1JB5A

Crystal structure of ntf2 m118e mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
123
Chain Sequence
b'KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDEFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
molecule tags Protein transport
source organism Rattus norvegicus
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
total genus 35
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb5A00
5JPPA 6STDA 3OWUA 3KE7A 3B4OA 5AIGA 3B8LA 3MYTA 2CKFB 1ZO2A 3EQQB 5AEWB 1NDOB 1O7GB 3FF2A 2QGUA 3EBTA 4HZ9B 5KP1A 2A15A 3HK4A 3NXJA 3MKIA 4HM0B 5EVHA 2B1XB 1OUNA 3BLZA 3CNMA 5G2GA 4HM2B 1CQSA 3S5CA 4HM4B 2GBXB 5TGNA 4XDWA 1JB2A 3OX9A 3GRDA 3NM2A 3I0YA 5BXQA 1S5AA 3IPTA 1JN5A 3KKGA 3RGAA 1Z1SA 3ECFA 5CF1A 1VZZA 3GWRA 4RZMA 3RGRA 1GYBA 1E3RA 3NUVA 1DMMA 3H51A 2F98A 4K1UA 5BVBA 4K1VA 3T8UA 3FGYA 2XSOB 2CHCA 4HM1B 2Z7AA 1IDPA 3GZYB 3MG1A 4HZBB 4MJDA 4OVMA 5CLKA 4Q53A 4XBTA 3ROBA 3T8NA 2Z76A 5IENA 3EF8A 5FW5A 2IMJA 1ASKA 5D83A 1JKGA 3JUOA 4X2OA 5KP3A 1OF5B 4HJLB 3M8CA 5KP4A 1UUWB 3EX9A 1JB4A 1OHSA 2F99A 3F8XA 1A2KA 4STDA 5CF2A 2PZVA 4LMIA 5AIFA 2F86B 2HMNB 3K7CA 4WP5A 3F40A 2INXA 4HVNA 1QMAA 4L8PA 3UJMA 4XBXA 1Q40B 3EN1B 1W02A 5AIHA 1ISKA 4R9KA 1Q42A 2BMQB 5CXOA 3ER7A 1TP6A 4XDVA 3F7XA 1E97A 3JUQA 2RFRA 2GXFA 3OWSA 4J9AA 4OUQA 1EA2A 1W01A 2YFJB 3Q90A 1STDA 2RCDA 1NU3A 2UX0A 2GBWB 3EC9A 3G0KA 1AR0A 5HGRA 5IF6A 1OPYA 4HM7B 1K41A 5IG4A 3BB9A 3F14A 1DMNA 1EG9B 1BUQA 3MHEA 4H3UA 1C7HA 1GY5A 2RGQA 2STDA 3EHCA 4FCMA 4WWUC 3SEDA 2XSHB 3F7SA 4WYKB 5AEUB 1JN5B 5IEPA 1JKGB 1NWWA 3DUKA 2HMMB 4HM8B 5DRVA 1GY6A 1OF5A 1WQLB 3E99A 3DZLA 3F9SA 1GS3A 3JUMA 4L8OA 5IERA 3EN8A 1O7NB 1W00A 2I9WA 3EJVA 3HX8A 3OWYA 4J8TA 7STDA 2YFIB 4HM6B 3CU3A 2OWPA 3GZBA 3LZAA 2GEXA 5IG0A 1O7PB 5IG5A 3LYGA 3FZWA 1SJWA 3G8ZA 3MG3A 2B24B 2W2CA 3DXOA 2JQ5A 5CK6A 5AIIA 3D9RA 5STDA 4ORLA 3VSYA 4U13A 1ULJB 1TUHA 3B7CA 1DMQA 4L7KA 3G16A 4PEJA 3KZTA 1OCVA 2K54A 5JPUA 