1JA9A

Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
b'SKPLAGKVALTTGAGRGIGRGIAIELGRRGASVVVNYGSSSKAAEEVVAELKKLGAQGVAIQADISKPSEVVALFDKAVSHFGGLDFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGGRIILTSSIAAVMTGIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAPGGYKGMPQEKIDEGLANMNPLKRIGYPADIGRAVSALCQEESEWINGQVIKLTGGGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,6,8-tetrahydroxynaphthalene reductase
publication title A structural account of substrate and inhibitor specificity differences between two naphthol reductases.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Oxidoreductase
total genus 100
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ja9A00
3HFGA 1VKOA 1EUDA 3TFQA 3O38A 4C7KA 1U2DA 2O48X 1JQBA 2WSBA 3QVSA 4E13A 3GDFA 2VRCD 1DHTA 3G3EA 1U2GA 1X14A 1BWSA 3N58A 4LSWA 2PA3A 4S3MA 4ZVVA 1LDEA 3MJVA 4LVUA 1EEHA 1RYEA 3GZNB 1BHSA 2RH8A 4FDAA 4Z3KA 1E7SA 1R0KA 4D41A 2R00C 2C5EA 2B5VA 3I6IA 5COBA 3PVZA 1B15A 4KTVE 2Q3EA 1N9GB 3QHAA 1R15A 2X7HA 3ABIA 5KVCA 3WQRA 3RKUA 3GVHA 1GYPA 3FNEA 1XQ1A 1YJ8A 1W6UA 4L75A 1UR5A 3BA1A 4WCFA 4CMIA 1DJQA 4EDFA 2AXQA 2CSUA 1ONPA 1X13A 4XGIA 2JKVA 3IIEA 4BUCA 3M2PA 4GH5A 4UULA 4BGIA 4DIFA 1E6EA 4XRGA 5CG2A 4CLHA 4RPHA 3LC2O 4OQYA 3Q2IA 5CG1A 3D4NA 4RPLA 3L77A 1JTVA 1VJ1A 4IY1A 1AE1A 4NJMA 2IYOA 4O6VA 2AA3A 3CPSA 1K3TA 1PL7A 1NVMB 3ADOA 2GD1O 3GMSA 4BS9A 4P22A 3DB2A 3B1KA 3NDJA 1UP7A 3JYLA 2WYWA 4BNMA 4II3A 5IAAA 5BR7A 1NAHA 3FR7A 4J90A 2Z1MA 4RPJA 4BNLA 5L4LA 1JVSA 3GH3A 1GAEO 2GN8A 2GLXA 2VUUA 3JQFC 1NTOA 4GWKA 3G17A 3NX4A 1JKFA 4CM8B 1QORA 4JROA 3O9ZA 3IUSA 3KV3O 4FB5A 1TT5B 2O3SA 4WLOA 1J5PA 1C3VA 2BKAA 1P45A 1P1IA 4XR9A 4QFDA 3RUFA 3ZV5A 4J1TA 1NVTA 3GFGA 3M6IA 4EBFA 1YJQA 1UDCA 2C7VA 4OKIA 2PY6A 3NKLA 1U3VA 1NHWA 4MVJP 3ANMA 3NJ8A 2GF2A 4CMGA 3HDYA 4M55A 2OBNA 2PZKA 3NDIA 4FFLA 3RUCA 1DXYA 2GASA 4IZHA 1BTOA 3RFXA 3S2EA 2Y1GA 3W4JA 2NTJA 2C07A 2DBZA 1ZH8A 4U6SA 4PLVA 1CQJA 2C7GA 3LSYA 4IJUA 4LK3A 4RO0A 2IZ0A 1K0UA 2VHZA 2CDAA 3PHLA 5DP2A 3ANNA 1BVRA 1HLPA 4J4BA 4MIYA 1AGNA 5LCXA 2X9VA 4FIZA 5TSDA 1YQGA 4NHEA 2I3AA 3D7LA 4NPCA 1BXKA 4I5DA 4IINA 1YQXA 3UGKA 1Y8RA 1T24A 3VHRA 1PEDA 1UDBA 2OL4A 4EITA 4E5MA 1RM3A 1N2SA 1LQUA 2DLDA 1LEHA 3I23A 3P7MA 3LVFO 1XEAA 3GOHA 2C54A 5G4KA 5FF9A 4QEDA 3EVNA 1DRUA 2JD2A 1Q1NA 5CDGA 2CZCA 1YL6A 2ZJ0A 1WDKA 2X8LA 1DFGA 4PVCA 2H9IA 3HADA 3I4FA 5BT9A 2AEMA 1CERA 2GERA 2BFOA 1X0XA 4WCFB 4CMIB 3U4CA 2A92A 4MIOA 2ZKLA 4B4VA 1XU7A 3DTTA 3ICPA 1ISIA 4FOSA 5I8ZA 3RBZA 1HDZA 2HRBA 1GD1O 1DPGA 5DOVA 4IJKA 2WYVA 3WJAA 3CINA 4JNKA 2J6IA 2ILTA 3ULKA 4KQWA 3D3EA 4NQZA 1C0IA 2I6TA 3PLRA 1HETA 1PL8A 1T2FA 1U1IA 1P0CA 4NJMB 5TT0A 1WDMA 3ZWYA 4GVXA 1DSSG 4PG6A 3U4DA 1U9JA 3G49A 4UVIA 3GHHA 2Y0CA 1QLJA 1OFGA 4XX0A 2VYVA 4A7PA 3ENNA 4I5FA 1PS8A 2JFFA 3DHNA 4BNJA 3BTOA 3SJ7A 3HJAA 3W6ZA 3ZHYA 2Y05A 4IXTA 5T64A 4F6LA 3MJ4A 5L7WA 3F47A 3KYBA 3BHIA 1QYXA 3K2EA 1E7WA 2PD3A 2E6UX 1V9LA 3OA0A 4YWJA 4MKZA 3HB4X 5C7OO 1H5QA 1FMCA 4PLPA 1PS9A 4W99A 3IKVA 1X7GA 2O23A 2P5YA 3ROMA 5BSGA 4I8XA 4KUHA 5JY6A 4J7UA 3ZV6A 1UXIA 4KDEA 4RZHA 1K6JA 1SAYA 2I67A 1ID1A 2V6BA 3QWBA 3GRPA 1AXEA 2NM0A 3JYQA 3RBXA 1L7DA 5LC1A 2EG9A 3FWZA 1EUZA 2JCXA 3DO5A 4QX6A 3E9NA 1EDZA 1ZK4A 2G17A 1UXJA 2PWZA 5CEJA 4TRMA 3LLSA 4PLGA 4DRYA 3IDSA 5IG2A 2P4QA 4EUHA 1PZFA 1N92A 4JXKA 4RORA 2ZYGA 5C7IO 3LU1A 5K9ZA 1SOWA 2BGKA 4KOAA 3FWNA 5G0UA 4RLSA 2VOJA 3BMCA 4IM7A 1BW9A 1ZEMA 3CTMA 3O4RA 1PQWA 2RIRA 4BNTA 1DLIA 3COSA 3HSKA 1D4FA 1HDCA 3GDGA 4J2HA 1TEHA 5DBIA 1XGKA 5FI3A 1UZLA 5EQDA 3F4LA 1GR0A 1JW9B 2H1SA 3PGXA 4WCDA 1YB4A 2E49A 1WMAA 3JQ7A 1LX6A 4CLXA 4UUMA 1JKIA 2PZJA 3NT4A 2Y1CA 1Y8RB 2I65A 4TSKA 9LDBA 1P1HA 1QMGA 4F46A 1SBYA 3QVXA 2P2SA 4IIVA 5DDIP 5JCJA 1B26A 1XU9A 4C4OA 3L4SO 2Y1OA 3W4IA 4CPDA 3TFOA 5GZ6A 4E5PA 2GSDA 4D3FA 5G4KB 4H3VA 1VL6A 2RAFA 1LXCA 3GUYA 3DMYA 4M8SA 4Z0HO 5IFLA 4BO8A 4JGBA 1QYCA 3EZYA 2G0TA 4TRRA 4XR4A 4Y67A 3VKVA 3NAQA 3RC7A 2Q1TA 1Y8QA 2FMUA 3GEDA 2BFPA 2VRCA 1HDOA 2FR8A 4Y6PA 5KTKA 2O2SA 3C7DB 5CDYA 5ENDA 3OA2A 1V6AA 3ZWWA 3DBVO 4CV3A 1FDUA 2DTDA 2CF6A 1BGVA 1ZK3A 2DKNA 3GR6A 1GZ3A 2QZZA 5TX7A 4AJPA 5T57A 1J6UA 5FWNA 1KY4A 2AHRA 3H65A 3S2GA 4B3HA 3VZPA 3IAHA 5TF4A 4ESOA 4G81A 4R1UA 4RVGA 2Z1NA 1X0VA 3PQEA 2HQ1A 2YDXA 4KWHA 2X4GA 1LLUA 4AJ1A 4OGWA 3VC7A 4D3SA 5F1OA 3ZWVA 2EERA 2O2YA 2YYYA 3GNQA 4JK3A 1LC3A 1YL5A 5AXCA 1O89A 3SC6A 4R3WA 3I3OA 3LK7A 3I9OA 2Y1DA 2GCGA 4CM3A 5KJ6A 4J49A 5IZCA 4OM8A 3KHUA 5DULA 3RCBA 4MVJM 1NAIA 2HRZA 5I9NA 4DTIA 1B8UA 2X0JA 1EBUA 4NR0A 4OMUA 1UH5A 1T2EA 4JN6B 4CQLA 3RUAA 3AW9A 2OP1A 3DWFA 1YDEA 3Q1LA 2CVQA 5KJCA 2FWMX 5F21A 4HNGA 4BNHA 1IOLA 1I30A 2TMDA 3QWHA 4MO2A 1KC1A 3T4EA 5HTOA 3OQBA 1ZSVA 2E82A 1QP8A 3F1KA 2EJWA 3INTA 3Q9UA 1ADGA 1GYQA 1HDYA 1R12A 3KO8A 2IEDA 1B2LA 3H9QA 4AJKA 1XWFA 1DAPA 3EYWA 1JKJA 3BMCB 1U3WA 1BW9B 3WJ7A 1GDHA 4URFA 3VPGA 3ZWBA 2D0IA 2AG5A 5EQFA 3JQAD 2CUKA 1U5AA 5J23A 4ND2A 3ONEA 5ADHA 3IS3A 4W9NA 3DHYA 3JV7A 4YA6A 1RKXA 1NFFA 1G1AA 1WMBA 4YB8A 3JQ7B 3IP3A 1DIRA 2EWMA 2HK7A 4F3YA 1PJTA 4BOYA 2WE8A 3H3FA 4J1NA 1DRVA 4RGBA 4MDHA 