1JAEA

Structure of tenebrio molitor larval alpha-amylase
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of yellow meal worm alpha-amylase at 1.64 A resolution.
pubmed doi rcsb
molecule tags Glycosidase
molecule keywords ALPHA-AMYLASE
total genus 168
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jaeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jaeA01
1JYWA 5LA1A 1C92A 3VDHA 2VT0A 1BFNA 3B9EA 1VFFA 4MJ4A 1QNSA 2XVNA 4FNRA 1WP6A 2J7GA 5BXPA 3GZAA 4ZXOA 3DC0A 3LPOA 2O9RA 3DX1A 1AQMA 1E6SM 1GOWA 2F7OA 5CSYA 2D23A 1H4PA 2EO7A 1UWQA 2AAAA 3KEHA 1NARA 1GHRA 1B0IA 4HZ6A 2J7FA 4PTVA 3WIJA 5E9AA 3WY3A 2YLAA 5LA2A 1NOWA 3RM4A 4CCEA 4HA4A 3EJQA 5DT5A 1VJZA 2X05A 1HKMA 1PX8A 3WSUA 2D3NA 4AMWA 3CUFA 2VC9A 1JZ8A 4HPHA 4AZIA 1E0WA 3VIFA 1I1WA 4XZWA 2X0HA 4V2XA 3GXDA 4GO9A 2YFNA 4B9YA 3L2LA 3CZLA 4MADA 1TQWA 3T08A 2JIWA 3SUWA 3ZIZA 1HP5A 3AIRA 3HG4A 4PMNA 2DSKA 3VMPA 3EDKA 1W2VA 1J0YA 2A3AA 4XV0A 2F7PA 2IXVA 1W9XA 3GM8A 2DH2A 3FAXA 1ESWA 2J79A 4DO6A 1UD3A 1HXJA 2DQXA 2EAEA 1JG9A 2ZUUA 4YHGA 3G6LA 3AS1A 5I0DA 1K9EA 1F4AA 5D4YA 2VZSA 1EO5A 1KGXA 3CLWA 4QCEA 3ARRA 3IK2A 4D1JA 4CD6A 2J25A 4AWEA 3D51A 1Q6FA 5A8OA 1GQKA 4GQQA 3GXMA 1KXTA 3WFLA 5A6KA 1PEZA 1BF2A 4J28A 1NWRA 2J47A 4UFLA 5FIPA 3WELA 1QW9A 2W63A 1V6YA 2CNCA 3T0AA 4AMXA 5A6AA 3QHNA 4J3UA 3TONA 1BGGA 1W2PA 2YBTA 1WZKA 3WF1A 4FNPA 2XWEA 3A47A 4X0NA 3WH7A 3M46A 4AYGA 3WQ4A 5A95A 1GQIA 1LQ0A 2ZUNA 3PTMA 1BGAA 1C7SA 1MQPA 1B3ZA 2VR4A 1PPIA 2DPEA 1DWJM 2OW6A 1EOKA 4Y7EA 3CZ8A 2DT0A 2WHMA 1XHGA 3ZSTA 1GHSA 2ZOXA 3A3HA 3N04A 1UH2A 4J7RA 4BCEA 3AS0A 4AIOA 3CZNA 3NCOA 1WB0A 3WF3A 5DMYA 2JIEA 4ZE4A 1UZ4A 3D50A 4CU7A 1OT1A 4OBRA 3W4RA 1B2YA 5CXPA 5A8PA 3QGVA 1GQLA 2GFTA 3QOMA 3VOCA 4GZJA 1JI1A 2F7QA 4MAZA 3BVUA 3CZSA 3WBAA 3FNDA 3RILA 1GOIA 1QOXA 4GPNA 1HVQA 3WL0A 1NP2A 3MMUA 4UQ9A 3FHAA 3EJUA 2CBJA 1UKTA 3SCVA 3DX3A 1E1FA 2EPKX 5AYBA 1LL6A 3W27A 3UG4A 2VL4A 4PTWA 1E70M 1JF5A 3DYOA 4CKQA 4D6EA 2OYKA 4S3JA 3J7HA 1DEDA 1R7AA 1UA3A 2FDMA 3PN8A 3WDQA 2PWHA 1NWUA 2E0PA 2CBUA 2OWWA 4PRWA 3BVXA 2X1IA 4P7OA 1ISXA 1TA3A 4DM2A 2YL8A 1V3KA 2ZXQA 1OIFA 2D24A 5FD0A 4UTFA 3T09A 4BQ2A 2OWCA 3VGDA 5C70A 4FLSA 1R34A 1H0GA 5C71A 2NT1A 1V3MA 1V08A 2XJ7A 1J12A 5ABHA 2XN2A 2WW5A 1H09A 2Y8KA 3AMLA 1TQUA 1UH4A 3W38A 1K6AA 2J8FA 2ZXDA 3WUGA 2A3CA 1KBKA 1PBGA 2O92A 2XFFA 3WH8A 1MVYA 2ZE0A 4AYSA 4MTVA 4GZIA 4DUXA 3RJYA 3W81A 3CC1A 4D6JA 1NH6A 1GUVA 2VR5A 2CEQA 2XIBA 1W1PA 1JL8A 1JAEA 4N0RA 1VFUA 3BSGA 3CMJA 2DT1A 3I3EA 3UR8A 1KR0A 3WH6A 1UD2A 1BPLB 2V3FA 1AVAA 1SZNA 1US2A 1DWHM 3DECA 1XD1A 5BXSA 3MMWA 1RP9A 1U2YA 1BAGA 4CGTA 1FHDA 4DWSB 2VI0A 1VEMA 4NRSA 4M1RA 3WEZA 2X2YA 4UQAA 4S3KA 3EMZA 4HMEA 5JBDA 1WZMA 2NSXA 4QFUA 5CPTA 2OYMA 3L4UA 6A3HA 2GVYA 5D8WA 1G9HA 4WKAA 3ZJKA 3WNNA 1UWIA 3MUZ1 2BFGA 4W88A 3W26A 7TAAA 1B9ZA 2QF8A 3GXNA 1FP8A 1O7DC 5CGMA 3B9AA 2F61A 4P7LA 4D71A 4L4PA 2BHUA 4KH2A 2YOCA 1V6VA 1W3JA 2WLYA 1GOMA 2WHLA 3WQ5A 4PMVA 4EKJA 1MW2A 1XH0A 2WLZA 3GXIA 1CXEA 1V02E 3FXYA 4W7UA 3WNMA 5D9MA 1D2KA 2WBKA 4IPNB 1W3HA 2DSWA 1MW1A 1LLOA 2W67A 2GK1B 1JDDA 3AHZA 3BMWA 2DH3A 3IGUA 3HMCA 1NM9A 5M03A 3CIVA 3H53A 1CIUA 1WNOA 1BLIA 3TV8A 4LX4A 4KMQA 3VU2A 2PWEA 3K8MA 1FA2A 1JIBA 2XTKA 3MMDA 2A3BA 1J11A 1E4IA 4M82A 1BVNP 1V3LA 3VD9A 1QNRA 1V0MA 5D9OA 3WF4A 4LXFA 2DEPA 1EDQA 4AD1A 4BS0A 4FNTA 2FH6A 2Y24A 3VMNA 1LJYA 4AW7A 3KL3A 3ZJ7A 1W3KA 1E73M 1G01A 1BQCA 2GSJA 2A3EA 3DHUA 1GVYA 3S5YA 3PZNA 1UOKA 2WVUA 4JCLA 2YFOA 2XPKA 4IPLA 3SCWA 1OGGA 4EE9A 1PS3A 3D3AA 5I23A 1GCYA 1HX0A 3I3BA 1X6NA 1JZ4A 4CN1A 4CN4A 1K9FA 5LA0A 4WKHA 3ZO9A 3A4WA 3AZRA 3EJTA 4GI8A 4BF7A 5IHSA 4OGZA 1QWUA 1QI5A 2QMJA 2EJ1A 1W9VA 3F5JA 1MW3A 1Q6CA 2CHNA 4HPGA 1CLVA 1I75A 3IANA 1JXJA 2E4TA 1ECEA 2VQTA 1W3LA 1ISVA 3QHMA 1KXHA 1US3A 3F5LA 5DFAA 2Y8VA 4M8UA 5A2BA 5DF0A 3FW6A 1OCQA 2WVVA 3KZSA 2WC7A 1Q6GA 1R7OA 5A69A 1H11A 4GI9A 4FNUA 2VUYA 2Y2WA 3WY1A 2X09A 4AZ5A 4FMVA 1MQQA 4J27A 3OLDA 4CU8A 2XG9A 2XFRA 3ALGA 2BXYA 1UWUA 4JFUA 2JF7A 3BUQA 1E43A 5M3WA 1E55A 5HBFA 3NIYA 4GQRA 5CPSA 4N42A 5E0FA 5I6SA 1MYRA 5GNZA 4R27A 5ECUA 1E5JA 3T2OA 4CD8A 1LG1A 5IDIA 4BA0A 4AISA 3AIQA 2V5CA 2WYSA 1G94A 1KBBA 4AD4A 4UZUA 5A8QA 1E4NA 2F1BA 4J3SA 1YQ2A 3VSVA 2XVGA 5I24A 3CUGA 2AOSA 4D6CA 1WO2A 3CZKA 3L4TA 4FNSA 3CHDA 3WDRA 3FAWA 2CERA 1QBBA 3SIMA 3UR7A 4U2YA 3UEQA 3IAQA 4F8XA 1VRXA 2F2HA 3POHA 4A3HA 1Q4NX 2VZUA 2UY2A 4W8AA 4ATDA 3HG5A 3VX0A 4E8CA 4U31A 1HKIA 4ZE5A 1JGIA 2CESA 4FLRA 4UFMA 3VIMA 5IFPA 3CZJA 5AY7A 1J0IA 1AQHA 4AEEA 3VD5A 1R8LA 3SUSA 5ABFB 5FL0A 2VZOA 2GDUA 4KRTA 2ZXAA 3WF0A 3OLEA 1ZBWA 1C8YA 3PZTA 5EFFA 3AI0A 5ABFA 2WCGA 4AY1A 1FH9A 3AIBA 3IAPA 3LX9A 2QV4A 2VZVA 4OBSA 1CPUA 1UR9A 3SCTA 3WD3A 3PTKA 1M7XA 4A4AA 2G3NA 3K4AA 2CCRA 3GXTA 3WDJA 4OUEA 5M17A 2YA1A 3TTSA 4D72A 1ODZA 4AC1X 1V0KA 2ZXBA 2VTFA 1QBAA 4QLLA 3AROA 1TMQA 5BXRA 4UFJA 1NP0A 1UR4A 3UG5A 1OM0A 3K4DA 2WPGA 3A4AA 3A24A 2BVDA 2J74A 5E6ZA 3UCQA 3EJPA 3NSNA 2D73A 1JI2A 2VMFA 3ZT5A 4W8LA 2QPUA 1CZ1A 4Z2IA 1XRVA 4HP5A 5CSUA 1MW0A 1E9LA 2VURA 2BHYA 2W66A 1KGWA 3GYCA 2WVVB 4OOUA 