3DM8A 4LEHA 3F8HA 3VGNA 1JB5A 1HKXA 2BNGA 2QIYA 1OHPA 3FF0A 3FKAA 3GZRA 4N3VA 2XRXB 4X2HA 3SOYA 4HM5B 2BMOB 1QJGA 4HKVB 3CNXA 3GZXB 3JUPA 2GEYA 4XB5A 2XR8B 3B4PA 3A76A 1GY7A 1O7HB 3EBYA 5IG3A 2YFLB 2HMJB 1U5OA 2HMLB 3DMCA 5AI1A 4KVHA 3SOAA 2BMRB 2HMKB 3NBRA 4FCJA 4R1KA 2HMOB 3OV4A 1O7MB 1OGXA 3NV0A 5DREA 3KSPA 1OH0A 3STDA 3OXAA 2Z77A 3CPOA 3UNLA 3K0ZA 4HM3B 3HZPA 3MSOA 4XBYA 3NHXA 1UUVB 4GB5A 1ZX2A 5D81A 4XM4A 3MG2A 4CDLA 8CHOA 4LGQA 1OGZA 1O7WB 1Q40A 1ULIB 3H3HA 4I4KA 5IEOA 3WMDA 3JUNA 3FLJA 4WYKA 1E3VA 3NV0B 5D82A 3FSDA 1W6YA 4R9LA 1OHOA 3FH1A 2R4IA 4IIAA
chains in the Genus database with same CATH superfamily
3KE7A 5AIGA 9RNTA 3IMAB 1JBRA 3A5EA 1W4NA 1ZO2A 6RNTA 3WA3A 1TIJA 1NDOB 5BU4A 2QGUA 3EBTA 2QA43 1VQO3 5EVHA 1JJ22 2B1XB 3ALAA 3CNMA 5ELJA 3S5CA 2F4YA 1A67A 3DGLA 4XDWA 1LOVA 5TGNA 1A2PA 2BO9B 2P0XA 1J2BA 3WODG 5BXQA 2P05A 2XFSA 4BL2A 1EQKA 5LC7A 1Z1SA 1K8A4 1RGLA 1RNTA 1YGWA 2XEPA 3GWRA 1UGHI 4FCZA 1AY7A 4K1VA 3T8UA 1SIIA 2CHCA 4HM1B 2Z7AA 3GZYB 3MG1A 5CLKA 1UW1A 4Q53A 5IENA 2Z76A 1RGHA 1VQ83 1NB3I 2W6JH 3TDGA 1RCLA 1HZ1A 4MMZB 5A0OB 1OF5B 3QK9A 5KP4A 1IYYA 5IW9A 1PU4A 3LTDA 4N6UA 1OHSA 1U8CB 1US1A 2PZVA 3PGBA 2W04A 2OQEC 4BIRA 4N6LA 4LYLB 2BT3A 1QMAA 2SBLA 4KFEA 5AIHA 1W02A 4J5KA 3CMA3 4R9KA 4WFOA 2BMQB 1N8QA 1K734 1B2XA 1TP6A 4KFDA 3JUQA 5G1KA 1CYUA 1G96A 1BSCA 4KT3B 3EC9A 2RCDA 3G0KA 3G4S3 1RN4A 1X1XA 5IF6A 4N6OB 2KF3A 3DGMA 3Q3FA 4N6TA 4RNTA 5IG4A 1RGFA 3BB9A 4NPBA 3N54B 1EG9B 1LOXA 1IVXA 4AEQA 1M1XB 2IUKA 1GY5A 1FGMA 1DE3A 4ZM8A 2JDIH 2RGQA 3CD63 4NREA 2GU1A 3WR2A 3LXUX 1ZGXA 4JRFA 2CWTA 3LH4A 3BNCA 1GY6A 1WQLB 2XF3A 1D6ZA 2IYJA 3AMOB 1GS3A 3E99A 3F9SA 2CW9A 4MMYB 3HX8A 5IERA 3FCSB 2I9WA 3OWYA 2MC8A 2IA7A 2J8XB 5M18A 2YFIB 1UGIA 1QAFA 2OWPA 3GZBA 1O7PB 1NB5I 2KF4A 1CH0A 1VQP3 4N6V0 3QRDA 2Y73A 4BTYA 2LQVA 5STDA 1WMOA 1IT8A 1BRHA 2RBIA 3B7CA 1LQGC 2FNQA 1OCVA 2K54A 2C4BA 2E2UA 1YNVX 1B2SA 3VGNA 2QIYA 1Y4KA 4N3VA 1QJGA 