4NDNE 1SC6A 1E92A 4XRRA 3RUIA 4FFMA 2D2IA 4E31A 1U4OA 3I5MA 4NMHA 4YRDA 3ZWAA 1PGQA 1R6DA 4XCVA 1PGPA 1Z74A 5BQFA 2WM3A 1A9ZA 4FBGA 4CMEA 1P1RA 2Q2VA 1ISFA 3CEAA 2FOIA 3FCOA 3V2HA 3ANLA 4BGVA 1MG0A 1NQOA 1SB8A 2J8ZA 4ONEA 2X0IA 3PIIA 4L8VA 1LA2A 1Y8QB 5DOZA 5L4NA 2QRLA 3L6DA 4D3DA 2QZ9A 5A9SA 1Q7BA 1JA9A 3UH1A 4CV1A 3WFJA 2EXXA 2FN7A 5CPFA 2I66A 3CIFA 3GK3A 2P9GA 2W90A 1RM0A 3MWEB 4E5KA 3DFUA 1NNUA 1T1SA 2PGLA 4A5OA 1ONOA 1E1MA 1UDAA 1DDOA 1CETA 1VC2A 1NQTA 2VNSA 2CDBA 1UJMA 4MVJF 1P33A 1B8PA 3KEQA 1GZ6A 3BHMA 4B8WA 1YBMA 3FNGA 4Q3CA 3RJ9A 4CLEA 2Y67A 4I5EA 5EMHA 5A9TA 4CJXA 3DZFA 3WGYA 3LT2A 5U1PA 5KIAA 4J0EA 3ST7A 3WGZA 5TIIA 4CMCA 1MXFA 5B12A 1Z82A 1NWHA 3L9XA 3ONDA 4LISA 3LT4A 1SNYA 1X7HA 2RBEA 4YRBA 4HKTA 5COAA 5AXBA 5LDGA 4JJIA 1EK5A 4XYGA 4YAGA 2VT3A 3AUTA 3FI9A 5KKCA 5IDXA 1PL6A 1KEVA 2ZYDA 1CQIA 2NLOA 1ZNQO 4CQLB 4K28A 2JCYA 4GLLA 1ZSNA 2PKRA 4NJOA 3WSWA 4A10A 5GY7A 2NWQA 1JDJA 2Q4EA 1MFZA 1PWXA 4I9UA 1WLYA 1OMOA 2FP4A 2PNFA 2IEBA 4UUNA 2X23A 4K6CA 1PJQA 3IUPA 5K6AA 3HG7A 4YJGA 5A04A 1YRLA 2ZB3A 2D5AA 1I2CA 5IXSA 3JQ9A 5I7VA 1N7HA 5H81A 1SMKA 5EERA 3V1YA 3VZQA 3PQFA 2DT5A 2X0NA 3H9JA 3ZWPA 4M87A 1GCUA 1IHYA 5LDHA 4RF2A 1XR3A 1PX0A 1A9YA 2HUNA 2W98A 3P5SA 3PHHA 1R4MA 2OFPA 4NBVA 3TNLA 3JYNA 3A14A 3L6OO 1ULSA 5JXWA 3PQDA 2OHXA 5JDIA 3KEOA 1VKNA 5C5IA 4IPTA 5IF3A 3OICA 4RF5A 5K0ZA 1K2WA 4GMFA 3U62A 1P1JA 4AVYA 4K6FA 1ZK2A 3VPSA 1HZJA 1C0KA 1BXZA 5ER9A 1PGJA 4CM9D 1RJWA 1U8FO 3ZZNA 1GV1A 4CR7A 5I9MA 3KXDA 1DIBA 1GY8A 4M49A 1KVRA 4RCVA 1HF3A 5B1YA 4J1SA 4WK6A 4Y98A 1F8FA 4IZIA 1DIGA 3LZ6A 4U5QA 1WW8A 3ETEA 3H9GA 3TJRA 2GN4A 5A9SB 3CE6A 4FQ8A 4FCCA 1GQYA 4TQGA 2GN9A 1C14A 2WWRA 5DCWA 4R41A 1CEQA 4XZ3A 1YL7A 4JLWA 3K73O 4NU5A 2VZ8A 3LYLA 3AUSA 5H82A 3HUDA 4JJGA 4E21A 3H2SA 2B0JA 4RPGA 3SEFA 3INRA 1A7AA 3PEFA 3BIOA 2HJSA 3AI2A 4INAA 1LTHR 3DZKA 3PJFA 4RQTA 1JAXA 1SEVA 1QYVA 3ENKA 3TDKA 1I5RA 4HADA 3WNQA 3GVPA 3WG9A 1MA0A 3NTQA 4BKRA 1NQ5A 2ZB4A 4IDEA 1Z45A 1H6BA 3S1LA 1EUCA 3TL2A 4W9NC 2X1HA 2NU8A 3LLVA 3IKTA 3UCXA 2B83A 2E37A 3MOIA 4RL6A 2CD9A 5KKAA 3ROQA 1M6WA 4JIGA 2AQHA 4TZTA 1I3LA 1ISJA 2UVDA 4N7RA 3OF2A 4ALNA 4ZQEA 5KOIA 1T2DA 1KY5A 4D46A 5T5QA 1GYRA 3HN7A 1ZEJA 1E7RA 2J5KA 1NR1A 2BGMA 2DVMA 5JDCA 2WDZA 4II2A 1R0LA 4AJ4A 1UAYA 5L4SA 3CSDA 1XA0A 2XAAA 4M89A 1VRWA 2VTDA 1PU2A 3AFMA 3JSAA 2GZ3A 5F1KA 4Z9FA 2GPTA 3UF0A 4N18A 3TL3A 4CMHA 4WEOA 4GVLA 2WYUA 4BO7A 1E1KA 1JAYA 2Y0EA 3FN4A 4YJGB 5AQ1A 1L7EA 3PYXA 1OC4A 3H3JA 2NACA 4IBOA 1D1SA 2BF7A 2QYSA 1L1FA 3WYBA 2UYYA 4HBGA 2YY7A 3NTOA 5A3JA 2ZQYA 2QRJA 3E1KA 3ZU4A 4B4UA 1NXQA 3LT0A 5IDWA 3H7AA 1IPEA 4R01A 1Q7GA 3JYPA 1VM6A 3R3JA 2E48A 1AHHA 3GEGA 5IJZA 1R4MB 4QT0A 5JBIA 3F1LA 4YCAA 3IL2A 2YV1A 3UKOA 3EY4A 3WBFA 1U8XX 3GVXA 2DM6A 3C24A 2A9FA 2DAPA 2EP5A 1ZXLA 3MZ0A 4NBWA 1WWKA 3WLEA 3JQAA 4GL4A 4ITUA 5JCXA 2FR0A 2HK8A 1CWUA 4DLLA 4QO7A 4XA8A 3OEWA 1KVSA 1ISHA 3IP1A 3VPXA 5I8WA 1RWBA 4XYLA 3WTCA 1O95A 1R37A 2NUAA 3TZKA 3BYZA 1W4ZA 1Z6ZA 2BHLA 4ROSA 1ZK0A 2V65A 1NX6A 2X9GA 2D1YA 4Y6SA 2VUSA 4BMNA 3WX0A 4LMPA 1K5HA 1ONNA 3CKYA 4HP8A 4I9NA 1S7CA 3DZJA 1PJCA 3OP4A 4H15A 5I7EA 1OAAA 1M66A 3AFNA 4UEOA 4CM4A 4BO4A 3L6EA 1U7TA 2W8ZA 4GKVA 1P77A 1C0LA 3Q2KA 1ZFNA 5C3MA 5DBFA 2UUPA 4PG7A 1GZ4A 5FFFA 1IZ9A 4CMBA 3U5TA 1WP4A 1ZIDA 2FR1A 1HDRA 3FD8A 4WNCA 4BQRA 1P44A 1HE4A 4GBJA 5KJEA 5F1PA 5HRUA 3PK0A 3KUXA 1NPYA 1DC6A 3C8MA 4KTTE 4CV2A 4DC1A 4QQRA 4D79A 1E5LA 4Q3BA 3HHPA 4HFNA 1OC2A 2PGJA 5AYVA 3SXPA 2RH4A 4IDGA 1DO8A 4NK4A 1B3BA 1JVBA 4HX5A 1LSSA 3NUGA 3K9QO 3WTBA 3AOEC 1IUKA 2DBQA 1O6ZA 2FZWA 4P8RA 3RD5A 3SC4A 1HTBA 2PR2A 1NYTA 2VQ3A 1GCOA 1HE2A 3WSVA 1E5QA 4ZD6A 5CAEA 3PHGA 2E4AA 4BKPA 2X22A 1ADCA 4NH4A 5BSHA 3RUHA 4IDAA 1H94A 1U5CA 2DPGA 4ALLA 2QHXA 3VTFA 1UZNA 1A71A 4RZIA 4OOFA 4DPMA 3RFTA 1ZKMA 1BSVA 3JQEA 3QW2A 4MKRA 3FTNA 4Y9DA 3OJLA 1W73A 4FGSA 3H5NA 1GU7A 1DFHA 2UDPA 8LDHA 3V8BA 4GAEA 4XIYA 2QW8A 3RJ5A 5JAIA 3L4BC 2QQ5A 2BELA 1FK8A 2ZTLA 3C7AA 2EHDA 3ADPA 4P38A 5GMOA 3S8MA 1GL3A 4I1IA 3PJDA 1V3TA 4IXWA 1M6HA 3LF2A 4KUEA 3WLFA 3QVWA 4RLHA 4K1LA 4AL4A 1EFLA 4EJMA 2OP0A 1ZXBA 2GR9A 5DCUA 3FBGA 2JAPA 3GAFA 2LDBA 4HXYA 4WOJA 2A94A 3MEQA 3N7UA 1E3WA 4BV8A 2O4UX 4E5YA 1NPDA 1SOVA 1WNTA 1K89A 1KEWA 3ZGYA 4QUKA 3JQAB 3W1VA 1XIVA 4YJDA 3MTGA 3BAZA 2VT2A 1T2AA 2Y1FA 4RDHA 4C7JA 3WWZA 4Z9XA 3PPIA 4FJ2A 1FDVA 3H2ZA 1K6XA 3TN7A 4F45A 1GEEA 3PFWO 2UV8A 4R9SA 2NNLD 4XYBA 5U4QA 4YT2A 3K92A 3JD3A 4YAJA 4B8ZA 1DHRA 3QQPA 4HUJA 3VZSA 4ZN6A 4CM4B 3H8VA 4XIJA 3V2UA 1HYGA 2B37A 2NVBA 4CM9A 4JBHA 4RV9A 3IMFA 4UAGA 1WXDA 4E12A 3IJPA 4CUKA 1Z7BA 5AXDA 4BB6A 1H9AA 1O8CA 2GZ1A 2X5JO 1I2BA 2NTNA 3HDJA 4YT5A 2Y68A 2IXAA 5IXYA 5IN5A 1I0ZA 1K6IA 2BH9A 3GG2A 2CFCA 3CMMA 5CPBA 3OQ6A 4WLFA 4GQAA 3O03A 4YTEA 1LJ8A 3U3XA 1Y6JA 1Y9EA 2P9CA 3M1AA 3TWOA 2O7SA 1OBFO 3DBLA 5KCZA 2GZ2A 2AQ8A 4W7HA 4YR9A 7ADHA 3A1NA 5A4DA 2VCYA 1B7GO 3DAPA 3DOOA 5FYDA 4JP2A 4WJZA 2P5UA 2DU8A 4RF3A 4XDYA 2HMVA 5F5LA 3DTYA 2IZZA 3PJGA 4FGWA 3OJFA 3QRWA 4O1MA 4TROA 1EVIA 5HBRA 4J4TA 1E6WA 1QV7A 4UREA 4WCFC 4XWYA 4PG4A 3GVCA 3GT0A 4FR5A 4NFHA 4YQZA 3H5RA 3AY3A 5ES3A 