1JAJA

Solution structure of dna polymerase x from the african swine fever virus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a viral DNA repair polymerase.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Viral protein
molecule keywords DNA POLYMERASE BETA-LIKE PROTEIN
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jajA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jajA01
1ZQGA 4KLEA 9ICXA 3GDXA 3WFQE 4EBKA 3OVSA 3ISCA 1UEUA 4XA5A 2NRKA 2ZH2A 3JPPA 1XSNA 4RWOA 5DDYA 3UXNA 4I2DA 4FHVA 1NOMA 7ICSA 2M2WA 2M2VA 4UB2A 4R63A 3OUYB 9ICEA 8ICPA 1R8BA 4GXKA 1JN3A 7ICPA 3MDAA 4PHEA 3PMNA 5IIJA 1Q78A 4NLNA 4K4HA 4WC6A 3WFOA 4QZHA 1ZQIA 4X4NA 1UEVA 4X4TA 2M2TA 5BPCA 3UPQA 4PHAA 5CA7A 4MF2A 4M5DA 3AUOA 4DO9A 4NY8A 9ICCA 1R8AA 2BPCA 9ICQA 2ZH8A 7ICNA 4YN4A 5HR9A 4IQWA 4IQUA 4X0AA 3UPSA 5IINA 4EBJA 4FH5A 7ICVA 5J2DA 2FMSA 3C66A 3H38A 4P4OA 4UBBA 4XRHA 4RQ8A 4MF8A 3RH6A 4I2BA 9ICBA 9ICJA 4WC2A 4F5NA 2BCSA 5IIIA 4TUQA 9ICTA 5J0WA 4QZEA 2BCVA 4WC3A 1TFWA 2GWSA 4KLLA 3C2MA 4S3NA 4Z6DA 4UBCA 9ICKA 3AQMA 3HX0A 5EOZA 1ZQOA 7ICFA 9ICWA 5HRFA 1MIYA 4XUSA 2PFNA 2PFPA 2DRBA 8ICGA 3AQLA 3OUYA 9ICMA 3LQCB 1ZQLA 9ICAA 3OGUA 7ICLA 1MQ3A 4E7XA 4UB4A 5J2BA 4KLIA 4JWNA 3LK9A 4M04A 8ICJA 4X4RA 8ICVA 1WOTA 2O5AA 1JMSA 4I29A 8ICAA 2HHPA 3WFPA 4PGXA 4WCWA 5HHHA 4RWNA 5J29A 4Z6FA 3C2LA 2PFQA 3HIYA 4I2JA 3MBYA 5DB8A 4M2YA 4FHXA 1TFYA 5J0RA 4RQ0A 1BPXA 4MFCA 3H37A 4I27A 4AT8B 1FA0A 3TFRA 4TUSA 2IHMA 1ZQAA 4I2EA 1ZQYA 8ICLA 4X0BA 2DVIA 7ICGA 4AT8A 2PXIA 3K75D 5CJ7A 5IIKA 1RZTA 4WC7A 4RPYA 2BPFA 9ICHA 1ZQZA 2ZH5A 8ICCA 8ICRA 9ICLA 3H3AA 9ICNA 1JQRA 1ZQUA 5J0TA 2ZH9A 8ICWA 5IILA 4Z6EA 5CP2A 4I2AA 4PPXA 4QZ9A 4QZAA 4WC4A 4X4VA 5DBAA 3V7LA 4RQ1A 3RJEA 2BCRA 4M9HA 3RJHA 4RWQA 9ICIA 4QZDA 3JPNA 4R66A 4TUPA 4KLGA 4NLKA 5D49A 5HRBA 4AT7B 3HWTA 1XSLA 4NLZA 3RJIA 4P4MA 1HUZA 3WFRE 5CR0A 4RQ4A 4QZCA 5HRDA 5D46A 1JAJA 4ATBB 4RQ3A 3RJJA 5HRIA 1RPLA 4RPXA 2DRAA 3TFSA 7ICIA 4I2HA 3JPQA 2M2UA 5DBCA 4YMMA 4I28A 4O5CA 3RJGA 5J0SA 4E80A 3C2KA 2ISOA 4UD4A 5J0UA 3NYBA 9ICSA 4NM2A 3MGIA 4RWPA 3JPRA 4P4PA 3OVBA 2ID1A 4QZ8A 3JPTA 4PHPA 4QZFA 5DECA 7ICJA 8ICMA 5DKWA 4DOCA 4WC0A 3AQKA 1ZQVA 7ICUA 4WC1A 8ICQA 1ZQCA 4RQ7A 2ISPA 2FMQA 5CWRA 4LT6A 4X5VA 4KLTA 2BCQA 4O5KA 1ZQPA 3C18A 4UAWA 1ZQNA 8ICYA 4KLJA 4UAYA 4AT9A 9ICOA 4P2HA 3MGHA 5HRHA 4FHYA 2DR8A 4TURA 4Z6CA 4I2GA 5HRGA 4O5EA 3C5GA 4X4QA 2ZH4A 3JZ0A 4AT9B 1BPZA 5J2HA 1ZQRA 8ICZA 8ICSA 2ZHAA 3HJ1A 4NXZA 5J2JA 2DR7A 4X4UA 5F2VO 1ZJMA 4WC5A 9ICGA 4YD2A 4RPZA 1BPYA 4M0AA 4IG8A 9ICRA 7ICHA 9ICVA 4M9NA 3ISBA 3RH4A 4FHWA 8ICUA 3WFSC 5DB7A 4AT7A 4LVSA 4F5OA 5BOLA 3RJFA 5J0XA 4YMNA 4LZDA 1F5AA 2VANA 5D4BA 2I9GA 2BPGA 2DR5A 1KEJA 7ICTA 1TV9A 5J2KA 4I2FA 1ZJNA 1BPBA 9ICPA 2W9MA 1MQ2A 8ICEA 1ZQDA 4KLMA 1VJ7A 3L9DA 3JPOA 4K4GA 1V4AA 4NKTA 7ICKA 9ICUA 4FO6A 4KLUA 1ZQEA 3V72A 7ICMA 4UB3A 4UB5A 3V7KA 4UD5A 4X4OA 2ZH7A 8ICKA 7ICOA 5IIMA 3B0XA 3UXPA 4K4IA 3C5FA 1MIWA 1ZQHA 4LZGA 4YMOA 4YD1A 2PFOA 2FMPA 4UB1A 3PNCA 4I2IA 4NKUA 2DR9A 4XQ8A 4RT2A 4UAZA 4QZGA 5DDMA 5J2IA 7ICEA 4MFFA 1HUOA 4PHDA 4DOBA 1MIVA 4F5PA 3UQ2A 1R89A 4DOAA 3OVAA 3H39A 4KLFA 4M9JA 2ZH3A 2BE3A 4YCXA 3JYYA 4KLDA 4PGQA 5J2AA 4F5QA 1UETA 1KDHA 4PH5A 5CHGA 3RH5A 5BOMA 4EP7A 1BPDA 1TVAA 3ISDA 5HRKA 4ATBA 4X4SA 4X4PA 8ICFA 8ICIA 4NM1A 4WBYA 4WBZA 4KLQA 4QZIA 2ZH1A 4GXJA 3HJ4A 5J0QA 4MFAA 1ZQJA 7ICQA 1KNYA 4PGYA 1XSPA 3UXOA 5J0OA 4XQ7A 2ZH6A 1VFGA 4IQVA 5DB9A 8ICXA 4KLHA 5DBBA 5HHIA 8ICHA 3V7JA 1NO5A 3RJKA 2RFFA 4E8FA 1ZQWA 4M47A 5J2GA 9ICFA 8ICBA 3JPSA 4JWMA 2Q66A 1ZQMA 3PMLA 4R64A 5J0PA 1ZQFA 4RQ6A 5J2CA 3B0YA 3AQNA 1PX5A 5TZVA 1ZQXA 8ICNA 8ICTA 1YLQA 3OV7A 4O9MA 4FH3A 5DEDA 1R8CA 4I2CA 4KLOA 4RQ5A 3UQ0A 2ZHBA 3MDCA 1ZQKA 7ICRA 4IQTA 5J2EA 5DB6A 1ZQTA 1BPEA 4R65A 4KLSA 1Q79A 4QZBA 5HRLA 4RQ2A 2PBEA 5CB1A 1ZQQA 5IIOA 5J0YA 4RT3A 1ZQSA 4M9LA 8ICOA 2P66A 4F5RA 2BCUA 5J2FA 3HW8A 1ZQBA 2O1PA 4M9GA 4FHPA 3AU6A 5HC9A 4GXIA 5HREA 3AU2A 1OU5A
