1JB4A

Crystal structure of ntf2 m102e mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQEFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 34
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb4A00
3FZWA 1QJGA 4FCJA 3JUPA 5IG3A 5D81A 4FCMA 1OUNA 2GEYA 4U13A 3K7CA 2PZVA 4XB5A 4OVMA 1OGZA 3KZTA 1E3RA 6STDA 4HM1B 5IEPA 2STDA 5CXOA 2A15A 1BUQA 2RFRA 1GY7A 4L8OA 2JQ5A 3NHXA 3DM8A 3WMDA 4N3VA 2YFLB 1JKGA 1QMAA 4WYKA 1C7HA 3SEDA 4PEJA 4K1UA 3DUKA 2R4IA 3BB9A 5JPUA 3EC9A 3RGRA 3FKAA 3MG3A 2Z77A 4HKVB 1U5OA 3OWYA 4HM2B 3EBTA 4HM4B 5IERA 3OWUA 4MJDA 1ULIB 5CF1A 3EJVA 4L8PA 3NV0B 3NUVA 2YFIB 1HKXA 3OWSA 5DRVA 1O7MB 2Z76A 3EX9A 4X2OA 1EA2A 3FF2A 5CF2A 4J9AA 2UX0A 3HX8A 3HZPA 3GZYB 2F98A 3G16A 5CK6A 3SOYA 5STDA 1JB2A 1O7WB 4LEHA 3FF0A 3CPOA 1OF5A 1NWWA 3NM2A 2B24B 3GZRA 5D82A 1NDOB 3JUOA 3DZLA 2HMKB 3D9RA 3G8ZA 3KE7A 2W2CA 1UUWB 1E97A 1GS3A 4IIAA 3ECFA 1Q40B 4HM7B 3E99A 3F40A 1UUVB 2GXFA 4HM6B 7STDA 3S5CA 4LMIA 1JN5B 3OX9A 1SJWA 5AEWB 3EN1B 1ASKA 1OPYA 4OUQA 5IG5A 5IF6A 5BXQA 4ORLA 4GB5A 1ISKA 3VGNA 2RGQA 5HGRA 5DREA 2INXA 1E3VA 1ULJB 2OWPA 1ZO2A 1W02A 2IMJA 5EVHA 3JUNA 1WQLB 2BNGA 4XM4A 2GBXB 3RGAA 5KP1A 3HK4A 3OXAA 3T8UA 2CHCA 3M8CA 3ER7A 3F8XA 3B4OA 2CKFB 5IENA 3JUMA 5FW5A 2HMLB 3H3HA 4HM3B 2YFJB 3VSYA 2XSOB 1DMMA 4K1VA 5BVBA 1OHOA 3T8NA 1JB5A 4CDLA 2BMRB 1TP6A 3IPTA 3F7SA 1S5AA 1JKGB 4WYKB 3EF8A 1JB4A 5TGNA 3FH1A 1DMQA 4XDVA 2QIYA 3DXOA 3MG1A 4XBXA 4STDA 8CHOA 3F7XA 4WWUC 5AIIA 5IG0A 1Z1SA 1Q40A 4XDWA 1O7NB 5AI1A 4R9KA 1OH0A 4HZBB 1TUHA 3GZXB 3MSOA 4R9LA 1GYBA 5AEUB 2HMJB 4HM8B 4RZMA 4KVHA 4H3UA 3FSDA 1O7GB 3ROBA 3SOAA 1ZX2A 3CNMA 2XRXB 3UNLA 3EHCA 1EG9B 1W00A 4XBYA 3F9SA 2XR8B 2HMMB 3NBRA 3I0YA 3LZAA 4HM5B 3NXJA 1OHSA 2BMQB 2F86B 2RCDA 5G2GA 3A76A 3GWRA 1O7PB 3MKIA 3KSPA 3DMCA 2B1XB 3B8LA 5D83A 3EQQB 1OGXA 2Z7AA 3FLJA 2HMNB 1NU3A 4Q53A 5AIHA 1W01A 5IG4A 1VZZA 1GY5A 4X2HA 2GEXA 5CLKA 5KP3A 3NV0A 1AR0A 3EN8A 3CU3A 3CNXA 3FGYA 4WP5A 1GY6A 1IDPA 3LYGA 3G0KA 2QGUA 3BLZA 3B7CA 2BMOB 5IEOA 3OV4A 3GRDA 2F99A 3GZBA 1Q42A 3UJMA 4XBTA 1DMNA 3MG2A 4HJLB 3K0ZA 3EBYA 3H51A 4I4KA 5JPPA 5KP4A 1O7HB 1W6YA 4J8TA 3MYTA 3STDA 3JUQA 2HMOB 3MHEA 3F14A 5AIFA 4LGQA 3KKGA 4HZ9B 1A2KA 4L7KA 1JN5A 3B4PA 1K41A 5AIGA 1OHPA 3F8HA 1STDA 4R1KA 2GBWB 2XSHB 2I9WA 1OCVA 1CQSA 2K54A 3Q90A 1OF5B 4HM0B 4HVNA
chains in the Genus database with same CATH superfamily
2RBIA 1QJGA 3FZWA 3BU4A 3AMOA 1Q814 1IVVA 3GSPA 1GMPA 1RGGA 4FCJA 4RNTA 3JUPA 5IG3A 3RDEA 1BSDA 1JNQA 1OUNA 2GEYA 2J8XB 4FCMA 4GHOA 4U13A 5D81A 5G1KA 5BIRA 1QVG2 5M1AA 3CD63 3CCQ3 1QAFA 4N6V0 3CCL3 3K7CA 2PZVA 4XB5A 1BANA 4OVMA 1OGZA 3KZTA 1E3RA 4LZIA 2CWUA 6STDA 2P38A 3SX1A 2KRTA 4HM1B 5IEPA 2STDA 1VQK3 2K3DA 3UL5A 1B2MA 5CXOA 1V58A 2A15A 1BUQA 1JBTA 2RFRA 1GMRA 3TDGA 3G4S3 1GY7A 1MWSA 4L8OA 4O8SA 1KD14 1BNEA 1SQWA 4FMDA 1RGLA 3AGOA 1FUSA 1QALA 1TIJA 2JQ5A 1TFKA 3NHXA 2AAEA 3NX0A 2OOVA 4BTYA 5HOHA 1NJI4 1VQ73 3G713 3DM8A 1YHQ3 1D6UA 5A0OB 4EV5A 1LOXA 1MWUA 3WMDA 3HOHA 4N3VA 1UCIA 2Y74A 2BU4A 1AVKA 3KSED 3HIIA 2YFLB 2P0MA 1VQM3 1M1XB 1LNHA 4EBGA 5BU4A 4WHAA 1VQ43 4IT7A 2FGTA 1JKGA 1QMAA 1DVDA 2F56A 4WYKA 1C7HA 2H0IA 2AADA 3SEDA 1RTUA 5JBSA 3EE1A 4PEJA 4K1UA 1GMQA 1STFI 1G02A 1YIT3 3DY5A 1HU9A 1CH0A 2CG0A 3DUKA 3WDGB 1N9EA 2XEPA 2CFGA 3S29A 2R4IA 3BB9A 1RJOA 3LTCA 2CFKA 4BL3A 4EV2A 1AVLA 2XGLA 1ROAA 1BSEA 4OK0A 3EC9A 5JPUA 5FGOA 2C10A 4CCVA 3CCV3 3D79A 1N8R4 1GD4A 3FKAA 1I2EA 3MG3A 1BRSA 1D6ZA 2Z77A 3LT9A 4NPBA 3RGRA 5RNTA 1JBSA 4K90B 1FGRA 1TTOA 4HKVB 1WTHA 1U5OA 3OWYA 4HM2B 3EBTA 1WMOA 3WOEB 1I3FA 2CX0A 4HM4B 5IERA 1IU7A 3D3LA 4HOHA 1SARA 1DVCA 2W0QA 2W56A 3GAXA 1SIIA 3OWUA 2CG1A 1LRAA 4AEQA 4MJDA 1ULIB 1UDII 5AYSC 1US1A 4MMZB 1C54A 5CF1A 3EJVA 4L8PA 1DE3A 3NV0B 3G6E3 3NUVA 2YFIB 1HKXA 1X1XA 3KIIA 1N9JA 3OWSA 3LTDA 1O7MB 2Z76A 5DRVA 1HYFA 1T5YA 3EX9A 4X2OA 3SVAA 1EA2A 1FGQA 3FF2A 2IA7A 1VQL3 5CF2A 3PXMA 4J9AA 1KWIA 2UX0A 3HX8A 2W9QA 1IQ8A 1BUJA 1FA3A 3HZPA 3GZYB 2F98A 3G16A 5CK6A 1RCKA 3AGNA 3SOYA 3VF1A 5STDA 1JB2A 1O7WB 2D42A 3FF0A 4LEHA 4AKZA 1JBRA 1BU4A 2CWTA 3CPOA 2WOHA 1R4CA 3NM7A 2O3OA 4HYZA 1OF5A 1NWWA 2CWVA 3D5GA 2KAAA 3S67A 3K5TA 2BHMA 3NM2A 2B24B 3GZRA 4TX4A 1D6YA 2C11A 2F4YA 1NDOB 1JZDA 5D82A 3I553 1BNIA 4KFFA 1A90A 3JUOA 2Y73A 3DZLA 