3OMLA 3PHJA 4ZICA 5CEEA 1UP6A 3EW7A 4Y6RA 2PZLA 4W4TA 5A05A 2AG8A 1F0YA 4S1VA 3GNTA 3HNPA 1Q2XA 4ZRNA 2XPCA 1BDBA 4CODB 5I9LA 1DC4A 1H6AA 3EGOA 4QFCA 3ZU2A 1WAMA 3S2FA 5L7TA 1ULUA 4OXYA 1KVUA 4GSKA 1P31A 1JLLA 2PKQP 2Q4BA 1YBVA 3I52A 3SLKA 4R9RA 3VH3A 4LN1A 3QWAA 2WD8A 3L9WA 3PXXA 5I7SA 4RQUA 3TOZA 1PZHA 3SLGA 4IS3A 5HS4A 3UICA 3PRJA 5ILGA 4X54A 3SBOA 1B16A 3B6ZA 2PLAA 4R1TA 1M2WA 1HYHA 2A4KA 3DBHA 2BI7A 3R0IA 4A2CA 2X58A 4E33A 4BKOA 2WJPA 4D44A 4NFYA 3PWKA 5EN4A 3ASVA 1ENPA 2ZB8A 4MP3A 3SVTA 4RVHA 5DBGA 1LQTA 1I3NA 2NQTA 3Q0EA 4G2NA 1LI4A 2VZ9A 1C1DA 1E3WB 1CRWG 3ETDA 4Z9YA 3E03A 2NU9A 3WGOA 3GRKA 3ZNQA 4CUZA 2PH3A 3DFZA 4NBRA 4DQXA 1TA4A 3BHJA 1U4SA 2OOSA 2YFHA 3ZH2A 1PZEA 4J9VA 2AQIA 3E8XA 4WLEA 4XKJA 3PHIA 9LDTA 3OETA 2NVUA 1O9BA 3PJEA 5A5FA 1R4NA 3GA0A 3E9QA 4MP8A 4UUOA 4YVFA 3ZU5A 4DUPA 1Q0QA 4ZQGA 4JP3A 5DT9A 2FY8A 3DOCA 4DBVO 4DQUA 3RI3A 2BI8A 1HDXA 5EPOA 3RASA 3BMQA 4BO1A 1JU9A 1LSUA 2P91A 4GI2A 3KM0A 4GMGA 3JTMA 1VSVA 1ZMTA 3H9UA 1LBEA 1W8DA 5HWSA 1E77A 3TOXA 5JAMA 5TGDA 4CLOA 1GADO 4U8GA 4O63O 4PZCA 5JAQA 4BO3A 4G5HA 2LDXA 5COQA 2POQX 2NTVA 2W2KA 3CMCO 4DPKA 1FF9A 4B7UA 2JD1A 3ZNPA 2FZEA 1YBAA 1U3TA 3EUWA 1YXMA 3ITDA 4MVJI 3DBLB 4EYEA 1LU9A 1XHLA 1IULA 3WDSA 1PR3A 1HYEA 4QXMA 5T8KA 4N5MA 3JD1A 4TWRA 2P68A 3KB6A 4QECA 2GNAA 3A4VA 1YONA 4BNZA 1PIWA 1VE9A 2EKQA 3GG9A 3NJ4A 5FEUA 2NADA 5ENVA 2I5PO 1T2CA 4WKGA 2Q2QA 2X5OA 5CFZA 2C2XA 3S2IA 1NFRA 4HY3A 2HMUA 2CVZA 1Y7TA 3GGOA 4ALJA 1F06A 1I33A 4D7AA 3F5SA 4BNFA 4DIBA 3CH6A 4DQVA 4AICA 2EIHA 4DMMA 3I9MA 4BNIA 3OIDA 5CDTA 2OUIA 4O59O 4GGPA 3GHYA 2BFAA 2EW8A 3RAJA 1ZMOA 1NFQA 2DBVO 2XXJA 3GAZA 1QYWA 3HE3A 4EZBA 2OZPA 3H6KA 4TVOA 2VYND 3LC1O 3OEYA 3DBHB 2HK9A 5JS6A 3ORFA 1PJ4A 4YT8A 4DREA 5TC4A 1BRMA 3KLMX 4NU6A 2Y66A 1AHIA 5A02A 3QLJA 3UUWA 3GY0A 1IPFA 2QX7A 5TJHA 3WQSB 1N5DA 2ZJ1A 5T6BA 1HL3A 3UN1A 5I7FA 5BSEA 1C1DB 3HWRA 3VVBA 4OYRA 1ORRA 1IB6A 1XG5A 4WLNA 3EAGA 1E3JA 3MJCA 4DYDA 2F00A 4RPKA 2GYYA 3C3XA 2GRAA 4XQGA 3BTVA 2NVUB 5U9CA 1BDMA 3GEMA 5JW6A 4ID9A 1R4NB 2C59A 4ALIA 3ROKA 1BXGA 4JBGA 3SJUA 2HJRA 2CVOA 2BMAA 3DMTA 4E4YA 3T7EA 1RM4A 4PRKA 4IQGA 3PDUA 3WYEA 4BNYA 2HAEA 3BMQB 1JWAB 2J5RA 1V8BA 2BLLA 4J91A 2DFVA 3DDNA 1MXHA 4TVBA 4XQCA 3OJEA 4EJ6A 4XJTA 3DZIA 2IRWA 4OO3A 3ZNNA 3G79A 1DRWA 2ZTVA 4WPGA 3QVTA 5L53A 4U0KA 1QYDA 4CLOB 1ISMA 1Y5MA 2EEZA 2JHGA 1ZSYA 3ETGA 4DBZA 1KYQA 5L9AA 3AUAA 3UCFA 1V3UA 3DR3A 1E7QA 2W2KB 5DF1A 4OXNA 2O3TA 4KDFA 2ZB7A 4IJVA 3UHAA 3OECA 4N5LA 2YZ7A 3DZGA 4YT4A 3OQ1A 1UUFA 4PN3A 1LDNA 3GGGA 1M76A 2JJYA 3STHA 3RSHA 3A9WA 3FR8A 3ZHBA 4YXFA 2YHUA 1C0PA 1U7HA 3ZNOA 3E48A 2IODA 2FPIA 3X2EA 3OIGA 1CF2O 4RDIA 3VTZA 1NVGA 4BNNA 1V3VA 4ZJUA 3E5RA 1XKQA 2GGSA 3BXXA 1CIVA 4KQXA 4QTZA 4WNIA 2TMGA 2VN8A 3NTRA 4PZDA 3ZW8A 5JSFA 3CZRA 3UOGA 1N8KA 1XSEA 1U3UA 3D1LA 3TF5A 5THQA 1NBOA 1H9BA 3C1OA 3MCVA 4M86A 3PDJA 2HMTA 2DFDA 4MKXA 5ICMA 2NU7A 2QYTA 3QWFA 4YJFA 4R68A 4F6CA 4FS3A 5JO0A 1MUUA 2O3JA 3DC2A 4GX1A 3B1JA 5L7YA 1U28A 3DEYX 3JQFA 4CM1A 1JN0A 4L76A 2B4TO 3LC7O 3PYMA 3MJEA 5JE8A 2VOEA 4ZRMA 3H4VA 2HMWA 4PGFA 1ENYA 4NFSA 5TT1A 3ZU3A 4J2OA 1B3RA 1GUZA 3MWDB 1V35A 4M54A 1GPJA 1SEPA 4GKBA 5CHEA 3C85A 3V1UA 3GVIA 2SCUA 1DAOA 5IZCC 4HFMA 5G0SA 2J3IA 4DYVA 3B20A 4IMPA 4CLRA 4XYMA 5JY1A 4A03A 2EV9A 4FJ0A 4J16A 3GPDG 2Y99A 1EBFA 1MG5A 4IGEA 4PLTA 5IDYA 3FNFA 1P0FA 3HQ4O 3I9JA 1B14A 3WFIA 1ADFA 3LT1A 4IJWA 4NK5A 1B0AA 3KRTA 4DL9A 5KJ1A 4J43A 1GFSA 3C7CB 1ZO8A 3F9IA 4I5GA 2R6JA 3MOGA 2AE2A 5HS6A 4H16A 3RBVA 1BXGB 2WTBA 2GN6A 1KVQA 5DN9A 2YW9A 5L40A 4DLBA 1DC5A 2PKQO 4E2YA 4KUGA 1OOEA 3QJ5A 2UAGA 2WMDA 4R54A 5BNFA 1I24A 1TT7A 4EW6A 2YFQA 3QIVA 3MTJA 5ITVA 3JCZA 4XB1A 5TQVA 4BO0A 3M2TA 4DGSA 2D3TA 4E2XA 8ADHA 3V5NA 1QLHA 1R66A 2C2YA 5DNAA 4KWIA 2VHYA 5G4LA 3HZZA 2DBRA 3U49A 1E1NA 3ON5A 3HFSA 4FFNA 1LDYA 3OJ0A 3GN1A 2Y93A 3VZRA 3W8DA 1HRDA 2VUTA 3TZCA 3RKRA 4NG5A 4EUFA 3EDMA 4E5NA 4D42A 3L07A 4PZEA 4BMVA 1F14A 4CMEC 3VOSA 2C5AA 4DA9A 3AUUA 4FFPA 3C1TA 3F5QA 3EMKA 4J1QA 3EHEA 3VPHA 1HXHA 5KJFA 2O4CA 1R0SA 3JQCA 1DIHA 1IYZA 3K5PA 5IZ4A 3IOYA 3WB9A 4J0FA 1OI7A 3AM5A 5G2OA 2ZATA 4BKUA 2EJVA 2Q1UA 1G0OA 1GPDG 2D8AA 1EE9A 1VPDA 1XQ6A 1N7GA 3U0BA 2F1KA 3P2OA 4DVJA 4BL5A 4I08A 1EE2A 3VH2A 3Q11A 1RYDA 1PZGA 3E18A 4HFRA 3H9EO 4YJFB 4I9HA 3QP9A 3G0OA 5BSFA 7MDHA 2PZMA 4BO2A 4CV0A 1PSDA 1LDBA 1CDOA 1RM5A 4ZU3A 3BZUA 3TZQA 1LC0A 3AOGA 1PWZA 2EKPA 3A06A 2O7QA 3DONA 1E3SA 1YE3A 2NVWA 4FFRA 4CQMD 4ZHSA 3EK2A 3I4CA 5JNLA 2BFMA 2YHIA 1MB4A 3WGQA 3ICCA 1MV8A 2PK3A 2OMEA 4OH1A 3FNHA 4PLFA 2V7PA 2ZYAA 3E9MA 3EVTA 3HB5X 4FW8A 3D4PA 3D0OA 4GX5A 1ENZA 4LCJA 3W8FA 4B7XA 4BHTA 4K9DA 4OL9A 2YUTA 4BO9A 4B7CA 1I32A 4CLRB 3VAZA 1T25A 4YQYA 3VH1A 2FRDA 1UAGA 2ET6A 1O5IA 2YQ5A 3B1FA 3NT2A 4XDZA 5KVQA 3ZWXA 2Q45A 3KYDA 1LRKA 3VDRA 2Z5LA 4JX8A 3JQ6A 2VYNA 1T26A 1P9LA 1D3AA 1FDWA 3I9NA 4OOEA 5H83A 4Z6KA 3DOJA 1YS4A 1NHGA 2O3RA 5EIOA 1E3EA 3IC5A 4MP6A 3ROPA 5K6AC 4IUYA 3OH8A 4OSOA 1PR9A 2ZQZA 3L0DA 3JQ9C 3AM3A 1KERA 3U4HA 3KSZO 4YAKA 3ITKA 4OXKA 5T67A 1YGYA 1NASA 4J9UE 3W4KA 3E6AA 1FDTA 2IE0A 4KP7A 5L95A 5KNLA 4R1SA 1D1TA 