chains in the Genus database with same CATH superfamily
1ZQGA 4KLEA 9ICXA 3GDXA 3WFQE 4EBKA 3OVSA 3ISCA 1UEUA 4XA5A 4K9BA 2NRKA 2ZH2A 3JPPA 1XSNA 4RWOA 5DDYA 3UXNA 4I2DA 4FHVA 1NOMA 7ICSA 2M2WA 2M2VA 4UB2A 4R63A 3OUYB 9ICEA 4EEBA 8ICPA 1R8BA 2BBHA 5JTGA 4GXKA 1JN3A 7ICPA 3MDAA 4PHEA 3PMNA 5IIJA 1Q78A 4KM5A 4NLNA 4K4HA 4WC6A 3WFOA 4QZHA 1ZQIA 4X4NA 1UEVA 4X4TA 2M2TA 5BPCA 3UPQA 4PHAA 5CA7A 4MF2A 4M5DA 3AUOA 4DO9A 4K96A 4NY8A 9ICCA 1R8AA 2BPCA 9ICQA 2ZH8A 7ICNA 4YN4A 5HR9A 4IQWA 4IQUA 4MKPA 4X0AA 3UPSA 5IINA 4NXWA 4EBJA 5D61A 4FH5A 7ICVA 5J2DA 3PHZA 2FMSA 3C66A 4NXVA 3H38A 4P4OA 4UBBA 4XRHA 4RQ8A 4MF8A 3RH6A 4I2BA 9ICBA 9ICJA 4WC2A 4F5NA 2BCSA 5IIIA 4TUQA 9ICTA 5J0WA 4QZEA 2BCVA 2GAFD 4WC3A 1TFWA 2GWSA 2IHOA 4KLLA 3C2MA 4S3NA 4Z6DA 4UBCA 9ICKA 3AQMA 3HX0A 5EOZA 1ZQOA 7ICFA 9ICWA 5HRFA 4WOYA 1MIYA 4XUSA 4EGWA 2PFNA 2PFPA 2DRBA 8ICGA 3AQLA 3OUYA 9ICMA 3LQCB 1ZQLA 9ICAA 4OAGA 3OGUA 7ICLA 1MQ3A 4K9AA 4E7XA 4UB4A 5J2BA 4KLIA 4JWNA 3LK9A 4M04A 8ICJA 4X4RA 8ICVA 1WOTA 5D63A 2O5AA 1JMSA 4I29A 8ICAA 2HHPA 3WFPA 4PGXA 4WCWA 5HHHA 5D62A 5J29A 4RWNA 4Z6FA 3C2LA 2PFQA 3HIYA 4I2JA 3MBYA 5DB8A 4M2YA 4FHXA 1TFYA 5J0RA 4RQ0A 1BPXA 4MFCA 3H37A 4I27A 4AT8B 3MCRA 1FA0A 3TFRA 4TUSA 2IHMA 1ZQAA 4I2EA 1ZQYA 8ICLA 4X0BA 2DVIA 7ICGA 4AT8A 2PXIA 3K75D 5CJ7A 5IIKA 1RZTA 4WC7A 4RPYA 2BPFA 9ICHA 2IUBA 4JLXA 1ZQZA 2ZH5A 8ICCA 8ICRA 9ICLA 5CFUA 3H3AA 4EV6A 9ICNA 1JQRA 1ZQUA 5J0TA 2ZH9A 8ICWA 5IILA 4Z6EA 5CP2A 4I2AA 4PPXA 4QZ9A 4QZAA 4WC4A 4X4VA 5DBAA 3V7LA 4RQ1A 3RJEA 2BCRA 4M9HA 3RJHA 3EF2A 4RWQA 9ICIA 4QZDA 3JPNA 4R66A 4TUPA 2B4VA 4KLGA 4NLKA 5D49A 3JCFA 5HRBA 4AT7B 3HWTA 1XSLA 4NLZA 3RJIA 4NXXA 4P4MA 1HUZA 3WFRE 5CR0A 4RQ4A 4QZCA 5HRDA 5D46A 1JAJA 4ATBB 4RQ3A 3RJJA 4XJEA 5HRIA 1RPLA 4RPXA 2DRAA 2FCLA 3TFSA 7ICIA 3NKUA 4I2HA 3JPQA 2M2UA 5DBCA 4YMMA 4I28A 4O5CA 3RJGA 5J0SA 4E80A 3C2KA 2ISOA 4UD4A 4OAFA 5J0UA 3NYBA 5CFSA 9ICSA 4NM2A 3MGIA 4RWPA 4O67A 4WH5A 3JPRA 4P4PA 3OVBA 2ID1A 4QZ8A 3JPTA 2HN1A 4PHPA 4QZFA 5DECA 7ICJA 8ICMA 5DKWA 3NWIA 4DOCA 4WC0A 3AQKA 1ZQVA 7ICUA 4WC1A 8ICQA 1ZQCA 4RQ7A 2ISPA 2FMQA 5CWRA 4HX0A 4X5VA 4LT6A 4KLTA 2BCQA 4O5KA 1ZQPA 1GPJA 3C18A 4WQLA 4UAWA 4LEZA 1ZQNA 3CK6A 8ICYA 4KLJA 4UAYA 4AT9A 5CFTA 9ICOA 4P2HA 3MGHA 5HRHA 4FHYA 2DR8A 4TURA 4Z6CA 4I2GA 5HRGA 4O5EA 3C5GA 4X4QA 3ERCC 2ZH4A 3JZ0A 4AT9B 1BPZA 5J2HA 1ZQRA 8ICZA 8ICSA 2ZHAA 3HJ1A 4NXZA 5J2JA 2DR7A 4X4UA 5CHEA 5F2VO 1ZJMA 4WC5A 9ICGA 4YD2A 4RPZA 1BPYA 4M0AA 4K99A 4IG8A 9ICRA 7ICHA 4NXTA 9ICVA 4M9NA 3ISBA 3RH4A 4FHWA 4K8VA 2HN2A 8ICUA 3WFSC 5DB7A 4AT7A 4LVSA 4F5OA 5BOLA 3RJFA 5J0XA 4N7RA 4LEYA 4YMNA 2B56A 4LZDA 1F5AA 2VANA 5D4BA 2I9GA 2BPGA 2DR5A 1KEJA 4I0UA 7ICTA 4LEVA 1TV9A 5J2KA 4I2FA 1ZJNA 4O6AA 1BPBA 9ICPA 2W9MA 1MQ2A 8ICEA 1ZQDA 4KLMA 1VJ7A 3L9DA 3JPOA 4K4GA 1V4AA 4NKTA 7ICKA 9ICUA 4FO6A 4O68A 4KLUA 1ZQEA 3V72A 7ICMA 4LEWA 4UB3A 2GA9D 4JLZA 4UB5A 3V7KA 4UD5A 4X4OA 2ZH7A 8ICKA 7ICOA 5IIMA 3B0XA 3UXPA 4K4IA 3C5FA 4FO1A 1MIWA 1ZQHA 4LZGA 4YMOA 4YD1A 2PFOA 2FMPA 4UB1A 3PNCA 4I2IA 5B3QA 4NKUA 2DR9A 4XQ8A 4RT2A 4UAZA 4QZGA 5DDMA 5J2IA 7ICEA 4OAIZ 4MFFA 1HUOA 4PHDA 4DOBA 1MIVA 4F5PA 3UQ2A 1R89A 2BBJA 4DOAA 3OVAA 3H39A 4KLFA 4M9JA 2ZH3A 2BE3A 4YCXA 3JYYA 2B51A 3ER8C 4KB6A 4KLDA 4PGQA 5J2AA 4F5QA 1UETA 1KDHA 4PH5A 4OAHA 5CHGA 3RH5A 5BOMA 4EP7A 1BPDA 3NVOA 1TVAA 3ISDA 5HRKA 4ATBA 4X4SA 4X4PA 4K97A 8ICFA 8ICIA 4NM1A 4WBYA 4WBZA 4KLQA 4QZIA 2ZH1A 4GXJA 3HJ4A 5J0QA 4MFAA 1ZQJA 7ICQA 1KNYA 4PGYA 1XSPA 3UXOA 5J0OA 4XQ7A 2ZH6A 4EEDA 1VFGA 4IQVA 5DB9A 8ICXA 3OWGA 4KLHA 5DBBA 5HHIA 8ICHA 3V7JA 1NO5A 3RJKA 2RFFA 4E8FA 1ZQWA 4M47A 5J2GA 9ICFA 8ICBA 3JPSA 4JWMA 2Q66A 1ZQMA 3PMLA 4WQKA 4NXUA 4R64A 5J0PA 1ZQFA 4RQ6A 5J2CA 3B0YA 3AQNA 1PX5A 5TZVA 1ZQXA 8ICNA 8ICTA 1YLQA 3OV7A 4O9MA 4FH3A 5DEDA 1R8CA 4I2CA 4KLOA 4RQ5A 3UQ0A 2ZHBA 3MDCA 3ER9B 1ZQKA 7ICRA 4K98A 4IQTA 5J2EA 5DB6A 1ZQTA 3K7DA 1BPEA 4R65A 4KLSA 1Q79A 4QZBA 5HRLA 4RQ2A 2PBEA 5CB1A 1ZQQA 5IIOA 5J0YA 4RT3A 1ZQSA 4M9LA 8ICOA 2P66A 4F5RA 2BCUA 5J2FA 3HW8A 1ZQBA 2EWRA 4M9GA 2O1PA 3AU6A 4FHPA 4O69A 5B3PA 5HC9A 4GXIA 5HREA 3AU2A 1OU5A
chains in the Genus database with same CATH topology
1ZQGA 4KLEA 9ICXA 3GDXA 3WFQE 4EBKA 3OVSA 3ISCA 1UEUA 4XA5A 2NRKA 2ZH2A 3JPPA 1XSNA 4RWOA 5DDYA 3UXNA 4I2DA 4FHVA 1NOMA 7ICSA 2M2WA 2M2VA 4UB2A 4R63A 3OUYB 9ICEA 8ICPA 1R8BA 4GXKA 1JN3A 7ICPA 3MDAA 4PHEA 3PMNA 5IIJA 1Q78A 4NLNA 4K4HA 4WC6A 3WFOA 4QZHA 1ZQIA 4X4NA 1UEVA 4X4TA 2M2TA 5BPCA 3UPQA 4PHAA 5CA7A 4MF2A 4M5DA 3AUOA 4DO9A 4NY8A 9ICCA 1R8AA 2BPCA 9ICQA 2ZH8A 7ICNA 4YN4A 5HR9A 4IQWA 4IQUA 4X0AA 3UPSA 5IINA 4EBJA 4FH5A 7ICVA 5J2DA 2FMSA 3C66A 3H38A 4P4OA 4UBBA 4XRHA 4RQ8A 4MF8A 3RH6A 4I2BA 9ICBA 9ICJA 4WC2A 4F5NA 2BCSA 5IIIA 4TUQA 9ICTA 5J0WA 4QZEA 2BCVA 4WC3A 1TFWA 2GWSA 4KLLA 3C2MA 4S3NA 4Z6DA 4UBCA 9ICKA 3AQMA 3HX0A 5EOZA 1ZQOA 7ICFA 9ICWA 5HRFA 1MIYA 4XUSA 2PFNA 2PFPA 2DRBA 8ICGA 3AQLA 3OUYA 9ICMA 3LQCB 1ZQLA 9ICAA 3OGUA 7ICLA 1MQ3A 4E7XA 4UB4A 5J2BA 4KLIA 4JWNA 3LK9A 4M04A 8ICJA 4X4RA 8ICVA 1WOTA 2O5AA 1JMSA 4I29A 8ICAA 2HHPA 3WFPA 4PGXA 4WCWA 5HHHA 4RWNA 5J29A 4Z6FA 3C2LA 2PFQA 3HIYA 4I2JA 3MBYA 5DB8A 4M2YA 4FHXA 1TFYA 5J0RA 4RQ0A 1BPXA 4MFCA 3H37A 4I27A 4AT8B 1FA0A 3TFRA 4TUSA 2IHMA 1ZQAA 4I2EA 1ZQYA 8ICLA 4X0BA 2DVIA 7ICGA 4AT8A 2PXIA 3K75D 5CJ7A 5IIKA 1RZTA 4WC7A 4RPYA 2BPFA 9ICHA 1ZQZA 2ZH5A 8ICCA 8ICRA 9ICLA 3H3AA 9ICNA 1JQRA 1ZQUA 5J0TA 2ZH9A 8ICWA 5IILA 4Z6EA 5CP2A 4I2AA 4PPXA 4QZ9A 4QZAA 4WC4A 4X4VA 5DBAA 3V7LA 4RQ1A 3RJEA 2BCRA 4M9HA 3RJHA 4RWQA 9ICIA 4QZDA 3JPNA 4R66A 4TUPA 4KLGA 4NLKA 5D49A 5HRBA 4AT7B 3HWTA 1XSLA 4NLZA 3RJIA 4P4MA 1HUZA 3WFRE 5CR0A 4RQ4A 4QZCA 5HRDA 5D46A 1JAJA 4ATBB 4RQ3A 3RJJA 5HRIA 1RPLA 4RPXA 2DRAA 3TFSA 7ICIA 4I2HA 3JPQA 2M2UA 5DBCA 4YMMA 4I28A 4O5CA 3RJGA 5J0SA 4E80A 3C2KA 2ISOA 4UD4A 5J0UA 3NYBA 9ICSA 4NM2A 3MGIA 4RWPA 3JPRA 4P4PA 3OVBA 2ID1A 4QZ8A 3JPTA 4PHPA 4QZFA 5DECA 7ICJA 8ICMA 5DKWA 4DOCA 4WC0A 3AQKA 1ZQVA 7ICUA 4WC1A 8ICQA 1ZQCA 4RQ7A 2ISPA 2FMQA 5CWRA 4LT6A 4X5VA 4KLTA 2BCQA 4O5KA 1ZQPA 3C18A 4UAWA 1ZQNA 8ICYA 4KLJA 4UAYA 4AT9A 9ICOA 4P2HA 3MGHA 5HRHA 4FHYA 2DR8A 4TURA 4Z6CA 4I2GA 5HRGA 4O5EA 3C5GA 4X4QA 2ZH4A 3JZ0A 4AT9B 1BPZA 5J2HA 1ZQRA 8ICZA 8ICSA 2ZHAA 3HJ1A 4NXZA 5J2JA 2DR7A 4X4UA 5F2VO 1ZJMA 4WC5A 9ICGA 4YD2A 4RPZA 1BPYA 4M0AA 4IG8A 9ICRA 7ICHA 9ICVA 4M9NA 3ISBA 3RH4A 4FHWA 8ICUA 3WFSC 5DB7A 4AT7A 4LVSA 4F5OA 5BOLA 3RJFA 5J0XA 4YMNA 4LZDA 1F5AA 2VANA 5D4BA 2I9GA 2BPGA 2DR5A 1KEJA 7ICTA 1TV9A 5J2KA 4I2FA 1ZJNA 1BPBA 9ICPA 2W9MA 1MQ2A 8ICEA 1ZQDA 4KLMA 1VJ7A 3L9DA 3JPOA 4K4GA 1V4AA 4NKTA 7ICKA 9ICUA 4FO6A 4KLUA 1ZQEA 3V72A 7ICMA 4UB3A 4UB5A 3V7KA 4UD5A 4X4OA 2ZH7A 8ICKA 7ICOA 5IIMA 3B0XA 3UXPA 4K4IA 3C5FA 1MIWA 1ZQHA 4LZGA 4YMOA 4YD1A 2PFOA 2FMPA 4UB1A 3PNCA 