3LH4A 3Q1CA 3U1WA 1VQN3 2PNCA 2HMKB 3D9RA 2L4VA 1I2GA 3G8ZA 4BL2A 1QVF2 3WR2A 6GSPA 1BRKA 1EKMA 3KE7A 1OACA 1X1WA 2W2CA 4HAAA 2IUJA 1UUWB 1I8VA 4JRFA 1E97A 3BNBA 2IYJA 1RGFA 4N6NB 1GS3A 4IIAA 2FXTA 1I70A 3I563 2UUGC 4FCZA 1PFPA 1TRPA 2CW9A 3ECFA 3CXC2 5EEOA 3V98A 1MWTA 1Q40B 1UCKA 1UW1A 1W7CA 3E99A 3F40A 4HM7B 1K28A 1UUVB 2GXFA 4HM6B 2W6JH 4ILFA 2O9UX 7STDA 3FG1A 3S5CA 4LMIA 1BVIA 2H0HA 1I3IA 2XFTA 1JN5B 2OQEC 3OX9A 4BU4A 1SJWA 2BO9B 4R4KA 2P05A 1NB5I 3IMAB 1KSIA 2KCDA 5AEWB 1YIJ3 3EN1B 3QRDA 3DGNA 4MMYB 1VQ93 1FZUA 4EC6A 1ASKA 1N8QA 1OPYA 4LSOA 4MEIA 4OUQA 1B27A 3FCSB 5IG5A 1BNGA 5IF6A 2M7OA 5BXQA 3MPHA 2CC3A 4ORLA 1BNSA 4QWTA 3UL6A 4GB5A 4WFOA 1ISKA 2KXGA 1RLSA 1CYVA 3VGNA 2RGQA 4CPKA 5HGRA 2KF6A 5DREA 2OTJ3 3LT8A 2INXA 2L1SA 3CC73 3S27A 1E3VA 1N5PA 1ULJB 2OWPA 4J5KA 3NBJA 2FNQA 1ZO2A 1W02A 3AMOB 4O3VA 2IMJA 1M9GA 1B3SA 5EVHA 1F8NA 1V57A 2WGOA 1IQYA 3JUNA 4G1MB 3FG4A 1A67A 1WQLB 2BNGA 4XM4A 3U97A 1YJW3 1HZ1A 2GBXB 3RGAA 2MF7A 1N5HA 1GOYA 2KF5A 3HK4A 1L5GB 5KP1A 3M8CA 2CHCA 3OXAA 3RNTA 3ER7A 3F8XA 3T8UA 4NHFA 3B4OA 2CKFB 4BIRA 5IENA 1B2UA 1BRHA 1IVXA 2ML5A 3JUMA 5FW5A 2HMLB 3H3HA 3NQYA 4HM3B 2YFJB 3WA2X 1B21A 3VSYA 3X40A 1VQQA 9RNTA 2CFLA 2XSOB 2D1WA 2IY2A 1DMMA 3PCSA 3X42A 1PY3A 4K1VA 2QEX3 5BVBA 4KFDA 4EYCA 4HBRA 1OHOA 1RSNA 1YI23 3T8NA 4FMAA 2OTL3 3DGLA 1JB5A 3ZFZA 3URPA 3OW22 4CDLA 3BNDA 1K734 3KCHA 2SBLA 1AV4A 2BMRB 1TP6A 1RN7A 1W6CA 2W04A 1Q9EA 3IPTA 3N54B 4KZ1A 1JZOA 3F7SA 4R80A 6RNTA 4KFEA 1WMNA 2OOVC 1M904 1GOVA 1S5AA 1JKGB 2W9PA 1BRNL 1VQ53 5ELUA 4WYKB 3EF8A 1JB4A 4MMXB 3HIGA 5TGNA 2CK3H 4DKIA 3FH1A 4N6LA 2KF3A 1DMQA 4XDVA 1IV7A 1VQ83 1M1K4 3K63A 2F5WA 1NB3I 1UCLA 2QIYA 3DXOA 3MG1A 4XBXA 2LYXA 4STDA 1ROVA 3X3ZA 8CHOA 3NBBA 1TFOA 4N6UA 3F7XA 1FGTA 3A5EA 4WWUC 2YX9A 2R41A 3V99A 5AIIA 5IG0A 2E2VA 1RGHA 3HI7A 1Z1SA 1T2HA 5ELJA 5AYRB 3K9MC 1RNTA 5M19A 1Q40A 3CCE3 1IVWA 3DGOA 1VQP3 1FGMA 4XDWA 1O7NB 1X1UA 2CFDA 7RNTA 2OCTA 5AI1A 3CCU3 3CCR3 4R9KA 3Q2PA 1OH0A 4HZBB 1TUHA 1W5ZA 2W56B 1BNRA 1IT7A 3GZXB 3MSOA 3FG3A 1KC84 1SPUA 4R9LA 1B20A 2IUKA 1GYBA 3CCM3 3N8BA 4GL6A 1RGEA 2C4BA 2MC8A 3V92A 5AEUB 3SLUA 4O02B 1R4YA 2HMJB 4HM8B 2QA43 2HOHA 4RZMA 1RN1A 4KVHA 1B2XA 1MOLA 4H3UA 3CC23 3FSDA 1FUWA 1O7GB 4RBNA 3CC43 3PCRA 3SYUA 3DGMA 4O2HA 3CCJ3 3ROBA 3SOAA 1ZX2A 3CNMA 2XRXB 5LC7A 3QK9A 3UNLA 1GSPA 3CME3 3EHCA 5GSPA 1EG9B 1K9M4 1T3BA 1W00A 4FR9A 4XBYA 1J2BA 4I5QA 4RNYA 3D4AA 3F9SA 2BT3A 1LQMB 2XR8B 4IPBA 1YJN3 3L0RA 2HMMB 3IJEB 3NBRA 2K0MA 3I0YA 3LZAA 4HM5B 4CJNA 2KF4A 1BRIA 1FGOA 1NO3A 3NXJA 1GOUA 2ZA4A 1OHSA 1QAKA 2BMQB 1YNVX 2F86B 2F5MA 3ZG5A 1X1YA 1LOVA 2P0XA 2RCDA 5G2GA 3T0UA 3UB1A 2ZDJA 4BTXA 3A76A 1BSCA 1TRQA 1JV2B 3J7Yd 3GWRA 1IV9A 1O7PB 1RGKA 1RGCA 3PZWA 1S723 3MKIA 4N6TA 3KSPA 3DMCA 1AY7A 2B1XB 1BGSA 3B8LA 5D83A 3SXXA 3X41A 1LXEA 2V1LA 1CYUA 2WOFA 3EQQB 2CH9A 1OGXA 1LOWA 2XGNA 7GSPA 1RRLA 2Z7AA 2HMNB 3FLJA 1VQO3 1Q7HA 1IT8A 1NU3A 1ZS7A 1UGHI 4Q53A 1RMSA 5G1LA 5AIHA 1W01A 1W6GA 5IG4A 1TU5A 1A2VA 1VZZA 1GY5A 4X2HA 2GEXA 1RKYA 3AHSA 1SIHA 1UUGB 5CLKA 5KP3A 1G0TA 1ZGXA 1Y4KA 1G96A 3PS8A 3JVCA 2WGQA 3NV0A 1AR0A 3EN8A 3CU3A 1CEWI 3CNXA 3FGYA 4WP5A 1RNBA 2SARA 4N6OB 4EXRA 1GY6A 1IDPA 1LVNA 1DETA 1A2PA 1BNJA 1Q7Y4 3NQZA 5IW9A 3LYGA 1TJDA 4AKYA 3CMA3 1BRGA 3WOFB 1YVSA 1BRJA 2RNTA 4LYLB 1B2SA 2ZL8A 3G0KA 3LOYA 1RRHA 2QGUA 3BLZA 1B2ZA 1I2FA 3ALAA 3LTBA 2LQVA 3B7CA 1W2ZA 2BMOB 1WNHA 4N6MA 5IEOA 1BAOA 1DYUA 1YGEA 3GRDA 3OV4A 2F99A 3GZBA 1AQZA 1Q42A 1LQGC 3UJMA 8RNTA 1PYLA 1DMNA 1FYSA 1GD3A 3DGYA 3KFQC 4XBTA 5EQLA 5M18A 2E2TA 1LOYA 4K61A 3MG2A 4H61A 5LC6A 2RSXA 2CIUA 3EB8A 1W2B2 3X3XA 1MGRA 1BSBA 2XF3A 3DH2A 4HJLB 4J5GA 4NREA 3K0ZA 2GSPA 3EBYA 3CPW2 3H51A 3ZG0A 1UI8A 5I97A 1RHLA 1RDSA 4I4KA 1UGIA 3PYJA 5JPPA 1U8CB 5KP4A 1K8A4 2CFWA 3KN4A 4FMCA 1IQXA 1O7HB 3Q3FA 1W6YA 1JRQA 1FUTA 1WMPA 1YVBI 1FW7A 4J8TA 1MGWA 1EEJA 1BSAA 1EUIC 3N9HA 1LNIA 3PGBA 3MYTA 1JJ22 1V74A 1W4NA 1I0VA 1BNFA 1RCLA 3STDA 1IVUA 3JUQA 2HMOB 1KQS2 2OQEA 2H0GA 3AHWA 3MHEA 2ZHXB 3F14A 1MWRA 2GU1A 2UGIA 5AIFA 4BTWA 3LMLA 1UCJA 4FMBA 3WODG 4LGQA 1BIRA 3LTAA 3KKGA 4HZ9B 3WHOA 1A2KA 4L7KA 1JN5A 3B4PA 1K41A 3BIRA 3D5IA 5AIGA 3WA3A 3LXUX 1BOXA 1Q824 2JDIH 1VQ63 1NNVA 2Z6BA 1PU4A 1OHPA 3BNEA 1RGAA 2WO0A 1MNLA 4KT3B 1IYYA 3S28A 2ML6A 2P09A 2BIRA 3F8HA 1STDA 4R1KA 2GU3A 1RN4A 2GBWB 2W03A 2XFSA 2XSHB 3BNCA 4JF8A 2E2UA 2I9WA 1IK3A 1UI7A 1YGWA 2XH9A 3O8YA 4RNZA 1OCVA 1CQSA 2K54A 4EW5A 1Q864 1EQKA 3MWZA 4ZM8A 1I0XA 3Q90A 3CCS3 4GSPA 1OF5B 2Q07A 4HM0B 4HVNA 3X3YA 1T2IA 2CX1A 1YJ93