4OAQA 3O26A 1ZBQA 4IS2A 1ML3A 2XF8A 1P3DA 1LLQA 3D3WA 1E6UA 4J7CA 4TMFA 3WQQA 3RU7A 3JQ8A 4DPLA 2OORA 4PFJA 1DIAA 4E0BA 4W7IA 3VPFA 1FDSA 2EGHA 5AXAA 1CJCA 1I36A 3CXRA 4WASA 5TS3A 1I3MA 5JDIC 3KVOA 1HE5A 1HE3A 6LDHA 3DHEA 4G65A 3RU9A 4MVJH 4A73A 5CEFA 1JWBB 4PG8A 1ISGA 4TRNA 2C29D 2HKIA 1VL8A 3IJRA 3NYWA 1YB1A 3FRJA 1ZJZA 2Q46A 2O3QA 3DAFA 1QR6A 3DAGA 3WBBA 5ICSA 3H5AA 5JFOA 4FOOA 2VHXA 1V0JA 3AJRA 1QXSA 4CLDA 5ILOA 4QO8A 1NWCA 3WGGA 4UUPA 1B8VA 3K30A 2RHCA 3NGLA 3F6YA 2ZCUA 2Y1EA 3ZWOA 3PIDA 4J7XA 1E1LA 1G6KA 2DUWA 4AJNA 3P2YA 4CMJA 1NR7A 2Q99A 3NV9A 2A35A 4L4XA 5F5NA 3ZWNA 1TI7A 1DFIA 2J3JA 2VTEA 1DB3A 1ZJYA 2CY0A 3OIFA 4OIMA 3WS7A 2WD7A 1W0CA 5CP8A 3WR5A 3FSRA 4B4WA 4Q3EA 3D64A 5G0VA 5THKA 3WGHA 4AJHA 4MVJD 5JC8A 5TLSA 3ZWCA 4BO5A 1YDWA 4DLAA 4P4LA 4Q3NA 2VZ0A 4JJFA 5TNXA 4P4GA 1OZAA 4CL8A 4E2ZA 2YV2A 2YHIB 2XXBA 5JO9A 4AG3A 1BVUA 1HKUA 2VHWA 5GZ1A 2J3KA 3VDQA 5BNIA 1EK6A 2AQKA 5DCYA 1AN9A 4BMSA 4YDRA 4B3JA 1PJ2A 5MGBA 1KEPA 3KLPX 2IZ1A 2ZIZA 3Q3CA 4IDBA 5JDCC 4CUJA 2BGLA 5G0WA 1WDLA 3FPLA 2DTEA 3KYDB 1ENOA 3V1TC 1GEGA 3C1AA 1N1GA 4EGFA 5DP1A 1QV6A 4IDDA 1EMDA 4AJ2A 3G1TA 4TRJA 4W6ZA 3RQSA 1HDGO 5L45A 2I3GA 4YJHA 4GX0A 4XJSA 1SPXA 2FSSA 1PQUA 1GV0A 1E7YA 4OSPA 4XGNA 1MLDA 4BNKA 4FC6A 3DXFA 4FPXA 4CM7A 2WEKA 4AJEA 1G0NA 4BGUA 3NEPX 2J3HA 1PJ3A 2Q2WA 3D3WB 4UEKA 3PGJA 1MGOA 3JQ8B 1X1TA 1HSOA 4LW8A 1LNQA 4YBZA 5EJ2A 3W8EA 5A9RA 2EKLA 2IXBA 2DPHA 3FPCA 4M1QA 1PS0A 3GPIA 4E6PA 2AW5A 4WLVA 2R2GA 1PQPA 4KZPA 4NZ9A 2HMSA 4EUEA 3PZBA 5A3VA 4TKLA 3WICA 2OO5A 2W4QA 1YO6A 4N54A 1F17A 1T4DA 1WZIA 2X5KO 1FJHA 5IN4A 3KETA 4JBIA 4YAEA 4UEJA 2PTGA 3JQDA 1LSJA 1YOVA 2JFHA 5TRTA 5B4UA 2OBYA 3BMNA 1NPTO 1IE3A 3AK4A 1QSGA 1DEHA 1R16A 3QY9A 4ND1A 3PWZA 1LRJA 1PJLA 4ZA2A 4EEXA 3ZCXA 5HA5A 3QSGA 1XELA 2DUUA 1M67A 1YKFA 2G1UA 4Z0TA 5JAZA 4TZKA 3AY6A 3PYLA 3PP8A 2WD7B 4RVSA 3I1JA 2UUOA 4FN4A 4IQ0A 5L51A 4YYZA 1EVJA 4DXHA 3TPCA 3TQHA 1HT0A 2C0CA 4B4OA 4BNUA 4OKNA 3RC2A 1EVZA 3ZV4A 1PGNA 2O3UA 2Q1WA 5MDHA 3JQGA 1DOHA 2GO1A 5F3RA 3WWYA 3N74A 4OQZA 3HDHA 1UXKA 2EW2A 2P9EA 3TSCA 2XOXA 4MIEA 4ND5A 3WOHA 4R4JA 2WE7A 4ZQFA 2EGGA 3D4OA 2C20A 4YACA 2PD4A 3FF4A 4LRSB 4NNJA 4OJNA 3ZN2A 1H6CA 4ND3A 4IDCA 4XYEA 1EDOA 1PGOA 5EESA 1VJ0A 4Q39A 2AEJA 4J4HA 3RVDA 5AOVA 4UVGA 4R5MA 3PI7A 4CQMA 2HSDA 2CDCA 1VL0A 2IDZA 4NI5A 1P1KA 1Z7EA 3QV1A 1YWGO 2W2LD 4WECA 5A1TA 1I10A 4PIVA 1J0XO 2EP7A 5GZ3A 1X7DA 1PTJA 1KS9A 4MJLA 1O0SA 4YJHB 1TLTA 2YDYA 1XYGA 3WMWA 5FI5A 1GQ2A 1GQQA 3BMOA 4FSHA 1H2HA 4E30A 5C37A 1A27A 3E5MA 2G76A 1HLDA 2ZK7A 5JLAA 1ADBA 2HU2A 4ND4A 1F8GA 4HWKA 3UVEA 3E82A 3FTPA 1J4AA 4L73A 5IDQA 2PH5A 1RPNA 1YQDA 2HDHA 1I2ZA 4P4NA 1Y9AA 4QSMA 1BG6A 1UXGA 4TKMA 5HM8A 3LQFA 1WPQA 3GQVA 3JD0A 3U09A 2C82A 1CYDA 4FC7A 1TVEA 2I76A 1VI2A 4XGKA 4W82A 1Z75A 2QG4A 1ZCJA 1WZEA 4GSLA 3D5TA 2ZTUA 4RVDA 3QWIA 4WE3A 3GNSA 4LRTB 2B4RO 2X6TA 4U7WA 3OBBA 5CDUA 3GC6A 4Q3AA 4XQ9A 1EQ2A 1AUPA 3HN2A 3I6QA 3PTZA 4WOKA 4U0JA 4WEQA 1EVYA 3DBRA 3UFXA 4RVUA 3QVOA 3DQPA 3PZRA 2FPGA 3I9LA 2JD0A 4LCEA 1P1FA 4O0LA 1H2BA 4BNVA 1KVTA 1E3LA 2PGDA 1Q0HA 3FBTA 3GF4A 4L4RA 2YV3A 1YOVB 1E7MA 2PFGA 1UXHA 1C1XA 3BMNB 3D5QA 3MJSA 4GPD1 5B4TA 2BRUA 1IHXA 2Q1SA 3O8QA 3R6DA 4PLWA 1HZZA 4AJJA 2VWQA 3U4IA 3AWDA 4RF4A 3RWBA 3DZBA 2PV7A 1MFPA 1XDWA 4XQEA 3INGA 3QE3A 4D45A 3AM4A 4Z0PA 3ZDFA 3QA9A 5B4VA 3TZHA 1NM5A 3T4XA 1GUYA 4PLYA 4D0RA 2J5QA 1DBVO 4ALKA 3OFSA 1H0KA 1SB9A 3AY7A 3PWSA 1AXGA 4MVJG 1UZMA 4NBUA 4LSMA 4L74A 1VJTA 2X9NA 4L4SA 4PLCA 4WLUA 4CMKA 2VRBA 2DTXA 3KOUA 3R3SA 4IQ8A 3AI1A 2FSVA 3OHSX 4K26A 3JQGB 3KBOA 4HV4A 4PLHA 1MP0A 3JQBA 4IDFA 5EL0A 1LSOA 3S55A 2AMFA 3M1LA 6ADHA 1TXGA 3W6UA 5EINA 3PLNA 5ER6A 1LLCA 4XD2A 3K31A 2VWHA 3LDHA 2GUGA 1XLTA 2I9PA 3EC7A 5AVOA 5ITWA 3WYCA 1MC4A 3F4BA 5KWEA 2Z95A 4D43A 1XCBA 3BTSA 3ZV3A 1IL0A 3K2BA 4XEHA 4BV9A 3R1IA 3EZLA 4MVJA 2JFGA 3ONFA 3X2FA 1Y5RA 1PJBA 1ZUD1 2OXIA 1GUFA 5JYDA 2G5CA 1ZZEA 3UCEA 1FXSA 1Y81A 4D0SA 4O5OA 4L9RA 1SZJG 1T4BA 4AJIA 3AU8A 4LMRA 3KYCA 1MX3A 1QKIA 2X0RA 3JYOA 2GDZA 2V6FA 4ALMA 4CQMB 1LDGA 3CUKA 4GX2A 2NSDA 1M75A 4Q3DA 3ZI0A 1LLDA 3B70A 2JHFA 4GWGA 5JMPA 4RJTA 4J3FA 3UW3A 4BGEA 4CM6A 1Y1PA 4RVFA 1PJSA 4HFJA 1TB4A 3DZHA 1P74A 2I99A 4BIIA 4E32A 2H5LA 1KETA 3NRCA 3BMOB 4FJ1A 3RROA 3VKUA 1LRLA 3K6JA 2IYPA 4UVEA 4BVAA 3TRIA 3VH4A 2P4HX 3VVCA 3WIDA 2FPPA 1ZW1A 2B35A 1X15A 2QIOA 3RUDA 1A7KA 1Q7CA 2NU6A 5JYEA 3PFFA 3WXBA 2R00A 4PLZA 1VLLA 1YVEI 4YEDA 3GN2A 5JMWA 4BB5A 1KIFA 4EEZA 4ILKA 4YAIA 1GTMA 1YB5A 3AU9A 3I83A 3AI3A 3RC9A 1DJNA 2AE1A 2RCYA 4JCOA 1S6YA 2VWGA 4GLOA 4BKQA 4XB2A 1A72A 2YJZA 3KSDO 3ZW9A 5C7LO 3DBRB 2D59A 4CMAA 4A26A 3T7CA 5TJ9A 3MJTA 2O50A 2V6GA 4WGGA 4MPDA 4UVDA 2JCVA 1C1XB 4H7PA 2ZTMA 3RIHA 1A4UA 3GUCA 1Z73A 2CF5A 3UAGA 2VWPA 3O8QB 4KMSA 2Y0DA 2HLPA 5G0TA 1I3KA 1D8AA 2H6EA 4Y8VA 1QRRA 3G1UA 4N5NA 3LF1A 1A4IA 2YQ4A 4LGVA 2NV6A 4L0QA 1MC5A 3WMXA 1E0DA 3UXYA 2X86A 1NP3A 3SX2A 4EJ0A 1E3IA 3Q6IA 2FHSA 4DIOA 5A03A 3JD4A 2ZCVA 3DL2A 2HO5A 4ZQBA 3WGIA 4MOWA 2Q49A 1I8TA 4FFOA 4BO6A 3TZ6A 1J49A 4ZQHA 3GLQA 4CM5A 2RHRA 3BTUA 4IGFA 3GZNA 2CNBA 3RC1A 3OSUA 1LUAA 