5A8NA 2HISA 2VOTA 1WCGA 4D6FA 2ZUTA 4UFIA 2ZIDA 4PUDA 3PZGA 1YHTA 3GH5A 5BRPA 2XN0A 2BY2A 1HWWA 3ZMRA 2XGIA 3EMQA 3OGRA 4CVWA 4JKMA 4W7WA 4UZSA 1E6XM 5ABEA 2V38A 1IZKA 3CV5A 1PIGA 2YA0A 2CITA 3SUTA 5A8MA 2F1AA 3NDZA 2E9LA 4NZCA 3CO4A 4V27A 3ARUA 4HMDA 4PMYA 2C7FA 1S46A 1VF8A 2J7HA 1EA9C 3W37A 3N9KA 2WZHA 1SFSA 1I1XA 2GJXA 2D0HA 2W61A 1FH8A 1WDQA 4B3KA 1GOOA 1KTBA 1T0OA 1E6PA 2O9OA 4Z2HA 4P8WA 4NRRA 4UCFA 3DX2A 1E0XA 2DSUA 1GPFA 5BROA 3KLLA 6TAAA 3PZMA 4PMRA 1GVIA 4H04A 3KLKA 4Q22A 4LGXA 1BG4A 2J62A 2W91A 3O2LA 3OGVA 3BVVA 5A6MA 4W84A 4F66A 1B3XA 3SUUA 3WNPA 1RP8A 1EXPA 1NQ6A 1OIMA 2IUZA 1N82A 3N13A 4GZEA 4FNQA 1R47A 4JFSA 4HA1A 1ITCA 3GNPA 5I5RA 5I79A 2OW7A 2ZUVA 1MFVA 1G0CA 2PWDA 3SCRA 3NJ3A 1WE5A 3WD4A 2WAGA 1A47A 2J78A 3F5KA 2WMGA 3OZPA 3LXBA 1TUXA 3WUFA 1OD8A 3CHFA 4CD4A 3WEMA 1JNEA 4MNJA 3WEOA 1V0LA 2WKGA 4GO8A 3BAWA 1L8NA 1E1EA 3EBVA 3WQWA 1E6ZA 4TTUA 2PWGA 1KGUA 3QOKA 3EDJA 2D1ZA 2GK1A 1KFWA 3N18A 3D4YA 3O9NA 3VILA 1UD8A 4KRUA 5IHRA 1R75A 3I3DA 4PMQA 5LYRA 3TTQA 1D7FA 1JF6A 4TX6A 4OKDA 4PMZA 1H3GA 1WZLA 1W9DM 5GPRA 1V3HA 3THDA 4WF7A 2TAAA 2YKKA 2EXOA 4WIWA 1FOBA 4NZFA 2VX7A 3BLKA 3LRKA 2YIHA 4HOZA 1J18A 2WM0A 3AMGA 3F4VA 3WL1A 3ZJ6A 5A3HA 1XV8A 1WKYA 4E8DA 1O6IA 2ZUMA 3K8KA 5GQBA 2GJRA 5HDRA 4PCSA 2XM2A 5HPOA 1W1VA 5IFTA 1QI2A 2EEXA 4UR9A 4ACZA 3BGAA 4K68A 4CCCA 1GOQA 1V03A 3T0DA 3N12A 1KQYA 3VVGA 3PBGA 3UETA 3BUDA 2ZX8A 2G4FA 3K1DA 3UERA 4JFVA 1UR1A 3WDIA 3U5YA 1VIWA 2WC4A 2VX6A 1OB0A 7CGTA 2JFEX 1KXQA 1OINA 3L4VA 2J77A 4MNMA 3HG2A 3PZUA 2DDXA 2WWDA 3ZT6A 3NYDA 3MU7A 1JZ3A 4D6IA 1QI0A 1U30A 1TVPA 2ALWA 2E8ZA 3WUBA 1W91A 4QLKA 3BAXA 1O7AA 2V3GA 3WUEA 4GI6A 3A6OA 1HXKA 2NW0A 4J3WA 4JKKA 2BHZA 3CZEA 4ZXLA 4ZEPA 1BG9A 1SMDA 3VIJA 2DT3A 1PIFA 3N17A 2OSXA 2YDSA 4P7RA 1CNVA 2WMHA 3PZVA 3G6MA 2BV9A 2OSWA 4D6GA 2X8RA 1CDGA 4Z2LA 5AC4A 4WSKA 1C93A 2PWFA 1D3CA 3RM9A 1JZ7A 3M7SA 2ZUSA 3T2QA 4BQ4A 5DO8A 2W92A 4JIEA 5AC5A 3GBDA 5JBEA 1KQZA 2YA2A 1BHGA 4PMUA 3WFZA 3AXIA 1PX4A 2WHJA 3W25A 1UH3A 3LRMA 3VNZA 2W62A 1HT6A 3BC9A 5ABGA 4M56A 1DP0A 2VVNA 4U3AA 4IM4A 2YL6A 3AHVA 1ITXA 1P6WA 3B9DA 1Z32X 1H1NA 3CMGA 3AMKA 1MXDA 3NSXA 3K46A 1V0NA 4CD7A 3AICA 3BUBA 3W53A 4QCFA 1HL8A 3W0KA 3RCNA 2QLYA 1KB3A 2CKSA 2G3JA 4HTYA 5A6JA 3MSDA 1JD7A 5CLTA 1W9PA 1XH1A 4DO4A 2DGAA 2AMGA 4X9YA 1JFXA 4LPCA 3LXCA 3VD7A 3ARYA 1PX3A 4HU0A 4UQDA 3EJSA 4RE2A 4TTGA 1R86A 4AD3A 4Z2GA 3WDHA 3ZSSA 5EFDA 2EADA 3GNRA 4X0VA 5JBFA 4AIUA 1CENA 1CEOA 2CPUA 4HU8A 2ZWZA 3WD2A 1X1NA 3T2PA 4C7DA 1E15A 2EABA 2WSPA 3K8LA 4MDOA 5CLWA 1WAWA 3BAJA 1B30A 5D8ZA 3WNLA 1DHKA 2VRJA 2J75A 3W6LA 4C7FA 4DWSA 2WCAA 2JF6A 1OGBA 3VGBA 2GJPA 4P8XA 3HN3A 3KE0A 4AZHA 1JYNA 2WMKA 1EIBA 1PJ9A 3LPGA 2JEPA 3MKKA 4AD2A 1SYTA 5HPCA 4B9ZA 1EHAA 2RGMA 1XD0A 5HXMA 4TVDA 3ECQA 4UQEA 3ARVA 4DO5A 5CJ5A 1MQRA 2ZX7A 2V3EA 2WCSA 4MB5A 2DT2A 5FKYA 4Z2KA 3MI6A 1CYGA 3VD4A 5I2UA 3QHOA 4QLJA 1F4HA 3A22A 3ZT7A 1HNYA 3OBAA 1UKOA 4H41A 1JYVA 1PZ3A 1H0IA 3APGA 1E6QM 3ARSA 3VUPA 1DWIM 1LWHA 4FF5A 5BCAA 1XSIA 1JFHA 3KWXA 5JIPA 1H5VA 1R87A 1QHOA 2VCAA 1EH9A 2VZTA 2FHFA 1CGTA 1ZL1A 1VAHA 1ODUA 3VIKA 2BXZA 4HA3A 3AXHA 1VFMA 3II1A 4TVCA 1XSKA 2WZEA 4PUEA 1E6NA 2DIJA 1LF1A 1VJSA 1FHLA 3ARZA 2OSYA 1QHZA 4U2ZA 3D52A 1KR1A 1DTUA 3OG2A 3CUIA 3OA5A 3WD0A 4P7NA 4OZOA 4W7VA 3O6AA 3WY4A 3VKKA 4DWSD 1ZJBA 2WSKA 4XZBA 2F18A 2O9TA 5C8BB 2CBVA 3WQ6A 1QVBA 1OT2A 2EACA 4CN6A 1GW1A 1V6XA 3UG3A 1C91A 4NX0A 2YBUA 1G1YA 1DWGM 1J0HA 1EQCA 2PBGA 3CHEA 4PTXA 2VCCA 3AHTA 5BYWA 1C3FA 2J7BA 4UOQA 3SUVA 3SCPA 2Y5EA 2VVSA 1CTNA 1QPKA 4UFKA 1JD9A 1M53A 2JEQA 1TE1A 2CXGA 1KTCA 1ZJAA 3L4ZA 2VX4A 1QI4A 3ARTA 5A1AA 4RE4A 3LMYA 1FFRA 3VMOA 4PTMA 4CD5A 2UY3A 4JFTA 4JZ5A 3DYPA 1UR0A 4PMDA 3VD3A 3E1F1 2XHYA 3BVTA 3AXXA 4LYRA 4JFWA 1BYAA 2WHKA 4HZ7A 3MUAA 3VO0A 5BWFA 3AS3A 1GONA 1E3ZA 3VGFA 3PZIA 4A3YA 1UKQA 3WNKA 4HMCA 1X6LA 3CPUA 4D1IA 3TTOA 4HOXA 3CGTA 4PBGA 3VGGA 3NUKA 1W9BM 2J8GA 2PBOA 1HJUA 1LG2A 1E56A 3TOPA 2OWXA 4W89A 3MUIA 1HJSA 1LL7A 2BVTA 5M5DA 3RM8A 3D5HA 2EBNA 3VPLA 4E4PA 2W4XA 2DIEA 2XWDA 2E40A 2WZIA 2VRKA 2ZX9A 1GOKA 2WXDM 3AMCA 1JZ6A 3VM7A 1XCXA 4OOZA 4URIA 1PAMA 1UG6A 5A6BA 3AOFA 1QNOA 3U7BA 4AZCA 4EANA 3U57A 3WH5A 4J3VA 3ZJ8A 2WWCA 3AZSA 4H2CA 4W85A 4TX8A 3W82A 3LXAA 1UA7A 1QX1A 1UR2A 1GQJA 1GNXA 5E0CA 1IV8A 4HZ8A 2JE8A 3POCA 2EQDA 1CGYA 2FYVA 1R46A 1R85A 1H41A 3A21A 3RDKA 2IXUA 2NT0A 3ARXA 2YJQA 5EBAA 1NWSA 2XVLA 2GJXB 1UR8A 3H54A 1CGUA 2VO5A 1R33A 3SEPA 4L4OA 1UKPA 1UD6A 4CCDA 2QHAA 4AZCB 2GDVA 3RJXA 5A94A 2PF0A 4ML4A 1Q6EA 1UWTA 3ZOAA 3W29A 1UZ1A 1C7TA 3GH4A 4CU6A 1FP9A 5A6SA 4C7GA 2FHCA 3WNOA 1GJUA 1ISYA 2WKLA 1OGSA 3U5UA 2WNWA 2X2IA 3HJEA 2CYGA 1V3IA 3L4WA 1E40A 3CTTA 3THCA 3QR3A 1SR0A 3BVWA 4W93A 2X0YA 1TQTA 2YL5A 4AZ6A 4OIFA 1EGZA 3BLPX 2G8ZA 2DSZA 1BVZA 4AMCA 1LL4A 3DYMA 5A6BD 1RD6A 1XYFA 5A2AA 1J10A 1RPKA 4HOWA 1HN1A 1NWTA 4M81A 4MAVA 4UNIA 4YPJA 3VTRA 2CHOA 1J0JA 1VEOA 1BYDA 3A5VA 1QNPA 3BSHA 4TVUA 4D6DA 2WMFA 3AIWA 2WVSA 1V02A 4NF7A 4GIAA 1TVNA 2V3DA 1J0KA 2UWFA 4AEFA 1ZB5A 4JAWA 5BRQA 3FN9A 4FK9A 4Q7NA 4P8UA 1ZBVA 1E6RA 