1JAJA

Solution structure of dna polymerase x from the african swine fever virus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA-LIKE PROTEIN
publication title Solution structure of a viral DNA repair polymerase.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Viral protein
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jajA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jajA01
2BPFA 4WC4A 4X0BA 1JAJA 8ICNA 4WC7A 3C5GA 2VANA 4WC2A 5J0PA 1ZQKA 3WFSC 5CR0A 3UXNA 4WBZA 8ICMA 9ICGA 1BPEA 4I27A 5J0UA 1ZQHA 7ICUA 9ICXA 3TFSA 7ICIA 3TFRA 4DOCA 7ICRA 4KLQA 1ZQTA 1ZQEA 1VJ7A 4Z6DA 3UPSA 1ZQWA 4UB5A 4FH5A 5EOZA 4UAWA 5BOMA 1ZQFA 5DBAA 2ID1A 5BOLA 3RH4A 3V7LA 4K4HA 4QZAA 4TUSA 3AQMA 3JPOA 2PFOA 4AT8A 5DB7A 5HRLA 4RWOA 3V72A 4TUPA 5J29A 4TUQA 8ICHA 4YN4A 1FA0A 8ICWA 4I2DA 5CWRA 5J0YA 4F5RA 1YLQA 4NLZA 3V7JA 1BPYA 4M47A 1HUZA 3UPQA 2GWSA 4RQ5A 5J2DA 3H38A 3JPTA 3RJKA 9ICMA 2ISOA 1BPBA 4AT9A 4RQ3A 4X4UA 1JN3A 4MFFA 3MDCA 1TVAA 1ZQIA 4QZEA 5DKWA 4IQVA 8ICLA 4E80A 4I2EA 2BPGA 5DBBA 8ICEA 2PFQA 1ZQAA 1MIWA 3JPSA 4RQ7A 1ZJMA 5HRFA 4RQ6A 2RFFA 4M0AA 1OU5A 4I2IA 4KLDA 3OUYB 1KDHA 4RQ8A 4X0AA 2DRBA 2ZH5A 1TFYA 4QZCA 2ZH2A 4MFAA 4R65A 1BPZA 1ZQJA 4I2HA 4S3NA 4KLTA 4GXJA 4E8FA 4RPZA 5J2EA 5HRGA 7ICMA 4AT7B 5J2CA 2DRAA 4NKUA 4LZGA 1ZQRA 3C2KA 8ICOA 3C2LA 4R63A 4FHWA 3B0XA 4X4OA 4XQ8A 4WC6A 4UBCA 4X4SA 1ZQCA 2PXIA 3HJ4A 5DBCA 1ZQGA 4Z6FA 4WC5A 2BPCA 2DR5A 4RPYA 3MDAA 1ZQQA 1ZQXA 5HREA 4M2YA 5D4BA 1R8BA 2NRKA 3RJEA 4PGQA 1NO5A 8ICZA 2M2TA 4KLJA 4UAZA 4YMMA 3PMNA 3JPPA 4KLOA 2I9GA 3RJFA 4YCXA 3UXPA 4R66A 4WCWA 3OV7A 4DOAA 4KLMA 3WFOA 1ZQZA 3AQLA 4JWNA 9ICHA 3MGHA 3LQCB 2IHMA 4KLEA 2O5AA 8ICBA 4EBKA 3AQKA 3C66A 8ICXA 1JQRA 4UB3A 4F5PA 4KLLA 3HW8A 3OGUA 5HRHA 4YD1A 3GDXA 8ICCA 4QZFA 4MF8A 7ICJA 4RPXA 5HRDA 3B0YA 3JPRA 5TZVA 5IIMA 4TURA 2BCQA 9ICPA 5IIOA 5DB8A 1HUOA 9ICVA 1PX5A 1XSLA 5HR9A 4RWQA 3HIYA 5J2GA 8ICGA 2M2UA 4FHXA 4NY8A 7ICVA 3HJ1A 4M9NA 1R8CA 4PHDA 1Q78A 3RH6A 1UETA 4UB2A 4O5CA 7ICLA 5J0XA 9ICEA 1JMSA 4PHAA 4I2AA 3H37A 4PHPA 4M9GA 3UXOA 4EP7A 2HHPA 5IINA 4WC3A 8ICYA 1ZQBA 2PFPA 4YMOA 4UD5A 5CJ7A 3PMLA 1ZQVA 3K75D 4KLHA 5HHIA 5J2FA 8ICRA 9ICSA 4UAYA 2W9MA 2BE3A 5F2VO 9ICQA 7ICTA 4UB4A 8ICAA 9ICIA 5HRIA 3WFPA 3MBYA 4LZDA 1BPXA 5J2HA 3AUOA 5J2JA 3OUYA 3V7KA 1ZQLA 9ICNA 4M5DA 2BCUA 4KLFA 4Z6EA 2BCVA 2ZHAA 1MIVA 2FMSA 9ICJA 7ICNA 4FO6A 1ZJNA 4UB1A 2DR8A 5J2KA 5HRKA 3ISBA 7ICPA 1VFGA 9ICKA 4KLSA 4AT7A 4X4RA 5IILA 9ICFA 5CB1A 4O5KA 4PGYA 4LVSA 3WFRE 3OVSA 9ICBA 4YD2A 4WC1A 2P66A 1RPLA 5BPCA 4E7XA 4WC0A 4RQ4A 2M2WA 3L9DA 4IQTA 4RQ0A 4I28A 2ZH1A 4XQ7A 5DECA 1ZQSA 5IIKA 3RJJA 3OVAA 4RWNA 3C2MA 5J2IA 4IQUA 2ZH7A 2Q66A 4LT6A 1ZQPA 2ZHBA 4FHPA 4I2CA 8ICQA 4X4TA 4QZ9A 3H39A 3NYBA 5J0OA 1KNYA 3JPQA 8ICUA 1ZQOA 5DB6A 4GXIA 3OVBA 4XA5A 4X4QA 4UBBA 9ICAA 5J0WA 7ICKA 4ATBB 4QZIA 8ICPA 4RT3A 4X4VA 4P4MA 1ZQNA 4AT8B 1Q79A 4MFCA 1ZQUA 3RJGA 3ISDA 7ICHA 4Z6CA 2DR9A 4IG8A 4UD4A 3PNCA 4I29A 8ICIA 4ATBA 1R8AA 4KLGA 4I2BA 2M2VA 8ICFA 4X4PA 3AQNA 4AT9B 4RQ2A 2BCRA 3UQ0A 4M9HA 7ICSA 4NM1A 5D46A 9ICRA 1TFWA 5DDMA 1XSNA 3RJIA 4IQWA 3ISCA 7ICGA 5J0TA 2ISPA 3WFQE 1MQ2A 4QZGA 2FMQA 4I2JA 4F5NA 1WOTA 3AU6A 5DEDA 1UEVA 9ICLA 9ICOA 4I2FA 4QZ8A 5HHHA 2PFNA 4NLNA 4P2HA 5HC9A 5HRBA 1MIYA 9ICTA 4P4OA 5J0QA 4F5OA 3RH5A 4MF2A 4RT2A 1BPDA 4NXZA 7ICEA 8ICSA 1F5AA 1ZQDA 5D49A 9ICCA 2FMPA 4DO9A 4R64A 4YMNA 4EBJA 1RZTA 9ICUA 3HWTA 3JPNA 4QZHA 4F5QA 4RWPA 2O1PA 7ICOA 4QZBA 5J2AA 4KLIA 3AU2A 5CHGA 4FH3A 1UEUA 4RQ1A 4M9LA 5IIIA 4P4PA 1ZQYA 4K4GA 4DOBA 1V4AA 4XUSA 4FHVA 3HX0A 2BCSA 7ICFA 1XSPA 3C18A 4WBYA 5J2BA 4FHYA 2ZH3A 2ZH4A 4PGXA 4I2GA 8ICJA 4M04A 4GXKA 4M9JA 3JZ0A 1NOMA 4X5VA 5DDYA 2ZH8A 3H3AA 4K4IA 5CP2A 5DB9A 4NKTA 5CA7A 4PH5A 4O5EA 4X4NA 8ICKA 2PBEA 4KLUA 4XRHA 3RJHA 1R89A 1MQ3A 4JWMA 2DVIA 3C5FA 8ICVA 2DR7A 1ZQMA 3UQ2A 1KEJA 5J0RA 2ZH6A 1TV9A 5J0SA 4NM2A 3MGIA 4O9MA 4PPXA 2ZH9A 3JYYA 4QZDA 4NLKA 9ICWA 4PHEA 7ICQA 3LK9A 8ICTA 5IIJA