chains in the Genus database with same CATH topology
3FZWA 1QJGA 3AMOA 1Q814 1IVVA 4FCJA 3JUPA 5IG3A 3RDEA 1JNQA 4FCMA 1OUNA 2GEYA 4U13A 5D81A 1QVG2 3CD63 3CCQ3 1QAFA 4N6V0 3CCL3 3K7CA 2PZVA 4XB5A 4OVMA 1OGZA 3KZTA 1E3RA 4LZIA 2CWUA 6STDA 2P38A 3SX1A 2KRTA 4HM1B 5IEPA 2STDA 1VQK3 3UL5A 5CXOA 2A15A 1BUQA 2RFRA 3TDGA 3G4S3 1KD14 1GY7A 4L8OA 4O8SA 1SQWA 4FMDA 1QALA 1TIJA 2JQ5A 1TFKA 3NHXA 3NX0A 2OOVA 4BTYA 1NJI4 1VQ73 3G713 3DM8A 1YHQ3 1D6UA 5A0OB 4EV5A 1LOXA 3WMDA 4N3VA 2Y74A 1AVKA 3KSED 3HIIA 2YFLB 2P0MA 1VQM3 1M1XB 1LNHA 4EBGA 1VQ43 4WHAA 4IT7A 2FGTA 1JKGA 1QMAA 1DVDA 4WYKA 1C7HA 3SEDA 5JBSA 3EE1A 4PEJA 4K1UA 1STFI 3DY5A 1HU9A 2CG0A 3DUKA 3WDGB 1N9EA 2XEPA 2CFGA 3S29A 2R4IA 3BB9A 1RJOA 3LTCA 2CFKA 4EV2A 1AVLA 2XGLA 1ROAA 4OK0A 3EC9A 5JPUA 5FGOA 2C10A 4CCVA 3CCV3 1N8R4 1GD4A 3FKAA 3MG3A 3RGRA 1D6ZA 2Z77A 3LT9A 4K90B 1FGRA 4HKVB 1WTHA 1U5OA 3OWYA 4HM2B 3EBTA 1WMOA 3WOEB 4HM4B 5IERA 1IU7A 3D3LA 1DVCA 2W0QA 2W56A 3GAXA 1SIIA 3OWUA 2CG1A 4AEQA 4MJDA 1ULIB 5AYSC 1US1A 4MMZB 5CF1A 3EJVA 4L8PA 3NV0B 3G6E3 3NUVA 2YFIB 1HKXA 3OWSA 3KIIA 1N9JA 5DRVA 3LTDA 1O7MB 2Z76A 1T5YA 3EX9A 4X2OA 3SVAA 1EA2A 1FGQA 3FF2A 2IA7A 1VQL3 5CF2A 3PXMA 4J9AA 1KWIA 2UX0A 3HX8A 2W9QA 1IQ8A 1FA3A 3HZPA 3GZYB 2F98A 3G16A 5CK6A 3SOYA 3VF1A 5STDA 1JB2A 1O7WB 2D42A 3FF0A 4LEHA 4AKZA 2CWTA 3CPOA 2WOHA 1R4CA 3NM7A 2O3OA 4HYZA 1OF5A 1NWWA 2CWVA 3S67A 3K5TA 2BHMA 3NM2A 2B24B 3GZRA 4TX4A 1D6YA 2C11A 5D82A 1NDOB 1YIT3 3I553 4KFFA 1A90A 3JUOA 2Y73A 3DZLA 3LH4A 3Q1CA 3U1WA 1VQN3 2PNCA 2HMKB 3D9RA 2L4VA 3G8ZA 1QVF2 1EKMA 3KE7A 1OACA 2W2CA 2IUJA 1UUWB 4JRFA 1E97A 3BNBA 4N6NB 1GS3A 4IIAA 2FXTA 3I563 4FCZA 1PFPA 2CW9A 3ECFA 3CXC2 5EEOA 3V98A 1Q40B 1UW1A 1W7CA 3E99A 3F40A 4HM7B 1K28A 1UUVB 2GXFA 4HM6B 2W6JH 2O9UX 7STDA 3FG1A 3S5CA 4LMIA 2XFTA 1JN5B 2OQEC 3OX9A 1SJWA 2BO9B 4R4KA 2P05A 1NB5I 3IMAB 1KSIA 2KCDA 5AEWB 1YIJ3 3EN1B 3QRDA 3DGNA 4MMYB 1VQ93 4EC6A 1ASKA 1N8QA 1OPYA 4LSOA 4MEIA 4OUQA 3FCSB 5IG5A 5IF6A 2M7OA 5BXQA 3MPHA 2CC3A 4ORLA 4QWTA 3UL6A 4GB5A 4WFOA 1ISKA 2KXGA 1CYVA 3VGNA 2RGQA 5HGRA 5DREA 2OTJ3 3LT8A 2INXA 3CC73 3S27A 1E3VA 1N5PA 1ULJB 2OWPA 3NBJA 2FNQA 1ZO2A 1W02A 3AMOB 4O3VA 2IMJA 1M9GA 5EVHA 1F8NA 2WGOA 4G1MB 1IQYA 3JUNA 3FG4A 1A67A 1WQLB 2BNGA 4XM4A 3U97A 1YJW3 2GBXB 3RGAA 2MF7A 1N5HA 1L5GB 3HK4A 5KP1A 3M8CA 2CHCA 3OXAA 3T8UA 3ER7A 3F8XA 4NHFA 3B4OA 2CKFB 5IENA 1IVXA 2ML5A 3JUMA 5FW5A 2HMLB 3H3HA 3NQYA 4HM3B 2YFJB 3WA2X 3X40A 3VSYA 2CFLA 2XSOB 2D1WA 1DMMA 3PCSA 3X42A 4K1VA 2QEX3 5BVBA 4KFDA 4EYCA 4HBRA 1OHOA 1YI23 3T8NA 4FMAA 2OTL3 3DGLA 1JB5A 3OW22 4CDLA 3BNDA 1K734 2SBLA 1AV4A 2BMRB 1TP6A 1RN7A 1W6CA 2W04A 3IPTA 3N54B 4KZ1A 3F7SA 4R80A 4KFEA 1WMNA 2OOVC 1M904 1S5AA 1VQ53 1JKGB 2W9PA 5ELUA 4WYKB 3EF8A 1JB4A 4MMXB 3HIGA 5TGNA 2CK3H 3FH1A 4N6LA 1DMQA 4XDVA 1VQ83 1M1K4 3K63A 1NB3I 2QIYA 3DXOA 3MG1A 4XBXA 2LYXA 4STDA 1ROVA 3X3ZA 8CHOA 3NBBA 1TFOA 4N6UA 3F7XA 1FGTA 4WWUC 2YX9A 3V99A 5AIIA 5IG0A 2E2VA 3HI7A 1Z1SA 5ELJA 5AYRB 3K9MC 3CCE3 1Q40A 1IVWA 3DGOA 1VQP3 1FGMA 4XDWA 1O7NB 2CFDA 2OCTA 5AI1A 3CCU3 3CCR3 4R9KA 3Q2PA 1OH0A 4HZBB 1TUHA 1W5ZA 2W56B 1IT7A 3GZXB 3MSOA 3FG3A 1KC84 1SPUA 4R9LA 2IUKA 1GYBA 3CCM3 3N8BA 4GL6A 2MC8A 3V92A 5AEUB 3SLUA 4O02B 2HMJB 4HM8B 2QA43 4RZMA 4KVHA 1MOLA 4H3UA 3CC23 3FSDA 1FUWA 1O7GB 4RBNA 3CC43 3PCRA 3CCJ3 3DGMA 4O2HA 3ROBA 3SOAA 1ZX2A 3CNMA 2XRXB 5LC7A 3QK9A 3UNLA 3CME3 3EHCA 1EG9B 1K9M4 1W00A 4FR9A 4XBYA 1J2BA 4RNYA 3F9SA 2BT3A 4IPBA 2XR8B 1YJN3 3L0RA 2HMMB 3IJEB 3NBRA 2K0MA 3I0YA 3LZAA 4HM5B 1FGOA 1NO3A 3NXJA 1OHSA 1QAKA 2BMQB 2F86B 2P0XA 3UB1A 2RCDA 5G2GA 3T0UA 2ZDJA 4BTXA 3A76A 1JV2B 3J7Yd 3GWRA 1IV9A 1O7PB 3PZWA 1S723 3MKIA 4N6TA 3KSPA 3DMCA 2B1XB 3B8LA 5D83A 3SXXA 3X41A 1LXEA 2V1LA 1CYUA 2WOFA 3EQQB 2CH9A 1OGXA 2XGNA 1RRLA 2Z7AA 2HMNB 3FLJA 1VQO3 1IT8A 1NU3A 4Q53A 5AIHA 1W01A 1W6GA 5IG4A 1TU5A 1A2VA 1VZZA 1GY5A 4X2HA 2GEXA 1RKYA 1SIHA 5CLKA 5KP3A 1Y4KA 1G96A 3PS8A 3JVCA 2WGQA 3NV0A 1AR0A 3EN8A 3CU3A 1CEWI 3CNXA 3FGYA 