 2QBYB 1Z5GA 4MKHA 1RLUA 4G4SP 1XDBA 5F2NA 2NUTB 2WP0A 2ZZMA 3JR3A 1URPA 1EMDA 3NEJA 3IV9A 2OXCA 4I99A 4N9WA 4IW3B 5E4TA 4ZARA 4V03A 3RS2A 2CZGA 3GLTA 5CBPA 2VNIA 1ORRA 4M89A 4OVKA 2YYZA 1J70A 2E6UX 1SEPA 4WUVA 2X1VA 2IYQA 1C7JA 1C80A 3UWPA 4TROA 3HJFA 2CL0X 2KMLA 4INPA 4CDGA 1UBJS 5DM0A 1ZJJA 2JFYA 1M5UA 1VIVA 1XTTA 3B38A 1K6MA 3D0KA 3HYNA 1DPFA 3O1LA 4W1PA 5DNWA 3S8MA 3VDQA 4ALJA 4ARUA 3LO8A 1F12A 4WXPA 4H77A 4Y2HA 2Y92A 1PJTA 3NYIA 1I80A 3H4VA 3LZ6A 3NPMA 4U6QA 3RIXA 3K5HA 3UV7A 2MJLA 3KVOA 2JD0A 2ZQYA 3IIMA 3M6UA 3ZY4A 4OI0A 1L5FA 4INOA 4GL4A 2XVZA 2H59A 4PSKA 3UJPA 3TGLA 2O8BB 1XVTA 3NM5A 4N7RA 4WBNA 1GAEO 2XQIA 3TTWA 4M38A 1YF3A 2UVPB 2Z30A 3AR8A 3GVHA 1CP2A 3QK7A 3TO5A 4D1YA 5IYZA 2DF8A 5I7EA 5K8LA 1M2KA 1P0CA 1CFZA 1U3WA 4Y2YA 2C5EA 2OGSA 1II8A 2RHBA 3NXKA 4BJ5A 3D6UA 4GQIA 1GPUA 2IXEA 2XUAA 4QYXA 5FI3A 2GYWA 2ZETA 3I72A 1XMQB 1MJ5A 2GPJA 4O4HB 5KYKA 3K9LA 4EM6A 4ITUA 1OGYA 5F7XA 1XCGB 2EG5A 1A9SA 3HACA 4H18A 4N5LA 4PFKA 4RXMA 3FMPB 5AXDA 2VSOA 3QMWA 5CCDA 4D80A 3W79A 4GZMA 1DEXA 3UO8B 4C4ZA 3BWMA 3AFNA 3LC2O 5AP9A 3BFKA 5M5BA 3IPYA 4C5AA 1JR3A 3WWPA 4R8SA 4MEAA 3I4LA 3IMGA 3GLIA 4Q1AA 3W8FA 3WKDA 5IANA 1UFQA 4MYRA 2A0KA 2YXEA 1NMYA 3RAEC 3CPEA 4CKZA 5JECA 5TLSA 9MHTA 1P4RA 4OK3A 5AW4A 1WZ2A 4CKXA 3T4UA 2OAEA 3A26A 3EDQA 3P0RA 2V7WA 3KAJA 3MAGA 2EF1A 1SRRA 3GRYA 3W3AD 2NUPB 4Q1DA 4DHWA 3GVXA 4S1OA 5FOXA 1QB8A 2Q8NA 5AIBA 2H3HA 4IMJB 5C7OO 1TOAA 1G4AE 1AGYA 1EP3B 4RKEA 4WVLA 5JROA 1BS2A 1NVFA 5K51A 2OCGA 3HYTA 2Z5LA 3I32A 4TKVA 3ASVA 1U63A 2QP4A 1OZGA 3CX3A 3IUNA 1DC3A 2LIPA 2IV3A 2FSPA 2O1WA 3ESBA 4LF7B 2ZJ8A 3A4TA 1XWWA 1Z5ZA 4XSHA 4FBGA 1N2CA 4KXYA 4BKMA 1YVEI 4AZSA 3GPLA 3KTAB 4Y2JA 3OLZA 4OAOA 1LFAA 2FPKA 1UKZA 1M54A 3MQ2A 1XEXA 4B3XA 2DFVA 1BEUB 2R44A 3I6MA 3N53A 1SU8A 1ZRMA 2A5LA 5EHGA 3TIFA 3TLKA 4DEVA 1A2BA 1JFFB 1JUDA 4YASA 3LBFA 2PMDA 4EGFA 5KSOA 3CLSD 1JXOA 4IFEA 4BBPA 3KYIB 1D1PA 1JQDA 1FJXA 5I4IA 