chains in the Genus database with same CATH superfamily
2BPFA 3OWGA 4WC4A 4X0BA 3MCRA 1JAJA 8ICNA 4WC7A 3C5GA 4OAFA 2VANA 4O6AA 4WC2A 5J0PA 1ZQKA 3WFSC 5CR0A 3UXNA 4WBZA 8ICMA 9ICGA 2GA9D 1BPEA 4I27A 5J0UA 1ZQHA 7ICUA 9ICXA 3TFSA 4NXTA 7ICIA 3ER8C 3TFRA 4DOCA 7ICRA 4KLQA 1ZQTA 1ZQEA 1VJ7A 4Z6DA 4KB6A 4NXUA 4WOYA 3UPSA 1ZQWA 4UB5A 4FH5A 5EOZA 4UAWA 5BOMA 1ZQFA 5DBAA 2ID1A 5BOLA 3RH4A 3V7LA 4K4HA 4QZAA 4TUSA 3AQMA 3JPOA 2PFOA 4AT8A 5DB7A 5HRLA 4RWOA 3V72A 4TUPA 5J29A 4TUQA 5CFSA 8ICHA 4YN4A 1FA0A 8ICWA 4OAHA 4I2DA 5CWRA 5J0YA 4F5RA 1YLQA 4NLZA 3V7JA 1BPYA 4M47A 1HUZA 3UPQA 2GWSA 4RQ5A 5J2DA 3H38A 3JPTA 3RJKA 9ICMA 4O67A 2ISOA 3NVOA 1BPBA 4AT9A 4RQ3A 4X4UA 1JN3A 4MFFA 5D61A 3MDCA 1TVAA 1ZQIA 4QZEA 5DKWA 4EV6A 4IQVA 8ICLA 3EF2A 4E80A 4I2EA 2BPGA 5CHEA 5DBBA 8ICEA 2PFQA 2HN2A 1ZQAA 1MIWA 3JPSA 4RQ7A 1ZJMA 5HRFA 4RQ6A 2RFFA 4M0AA 1OU5A 4I2IA 4KLDA 3OUYB 1KDHA 4RQ8A 4MKPA 4X0AA 2DRBA 2ZH5A 1TFYA 4QZCA 2ZH2A 4WQKA 4MFAA 4R65A 1BPZA 1ZQJA 4I2HA 4S3NA 4KLTA 4GXJA 4E8FA 4RPZA 5J2EA 4KM5A 4WH5A 5HRGA 7ICMA 4AT7B 4LEWA 5J2CA 2DRAA 4NKUA 4LZGA 1ZQRA 3C2KA 8ICOA 3C2LA 4R63A 4FHWA 3B0XA 4X4OA 4XQ8A 4O68A 4WC6A 4UBCA 4X4SA 1ZQCA 2PXIA 3HJ4A 3CK6A 5DBCA 1ZQGA 4Z6FA 4WC5A 2BPCA 2DR5A 4RPYA 4NXVA 3MDAA 1ZQQA 1ZQXA 5HREA 4M2YA 5D4BA 1R8BA 2NRKA 3RJEA 4PGQA 1NO5A 8ICZA 2M2TA 4KLJA 4UAZA 4YMMA 2IHOA 3PMNA 3JPPA 4KLOA 4K96A 2I9GA 3RJFA 4YCXA 3UXPA 4R66A 4WCWA 3OV7A 4DOAA 4KLMA 3WFOA 1ZQZA 3AQLA 4JWNA 9ICHA 3MGHA 3LQCB 2IHMA 4KLEA 5CFTA 2O5AA 8ICBA 4EBKA 3AQKA 3C66A 8ICXA 1JQRA 4UB3A 4F5PA 4KLLA 3HW8A 3OGUA 5HRHA 3NWIA 4YD1A 3GDXA 8ICCA 2B51A 4QZFA 4MF8A 7ICJA 4RPXA 5HRDA 4LEVA 3B0YA 1GPJA 3JPRA 5TZVA 5IIMA 4TURA 2BCQA 2B56A 9ICPA 5IIOA 5DB8A 1HUOA 9ICVA 4K99A 1PX5A 1XSLA 5HR9A 4RWQA 3HIYA 5J2GA 8ICGA 2M2UA 5D62A 4FHXA 4NY8A 7ICVA 3HJ1A 4M9NA 1R8CA 4PHDA 1Q78A 3RH6A 5CFUA 1UETA 4UB2A 4O5CA 7ICLA 5J0XA 9ICEA 3NKUA 1JMSA 4PHAA 4I2AA 3H37A 4PHPA 4M9GA 3UXOA 4EP7A 4OAGA 2HHPA 5IINA 4WC3A 4K8VA 8ICYA 1ZQBA 2PFPA 4O69A 4YMOA 4UD5A 5CJ7A 3PMLA 1ZQVA 2IUBA 3K75D 4KLHA 5HHIA 5J2FA 8ICRA 9ICSA 4NXXA 4UAYA 2W9MA 2BE3A 5F2VO 9ICQA 7ICTA 4UB4A 8ICAA 9ICIA 2BBJA 5HRIA 3WFPA 3MBYA 4LZDA 1BPXA 5J2HA 4EGWA 3AUOA 5J2JA 3OUYA 3V7KA 4LEZA 1ZQLA 9ICNA 4M5DA 2BCUA 4KLFA 4Z6EA 2BCVA 2ZHAA 1MIVA 2FMSA 9ICJA 7ICNA 4K9BA 4FO6A 1ZJNA 4UB1A 2DR8A 5J2KA 5HRKA 3ISBA 7ICPA 1VFGA 9ICKA 4KLSA 4AT7A 4X4RA 2HN1A 2FCLA 5IILA 9ICFA 5CB1A 4O5KA 4PGYA 4LVSA 3WFRE 3OVSA 9ICBA 4YD2A 4WC1A 2P66A 1RPLA 5BPCA 5B3QA 4E7XA 4WC0A 4RQ4A 4OAIZ 2M2WA 4LEYA 3L9DA 4IQTA 4RQ0A 4I28A 2ZH1A 4XQ7A 5DECA 1ZQSA 5IIKA 3RJJA 3OVAA 4RWNA 3C2MA 4EEDA 5J2IA 4IQUA 2ZH7A 2Q66A 4LT6A 1ZQPA 2ZHBA 4FHPA 4I2CA 8ICQA 4X4TA 4K9AA 4QZ9A 3H39A 3NYBA 5J0OA 1KNYA 3JPQA 8ICUA 4I0UA 1ZQOA 5DB6A 4GXIA 4JLZA 2EWRA 3OVBA 4XA5A 4X4QA 4UBBA 9ICAA 5J0WA 7ICKA 5JTGA 4ATBB 4QZIA 8ICPA 4RT3A 4XJEA 4X4VA 4P4MA 1ZQNA 4AT8B 1Q79A 4MFCA 1ZQUA 3RJGA 3ISDA 7ICHA 4Z6CA 2DR9A 2GAFD 4IG8A 4UD4A 3PNCA 4I29A 8ICIA 3PHZA 4ATBA 1R8AA 4KLGA 4I2BA 2M2VA 8ICFA 5D63A 4X4PA 3AQNA 4AT9B 4RQ2A 2BCRA 3UQ0A 4M9HA 7ICSA 4NM1A 5D46A 9ICRA 1TFWA 5DDMA 1XSNA 3RJIA 4IQWA 3ISCA 7ICGA 5J0TA 2ISPA 