4WP5A 4EXRA 4N6OB 1GY6A 1IDPA 1LVNA 1Q7Y4 3NQZA 5IW9A 3LYGA 4AKYA 3CMA3 3WOFB 2ZL8A 3G0KA 3LOYA 1RRHA 2QGUA 3BLZA 3LTBA 3ALAA 2LQVA 3B7CA 1W2ZA 2BMOB 1WNHA 4N6MA 5IEOA 1DYUA 1YGEA 3GRDA 3OV4A 2F99A 3GZBA 1Q42A 3UJMA 4XBTA 1DMNA 5EQLA 1GD3A 3KFQC 2E2TA 4K61A 3MG2A 4H61A 5LC6A 2RSXA 2CIUA 3EB8A 1W2B2 3X3XA 4HJLB 4NREA 2XF3A 3CPW2 3K0ZA 3EBYA 3H51A 1UI8A 5I97A 4I4KA 3PYJA 5JPPA 1U8CB 5KP4A 1K8A4 2CFWA 3KN4A 4FMCA 1IQXA 1O7HB 1W6YA 1JRQA 1WMPA 1YVBI 4J8TA 3N9HA 3PGBA 3MYTA 1JJ22 1V74A 1W4NA 3STDA 1IVUA 3JUQA 2HMOB 1KQS2 2OQEA 3MHEA 3F14A 2GU1A 5AIFA 4BTWA 3LMLA 4FMBA 3WODG 4LGQA 3LTAA 3KKGA 4HZ9B 1A2KA 4L7KA 1JN5A 3B4PA 1K41A 5AIGA 3WA3A 3LXUX 1Q824 2JDIH 1VQ63 2Z6BA 1PU4A 1OHPA 3BNEA 2WO0A 1MNLA 3S28A 2ML6A 2P09A 3F8HA 1STDA 4R1KA 2GU3A 2GBWB 2W03A 2XFSA 2XSHB 3BNCA 4JF8A 2E2UA 2I9WA 1IK3A 1UI7A 2XH9A 3O8YA 1EQKA 4RNZA 1OCVA 1CQSA 2K54A 1Q864 3MWZA 4ZM8A 3CCS3 3Q90A 1OF5B 2Q07A 4HM0B 4HVNA 3X3YA 1IV7A 1YJ93
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZW A;  1QJG A;  4FCJ A;  3JUP A;  5IG3 A;  5D81 A;  4FCM A;  1OUN A;  2GEY A;  4U13 A;  3K7C A;  2PZV A;  4XB5 A;  4OVM A;  1OGZ A;  3KZT A;  1E3R A;  6STD A;  4HM1 B;  5IEP A;  2STD A;  5CXO A;  2A15 A;  1BUQ A;  2RFR A;  1GY7 A;  4L8O A;  2JQ5 A;  3NHX A;  3DM8 A;  3WMD A;  4N3V A;  2YFL B;  1JKG A;  1QMA A;  4WYK A;  1C7H A;  3SED A;  4PEJ A;  4K1U A;  3DUK A;  2R4I A;  3BB9 A;  5JPU A;  3EC9 A;  3RGR A;  3FKA A;  3MG3 A;  2Z77 A;  4HKV B;  1U5O A;  3OWY A;  4HM2 B;  3EBT A;  4HM4 B;  5IER A;  3OWU A;  4MJD A;  1ULI B;  5CF1 A;  3EJV A;  4L8P A;  3NV0 B;  3NUV A;  2YFI B;  1HKX A;  3OWS A;  5DRV A;  1O7M B;  2Z76 A;  3EX9 A;  4X2O A;  1EA2 A;  3FF2 A;  5CF2 A;  4J9A A;  2UX0 A;  3HX8 A;  3HZP A;  3GZY B;  2F98 A;  3G16 A;  5CK6 A;  3SOY A;  5STD A;  1JB2 A;  1O7W B;  4LEH A;  3FF0 A;  3CPO A;  1OF5 A;  1NWW A;  3NM2 A;  2B24 B;  3GZR A;  5D82 A;  1NDO B;  3JUO A;  3DZL A;  2HMK B;  3D9R A;  3G8Z A;  3KE7 A;  2W2C A;  1UUW B;  1E97 A;  1GS3 A;  4IIA A;  3ECF A;  1Q40 B;  4HM7 B;  3E99 A;  3F40 A;  1UUV B;  2GXF A;  4HM6 B;  7STD A;  3S5C A;  4LMI A;  1JN5 B;  3OX9 A;  1SJW A;  5AEW B;  3EN1 B;  1ASK A;  1OPY A;  4OUQ A;  5IG5 A;  5IF6 A;  5BXQ A;  4ORL A;  4GB5 A;  1ISK A;  3VGN A;  2RGQ A;  5HGR A;  5DRE A;  2INX A;  1E3V A;  1ULJ B;  2OWP A;  1ZO2 A;  1W02 A;  2IMJ A;  5EVH A;  3JUN A;  1WQL B;  2BNG A;  4XM4 A;  2GBX B;  3RGA A;  5KP1 A;  3HK4 A;  3OXA A;  3T8U A;  2CHC A;  3M8C A;  3ER7 A;  3F8X A;  3B4O A;  2CKF B;  5IEN A;  3JUM A;  5FW5 A;  2HML B;  3H3H A;  4HM3 B;  2YFJ B;  3VSY A;  2XSO B;  1DMM A;  4K1V A;  5BVB A;  1OHO A;  3T8N A;  1JB5 A;  4CDL A;  2BMR B;  1TP6 A;  3IPT A;  3F7S A;  1S5A A;  1JKG B;  4WYK B;  3EF8 A;  1JB4 A;  5TGN A;  3FH1 A;  1DMQ A;  4XDV A;  2QIY A;  3DXO A;  3MG1 A;  4XBX A;  4STD A;  8CHO A;  3F7X A;  4WWU C;  5AII A;  5IG0 A;  1Z1S A;  1Q40 A;  4XDW A;  1O7N B;  5AI1 A;  4R9K A;  1OH0 A;  4HZB B;  1TUH A;  3GZX B;  3MSO A;  4R9L A;  1GYB A;  5AEU B;  2HMJ B;  4HM8 B;  4RZM A;  4KVH A;  4H3U A;  3FSD A;  1O7G B;  3ROB A;  3SOA A;  1ZX2 A;  3CNM A;  2XRX B;  3UNL A;  3EHC A;  1EG9 B;  1W00 A;  4XBY A;  3F9S A;  2XR8 B;  2HMM B;  3NBR A;  3I0Y A;  3LZA A;  4HM5 B;  3NXJ A;  1OHS A;  2BMQ B;  2F86 B;  2RCD A;  5G2G A;  3A76 A;  3GWR A;  1O7P B;  3MKI A;  3KSP A;  3DMC A;  2B1X B;  3B8L A;  5D83 A;  3EQQ B;  1OGX A;  2Z7A A;  3FLJ A;  2HMN B;  1NU3 A;  4Q53 A;  5AIH A;  1W01 A;  5IG4 A;  1VZZ A;  1GY5 A;  4X2H A;  2GEX A;  5CLK A;  5KP3 A;  3NV0 A;  1AR0 A;  3EN8 A;  3CU3 A;  3CNX A;  3FGY A;  4WP5 A;  1GY6 A;  1IDP A;  3LYG A;  3G0K A;  2QGU A;  3BLZ A;  3B7C A;  2BMO B;  5IEO A;  3OV4 A;  3GRD A;  2F99 A;  3GZB A;  1Q42 A;  3UJM A;  4XBT A;  1DMN A;  3MG2 A;  4HJL B;  3K0Z A;  3EBY A;  3H51 A;  4I4K A;  5JPP A;  5KP4 A;  1O7H B;  1W6Y A;  4J8T A;  3MYT A;  3STD A;  3JUQ A;  2HMO B;  3MHE A;  3F14 A;  5AIF A;  4LGQ A;  3KKG A;  4HZ9 B;  1A2K A;  4L7K A;  1JN5 A;  3B4P A;  1K41 A;  5AIG A;  1OHP A;  3F8H A;  1STD A;  4R1K A;  2GBW B;  2XSH B;  2I9W A;  1OCV A;  1CQS A;  2K54 A;  3Q90 A;  1OF5 B;  4HM0 B;  4HVN A; 
#chains in the Genus database with same CATH topology