3UESA 1PZ2A 4M24A 2ZICA 4E2OA 1WDPA 5CZKA 1EO7A 3DDGA 3AFBA 4MB4A 4MDPA 4RE3A 3PZ9A 4UOZA 3ARQA 4PYSA 4U5IA 3BUPA 1UD4A 1W32A 3WD1A 4W86A 3WQ8A 4H8HA 4J3TA 4NZJA 3VIOA 4DUVA 3ARPA 2JALA 5E1QA 5DT7A 4UOJA 3WDPP 4AZ7A 2YL9A 3S2CA 3L4XA 4MB1A 4V28A 1MXGA 3AJ7A 1GORA 4FLOA 5DEZA 1V6WA 3AYSA 3OGSA 4H7VA 3VM5A 1QHPA 2ESCA 4F79A 4AXNA 5FCZA 4JCMA 1B3WA 1HVXA 4LYPA 5KEZA 3CHCA 1MFUA 4B16A 3VDAA 3GDBA 3BAYA 1B1YA 2E3ZA 2VCBA 4DM1A 3N1AA 3VX1A 1EOMA 4D6HA 3LPPA 4AD5A 1E3XA 1WPCA 3MV01 5GNXA 1TG7A 2XSAA 1HKJA 1E71M 4B3LA 1EDGA 3ALFA 1HJXA 2WMJA 3VIHA 4LYQA 2J7CA 3CBWA 1E4LA 2D20A 1JYXA 4BZYA 1TQSA 4JL2A 3VGHA 3L2MA 2D0FA 2C0HA 2FGLA 2XGBA 3NSMA 4XX6A 2XUCA 3BAKA 4NXSA 3RIKA 5HOSA 3A23A 3WQVA 4QDMA 1JDAA 4P8VA 5D9PA 1BTCA 1CXLA 3AHYA 5I3DA 2ZWYA 3WMSA 1NOFA 1E72M 2PB1A 1JXKA 1CGXA 5FOOA 1W9UA 5D9NA 3BLBA 2BVYA 3ARWA 1J9YA 4JHZA 1ISZA 2XVKA 1QWNA 1HL9A 3GXPA 2J4GA 5E6YA 1OSEA 3CUJA 3WMCA 1XSJA 3TA9A 1C8XA 4XUYA 1QI3A 3SCQA 2WVTA 3GBEA 2BNJA 5E70A 1UASA 3CZGA 1KWKA 3FY1A 3GH7A 1UKSA 8A3HA 4H8UA 1B3VA 1TA3B 3TP4A 4GINA 2E8YA 3H55A 4YN5A 2XSBA 4XB3A 4KGJA 1EDTA 2XYLA 1ZS2A 1CECA 2G3IA 4IISA 2WBGA 3VNYA 2B31A 1GZJA 4TXEA 2E9MA 2FGZA 1Q6DA 1MWOA 2EPNA 1TCMA 3BCDA 1E0VA 6CGTA 4PCTA 1A3HA 2A3HA 3WBEA 1XH2A 2FHBA 3SCSA 1FH7A 1ZBCA 2WANA 4KGLA 3FHQA 4U5KA 5I78A 3W28A 4ACZB 2GUYA 4LQ1A 1CXKA 3VIGA 3SCNA 1B3YA 4OJYA 1VENA 3JUGA 3OZOA 3KL0A 4W8BA 2QPSA 4MJ2A 3T0BA 1AMYA 4GKLA 1E4MM 3AQUA 9CGTA 2J7EA 1VBUA 2EPMX 4PMXA 3BMVA 3GTNA 3OLGA 3VGEA 2CKRA 2X2JA 2HVMA 1CGVA 3VIPA 3S6TA 3AS2A 4MPKA 4W5UA 2E9BA 2XVPA 1E5NA 3AIUA 3KL5A 2D3LA 3WKZA 2VX5A 1UWRA 2D0GA 3EMCA 3PZOA 1HP4A 2UY4A 2YLLA 4UFHA 1B31A 4PN2A 2VJXA 5AYIA 1M01A 4AIEA 1TFVA 1CXHA 4TUFA 4AZGA 4TOQA 3DX0A 2UY5A 5F7UA 1KCLA 5I77A 4WKFA 4JKLA 1CXIA 1AQ0A 1V3JA 4WK9A 1XC6A 3LPFA 1HJVA 2WK2A 3S5ZA 3ZR6A 2Z1SA 3M6DA 4WJXA 5EMYA 1HF6A 5A2CA 1ZU8A 3TTYA 3MO4A 1UUQA 1WZAA 2XIIA 1CBGA 1HTYA 1UQZA 1HJQA 1EQPA 1CLXA 4JL1A 1ISWA 1JAKA 3VSTA 3BUIA 2F8QA 2XFYA 4PEEA 3VSUA 2RGLA 3AISA 2DSVA 3WMBA 1H2JA 1J01A 1DWFM 2PI6A 4ATWA 1VBRA 7A3HA 1CGWA 3EDDA 3IJ7A 3VDCA 4EK7A 3PZQA 4UQBA 1KWGA 2VNCA 2Z1KA 4DWSC 3DX4A 5KZ6A 1LWJA 1QW8A 1BSIA 1EHNA 2EPOA 4F9JA 3BXWA 2BY3A 1RH9A 1C8QA 3MANA 4EAMA 3WENA 4J3XA 3EYPA 3BCFA 1XGZA 3MV11 3AIEA 3PTQA 1JZ2A 4M80A 3HZ3A 1OBAA 4BQ5A 2V5DA 4W87A 2VRQA 1VFOA 1L0PA 4BQ3A 2BY1A 4P7QA 8CGTA 2BY0A 3OB8A 2C8NA 2WB5A 1TQVA 1ZBKA 2CIPA 2PC8A 3IJ9A 3PHAA 5JUVA 3L4YA 3ZR5A 1W1YA 2W5FA 3D4ZA 4CVUA 4AZBA 1XYZA 3OIHA 2G3MA 5TD4A 2EPLX 1QNQA 4H8VA 2X2HA 2F7RA 3IJ8A 4UQCA 1DWAM 1NOUA 3VINA 2IGTA 3WY2A 1IZJA 4IUGA 2XN1A 3VDBA 2ZUWA 3EDEA 4GXPA 3B8SA 5BXTA 5CQ1A 1WDRA 3BH4A 4ZENA 1G5AA 5A6LA 1UD5A 2CETA 3SURA 3SCUA 3GNOA 1TZ7A 3U7VA 1UHVA 1KCKA 4R5EA 3RMEA 4F9DA 3EDFA 1GJWA 2FH8A 2WMIA 5E09A 4QP0A 5CG0A 2YDQA 1M03A 1H49A 4WSJA 1UWSA 4AD0A 3VIIA 1CWYA 4M29A 3LRLA 4KWUA 3W6MA 2OYLA 3AIVA 1OWQA 4RL3A 4Z2JA 3AZTA 1HKKA 4YHEA 2CBIA 2J7DA 4WLCA 3W24A 5EB8A 1UQYA 3AYRA 1FFQA 3N11A 2VQUA 3MUY1 1CXFA 4ZFMA 3A4XA 2D2OA 2YDRA 4PSPA 2O9PA 2BS9A 1HIZA 3DDFA 5JIWA 2WMIB 5CGTA 3NDYA 3WN6A 1B90A 3CUHA 4NSBA 4PSRA 1J0ZA 1IT0A 3AHXA 2XM1A 4NI3A 4PMOA 3HU7A 1HJWA 1VB9A 3HG3A 1W1TA 3RPMA 1V6UA 3OLIA 3BAIA 2FE0A 1OD0A 1UYQA 3RO8A 3ZM8A 2Q8XA 4MNKA 1Y7VA 3GXFA 2ZX5A 1K9DA 4DUWA 3CH9A 2G41A 4ACYA 1M04A 5HNNA 3EJRA 1K9TA 2WC3A 4MNLA 1XCWA 3WF2A 1C90A 4QAWA 5IXEA 5GNYA 2Y4SA 4B15A 2QMKA 3WH9A 4FLQA 2OLHA 3N15A 1JZ5A 2ZX6A 1BYCA 3ZQ9A 4U33A 1BYBA 1JNDA 1VEPA 3AMDA 4JHOA 1JDCA 4W5ZA 3M07A 1TR1A 2D22A 4NXKA 4U3CA 4MB3A 3MS8A 1SMAA 1KXVA 3DHPA 1U33A 2MANA 3SCOA 4ATLA 4CUCA 5FL1A 1WDSA 3MSGA 5CPQA
chains in the Genus database with same CATH superfamily
2BOFX 3GUGA 3LB6C 4QHKI 3LGDA 2AQQA 3IV3A 1IGCL 5LA1A 4NUWA 3DSNB 3KG5A 3MJ8A 3WJZA 1TZAA 1MEHA 2QUTA 2VEPA 3H1ZA 1SLXA 4P8QA 3PREA 3IJEA 3B9EA 2BW5A 3CN1A 3O1NA 4R85A 1AFSA 3PWVA 4MJ4A 2UZXA 5HHXL 2XVNA 1Q1JH 1MKFA 3APCA 4FNRA 3VRIA 2OLDA 3GIVA 5IZ7A 4MDRA 5BXPA 4J2PA 3CT7A 2EDLA 1DJHA 3LI1A 4ERAA 2UZYA 3PAUA 3LEYH 3QULA 4YMZA 3QYNA 4N0YL 4XQ6A 4C83A 3GG7A 4GKOA 4NOFA 4ZO9A 2F7OA 5CGYD 4O02A 4J35A 5BQ7A 1W6TA 2D23A 1CLOH 1H4PA 4LSBA 5DJ0B 1BQHG 1CFTA 2NY1C 3QJFB 4U6XA 3VYNA 5B38G 4I7WA 1W0VA 1J8HA 3M0KA 2YGOA 43C9B 1NARA 1E4WH 4IK6A 1AD4A 3ETBF 3IIZA 2J7FA 3KRSA 1YEIH 2CKBB 5E9AA 3GKWL 4AY7A 5KN5A 5J12C 5BOZG 5ECJE 3BN3B 1IGCH 3MGAA 5I28A 2B4GA 4TVPE 5LA2A 2WP3O 1YNLH 1NOWA 3RM4A 2YXVA 4CCEA 4MYWB 3KRZA 1VJZA 5DT5A 3NVTA 3W76A 4F0HA 2WSQA 4FDWA 4R96A 1XQ4A 2HFGH 2J8TA 1F2JA 3OQEA 3TWAA 1PX8A 4JGUA 2RGSA 1N4XH 2D3NA 2XWBA 1P4UA 4PGEA 4N3TA 4DFHA 4DP6X 3CUFA 3TV3H 4G80B 3MTRA 2VC9A 1FL6A 4O28A 4K07A 2LAAA 4XVJL 4QKXB 3V0GA 4E9WA 3OA3A 2HJPA 3TQPA 1X9RA 2A6DA 2KLTA 4LV4A 2OP4H 2F84A 3TX9A 1MCRA 2B7OA 5SWUA 1CC3A 1MQKL 1KCRH 2WOBA 1DVFB 4X42A 1E0WA 2QCHA 3VIFA 3ZDXE 3L21A 2K1MA 4XP1L 3CSFA 2NZIA 2KMWA 4TSBL 5G5DB 3FO1B 4WI7A 4FI4A 5J04A 4WEUD 3T3PE 1FJ1B 3L2LA 5TK4A 5D8JH 4KX7A 1DUZB 3S5LB 2EILB 3QDGA 4TUJB 1TQWA 3OVPA 1S2VA 4W9TA 4HWZA 4U1GC 1T04A 2WINB 3W9EB 2X4OA 4L37A 