3WFQE 1MQ2A 4QZGA 2FMQA 4I2JA 4F5NA 1WOTA 3AU6A 5DEDA 1UEVA 9ICLA 3K7DA 9ICOA 4I2FA 4QZ8A 5HHHA 2PFNA 4NLNA 4P2HA 4FO1A 5HC9A 3ERCC 5HRBA 1MIYA 9ICTA 4P4OA 5J0QA 4F5OA 3RH5A 4MF2A 4RT2A 1BPDA 4NXZA 7ICEA 8ICSA 1F5AA 1ZQDA 5D49A 9ICCA 4N7RA 2FMPA 4DO9A 4R64A 4JLXA 4YMNA 4EBJA 1RZTA 9ICUA 4NXWA 3HWTA 3JPNA 4QZHA 4F5QA 4RWPA 2O1PA 7ICOA 4QZBA 5J2AA 4KLIA 3AU2A 5CHGA 4HX0A 4FH3A 1UEUA 4RQ1A 4M9LA 5IIIA 4P4PA 1ZQYA 4K98A 4K4GA 4DOBA 1V4AA 4XUSA 4FHVA 3HX0A 2B4VA 2BCSA 7ICFA 1XSPA 3C18A 4WBYA 3ER9B 5J2BA 4FHYA 2BBHA 2ZH3A 2ZH4A 4PGXA 4I2GA 8ICJA 4K97A 4M04A 5B3PA 4GXKA 4M9JA 3JZ0A 1NOMA 4X5VA 5DDYA 2ZH8A 3H3AA 4K4IA 4WQLA 3JCFA 5CP2A 5DB9A 4NKTA 5CA7A 4PH5A 4O5EA 4X4NA 8ICKA 2PBEA 4KLUA 4XRHA 3RJHA 1R89A 1MQ3A 4JWMA 2DVIA 3C5FA 8ICVA 2DR7A 1ZQMA 3UQ2A 1KEJA 5J0RA 2ZH6A 1TV9A 5J0SA 4NM2A 3MGIA 4O9MA 4PPXA 2ZH9A 3JYYA 4QZDA 4NLKA 9ICWA 4PHEA 7ICQA 4EEBA 3LK9A 8ICTA 5IIJA
chains in the Genus database with same CATH topology
2BPFA 4WC4A 4X0BA 1JAJA 8ICNA 4WC7A 3C5GA 2VANA 4WC2A 5J0PA 1ZQKA 3WFSC 5CR0A 3UXNA 4WBZA 8ICMA 9ICGA 1BPEA 4I27A 5J0UA 1ZQHA 7ICUA 9ICXA 3TFSA 7ICIA 3TFRA 4DOCA 7ICRA 4KLQA 1ZQTA 1ZQEA 1VJ7A 4Z6DA 3UPSA 1ZQWA 4UB5A 4FH5A 5EOZA 4UAWA 5BOMA 1ZQFA 5DBAA 2ID1A 5BOLA 3RH4A 3V7LA 4K4HA 4QZAA 4TUSA 3AQMA 3JPOA 2PFOA 4AT8A 5DB7A 5HRLA 4RWOA 3V72A 4TUPA 5J29A 4TUQA 8ICHA 4YN4A 1FA0A 8ICWA 4I2DA 5CWRA 5J0YA 4F5RA 1YLQA 4NLZA 3V7JA 1BPYA 4M47A 1HUZA 3UPQA 2GWSA 4RQ5A 5J2DA 3H38A 3JPTA 3RJKA 9ICMA 2ISOA 1BPBA 4AT9A 4RQ3A 4X4UA 1JN3A 4MFFA 3MDCA 1TVAA 1ZQIA 4QZEA 5DKWA 4IQVA 8ICLA 4E80A 4I2EA 2BPGA 5DBBA 8ICEA 2PFQA 1ZQAA 1MIWA 3JPSA 4RQ7A 1ZJMA 5HRFA 4RQ6A 2RFFA 4M0AA 1OU5A 4I2IA 4KLDA 3OUYB 1KDHA 4RQ8A 4X0AA 2DRBA 2ZH5A 1TFYA 4QZCA 2ZH2A 4MFAA 4R65A 1BPZA 1ZQJA 4I2HA 4S3NA 4KLTA 4GXJA 4E8FA 4RPZA 5J2EA 5HRGA 7ICMA 4AT7B 5J2CA 2DRAA 4NKUA 4LZGA 1ZQRA 3C2KA 8ICOA 3C2LA 4R63A 4FHWA 3B0XA 4X4OA 4XQ8A 4WC6A 4UBCA 4X4SA 1ZQCA 2PXIA 3HJ4A 5DBCA 1ZQGA 4Z6FA 4WC5A 2BPCA 2DR5A 4RPYA 3MDAA 1ZQQA 1ZQXA 5HREA 4M2YA 5D4BA 1R8BA 2NRKA 3RJEA 4PGQA 1NO5A 8ICZA 2M2TA 4KLJA 4UAZA 4YMMA 3PMNA 3JPPA 4KLOA 2I9GA 3RJFA 4YCXA 3UXPA 4R66A 4WCWA 3OV7A 4DOAA 4KLMA 3WFOA 1ZQZA 3AQLA 4JWNA 9ICHA 3MGHA 3LQCB 2IHMA 4KLEA 2O5AA 8ICBA 4EBKA 3AQKA 3C66A 8ICXA 1JQRA 4UB3A 4F5PA 4KLLA 3HW8A 3OGUA 5HRHA 4YD1A 3GDXA 8ICCA 4QZFA 4MF8A 7ICJA 4RPXA 5HRDA 3B0YA 3JPRA 5TZVA 5IIMA 4TURA 2BCQA 9ICPA 5IIOA 5DB8A 1HUOA 9ICVA 1PX5A 1XSLA 5HR9A 4RWQA 3HIYA 5J2GA 8ICGA 2M2UA 4FHXA 4NY8A 7ICVA 3HJ1A 4M9NA 1R8CA 4PHDA 1Q78A 3RH6A 1UETA 4UB2A 4O5CA 7ICLA 5J0XA 9ICEA 1JMSA 4PHAA 4I2AA 3H37A 4PHPA 4M9GA 3UXOA 4EP7A 2HHPA 5IINA 4WC3A 8ICYA 1ZQBA 2PFPA 4YMOA 4UD5A 5CJ7A 3PMLA 1ZQVA 3K75D 4KLHA 5HHIA 5J2FA 8ICRA 9ICSA 4UAYA 2W9MA 2BE3A 5F2VO 9ICQA 7ICTA 4UB4A 8ICAA 9ICIA 5HRIA 3WFPA 3MBYA 4LZDA 1BPXA 5J2HA 3AUOA 5J2JA 3OUYA 3V7KA 1ZQLA 9ICNA 4M5DA 2BCUA 4KLFA 4Z6EA 2BCVA 2ZHAA 1MIVA 2FMSA 9ICJA 7ICNA 4FO6A 1ZJNA 4UB1A 2DR8A 5J2KA 5HRKA 3ISBA 7ICPA 1VFGA 9ICKA 4KLSA 4AT7A 4X4RA 5IILA 9ICFA 5CB1A 4O5KA 4PGYA 4LVSA 3WFRE 3OVSA 9ICBA 4YD2A 4WC1A 2P66A 1RPLA 5BPCA 4E7XA 4WC0A 4RQ4A 2M2WA 3L9DA 4IQTA 4RQ0A 4I28A 2ZH1A 4XQ7A 5DECA 1ZQSA 5IIKA 3RJJA 3OVAA 4RWNA 3C2MA 5J2IA 4IQUA 2ZH7A 2Q66A 4LT6A 1ZQPA 2ZHBA 4FHPA 4I2CA 8ICQA 4X4TA 4QZ9A 3H39A 3NYBA 5J0OA 1KNYA 3JPQA 8ICUA 1ZQOA 5DB6A 4GXIA 3OVBA 4XA5A 4X4QA 4UBBA 9ICAA 5J0WA 7ICKA 4ATBB 4QZIA 8ICPA 4RT3A 4X4VA 4P4MA 1ZQNA 4AT8B 1Q79A 4MFCA 1ZQUA 3RJGA 3ISDA 7ICHA 4Z6CA 2DR9A 4IG8A 4UD4A 3PNCA 4I29A 8ICIA 4ATBA 1R8AA 4KLGA 4I2BA 2M2VA 8ICFA 