4I2IA 4NKUA 2DR9A 4XQ8A 4RT2A 4UAZA 4QZGA 5DDMA 5J2IA 7ICEA 4MFFA 1HUOA 4PHDA 4DOBA 1MIVA 4F5PA 3UQ2A 1R89A 4DOAA 3OVAA 3H39A 4KLFA 4M9JA 2ZH3A 2BE3A 4YCXA 3JYYA 4KLDA 4PGQA 5J2AA 4F5QA 1UETA 1KDHA 4PH5A 5CHGA 3RH5A 5BOMA 4EP7A 1BPDA 1TVAA 3ISDA 5HRKA 4ATBA 4X4SA 4X4PA 8ICFA 8ICIA 4NM1A 4WBYA 4WBZA 4KLQA 4QZIA 2ZH1A 4GXJA 3HJ4A 5J0QA 4MFAA 1ZQJA 7ICQA 1KNYA 4PGYA 1XSPA 3UXOA 5J0OA 4XQ7A 2ZH6A 1VFGA 4IQVA 5DB9A 8ICXA 4KLHA 5DBBA 5HHIA 8ICHA 3V7JA 1NO5A 3RJKA 2RFFA 4E8FA 1ZQWA 4M47A 5J2GA 9ICFA 8ICBA 3JPSA 4JWMA 2Q66A 1ZQMA 3PMLA 4R64A 5J0PA 1ZQFA 4RQ6A 5J2CA 3B0YA 3AQNA 1PX5A 5TZVA 1ZQXA 8ICNA 8ICTA 1YLQA 3OV7A 4O9MA 4FH3A 5DEDA 1R8CA 4I2CA 4KLOA 4RQ5A 3UQ0A 2ZHBA 3MDCA 1ZQKA 7ICRA 4IQTA 5J2EA 5DB6A 1ZQTA 1BPEA 4R65A 4KLSA 1Q79A 4QZBA 5HRLA 4RQ2A 2PBEA 5CB1A 1ZQQA 5IIOA 5J0YA 4RT3A 1ZQSA 4M9LA 8ICOA 2P66A 4F5RA 2BCUA 5J2FA 3HW8A 1ZQBA 2O1PA 4M9GA 4FHPA 3AU6A 5HC9A 4GXIA 5HREA 3AU2A 1OU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQG A;  4KLE A;  9ICX A;  3GDX A;  3WFQ E;  4EBK A;  3OVS A;  3ISC A;  1UEU A;  4XA5 A;  2NRK A;  2ZH2 A;  3JPP A;  1XSN A;  4RWO A;  5DDY A;  3UXN A;  4I2D A;  4FHV A;  1NOM A;  7ICS A;  2M2W A;  2M2V A;  4UB2 A;  4R63 A;  3OUY B;  9ICE A;  8ICP A;  1R8B A;  4GXK A;  1JN3 A;  7ICP A;  3MDA A;  4PHE A;  3PMN A;  5IIJ A;  1Q78 A;  4NLN A;  4K4H A;  4WC6 A;  3WFO A;  4QZH A;  1ZQI A;  4X4N A;  1UEV A;  4X4T A;  2M2T A;  5BPC A;  3UPQ A;  4PHA A;  5CA7 A;  4MF2 A;  4M5D A;  3AUO A;  4DO9 A;  4NY8 A;  9ICC A;  1R8A A;  2BPC A;  9ICQ A;  2ZH8 A;  7ICN A;  4YN4 A;  5HR9 A;  4IQW A;  4IQU A;  4X0A A;  3UPS A;  5IIN A;  4EBJ A;  4FH5 A;  7ICV A;  5J2D A;  2FMS A;  3C66 A;  3H38 A;  4P4O A;  4UBB A;  4XRH A;  4RQ8 A;  4MF8 A;  3RH6 A;  4I2B A;  9ICB A;  9ICJ A;  4WC2 A;  4F5N A;  2BCS A;  5III A;  4TUQ A;  9ICT A;  5J0W A;  4QZE A;  2BCV A;  4WC3 A;  1TFW A;  2GWS A;  4KLL A;  3C2M A;  4S3N A;  4Z6D A;  4UBC A;  9ICK A;  3AQM A;  3HX0 A;  5EOZ A;  1ZQO A;  7ICF A;  9ICW A;  5HRF A;  1MIY A;  4XUS A;  2PFN A;  2PFP A;  2DRB A;  8ICG A;  3AQL A;  3OUY A;  9ICM A;  3LQC B;  1ZQL A;  9ICA A;  3OGU A;  7ICL A;  1MQ3 A;  4E7X A;  4UB4 A;  5J2B A;  4KLI A;  4JWN A;  3LK9 A;  4M04 A;  8ICJ A;  4X4R A;  8ICV A;  1WOT A;  2O5A A;  1JMS A;  4I29 A;  8ICA A;  2HHP A;  3WFP A;  4PGX A;  4WCW A;  5HHH A;  4RWN A;  5J29 A;  4Z6F A;  3C2L A;  2PFQ A;  3HIY A;  4I2J A;  3MBY A;  5DB8 A;  4M2Y A;  4FHX A;  1TFY A;  5J0R A;  4RQ0 A;  1BPX A;  4MFC A;  3H37 A;  4I27 A;  4AT8 B;  1FA0 A;  3TFR A;  4TUS A;  2IHM A;  1ZQA A;  4I2E A;  1ZQY A;  8ICL A;  4X0B A;  2DVI A;  7ICG A;  4AT8 A;  2PXI A;  3K75 D;  5CJ7 A;  5IIK A;  1RZT A;  4WC7 A;  4RPY A;  2BPF A;  9ICH A;  1ZQZ A;  2ZH5 A;  8ICC A;  8ICR A;  9ICL A;  3H3A A;  9ICN A;  1JQR A;  1ZQU A;  5J0T A;  2ZH9 A;  8ICW A;  5IIL A;  4Z6E A;  5CP2 A;  4I2A A;  4PPX A;  4QZ9 A;  4QZA A;  4WC4 A;  4X4V A;  5DBA A;  3V7L A;  4RQ1 A;  3RJE A;  2BCR A;  4M9H A;  3RJH A;  4RWQ A;  9ICI A;  4QZD A;  3JPN A;  4R66 A;  4TUP A;  4KLG A;  4NLK A;  5D49 A;  5HRB A;  4AT7 B;  3HWT A;  1XSL A;  4NLZ A;  3RJI A;  4P4M A;  1HUZ A;  3WFR E;  5CR0 A;  4RQ4 A;  4QZC A;  5HRD A;  5D46 A;  1JAJ A;  4ATB B;  4RQ3 A;  3RJJ A;  5HRI A;  1RPL A;  4RPX A;  2DRA A;  3TFS A;  7ICI A;  4I2H A;  3JPQ A;  2M2U A;  5DBC A;  4YMM A;  4I28 A;  4O5C A;  3RJG A;  5J0S A;  4E80 A;  3C2K A;  2ISO A;  4UD4 A;  5J0U A;  3NYB A;  9ICS A;  4NM2 A;  3MGI A;  4RWP A;  3JPR A;  4P4P A;  3OVB A;  2ID1 A;  4QZ8 A;  3JPT A;  