 2RBI A;  1QJG A;  3FZW A;  3BU4 A;  3AMO A;  1Q81 4;  1IVV A;  3GSP A;  1GMP A;  1RGG A;  4FCJ A;  4RNT A;  3JUP A;  5IG3 A;  3RDE A;  1BSD A;  1JNQ A;  1OUN A;  2GEY A;  2J8X B;  4FCM A;  4GHO A;  4U13 A;  5D81 A;  5G1K A;  5BIR A;  1QVG 2;  5M1A A;  3CD6 3;  3CCQ 3;  1QAF A;  4N6V 0;  3CCL 3;  3K7C A;  2PZV A;  4XB5 A;  1BAN A;  4OVM A;  1OGZ A;  3KZT A;  1E3R A;  4LZI A;  2CWU A;  6STD A;  2P38 A;  3SX1 A;  2KRT A;  4HM1 B;  5IEP A;  2STD A;  1VQK 3;  2K3D A;  3UL5 A;  1B2M A;  5CXO A;  1V58 A;  2A15 A;  1BUQ A;  1JBT A;  2RFR A;  1GMR A;  3TDG A;  3G4S 3;  1GY7 A;  1MWS A;  4L8O A;  4O8S A;  1KD1 4;  1BNE A;  1SQW A;  4FMD A;  1RGL A;  3AGO A;  1FUS A;  1QAL A;  1TIJ A;  2JQ5 A;  1TFK A;  3NHX A;  2AAE A;  3NX0 A;  2OOV A;  4BTY A;  5HOH A;  1NJI 4;  1VQ7 3;  3G71 3;  3DM8 A;  1YHQ 3;  1D6U A;  5A0O B;  4EV5 A;  1LOX A;  1MWU A;  3WMD A;  3HOH A;  4N3V A;  1UCI A;  2Y74 A;  2BU4 A;  1AVK A;  3KSE D;  3HII A;  2YFL B;  2P0M A;  1VQM 3;  1M1X B;  1LNH A;  4EBG A;  5BU4 A;  4WHA A;  1VQ4 3;  4IT7 A;  2FGT A;  1JKG A;  1QMA A;  1DVD A;  2F56 A;  4WYK A;  1C7H A;  2H0I A;  2AAD A;  3SED A;  1RTU A;  5JBS A;  3EE1 A;  4PEJ A;  4K1U A;  1GMQ A;  1STF I;  1G02 A;  1YIT 3;  3DY5 A;  1HU9 A;  1CH0 A;  2CG0 A;  3DUK A;  3WDG B;  1N9E A;  2XEP A;  2CFG A;  3S29 A;  2R4I A;  3BB9 A;  1RJO A;  3LTC A;  2CFK A;  4BL3 A;  4EV2 A;  1AVL A;  2XGL A;  1ROA A;  1BSE A;  4OK0 A;  3EC9 A;  5JPU A;  5FGO A;  2C10 A;  4CCV A;  3CCV 3;  3D79 A;  1N8R 4;  1GD4 A;  3FKA A;  1I2E A;  3MG3 A;  1BRS A;  1D6Z A;  2Z77 A;  3LT9 A;  4NPB A;  3RGR A;  5RNT A;  1JBS A;  4K90 B;  1FGR A;  1TTO A;  4HKV B;  1WTH A;  1U5O A;  3OWY A;  4HM2 B;  3EBT A;  1WMO A;  3WOE B;  1I3F A;  2CX0 A;  4HM4 B;  5IER A;  1IU7 A;  3D3L A;  4HOH A;  1SAR A;  1DVC A;  2W0Q A;  2W56 A;  3GAX A;  1SII A;  3OWU A;  2CG1 A;  1LRA A;  4AEQ A;  4MJD A;  1ULI B;  1UDI I;  5AYS C;  1US1 A;  4MMZ B;  1C54 A;  5CF1 A;  3EJV A;  4L8P A;  1DE3 A;  3NV0 B;  3G6E 3;  3NUV A;  2YFI B;  1HKX A;  1X1X A;  3KII A;  1N9J A;  3OWS A;  3LTD A;  1O7M B;  2Z76 A;  5DRV A;  1HYF A;  1T5Y A;  3EX9 A;  4X2O A;  3SVA A;  1EA2 A;  1FGQ A;  3FF2 A;  2IA7 A;  1VQL 3;  5CF2 A;  3PXM A;  4J9A A;  1KWI A;  2UX0 A;  3HX8 A;  2W9Q A;  1IQ8 A;  1BUJ A;  1FA3 A;  3HZP A;  3GZY B;  2F98 A;  3G16 A;  5CK6 A;  1RCK A;  3AGN A;  3SOY A;  3VF1 A;  5STD A;  1JB2 A;  1O7W B;  2D42 A;  3FF0 A;  4LEH A;  4AKZ A;  1JBR A;  1BU4 A;  2CWT A;  3CPO A;  2WOH A;  1R4C A;  3NM7 A;  2O3O A;  4HYZ A;  1OF5 A;  1NWW A;  2CWV A;  3D5G A;  2KAA A;  3S67 A;  3K5T A;  2BHM A;  3NM2 A;  2B24 B;  3GZR A;  4TX4 A;  1D6Y A;  2C11 A;  2F4Y A;  1NDO B;  1JZD A;  5D82 A;  3I55 3;  1BNI A;  4KFF A;  1A90 A;  3JUO A;  2Y73 A;  3DZL A;  3LH4 A;  3Q1C A;  3U1W A;  1VQN 3;  2PNC A;  2HMK B;  3D9R A;  2L4V A;  1I2G A;  3G8Z A;  4BL2 A;  1QVF 2;  3WR2 A;  6GSP A;  1BRK A;  1EKM A;  3KE7 A;  1OAC A;  1X1W A;  2W2C A;  4HAA A;  2IUJ A;  1UUW B;  1I8V A;  4JRF A;  1E97 A;  3BNB A;  2IYJ A;  1RGF A;  4N6N B;  1GS3 A;  4IIA A;  2FXT A;  1I70 A;  3I56 3;  2UUG C;  4FCZ A;  1PFP A;  1TRP A;  2CW9 A;  3ECF A;  3CXC 2;  5EEO A;  3V98 A;  1MWT A;  1Q40 B;  1UCK A;  1UW1 A;  1W7C A;  3E99 A;  3F40 A;  4HM7 B;  1K28 A;  1UUV B;  2GXF A;  4HM6 B;  2W6J H;  4ILF A;  2O9U X;  7STD A;  3FG1 A;  3S5C A;  4LMI A;  1BVI A;  2H0H A;  1I3I A;  2XFT A;  1JN5 B;  2OQE C;  3OX9 A;  4BU4 A;  1SJW A;  2BO9 B;  4R4K A;  2P05 A;  1NB5 I;  3IMA B;  1KSI A;  2KCD A;  5AEW B;  1YIJ 3;  3EN1 B;  3QRD A;  3DGN A;  4MMY B;  1VQ9 3;  1FZU A;  4EC6 A;  1ASK A;  1N8Q A;  1OPY A;  4LSO A;  4MEI A;  4OUQ A;  1B27 A;  3FCS B;  5IG5 A;  1BNG A;  5IF6 A;  2M7O A;  5BXQ A;  3MPH A;  2CC3 A;  4ORL A;  1BNS A;  4QWT A;  3UL6 A;  4GB5 A;  4WFO A;  1ISK A;  2KXG A;  1RLS A;  1CYV A;  3VGN A;  2RGQ A;  4CPK A;  5HGR A;  2KF6 A;  5DRE A;  2OTJ 3;  3LT8 A;  2INX A;  2L1S A;  3CC7 3;  3S27 A;  1E3V A;  1N5P A;  1ULJ B;  2OWP A;  4J5K A;  3NBJ A;  2FNQ A;  1ZO2 A;  1W02 A;  3AMO B;  4O3V A;  2IMJ A;  1M9G A;  1B3S A;  5EVH A;  1F8N A;  1V57 A;  2WGO A;  1IQY A;  3JUN A;  4G1M B;  3FG4 A;  1A67 A;  1WQL B;  2BNG A;  4XM4 A;  3U97 A;  1YJW 3;  1HZ1 A;  2GBX B;  3RGA