2B4QA 4ZGWA 3KTDA 3HDQA 2VNAA 1EFKA 4MVJE 1ZVMA 4AFNA 3AOEA 3IQDB 1HEUA 3JD2A 4R16A 1HSZA 4BQPA 1N9GA 3RFVA 1SCUA 3WNVA 4CL3A 4CR6A 5JC1A 2DQ4A 4B79A 3KZVA 1SO8A 2JL1A 4E3ZA 2H63A 4A0SA 4DC0A 1Q0LA 2EF1A 3RUEA 2VYVD 4R5HA 4AJLA 5T8KC 2AEFA 4NIMA 5CDSA 2B69A 1WVGA 3F3SA 1IY8A 1VSUA 3CZMA 4GGOA 3WIEA 1X1EA 3P19A 3KYCB 1KC3A 1T1RA 3A28A 3NGXA 1KEUA 4R69A 4B3IA 3ZWMA 3GZ4A 4JQCA 2CMDA 2DC1A 3ASUA 1NQAO 4PVDA 1N1EA 1IZ0A 2Q50A 5JPIA 4YPOA 4DWVA 3ZHZA 4UVHA 3GFBA 4PCVA 4NBTA 2OGUA 3FHLA 5A5EA 3L4BA 4E2WA 4WUVA 4BNXA 4R1NA 4PRLA 1KOLA 1EZ4A 2D4AA 1KBZA 1D7OA 5B37A 1H93A 2B5WA 5L3ZA 2V6MA 2PD6A 5A06A 2B36A 4CM8A 1QG6A 2D5CA 2HCTA 1O94A 3KSUA 3V2GA 4BNWA 4PG5A 2W2LA 1H6DA 4HNHA 1TT5A 4YRAA 4FD3A 4EI2A 5KVVA 3OM9A 5BNTA 4DMLA 5DZSA 2G82A 4OHUA 4IIUA 1EQUA 3ZHXA 3NDRA 3Q9NA 3JQBC 1A5ZA 3U9LA 2VHVA 4LVCA 4MINA 4R51A 4Q9NA 3WGTA 4J6FA 3I9KA 1LDMA 4A27A 4CR8A 3GMDA 4R3NA 1ZK1A 3GGPA 4AJOA 1I01A 3K8ZA 1F12A 3F46A 3GDOA 4IMRA 1HWYA 1YH3A 2NQ8A 4U6QA 2QRKA 3OJOA 1DC3A 2BD0A 4BNGA 5KVSA 1BMDA 1UP4A 2JAHA 3K96A 5JCJD 1DLJA 3NT5A 3DMTC 1ARZA 4Z3DA
chains in the Genus database with same CATH superfamily
3C3EA 3HFGA 3L0BA 3LQ1A 4PFKA 3EPRA 1CE8B 1LBIA 3TFQA 3GRZA 5LNK6 3OZWA 3M3DA 3DOEA 2W42A 3O38A 3TXXA 3HV2A 4L5YA 5LSAA 2WSBA 1LF0A 2LW7A 3QVSA 4O3FA 4BB9A 4E13A 5C4MA 2GB4A 1GNLA 2I1LA 2VRCD 1QFMA 3RT7A 4DR3B 1ZM3A 2AJCA 1DU4A 2X5XA 4LQ4A 4X1YA 4ZOLA 5IEBA 3NBYC 2ZSKA 3L84A 2YWDA 3IT3A 5AI4A 3IAM6 3AESB 4ECAA 2UYHA 4ZVRA 2AFHA 3RGWS 2P7HA 3MJVA 3TKAA 1AKYA 1BHSA 2RH8A 3AO0B 3ELWA 3QX9A 1HT1E 1MPXA 2LIPA 3DXZA 2HLDA 2C5EA 4RIGA 4QGHA 2JBAA 2I6FA 5CGQB 5SYMA 3GP3A 5COBA 4BFUA 3I9FA 4M98A 1B15A 4FWBA 2Q3EA 1CUHA 5FO0A 3SJZA 5LQMA 4K05A 2X7HA 3ABIA 1ZRNA 3WQRA 4G89A 5KVCA 1GYPA 5SZIA 5EP2A 1XQ1A 3F73A 1W6UA 4EA9A 1UR5A 2AN9A 1H2FA 4LZWA 4OMCA 4WCFA 4CMIA 5A4FS 1VLMA 2ORYA 2R6GA 3ELDA 1X13A 3PSAA 1P61B 1KTIA 3MQFA 3QFRA 4BVJA 4XGIA 1OPXA 1T1EA 1AA6A 4PQFA 1Z13A 2JGNA 3M2PA 3T5CA 4K3UA 1OH6A 2ISQA 1EA7A 4JOSA 1K8QA 4P93A 4XRGA 5JYCA 5KVAA 2OYCA 2HADA 3SC3A 3LC2O 4W1QA 1TEZA 5EJFA 2G3YA 3NAGA 4D8YA 3FYCA 1HNZB 2IHJA 1UINA 1XZEA 1TF7A 4B4KA 4IY1A 1AE1A 5AUQA 3K5HA 4A1OA 4U3JB 1PL7A 3AKYA 4EBBA 5BUZA 3H4TA 5J2UA 5L3VA 4QTTB 4CKWB 2JDID 1WCXA 3DB2A 3FGPA 2OBMA 3H5VA 4QLOA 5A03A 2WYWA 4MQFA 3T9FA 2QAGC 5IAAA 5BR7A 1NAHA 2NSJA 4J90A 4Q05A 5JARA 5L4LA 4ACAA 3S8EA 5FDFA 2NP6A 1GAEO 2ACKA 2O6LA 2I1WA 4ND6A 1TIBA 1W52X 1Z88A 3JQFC 5E4YA 4MKGA 1SOUA 3DGFC 3G17A 3K70B 3QUAA 2ZIAA 4CM8B 1JYFA 1NC1A 1VTKA 2BMFA 3TSYA 3H18A 5M5BA 3TE6A 4KIJA 2Z9DA 4E14A 3KV3O 2XQIA 2I4NA 2RKBA 1KQGA 1T0JB 4A36A 4NCIA 1XZIA 5GOZA 1LS1A 1FTYA 1PF7E 1S01A 2GM5A 1P1IA 4P84A 1TYDE 2Q3BA 4PIMA 1FRQA 3TDMA 4DJEC 4B3GA 2ONCA 3A05A 4OKIA 4WSOA 1UWLA 1T9GS 2PY6A 2X5NA 3DEIA 4B87A 3BK2A 3MTBA 4MWDA 1XD9A 4Z8YA 4A2WA 1QIDA 4MVJP 3VO9A 3PQCA 2GF2A 5LMCA 1NJ5A 2CL6X 1T4MA 4UM8B 5K3BA 1XT6A 2OBNA 2WAOA 3Q72A 1DXYA 3EZ7A 4C1NA 3HP7A 1SKYE 1GKKA 1XAHA 4C3UA 1AKUA 1W30A 4FGLA 4HAUA 4MB0A 3RFXA 3RS8A 3W4JA 5DBOA 2D2XA 4GPTA 1WABA 4WXEA 5JRJA 2DBZA 1ZH8A 2FZ4A 2HU5A 1Y1LA 2EKBA 4E5DA 3CCFA 1K0UA 2CDAA 3GT7A 3KUDA 5LU8A 3I39X 1IM2A 1DZ3A 2JCGA 5LCXA 3ZZ0A 4UOQA 2INGX 4Y30A 1QH0A 4BMZA 1P6QA 1NN3A 1V71A 5TSDA 1YQGA 4NHEA 4RD4A 1HX7A 4D4GA 2I3AA 3EEQA 2XXAA 3PJRA 3FMVA 1AQUA 4X1YB 3NJRA 4I5DA 4ZOLB 3NI2A 4CKYA 3UGKA 2QRUA 1KQNA 1ODJA 3G7NA 4B43A 1T24A 2GZSA 5K0NA 5F9FA 1UDBA 2OL4A 4EITA 4HQNA 1IN5A 4E5MA 2AFHB 4LJAA 1RFGE 1MGPA 2Q0HA 2GPWA 1XEAA 2JBAB 5SICE 5FJIA 4ISCA 2FFBA 4QEDA 3HYRA 1Q1NA 3S4YA 5CDGA 2CZCA 1QCZA 2GJ8A 2ZJ0A 1YQWA 4B45A 5A7FA 3DA8A 5IC5A 2A9RA 5GJVC 1FMJA 4MW2A 3TM5A 2C58A 1CP2A 1I6WA 5J2TF 4WCFB 4CMIB 1X0XA 5DNDA 4MIOA 4TYQA 5IDVA 4PYIA 2O1SA 4P08A 1R1DA 1E2IA 4HQRA 3VO8A 1HDZA 4DDVA 1ZL2A 4BMYA 4YS6A 3HYTA 2XT9A 3RYIA 4IJKA 2NSHA 2WYVA 4NONA 2VSXA 4JT2A 3ITEA 5KYGA 1PBNA 3WGVA 1RXUA 2ILTA 1NW8A 3OIYA 3IB6A 4NQZA 1QGAA 1WBJB 1PL8A 3GI1A 3IBTA 1EFAA 2A7QA 1WDMA 2E18A 4I81A 1CJVC 3KT3A 3NXSA 2RAUA 4RBNA 5FO1A 2CUZA 1DSSG 2VG8A 2WHXA 3RS0A 3V8MA 2RI6A 4L8YA 3UMBA 3G49A 1WXHA 3GHHA 3ECAA 4UVIA 1JLSA 4Z49A 4MQFB 5GADl 2VYVA 1LW6E 4FX2A 4A7PA 3VFDA 3DHNA 1WMDA 4L9WA 4Z99A 5T64A 1PR0A 1ECBA 3QVLA 5BSWA 3KYBA 4TYNA 1ZCFA 2G9RA 2WT4A 1FP7A 1QYXA 1E7WA 2E6UX 4L7VA 1V9LA 3OA0A 5FFMA 4IG4A 1ZI8A 4MKZA 3TRFA 3I53A 3Q5DA 2Q5JA 4M88A 1DBRA 5LA6A 3PFCA 2JJ2D 4CW7A 2IYVA 4B0OA 3O9MA 3BOSA 3K5IA 4HAZA 4YIKA 1X7GA 2P5YA 2ZVJA 3ACCA 1S7GA 2P5TB 3ROMA 5BW5A 5FA6A 3FSGA 4HGQA 1O0CA 1RPJA 3TPFA 5KDLA 1QE0A 3T1OA 4RZHA 3C6MA 3UMVA 3EOZA 2I67A 3QWBA 3FVWA 4BP1A 2ZTSA 1FX1A 2NM0A 3JYQA 4TOIA 3RBXA 1KI6A 3OEED 3P2MA 2EG9A 1AM4D 1AF4A 4JVLA 2KLBA 5IM4A 3BBLA 2IYSA 1EDZA 2MSDB 4JMLA 3KUUA 1UXJA 4TTIA 3PD1A 4DRYA 3IDSA 1CUEA 1P0PA 3NUZA 5IG2A 2P4QA 1PZFA 3NP7A 4JXKA 3NKFA 3URMA 2AD5A 4RY0A 5C9ZA 3LUFA 3DGEC 5EE3A 3FWNA 1ST3A 1ZR4A 1WY7A 4DQDA 4RHCA 1JB1A 1BW9A 2GKOA 1VHTA 2I4IA 3CTMA 3EGEA 4X45A 2RIRA 4HUQA 4BVLA 5G41A 1D4FA 5E7MA 2EZ4A 3ZCTA 2VBIA 2FZGA 4HEA6 5DBIA 2GF9A 1L8OA 2F17A 2F1HA 5EQDA 4XM1A 1PK9A 3JWJA 4D96A 4Y2GA 1X1SA 2E49A 