4PHP A;  4QZF A;  5DEC A;  7ICJ A;  8ICM A;  5DKW A;  4DOC A;  4WC0 A;  3AQK A;  1ZQV A;  7ICU A;  4WC1 A;  8ICQ A;  1ZQC A;  4RQ7 A;  2ISP A;  2FMQ A;  5CWR A;  4LT6 A;  4X5V A;  4KLT A;  2BCQ A;  4O5K A;  1ZQP A;  3C18 A;  4UAW A;  1ZQN A;  8ICY A;  4KLJ A;  4UAY A;  4AT9 A;  9ICO A;  4P2H A;  3MGH A;  5HRH A;  4FHY A;  2DR8 A;  4TUR A;  4Z6C A;  4I2G A;  5HRG A;  4O5E A;  3C5G A;  4X4Q A;  2ZH4 A;  3JZ0 A;  4AT9 B;  1BPZ A;  5J2H A;  1ZQR A;  8ICZ A;  8ICS A;  2ZHA A;  3HJ1 A;  4NXZ A;  5J2J A;  2DR7 A;  4X4U A;  5F2V O;  1ZJM A;  4WC5 A;  9ICG A;  4YD2 A;  4RPZ A;  1BPY A;  4M0A A;  4IG8 A;  9ICR A;  7ICH A;  9ICV A;  4M9N A;  3ISB A;  3RH4 A;  4FHW A;  8ICU A;  3WFS C;  5DB7 A;  4AT7 A;  4LVS A;  4F5O A;  5BOL A;  3RJF A;  5J0X A;  4YMN A;  4LZD A;  1F5A A;  2VAN A;  5D4B A;  2I9G A;  2BPG A;  2DR5 A;  1KEJ A;  7ICT A;  1TV9 A;  5J2K A;  4I2F A;  1ZJN A;  1BPB A;  9ICP A;  2W9M A;  1MQ2 A;  8ICE A;  1ZQD A;  4KLM A;  1VJ7 A;  3L9D A;  3JPO A;  4K4G A;  1V4A A;  4NKT A;  7ICK A;  9ICU A;  4FO6 A;  4KLU A;  1ZQE A;  3V72 A;  7ICM A;  4UB3 A;  4UB5 A;  3V7K A;  4UD5 A;  4X4O A;  2ZH7 A;  8ICK A;  7ICO A;  5IIM A;  3B0X A;  3UXP A;  4K4I A;  3C5F A;  1MIW A;  1ZQH A;  4LZG A;  4YMO A;  4YD1 A;  2PFO A;  2FMP A;  4UB1 A;  3PNC A;  4I2I A;  4NKU A;  2DR9 A;  4XQ8 A;  4RT2 A;  4UAZ A;  4QZG A;  5DDM A;  5J2I A;  7ICE A;  4MFF A;  1HUO A;  4PHD A;  4DOB A;  1MIV A;  4F5P A;  3UQ2 A;  1R89 A;  4DOA A;  3OVA A;  3H39 A;  4KLF A;  4M9J A;  2ZH3 A;  2BE3 A;  4YCX A;  3JYY A;  4KLD A;  4PGQ A;  5J2A A;  4F5Q A;  1UET A;  1KDH A;  4PH5 A;  5CHG A;  3RH5 A;  5BOM A;  4EP7 A;  1BPD A;  1TVA A;  3ISD A;  5HRK A;  4ATB A;  4X4S A;  4X4P A;  8ICF A;  8ICI A;  4NM1 A;  4WBY A;  4WBZ A;  4KLQ A;  4QZI A;  2ZH1 A;  4GXJ A;  3HJ4 A;  5J0Q A;  4MFA A;  1ZQJ A;  7ICQ A;  1KNY A;  4PGY A;  1XSP A;  3UXO A;  5J0O A;  4XQ7 A;  2ZH6 A;  1VFG A;  4IQV A;  5DB9 A;  8ICX A;  4KLH A;  5DBB A;  5HHI A;  8ICH A;  3V7J A;  1NO5 A;  3RJK A;  2RFF A;  4E8F A;  1ZQW A;  4M47 A;  5J2G A;  9ICF A;  8ICB A;  3JPS A;  4JWM A;  2Q66 A;  1ZQM A;  3PML A;  4R64 A;  5J0P A;  1ZQF A;  4RQ6 A;  5J2C A;  3B0Y A;  3AQN A;  1PX5 A;  5TZV A;  1ZQX A;  8ICN A;  8ICT A;  1YLQ A;  3OV7 A;  4O9M A;  4FH3 A;  5DED A;  1R8C A;  4I2C A;  4KLO A;  4RQ5 A;  3UQ0 A;  2ZHB A;  3MDC A;  1ZQK A;  7ICR A;  4IQT A;  5J2E A;  5DB6 A;  1ZQT A;  1BPE A;  4R65 A;  4KLS A;  1Q79 A;  4QZB A;  5HRL A;  4RQ2 A;  2PBE A;  5CB1 A;  1ZQQ A;  5IIO A;  5J0Y A;  4RT3 A;  1ZQS A;  4M9L A;  8ICO A;  2P66 A;  4F5R A;  2BCU A;  5J2F A;  3HW8 A;  1ZQB A;  2O1P A;  4M9G A;  4FHP A;  3AU6 A;  5HC9 A;  4GXI A;  5HRE A;  3AU2 A;  1OU5 A; 
#chains in the Genus database with same CATH topology
 1ZQG A;  4KLE A;  9ICX A;  3GDX A;  3WFQ E;  4EBK A;  3OVS A;  3ISC A;  1UEU A;  4XA5 A;  4K9B A;  2NRK A;  2ZH2 A;  3JPP A;  1XSN A;  4RWO A;  5DDY A;  3UXN A;  4I2D A;  4FHV A;  1NOM A;  7ICS A;  2M2W A;  2M2V A;  4UB2 A;  4R63 A;  3OUY B;  9ICE A;  4EEB A;  8ICP A;  1R8B A;  2BBH A;  5JTG A;  4GXK A;  1JN3 A;  7ICP A;  3MDA A;  4PHE A;  3PMN A;  5IIJ A;  1Q78 A;  4KM5 A;  4NLN A;  4K4H A;  4WC6 A;  3WFO A;  4QZH A;  1ZQI A;  4X4N A;  1UEV A;  4X4T A;  2M2T A;  5BPC A;  3UPQ A;  4PHA A;  5CA7 A;  4MF2 A;  4M5D A;  3AUO A;  4DO9 A;  4K96 A;  4NY8 A;  9ICC A;  1R8A A;  2BPC A;  9ICQ A;  2ZH8 A;  7ICN A;  4YN4 A;  5HR9 A;  4IQW A;  4IQU A;  4MKP A;  4X0A A;  3UPS A;  5IIN A;  4NXW A;  4EBJ A;  5D61 A;  4FH5 A;  7ICV A;  5J2D