4LWOA 2PUAA 4Y6LA 1FXWF 1W0KD 1GPLA 2QG4A 2HV8A 1FFWA 3DTVD 4EDHA 4PIMA 5A06A 4W5NA 1XAJA 4GLLA 4J0KA 4MIOA 4X66B 1IIBA 3MRVA 3GZNB 2CDNA 5I6DA 4E08A 4NVRA 1ZN2A 2AT1A 2V55B 2YDYA 4MVJE 4GXRA 2Q4EA 5FOWA 2EHDA 4DPLA 1RIFA 3F9IA 4RIHA 4G0YA 4IQGA 3T38A 1GZ6A 1FFAA 3K31A 2V5AA 3CNOA 3DE4X 3CONA 4OQXA 1JL3A 4HLQB 1TO2E 4QWMA 4ZN6A 3LDHA 1US8A 1Z6YA 4BNZA 2O3RA 4J3FA 5CVUA 5EP1A 3I9OA 3HB7A 2XVXA 4ZI3A 4KX3A 4XIFA 4JD5A 3SBOA 3DKKA 2AZ4A 1GUZA 2VAVA 3MERA 2Y0BA 3MCTA 3SZLA 2ZCJA 1NYRA 1EFDN 1HPLA 2O8FA 1ICEA 2L18A 1QHSA 4DKXA 4DQUA 1I0ZA 3IR5A 5JSZB 2PL3A 3IQEA 2O0KA 4Q1EA 2XTJA 4UMDA 3ZHZA 4ZODA 3P52A 3FTPA 5L3ZA 4WL0A 2PX4A 2YVUA 2ZRKA 4DMMA 2WINI 1T4MA 3EZ2A 1FYVA 3V33A 1E1MA 1AGPA 3S2IA 3ENVA 3LUJA 4FE3A 2IEAA 5I4CA 1PFWA 2FMFA 2XA9A 3SR4A 1DAKA 4Z4HA 1W9MA 3DEZA 1Z35A 2VTBB 4QOIA 2QJRA 3IALA 2WI8A 3OCYA 3F7MA 2EX1A 4R40A 2MSKA 2MIIA 3AIOA 4LQLA 2PJZA 1VB3A 1U9JA 2H4FA 2HU7A 5BSRA 4D3SA 1EGVB 2FTKE 4PNPA 1JEQA 3ROGA 4JU9A 2FZGA 1LSUA 3QX9A 5JSUA 1PK8A 2CLIB 3CY6A 4JJAA 4XUEA 2B1QA 1EHYA 1FX0B 1K3TA 1SZDA 3ADPA 2VNSA 2Q7OE 2OQRA 3NDRA 1RYBA 3KE9A 3UQZA 4EKNB 1NOIA 3TWOA 2ACVA 5ALMA 4WEOA 4CTMA 3ANYB 3WIOA 3GLFA 1UANA 1CBUA 3DL0A 3L1KA 4XFJA 4RCVA 3HCFA 2LVBA 3F6CA 4FILA 3O9VA 4C5BA 3FPSA 4ZAXA 4L3OA 4QX6A 3FVQA 3V42A 1OX4A 2C9DA 2H3EA 3H2KA 1RXUA 3BEOA 5FBRB 4AY3A 3JTEA 3GQBA 4HAXA 1BW9A 3KTDA 3CO5A 3GEBA 2P4HX 3JRXA 4HX2A 1Z8HA 2PZLA 4NZZA 3UVEA 3OOSA 4D57A 2JDID 5D87A 2OK8A 3CN7A 2LKDA 1BH2A 3MS2A 3B9RA 4ZAVA 2LKCA 4P7JA 3LK6A 4I1RA 2HCBA 3DM5A 3IIEA 2ACWA 1QCDA 4YJGA 5FFMA 1QIMA 4D9FA 1D7AA 4UVIA 4UEKA 3RKSA 2GXQA 3LBNA 3OX2A 2HNKA 4EGAA 3MOSA 1PNTA 2F64A 2WU3A 4NV1A 3SYMA 2YVKA 3EISA 4Z0PA 3ROQA 3W9YA 3TW4A 1R0WA 1KPGA 3QUSA 5D3MB 2OR3A 2CC2A 2IYWA 2OYCA 1F6WA 5B58C 1L3CA 4UASA 4CNBA 1NA5A 5DB4A 1H1LA 3PLNA 5FNVA 1R12A 5LQSA 1JXQA 3H5IA 2IXAA 1D4OA 4RA6A 5E7JA 4K9QA 5BNZA 2PZKA 2AQKA 4IINA 1D0SA 1A4IA 4CFSA 4TUYB 1ZM2A 