4X4PA 3AQNA 4AT9B 4RQ2A 2BCRA 3UQ0A 4M9HA 7ICSA 4NM1A 5D46A 9ICRA 1TFWA 5DDMA 1XSNA 3RJIA 4IQWA 3ISCA 7ICGA 5J0TA 2ISPA 3WFQE 1MQ2A 4QZGA 2FMQA 4I2JA 4F5NA 1WOTA 3AU6A 5DEDA 1UEVA 9ICLA 9ICOA 4I2FA 4QZ8A 5HHHA 2PFNA 4NLNA 4P2HA 5HC9A 5HRBA 1MIYA 9ICTA 4P4OA 5J0QA 4F5OA 3RH5A 4MF2A 4RT2A 1BPDA 4NXZA 7ICEA 8ICSA 1F5AA 1ZQDA 5D49A 9ICCA 2FMPA 4DO9A 4R64A 4YMNA 4EBJA 1RZTA 9ICUA 3HWTA 3JPNA 4QZHA 4F5QA 4RWPA 2O1PA 7ICOA 4QZBA 5J2AA 4KLIA 3AU2A 5CHGA 4FH3A 1UEUA 4RQ1A 4M9LA 5IIIA 4P4PA 1ZQYA 4K4GA 4DOBA 1V4AA 4XUSA 4FHVA 3HX0A 2BCSA 7ICFA 1XSPA 3C18A 4WBYA 5J2BA 4FHYA 2ZH3A 2ZH4A 4PGXA 4I2GA 8ICJA 4M04A 4GXKA 4M9JA 3JZ0A 1NOMA 4X5VA 5DDYA 2ZH8A 3H3AA 4K4IA 5CP2A 5DB9A 4NKTA 5CA7A 4PH5A 4O5EA 4X4NA 8ICKA 2PBEA 4KLUA 4XRHA 3RJHA 1R89A 1MQ3A 4JWMA 2DVIA 3C5FA 8ICVA 2DR7A 1ZQMA 3UQ2A 1KEJA 5J0RA 2ZH6A 1TV9A 5J0SA 4NM2A 3MGIA 4O9MA 4PPXA 2ZH9A 3JYYA 4QZDA 4NLKA 9ICWA 4PHEA 7ICQA 3LK9A 8ICTA 5IIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPF A;  4WC4 A;  4X0B A;  1JAJ A;  8ICN A;  4WC7 A;  3C5G A;  2VAN A;  4WC2 A;  5J0P A;  1ZQK A;  3WFS C;  5CR0 A;  3UXN A;  4WBZ A;  8ICM A;  9ICG A;  1BPE A;  4I27 A;  5J0U A;  1ZQH A;  7ICU A;  9ICX A;  3TFS A;  7ICI A;  3TFR A;  4DOC A;  7ICR A;  4KLQ A;  1ZQT A;  1ZQE A;  1VJ7 A;  4Z6D A;  3UPS A;  1ZQW A;  4UB5 A;  4FH5 A;  5EOZ A;  4UAW A;  5BOM A;  1ZQF A;  5DBA A;  2ID1 A;  5BOL A;  3RH4 A;  3V7L A;  4K4H A;  4QZA A;  4TUS A;  3AQM A;  3JPO A;  2PFO A;  4AT8 A;  5DB7 A;  5HRL A;  4RWO A;  3V72 A;  4TUP A;  5J29 A;  4TUQ A;  8ICH A;  4YN4 A;  1FA0 A;  8ICW A;  4I2D A;  5CWR A;  5J0Y A;  4F5R A;  1YLQ A;  4NLZ A;  3V7J A;  1BPY A;  4M47 A;  1HUZ A;  3UPQ A;  2GWS A;  4RQ5 A;  5J2D A;  3H38 A;  3JPT A;  3RJK A;  9ICM A;  2ISO A;  1BPB A;  4AT9 A;  4RQ3 A;  4X4U A;  1JN3 A;  4MFF A;  3MDC A;  1TVA A;  1ZQI A;  4QZE A;  5DKW A;  4IQV A;  8ICL A;  4E80 A;  4I2E A;  2BPG A;  5DBB A;  8ICE A;  2PFQ A;  1ZQA A;  1MIW A;  3JPS A;  4RQ7 A;  1ZJM A;  5HRF A;  4RQ6 A;  2RFF A;  4M0A A;  1OU5 A;  4I2I A;  4KLD A;  3OUY B;  1KDH A;  4RQ8 A;  4X0A A;  2DRB A;  2ZH5 A;  1TFY A;  4QZC A;  2ZH2 A;  4MFA A;  4R65 A;  1BPZ A;  1ZQJ A;  4I2H A;  4S3N A;  4KLT A;  4GXJ A;  4E8F A;  4RPZ A;  5J2E A;  5HRG A;  7ICM A;  4AT7 B;  5J2C A;  2DRA A;  4NKU A;  4LZG A;  1ZQR A;  3C2K A;  8ICO A;  3C2L A;  4R63 A;  4FHW A;  3B0X A;  4X4O A;  4XQ8 A;  4WC6 A;  4UBC A;  4X4S A;  1ZQC A;  2PXI A;  3HJ4 A;  5DBC A;  1ZQG A;  4Z6F A;  4WC5 A;  2BPC A;  2DR5 A;  4RPY A;  3MDA A;  1ZQQ A;  1ZQX A;  5HRE A;  4M2Y A;  5D4B A;  1R8B A;  2NRK A;  3RJE A;  4PGQ A;  1NO5 A;  8ICZ A;  2M2T A;  4KLJ A;  4UAZ A;  4YMM A;  3PMN A;  3JPP A;  4KLO A;  2I9G A;  3RJF A;  4YCX A;  3UXP A;  4R66 A;  4WCW A;  3OV7 A;  4DOA A;  4KLM A;  3WFO A;  1ZQZ A;  3AQL A;  4JWN A;  9ICH A;  3MGH A;  3LQC B;  2IHM A;  4KLE A;  2O5A A;  8ICB A;  4EBK A;  3AQK A;  3C66 A;  8ICX A;  1JQR A;  4UB3 A;  4F5P A;  4KLL A;  3HW8 A;  3OGU A;  5HRH A;  4YD1 A;  3GDX A;  8ICC A;  4QZF A;  4MF8 A;  7ICJ A;  4RPX A;  5HRD A;  3B0Y A;  3JPR A;  5TZV A;  5IIM A;  4TUR A;  2BCQ A;  9ICP A;  5IIO A;  5DB8 A;  1HUO A;  9ICV A;  1PX5 A;  1XSL A;  5HR9 A;  4RWQ A;  3HIY A;  5J2G A;  8ICG A;  2M2U A;  4FHX A;  4NY8 A;  7ICV A;  3HJ1 A;  4M9N A;  1R8C A;  4PHD A;  1Q78 A;  3RH6 A;  1UET A;  4UB2 A;  4O5C A;  7ICL A;  5J0X A;  9ICE A;  1JMS A;  4PHA A;  4I2A A;  3H37 A;  4PHP A;  4M9G A;  3UXO A;  4EP7 A;  2HHP A;  5IIN A;  4WC3 A;  8ICY A;  1ZQB A;  2PFP A;  4YMO A;  4UD5 A;  