2DFAA 2ZXGA 2JIWA 4MLJA 3YPIA 3PBYA 1PE1A 4FHAA 3R4IA 2ZA3A 2QJDA 4QO1A 5T91A 5D2LB 2VDIA 5INCB 1TV3A 3IUDA 2XZZA 3FN3A 2FO8A 1U93B 1EAPB 4ZMOA 2DSKA 3FULA 3QQ9C 4H26A 3EDKA 3FT9A 1W2VA 4YDJA 4Q9CA 1KBWA 2R4SH 2W94A 4XV0A 2NVAA 1ZNNA 1HOCA 5I1DB 3NJMA 1TRDA 5DZOA 3GNDA 1QW7A 1VFLA 1JUFB 4XNZC 2I56A 2JTDA 2ZYRA 3FAXA 1E7VA 2BSDA 3W1NA 3VKJA 1GYLA 3TN0D 3DPBA 5H6HA 2DZPA 2FCBA 3VXRB 1HILA 4KK9C 4BZ2A 3CIWA 2ZUUA 4PREB 3PBMA 3THDA 2XC8A 4DKFL 1OX4A 3UU0A 3G6LA 1U42A 4OAWB 2GTWA 3KXFB 1F4AA 1SVBA 3H4GA 3P80A 4UMAA 1KB5A 2H3XC 4LRNH 4YLCA 4LSTH 1LRQA 1WBJA 1JPSH 2KS0A 3A9IA 4RWYH 1KGXA 3ILQC 3GRWA 2ZZ2A 1N3NA 3UTOA 3MRMB 3RVXC 4R4BB 5I3JA 2A6IA 2HK1A 3OO2A 1KG0B 4MVBD 4HWEH 3HNVH 2JCCF 1RZMA 1RUAH 3D51A 4AHQA 5A8OA 2Q76B 1S1RA 1XPYA 1E50A 2A6KA 4GQQA 2OR9L 3GXMA 3ZE0B 2OEMA 4E5XB 1KEGL 5FK9B 2F8VA 3DJRA 3RU8H 1J8VA 1UWAA 2DZWA 3CTLA 4CBPA 2PLJA 1A7RL 2XRAH 3WXVL 2BSLA 1ZVSA 4L64A 4RV8A 3S9ZA 3PK7A 5DZLA 3QJZA 1Z66A 5SX5K 5J56B 4YE4L 1LUCA 2HJKA 1BF2A 1NWRA 5GJTH 4XP5L 1SFJA 1YDYA 2J47A 4F2UA 3PWPB 4UB9A 2E9GA 2PTDA 3FQRB 1SM3H 4AM0B 2QULA 1V6YA 5EFIB 3LYEA 4AQZA 2R4SL 2PU0A 4RWYL 4HKJA 3N1MC 4HJJH 3MODL 4B7LA 2YXFA 3D9AL 1ME8A 3QHNA 4I8DA 5EA0L 1ZTXE 4Y9BA 2VR7A 4ORMA 2VXQL 1J5IA 3HPFA 2NNRA 2QCDB 1AK5A 1WZKA 1WG3A 3WF1A 1LTDA 4JIQA 3LIZA 4KI5E 5CAYB 4IBWA 5DVNA 4FOJA 5A2JH 4PUNA 5G5IA 3V4UL 3R0MA 4K8HA 1BA9A 3M46A 2GPTA 1MY5A 4AGNA 3QEQD 2FZ9A 2Y07H 2IV9A 1E9OA 3J27A 4QRSB 2MUCA 3CFEB 4OGXL 1CT8B 3FLUA 1XXDC 1AXTH 4W9ZA 4P3CH 5GGTA 5K9JL 5LBSA 1XZWA 4UDTA 3DTXB 1LQ0A 1Q6LA 2LU7A 3LRHA 3EKCA 1B3ZA 3LZRA 2ZG2A 4B96A 2X10A 3PB2A 1DWJM 5E2JA 5JMUA 1ADQA 4UQ3B 1ED3A 2QSCH 4LUJA 3I10A 2DT0A 4NP9A 5B39A 4WUUD 3M6YA 5I6XC 3RU8L 4OV6F 4PGLA 3TSDA 3M88A 2ZOXA 4OZFG 5EA0H 1JPTL 3ZMEA 3A3HA 1MVUB 4ADSA 3N04A 3KS6A 3PAOA 3LNPA 1Z3NA 3HGRA 4OD1H 4AIOA 5FJTA 4N2FA 4A04A 1SFHA 2XYCA 3H7RA 4GLEA 3MMTA 2F15A 1EF2A 1UZ4A 3VOIA 4HGKC 1M6UA 4ZDHB 3W4RA 3MUHL 4NN6B 4BGLA 2GWNA 4U6YB 4KUZL 5C09D 2HVKA 2W07A 3QGVA 5AUMB 2GFTA 3RB5A 1QI0A 5EZJB 2OT0A 3WU1A 3OYZA 4K37A 1JI1A 4Q4IA 4AV0A 4HQQH 3BZFB 2VN5A 3BVUA 3FJTA 3RGBA 1YDPA 4DW2H 2E5BA 4WU5B 5T3ZD 4W9EC 3FNDA 4L0ZA 4AQ1A 2Z6JA 2ZUXA 3W7EA 1BQRA 3P4MA 3WL0A 3KVPA 1PEWA 3DG3A 5AD0A 1L9PA 3MMUA 4Q6XA 4UQ9A 2K78A 4GRMA 1B0GB 4GB9A 3HPLA 3EJUA 4LLVA 1X5FA 1U92B 4EUPA 2A77H 3T0EE 1TCDA 4FXJA 3IXTB 2EPKX 2PDUA 4KXCA 4U1JB 3UG4A 2DDQL 5BJTA 3ABKB 2EGZA 5LHEA 6PAZA 4LOUD 3PY2A 1E70M 2HJFA 1J5OL 4CKQA 3ARDA 2AQPA 3NRFA 1H5YA 3J7HA 1AQKH 1ZD6A 4RQQA 4GNKB 1TZ8A 3WJJC 3U36A 4C54A 3AZUA 2YARA 5C0QA 3N85H 2FLBT 2YPVA 4XPTH 1HKLL 4PRWA 4NPYA 4YHNB 2X1IA 4HQQL 3S83A 3OR7B 3SKOA 3Q13A 3BIKB 1KACB 4ZMNA 4V1DD 2ZXQA 3WQPA 2XVBA 4FKEA 4PJCF 3TBYB 4EVZA 3QXTA 1GOGA 4JRXD 4MNHB 4X8GA 1JXGA 1OIFA 4OTXH 3T09A 3MP4A 1H3PL 1HIMH 2W81C 3DPDA 3F6LA 4Q8VA 1R34A 2Y9RT 4A35A 3L7RA 1CFNA 4M6AA 5CN2A 4J6IA 4DK5A 1VRDA 2E6DA 4O8AA 4BK5A 2XJ7A 2PDWA 4Q6JA 1HZKA 5FAJA 2XN2A 3I84A 1H1ZA 3V10A 2ZA2A 4ERSL 1TQUA 2EO9A 1P6BA 3VE7A 2OMYA 1BOGB 4B9GA 3BP7B 3VQ2C 5AKTA 4N8PA 4RFNC 4XBGA 2E5CA 1YY8B 2ITDB 2OMWA 1RAMA 1T0MB 2AGJL 4RGND 1I7ZB 2NXIA 4GACA 4Z7QF 1NSJA 2XFFA 4LT9A 1BJ8A 5GHWH 3VH8A 1ZT1A 2IS7A 4C1NA 2BH0A 2H0FA 4QITA 1UZ8A 2C34A 5DMIH 4MTVA 3GBNH 3SSGA 1O68A 1CF1A 3MLSH 3MNVA 1FZKB 3HFMH 3JWDL 1AIFA 4KFZC 1KLFA 3RIFF 2CZVA 3L48A 3X12A 3RJYA 3RVVD 4S10A 4DN3H 5G4EA 3E6FB 2R23A 4FHJA 1I3RA 1KD0A 2ADJB 4Y2OB 3F62A 3CQFA 3ZE1B 3V4LA 3MJ9A 3KVMA 3HZKB 4JFFB 5GJNA 1IAII 3G0SA 1F11B 1VFUA 1K5NA 1G7LA 1ID5I 5FKPA 5ITFA 4R0LC 1XM3A 3A4JA 3LD8B 1HKVA 1UD2A 5AB1A 5D9SB 4OSUH 3ZTDC 3RX4A 1BPLB 4QNPF 2Z4GA 4C6DA 1Q0XL 2V3FA 1AVAA 4KXDA 3C9NB 4E8GA 1L6YA 5E24E 4N90D 1M6OB 1X8CA 2XT1B 1CK0H 4IBSA 4WTQA 5BXSA 1RLCL 2QPEB 2VL5A 1BAGA 5HR7A 4IGBA 4XCEB 2WYHA 3S2NA 4O1CA 1RULL 5E9XA 4Z7WF 5REQB 3C6LC 3L08A 1P9MC 3PAZA 3BLFA 4NRSA 4IL0A 1IM9B 1DVYA 3DVIA 4NU7A 4PRPD 2CDGA 4XPBH 3NQCA 1V7NH 2AJXL 4QHRA 1KF9B 3LS4H 3BZEA 3EMZA 4HMEA 2KPNA 2P26A 5M94B 1KTRL 1VZHA 2GSMB 5CCKH 4GSUA 1XIJA 3MT1A 3BCJA 2PETA 2PCYA 5CPTA 1I85C 5I6LA 3JVFC 3ARDD 4CKVX 5J5RA 2WSRA 4IDJL 1ITBB 2B59A 3TN0C 1TUFA 2GVYA 1QFOA 3BHBB 3W11C 4JIPA 3QUMB 1TKKA 3TJXA 3W39A 3FF8A 1OFDA 3BWUC 1YPZA 5J8OA 2V17L 1GKQA 5D05A 3B2UD 3EJZD 2MTAA 1D7BA 1U95B 2FGWL 2WQUA 5T5FH 1TZGH 4CRPA 7TAAA 3W26A 5FESA 1NA8A 5JYLA 1TV8A 2X9YA 2R91A 3BJLA 4P57B 4U6VH 4ZL1A 1ZVSB 4DAIA 3CJJA 4JDVA 4OZIF 1RIHL 1KJMA 2GGJA 2BFVH 4PGDB 4X4YB 5IB4B 4HH9B 3DG7A 2PCFB 2R15A 1NGQH 4D8ZA 1CFVL 1QATA 5AZ2H 1UCBH 3U7WH 3ZE2F 1RUPL 2BHUA 1SQMA 1QLEB 2AITA 4H0IA 4ALAC 3C6SA 4EIGB 1V6VA 1W3JA 3UH8A 2WHLA 5C7ZA 3WQ5A 2XN9A 2INEA 4PMVA 1MW2A 1I9CB 4HKJB 2WYTA 5C0NC 1A3LH 5DD5L 2ZWNA 3CVDA 4JAMB 4Z8FL 5J13B 3CFJB 3MFFA 1CXEA 4P2AA 4R2GD 2BIQA 4Q4MA 3VWJC 1FAIH 1H8SA 3RPDA 2ZC1A 4GQGA 4TVPL 5JMOC 4W7UA 4B5WA 5IUCA 4Y89A 4PTTB 2MHAB 3LNFA 4WV1C 1OAKH 2WBKA 5LGKA 4JHWL 1EJTC 3LMZA 3P4NA 4IPNB 4V1YA 1UXMA 2BOBB 3INOA 1Q9WB 3OL2A 4YSPA 2OCCB 2X7LA 3BIAX 1W0VB 3LMJH 1EO8H 1W3HA 3LTPA 4R34A 3GR4A 2GK1B 1F74A 1IUZA 1A1OA 1IIKA 