1FOEB 2WU4A 1P4RA 1E79D 1WMAA 1LX6A 1V7ZA 2ZT8A 2VFAA 1I13A 4FHGA 3ICVA 1XUOA 1BA3A 4HB4A 1YHNA 1FMTA 3AHFA 4UUMA 2WIDA 5ILQA 4QAJA 3X1YA 2XXAB 2UYGA 2HTEA 3BHNA 2A0XA 1QV9A 2IELA 2Y1CA 1WBDA 4TSKA 2C0QA 2GBPA 9LDBA 3BE5A 1B0UA 1ZD5A 4KR9A 3QX3A 2GFIA 4G41A 1R2QA 4DDKA 1JEDA 3BFPA 5DX1A 3WWCA 1SCBA 2P2SA 2O7RA 3RU2A 2QTVA 3I2GA 3SQNA 3TFOA 3W4IA 4E5PA 1H8ED 2Y0PA 2EGUA 1PR4A 3A4MA 3S70A 4D3FA 3OQJA 3V8NA 4M8SA 3CTPA 1FQKA 3RRJA 4N5DA 4M8IA 4Y67A 4XR4A 3TTVA 2ZXFA 4YDHB 4XXHA 5JYBA 2ZBEA 1A9QA 3RC7A 2JVJA 3CM0A 3NHUA 4TQ9A 4EHFA 13PKA 3GEDA 2BFPA 2WM9B 4KEAA 4M0MA 5EI5A 4YV7A 2FR8A 5IK2D 5CDHA 1C7RA 4MQLA 1MR3F 1J56A 1J9EA 1U02A 2O2SA 5CDYA 4FYWA 4MGEA 3KB8A 5KO2A 1AT1A 4C06A 1W59A 3ZWWA 3DBVO 4B40A 2VRWA 5F78A 4ERXA 4RTJA 4OBXA 3M6FA 2GETA 3IPLA 1FDUA 1E2JA 1ZK3A 4CF4A 1IN8A 3TVDA 3RYIB 4PV7A 1J6UA 5T57A 5FWNA 1ZQ9A 1SG0A 5CW2A 5CXUA 4N9QA 1QMPA 1Z0IA 3D7NA 1RAAA 3IERA 5B1HA 4AS2A 3VR6H 2AR0A 5TF4A 3FCEA 5JI2E 2WF6A 2Z1NA 1ND5A 1Z4QA 2AG1A 4XVHA 5CUQA 3R0XA 1X0VA 4EDHA 5J58A 2XZLA 1HFKA 2GM9A 4AJ1A 4DQ0A 1YZNA 2M6KA 4EMSA 2YWFA 1RTKA 2Q07A 1OFHA 3CS3A 3O7MA 2EERA 2R5WA 2O2YA 3Q3IA 5SZHB 4YMTA 1UOEA 1VJCA 4JK3A 5SZJA 2O1WA 2P90A 3L7CA 5BSVA 4R3WA 2WM8A 3I3OA 4IV0A 3I9OA 3OLXA 4O4HA 3R3HA 2WLTA 2R6ZA 1SK9A 2R6CA 4WKNA 2QRZA 4J49A 2OVFA 5KJ6A 5IZCA 4Z4GA 5LP1A 1QG2A 5LA6B 1VL1A 1L4YA 4QQ8A 3VM6A 2OGTA 2Q5QA 4Z54A 3COJA 5FBQB 4DTIA 1QFSA 1I2DA 1B8UA 2BUAA 1CJSA 1K27A 4YMUA 1UKYA 1RE0A 4C78A 2A78A 5BRJA 3SKVA 2IITA 1XROA 1P5ZB 3E5NA 4JJKA 4G9GA 1YDEA 1E2PA 4I0WB 4EELA 3IO3A 1KI6B 4FIDA 1PUJA 3VR6D 5K05A 3IQGX 4F2HA 2QJWA 3HA7A 2GH1A 5DLPA 2GVDC 2EJWA 3INTA 4PEVA 4YAUA 4MDFA 4PPFA 4V0RA 5BYJA 1K66A 3PEWA 3CH5A 1YS7A 3HYLA 3KO8A 3NM6B 1XWFA 2NTEA 3WAJA 3TIIA 1MB3A 4PRZA 1EGAA 3EYWA 2OYRA 1JKJA 3A3OA 5IVIA 1ZA2A 2D4HA 5AI0A 2G5PA 3HKDA 1BW9B 2PZFA 3IIKA 4UZEA 5JBQA 3P45A 3AVYA 4HUQB 3ZXSA 3GJZA 3ZWBA 3QE0A 4HL6A 3NHYA 4D6YA 3I8OA 1G2IA 4FFBA 4Q9KA 1E69A 3JQAD 2YXDA 4ND2A 2J9FA 5ADHA 1H66A 3DHYA 4GOOD 1YRYE 3BUSA 1G1AA 4F5DA 1WMBA 4N0PA 5BN4A 2XD4A 3AZQA 3C48A 2J87A 4KN5A 2AI3A 1JG4A 3IP3A 1DIRA 2EWMA 4F3YA 1PJTA 4V2UA 1DRVA 4IMIB 3FTFA 4MWCA 2IXEA 4H1HA 4EHKA 4NDNE 3LY7A 2AD1A 5K5EA 4N0MA 2CJWA 2ORWA 4XRRA 5EC8A 5FLYA 3F98A 3ND9A 2D2IA 3T9BA 3K94A 1V4NA 4NMHA 1PYOA 1Y9DA 2O52A 1C29B 2QTVB 1TVKA 1PGQA 5JRZA 1R6DA 4K87A 1GZUA 4W8HA 2PMFA 4R1OA 3F67A 1FU4A 5KTPA 2C9DA 4LBYA 1XPJA 1P1RA 3FCOA 3FYUC 2ATXA 2FOIA 2ZIEA 3IQEA 4JGGA 2H65A 2WU1A 1MG0A 4LZLA 4YI5A 4HB2A 2X13A 2E55A 1AKVA 2FB9A 5LQCA 3ZZ1A 2HZ7A 3ABQB 1LA2A 5AW8A 5FTNA 5FLXA 1UK6A 3HCCA 4G0UA 5KWJA 2VJKA 1X80A 2FCAA 2ZYIA 3IAS6 1OYYA 4K9QA 2G7MC 2J3MA 3VOAA 3WV5A 3F7MA 2ANCA 4GPBA 4W5NA 1Y6FA 4CV1A 1SD1A 5ALTA 3KQYA 4BJ6A 2E9SA 3TCNA 3MGCA 3G9TA 1FYWA 2RMKA 1RM0A 4KXQA 4E5KA 1KJ8A 4LTDA 1NNUA 3G5MA 3W6NA 1T1SA 2VF7A 4OBWA 1KMNA 1TQ2A 4A5OA 1T0PA 5TGZA 2I71A 1YQEA 2HV8A 1DDOA 2XUGA 5E95A 4RZSA 3WYNA 1NQTA 2GHTA 4D80A 5FL7A 3VX3A 4O25A 4L8GA 1M72A 1B8PA 3H19A 1GZ6A 3BHMA 3KEQA 2EVWX 3VUFA 3SEAA 1MO5A 2ZEJA 1O97D 4KSYA 4Q3CA 4YP6A 3LCJA 1XV5A 2Y67A 3RJ9A 5A9TA 2PIAA 3DZFA 3QMWA 4PX9A 1FSPA 4MB6A 1NQWA 4DC9A 5KIAA 1YDMA 3LRPA 1HM5A 3WGZA 1LZLA 1SM4A 3DT6A 4R9UC 3UKDA 4CMCA 5TIIA 4EKEA 1NWHA 3L9XA 1KZYC 421PA 4A6XA 2OBXA 3LT4A 3MFQA 4O4HB 3ND7A 2R8YA 3WQBA 3G6WA 3AHJA 1UJBA 3CUSA 3NHZA 4YRBA 2HR1A 1KMQA 3WK7A 1TPYA 2LKCA 4JJIA 1RXSA 3GA5A 3AUTA 4E15A 4KXXA 3SXUA 4C6TA 4NXMB 5FBVB 4RVCA 4IHJF 5IDXA 3L18A 1DAHA 4POOA 5LMZA 1CQIA 1PUIA 2YVKA 4DSAA 1NXSA 1YF3A 2GESA 4K28A 1M6NA 4GLLA 4JUBA 4K9KA 1G66A 2FNAA 4W9RA 1JDJA 2FJ0A 3CC8A 4LJYA 3VZCA 2WJ6A 1PWXA 1UPCA 1KEEA 2Z6VA 4I9UA 1J2RA 4HVAA 2PNFA 3C0KA 3JZDA 3OZEA 2IEBA 3P0EA 4R7ZA 2EX1A 5DTRA 5ESXA 1BROA 4K6CA 5E7QA 2I55A 1FNSA 5K6AA 1P7YA 1UC4B 4B5LA 4CKZA 1ZOPA 3HG7A 5DGHA 5CVVA 1NOJA 2YXBA 3TMKA 1KGSA 5A04A 1YRLA 5ITZA 2JFZA 5KNBH 5BOVA 4G23A 1X77A 3TINA 3JQ9A 5I7VA 5K0BA 3UK0A 1V3QE 4YRTA 4PZLA 1SBQA 4IICA 3WHKA 4CQNA 1JKJB 1RWXA 2DPXA 3MJHA 4IZOA 3H9JA 3HKDB 4H0CA 1EX1A 1GCUA 3MG9A 1N8TA 4FFBB 1QVAA 1A9YA 4TM7A 3LLMA 3LK6A 3Q0TA 2DY0A 2IUSA 4IWXA 2J9FB 2QI9F 2XTAA 1K6MA 5F9HA 5EIEA 4X85A 3T35A 4M1SA 2CLEB 5BN4B 2C31A 2P4EA 2C04A 3VNSA 3ZHRA 4CCAA 2G9NA 4NBVA 1WCIA 1JJIA 1SGWA 3BIJA 1CY2A 4CETA 2UZ4A 2VKTA 1KFBB 3K8OE 4L5IA 4U39A 3PNMA 3PQDA 3HC7A 3EWIA 1WOMA 3L8FA 9ABPA 2H29A 5DHUA 1QTRA 5K0ZA 1K2WA 2CJWB 1SQGA 2QLTA 3TAUA 3Q8LA 4GI3A 4GMDA 1P1JA 1IVYA 4EUKA 3DL7A 3L79A 4KR7A 2X8JA 2XKJE 1XVUA 721PA 1HZJA 1C0KA 2B2CA 2XNDD 4NZYA 5ER9A 1TVKB 3UENA 3L1KA 1RWVA 3L1VA 1T8SA 3QKSA 5JEEA 1RJWA 2ZRKA 2A67A 2CDNA 1NSTA 2TMKA 3ZZNA 5KNBD 2VJDA 3VISA 5B6PA 1JE1A 1R6AA 4LJSA 2X8WA 3THSA 4WL0A 4WHMA 5B1YA 1ZWKA 2FFRA 2XNKA 3NZEA 4J1SA 3RS9A 5BSUA 4Y98A 4IP0A 4YR7A 1Z6AA 4RTRA 1Q11A 1UK9A 4U5QA 2PAFA 3ETEA 1X80B 1KKUA 2BJVA 3KDAA 3M6LA 3NBFA 4P4TA 3TJRA 4KLNA 1NLZA 1N2GA 2PRJA 1KSHA 4FQ8A 4FCCA 3DS8A 4IKEA 1NUHA 2GN9A 1EJBA 2WWRA 5BORA 1K06A 3OZAA 2GEVA 4RHUA 4JLWA 3SEQA 3W9BA 2VZ8A 1AKWA 1TMKA 3G0CA 1BIFA 1PW5A 1PKEA 5H82A 3MUNA 3RDPA 3RSSA 5K8VA 1WR8A 3A6DA 4CEHA 