A;  3PHZ A;  2FMS A;  3C66 A;  4NXV A;  3H38 A;  4P4O A;  4UBB A;  4XRH A;  4RQ8 A;  4MF8 A;  3RH6 A;  4I2B A;  9ICB A;  9ICJ A;  4WC2 A;  4F5N A;  2BCS A;  5III A;  4TUQ A;  9ICT A;  5J0W A;  4QZE A;  2BCV A;  2GAF D;  4WC3 A;  1TFW A;  2GWS A;  2IHO A;  4KLL A;  3C2M A;  4S3N A;  4Z6D A;  4UBC A;  9ICK A;  3AQM A;  3HX0 A;  5EOZ A;  1ZQO A;  7ICF A;  9ICW A;  5HRF A;  4WOY A;  1MIY A;  4XUS A;  4EGW A;  2PFN A;  2PFP A;  2DRB A;  8ICG A;  3AQL A;  3OUY A;  9ICM A;  3LQC B;  1ZQL A;  9ICA A;  4OAG A;  3OGU A;  7ICL A;  1MQ3 A;  4K9A A;  4E7X A;  4UB4 A;  5J2B A;  4KLI A;  4JWN A;  3LK9 A;  4M04 A;  8ICJ A;  4X4R A;  8ICV A;  1WOT A;  5D63 A;  2O5A A;  1JMS A;  4I29 A;  8ICA A;  2HHP A;  3WFP A;  4PGX A;  4WCW A;  5HHH A;  5D62 A;  5J29 A;  4RWN A;  4Z6F A;  3C2L A;  2PFQ A;  3HIY A;  4I2J A;  3MBY A;  5DB8 A;  4M2Y A;  4FHX A;  1TFY A;  5J0R A;  4RQ0 A;  1BPX A;  4MFC A;  3H37 A;  4I27 A;  4AT8 B;  3MCR A;  1FA0 A;  3TFR A;  4TUS A;  2IHM A;  1ZQA A;  4I2E A;  1ZQY A;  8ICL A;  4X0B A;  2DVI A;  7ICG A;  4AT8 A;  2PXI A;  3K75 D;  5CJ7 A;  5IIK A;  1RZT A;  4WC7 A;  4RPY A;  2BPF A;  9ICH A;  2IUB A;  4JLX A;  1ZQZ A;  2ZH5 A;  8ICC A;  8ICR A;  9ICL A;  5CFU A;  3H3A A;  4EV6 A;  9ICN A;  1JQR A;  1ZQU A;  5J0T A;  2ZH9 A;  8ICW A;  5IIL A;  4Z6E A;  5CP2 A;  4I2A A;  4PPX A;  4QZ9 A;  4QZA A;  4WC4 A;  4X4V A;  5DBA A;  3V7L A;  4RQ1 A;  3RJE A;  2BCR A;  4M9H A;  3RJH A;  3EF2 A;  4RWQ A;  9ICI A;  4QZD A;  3JPN A;  4R66 A;  4TUP A;  2B4V A;  4KLG A;  4NLK A;  5D49 A;  3JCF A;  5HRB A;  4AT7 B;  3HWT A;  1XSL A;  4NLZ A;  3RJI A;  4NXX A;  4P4M A;  1HUZ A;  3WFR E;  5CR0 A;  4RQ4 A;  4QZC A;  5HRD A;  5D46 A;  1JAJ A;  4ATB B;  4RQ3 A;  3RJJ A;  4XJE A;  5HRI A;  1RPL A;  4RPX A;  2DRA A;  2FCL A;  3TFS A;  7ICI A;  3NKU A;  4I2H A;  3JPQ A;  2M2U A;  5DBC A;  4YMM A;  4I28 A;  4O5C A;  3RJG A;  5J0S A;  4E80 A;  3C2K A;  2ISO A;  4UD4 A;  4OAF A;  5J0U A;  3NYB A;  5CFS A;  9ICS A;  4NM2 A;  3MGI A;  4RWP A;  4O67 A;  4WH5 A;  3JPR A;  4P4P A;  3OVB A;  2ID1 A;  4QZ8 A;  3JPT A;  2HN1 A;  4PHP A;  4QZF A;  5DEC A;  7ICJ A;  8ICM A;  5DKW A;  3NWI A;  4DOC A;  4WC0 A;  3AQK A;  1ZQV A;  7ICU A;  4WC1 A;  8ICQ A;  1ZQC A;  4RQ7 A;  2ISP A;  2FMQ A;  5CWR A;  4HX0 A;  4X5V A;  4LT6 A;  4KLT A;  2BCQ A;  4O5K A;  1ZQP A;  1GPJ A;  3C18 A;  4WQL A;  4UAW A;  4LEZ A;  1ZQN A;  3CK6 A;  8ICY A;  4KLJ A;  4UAY A;  4AT9 A;  5CFT A;  9ICO A;  4P2H A;  3MGH A;  5HRH A;  4FHY A;  2DR8 A;  4TUR A;  4Z6C A;  4I2G A;  5HRG A;  4O5E A;  3C5G A;  4X4Q A;  3ERC C;  2ZH4 A;  3JZ0 A;  4AT9 B;  1BPZ A;  5J2H A;  1ZQR A;  8ICZ A;  8ICS A;  2ZHA A;  3HJ1 A;  4NXZ A;  5J2J A;  2DR7 A;  4X4U A;  5CHE A;  5F2V O;  1ZJM A;  4WC5 A;  9ICG A;  4YD2 A;  4RPZ A;  1BPY A;  4M0A A;  4K99 A;  4IG8 A;  9ICR A;  7ICH A;  4NXT A;  9ICV A;  4M9N A;  3ISB A;  3RH4 A;  4FHW A;  4K8V A;  2HN2 A;  8ICU A;  3WFS C;  5DB7 A;  4AT7 A;  4LVS A;  4F5O A;  5BOL A;  3RJF A;  5J0X A;  4N7R A;  4LEY A;  4YMN A;  2B56 A;  4LZD A;  1F5A A;  2VAN A;  5D4B A;  2I9G A;  2BPG A;  2DR5 A;  1KEJ A;  4I0U A;  7ICT A;  4LEV A;  1TV9 A;  5J2K A;  4I2F A;  1ZJN A;  4O6A A;  1BPB A;  9ICP A;  2W9M A;  1MQ2 A;  8ICE A;  1ZQD A;  4KLM A;  1VJ7 A;  3L9D A;  3JPO A;  4K4G A;  1V4A A;  4NKT A;  7ICK A;  9ICU A;  4FO6 A;  4O68 A;  4KLU A;  1ZQE A;  3V72 A;  7ICM A;  4LEW A;  4UB3 A;  2GA9 D;  4JLZ A;  4UB5 A;  3V7K A;  4UD5 A;  4X4O A;  2ZH7 A;  8ICK A;  7ICO A;  5IIM A;  3B0X A;  3UXP A;  