2JH9A 2Z8YA 4CIDA 2WPDD 1BQEA 1K75A 1E77A 3T7JA 3OTHA 4K9RA 1HQCA 3JD1A 2JJ2A 1LX7A 3JWPA 5D5QA 1VL1A 1C2YA 3U49A 1RABA 2PL9A 1CQXA 5DBGA 2ZUDA 4W5QA 4Q21A 3RKRA 1OXXK 4JJ7A 5J1SB 2QPLA 1RE0A 3BSYA 3K16A 3WWZA 1FSZA 2Q2VA 2DKFA 4M0UA 2O8EB 5LFAA 3O9MA 4PYLA 3PYLA 1EA5A 2Y1WA 3O8BA 1H2BA 2OHXA 4FFLA 4KXVA 2BC9A 5JJKA 3QU4A 2BGGA 2EL9A 5TE9A 3BMNB 3LFTA 2EJWA 2WJ4A 5AJZA 4ENSA 1IY8A 4BJ1A 3RHSA 5JARA 2RAFA 5IDYA 1A9XB 1E1NA 1VG1A 2FFAA 2BH9A 1XTQA 4JLUA 1LV7A 1P2DA 5F4BA 1DWPA 5DH9A 1FX0A 4RGVA 4QTXA 5FA5A 1AMUA 3EULA 5C52B 1SB9A 3P1JA 4YCDA 1WUYA 4TXMA 3PS9A 5AOAA 4DJFC 2UYYA 4R3WA 1E5LA 1W25A 5J2TB 4YCMA 3H5RA 3PWSA 3WS7A 2JLVA 4G1BA 1S8NA 4DCMA 3IEUA 3MTGA 3CF4G 3ZYCA 4IJVA 3ORQA 1M3SA 4X7MA 2II6A 4RA9B 4OQPA 2TMGA 3H0KA 3IPXA 4PQYA 1RZVA 3KKZA 1Y42X 1Y6FA 3O0TA 3GAZA 2ORED 3BK1A 4G0QA 3ET5A 4MZDA 1GM5A 3L41A 1UZNA 3ZX4A 1XFDA 2NPOA 2ZJ0A 1NMXA 3ZCQA 1KEUA 2ZE7A 4G67A 2HQOA 3WA7A 4YJKA 3AUUA 5LDGA 5FO0A 1VRWA 5EOVA 5ALJA 4CMIA 5ISMA 3L2OB 4OQDA 2HPHA 4YACA 1TXGA 4ARAA 3G2LA 2QM7A 2FW0A 4Q7LA 3N5KA 5JMWA 3N8DA 2C2BA 2XCUA 4EL5A 5A5EA 2ZYGA 1NTRA 2HD4A 3BAZA 2I33A 3DE2X 3EYAA 4FIZA 3COVA 4TTPA 4MJXA 3BGOS 5ALIA 3WAJA 5CNKA 1L4LA 1M2GA 3C8DA 3PR1A 2ZWMA 3KQLA 3EGWA 4C0KA 2VAXA 4BIMA 4Q3LA 1QFMA 1XVLA 4C76A 5JJIA 1Q0LA 2CNDA 1A96A 4HB0A 1TD9A 3NHWA 1M2VB 4D41A 1GT91 4YDHB 3BK2A 4UOEA 5INTA 4JGIA 3PFNA 4BO8A 5FPSA 2ZE8A 1PR5A 1Y82A 2AZMA 2Q62A 2WWXA 2XRFA 3C1TA 3NDJA 1JAZA 1RI5A 1YBHA 3L92A 4U7TB 4QOHA 4TUYF 4AN4A 3U5ZB 3WADA 3EGOA 5A1TA 1VLHA 2ORYA 4EW2A 2HM7A 3FB4A 4RPGA 3SZUA 4JP2A 1V4BA 2BTOA 4QG7A 3A6JA 5GM2A 5IZ4A 5T8KC 2OBFA 4W8HA 5EA2A 3DR5A 2ZRCA 2VDNB 4ZVOA 4K9OA 3AY6A 3PVCA 2RI0A 3VO9A 1JKIA 4LMBA 4YONB 5B4TA 5IM4F 1ACMA 3KJIA 2J30A 1BN7A 4W7SA 3L01A 5KKAA 4X90A 3TFOA 3GVPA 3UXHA 1EHIA 4TN1A 1SD1A 2VDWB 4UAGA 3MC1A 3Q7IA 1HL3A 3Q2OA 3QFRA 3BBPA 4QU9A 4YA6A 3K0HA 2HRQA 3RUCA 3SS7X 1KAHA 1IFXA 5FOQA 2IZ0A 4D8XA 