4HKVB 1ROAA 2GEYA 1NNVA 3EBYA 5IG3A 1Q824 4KZ1A 2YFLB 2CG1A 2HMJB 5LC6A 5AI1A 1RCKA 4KVHA 3MPHA 3N9HA 1BAOA 4AKYA 1BRKA 1QVG2 1MWRA 1O7MB 1AVKA 1OGXA 3STDA 6GSPA 3OXAA 3CPOA 1G0TA 1VQM3 3NHXA 4GB5A 1IK3A 4XM4A 2R41A 8CHOA 4EBGA 1GOVA 2SARA 2W03A 3FH1A 3NQZA 8RNTA 2CFWA 4R9LA 1BSDA 2OOVC 3KCHA 4O3VA 3OWUA 1GD4A 3MYTA 5AEWB 4RNYA 3FG4A 1I0VA 3LTAA 5ELUA 2A15A 4EW5A 4K90B 1I2GA 2OCTA 2UGIA 1RGAA 2C10A 4HM2B 3X42A 1A90A 1BNGA 1BU4A 1FGTA 1LXEA 3SX1A 1Q7Y4 1M904 5I97A 5CF1A 3ECFA 3RGRA 1RGCA 1E3RA 3NUVA 1DMMA 3H51A 2W9QA 1BSBA 2E2TA 2HOHA 4I5QA 2XFTA 4OVMA 1LOWA 4HZBB 3DH2A 1QAKA 3WOFB 1GD3A 1WNHA 2CIUA 2IMJA 2BIRA 4DKIA 3JUOA 4X2OA 3CC73 4O2HA 3M8CA 4HBRA 1N9JA 4KFFA 4GSPA 1F8NA 3F8XA 1A2KA 5EQLA 3CCQ3 5AIFA 2O3OA 3K7CA 4CPKA 2KF6A 1JBTA 4TX4A 4HVNA 3WA2X 1TJDA 1RLSA 1VQQA 1BRNL 1Q42A 1HU9A 3ZG0A 3SXXA 1JZDA 1TTOA 2CWUA 3ER7A 4XDVA 5CXOA 2RFRA 3OWSA 5AYSC 1UCLA 2YFJB 1QALA 2GBWB 1AV4A 1AR0A 1LQMB 1BANA 4HM7B 2WO0A 1EUIC 1FGOA 2WOFA 2K0MA 1DMNA 1FUWA 1GOUA 4H3UA 1T2HA 3DY5A 1OACA 1VQ73 2ZL8A 4HYZA 3CCM3 1T5YA 1IU7A 3EHCA 3BIRA 1Q864 2ZA4A 1I3IA 3F7SA 1UI7A 2FGTA 4WYKB 3CCV3 1JN5B 3UL6A 5HOHA 3DUKA 1N5HA 3LT8A 3S67A 1W5ZA 4CCVA 1OF5A 2E2VA 1DVDA 4IT7A 2KAAA 3RNTA 3NBBA 5IG0A 3AGNA 3V92A 5IG5A 1VQ63 1SJWA 3G8ZA 3MG3A 1BNEA 2B24B 2RNTA 2JQ5A 4J5GA 5AIIA 5FGOA 4CJNA 2CK3H 1BNFA 1DMQA 1I2EA 4L7KA 4PEJA 5GSPA 4EV5A 3BNEA 2KRTA 3SYUA 3D79A 1BNSA 3F8HA 1HKXA 2BNGA 2O9UX 1OHPA 3GZRA 3KN4A 3T0UA 1STFI 2XRXB 3UB1A 3SOYA 4HM5B 3HIIA 2QEX3 3GZXB 3JUPA 2XR8B 3URPA 3A76A 4BTWA 1TFOA 3K9MC 3N8BA 1I0XA 1VQ53 3DMCA 3I563 3CPW2 3ZG5A 4R1KA 3DGNA 2FXTA 3SVAA 4BL3A 3OV4A 1WMNA 1LNIA 3KSPA 2WGQA 1I8VA 2Z77A 3K0ZA 3U1WA 3KSED 1EEJA 3MSOA 4HM3B 4XBYA 4CDLA 1A2VA 1ZX2A 5D81A 5JPPA 1BSAA 1Q40A 1O7WB 4OK0A 5M19A 3MWZA 3CC23 1IVVA 3FLJA 4WYKA 1UCKA 3NV0B 5EEOA 5D82A 2YX9A 1DYUA 3GSPA 1Q9EA 1OHOA 3SEDA 3CCL3 1YHQ3 1VQ43 1TU5A 3PZWA 1Q7HA 1MWTA 3CCJ3 1IV9A 3B8LA 3V99A 