4A8JC 2C9ZA 3H2SA 3MLBA 2H85A 3INRA 4K03A 1A7AA 1G4HA 2G07A 3BIOA 2H06A 1ZM9A 3AI2A 4ZJYA 5JV5A 3KOWA 3O2SB 4FHZA 2QUAA 1VJ5A 4GXNA 4YRLA 1RQXA 2WD9A 3G1WA 1L7BA 5E7IA 1SEVA 2JIOA 4HADA 5FV7A 3GVPA 1SUCA 1P7VA 1SVWA 3MWLA 3NTQA 4HWRA 1BJRE 4IDEA 1DQNA 1UFKA 3THOA 3THYA 3S1LA 5ADWA 2CYBA 2GJ4A 4W9NC 4HZUA 1GFZA 4OQDA 5KTMA 2C1EA 3QVUA 1UT8A 1WQ4A 1ZY2A 3QU2A 5EKXA 2XRYA 1RXYA 3KYIB 3ROQA 2AQHA 5LNK1 1FIUA 2VQEB 2UVDA 2G9UA 3ILSA 3OF2A 5EGSA 5D01A 1B1AA 1NVUQ 2YJ5A 1R3DA 2OLEA 3HGTA 4H2DA 5B58T 4MVCA 1IC6A 2ZI5A 3G5AA 2ADFA 4PXAA 3S27A 3SXUB 1SKQA 4C6TB 4KI7A 2BHTA 1GYRA 1QFZA 1E7RA 1CQIB 3KT8A 3NTLA 4URVR 3X1KA 1Y1QA 2WDZA 3IAM1 5ES4B 4XWWA 1UAYA 1XA0A 2AT1A 4B1FA 1TM5E 4M89A 2I2CA 3DKVA 5BN1A 2F3QA 1VRWA 3EWSA 2VTDA 4ZPJA 2Z6QA 3MS2A 1YQUA 1JIIA 3KPVA 1U81A 4YLGA 1KEEB 2P2DA 4DLRA 5IFKA 5JH7F 3LXRA 2GZ3A 3GJSA 3UWDA 3H8SA 2QNRA 2RGAA 4GSYA 4CMHA 3TL3A 5CFOA 3OWOA 1TIKA 2Q4OA 3Q7SA 4QOFA 3UB3A 1OBCA 1E1KA 5IMBA 3O8RA 4P80A 5ITZB 1YD7A 2DCUA 3PYXA 1QP0A 1OCEA 1NJ2A 3H3JA 1DWQA 4IGAA 4YECA 3SX4A 3W6OA 2FQ1A 4DIUA 3P9SA 4TTSA 3E8SA 4NL4H 4HBGA 3NTOA 1W4AA 1O0BA 5A3JA 2ZQYA 2X3UA 5HE9A 3ZU4A 1NXQA 1T3LA 4FLEA 2NUPA 1XJQA 3H7AA 3BDIA 5HG0A 5IDWA 5P8WA 5EKSA 3VBCA 1VMIA 3PR2B 3UJBA 2ASVA 2Z4SA 2JLAA 3NAZA 1Q7GA 3L8CA 1LTKA 3OUZA 3W3ZB 2X14A 5AVKA 2PG3A 2KWIA 3EXHC 3PQ4A 2A5JA 2R65A 2WR8A 3CPEA 4OLHA 6Q21A 1WCIB 3X44A 1ULZA 2CXTA 2HWYA 3NRJA 2C9BA 3CVVA 3IAUA 2R6AA 5FBHA 2LPMA 1A96A 1IATA 1C3EA 2J9GA 1SU8A 4KE9A 3VVMA 4EZIA 5HZHA 2CWWA 3IL2A 3A6KA 3EY4A 3FNRA 4EGJA 1QQTA 2ZU6A 3C24A 2ZVPX 3JU3A 2ZRHA 2YBEA 5DW0A 3SOZA 1G5QA 3W9SA 3WNZA 1XTZA 2DAPA 2NZYA 2P9YA 2X8JB 3BFKA 3MZ0A 4NBWA 1JLRA 1QHHA 1WWKA 3SP1A 2HDWA 3MWGA 3QKSB 4GR5A 4ITUA 5CNIA 2FR0A 2EAUA 2HK8A 3HLTA 2BBOA 5HVNA 3TR6A 4XA8A 5AKLA 2B1QA 3IUJA 5ICCA 4AN4A 1QAOA 3OEWA 1XWWA 5DTEA 4BMXA 3W1EA 5KTNA 4Z7QB 1UBRS 3VR1A 2G1PA 2PYIA 2V4ZA 1BCSA 1W4ZA 4YP7A 2VDNB 2OEPA 1QZXA 2BHLA 3A3NA 4LA4A 4PR3A 4Y6SA 2Y9PB 4Y2TA 3RSOA 1EQAA 2P6PA 4HP8A 5BQOA 1CNMA 1E2MA 1CP3A 3DZJA 2PO5A 1E0SA 3D6FA 4H15A 4J2TA 5FAKA 3AFNA 1IBLB 4D9KA 5GTDA 1JI0A 4BO4A 1KYWA 4GMKA 3JZMA 1TM7E 4MV7A 1BE1A 1HG0A 3L49A 1OWPA 5DCLA 1A0OA 5DBFA 3DMHA 4CEHB 4CT0A 2FR1A 2PQ6A 1HDRA 1RWPA 2CJPA 3KJZA 2ERYA 3OKPA 1HE4A 3Q8XB 3QPBA 4GBJA 4OXRA 3ZCVA 3DNMA 5LD2C 2B1RA 3NHPA 4PYLA 3PK0A 4BRSA 4P6VF 1XQXA 1Q14A 2VSQA 1B74A 2CXPA 2XB4A 4US1R 2BPOA 5B2FA 2C96A 1EFCA 1NATA 2FQYA 1E5LA 1W4LA 4OYHA 1FS4A 2GYVA 3LHSA 4HFNA 3CNLA 5EIXA 3UIEA 2Z8YA 2HF8A 3QTLA 4QUBA 3THYB 2A86A 4K0KB 4OG2A 4FINA 4G56A 1P39A 2ETXA 4HK4A 1HFEL 3HUTA 4HZUB 2PUBA 4UUBA 4ZT5A 4V02A 5EIWA 4DZZA 1J7KA 1EJ6A 1QNLA 5EZQA 5CCEA 2P2GA 3FKQA 3SR3A 3WTBA 3P2KA 1JH8A 1F8YA 3VPCA 3IELA 5ALSA 2DBQA 3R5JA 4FT2A 1E2FA 5E4TA 4I50F 3TQTA 5JFGA 1GRCA 1MO6A 1ETUA 5I4BA 2PR2A 2ZAOA 1OYVA 1U9YA 3I6MA 1AMNA 1QIIA 5D6NA 2X0EA 1JHRA 2XH8A 3T1QA 1US8A 2QJRA 4IIJF 4JUCA 4ZD6A 2EFDB 3PHGA 2E4AA 1NF9A 1QQAA 4BKPA 1E1QA 2X22A 3AINA 1VE1A 4P81A 4NH4A 5BSHA 2R4TA 3ISTA 4RKEA 2A58A 3E2MA 3JRNA 3VTFA 2A0YA 5AVYA 3I34X 1A71A 1KAGA 1XZMA 2YVLA 2ZE5A 3HM2A 2NPIA 1ZISA 3JVEA 1TVMA 2GILA 4DCGA 3ILXA 4WBSA 1ZKMA 2YJGA 3FMIA 3O91A 4YRGA 1JDNA 4P5PA 1GQRA 1SXIA 1D8TA 4MKRA 1NXOA 3F3MA 3FTNA 4BEJA 1G8MA 2Z2IA 3OJLA 2IOYA 1KMCA 1ZGGA 2UXDB 1MCZA 4TTQA 8LDHA 2LGJA 3LPAA 1AS0A 4GAEA 4BE4A 4BLOA 2DH6A 4MV0A 2H48A 4PAGA 5JAIA 2G1AA 3DAOA 1JDUA 3L4BC 2NUPB 1AC5A 3R3YA 4IHAA 4QFMA 2EJUA 3HBLA 4OLFA 4JASB 1VMKA 1NT4A 2BR5A 3C7AA 3RIXA 4AO6A 2RGYA 2EHDA 2FGKA 5GMOA 5SYNA 4UJ5A 1EVEA 1GL3A 3V7FA 4IXWA 4K9MA 1Q7TA 2VUHB 3LF2A 5JJIA 1AZTA 4MYRA 4KHPB 3NORA 4MKHA 2UVPA 3Q15C 1SC1A 3WLFA 4C22A 1TC2A 4EL0A 2V5VA 4TMYA 1EWRA 1HDEA 3OOWA 4G1VA 4M60A 2GR9A 1BGXT 1JSXA 2PFKA 4KRXA 1Z68A 2LDBA 3CLSC 4UZFA 4PYMA 5AK4A 3MEQA 5FNZA 4AN0A 3N7UA 4MCIA 2O9JA 1IQPA 2QN1A 3BDVA 2GBGA 4EHLA 1I3OA 2RH5A 2JZNA 2FKNA 1GLGA 1QHHB 4U00A 2V58A 3C45A 1WY5A 3QGMA 1BHJA 2VCEA 3ESRA 3SJBA 5M3BA 3LPNA 1QO9A 3LUKA 4IUDS 3KL2A 3UKJA 4ZHQB 2Y1FA 3KAPA 3X1WA 1C3JA 2D5BA 2QR5A 3L1UA 4OFBA 2OCYC 2XBMA 4PYRA 1BCSB 1XVVA 4Z9XA 1KH2A 2JEZA 3PPIA 3RRMA 2VP6A 1GEEA 3UPUA 5FOSA 2G9ZA 4GRAA 4QPCA 4XYBA 4F71A 1TK9A 1V2HE 1YQTA 1OE0A 3JD3A 3D3NA 1JPJA 3AWIA 5ARDA 4B8ZA 2ZBUA 3LKBA 3VZSA 4B31A 4DLTA 2H17A 1YR8A 3H8VA 3V2UA 4BMCA 2QM0A 5TEVA 4NAVA 3HR4A 4JI5B 4CG3A 5EG5A 2HXSA 1JXAA 1XZDA 1S2MA 3H3XA 3IJPA 4GZLA 3DMNA 4CUKA 4NX2A 5AXDA 1H9AA 1J8QA 4RDCA 4ARCA 4KBFA 3WNBA 4YT5A 3P26A 4LI0A 2IXAA 1U6KA 2QENA 1UPBA 2OGZA 1F9EA 5FLKA 1GPAA 1S2LA 3K71B 1IOVA 3OSZA 3E1SA 2CFCA 1NW4A 5HIMA 4EAQA 2DHRA 4EFMA 5H16A 4GQAA 1UM8A 3O03A 1LJ8A 4QXQA 3LAWA 1Y6JA 2VH5R 4TN1A 3EYAA 3N59A 3EFBA 3COVA 3TWOA 1OBFO 4WTOA 1E18A 2ECKA 2YFKA 1X7WA 1ZN2A 2QM3A 3PUVA 4HEA1 3MM4A 4RC9A 4W7HA 3UJCA 1CEXA 1RE1A 3A1NA 3ZHUA 5A4DA 2VCYA 3E9ZA 2Q9BA 4DV3B 3ZY6A 1SXGA 3DOOA 5ALKA 5IWCA 1F6DA 1O6BA 4MV8A 2HMVA 4RFVA 5F2OA 4JU9A 2IZZA 1MO4A 3QRWA 5LBTA 4C7MA 1JDTA 1EVIA 1MB0A 4KDRA 1BFKA 3C16C 1US8B 4UREA 3FFXA 1E8NA 4WCFC 5E8RA 3RVLA 3GVCA 4FBLA 5IKEA 4U7JA 5HIAA 4K88A 1KPGA 4MNTA 3WKEA 3PUJA 4FONA 1UP6A 