3QBJA 2W6NA 2F7SA 4AP5A 3FGZA 2OOSA 4JXZA 1J2UA 4AP6A 1H8EA 1KO1A 1SELA 1UBOS 1XRMA 2ONYA 2XNJA 2Y66A 3LM8A 2I7CA 2O3TA 1YS9A 1HG0A 2X6TA 2HSGA 1YZVA 4I7EA 2OFWA 5DNEA 2LCFA 3G5TA 3ZW7A 4I3FA 4AJKA 2WD7B 4E7PA 2GZ2A 1X1AA 3OM1A 4LVUA 1R9MA 1WRBA 3GLFE 4B7CA 1UZLA 5CCEA 2C84A 3VHRA 5I7VA 2ZJ1A 4A2CA 1Y3CE 1Z8DA 3RGWS 3ZWYA 3FHTA 3TXYA 4M1WA 1KJJA 5BMOA 1XRJA 2FEXA 2D13A 2WYWA 4S12A 5ARCA 2VJMB 4WA8A 4XIGS 3AVUA 4MRAA 4PTZA 4TMVA 3RK1A 3KS9A 4YJHB 2IDKA 2VNAA 2IU3A 4XW2A 1XALA 1XVAA 4YCBA 1J33A 4KWEA 5HF9A 1YDMA 3B52X 3FETA 3MAAC 4HD8A 5SZJA 4KR9A 3RGGA 5BV0A 4B2IA 1AN9A 1SQ6A 1BMQA 2B36A 3M6LA 4N0EA 3RVMA 2WT9A 4W63A 3BXEA 3LE8A 1PWZA 1QZ3A 4NOMA 3BXGA 3GCGA 3ZHTA 4P93A 2MSDB 3R4VA 4QGBA 3MTEA 3LLMA 4FN4A 3C3PA 1DRVA 3D7SA 4O4JA 3ICEA 4D56A 1F17A 1YR7A 1EK0A 1TVMA 2NZJA 1F3LA 2G80A 3KUCA 3SMVA 4WLEA 4OHKA 4RHTA 2Y0PA 1JQBA 1XCJA 3MTJA 4LCEA 3E15A 2PWYA 3EZFA 4OO3A 3E9NA 1KOLA 2OYRA 2HOQA 1WZNA 1ZINA 1N2OA 3BZWA 2OZEA 1DV1A 2RI1A 4B6QA 4DUYB 3OQOA 2IEDA 3MD0A 3PQDA 5DHRA 1IHYA 3LKZA 4N12A 2BAGA 1HK7A 2IYYA 4X1OA 3W2HA 1SUIA 5EERA 4B75A 3V6LA 4NV0A 1VMDA 3FUXA 3T9DA 3WHPA 1EIWA 3H99A 1TIKA 3FCOA 1KYVA 3WB9A 4QGSA 1B2LA 2H52A 2FSGA 2ODPA 3LSYA 3LF1A 2JAHA 2OO5A 2B1GA 4MWZA 4Q0MA 3U1TA 1V3QE 1L7VC 1GUAA 1NVMB 1LF5A 1B1CA 1FU8A 1JHUA 3H04A 5EE5B 2NZ2A 2QX4A 4RAOA 4DDKA 3MWDA 1UXHA 4X85A 4BV2A 4MVJA 2P8SA 3R41A 2BGMA 4QLBA 1YKSA 1QVVA 1S02A 3OZTA 3T7CA 4XGIA 3FUUA 4WZBE 3R5HA 1WXWA 4D4IA 3RV4A 3P9KA 4ZFNA 1B8PA 1JWBB 3BIWA 2X2EA 1X77A 2WTXA 3CE6A 2XBLA 4HRYA 4R7ZA 3DZHA 3SICE 4AF6A 2JJQA 4E15A 2FPWA 3AEKA 3H8WA 4KSYA 5D5HA 4DIMA 3C8MA 3CZMA 5HKBA 4CQNA 4OYHA 1RRPA 2MYPA 1PJLA 3Q6MA 4BJ3A 4X6LA 4P22A 1YH3A 4JH0A 1MB9A 1O03A 2QX8A 2RAUA 4KGDA 3FMGA 1D07A 3IXLA 5AOBA 3I2FA 5AQ1A 2C4WA 5K45A 3JPWA 3F78A 1Q3TA 4QZVA 1NUQA 1OLUB 2GJ4A 5EPOA 4F8JA 3KTFA 1N5IA 3G1TA 4HLUC 4LE1A 1GN8A 1WO8A 4Q7EA 4LHZA 5G2OA 2R48A 2YWBA 2QM8A 4HMOA 3Q5EA 