5CJ7 A;  3PML A;  1ZQV A;  3K75 D;  4KLH A;  5HHI A;  5J2F A;  8ICR A;  9ICS A;  4UAY A;  2W9M A;  2BE3 A;  5F2V O;  9ICQ A;  7ICT A;  4UB4 A;  8ICA A;  9ICI A;  5HRI A;  3WFP A;  3MBY A;  4LZD A;  1BPX A;  5J2H A;  3AUO A;  5J2J A;  3OUY A;  3V7K A;  1ZQL A;  9ICN A;  4M5D A;  2BCU A;  4KLF A;  4Z6E A;  2BCV A;  2ZHA A;  1MIV A;  2FMS A;  9ICJ A;  7ICN A;  4FO6 A;  1ZJN A;  4UB1 A;  2DR8 A;  5J2K A;  5HRK A;  3ISB A;  7ICP A;  1VFG A;  9ICK A;  4KLS A;  4AT7 A;  4X4R A;  5IIL A;  9ICF A;  5CB1 A;  4O5K A;  4PGY A;  4LVS A;  3WFR E;  3OVS A;  9ICB A;  4YD2 A;  4WC1 A;  2P66 A;  1RPL A;  5BPC A;  4E7X A;  4WC0 A;  4RQ4 A;  2M2W A;  3L9D A;  4IQT A;  4RQ0 A;  4I28 A;  2ZH1 A;  4XQ7 A;  5DEC A;  1ZQS A;  5IIK A;  3RJJ A;  3OVA A;  4RWN A;  3C2M A;  5J2I A;  4IQU A;  2ZH7 A;  2Q66 A;  4LT6 A;  1ZQP A;  2ZHB A;  4FHP A;  4I2C A;  8ICQ A;  4X4T A;  4QZ9 A;  3H39 A;  3NYB A;  5J0O A;  1KNY A;  3JPQ A;  8ICU A;  1ZQO A;  5DB6 A;  4GXI A;  3OVB A;  4XA5 A;  4X4Q A;  4UBB A;  9ICA A;  5J0W A;  7ICK A;  4ATB B;  4QZI A;  8ICP A;  4RT3 A;  4X4V A;  4P4M A;  1ZQN A;  4AT8 B;  1Q79 A;  4MFC A;  1ZQU A;  3RJG A;  3ISD A;  7ICH A;  4Z6C A;  2DR9 A;  4IG8 A;  4UD4 A;  3PNC A;  4I29 A;  8ICI A;  4ATB A;  1R8A A;  4KLG A;  4I2B A;  2M2V A;  8ICF A;  4X4P A;  3AQN A;  4AT9 B;  4RQ2 A;  2BCR A;  3UQ0 A;  4M9H A;  7ICS A;  4NM1 A;  5D46 A;  9ICR A;  1TFW A;  5DDM A;  1XSN A;  3RJI A;  4IQW A;  3ISC A;  7ICG A;  5J0T A;  2ISP A;  3WFQ E;  1MQ2 A;  4QZG A;  2FMQ A;  4I2J A;  4F5N A;  1WOT A;  3AU6 A;  5DED A;  1UEV A;  9ICL A;  9ICO A;  4I2F A;  4QZ8 A;  5HHH A;  2PFN A;  4NLN A;  4P2H A;  5HC9 A;  5HRB A;  1MIY A;  9ICT A;  4P4O A;  5J0Q A;  4F5O A;  3RH5 A;  4MF2 A;  4RT2 A;  1BPD A;  4NXZ A;  7ICE A;  8ICS A;  1F5A A;  1ZQD A;  5D49 A;  9ICC A;  2FMP A;  4DO9 A;  4R64 A;  4YMN A;  4EBJ A;  1RZT A;  9ICU A;  3HWT A;  3JPN A;  4QZH A;  4F5Q A;  4RWP A;  2O1P A;  7ICO A;  4QZB A;  5J2A A;  4KLI A;  3AU2 A;  5CHG A;  4FH3 A;  1UEU A;  4RQ1 A;  4M9L A;  5III A;  4P4P A;  1ZQY A;  4K4G A;  4DOB A;  1V4A A;  4XUS A;  4FHV A;  3HX0 A;  2BCS A;  7ICF A;  1XSP A;  3C18 A;  4WBY A;  5J2B A;  4FHY A;  2ZH3 A;  2ZH4 A;  4PGX A;  4I2G A;  8ICJ A;  4M04 A;  4GXK A;  4M9J A;  3JZ0 A;  1NOM A;  4X5V A;  5DDY A;  2ZH8 A;  3H3A A;  4K4I A;  5CP2 A;  5DB9 A;  4NKT A;  5CA7 A;  4PH5 A;  4O5E A;  4X4N A;  8ICK A;  2PBE A;  4KLU A;  4XRH A;  3RJH A;  1R89 A;  1MQ3 A;  4JWM A;  2DVI A;  3C5F A;  8ICV A;  2DR7 A;  1ZQM A;  3UQ2 A;  1KEJ A;  5J0R A;  2ZH6 A;  1TV9 A;  5J0S A;  4NM2 A;  3MGI A;  4O9M A;  4PPX A;  2ZH9 A;  3JYY A;  4QZD A;  4NLK A;  9ICW A;  4PHE A;  7ICQ A;  3LK9 A;  8ICT A;  5IIJ A; 
#chains in the Genus database with same CATH topology
 2BPF A;  3OWG A;  4WC4 A;  4X0B A;  3MCR A;  1JAJ A;  8ICN A;  4WC7 A;  3C5G A;  4OAF A;  2VAN A;  4O6A A;  4WC2 A;  5J0P A;  1ZQK A;  3WFS C;  5CR0 A;  3UXN A;  4WBZ A;  8ICM A;  9ICG A;  2GA9 D;  1BPE A;  4I27 A;  5J0U A;  1ZQH A;  7ICU A;  9ICX A;  3TFS A;  4NXT A;  7ICI A;  3ER8 C;  3TFR A;  4DOC A;  7ICR A;  4KLQ A;  1ZQT A;  1ZQE A;  1VJ7 A;  4Z6D A;  4KB6 A;  4NXU A;  4WOY A;  3UPS A;  1ZQW A;  4UB5 A;  4FH5 A;  5EOZ A;  4UAW A;  5BOM A;  1ZQF A;  5DBA A;  2ID1 A;  5BOL A;  3RH4 A;  3V7L A;  4K4H A;  4QZA A;  4TUS A;  3AQM A;  3JPO A;  2PFO A;  4AT8 A;  5DB7 A;  5HRL A;  4RWO A;  3V72 A;  4TUP A;  5J29 A;  4TUQ A;  5CFS A;  8ICH A;  4YN4 A;  1FA0 A;  8ICW A;  4OAH A;  4I2D A;  5CWR A;  5J0Y A;  4F5R A;  1YLQ A;  4NLZ A;  3V7J A;  1BPY A;  4M47 A;  1HUZ A;  3UPQ A;  2GWS A;  4RQ5 A;  5J2D A;  3H38 A;  3JPT A;  3RJK A;  9ICM A;  4O67 A;  2ISO A;  3NVO A;  1BPB A;  4AT9 A;  4RQ3 A;  4X4U A;  1JN3 A;  4MFF A;  5D61 A;  3MDC A;  1TVA A;  1ZQI A;  4QZE A;  5DKW A;  4EV6 A;  4IQV A;  8ICL A;  3EF2 A;  4E80 A;  4I2E A;  2BPG A;  5CHE A;  5DBB A;  8ICE A;  2PFQ A;  2HN2 A;  1ZQA A;  1MIW A;  3JPS A;  4RQ7 A;  1ZJM A;  5HRF A;  4RQ6 A;  2RFF A;  4M0A A;  1OU5 A;  4I2I A;  4KLD A;  3OUY B;  1KDH A;  4RQ8 A;  4MKP A;  4X0A A;  2DRB A;  2ZH5 A;  1TFY A;  4QZC A;  2ZH2 A;  4WQK A;  4MFA A;  4R65 A;  1BPZ A;  1ZQJ A;  4I2H A;  4S3N A;  4KLT A;  4GXJ A;  4E8F A;  4RPZ A;  5J2E A;  4KM5 A;  4WH5 A;  5HRG A;  7ICM A;  4AT7 B;  4LEW A;  5J2C A;  2DRA A;  4NKU A;  4LZG A;  1ZQR A;  3C2K A;  8ICO A;  3C2L A;  4R63 A;  4FHW A;  3B0X A;  4X4O A;  4XQ8 A;  4O68 A;  4WC6 A;  4UBC A;  4X4S A;  1ZQC A;  2PXI A;  3HJ4 A;  3CK6 A;  5DBC A;  1ZQG A;  4Z6F A;  4WC5 A;  2BPC A;  2DR5 A;  4RPY A;  4NXV A;  3MDA A;  1ZQQ A;  1ZQX A;  5HRE A;  4M2Y A;  5D4B A;  1R8B A;  2NRK A;  3RJE A;  4PGQ A;  1NO5 A;  8ICZ A;  2M2T A;  4KLJ A;  4UAZ A;  4YMM A;  2IHO A;  3PMN A;  3JPP A;  4KLO A;  4K96 A;  2I9G A;  3RJF A;  4YCX A;  3UXP A;  4R66 A;  4WCW A;  3OV7 A;  4DOA A;  4KLM A;  3WFO A;  1ZQZ A;  3AQL A;  4JWN A;  9ICH A;  3MGH A;  3LQC B;  2IHM A;  4KLE A;  5CFT A;  2O5A A;  8ICB A;  4EBK A;  3AQK A;  3C66 A;  8ICX A;  1JQR A;  4UB3 A;  4F5P A;  4KLL A;  3HW8 A;  3OGU A;  5HRH A;  3NWI A;  4YD1 A;  3GDX A;  8ICC A;  2B51 A;  4QZF A;  4MF8 A;  7ICJ A;  4RPX A;  5HRD A;  4LEV A;  3B0Y A;  1GPJ A;  3JPR A;  5TZV A;  5IIM A;  4TUR A;  2BCQ A;  2B56 A;  9ICP A;  5IIO A;  5DB8 A;  1HUO A;  9ICV A;  4K99 A;  1PX5 A;  1XSL A;  5HR9 A;  4RWQ A;  3HIY A;  5J2G A;  8ICG A;  2M2U A;  5D62 A;  4FHX A;  4NY8 A;  7ICV A;  3HJ1 A;  4M9N A;  1R8C A;  4PHD A;  1Q78 A;  3RH6 A;  5CFU A;  1UET A;  4UB2 A;  4O5C A;  7ICL A;  5J0X A;  9ICE A;  3NKU A;  1JMS A;  4PHA A;  4I2A A;  3H37 A;  4PHP A;  4M9G A;  3UXO A;  4EP7 A;  4OAG A;  2HHP A;  5IIN A;  4WC3 A;  4K8V A;  8ICY A;  1ZQB A;  2PFP A;  4O69 A;  4YMO A;  4UD5 A;  5CJ7 A;  3PML A;  1ZQV A;  2IUB A;  3K75 D;  4KLH A;  5HHI A;  5J2F A;  8ICR A;  9ICS A;  4NXX A;  4UAY A;  2W9M A;  2BE3 A;  5F2V O;  9ICQ A;  7ICT A;  4UB4 A;  8ICA A;  9ICI A;  2BBJ A;  5HRI A;  3WFP A;  3MBY A;  4LZD A;  1BPX A;  5J2H A;  4EGW A;  3AUO A;  5J2J A;  3OUY A;  3V7K A;  4LEZ A;  1ZQL A;  9ICN A;  4M5D A;  2BCU A;  4KLF A;  4Z6E A;  2BCV A;  2ZHA A;  1MIV A;  2FMS A;  9ICJ A;  7ICN A;  4K9B A;  4FO6 A;  1ZJN A;  4UB1 A;  2DR8 A;  5J2K A;  5HRK A;  3ISB A;  7ICP A;  1VFG A;  9ICK A;  4KLS A;  4AT7 A;  4X4R A;  2HN1 A;  2FCL A;  5IIL A;  9ICF A;  5CB1 A;  4O5K A;  4PGY A;  4LVS A;  3WFR E;  3OVS A;  9ICB A;  4YD2 A;  4WC1 A;  2P66 A;  1RPL A;  5BPC A;  5B3Q A;  4E7X A;  4WC0 A;  4RQ4 A;  4OAI Z;  2M2W A;  4LEY A;  3L9D A;  4IQT A;  4RQ0 A;  4I28 A;  2ZH1 A;  4XQ7 A;  5DEC A;  1ZQS A;  5IIK A;  3RJJ A;  3OVA A;  4RWN A;  3C2M A;  4EED A;  5J2I A;  4IQU A;  2ZH7 A;  2Q66 A;  4LT6 A;  1ZQP A;  2ZHB A;  4FHP A;  4I2C A;  8ICQ A;  4X4T A;  4K9A A;  4QZ9 A;  3H39 A;  3NYB A;  5J0O A;  1KNY A;  3JPQ A;  8ICU A;  4I0U A;  1ZQO A;  5DB6 A;  4GXI A;  4JLZ A;  2EWR A;  3OVB A;  4XA5 A;  4X4Q A;  4UBB A;  9ICA A;  5J0W A;  7ICK A;  5JTG A;  4ATB B;  4QZI A;  8ICP A;  4RT3 A;  4XJE A;  4X4V A;  4P4M A;  1ZQN A;  4AT8 B;  1Q79 A;  4MFC A;  1ZQU A;  3RJG A;  3ISD A;  7ICH A;  4Z6C