3BMWA 4GEJA 4UAOB 3AHZA 4C6MA 2A74A 3N42B 5FOBA 1WNOA 1WWWX 1ECQA 4NQVB 4Z7QB 4FQIL 1PS9A 5J7CC 1CYWA 5HJDA 3UO1H 3VU2A 2G2RB 2PWEA 4O0ZA 2RFGA 3K8MA 4GH7B 3Q9PA 5GS2H 2P80A 4JFFD 4ONVA 3MMDA 3BV7A 1DQJB 1EJRC 2R4RH 2PP9A 1K4CB 3KRUA 1TIWA 5B1CA 2ADGA 2BSRB 5ESVB 1IT8A 1V0MA 1B0GA 4LLVB 5ABZA 2GQ9A 1D5BA 4EAEA 4IPPA 4WR3A 5EU3A 1EDQA 4JZOA 3B40A 4XRCA 1ZE3H 5HI5C 5KBNC 2RDWA 3FA3A 4A29A 4FNTA 3FUHA 2Y24A 3U4EB 3DGRA 1KTLA 1RZJH 4AW7A 1CFVH 3KHQA 5C08B 1EX1A 1GEHA 3AAZB 2I14A 1W6LA 1Y0LB 1DZBA 3LMJL 4WO0A 1I3GH 3AABA 5HDWA 5KWYC 1PDKB 3FTUA 4ODBD 4PS4L 2EE6A 5CC5A 3CBKB 1XF3A 1MHEA 3RVXD 4AQAB 3VW3H 1QOPA 1H3VA 1FYHB 1S9XB 2E7FA 4EP8C 1XF2B 7PAZA 3L17A 5E6UB 1XIIA 2C19A 2XY1A 1G4MA 1M71B 1I9EA 3INUH 4L37B 4PMEA 5JW4Q 1VHCA 4YHLH 2QQNH 2C3HA 3GS0A 5DJAA 3S5YA 4HUVB 5E6IC 3R19A 5HPMA 4C6JA 3GMOB 4GNJA 4H9TA 1QASA 1F5WA 1W72H 2A9AA 4NZTL 3WN5A 1A0QL 2I9TB 1XCQA 4XZUA 2BMBA 5E2VL 5C7HA 5HQLA 3MV9B 1ZV5A 4ZTYA 4AWTA 1ULVA 2J8UF 4FLHA 1NEYA 4B53A 3NPXA 5CBIA 3B0UX 5DMKA 1OPGL 4LSVL 1HX0A 1JR1A 1U3HD 4K23L 2X2UA 3I3BA 4Q6YA 2CWXA 4P23A 1EAOA 1FIGH 3NCEB 3H7LA 2XV2A 2DZBA 3EYFA 4J23A 4DNLA 3BPLC 3DIFA 4Z7NB 3MO1A 2IALA 2V0AA 5LA0A 4XD6A 3VXRA 1BZ7B 2IQDA 5LNDA 4RE0A 4KTDL 2PYFB 3AZRA 4BF7A 1D5XB 4M6MH 4OGZA 3GLDA 1CDUA 1QI5A 1NCDL 3H2FA 2CCLA 1KBJA 4GJIA 4MNGE 3QK0A 3G1DA 2NTFB 4MAYD 3LDVA 4I7UA 5HANA 1KYOK 3QJQB 1BXXA 4ZK8A 2FEDD 3QY8A 1ZT1B 1P2CA 1CDJA 2X4RA 2DUZA 3NR0A 1BYOA 3RL1A 4HPGA 1CLVA 4N20A 2NQLA 4TL4A 3IANA 7ODCA 6REQA 4UR7A 3LKPA 4GMSL 3UGEA 1EXHA 2J6VA 4JG0H 5ERWB 5DHYB 3IETA 2VQTA 2EKCA 3CFBA 3JW7A 5JPNB 1WISA 3BKYH 4X2UA 3F83A 1TQJA 4R0LA 4MBRA 5E99H 1F9CA 1IGIH 2A5HA 5AW1B 4Y2DD 1OAUH 3T1FA 3Q37A 4L56A 1OXYA 1FIGL 3FQUA 4Y4KB 3V0VA 4ZMPA 1KXHA 1US3A 4OUUA 4HHPA 3UGVA 2QQNL 4M8UA 2HJKB 5DF0A 3QZWA 2AI0H 5DMJB 1LUCB 2VFGA 1RVFL 5C6TL 3DETC 3R5EA 5HJXA 2WVVA 5FACA 5E2VH 4OT7A 3ATEA 4J4PC 1FE8L 2Q9OA 1JK9A 4HKXA 1M7JA 3PNRB 2GPZA 2Y2WA 4N0UB 5MKGA 1NPNA 4XX1E 1T40A 2X09A 3VXTB 4NQCA 4JKPH 4G6KH 4J27A 2GCYA 1NFDA 4QXTB 4UNVA 4E9YA 2QGDA 5BXFB 4KEUA 2XG9A 2EKSA 2XFRA 5B21A 2A6JA 2BXYA 1FZKA 2OJ1A 4RNJA 4DZIA 1UWUA 3MV7A 2JF7A 4KTDH 4ONFL 2FNBA 3NCYS 3W1AA 4X6DA 1KW1A 5M3WA 1FORL 1QSFD 3MBED 4YHPB 5KOMC 5HDBE 2AQ3A 3HI5L 1W6WA 2VDLL 1XCFA 2E6PA 5F7NC 4N42A 2YSSA 4Z7VA 3DUGA 4IU3B 3US1A 3U2CA 4MJIB 3RVVC 4PRNA 5I1JH 5L6YL 1K6QH 3E96A 1MYRA 3KM8A 5I3GA 5D9SA 3EZJB 2HS6A 4A38A 2FK9A 4R27A 5ECUA 1VKFA 4F93B 1KXVC 1ZIAA 1RQ5A 4IIQC 4LFHG 4P5KB 4PJHE 1IEXA 2CKNA 1RSYA 2I9LA 4DJMA 5CSRA 1IC1A 3GMRA 1NJ9B 2ROYA 4PJIE 4QEGA 4R4NC 1HAUA 2XXFA 1RV8A 1SSDA 2D7TL 2NY2D 2X4NB 4HLZG 1R9ZA 4AD4A 1RA0A 1L6SA 4XBKA 2XQYG 4RZKA 4L4MA 4KNQA 4HIHA 3H0TA 1NC4D 2HX7A 1IQDB 4F8QA 3K13A 5C9UA 2K7QA 3NDZE 1GAFL 4K7PX 2V9DA 1NIDA 1GG0A 5TJWK 1L9MA 4PRIA 5C0CE 4KQNA 5I24A 3CUGA 2P5EA 5C7XH 3V16A 4HV8A 3NNTA 1H5BC 1R17A 2N0MA 3CHDA 3RRXA 3H9SB 3WDRA 3ESMA 2O5XH 1T1YA 1WHPA 1S9KC 3ONBA 2CERA 3BOXA 1UADC 3DUUB 5GZND 4MCZB 1E28A 2CK0L 4U6TA 3GIPA 4NAQA 3V95A 1RJZB 2OMXB 2X0UA 1TVHB 4NUPA 3OVQA 5KJ7E 3GBMH 3PNZA 5EU6E 1Q4NX 2PP7A 3N91A 2VB5A 3LQZA 5I1LB 2NXZD 3PG2A 1T1ZA 3ZU8A 3FOKA 1SBBA 1BECA 1R3JB 1MAML 3VX0A 3LQLA 3VDGA 4QHNB 4XBPA 2HP4A 3PTDA 2W8CA 3GHBH 4HEPG 3ARDB 4YDLB 4RNHA 4FKKA 1GZQA 4OF7A 4FLRA 1XH3A 3EWDA 3STBA 3RHGA 3G1XA 3LERA 2LV4A 3QPKA 1E9YB 2DYPB 3GRBA 4ZXBA 3TROA 3OYXA 4WTWA 5AVTB 3ZHNA 5C07D 4K5OA 1E0TA 5AN7A 4M7TA 3H70A 4HUKB 3FT3A 3VAEA 4JKNA 3VD5A 4AEEA 4UTJA 5ABFB 5E51A 1OG0A 3JTSB 4RX4A 4OZGB 1EHLH 3MRGB 3HE7A 3F4DA 2ZXAA 5E1HB 3SYQA 2R9RA 1X5XA 3OLEA 4Z9KB 3NO1A 4MS8C 2DL2A 1SJHA 3C4UA 1TF4A 1C8YA 3PZTA 1V5JA 3Q1SH 4MAUL 2UY6B 4NHUA 2EDDA 4GG8B 3ZHKA 4BK5C 2Z8VC 5C8JB 3W85A 2WCGA 1DJWA 5ECVA 5KYXA 3PU7A 3TC9A 4JDTL 1Q7ZA 1DL7H 3MBEB 1PFCA 2ZKHL 2HV5A 4NN6C 1OZTG 2BNRE 3FTVA 4I3RH 2ZPKL 3RWJB 4CGUB 5HPMB 5I66A 1FWAC 2WIMA 4JM2C 2VXNA 1US0A 3S46A 3SCTA 3KAAA 1KFCA 5AL8A 1UWEH 1UT1A 1ZOXA 4RXGA 1M7XA 3CQHA 4BI5A 3EOOA 4A4AA 3MGOB 2VEFA 1E42A 5JOFB 1B6DA 2W4XA 3K4AA 2LTQB 4EQ2A 2P88A 4JHAH 5H94B 1XLAA 3TVAA 2NNCA 3HGJA 5DJ6A 5KS9E 3MRKA 4K71B 4KROB 1AH3A 1NCCH 1DQDH 1RHFA 5SWZE 3W0WB 2YD7A 1M05A 4FXFA 1TWIA 4UZGA 2UZ9A 2GL5A 3G6AA 4B9JA 2H9AA 1V0KA 3KBEA 1TSHA 4KPLA 3LKQA 2G96A 1NC4B 1OLZA 2VUKA 5GGTL 3T8XA 1BOYA 1RSFA 4W5ZA 1NP0A 1UR4A 4ANKA 4OE7A 2FTAA 3B7YA 1RCXB 2CZFA 2WPGA 3A4AA 3A24A 3Q5OA 5C0BE 1Q7MA 3KPQB 5E6ZA 2F5BH 4JY6B 4R3SA 2X4TA 3T0WA 4P4RA 2OOFA 3BQ5A 3CDYA 4CEUC 1NIUA 3FH8A 4P3WA 4Z6AT 1JI2A 2X3AA 1UIPA 4YJ5A 5DWUL 4L3FA 1E0UA 4NWTL 5J9PB 4LJ3A 2FT8A 2Y06H 3GB7B 3UYOD 3LHWA 3ZT5A 3TF4A 4ISVA 4IGBB 5B8CC 2ZRWA 2B08A 2YAPA 4Z2IA 2QFRA 2GGGA 2WZAA 3QMSA 4XD4A 2CDGB 4OT1L 3DV4B 1DHPA 1RBLA 1KGWA 3JVAA 4R7LA 4MHHG 1HH6B 2BDNL 2NLJA 3IRPX 2WVVB 4QI3A 4QRRA 3B9NA 4ZD3L 2VOTA 3DGCR 1TJHL 1DIEA 1XCTB 4NWUL 1MJUL 1TSIA 4D6FA 2EIKB 3L7EB 4TLSA 1PG7X 1GS7A 1FHUA 3NPZB 3QYCA 2FQGA 1QEWA 4PJ9C 1F3WA 1RJLA 3CVHB 3OZ9L 5E5MB 1U8OB 4K94H 3SDCC 1KN4H 3LD5A 1THCA 2BY2A 5F1OB 3ZMRA 3LZ3A 4JZNB 4BH7B 2P5EE 4O2FB 4L9YA 5C0GB 3B5GA 