3IDFA 2AVDA 1U2SA 2ZVJA 4NS4A 1PX2A 3QTTA 3VR5H 1WBDA 3C3JA 3PC6A 1RC1A 2FEWB 3M8KA 1T6ZA 2VT7A 4LV6A 2ODBA 2J8ZA 3UXMA 2AOUA 3QYJA 3QKRB 1BIFA 2XWQA 2XUOA 3L0SA 5CNJA 4OSEA 3SQDA 2GUWA 1DPGA 2V3VA 1K63A 3TCNA 3KAPA 3HJAA 1MP0A 3BRWA 1VE5A 3GYGA 2FZLA 4RMHA 16PKA 3B12A 5AR1A 1IQ0A 1ZM7A 3B1JA 4K28A 3UUWA 5FTLA 5TV2A 4YRNA 3ZGZA 1BEZA 1D03A 1KAEA 3KYDA 4O4IF 3VKHA 2YV3A 2VWHA 1GQRA 2ZSAA 5DN6D 1DXYA 1OAOA 3K1AB 4OOFA 4LVOA 1GAXA 1GCAA 4WXYB 3NETA 3RHTA 4WUTA 4BZQA 4ER3A 4JGGA 4LDAA 5FD8A 3UW3A 4ZDJA 2VZLA 1L5YA 1NZDA 3ZE2B 3RU7A 3FCXA 5AM2A 2VA8A 3ZVKA 4IEFB 4I4TA 2YJNA 3HGTA 4Q9KA 6NULA 4CIYA 1YDFA 1U99A 1FFCA 1ZMRA 4E4TA 3LHDA 4QDOA 4ZOCA 1Z6GA 4ZZ3A 2IBSA 2QL7A 1TYCA 5HCNA 4B4DA 4IUYA 3X1XA 1GQSA 1R2QA 1SQGA 3CZ9A 2XVMA 1IY0A 5KNDA 1G3IA 2F8LA 5IJXA 2VYFA 1IIRA 3AG5A 4LY9A 5EHZA 4GECA 1TL7C 1E5TA 3W5HA 1LUAA 5H7XA 3RK4A 3IHWA 4GI3A 4HKTA 1FNNA 2QQEA 1WZUA 3B6IA 1EFUA 4HMQA 4C88A 5EKUA 4B4WA 1CSEE 1XSEA 2AK3A 4J0QA 4C43A 3KZNA 4AY4A 4DUGD 3TSYA 4E4YA 2ST1A 2W2LA 2BZGA 3ELWA 1ZBDA 2Z1DA 2MSNA 5AH0A 3EJWA 1SHJA 1DNPA 3IQIX 4PQFA 3ZDRA 3L05A 3OLWA 4OHOA 2GD0A 2IHJA 2VUHB 3B6JA 4M9RA 2E48A 3MILA 1Z38A 4RMGA 4TSFD 1XO1A 1OLUA 4AJEA 4GYKA 3OJCA 3RS8A 4O8CA 3M83A 3H4IA 1CF9A 2C1XA 1YBVA 3ED1A 2FP3A 3LP6A 1QIDA 4V0MA 4HADA 3O8RA 2OILA 4OOEA 2RGXA 2X0KA 2FWBA 1IUNA 1LZLA 2A9OA 2NO1A 4XQGA 3WLLA 4COOA 3HCAA 1V5EA 1XMJA 2ZAIA 1UBFA 3NZEA 3OZ7A 1DOAA 4A26A 2F4VB 2NQTA 3QLEA 5C4IA 4C5CA 1R4MB 1TK3A 1SD2A 2C9BA 4KR7A 2R6GA 1F5NA 2B2NA 4RDIA 3WG9A 4XWWA 5C0OE 2O1SA 4WZBA 2VXBA 3R09A 2HCRA 5DYWA 1V11B 2GZRA 2CNNA 3BULA 3PR3A 1ZD8A 3K1JA 4Y6GB 2B8TA 3NUZA 4ZCSA 3RIGA 2E3JA 4BYGA 3VTAA 4FZVA 4O3FA 2F62A 4COKA 4LNUA 5FL3A 2Z3WA 1OHHA 4DV6B 5LMNB 2YRFA 2ZJ7A 1LSOA 2WT8A 1CR6A 2EFHB 5ALWA 1P4AA 5AIAA 3RV3A 4RHFA 3BQNB 3ABOB 3WNBA 1AA9A 1WXIA 4JYCA 1SXJA 1V7CA 4BRUA 3FOFC 2XMSA 2HA2A 3KUDA 3LCMA 4B32A 5K6RA 3G0HA 2W37A 2C88A 4PHTA 4C21A 