2CKFB 2CX0A 1FW7A 1O7GB 4HZ9B 4ILFA 4LZIA 5KP1A 3HK4A 2ML5A 3MKIA 1RTUA 1OUNA 3BLZA 5RNTA 2CH9A 1CQSA 3JVCA 1BNIA 4HM4B 1BRJA 1HYFA 2W9PA 3PCRA 1BVIA 2CWVA 1S5AA 1JN5A 1I70A 2CX1A 1IQXA 1FZUA 1VZZA 3CCE3 1GYBA 1QVF2 5BVBA 4FR9A 3D5IA 4EC6A 1PFPA 3KFQC 2XSOB 1CEWI 3Q2PA 1MGRA 4XBTA 2ZDJA 5FW5A 4NHFA 1BRGA 3IJEB 2F5WA 1NJI4 2IY2A 3WHOA 5KP3A 1MOLA 4HJLB 1W2ZA 1BGSA 1T3BA 3X3ZA 2BU4A 3CCU3 3EX9A 1S723 1RNBA 1N8R4 5CF2A 1BRIA 3HIGA 3K63A 1BRSA 1X1YA 1VQN3 3WDGB 2HMNB 5BIRA 3F40A 2L4VA 2INXA 3UJMA 4L8PA 4XBXA 1Q40B 3EN1B 1ISKA 1RGKA 3NM7A 1BOXA 1KSIA 1PYLA 1WTHA 1E97A 1FYSA 2CFKA 1NO3A 1I2FA 2GXFA 2P38A 3HOHA 2GSPA 1RRLA 4J9AA 1W01A 1V74A 2PNCA 1STDA 4LMIA 1NU3A 2UX0A 5HGRA 1B2UA 3ROBA 1OPYA 1RN7A 2CFLA 1K41A 4EV2A 2W0QA 1YJW3 1FUSA 3G713 1KC84 1DVCA 1BUQA 1C7HA 1FUTA 1IVWA 1FGQA 3AMOA 1JBSA 1VQL3 2STDA 3L0RA 4FCMA 4WWUC 2XSHB 3CCS3 2W56B 2OTJ3 1D6UA 2Q07A 4BTXA 1NWWA 1B27A 1V58A 2WOHA 5DRVA 3JUMA 3O8YA 3VF1A 4L8OA 1GMPA 3DZLA 3ZFZA 1IV7A 2V1LA 1ZS7A 1O7NB 3EJVA 1LOYA 1UUGB 2LYXA 3J7Yd 1IQYA 3CCR3 2KF5A 4H61A 3LZAA 2GEXA 1JNQA 4RNZA 1T2IA 3LYGA 2CG0A 1JZOA 1SPUA 3LOYA 4FMBA 4QWTA 1UCJA 2OTL3 2W2CA 3DXOA 2L1SA 3CXC2 1GOYA 3VSYA 1X1WA 2D1WA 1D6YA 3BNBA 2MF7A 3V98A 4BU4A 3KZTA 1SARA 2M7OA 3X3XA 4N6NB 3DM8A 4LEHA 5JPUA 1MWUA 3X3YA 2IUJA 4X2HA 1YIT3 1K9M4 2BMOB 3FG3A 3PS8A 4HAAA 3CNXA 1CYVA 3U97A 1RKYA 4XB5A 3I553 3B4PA 3Q1CA 2K3DA 3X41A 3LMLA 1TFKA 1LVNA 2BHMA 2CFGA 3FG1A 3SOAA 3WOEB 2BMRB 3OW22 1KD14 1IVUA 2WGOA 1RRHA 3UNLA 4RBNA 3AHWA 1YI23 5G1LA 4O8SA 4GHOA 1Q814 2AADA 3HZPA 2CFDA 4WHAA 1UUVB 1TRQA 1RSNA 3MG2A 4EXRA 3PYJA 1OGZA 4LGQA 4N6MA 4I4KA 3AGOA 1RN1A 4G1MB 2F5MA 3FSDA 1W6YA 2H0GA 1IQ8A 2XGLA 4MJDA 1V57A 1YJ93 1M1K4 6STDA 2C11A 3B4OA 1YVBI 1FGRA 3EQQB 1K28A 2RSXA 2XH9A 3FF2A 1R4YA 1W2B2 1UI8A 1LRAA 3NXJA 4HM0B 5G2GA 1UDII 1RJOA 1YJN3 1SQWA 1KWIA 2GBXB 1YIJ3 1JB2A 3OX9A 3GRDA 3NM2A 2XGNA 3I0YA 3CME3 3IPTA 3KKGA 1I3FA 2W56A 4FMCA 