2QD3A 3LQ4A 5JMTA 5TB5A 2ERCA 1P19A 5LZ7A 1XJWA 1MB2A 2XPCA 4CKBA 4Y2VA 2GZDA 3QFFA 2AL7A 3C6QA 3KVNA 5K51A 3UJ9A 3ZU2A 1T6XA 2DZDA 4C2BA 5KDOA 4HNQA 2QTGA 3C5VA 3O73A 4BRUA 3HCDA 3GLFA 3SLKA 5CXQA 5EMLA 1QOPB 4PXSA 5LJLA 4ZZ3A 3PXXA 1I1OA 5I7SA 4RQUA 1VP3A 4LDJA 3TOZA 2J4FA 2XV1A 3D0KA 3UQYS 3TO5A 2FEOA 4UXIA 3SBOA 5EJ8A 4I55A 3DEZA 3GWGA 3G9XA 4QPZA 1B16A 3B6ZA 4X54A 4PPQA 1VE6A 3AHCA 1NUUA 3RSLA 3TQFA 4C9BA 2ZT7A 3DFKA 3I0NA 3GFSA 4UTXA 5KTSA 3EN0A 2I22A 2IP4A 2TRSB 2UVPB 3D3KA 2WJPA 4D44A 2GS9A 3HJRA 3ENVA 3N2YA 2VAVA 2JAWA 1R8YA 1CQPA 1KFKB 4X6LA 4D43A 3SVTA 3M82A 4AP9A 1JQLB 1UC8A 4G2NA 5AP9A 4Z1MA 2FRVA 1DEXA 2BWJA 2PZ8A 3CX4A 3ETDA 5DBHX 3TBHA 4LSGA 2PM8A 3KC2A 2NU9A 3BWEA 3GRKA 4RGQA 2KE5A 4FT4A 3BHJA 3ZD8A 1U4SA 1XDDA 2SHKA 3M4ZA 3NVDA 2XMBA 1KI8A 1DKRA 5TV2A 3I5UA 3QPWA 3EEIA 4WLEA 1FUUA 1Z12A 2C9YA 4R8SA 4WA8A 4FOPA 3PJEA 2WPDD 3WJ1A 1S3GA 1R4NA 1SUPA 2VCHA 2WSIA 1UODA 3FLAA 3GA0A 4ZVUA 5A5FA 4YVFA 5IUNC 4DUYB 1Q0QA 3T7SA 4EFLA 2HYIC 2WF8A 3FIUA 5DT9A 4DQUA 2XVZA 4RZ2A 4PS0A 1XB2A 1N2JA 1FZTA 4KV7A 5BY2A 1HLGA 4B7AA 5JANA 1F60A 2P91A 2QLLA 2DLCX 3I01A 2O54A 1KQ3A 1Q91A 1TD9A 3DWEX 4OQEA 3H9UA 5FORA 3TLAA 1LBEA 1XMQB 4QYIA 1E77A 2LP4Y 5K8IA 2COKA 4FGUA 1U1DA 2VJMA 1T2UA 2CL0X 4FSDA 2E89A 5BXQC 5JAMA 4QDXA 5DHFA 5TGDA 1IBRA 3PNPA 2HA7A 1WD5A 2QUBA 2P8JA 1XN1A 4FDVA 2BUBA 1GADO 3CX3A 2WNHA 1U7OA 4BO3A 3N5CA 4HNRA 4B2PA 2XQFA 1YK0A 2ONYA 3OU6A 2P8SA 3B5IA 2JD1A 3HVHA 3JVIA 4FBMA 4ZTBA 1UKBA 5IWAB 3AVXA 2OV4A 3GLKA 3M83A 2PWYA 1HBJA 2QSJA 3M6AA 4F3RA 3ITDA 3E3MA 4Y2QA 2W6OA 1TZMA 1NVXQ 2R7LA 5KTTA 1X7WB 4EYEA 3NCHA 4KIWA 3W5JA 1LU9A 1ZU4A 2BV3A 4FMCB 1WV0A 1J06A 3KU1A 1CZRA 2EL7A 1C2YA 4XIFA 1PR3A 3EIHA 1D2HA 1G7TA 5C53B 3JD1A 3BJRA 2CNNA 4EG6A 1L1RA 2GNAA 3A4VA 4QECA 3W2EA 3C8UA 4TWIA 1M6VA 4EVQA 2HJWA 4BNZA 1K7XB 3MFYA 3QBDA 4XWAA 2WUFA 3AVUA 2DQKA 1M5RA 3OQOA 1N1DA 5BNWA 4MV4A 1T2CA 2F7SA 3TW0A 1YR2A 3DLBA 3LPCA 2PEYA 2AJTA 3ECCA 5BUQA 3COYA 4BJ3A 1QF6A 1IUOA 3QE2A 1Y7TA 3GGOA 4UQPA 2ZJ7A 1TDJA 2A3NA 4CKBB 5FFFA 3SHVA 4ERNA 1JNXX 1P9WA 2VDPB 3F5SA 4UDXX 4PSCA 3E27A 1DUIA 2IEAA 2A8YA 2BDUA 5TQJA 1L5SA 3GLFB 3GHYA 4TL6A 1FUIA 1RYNA 1K7FB 1Y42X 3IAS1 2EW8A 4HDKA 4X3PA 5KDDA 3LFTA 1NFQA 3F97A 5IJWA 1NW3A 2XXJA 3HE3A 2CNWA 4EZBA 1T5OA 2OZPA 1X42A 4I55B 1MRNA 1UMKA 2VYND 3A4YA 5ADUS 4KN9S 2QSZA 4NQRA 2VJLA 3LP8A 4PQRA 2HQSA 2XUAA 4HLNA 4M9ZA 4S24A 3ZQUA 5BV2P 2HK9A 4NYJQ 4Y7CA 3MWDA 3N3AC 2Y77A 1HFJA 1MZVA 3PUIA 1GU0A 2IYRA 4YT8A 5FPHA 4AU1A 4DREA 6NULA 5DYTA 3KSBC 1AHIA 3UUWA 3SKYA 1H4TA 3RNLA 4AQDA 2QX7A 3MTDA 4R2JA 1N5DA 4YJ2F 1OT5A 2ZJ1A 2J45A 1HL3A 3DDZX 5EA2A 3AEQA 3UN1A 4F5YA 1U1GA 4TT8A 5H68A 1CUBA 2VDWA 1HY3A 1HNXB 4MICA 5CURA 5KAMA 2NU9B 4KK4A 3KD3A 1MQ8B 1UANA 3L5OA 2IUTA 3IOCA 5HR5A 3S99A 1ACMA 2GRAA 4XQGA 2XCLA 3BTVA 1QRAA 4GIBA 3F6CA 2XNJA 1DINA 2AUTA 2FPRA 1BDMA 2AN5A 2PX4A 3GEMA 3U3KA 5M34A 2DFLA 1R4NB 2H1WA 3R5SA 1TIPA 1BXGA 5KEIA 1A8SA 4FNMA 3OEHD 1J0CA 3EVDA 1OZHA 2CB0A 1F6WA 2Q8QA 5K20A 4IQGA 3PDUA 1ORDA 5CIWA 5FTKA 3WYEA 4BNYA 4J91A 4I6JA 2DFVA 3G5TA 3DDNA 3QQ5A 4V3BA 4TVBA 4RHEA 3CVOA 2D1SA 3P4UA 4XJTA 4QYIB 3ETCA 3VSBA 4R8KA 3DZIA 1A82A 1CUSA 2VJMB 3ZNNA 4HLQB 5K8JB 2ZTVA 2ZSAA 5CVDA 4JGIA 5JWOA 4WPGA 4WBNA 5KX5F 1ISMA 1Y5MA 2EEZA 2JHGA 2WP8J 2ZJAA 5B1DA 3N0RA 1NNLA 4O2RA 1R0RE 1KYQA 2C78A 5L9AA 3Q8KA 5I3CA 3OY7A 2VYCA 4DMHA 1BYUA 1MX9A 3DL4A 3LL7A 1VHDA 2PRZA 3E61A 2V7QD 4KDFA 4QLAA 4AAYA 4AULA 4BN0A 3QI7A 3ESZA 1A2BA 1M5TA 3DZGA 2FUCA 6REQA 1K1EA 2ZR9A 3TLYA 2HREA 3KTAA 4CTKA 2ZG6A 3HXKA 5CBPA 4U7PB 2DT8A 1W5SA 3STHA 3A9WA 2IV3A 3C3JA 3T5DA 1C0PA 2AK2A 3AXSA 1ZHHA 4S12A 3ZNOA 4ZC8A 4DDHA 2P1ZA 3R5HA 3PFIA 3W7BA 3X2EA 3OIGA 3B48A 4G01B 3H7IA 4RDIA 4MMXB 1CR1A 4YHBA 2FR8C 1M6VB 3A26A 2GGSA 3KG2A 5JD3A 4D9JA 5LJIA 1VCMA 5DNCA 2RHLA 3UJPA 2LWIA 5JSFA 3NYQA 1GU1A 2P0EA 1JG1A 1YMUA 1G6Q1 1FTQA 3AIOA 3CZRA 3D6AA 5DSXA 3ZBUA 1Z9BA 1N8KA 4LGCA 1XSEA 1U3UA 3HCOA 3ND5A 2W6QA 3CN9A 1H9BA 3O4IA 1CZHA 3QKIA 1WU8A 4X66B 3R9IA 1GAJA 4JZKA 5FHRA 5FOTA 3KR1A 2J5BA 1EM6A 4MKXA 5ICMA 2OV1A 1BE6A 3LZDA 1OXUA 1SVNA 2QTBA 2V8OA 2F3PA 3L7LA 2XTJA 3QWFA 5HYVA 2PZEA 4YMGA 5KTYA 4ZWNA 1JE0A 3RG2A 1N33B 2V7GA 1Q74A 1V5GA 3FUWA 1Q0TA 1YIAA 4HDKB 3RHSA 3E9EA 5HIKA 5KWSA 3EARA 3Q9LA 5B7QA 4YO8A 4M0DA 1Z7YA 2QD4A 3IHWA 3DCNA 3PYMA 3EH2A 3I0ZA 3QJYA 2GEKA 4HLCA 5DLQC 5AR1A 5JE8A 4Q4JA 5TS2A 2PXHA 4X20A 1ENYA 2AKYA 2OG1A 1F3OA 2PS3A 3AETA 3TEFA 1WL8A 4LRXA 2X1VA 1B3RA 4EG5A 1RYFA 3MWDB 3FWPA 1C8KA 1GPJA 2CYAA 1H1DA 4L5JA 4LF6B 3OLWA 1VG1A 2OMKA 2GEFA 4RCZA 1M2EA 1JV2B 3EVZA 4DANA 5IZCC 1A88A 1XI2A 2LRHA 1ZGCA 5G0SA 4QT4A 3TECE 3LXUX 3IEPA 1IJBA 1PFGA 4DYVA 2IH2A 4DMKA 1SIUA 1JR2A 4IRUB 4XYMA 3AEQB 3UJAA 2EV9A 4OMDA 1LKZA 4J16A 4MUEA 2ODTX 1U1FA 4JR2A 2VDWB 3REGA 2Q3DA 1P0FA 3AR7A 5FUWA 4CU5A 1H23A 2J6BA 3EGXA 3ES9A 4PNPA 3V1LA 2B30A 2EX4A 4U7TB 1ADFA 2FWRA 3CEJA 3LT1A 1YNOA 2LV8A 5JVDA 5KJ1A 2HGZA 4KW7A 5EHQA 3C7CB 3JPWA 2C5LA 2C94A 2HXGA 1H0HA 1BHQ1 4WFQA 2MIIA 1BXGB 2F48A 1AZWA 5FTLA 3UHJA 1WXXA 2WQZA 1QHGA 1ZN7A 2HQOA 4KRFA 5EKUA 3KP1A 4O1IA 4PSKA