3TH3T 1ZDQA 4UZSA 3SDAB 2G37A 2V2TA 2GOUA 3VCCA 3X1GA 5JPNA 3CV5A 4RZ5A 5LNEA 1XKJA 3SUTA 4JHMA 1U95A 3TPUB 3IJYB 1PYWA 2N0KA 1YLBB 4BFIB 1EJVC 5J6GA 2A38A 3FQUB 2C7FA 3KLHC 1U21A 3O6KH 1F02I 3UTSB 5FR3A 2ONEA 3BW3A 2X89D 4KEMA 1EA9C 4FQCH 3N9KA 3MJGX 4NN7C 2F19L 4RMQA 4PBVC 1XGTA 2V2XB 5DR5H 1NC2D 3ISRA 1Z5YD 1T4WA 3MA7A 4G8IA 1P0NA 3ONCA 2VC2L 2ZONA 3CN0A 2Q0ZX 4RR4A 4B3ZA 3AREB 1AIZA 2YPVL 4B3KA 1KTBA 1T0OA 2VDML 2G0LA 1V10A 3APFA 4WI4A 2AQOA 4O4WA 1RUKH 3ITTA 2YHGA 4NRRA 2J1ZA 3KYMA 3S6CA 3DX2A 4JPKH 3GX9A 2YXXA 2XXGA 4NQCB 3W2KA 1W37A 3UZVB 1INEL 4YHOL 1SN2A 3IXAA 1UURA 3EYSL 5H8DA 2DSUA 5IVXA 4KFPA 4P59L 1AR1B 1GPFA 1T1WA 5T5NG 3RWIB 1MZYA 2PRMA 1KJVB 4GRLD 4WW2B 4L4VB 5HYJD 4U1KA 4KRZA 5HYIA 3PZMA 5AFDA 1A7PL 2VXTL 5D1XA 3GAKA 1M68A 3TJ4A 4ODXB 2ALRA 4D9RE 3I4EA 4NAFA 4LGXA 3HHSA 3SCMC 5JHLL 1BG4A 3JV4B 2J62A 5IQ7L 4Q4QA 1ROWA 3DOHA 2QKSA 1GXEA 1H60A 3BSZH 3OB0K 3KZ8A 4ZQCA 3MRBA 3RAJL 4JTIA 1B3XA 1EP2A 1T1YB 4PTDA 3PXLA 3BG5A 5D2WA 1QNIA 3MBEC 3WNPA 1NQ6A 1OIMA 5AW9B 3C6CA 4JD4A 1N82A 4X4XA 1TDQA 1AH1A 2GDQA 4QNWA 2J13A 4PG9A 2DQDH 4Y88A 2AQ1A 1U3ZA 4BZ1L 4JTKA 1ITCA 1DQML 3GNPA 4HA1A 3H7BB 3N3EA 4PG2C 3L8QA 2OW7A 1QLEH 5I5RA 5EEUA 3LENA 1MFVA 2JCCE 1YEHH 4FQCL 4TNVK 3SCRA 3MDUA 2FFIA 1FWBC 1OF2A 4LSUH 3WD4A 2GUOA 3RCYA 2CU0A 3Q8BA 4GEIA 3AAZA 1C16A 3MQIA 1TUXA 2R1PA 3RTQB 4PJ8D 1Z7AA 4M4RB 3GVRA 4LNYA 1BM3H 1SFTA 3CHFA 3VG9B 5MP6L 4WJ8A 4LLYA 2O1AA 1GHFH 1QR4A 3HRZC 3WEMA 3PHSA 4IQDA 5D2YA 5IJBC 3T71A 4XZ4A 3M1OA 3ZR4A 1L9RA 1MHHB 3EBVA 1U58B 2NQDA 3WQWA 3TYDA 4Y2DC 1KSRA 3UIZA 4DKEL 5F2MA 4TKWA 1AG0A 3JUZA 2O6EA 4Z3JA 1ANUA 2ZYSA 2G5BA 3LU2A 1QPPA 3WN5B 3QOKA 1SW7A 4OHQA 5AB2A 2XN9D 4NCC1 3EOEA 4LAMA 3STCA 3FT1A 1FHVA 4HWEL 4OKVA 3HNVL 1NQKA 4OF6A 5L8LB 1R6WA 4O15A 3VXRE 3GRWH 2F54D 2Z93B 1TSRA 4PD4J 5TE6H 3O9NA 1TQCB 4B7IA 2PP0A 5EZLA 4JRYA 4LSUL 1XRSA 2X1TA 2G9HB 2DLIA 3VVVA 3MRLB 3KCLA 4KRUA 1NMCB 3H2CA 4JFEB 2IALB 3S88L 3G22A 2E6QA 3DIFB 4U1IA 4XMWA 4BK8A 2QDVA 4DP1X 2Q09A 3CEUA 2EIEA 1G7IA 2OZ4H 4O16A 3E6HB 3EX2A 2H90A 1D7FA 3TTQA 3TS8A 1DZ0A 2JFCA 5DD6A 4B95C 2YCJA 3NM1A 3AU1B 2CIKB 3HF3A 3BD3A 3TIMA 5CBJA 1NC2B 4MMWA 1WZLA 4QYAA 2DBLL 5D7KD 1N64L 5DZVA 5GPRA 4MA7L 1X5LA 5KOVC 3ZX1A 5GS0D 1JCYA 2V5LA 2EXOA 1SZFA 4PR4A 2CHDA 2OX5A 2ZE3A 1FOBA 3C08H 3PNWB 4GBUA 2C1PB 1KCRL 5DC0A 1J18A 3BLKA 4HOZA 2AXWA 2ZUYA 3NJIA 4HUXB 1E2WA 2P4AB 4G43B 4M3HA 4HXBH 3MUUA 3VTMA 4N2DA 2CXEA 4PWFA 2VDOL 4QCIB 1P4LA 3CCHA 2OZ4A 4MJ5B 2IKIA 2AKMA 4ELME 1O6IA 3WMPA 2ZUMA 4M1DL 3VFTA 3VXSA 3Q8CA 4IWWA 3RY6A 3IK4A 4PV9A 4PTUB 3PWLB 2K8MA 3S34L 5GQBA 3FGCB 2UBPC 3PL6B 2X4OB 3WQGA 2GJRA 1T22B 2K8QA 5LNRA 2G3ZA 5HDRA 3LHYA 5HPOA 5KYYB 5G1MA 5B8CA 1DJYA 5F9OL 4HPNA 2EEXA 3DUSB 5F6HJ 2QUNA 3EBIA 3VFCA 5KVDH 4A2EA 1BOGA 4LCWA 4UOW0 4F80A 4ACZA 3G08A 1SW3A 4IKLA 5FYJU 5ITBL 4K68A 2KLSA 1KDIA 1U3NA 3WJMA 4HT1H 2GJLA 1FWWA 3R89A 3O6CA 1UENA 3MUXA 3WTVA 3GNML 4ZBCA 3BUDA 5JU6A 35C8L 5KW9H 4CA4A 2V8MA 3S96A 4X6DB 2FR4A 2CO6B 1BVOA 1FNFA 1BBJA 2BSED 5IIEA 2NQCA 3AGWA 2B4CH 3BQUB 4JZJC 4KZ0A 4OJCA 5ICZB 1BZ9A 3MNMA 2OQYA 3R94A 3L13A 1TU2A 2VR3A 3ISYA 3QORD 4QRTA 3SQRA 3Q2NA 1KB5B 3KVDD 1DN0B 4B9IA 1UWFA 1XBVA 2VX6A 2HZHA 5KBPA 1KXQA 2FB4H 2GITA 3QWNA 2HH0H 3HG2A 3V0AC 2E7DA 3FO9A 3BK0A 3TBCA 1CR9H 3FRUA 3DO7B 3C5ZD 2EDHA 2XFXA 2UV8G 4HXBL 1A1MA 3CFDB 1X7QA 1T4KB 1D9KA 2Y72A 2P5WD 3FO2A 3NZHH 4KK8C 4NZUL 2E8ZA 3GSQA 3WUBA 1W91A 3ZE0E 1F0LA 4FB7A 3BGJA 4YFLF 4XPGL 3GLEA 1Q38A 2B9AA 3BUYA 3RUGB 3OMAB 3QFJA 4ZTEA 1O7AA 1FL3A 1DANU 1UJPA 3LNDA 1CW2A 3NQMA 5F93C 5I1HH 2CZEA 1R0MA 3BZJA 3KPRE 5G2IA 5AZ1A 1AYRA 2R8SH 4DXXA 2KI6A 1EYWA 3PWPE 2RDTA 4XNUH 2DRUA 4K0OA 4N9BA 5HVWA 4ZEPA 1H1YA 1N0LB 1BG9A 3TW6A 4HS6A 4JFED 5ISZD 3TCLA 1TMCB 2FL5B 2YBGA 4EDWH 3NOYA 3P5YA 2VJ8A 3N43B 3MBXH 1SBSH 3FCSA 4ZNEA 2A73B 3UZVA 3O41A 1CNVA 1IFHL 4WY7H 3GJEA 5IEHB 4UUJB 3DFHA 3IF1A 3KVQA 4LEQA 3NPSC 3GC2A 4F20A 3BDKA 35C8H 3G6MA 3FTYA 3QNXB 3DIDA 4Y19B 1MFCL 3BE1L 4ICXA 1HCZA 5FS5A 2OKOA 4ZNCD 3APNA 4P5SA 4Z5RA 1RA5A 1E8XA 4AYID 4PJ9D 4ZSUA 4X60A 4WSKA 3W7DA 2IIJA 4W9DC 3C8HA 4JM2D 5I1HL 1QPNA 4KNSA 3ZKQD 3O0KA 3ZTEA 3KS0H 5K9JH 1GZPB 1J87A 1YPZE 2ZUSA 4KCVA 4QQUA 3LDBC 3S37L 1T99A 4P2VA 5I06A 1GTEA 5HHOD 5AW2B 2CH8A 1IEHA 3KYOB 1ZHBB 3ORWA 4AG0A 2W92A 4O5LH 2NX5D 3NZHL 2AEIT 2MJWA 5CEWA 5AYUL 5EO9B 4DJFC 5EOTA 3BJFA 3GO1H 2NYKA 1SY6H 1DVQA 4M03A 4H44C 5BS0B 3DH7A 4LFYA 2R2CA 5D72L 3W25A 1LK3H 1UH3A 2EKGA 5GJMA 3FF7A 3BC9A 5DLMH 3QIBA 5D5MB 2M26A 2OTPA 1TRIA 2VVNA 4HU4A 4U3AA 3SE8L 4R33A 3OAZH 2V82A 2CCWA 5FW6A 3HC0A 2KYIA 3MLSL 3HFML 1RQEA 4AX7A 3WEXB 3GSRB 3PB0A 1H1NA 3BYYA 4BKNA 4NAFB 2KQMA 4MDIA 4F9LA 1NAMB 3TYFA 5DT1H 2QCNA 1ES0A 2HNEA 2Z27A 2Y0SA 3OQ3B 4H13C 4OFCA 1ENUA 2VLRE 3IGLA 3AICA 1E51A 25C8L 4WY7L 2XFGB 3W53A 3LV6A 3S36L 2Z92A 1IGYB 4K9JA 1HL8A 2QIIA 4GBDA 3RCNA 3PWPD 4NP4L 4AQ1B 5CD5C 3NXFA 1JFQL 2QR0A 1P4BH 1Q0XH 2G3JA 3BSMA 3DOSB 1D5RA 1FWCC 5I00A 1AXSB 4OQTL 2E4FA 5D72H 4YBQC 4G82A 1ZA3B 2DDQH 1PSKH 1JXFA 5IFPA 1WUZA 2EEAA 1ZAIA 1EAQA 3FB6A 