A;  2MF7 A;  1N5H A;  1GOY A;  2KF5 A;  3HK4 A;  1L5G B;  5KP1 A;  3M8C A;  2CHC A;  3OXA A;  3RNT A;  3ER7 A;  3F8X A;  3T8U A;  4NHF A;  3B4O A;  2CKF B;  4BIR A;  5IEN A;  1B2U A;  1BRH A;  1IVX A;  2ML5 A;  3JUM A;  5FW5 A;  2HML B;  3H3H A;  3NQY A;  4HM3 B;  2YFJ B;  3WA2 X;  1B21 A;  3VSY A;  3X40 A;  1VQQ A;  9RNT A;  2CFL A;  2XSO B;  2D1W A;  2IY2 A;  1DMM A;  3PCS A;  3X42 A;  1PY3 A;  4K1V A;  2QEX 3;  5BVB A;  4KFD A;  4EYC A;  4HBR A;  1OHO A;  1RSN A;  1YI2 3;  3T8N A;  4FMA A;  2OTL 3;  3DGL A;  1JB5 A;  3ZFZ A;  3URP A;  3OW2 2;  4CDL A;  3BND A;  1K73 4;  3KCH A;  2SBL A;  1AV4 A;  2BMR B;  1TP6 A;  1RN7 A;  1W6C A;  2W04 A;  1Q9E A;  3IPT A;  3N54 B;  4KZ1 A;  1JZO A;  3F7S A;  4R80 A;  6RNT A;  4KFE A;  1WMN A;  2OOV C;  1M90 4;  1GOV A;  1S5A A;  1JKG B;  2W9P A;  1BRN L;  1VQ5 3;  5ELU A;  4WYK B;  3EF8 A;  1JB4 A;  4MMX B;  3HIG A;  5TGN A;  2CK3 H;  4DKI A;  3FH1 A;  4N6L A;  2KF3 A;  1DMQ A;  4XDV A;  1IV7 A;  1VQ8 3;  1M1K 4;  3K63 A;  2F5W A;  1NB3 I;  1UCL A;  2QIY A;  3DXO A;  3MG1 A;  4XBX A;  2LYX A;  4STD A;  1ROV A;  3X3Z A;  8CHO A;  3NBB A;  1TFO A;  4N6U A;  3F7X A;  1FGT A;  3A5E A;  4WWU C;  2YX9 A;  2R41 A;  3V99 A;  5AII A;  5IG0 A;  2E2V A;  1RGH A;  3HI7 A;  1Z1S A;  1T2H A;  5ELJ A;  5AYR B;  3K9M C;  1RNT A;  5M19 A;  1Q40 A;  3CCE 3;  1IVW A;  3DGO A;  1VQP 3;  1FGM A;  4XDW A;  1O7N B;  1X1U A;  2CFD A;  7RNT A;  2OCT A;  5AI1 A;  3CCU 3;  3CCR 3;  4R9K A;  3Q2P A;  1OH0 A;  4HZB B;  1TUH A;  1W5Z A;  2W56 B;  1BNR A;  1IT7 A;  3GZX B;  3MSO A;  3FG3 A;  1KC8 4;  1SPU A;  4R9L A;  1B20 A;  2IUK A;  1GYB A;  3CCM 3;  3N8B A;  4GL6 A;  1RGE A;  2C4B A;  2MC8 A;  3V92 A;  5AEU B;  3SLU A;  4O02 B;  1R4Y A;  2HMJ B;  4HM8 B;  2QA4 3;  2HOH A;  4RZM A;  1RN1 A;  4KVH A;  1B2X A;  1MOL A;  4H3U A;  3CC2 3;  3FSD A;  1FUW A;  1O7G B;  4RBN A;  3CC4 3;  3PCR A;  3SYU A;  3DGM A;  4O2H A;  3CCJ 3;  3ROB A;  3SOA A;  1ZX2 A;  3CNM A;  2XRX B;  5LC7 A;  3QK9 A;  3UNL A;  1GSP A;  3CME 3;  3EHC A;  5GSP A;  1EG9 B;  1K9M 4;  1T3B A;  1W00 A;  4FR9 A;  4XBY A;  1J2B A;  4I5Q A;  4RNY A;  3D4A A;  3F9S A;  2BT3 A;  1LQM B;  2XR8 B;  4IPB A;  1YJN 3;  3L0R A;  2HMM B;  3IJE B;  3NBR A;  2K0M A;  3I0Y A;  3LZA A;  4HM5 B;  4CJN A;  2KF4 A;  1BRI A;  1FGO A;  1NO3 A;  3NXJ A;  1GOU A;  2ZA4 A;  1OHS A;  1QAK A;  2BMQ B;  1YNV X;  2F86 B;  2F5M A;  3ZG5 A;  1X1Y A;  1LOV A;  2P0X A;  2RCD A;  5G2G A;  3T0U A;  3UB1 A;  2ZDJ A;  4BTX A;  3A76 A;  1BSC A;  1TRQ A;  1JV2 B;  3J7Y d;  3GWR A;  1IV9 A;  1O7P B;  1RGK A;  1RGC A;  3PZW A;  1S72 3;  3MKI A;  4N6T A;  3KSP A;  3DMC A;  1AY7 A;  2B1X B;  1BGS A;  3B8L A;  5D83 A;  3SXX A;  3X41 A;  1LXE A;  2V1L A;  1CYU A;  2WOF A;  3EQQ B;  2CH9 A;  1OGX A;  1LOW A;  2XGN A;  7GSP A;  1RRL A;  2Z7A A;  2HMN B;  3FLJ A;  1VQO 3;  1Q7H A;  1IT8 A;  1NU3 A;  1ZS7 A;  1UGH I;  4Q53 A;  1RMS A;  5G1L A;  5AIH A;  1W01 A;  1W6G A;  5IG4 A;  1TU5 A;  1A2V A;  1VZZ A;  1GY5 A;  4X2H A;  2GEX A;  1RKY A;  3AHS A;  1SIH A;  1UUG B;  5CLK A;  5KP3 A;  1G0T A;  1ZGX A;  1Y4K A;  1G96 A;  3PS8 A;  3JVC A;  2WGQ A;  3NV0 A;  1AR0 A;  3EN8 A;  3CU3 A;  1CEW I;  3CNX A;  3FGY A;  4WP5 A;  1RNB A;  2SAR A;  4N6O B;  4EXR A;  1GY6 A;  1IDP A;  1LVN A;  1DET A;  1A2P A;  1BNJ A;  1Q7Y 4;  3NQZ A;  5IW9 A;  3LYG A;  1TJD A;  4AKY A;  3CMA 3;  1BRG A;  3WOF B;  1YVS A;  1BRJ A;  2RNT A;  4LYL B;  1B2S A;  2ZL8 A;  3G0K A;  3LOY A;  1RRH A;  2QGU A;  3BLZ A;  1B2Z A;  1I2F A;  3ALA A;  3LTB A;  2LQV A;  3B7C A;  1W2Z A;  2BMO B;  1WNH A;  4N6M A;  5IEO A;  1BAO A;  1DYU A;  1YGE A;  3GRD A;  3OV4 A;  2F99 A;  3GZB A;  1AQZ A;  1Q42 A;  1LQG C;  3UJM A;  8RNT A;  1PYL A;  1DMN A;  1FYS A;  1GD3 A;  3DGY A;  3KFQ C;  4XBT A;  5EQL A;  5M18 A;  2E2T A;  1LOY A;  4K61 A;  3MG2 A;  4H61 A;  5LC6 A;  2RSX A;  2CIU A;  3EB8 A;  1W2B 2;  3X3X A;  1MGR A;  1BSB A;  2XF3 A;  3DH2 A;  4HJL B;  4J5G A;  4NRE A;  3K0Z A;  2GSP A;  3EBY A;  3CPW 2;  3H51 A;  3ZG0 A;  1UI8 A;  5I97 A;  1RHL A;  1RDS A;  4I4K A;  1UGI A;  3PYJ A;  5JPP A;  1U8C B;  5KP4 A;  1K8A 4;  2CFW A;  3KN4 A;  4FMC A;  1IQX A;  1O7H B;  3Q3F A;  1W6Y A;  1JRQ A;  