3RJZA 3HSYA 3VR5A 4RSHA 3BH6A 1TB4A 1BDBA 1JIVA 3KV1A 3REQA 5JWRA 5HQTA 2QJTA 3TECE 4AECA 4KREA 2WWWA 2VRWA 1X19A 3O8QB 1C9KA 5K5EA 4ZV9A 4YN3A 4UUOA 4PONA 4DLRA 1T1IA 1T8PA 1QG4A 1EVJA 3PDUA 1KEZA 1S3GA 3AUSA 1A9ZA 1I7NA 3L6CA 3JR7A 2FW1A 1JIUA 5EJAA 5LC1A 4JFRA 2EWMA 2Z3ZA 4EPTA 3P27A 3R5FA 4R1OA 3OQMA 1YD7A 2ID8A 5JDCA 1F4PA 2WIAA 1JZSA 3LUKA 4KLCA 3PD7A 1XE3A 1SIWA 3GJ8A 1KK1A 4PTLA 4F56A 4MB0A 3FH0A 3G0IA 4BOYA 2O9JA 2FE1A 1J2EA 2PDAA 3HKCB 3FOBA 4V0SA 2ZWIA 2V6FA 1VKHA 1NFFA 3K5WA 2LNDA 4MWOA 3V00A 4GO1A 2X77A 4DCSA 4HB2A 3C6ZA 4EI2A 2XYQA 5IU6A 2XA1A 2P2CA 2CUNA 4HJXA 3H1PA 2QTFA 2NPFA 1SUPA 3TQCA 1KTIA 3AOEA 3BWEA 3OOEA 4P5PA 2DXIA 1JMVA 1SKUA 2NW6A 4BNHA 3OQIA 3DHEA 1PW7A 1TYDE 4HVAA 1KH3A 4D97A 2A1UA 1PWHA 3GZ4A 4LW8A 4XSVA 3EPHA 1LBQA 4JYBA 1YRHA 2ODEA 2ZRJA 3K0EA 5CNMA 4HH0A 3CMMA 3RAJA 3T5CA 2XCIA 2D1SA 2ISCA 3LAWA 4Y2UA 2BF4A 3P4UA 4BWVA 5KCZA 2DLNA 4WTOA 1LQ2A 1PSDA 1QWSA 2JVJA 4RTQA 4XPZA 5ICSA 1FX1A 3TR0A 3DBRA 3ZUPA 1XUOA 4MW1A 1OV6A 1DJQA 2NVBA 9LDTA 4HFRA 3LUGA 4OF4A 4GZLA 3EZLA 3K1ZA 4JT4A 5I9TA 3T3PB 4Y9DA 1QRTA 3ZJUA 3JQAD 5ITWA 1GRVA 2EEZA 5B1IA 3MTIA 2YINC 2W9XA 3RO7A 1Q77A 1J23A 5K0BA 1P5HA 3SXJA 3AP2A 2FSUA 1F4VA 1Q74A 1C9DB 2Q5HA 2C8KA 3O73A 4NV3A 4OH7A 5AI5A 1H85A 3QVUA 2A3RA 4KQJA 1QQ7A 3VX3A 5AKZA 4PHFA 4JI2B 1QPZA 2AF3C 1DINA 5L9AA 1G3UA 2D5BA 4RESA 2QVYX 4OUDA 1EG2A 1E6UA 5FUMA 1XCPA 1VHWA 2SKCA 1U7DA 3NRBA 1J20A 1RCTE 2IKQA 5FBVB 1SXHA 3B78A 3FFWA 3IAS1 1LSJA 1G16A 5SYMA 5BNTA 4R8MA 4YCAA 3RWBA 1IN6A 1G20B 4FKZA 1H23A 1WQ3A 2CJPA 3NI2A 4EY6A 3IODA 5KHOC 4ZQGA 2FP4A 3PRHA 3EXHB 3F3KA 3H4TA 4RK7A 5EE0A 4Z7NB 1S5PA 1D2EA 1ICIA 3H2BA 2GN2A 4PYNA 4CQMB 2GJSA 5KYVA 3PRYA 1JI3A 3IQFA 4WGGA 4UU8A 1EX6A 1BXGB 1ZIDA 3DHYA 2RHTA 3NC1C 2CLSA 4OGFA 4Y2RA 4ZC1A 4CM1A 5AW8A 2UXCB 2XTNA 3PL1A 1OLSA 2XUGA 1SVNA 2H51A 1LS1A 2X14A 3FPFA 3IEIA 4H7HA 2FDXA 4TMWA 4DSUA 4YXFA 3RFCA 2YY6A 3E5NA 5T4BA 5LBTA 2IYLD 