2DGAA 3UTZB 4F7TB 2C15A 2XKNA 3LVTA 2UWEB 1WFJA 3CN2A 4WK2B 1JV5B 1JFXA 4NQ1A 5KS9A 4K2UH 1E8WA 3SDCD 4C91A 4WENB 3G6AB 4HXAH 5GSRA 2ADFL 3SYAA 1EZSA 3SZKC 1DE4B 4UQDA 3L1EA 3EJSA 4LOUC 4LVNB 4AD3A 2WXRA 3GD1C 3ZL1A 4F2EA 3LV5A 3OSVA 4AJ0A 5C0BD 2REQA 3V5HB 3SE8H 4S0HA 1II4E 3MRPB 4URTB 4G2AA 1I7TB 1AE6H 1EP1A 3GHPA 3CXDH 1LO4L 3MLTB 1FWHC 3RY6C 1WBYA 1M7UA 2VABB 5B39G 1X1NA 3H3PH 4V2BA 1RXOB 4IFRA 4U0RC 1G1OA 1SJMA 3THQA 1VSCA 1Q1PA 4HZMA 1CLOL 4MDOA 1WAWA 5CJ8A 2FBOJ 2NY7H 5DRXB 2A4EA 3P4OA 5GGRB 3T0EA 1I1AB 4GYKA 3OHXB 4KF1A 3W1UA 5HNTA 4DF1A 3REWB 4X6BA 4XCCL 3TLQA 2J75A 2RDUA 1ZZMA 2CC0A 1RLBA 1K6WA 3GKWH 1VCAA 5FA4B 3WK3A 2BCMA 4GT0A 1UCBL 4CSZA 4AH2B 2JF6A 3SE3C 4DWSA 1NGXA 1MI5A 2LAGB 2XV3A 3QUKA 3TUUA 1QEWB 3LGGA 1A9VA 3BT0A 4P8XA 3OWEA 3B4UA 1PG7H 2JGQA 2Z64C 2C0AA 4GWEA 3AGVA 3HN3A 1O6TA 2HLAB 3S1GA 4IYKA 3N2XA 1FAIL 3NGFA 4O02L 3V5FA 4FQJH 4QS6A 1XGUB 1NBYB 4YH6A 3GT6A 3OB0H 4XZIA 1YEJH 4X7CC 1EIBA 3WJJA 3EO9L 1PJ9A 4WVXA 3AG3B 1MNZA 1OQOA 3KDNA 4M5YL 3TXVA 4Q58C 4AD2A 1N10A 4B5XA 2FT7A 1WITA 3S42A 2E9WA 3QR0A 5DZNA 2J27A 4O1AA 2P80D 4B9ZA 5I19L 2HG5B 2KZHA 2Y5TA 2RGMA 4X8CA 3MA7B 4G8IB 4M5ZL 5HXMA 1MDLA 4UBPC 1KFEA 5D8JL 5I17A 2GITB 1D6EA 5LUMA 4XMXA 2EYTB 3FJLA 4C56D 4JUSA 5IMOB 2DV0A 1MQRA 1PF3A 2YS4A 5JW5B 5KSBA 2ZX7A 3BLLA 3LTYA 4YDVB 3N4FA 1JPGB 2QPFA 3RGHA 1I2OA 2HX9A 3DI1A 1P7KA 4Y6GA 5E6IA 3P82A 5F2GA 3AWEA 1EB3A 4NIYE 4EPSA 1RUMH 5I2UA 4L1TA 2LQRA 1K8CA 2J7LA 5AAMA 2R0KH 2GVLA 2QCDA 4HK3N 1S7RB 3QEZA 4CNUA 3TVMD 3QWRA 3VXTA 3ZT7A 1GTFA 4G8EA 1DEEA 3W7RA 3D25B 1UKOA 1U8LA 2C3GA 3CXHK 3UYPA 3X13A 1JYVA 4ZR8A 1U8HB 4WHYH 4MZ8A 5AFAA 3SJ3A 4J6RL 1EF3A 3APGA 3TEVA 3PPSA 3NJVA 1S39A 1TMHA 3L1GA 2ZYIA 4H0LC 2CLLA 4FXTA 5BCAA 1WTLA 6XIMA 3L9CA 1JGVL 3PV6B 4I18B 2I16A 2HRLA 2ICWJ 3FCSB 4OF5A 4NQEB 5EIVA 2Q3ZA 1NU5A 4KWVA 4R9XA 1OW0A 5BUGA 5F7DB 3ULUC 5DBTA 3S6DA 3HC3H 4UB0H 4MDJB 4ODSL 3VCLA 3MA8A 4FXLA 3G1YA 4JFZH 2EEFA 4I0CC 4V1DE 1AD0B 1ML0A 1VADA 4RSVA 3EOSA 3K30A 4NJ9H 1WAAE 2E7MA 2FHFA 1O6SB 1RV6X 2VZTA 5TQ0H 1ZLSH 1L6ZA 5FJOA 4W81A 4RBPK 3DEQA 3OOQA 3FQ1A 1UGNA 4L61A 1T7WA 1AC6A 5J8LA 5T33L 3T4CA 3WLJA 2I9LB 2C9UA 2OV0A 4HUNB 2OI9B 1RR2A 2R1WA 3AXHA 4WK4B 3LSCA 1NJ9A 1VFMA 4JFQB 4Y4HA 5EU5B 3N3MA 4OF8A 4Y2WA 4V2CB 1KLGA 4ZAKD 3PGFH 2PDKA 2VMEA 2WY3B 4MMXA 2CLHA 2BNRA 3AXLB 2D69A 1XSKA 5IVNA 5IW3A 1HEJC 4PUEA 2DIJA 3ARZA 1FHLA 3BX7C 1LF1A 3C2YA 3R79A 1JGVH 3GBLA 2QJIA 2ENPA 4UDUB 1A0DA 3P2DA 3BQ6A 2A1WL 1RUML 2NW3B 4LF3A 2PPCA 5H2BB 5BS0A 1FXQA 3OG2A 5LGXA 3OA5A 2R0KL 1YMMA 3NMEA 4KJWD 4NENB 3LZ5A 1HYSD 3PAJA 3VKCA 2HT4D 3R1GH 1OGTB 1HNFA 2FSDA 4R4FH 1ZLSL 3RVUC 2YBVA 5FF4A 2VR8A 1K7XA 1RVKA 3GK8L 4UWMA 3L95A 4ODWB 5DVKA 4R97B 4R88A 1KC5H 2W67A 4LUYA 4N9GB 1C12B 2I7SA 5B22A 4LH8A 4DN4H 2WSKA 2WJDA 1FZOA 2F18A 5C97A 4ZS6D 5DJ0A 2BSCA 2BP8A 4JGMA 4U7MA 5JQ6H 1IGYA 4N0FA 1MZZA 1KY7A 3SDDA 3UG3A 4RNFA 3HPJA 4AGMA 1DJQA 4ABWA 1SZGA 3HN8A 3ZFHA 4KKPA 1BXUA 1J0HA 4U6HB 5EBLA 3VE0A 2O4QA 4BE5A 2P8PA 1E6JH 3WTTA 1CD9B 3ARBB 4G11A 3FMGL 3Q01A 2VW7A 5GRJH 4GAGH 2QSQA 3EW3B 4QJ4B 5IT2L 2VCCA 2ICEC 2P5WE 2OMVA 3SO3B 1C3FA 4K8RL 1Z9MA 4G6CA 3QIUA 3IJEB 3SUVA 5JHMA 1WA3A 4GC4A 4XOCA 3DMMD 1NCOA 3EFDH 3UYCA 1JZHA 5FWRA 4KNTA 5E1GA 3WEXA 2DYRB 4BKTC 1M53A 3S5NA 1IC4H 1Y6MR 1TE1A 2FWOA 3HBGA 4NSKA 1ZSDB 3M1CA 1V7ML 1ZJAA 2GTZA 1LZOA 2VX4A 1VH7A 5A1AA 3HI6L 2BOCA 1SDYA 1BMZA 4W68A 5K1JA 3NZGA 3UDWA 3FGCA 4K3HA 5MEOA 2CO7B 3SJVA 2R83A 4XC3L 4HK7A 4PMDA 3VD3A 3CVBA 5C92A 5CSZA 1NGYB 3QEGL 3GTXA 1XCQB 4XZUB 1VZIA 4AGQA 2XHYA 1GC1H 4IKNA 4AAJA 2ZAHA 1A5KC 3AXXA 5HGAA 4JXCA 4I1NB 3WXWL 3O6MH 4HF5H 4K23H 2Y3NA 3WJMB 1UWXK 4MF4A 3U7YH 3BGMA 3IMUA 2PYEE 2Y6SD 3ASNB 1ZGLM 4GLRH 2ZTJA 4EOUA 1DBML 2H3KA 2XKNB 2YGQA 5DEFB 1SSGA 3RR4A 1RVGA 4PJHA 4YVNA 3VGFA 1C8VA 1F6AA 4BH8A 1VD6A 4HVXA 4YDJB 3M41A 1PL3A 1I4NA 1UKQA 2MWCA 1CCZA 3FCUB 4U1LA 4XVOA 3FXGA 3T40A 5FHBL 1QTPA 1R0AL 1JQXA 3D12B 1X6LA 3EYVA 4PCFA 4ZTPL 3J8F7 1Q1JL 4NPKA 2CLIA 4D1IA 3HR5B 4HOXA 5I15H 1KM6A 4DNMA 3QUYA 5BMXA 3NIGB 4TUUA 2IH1A 4WUUB 4PBGA 4LBEA 2W1NA 4L8SC 3NUKA 5FJJA 3ELQA 3GFZA 2J8GA 3UTPD 1X1ZA 5KVEH 1XIBA 1SLUA 1TPH1 1ETZB 1HJUA 2PBOA 4NZ1A 1RK7A 1DUZA 4FI8A 3S5LA 1F6PA 3R7RA 1LG2A 1OX4B 3ULVH 2PODA 3EXSA 3OR6A 3FCTA 4FXRA 2EJAA 4R7DA 4W4QA 4F2TA 1XGPA 4IPIA 1TJ2A 3A6CL 1XIWC 3V0JA 5HYSA 1D2OA 2O56A 3PP3K 5TH2A 5A7EA 4PJXB 3WIHH 4Q8OA 2BVTA 1UT9A 3HE7C 3ME0A 1K85A 3VPLA 1R3WA 3NM3A 1CL7L 5FOJA 3D8MA 2GC4C 5IFHH 5J9PA 3P1VA 4AXWA 2E40A 2PWVA 2VM8A 4PWGA 3G77A 2VRKA 1GOKA 1JS4A 1FE8H 2FTYA 3AMCA 2E59A 5J13C 4LMQI 4PP1C 1KRAC 1PYMA 4UMCA 3VM7A 4PI0A 4OQVA 2WJ7A 3VFUA 4NGHL 4OOZA 3DFNA 4QTGA 4URIA 5KTLA 4PRPE 1UG6A 1IE4A 3QO0B 2B59B 3PM6A 5HJ3A 1QNOA 3U7BA 3MLWL 1AFVL 1PKQB 3K2IA 5IG7A 3DETD 1G84A 3GQYA 2YD1A 3ULVL 4PYGA 3P61A 2WWCA 2EKSB 2YEZB 3D9AH 2GTWB 1XGUA 3ZLFA 4A63A 4P5TA 1JZGA 4WFFE 5D2TA 1U8OA 5F2IA 4C8XA 2A3TA 1XLGA 1WVZA 5I15L 4HZ8A 3P02A 4R3UA 5MERB 2VDPB 3W2LA 4LSSL 2XWTA 1MDTA 5C86A 2YD0A 2EQDA 3F12A 3QUXB 2FYVA 1O0VA 4LK4A 2PYED 2GQAA 3GNXA 