1FUT A;  1WMP A;  1YVB I;  1FW7 A;  4J8T A;  1MGW A;  1EEJ A;  1BSA A;  1EUI C;  3N9H A;  1LNI A;  3PGB A;  3MYT A;  1JJ2 2;  1V74 A;  1W4N A;  1I0V A;  1BNF A;  1RCL A;  3STD A;  1IVU A;  3JUQ A;  2HMO B;  1KQS 2;  2OQE A;  2H0G A;  3AHW A;  3MHE A;  2ZHX B;  3F14 A;  1MWR A;  2GU1 A;  2UGI A;  5AIF A;  4BTW A;  3LML A;  1UCJ A;  4FMB A;  3WOD G;  4LGQ A;  1BIR A;  3LTA A;  3KKG A;  4HZ9 B;  3WHO A;  1A2K A;  4L7K A;  1JN5 A;  3B4P A;  1K41 A;  3BIR A;  3D5I A;  5AIG A;  3WA3 A;  3LXU X;  1BOX A;  1Q82 4;  2JDI H;  1VQ6 3;  1NNV A;  2Z6B A;  1PU4 A;  1OHP A;  3BNE A;  1RGA A;  2WO0 A;  1MNL A;  4KT3 B;  1IYY A;  3S28 A;  2ML6 A;  2P09 A;  2BIR A;  3F8H A;  1STD A;  4R1K A;  2GU3 A;  1RN4 A;  2GBW B;  2W03 A;  2XFS A;  2XSH B;  3BNC A;  4JF8 A;  2E2U A;  2I9W A;  1IK3 A;  1UI7 A;  1YGW A;  2XH9 A;  3O8Y A;  4RNZ A;  1OCV A;  1CQS A;  2K54 A;  4EW5 A;  1Q86 4;  1EQK A;  3MWZ A;  4ZM8 A;  1I0X A;  3Q90 A;  3CCS 3;  4GSP A;  1OF5 B;  2Q07 A;  4HM0 B;  4HVN A;  3X3Y A;  1T2I A;  2CX1 A;  1YJ9 3; 
#chains in the Genus database with same CATH homology
 3FZW A;  1QJG A;  3AMO A;  1Q81 4;  1IVV A;  4FCJ A;  3JUP A;  5IG3 A;  3RDE A;  1JNQ A;  4FCM A;  1OUN A;  2GEY A;  4U13 A;  5D81 A;  1QVG 2;  3CD6 3;  3CCQ 3;  1QAF A;  4N6V 0;  3CCL 3;  3K7C A;  2PZV A;  4XB5 A;  4OVM A;  1OGZ A;  3KZT A;  1E3R A;  4LZI A;  2CWU A;  6STD A;  2P38 A;  3SX1 A;  2KRT A;  4HM1 B;  5IEP A;  2STD A;  1VQK 3;  3UL5 A;  5CXO A;  2A15 A;  1BUQ A;  2RFR A;  3TDG A;  3G4S 3;  1KD1 4;  1GY7 A;  4L8O A;  4O8S A;  1SQW A;  4FMD A;  1QAL A;  1TIJ A;  2JQ5 A;  1TFK A;  3NHX A;  3NX0 A;  2OOV A;  4BTY A;  1NJI 4;  1VQ7 3;  3G71 3;  3DM8 A;  1YHQ 3;  1D6U A;  5A0O B;  4EV5 A;  1LOX A;  3WMD A;  4N3V A;  2Y74 A;  1AVK A;  3KSE D;  3HII A;  2YFL B;  2P0M A;  1VQM 3;  1M1X B;  1LNH A;  4EBG A;  1VQ4 3;  4WHA A;  4IT7 A;  2FGT A;  1JKG A;  1QMA A;  1DVD A;  4WYK A;  1C7H A;  3SED A;  5JBS A;  3EE1 A;  4PEJ A;  4K1U A;  1STF I;  3DY5 A;  1HU9 A;  2CG0 A;  3DUK A;  3WDG B;  1N9E A;  2XEP A;  2CFG A;  3S29 A;  2R4I A;  3BB9 A;  1RJO A;  3LTC A;  2CFK A;  4EV2 A;  1AVL A;  2XGL A;  1ROA A;  4OK0 A;  3EC9 A;  5JPU A;  5FGO A;  2C10 A;  4CCV A;  3CCV 3;  1N8R 4;  1GD4 A;  3FKA A;  3MG3 A;  3RGR A;  1D6Z A;  2Z77 A;  3LT9 A;  4K90 B;  1FGR A;  4HKV B;  1WTH A;  1U5O A;  3OWY A;  4HM2 B;  3EBT A;  1WMO A;  3WOE B;  4HM4 B;  5IER A;  1IU7 A;  3D3L A;  1DVC A;  2W0Q A;  2W56 A;  3GAX A;  1SII A;  3OWU A;  2CG1 A;  4AEQ A;  4MJD A;  1ULI B;  5AYS C;  1US1 A;  4MMZ B;  5CF1 A;  3EJV A;  4L8P A;  3NV0 B;  3G6E 3;  3NUV A;  2YFI B;  1HKX A;  3OWS A;  3KII A;  1N9J A;  5DRV A;  3LTD A;  1O7M B;  2Z76 A;  1T5Y A;  3EX9 A;  4X2O A;  3SVA A;  1EA2 A;  1FGQ A;  3FF2 A;  2IA7 A;  1VQL 3;  5CF2 A;  3PXM A;  4J9A A;  1KWI A;  2UX0 A;  3HX8 A;  2W9Q A;  1IQ8 A;  1FA3 A;  3HZP A;  3GZY B;  2F98 A;  3G16 A;  5CK6 A;  3SOY A;  3VF1 A;  5STD A;  1JB2 A;  1O7W B;  2D42 A;  3FF0 A;  4LEH A;  4AKZ A;  2CWT A;  3CPO A;  2WOH A;  1R4C A;  3NM7 A;  2O3O A;  4HYZ A;  1OF5 A;  1NWW A;  2CWV A;  3S67 A;  3K5T A;  2BHM A;  3NM2 A;  2B24 B;  3GZR A;  4TX4 A;  1D6Y A;  2C11 A;  5D82 A;  1NDO B;  1YIT 3;  3I55 3;  4KFF A;  1A90 A;  3JUO A;  2Y73 A;  3DZL A;  3LH4 A;  3Q1C A;  3U1W A;  1VQN 3;  2PNC A;  2HMK B;  3D9R A;  2L4V A;  3G8Z A;  1QVF 2;  1EKM A;  3KE7 A;  1OAC A;  2W2C A;  2IUJ A;  1UUW B;  4JRF A;  1E97 A;  3BNB A;  4N6N B;  1GS3 A;  4IIA A;  2FXT A;  3I56 3;  4FCZ A;  1PFP A;  2CW9 A;  3ECF A;  3CXC 2;  5EEO A;  3V98 A;  1Q40 B;  1UW1 A;  1W7C A;  3E99 A;  3F40 A;  4HM7 B;  1K28 A;  1UUV B;  2GXF A;  4HM6 B;  2W6J H;  2O9U X;  7STD A;  3FG1 A;  3S5C A;  4LMI A;  2XFT A;  1JN5 B;  2OQE C;  3OX9 A;  1SJW A;  2BO9 B;  4R4K A;  2P05 A;  1NB5 I;  3IMA B;  1KSI A;  2KCD A;  5AEW B;  1YIJ 3;  3EN1 B;  3QRD A;  3DGN A;  4MMY B;  1VQ9 3;  4EC6 A;  1ASK A;  1N8Q A;  1OPY A;  4LSO A;  4MEI A;  4OUQ A;  3FCS B;  5IG5 A;  5IF6 A;  2M7O A;  5BXQ A;  3MPH A;  2CC3 A;  4ORL A;  4QWT A;  3UL6 A;  4GB5 A;  4WFO A;  1ISK A;  2KXG A;  1CYV A;  3VGN A;  2RGQ A;  5HGR A;  5DRE A;  2OTJ 3;  3LT8 A;  2INX A;  3CC7 3;  3S27 A;  1E3V A;  1N5P A;  1ULJ B;  2OWP A;  