5LLTA 4H0CA 3M6VA 4U7GA 4C87A 3KDPA 3HZRA 5U9CA 1MAUA 3TW6A 2P5YA 1Z36A 5IKOA 1K08A 1YIOA 4U02A 1Z26A 3ECCA 2GB4A 4PG8A 4OA5A 5FTKA 3SDZA 4CM4B 6REQA 1W7AA 1A9YA 1LZKA 4V1CI 4E1BA 3U16A 2IEBA 3QEOA 2FRDC 5IH3A 2GBLA 1GR1A 3I1YA 3JWEA 3GRZA 4Q4DA 4RTRA 1CY1A 1B15A 1RKQA 2LP4Y 3B6EA 4MLZA 3V1NA 4EZBA 4ZQFA 3FIJA 5FIUA 1CB0A 3MMXA 3AEYA 1G5QA 4DY6A 4JI3B 1YZLA 2XWPA 3DZIA 4HAUA 3G1WA 4OKSA 4TWRA 4MROA 4KHZA 5TMPA 4AKHA 5TSDA 5DX0A 1VL6A 3OJLA 4HEJA 2HO5A 4IWNA 1E9FA 4BEVA 4QDTA 3PTAA 1JR2A 1XXHE 3URKA 5HCIA 2J1LA 1WW8A 2R25B 4YDRA 4D0LB 1K6EA 1A5AB 3KZKA 1X9IA 2NYUA 3ZGXA 1NF2A 1RLJA 1EFPA 3PKIA 1E1QD 1JKXA 3EC1A 4QYMA 3Q40A 5E3IA 4ZI7B 3FUWA 4KXFB 4DJDC 4PG6A 4EG6A 2DERA 2CZCA 521PA 1U7PA 4DR5B 4PBRA 3REGA 1QV6A 2IYZA 4DLTA 3PXGA 1DCKA 2X5JO 4JMPA 1XJ5A 4TLMB 4ZYUA 1NXQA 4UCXA 2P8JA 3HHEA 3WSVA 2HMAA 1CUGA 1ZD2P 1THTA 3Q9NA 4QRIA 2YMMA 2FOLA 2DH5A 2DUUA 1P3DA 1BJKA 1NBAA 1I4EB 2HAEA 2LV8A 4FGJA 3UGKA 1ZJ5A 2PZMA 3MRSA 1EUYA 2SNIE 2ZDGA 1XCMA 3EDRA 3D2LA 2DFKB 4MGKR 4DV3B 4BE7B 1YK1A 3WP0A 1L5RA 1PK7A 5CPBA 2CNWD 2V3CC 1LDNA 2GI4A 2HA5A 2VP6A 3ANLA 1Q7TA 1QM5A 3B3FA 4LRUA 3FMVA 4LYGA 4BZPA 4ERXA 4RTPA 2YOFA 3JYLA 1UBLS 4LRXA 2I1VB 4KQFA 4X6XA 4BFXA 1BJRE 3HBLA 2YICA 3U7IA 4ONEA 1ZM4A 1AM4D 4J7UA 2XE6A 1E3JA 2DFLA 5C8XA 1KO7A 2WWIA 3EUEA 1NVWQ 4HDSA 3BD7A 4NFLA 4BP9A 1XQYA 2O0JA 5K03A 4M3NA 3BKXA 3MXTA 5CP8A 5B1DA 2I67A 5HK8A 4ZK2A 3DAGA 3DO6A 3I3SR 1H6AA 1KMNA 1HLGA 4KDCA 4J8PA 1C2TA 4DDVA 3QHQA 4G4SO 4DKJA 4N76A 4M1TA 4TQ9A 4XUDA 5KU7A 3MWGA 2WHRA 4TTQA 2ALJA 4MVJP 4AJOA 1IHXA 2HIMA 4V0LA 1ZJWA 3INYA 3ON5A 4WBSA 4C2BA 3IUQA 3H13A 3O83A 4CUJA 2M9MA 1Z74A 1M2EA 1T3HA 2Q6OA 4ZDWA 3A2KA 4TV9A 1YFZA 2XZTA 4DSAA 3SQNA 3D6HA 2GK6A 2FK7A 4MRRA 4WFJA 4DBZA 3CT4A 4BBZA 1KY3A 1KI6B 4EMUA 3CUEF 1G8GA 1Q1QA 4PZLA 2Q7DA 1TM1E 4ZWNA 4F92B 2ZB4A 3IDQA 3QJYA 1FZTA 3L7AA 3BDAA 2QDXA 1TMYA 2DTXA 4GP9A 4Q9NA 1VDMA 3M4YA 4KIWA 4WCVA 5LZ9A 