1SJVA 3K81A 4ECNA 1H41A 1DQKA 4ZMTA 4K6AA 2H1LM 4JRXB 6ALDA 5F7DA 3C6SB 5I18L 1Q2SA 3O6FA 3A21A 3NGBB 3MXWH 4E68A 4N1HB 4C47A 3ARXA 2NT0A 4P5KA 2X4SB 4PJGE 2N01B 2FJFA 1AD0A 3DSNA 2Y1VA 4ZTOL 3MFGB 2NZ1A 4QD2E 3ECVA 1IAIM 1O5XA 1C29A 3RJQB 1KYOJ 3SEPA 3TMQA 2P8LB 3TAOA 4P4KB 3BWSA 1UD6A 2YEQA 1L3WA 4KKLC 4UTAL 1RQHA 3L2NA 1FLTX 4H1LH 2UV3A 3X11A 5I16B 4PRDB 5TQ2L 1IC5H 2Y0FA 3H4HA 4YNYA 3EH1A 3E3HA 3U2ZA 5AC8A 3AACA 1YKWA 3ZDWA 2CA4A 1YC7A 2DJSA 2VIRA 4M6QA 4NNCA 1DBJH 2PF0A 3DRQB 3FFSA 1QSVA 3KVJA 3ZOAA 3WN5C 1V7NL 4CU6A 3RX2A 1FP9A 2IDUA 1TTBA 5C0RH 2FHCA 2AW2A 1FFOA 1GJUA 1X7TA 1ISYA 3C8NA 5HQEA 3RX3A 1IZCA 4A3UA 3KGRA 4LU5L 5EO0A 1B2WH 2VLJB 1TETH 4OB5L 4TNVF 5D7JC 2PA6A 4ZQPA 2ICWA 4I7ZC 5G1TA 3GDKA 5B7FA 3U5UA 2X2IA 4KQ3L 4BRVA 5IOPA 1V3IA 2CYGA 3NL6A 4YXGA 1A14L 2AABH 2V7NB 4B60A 1LTXA 3CTTA 3QR3A 1VZGA 5CD3A 5L2JB 3ALWA 2YL5A 1T0NB 3D85B 3EG9A 4OIFA 3UF9A 2H32H 1O12A 4QS5A 1EGZA 1VPXA 2RIKA 4YZWA 2XZCH 1OCOB 4LASH 3T4AA 1RUQH 2P0OA 5IJVA 3N4AA 1IEAB 3O3AB 1RD6A 3MXWL 4F2ME 4GIEA 5A2AA 1RPKA 1ZTMA 1H7PA 2X2GA 3WUWG 3BANA 1L6GA 4PH8A 1REQB 5U7SA 3U6XA 4M81A 4MAVA 3GFXA 3UZEC 4EPEC 5LIXX 2CFFA 2CHOA 3ZDYB 3OZ9H 1DQQA 4YLQT 1QNPA 1S4IA 4TVUA 3LEPA 3P54A 1F6KA 1PIIA 3R06A 3T5WA 2PTVA 5TQ2H 2XACC 3US9A 3IGKA 2F1EA 1X44A 1MHHA 3G5YA 2BSSA 5GS0H 3P3YA 5EDXA 3GS7A 1NMBH 2WVSA 2PR4L 1E6OL 4A7QA 5INDB 4RMSA 4NF7A 5M5DA 1OWRM 1Q6RA 4NQXB 3P4MB 2PDJA 2JJVA 2WCPA 2QPXA 5AKVA 1TVNA 4AK1A 2V3DA 4HSHA 2X5PA 3N34A 2CRYA 2YAQA 3ULVE 3O8XA 4HNLA 5B7YA 3H7UA 4XO9A 4IOSD 3T6CA 3QA3B 3L2IA 2Q2EB 2QHLA 5AVVB 2CHXA 1EXUA 4X7SL 4LUIA 5DRCA 3LCFA 3QUXD 1AS7A 5TBOA 4Z7IA 1XGQB 4UIOA 4KRLB 4QR6A 3H9SE 1C08A 5IQLA 1JSYA 3FYYA 1OK8A 4CQ8A 1G7IB 3QJOA 1TTFA 5E8DL 3S9IA 3JT2A 3LIUA 1FNGB 5CWSB 3DRTB 2UZPA 5FECB 3INPA 3BP6B 1J86A 2ITDA 3DDGA 4Z7WB 7FABL 3AFBA 3UWEA 4FQPA 3HLKA 4MZRA 1CBVL 1X5JA 2EEDA 3GMLB 4KC3B 5GS0L 1H62A 4HYVA 4RE3A 2YGVA 3ARQA 1WXYA 4U5IA 1TEFA 2NUPA 1I8JA 4LNCA 3JWDC 3VFWB 3QQ9D 3K2GA 3BUPA 1DIKA 4LCUA 3MU3A 4XCNB 1PZUB 3GS6A 1W32A 3WD1A 5DJXB 3WQ8A 1H15A 2WN3A 4AVKA 1EGJA 5LWYL 5HHNA 3QBUA 4HNCA 5E1QA 4IL2A 5DT7A 3QFWA 3R0NA 5FF6A 3S2CA 3TU6A 3I7SA 3FB5A 3MJ9H 2ICES 1MXGA 2NY1B 1NMBL 1B0RA 1E6OH 1G7LB 1B4JH 1W8GA 3RNKA 3VIMA 5LQBH 3T1GA 1WDDA 3L3OB 4KRPB 3OX8B 3OGSA 4X9IA 2X6MA 1QHPA 4XNYH 4V1DB 4OWGA 4F79A 5FCZA 2QDHA 1HVXA 3UY8A 5KEZA 4FL4C 4J3ZA 3OXSA 1C5CH 1C8PA 1JCXA 4LALA 5E08H 3VDAA 4GXVL 1AW1A 3BAYA 1S9YB 1OPGH 4KXBA 5IHBA 5AWNH 3MBWA 1USZA 3N85L 3WLWC 4FRWA 1UP0A 4D6HA 3ZY7A 3IBEA 3ML8A 3W1XA 4AD5A 2PCQA 1LDCA 5D5MF 3WK0A 2FJHB 1WPCA 3BZDA 4HIIB 4APQD 2OLAA 4OGAC 4P5MB 4A39A 4BXVA 2J73A 1TG7A 2CO6A 1XLJA 2DY3A 1P5UA 3UBHA 2XSAA 5T9BG 1FDZA 3ILPB 1HKJA 5F6IB 4QXIA 3FONA 1UXLA 4PV8A 4YZFE 1E71M 4JFPB 5H1WA 1CLYH 5JIDA 5L6UA 5IQ9A 1S7UA 2OMXA 2WMJA 3CBWA 4LUSA 1E4LA 2YCLA 4EPKA 5LG1A 1JYXA 2XQBL 3DSFH 4HEMA 5C9XA 1CE6B 2QUUA 1YN6B 5MI0B 3VXSE 1Z3RA 2D7MA 5E08L 2XTJE 3G3LA 5DK0A 3TT1L 4JS3A 5KZCB 1X3DA 1G7MB 4U1MA 4X4ZA 1WA2X 4PY8J 5B4MD 1K72A 2BVWA 2QV5A 3RX7A 3NSMA 5E9DA 4Z7UE 4IBUA 2AI0L 4NXSA 3FA5A 2KUTA 1EFXA 4XN8A 5EC1A 4KCUA 4ZSTA 1H3TA 4E9QA 5E8PA 4YHOH 5HJ3B 4GMTL 5ETUA 1PKOA 4LAJH 2V6AA 1FZJA 1A3LL 4GS7C 4MUZA 1UATA 3MGTB 1N0LA 3SBWC 5C0CD 2QCLA 1MFDH 2V7HA 4P8VA 3ZIYA 5D9PA 3OJ2C 1YN7B 4AYDC 3TE9A 5I3DA 3ARFB 4DN3L 2ZWSA 1NOFA 4WXZA 2QFPA 5EUOB 4HIEB 1JXKA 5T5FA 1X5IA 4FFTA 4PRDA 2R94A 4DPQA 4ZX6A 1W9UA 4C65A 1GKEA 2BVYA 1Q13A 2UYLB 3ARWA 4GX9A 1IKFL 3NSCA 3U79A 5SWZD 3PBWA 4WSHA 1ISZA 1HXMA 3IDNB 4PJHF 5T8IA 2X4QB 3SGJA 3WQEA 2JELL 2NY3D 1KGIA 4GRMB 1IM9D 3TBVA 1Q8AA 3GXPA 2R69L 2X7LB 1T66C 2DZAA 4KK6D 1INDL 4JRXA 5BVPL 2ITFA 4DWDA 2Y6SC 1XSJA 2F8IA 5TF1H 3NPVA 3CH8A 2E77A 4ZBJA 4K5NA 2YMXH 1QI3A 3P73A 3CQKA 5BW7A 5JLZA 1ZCOA 3QRFM 1KFJA 3W84A 1EEYB 2OZ3A 3FFOA 1I53A 3OVUB 4Q56A 1J88A 5E70A 3RGVB 4DGYH 5JW4N 1WKEA 3M5XA 2KQNA 4NO3A 4GW5B 1N26A 4XC1L 8A3HA 1GVQA 4YVPA 1N2RB 5DMGD 2HUHA 3MRGA 4PMJA 4PUWA 1HHJA 1MEXL 1N59A 1MRFH 2QGYA 5J89A 3T4AB 2PYEB 5HGHA 4U49A 2CD0A 1SUHA 5AZUA 5E00B 3TP4A 1TV2A 3B37A 1P7HL 5AB0A 1JUKA 4BI7A 1ZSDA 2I24N 5DD0L 4BZ2H 3AB0C 1BTMA 3IDXL 1IIHA 3GYEA 2XSBA 2UY6A 4HCRA 4NHUB 4XUGA 4YN5A 4RPQA 1EHXA 3RNDA 2DQHH 4DERA 3H2PA 4LAUA 4RLDA 5DQJB 2GBAA 4CQ9A 4M7LH 5MEOB 2ENJA 2QEJA 4Y2LA 3NQDA 1YEFH 1GZJA 4TXEA 2V63A 2E9MA 5CLXA 1Q6DA 3ZQWA 2FJUB 1KPUB 2EPNA 4HT3A 4IGHA 3BCDA 3UBPC 1EANA 2JIXB 1KNOB 2NDGA 2OJZH 3NABH 4B41A 6CGTA 5FOBB 3UJIL 4DYKA 1I7UA 2FHBA 1FH7A 1G6RH 3O6LH 1RFDH 3O3UN 4QYOB 1NDTA 4M7ZB 1T20B 4XC1H 2AXGB 2ABBA 3TFXA 2H32B 4H3DA 2H41A 3ZE1F 3OKEA 4I89A 1SMOA 4ZW7A 3M1BB 5ISZA 3QARA 4JPIB 4U5KA 3EA1A 3P81A 3P6LA 3C5XA 2NZ9C 2MKLC 4LQ1A 5HI4D 1NGPH 1HZHH 5HYJB 2EVJA 3NO3A 4JX5A 4QRQA 4UINL 5EU3B 2KERA 4JO4H 3TYAA 3NA8A 1KGCE 2Q87A 4D9LL 4AEIL 3KL0A 2QCFA 3I6RA 1T5XB 4MJ2A 3AU1A 3LS5L 3SDXE 2X1OA 4OCNC 3RTQC 3BEVA 5C2UB 4KJPC 1E4MM 1ID2A 2LLLA 4O00A 5E5MA 4RXFA 5JNYA 4X9FA 4IZGA 1IAMA 1Q5MA 4QJ1A 5DXXA 4PE8A 2V9QA 4OD2B 4W9HC 2WMPA 2OX5B 3GTNA 3OLGA 3G1VA 4PRAA 3TPKA