A;  2DR9 A;  2GAF D;  4IG8 A;  4UD4 A;  3PNC A;  4I29 A;  8ICI A;  3PHZ A;  4ATB A;  1R8A A;  4KLG A;  4I2B A;  2M2V A;  8ICF A;  5D63 A;  4X4P A;  3AQN A;  4AT9 B;  4RQ2 A;  2BCR A;  3UQ0 A;  4M9H A;  7ICS A;  4NM1 A;  5D46 A;  9ICR A;  1TFW A;  5DDM A;  1XSN A;  3RJI A;  4IQW A;  3ISC A;  7ICG A;  5J0T A;  2ISP A;  3WFQ E;  1MQ2 A;  4QZG A;  2FMQ A;  4I2J A;  4F5N A;  1WOT A;  3AU6 A;  5DED A;  1UEV A;  9ICL A;  3K7D A;  9ICO A;  4I2F A;  4QZ8 A;  5HHH A;  2PFN A;  4NLN A;  4P2H A;  4FO1 A;  5HC9 A;  3ERC C;  5HRB A;  1MIY A;  9ICT A;  4P4O A;  5J0Q A;  4F5O A;  3RH5 A;  4MF2 A;  4RT2 A;  1BPD A;  4NXZ A;  7ICE A;  8ICS A;  1F5A A;  1ZQD A;  5D49 A;  9ICC A;  4N7R A;  2FMP A;  4DO9 A;  4R64 A;  4JLX A;  4YMN A;  4EBJ A;  1RZT A;  9ICU A;  4NXW A;  3HWT A;  3JPN A;  4QZH A;  4F5Q A;  4RWP A;  2O1P A;  7ICO A;  4QZB A;  5J2A A;  4KLI A;  3AU2 A;  5CHG A;  4HX0 A;  4FH3 A;  1UEU A;  4RQ1 A;  4M9L A;  5III A;  4P4P A;  1ZQY A;  4K98 A;  4K4G A;  4DOB A;  1V4A A;  4XUS A;  4FHV A;  3HX0 A;  2B4V A;  2BCS A;  7ICF A;  1XSP A;  3C18 A;  4WBY A;  3ER9 B;  5J2B A;  4FHY A;  2BBH A;  2ZH3 A;  2ZH4 A;  4PGX A;  4I2G A;  8ICJ A;  4K97 A;  4M04 A;  5B3P A;  4GXK A;  4M9J A;  3JZ0 A;  1NOM A;  4X5V A;  5DDY A;  2ZH8 A;  3H3A A;  4K4I A;  4WQL A;  3JCF A;  5CP2 A;  5DB9 A;  4NKT A;  5CA7 A;  4PH5 A;  4O5E A;  4X4N A;  8ICK A;  2PBE A;  4KLU A;  4XRH A;  3RJH A;  1R89 A;  1MQ3 A;  4JWM A;  2DVI A;  3C5F A;  8ICV A;  2DR7 A;  1ZQM A;  3UQ2 A;  1KEJ A;  5J0R A;  2ZH6 A;  1TV9 A;  5J0S A;  4NM2 A;  3MGI A;  4O9M A;  4PPX A;  2ZH9 A;  3JYY A;  4QZD A;  4NLK A;  9ICW A;  4PHE A;  7ICQ A;  4EEB A;  3LK9 A;  8ICT A;  5IIJ A; 
#chains in the Genus database with same CATH homology
 2BPF A;  4WC4 A;  4X0B A;  1JAJ A;  8ICN A;  4WC7 A;  3C5G A;  2VAN A;  4WC2 A;  5J0P A;  1ZQK A;  3WFS C;  5CR0 A;  3UXN A;  4WBZ A;  8ICM A;  9ICG A;  1BPE A;  4I27 A;  5J0U A;  1ZQH A;  7ICU A;  9ICX A;  3TFS A;  7ICI A;  3TFR A;  4DOC A;  7ICR A;  4KLQ A;  1ZQT A;  1ZQE A;  1VJ7 A;  4Z6D A;  3UPS A;  1ZQW A;  4UB5 A;  4FH5 A;  5EOZ A;  4UAW A;  5BOM A;  1ZQF A;  5DBA A;  2ID1 A;  5BOL A;  3RH4 A;  3V7L A;  4K4H A;  4QZA A;  4TUS A;  3AQM A;  3JPO A;  2PFO A;  4AT8 A;  5DB7 A;  5HRL A;  4RWO A;  3V72 A;  4TUP A;  5J29 A;  4TUQ A;  8ICH A;  4YN4 A;  1FA0 A;  8ICW A;  4I2D A;  5CWR A;  5J0Y A;  4F5R A;  1YLQ A;  4NLZ A;  3V7J A;  1BPY A;  4M47 A;  1HUZ A;  3UPQ A;  2GWS A;  4RQ5 A;  5J2D A;  3H38 A;  3JPT A;  3RJK A;  9ICM A;  2ISO A;  1BPB A;  4AT9 A;  4RQ3 A;  4X4U A;  1JN3 A;  4MFF A;  3MDC A;  1TVA A;  1ZQI A;  4QZE A;  5DKW A;  4IQV A;  8ICL A;  4E80 A;  4I2E A;  2BPG A;  5DBB A;  8ICE A;  2PFQ A;  1ZQA A;  1MIW A;  3JPS A;  4RQ7 A;  1ZJM A;  5HRF A;  4RQ6 A;  2RFF A;  4M0A A;  1OU5 A;  4I2I A;  4KLD A;  3OUY B;  1KDH A;  4RQ8 A;  4X0A A;  2DRB A;  2ZH5 A;  1TFY A;  4QZC A;  2ZH2 A;  4MFA A;  4R65 A;  1BPZ A;  1ZQJ A;  4I2H A;  4S3N A;  4KLT A;  4GXJ A;  4E8F A;  4RPZ A;  5J2E A;  5HRG A;  7ICM A;  4AT7 B;  5J2C A;  2DRA A;  4NKU A;  4LZG A;  1ZQR A;  3C2K A;  8ICO A;  3C2L A;  4R63 A;  4FHW A;  3B0X A;  4X4O A;  4XQ8 A;  4WC6 A;  4UBC A;  4X4S A;  1ZQC A;  2PXI A;  3HJ4 A;  5DBC A;  1ZQG A;  4Z6F A;  4WC5 A;  2BPC A;  2DR5 A;  4RPY A;  3MDA A;  1ZQQ A;  1ZQX A;  5HRE A;  4M2Y A;  5D4B A;  1R8B A;  2NRK A;  3RJE A;  4PGQ A;  1NO5 A;  8ICZ A;  2M2T A;  4KLJ A;  4UAZ A;  4YMM A;  3PMN A;  3JPP A;  4KLO A;  2I9G A;  3RJF A;  4YCX A;  3UXP A;  4R66 A;  4WCW A;  3OV7 A;  