4K4I A;  3C5F A;  4FO1 A;  1MIW A;  1ZQH A;  4LZG A;  4YMO A;  4YD1 A;  2PFO A;  2FMP A;  4UB1 A;  3PNC A;  4I2I A;  5B3Q A;  4NKU A;  2DR9 A;  4XQ8 A;  4RT2 A;  4UAZ A;  4QZG A;  5DDM A;  5J2I A;  7ICE A;  4OAI Z;  4MFF A;  1HUO A;  4PHD A;  4DOB A;  1MIV A;  4F5P A;  3UQ2 A;  1R89 A;  2BBJ A;  4DOA A;  3OVA A;  3H39 A;  4KLF A;  4M9J A;  2ZH3 A;  2BE3 A;  4YCX A;  3JYY A;  2B51 A;  3ER8 C;  4KB6 A;  4KLD A;  4PGQ A;  5J2A A;  4F5Q A;  1UET A;  1KDH A;  4PH5 A;  4OAH A;  5CHG A;  3RH5 A;  5BOM A;  4EP7 A;  1BPD A;  3NVO A;  1TVA A;  3ISD A;  5HRK A;  4ATB A;  4X4S A;  4X4P A;  4K97 A;  8ICF A;  8ICI A;  4NM1 A;  4WBY A;  4WBZ A;  4KLQ A;  4QZI A;  2ZH1 A;  4GXJ A;  3HJ4 A;  5J0Q A;  4MFA A;  1ZQJ A;  7ICQ A;  1KNY A;  4PGY A;  1XSP A;  3UXO A;  5J0O A;  4XQ7 A;  2ZH6 A;  4EED A;  1VFG A;  4IQV A;  5DB9 A;  8ICX A;  3OWG A;  4KLH A;  5DBB A;  5HHI A;  8ICH A;  3V7J A;  1NO5 A;  3RJK A;  2RFF A;  4E8F A;  1ZQW A;  4M47 A;  5J2G A;  9ICF A;  8ICB A;  3JPS A;  4JWM A;  2Q66 A;  1ZQM A;  3PML A;  4WQK A;  4NXU A;  4R64 A;  5J0P A;  1ZQF A;  4RQ6 A;  5J2C A;  3B0Y A;  3AQN A;  1PX5 A;  5TZV A;  1ZQX A;  8ICN A;  8ICT A;  1YLQ A;  3OV7 A;  4O9M A;  4FH3 A;  5DED A;  1R8C A;  4I2C A;  4KLO A;  4RQ5 A;  3UQ0 A;  2ZHB A;  3MDC A;  3ER9 B;  1ZQK A;  7ICR A;  4K98 A;  4IQT A;  5J2E A;  5DB6 A;  1ZQT A;  3K7D A;  1BPE A;  4R65 A;  4KLS A;  1Q79 A;  4QZB A;  5HRL A;  4RQ2 A;  2PBE A;  5CB1 A;  1ZQQ A;  5IIO A;  5J0Y A;  4RT3 A;  1ZQS A;  4M9L A;  8ICO A;  2P66 A;  4F5R A;  2BCU A;  5J2F A;  3HW8 A;  1ZQB A;  2EWR A;  4M9G A;  2O1P A;  3AU6 A;  4FHP A;  4O69 A;  5B3P A;  5HC9 A;  4GXI A;  5HRE A;  3AU2 A;  1OU5 A; 
#chains in the Genus database with same CATH homology
 1ZQG A;  4KLE A;  9ICX A;  3GDX A;  3WFQ E;  4EBK A;  3OVS A;  3ISC A;  1UEU A;  4XA5 A;  2NRK A;  2ZH2 A;  3JPP A;  1XSN A;  4RWO A;  5DDY A;  3UXN A;  4I2D A;  4FHV A;  1NOM A;  7ICS A;  2M2W A;  2M2V A;  4UB2 A;  4R63 A;  3OUY B;  9ICE A;  8ICP A;  1R8B A;  4GXK A;  1JN3 A;  7ICP A;  3MDA A;  4PHE A;  3PMN A;  5IIJ A;  1Q78 A;  4NLN A;  4K4H A;  4WC6 A;  3WFO A;  4QZH A;  1ZQI A;  4X4N A;  1UEV A;  4X4T A;  2M2T A;  5BPC A;  3UPQ A;  4PHA A;  5CA7 A;  4MF2 A;  4M5D A;  3AUO A;  4DO9 A;  4NY8 A;  9ICC A;  1R8A A;  2BPC A;  9ICQ A;  2ZH8 A;  7ICN A;  4YN4 A;  5HR9 A;  4IQW A;  4IQU A;  4X0A A;  3UPS A;  5IIN A;  4EBJ A;  4FH5 A;  7ICV A;  5J2D A;  2FMS A;  3C66 A;  3H38 A;  4P4O A;  4UBB A;  4XRH A;  4RQ8 A;  4MF8 A;  3RH6 A;  4I2B A;  9ICB A;  9ICJ A;  4WC2 A;  4F5N A;  2BCS A;  5III A;  4TUQ A;  9ICT A;  5J0W A;  4QZE A;  2BCV A;  4WC3 A;  1TFW A;  2GWS A;  4KLL A;  3C2M A;  4S3N A;  4Z6D A;  4UBC A;  9ICK A;  3AQM A;  3HX0 A;  5EOZ A;  1ZQO A;  7ICF A;  9ICW A;  5HRF A;  1MIY A;  4XUS A;  2PFN A;  2PFP A;  2DRB A;  8ICG A;  3AQL A;  3OUY A;  9ICM A;  3LQC B;  1ZQL A;  9ICA A;  3OGU A;  7ICL A;  1MQ3 A;  4E7X A;  4UB4 A;  5J2B A;  4KLI A;  4JWN A;  3LK9 A;  4M04 A;  8ICJ A;  4X4R A;  8ICV A;  1WOT A;  2O5A A;  1JMS A;  4I29 A;  8ICA A;  2HHP A;  3WFP A;  4PGX A;  4WCW A;  5HHH A;  4RWN A;  5J29 A;  4Z6F A;  3C2L A;  2PFQ A;  3HIY A;  4I2J A;  3MBY A;  5DB8 A;  4M2Y A;  4FHX A;  1TFY A;  5J0R A;  4RQ0 A;  1BPX A;  4MFC A;  3H37 A;  4I27 A;  4AT8 B;  1FA0 A;  3TFR A;  4TUS A;  2IHM A;  1ZQA A;  4I2E A;  1ZQY A;  8ICL A;  4X0B A;  2DVI A;  7ICG A;  4AT8 A;  2PXI A;  3K75 D;  5CJ7 A;  5IIK A;  1RZT A;  4WC7 A;  4RPY A;  2BPF A;  9ICH A;  1ZQZ A;  2ZH5 A;  8ICC A;  8ICR A;  