4DXDA 3AHJA 3UMSA 2JRLA 3K96A 1MZPA 1K97A 1ZQ9A 2YDXA 4J49A 2CL6X 4C9BA 4MQBA 2V8BA 4BQQA 1N57A 4HDNA 1LTKA 4J9UE 2J6HA 3JASB 3UICA 1PJZA 2JFPA 3S2FA 1EINA 3AM5A 4BNXA 5KYUB 2ZT5A 1OFUX 2JCXA 2JNWA 2Z83A 2YNMA 1T15A 3FDZA 3MYRA 1P7PA 2GBCA 4P81A 2Y8EA 3RASA 3BE4A 4G2TA 1DIGA 1T9HA 4DCUA 3PQ5A 2G5GX 4PSVA 4R9SA 1L1RA 3UM9A 3NANA 2VRNA 2BONA 4GZ6A 4F84A 2NU7A 2OGTA 3G8AA 5EJMA 1WE2A 5LM3A 2PL5A 1L1FA 1KVTA 2XUDA 3RJTA 3T5DA 4EA7A 2AKEA 1IN1A 4E94A 1IATA 2ZKLA 1L7MA 3M5PA 4ERNA 3UHAA 2B3DA 3BXOA 3KKMA 1R18A 3N05A 4CIVA 2GUGA 4XSGA 3WK4A 4PN7A 3EBOA 2R1UA 4IGAA 4NCJA 3U48A 4BN0A 4CV0A 3DTYA 9LDBA 3QJGA 4LJ6A 4TL9A 3QELA 3IBTA 3GCZA 3CINA 1M33A 4KVFA 1EJ2A 5BXYA 2F55A 1SOWA 4K9SA 5TF0A 3HSKA 2JATA 3IO5A 1OT3A 3SZOA 2OHIA 3HJUA 1G8PA 4JT9A 1F14A 3C2QA 1NHWA 3DG9A 3VU9A 1KARA 2ZRPA 4HLDA 3ILVA 2P27A 3RAPR 1RWBA 1HYGA 1IBLB 4DEYA 1YQ9A 4C04A 4OBXA 2ZS7A 5ALEA 2GEVA 2L2QA 5KU1A 4DFDA 4YCLA 1OU4A 3AJDA 2AJCA 4EJ6A 3EDMA 2ZRHA 1G9XA 3G9TA 2X0IA 4K40A 5I8ZA 4NFHA 1CRWG 1QG0A 5KYWA 2VOJA 2VJYA 3T1VA 4G9EA 4NBNA 4C6HA 4L15A 3WA6A 2PL1A 3UV3A 3JQAB 1UJNA 1CKEA 1HM5A 4MS1A 4LHYA 4PC6A 1SKMA 1V7QA 1V8BA 2I62A 2Q0XA 5CT6A 1CS0B 3THOA 2G06A 2V03A 2YJ5A 2GF2A 1L2TA 4H7FA 2ZYRA 3DHNA 3IJRA 4PGMA 5CPFA 2H8KA 4C7BA 2FK8A 4KAAA 3H3FA 2OZLA 1TCVA 4L75A 4RELA 5ALQA 4MA0A 3ZTTA 5F5LA 3OQPA 4MI3A 2B8EA 4Q3NA 5IJ0A 2YW9A 3K09A 3MJDA 4G8JA 4J0EA 1QVWA 4MH0R 1Q83A 4W6ZA 3OE1A 2DJIA 2P7IA 4ABTA 1FFGA 3GRUA 2PSJA 3OO0A 4ARVA 3V9AA 1SBHA 4UBLA 2VBFA 2VSQA 5T3UA 5IRCD 3KSDO 2D2IA 3L0CA 3RBXA 4JK3A 1SZCA 3L7OA 2CNOA 4PF1A 1FPMA 5E1DA 1KMQA 4L1KA 1H2FA 1RZRD 4DF3A 4R0NA 2ET6A 4JP5A 2VHVA 4AO6A 1NF9A 4FN5A 3JQPA 3M89A 5ADVA 4WFQA 1XTJA 3IMCA 4DR4B 2MHCA 5CM9C 1K7FB 2WQZA 4UNNA 4WZAE 4BNDA 1U2EA 2XGJA 4CIXA 5AM5A 4RTOA 2VP4A 1KJ9A 1CJUC 1OBHA 1TO1E 1YMVA 2EQ5A 3KJQA 4DIDA 3LXRA 3BM5A 3COPA 4U4AA 4F60A 3FYTA 4R05A 4PCLA 1JAIA 4Y3UA 3WTBA 1DO2A 1RS0A 4EJ2A 3WK8A