4DOA A;  4KLM A;  3WFO A;  1ZQZ A;  3AQL A;  4JWN A;  9ICH A;  3MGH A;  3LQC B;  2IHM A;  4KLE A;  2O5A A;  8ICB A;  4EBK A;  3AQK A;  3C66 A;  8ICX A;  1JQR A;  4UB3 A;  4F5P A;  4KLL A;  3HW8 A;  3OGU A;  5HRH A;  4YD1 A;  3GDX A;  8ICC A;  4QZF A;  4MF8 A;  7ICJ A;  4RPX A;  5HRD A;  3B0Y A;  3JPR A;  5TZV A;  5IIM A;  4TUR A;  2BCQ A;  9ICP A;  5IIO A;  5DB8 A;  1HUO A;  9ICV A;  1PX5 A;  1XSL A;  5HR9 A;  4RWQ A;  3HIY A;  5J2G A;  8ICG A;  2M2U A;  4FHX A;  4NY8 A;  7ICV A;  3HJ1 A;  4M9N A;  1R8C A;  4PHD A;  1Q78 A;  3RH6 A;  1UET A;  4UB2 A;  4O5C A;  7ICL A;  5J0X A;  9ICE A;  1JMS A;  4PHA A;  4I2A A;  3H37 A;  4PHP A;  4M9G A;  3UXO A;  4EP7 A;  2HHP A;  5IIN A;  4WC3 A;  8ICY A;  1ZQB A;  2PFP A;  4YMO A;  4UD5 A;  5CJ7 A;  3PML A;  1ZQV A;  3K75 D;  4KLH A;  5HHI A;  5J2F A;  8ICR A;  9ICS A;  4UAY A;  2W9M A;  2BE3 A;  5F2V O;  9ICQ A;  7ICT A;  4UB4 A;  8ICA A;  9ICI A;  5HRI A;  3WFP A;  3MBY A;  4LZD A;  1BPX A;  5J2H A;  3AUO A;  5J2J A;  3OUY A;  3V7K A;  1ZQL A;  9ICN A;  4M5D A;  2BCU A;  4KLF A;  4Z6E A;  2BCV A;  2ZHA A;  1MIV A;  2FMS A;  9ICJ A;  7ICN A;  4FO6 A;  1ZJN A;  4UB1 A;  2DR8 A;  5J2K A;  5HRK A;  3ISB A;  7ICP A;  1VFG A;  9ICK A;  4KLS A;  4AT7 A;  4X4R A;  5IIL A;  9ICF A;  5CB1 A;  4O5K A;  4PGY A;  4LVS A;  3WFR E;  3OVS A;  9ICB A;  4YD2 A;  4WC1 A;  2P66 A;  1RPL A;  5BPC A;  4E7X A;  4WC0 A;  4RQ4 A;  2M2W A;  3L9D A;  4IQT A;  4RQ0 A;  4I28 A;  2ZH1 A;  4XQ7 A;  5DEC A;  1ZQS A;  5IIK A;  3RJJ A;  3OVA A;  4RWN A;  3C2M A;  5J2I A;  4IQU A;  2ZH7 A;  2Q66 A;  4LT6 A;  1ZQP A;  2ZHB A;  4FHP A;  4I2C A;  8ICQ A;  4X4T A;  4QZ9 A;  3H39 A;  3NYB A;  5J0O A;  1KNY A;  3JPQ A;  8ICU A;  1ZQO A;  5DB6 A;  4GXI A;  3OVB A;  4XA5 A;  4X4Q A;  4UBB A;  9ICA A;  5J0W A;  7ICK A;  4ATB B;  4QZI A;  8ICP A;  4RT3 A;  4X4V A;  4P4M A;  1ZQN A;  4AT8 B;  1Q79 A;  4MFC A;  1ZQU A;  3RJG A;  3ISD A;  7ICH A;  4Z6C A;  2DR9 A;  4IG8 A;  4UD4 A;  3PNC A;  4I29 A;  8ICI A;  4ATB A;  1R8A A;  4KLG A;  4I2B A;  2M2V A;  8ICF A;  4X4P A;  3AQN A;  4AT9 B;  4RQ2 A;  2BCR A;  3UQ0 A;  4M9H A;  7ICS A;  4NM1 A;  5D46 A;  9ICR A;  1TFW A;  5DDM A;  1XSN A;  3RJI A;  4IQW A;  3ISC A;  7ICG A;  5J0T A;  2ISP A;  3WFQ E;  1MQ2 A;  4QZG A;  2FMQ A;  4I2J A;  4F5N A;  1WOT A;  3AU6 A;  5DED A;  1UEV A;  9ICL A;  9ICO A;  4I2F A;  4QZ8 A;  5HHH A;  2PFN A;  4NLN A;  4P2H A;  5HC9 A;  5HRB A;  1MIY A;  9ICT A;  4P4O A;  5J0Q A;  4F5O A;  3RH5 A;  4MF2 A;  4RT2 A;  1BPD A;  4NXZ A;  7ICE A;  8ICS A;  1F5A A;  1ZQD A;  5D49 A;  9ICC A;  2FMP A;  4DO9 A;  4R64 A;  4YMN A;  4EBJ A;  1RZT A;  9ICU A;  3HWT A;  3JPN A;  4QZH A;  4F5Q A;  4RWP A;  2O1P A;  7ICO A;  4QZB A;  5J2A A;  4KLI A;  3AU2 A;  5CHG A;  4FH3 A;  1UEU A;  4RQ1 A;  4M9L A;  5III A;  4P4P A;  1ZQY A;  4K4G A;  4DOB A;  1V4A A;  4XUS A;  4FHV A;  3HX0 A;  2BCS A;  7ICF A;  1XSP A;  3C18 A;  4WBY A;  5J2B A;  4FHY A;  2ZH3 A;  2ZH4 A;  4PGX A;  4I2G A;  8ICJ A;  4M04 A;  4GXK A;  4M9J A;  3JZ0 A;  1NOM A;  4X5V A;  5DDY A;  2ZH8 A;  3H3A A;  4K4I A;  5CP2 A;  5DB9 A;  4NKT A;  5CA7 A;  4PH5 A;  4O5E A;  4X4N A;  8ICK A;  2PBE A;  4KLU A;  4XRH A;  3RJH A;  1R89 A;  1MQ3 A;  4JWM A;  2DVI A;  3C5F A;  8ICV A;  2DR7 A;  1ZQM A;  3UQ2 A;  1KEJ A;  5J0R A;  2ZH6 A;  1TV9 A;  5J0S A;  4NM2 A;  3MGI A;  4O9M A;  4PPX A;  2ZH9 A;  3JYY A;  4QZD A;  4NLK A;  9ICW A;  4PHE A;  7ICQ A;  3LK9 A;  8ICT A;  5IIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...