3NBJ A;  2FNQ A;  1ZO2 A;  1W02 A;  3AMO B;  4O3V A;  2IMJ A;  1M9G A;  5EVH A;  1F8N A;  2WGO A;  4G1M B;  1IQY A;  3JUN A;  3FG4 A;  1A67 A;  1WQL B;  2BNG A;  4XM4 A;  3U97 A;  1YJW 3;  2GBX B;  3RGA A;  2MF7 A;  1N5H A;  1L5G B;  3HK4 A;  5KP1 A;  3M8C A;  2CHC A;  3OXA A;  3T8U A;  3ER7 A;  3F8X A;  4NHF A;  3B4O A;  2CKF B;  5IEN A;  1IVX A;  2ML5 A;  3JUM A;  5FW5 A;  2HML B;  3H3H A;  3NQY A;  4HM3 B;  2YFJ B;  3WA2 X;  3X40 A;  3VSY A;  2CFL A;  2XSO B;  2D1W A;  1DMM A;  3PCS A;  3X42 A;  4K1V A;  2QEX 3;  5BVB A;  4KFD A;  4EYC A;  4HBR A;  1OHO A;  1YI2 3;  3T8N A;  4FMA A;  2OTL 3;  3DGL A;  1JB5 A;  3OW2 2;  4CDL A;  3BND A;  1K73 4;  2SBL A;  1AV4 A;  2BMR B;  1TP6 A;  1RN7 A;  1W6C A;  2W04 A;  3IPT A;  3N54 B;  4KZ1 A;  3F7S A;  4R80 A;  4KFE A;  1WMN A;  2OOV C;  1M90 4;  1S5A A;  1VQ5 3;  1JKG B;  2W9P A;  5ELU A;  4WYK B;  3EF8 A;  1JB4 A;  4MMX B;  3HIG A;  5TGN A;  2CK3 H;  3FH1 A;  4N6L A;  1DMQ A;  4XDV A;  1VQ8 3;  1M1K 4;  3K63 A;  1NB3 I;  2QIY A;  3DXO A;  3MG1 A;  4XBX A;  2LYX A;  4STD A;  1ROV A;  3X3Z A;  8CHO A;  3NBB A;  1TFO A;  4N6U A;  3F7X A;  1FGT A;  4WWU C;  2YX9 A;  3V99 A;  5AII A;  5IG0 A;  2E2V A;  3HI7 A;  1Z1S A;  5ELJ A;  5AYR B;  3K9M C;  3CCE 3;  1Q40 A;  1IVW A;  3DGO A;  1VQP 3;  1FGM A;  4XDW A;  1O7N B;  2CFD A;  2OCT A;  5AI1 A;  3CCU 3;  3CCR 3;  4R9K A;  3Q2P A;  1OH0 A;  4HZB B;  1TUH A;  1W5Z A;  2W56 B;  1IT7 A;  3GZX B;  3MSO A;  3FG3 A;  1KC8 4;  1SPU A;  4R9L A;  2IUK A;  1GYB A;  3CCM 3;  3N8B A;  4GL6 A;  2MC8 A;  3V92 A;  5AEU B;  3SLU A;  4O02 B;  2HMJ B;  4HM8 B;  2QA4 3;  4RZM A;  4KVH A;  1MOL A;  4H3U A;  3CC2 3;  3FSD A;  1FUW A;  1O7G B;  4RBN A;  3CC4 3;  3PCR A;  3CCJ 3;  3DGM A;  4O2H A;  3ROB A;  3SOA A;  1ZX2 A;  3CNM A;  2XRX B;  5LC7 A;  3QK9 A;  3UNL A;  3CME 3;  3EHC A;  1EG9 B;  1K9M 4;  1W00 A;  4FR9 A;  4XBY A;  1J2B A;  4RNY A;  3F9S A;  2BT3 A;  4IPB A;  2XR8 B;  1YJN 3;  3L0R A;  2HMM B;  3IJE B;  3NBR A;  2K0M A;  3I0Y A;  3LZA A;  4HM5 B;  1FGO A;  1NO3 A;  3NXJ A;  1OHS A;  1QAK A;  2BMQ B;  2F86 B;  2P0X A;  3UB1 A;  2RCD A;  5G2G A;  3T0U A;  2ZDJ A;  4BTX A;  3A76 A;  1JV2 B;  3J7Y d;  3GWR A;  1IV9 A;  1O7P B;  3PZW A;  1S72 3;  3MKI A;  4N6T A;  3KSP A;  3DMC A;  2B1X B;  3B8L A;  5D83 A;  3SXX A;  3X41 A;  1LXE A;  2V1L A;  1CYU A;  2WOF A;  3EQQ B;  2CH9 A;  1OGX A;  2XGN A;  1RRL A;  2Z7A A;  2HMN B;  3FLJ A;  1VQO 3;  1IT8 A;  1NU3 A;  4Q53 A;  5AIH A;  1W01 A;  1W6G A;  5IG4 A;  1TU5 A;  1A2V A;  1VZZ A;  1GY5 A;  4X2H A;  2GEX A;  1RKY A;  1SIH A;  5CLK A;  5KP3 A;  1Y4K A;  1G96 A;  3PS8 A;  3JVC A;  2WGQ A;  3NV0 A;  1AR0 A;  3EN8 A;  3CU3 A;  1CEW I;  3CNX A;  3FGY A;  4WP5 A;  4EXR A;  4N6O B;  1GY6 A;  1IDP A;  1LVN A;  1Q7Y 4;  3NQZ A;  5IW9 A;  3LYG A;  4AKY A;  3CMA 3;  3WOF B;  2ZL8 A;  3G0K A;  3LOY A;  1RRH A;  2QGU A;  3BLZ A;  3LTB A;  3ALA A;  2LQV A;  3B7C A;  1W2Z A;  2BMO B;  1WNH A;  4N6M A;  5IEO A;  1DYU A;  1YGE A;  3GRD A;  3OV4 A;  2F99 A;  3GZB A;  1Q42 A;  3UJM A;  4XBT A;  1DMN A;  5EQL A;  1GD3 A;  3KFQ C;  2E2T A;  4K61 A;  3MG2 A;  4H61 A;  5LC6 A;  2RSX A;  2CIU A;  3EB8 A;  1W2B 2;  3X3X A;  4HJL B;  4NRE A;  2XF3 A;  3CPW 2;  3K0Z A;  3EBY A;  3H51 A;  1UI8 A;  5I97 A;  4I4K A;  3PYJ A;  5JPP A;  1U8C B;  5KP4 A;  1K8A 4;  2CFW A;  3KN4 A;  4FMC A;  1IQX A;  1O7H B;  1W6Y A;  1JRQ A;  1WMP A;  1YVB I;  4J8T A;  3N9H A;  3PGB A;  3MYT A;  1JJ2 2;  1V74 A;  1W4N A;  3STD A;  1IVU A;  3JUQ A;  2HMO B;  1KQS 2;  2OQE A;  3MHE A;  3F14 A;  2GU1 A;  5AIF A;  4BTW A;  3LML A;  4FMB A;  3WOD G;  4LGQ A;  3LTA A;  3KKG A;  4HZ9 B;  1A2K A;  4L7K A;  1JN5 A;  3B4P A;  1K41 A;  5AIG A;  3WA3 A;  3LXU X;  1Q82 4;  2JDI H;  1VQ6 3;  2Z6B A;  1PU4 A;  1OHP A;  3BNE A;  2WO0 A;  1MNL A;  3S28 A;  2ML6 A;  2P09 A;  3F8H A;  1STD A;  4R1K A;  2GU3 A;  2GBW B;  2W03 A;  2XFS A;  2XSH B;  3BNC A;  4JF8 A;  2E2U A;  2I9W A;  1IK3 A;  1UI7 A;  2XH9 A;  3O8Y A;  1EQK A;  4RNZ A;  1OCV A;  1CQS A;  2K54 A;  1Q86 4;  3MWZ A;  4ZM8 A;  3CCS 3;  3Q90 A;  1OF5 B;  2Q07 A;  4HM0 B;  4HVN A;  3X3Y A;  1IV7 A;  1YJ9 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...