9ICL A;  3H3A A;  9ICN A;  1JQR A;  1ZQU A;  5J0T A;  2ZH9 A;  8ICW A;  5IIL A;  4Z6E A;  5CP2 A;  4I2A A;  4PPX A;  4QZ9 A;  4QZA A;  4WC4 A;  4X4V A;  5DBA A;  3V7L A;  4RQ1 A;  3RJE A;  2BCR A;  4M9H A;  3RJH A;  4RWQ A;  9ICI A;  4QZD A;  3JPN A;  4R66 A;  4TUP A;  4KLG A;  4NLK A;  5D49 A;  5HRB A;  4AT7 B;  3HWT A;  1XSL A;  4NLZ A;  3RJI A;  4P4M A;  1HUZ A;  3WFR E;  5CR0 A;  4RQ4 A;  4QZC A;  5HRD A;  5D46 A;  1JAJ A;  4ATB B;  4RQ3 A;  3RJJ A;  5HRI A;  1RPL A;  4RPX A;  2DRA A;  3TFS A;  7ICI A;  4I2H A;  3JPQ A;  2M2U A;  5DBC A;  4YMM A;  4I28 A;  4O5C A;  3RJG A;  5J0S A;  4E80 A;  3C2K A;  2ISO A;  4UD4 A;  5J0U A;  3NYB A;  9ICS A;  4NM2 A;  3MGI A;  4RWP A;  3JPR A;  4P4P A;  3OVB A;  2ID1 A;  4QZ8 A;  3JPT A;  4PHP A;  4QZF A;  5DEC A;  7ICJ A;  8ICM A;  5DKW A;  4DOC A;  4WC0 A;  3AQK A;  1ZQV A;  7ICU A;  4WC1 A;  8ICQ A;  1ZQC A;  4RQ7 A;  2ISP A;  2FMQ A;  5CWR A;  4LT6 A;  4X5V A;  4KLT A;  2BCQ A;  4O5K A;  1ZQP A;  3C18 A;  4UAW A;  1ZQN A;  8ICY A;  4KLJ A;  4UAY A;  4AT9 A;  9ICO A;  4P2H A;  3MGH A;  5HRH A;  4FHY A;  2DR8 A;  4TUR A;  4Z6C A;  4I2G A;  5HRG A;  4O5E A;  3C5G A;  4X4Q A;  2ZH4 A;  3JZ0 A;  4AT9 B;  1BPZ A;  5J2H A;  1ZQR A;  8ICZ A;  8ICS A;  2ZHA A;  3HJ1 A;  4NXZ A;  5J2J A;  2DR7 A;  4X4U A;  5F2V O;  1ZJM A;  4WC5 A;  9ICG A;  4YD2 A;  4RPZ A;  1BPY A;  4M0A A;  4IG8 A;  9ICR A;  7ICH A;  9ICV A;  4M9N A;  3ISB A;  3RH4 A;  4FHW A;  8ICU A;  3WFS C;  5DB7 A;  4AT7 A;  4LVS A;  4F5O A;  5BOL A;  3RJF A;  5J0X A;  4YMN A;  4LZD A;  1F5A A;  2VAN A;  5D4B A;  2I9G A;  2BPG A;  2DR5 A;  1KEJ A;  7ICT A;  1TV9 A;  5J2K A;  4I2F A;  1ZJN A;  1BPB A;  9ICP A;  2W9M A;  1MQ2 A;  8ICE A;  1ZQD A;  4KLM A;  1VJ7 A;  3L9D A;  3JPO A;  4K4G A;  1V4A A;  4NKT A;  7ICK A;  9ICU A;  4FO6 A;  4KLU A;  1ZQE A;  3V72 A;  7ICM A;  4UB3 A;  4UB5 A;  3V7K A;  4UD5 A;  4X4O A;  2ZH7 A;  8ICK A;  7ICO A;  5IIM A;  3B0X A;  3UXP A;  4K4I A;  3C5F A;  1MIW A;  1ZQH A;  4LZG A;  4YMO A;  4YD1 A;  2PFO A;  2FMP A;  4UB1 A;  3PNC A;  4I2I A;  4NKU A;  2DR9 A;  4XQ8 A;  4RT2 A;  4UAZ A;  4QZG A;  5DDM A;  5J2I A;  7ICE A;  4MFF A;  1HUO A;  4PHD A;  4DOB A;  1MIV A;  4F5P A;  3UQ2 A;  1R89 A;  4DOA A;  3OVA A;  3H39 A;  4KLF A;  4M9J A;  2ZH3 A;  2BE3 A;  4YCX A;  3JYY A;  4KLD A;  4PGQ A;  5J2A A;  4F5Q A;  1UET A;  1KDH A;  4PH5 A;  5CHG A;  3RH5 A;  5BOM A;  4EP7 A;  1BPD A;  1TVA A;  3ISD A;  5HRK A;  4ATB A;  4X4S A;  4X4P A;  8ICF A;  8ICI A;  4NM1 A;  4WBY A;  4WBZ A;  4KLQ A;  4QZI A;  2ZH1 A;  4GXJ A;  3HJ4 A;  5J0Q A;  4MFA A;  1ZQJ A;  7ICQ A;  1KNY A;  4PGY A;  1XSP A;  3UXO A;  5J0O A;  4XQ7 A;  2ZH6 A;  1VFG A;  4IQV A;  5DB9 A;  8ICX A;  4KLH A;  5DBB A;  5HHI A;  8ICH A;  3V7J A;  1NO5 A;  3RJK A;  2RFF A;  4E8F A;  1ZQW A;  4M47 A;  5J2G A;  9ICF A;  8ICB A;  3JPS A;  4JWM A;  2Q66 A;  1ZQM A;  3PML A;  4R64 A;  5J0P A;  1ZQF A;  4RQ6 A;  5J2C A;  3B0Y A;  3AQN A;  1PX5 A;  5TZV A;  1ZQX A;  8ICN A;  8ICT A;  1YLQ A;  3OV7 A;  4O9M A;  4FH3 A;  5DED A;  1R8C A;  4I2C A;  4KLO A;  4RQ5 A;  3UQ0 A;  2ZHB A;  3MDC A;  1ZQK A;  7ICR A;  4IQT A;  5J2E A;  5DB6 A;  1ZQT A;  1BPE A;  4R65 A;  4KLS A;  1Q79 A;  4QZB A;  5HRL A;  4RQ2 A;  2PBE A;  5CB1 A;  1ZQQ A;  5IIO A;  5J0Y A;  4RT3 A;  1ZQS A;  4M9L A;  8ICO A;  2P66 A;  4F5R A;  2BCU A;  5J2F A;  3HW8 A;  1ZQB A;  2O1P A;  4M9G A;  4FHP A;  3AU6 A;  5HC9 A;  4GXI A;  5HRE A;  3AU2 A;  1OU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...