3RGAA 1AQZA 4RZMA 1BSEA 1BIRA 1MNLA 1RMSA 2F98A 4K1UA 4MMXB 1W6CA 4EYCA 3FGYA 3BNDA 1IDPA 3SLUA 2GU3A 3T8NA 1B21A 2P09A 3EF8A 1ASKA 3LTCA 1JKGA 5D83A 1GSPA 1IT7A 3HI7A 1JRQA 2OOVA 1UUWB 1ROVA 4O02B 3EE1A 1JB4A 1SIHA 2Y74A 2F99A 2UUGC 4STDA 1N5PA 3PXMA 2F86B 4WP5A 4R4KA 3NQYA 2H0IA 2D42A 4FMAA 4R80A 2F56A 3F7XA 1KQS2 1BNJA 4OUQA 5JBSA 1EA2A 3Q90A 1N9EA 1UCIA 1GMQA 3NX0A 4FMDA 3RDEA 3F14A 3LT9A 3MHEA 3PCSA 1G02A 4IPBA 1B2ZA 1TRPA 2H0HA 1MWSA 5AEUB 3DGOA 5IEPA 1JKGB 2CC3A 4HM8B 2HMMB 4GL6A 1B3SA 4HOHA 3S29A 5M1AA 3EN8A 1W00A 3K5TA 4J8TA 4MEIA 4K61A 7STDA 1M9GA 4HM6B 3CU3A 3LTBA 1VQ93 1C54A 2OQEA 1BNRA 2KCDA 1PY3A 3FZWA 1B20A 1WMPA 3BU4A 2ML6A 2Z6BA 5CK6A 3S27A 3D9RA 4ORLA 2AAEA 3KIIA 4U13A 1ULJB 1TUHA 1FA3A 1L5GB 3G16A 3UL5A 1BUJA 1RGEA 1JV2B 1GMRA 1JB5A 1R4CA 1W6GA 3FF0A 3FKAA 3GAXA 1RHLA 3D5GA 3G6E3 1VQK3 2KXGA 1GY7A 1O7HB 1YVSA 1MGWA 1DETA 1U5OA 2HMLB 3EB8A 3D4AA 2ZHXB 2HMKB 3NBRA 4FCJA 2HMOB 4JF8A 4AKZA 3NV0A 5DREA 3NBJA 1OH0A 1W7CA 3D3LA 3S28A 2P0MA 3CC43 1LNHA 1ULIB 1X1UA 3H3HA 1B2MA 5IEOA 1YGEA 3WMDA 1RGGA 3JUNA 3X40A 3AHSA 1E3VA 1AVLA 3DGYA 4LSOA 5AYRB 1RDSA 7RNTA 7GSPA 1EKMA 2R4IA 4IIAA
chains in the Genus database with same CATH topology
3KE7A 5AIGA 3IMAB 1W4NA 1ZO2A 3WA3A 1TIJA 1NDOB 2QGUA 3EBTA 2QA43 5EVHA 1JJ22 2B1XB 3ALAA 3CNMA 5ELJA 3S5CA 1A67A 3DGLA 4XDWA 5TGNA 1J2BA 2BO9B 2P0XA 3WODG 5BXQA 2P05A 2XFSA 1EQKA 5LC7A 1Z1SA 1K8A4 3GWRA 2XEPA 4FCZA 4K1VA 3T8UA 1SIIA 2CHCA 4HM1B 2Z7AA 3GZYB 3MG1A 5CLKA 1UW1A 4Q53A 5IENA 2Z76A 1VQ83 1NB3I 2W6JH 3TDGA 4MMZB 5A0OB 1OF5B 3QK9A 5KP4A 5IW9A 1PU4A 3LTDA 4N6UA 1OHSA 1U8CB 1US1A 2PZVA 3PGBA 2W04A 2OQEC 4N6LA 2BT3A 1QMAA 2SBLA 4KFEA 5AIHA 1W02A 3CMA3 4R9KA 4WFOA 2BMQB 1N8QA 1K734 1TP6A 4KFDA 3JUQA 1CYUA 1G96A 3EC9A 2RCDA 3G0KA 3G4S3 5IF6A 4N6OB 3DGMA 4N6TA 5IG4A 3BB9A 3N54B 1EG9B 1LOXA 1IVXA 4AEQA 1M1XB 2IUKA 1GY5A 1FGMA 4ZM8A 2JDIH 2RGQA 3CD63 4NREA 2GU1A 3LXUX 4JRFA 2CWTA 3LH4A 3BNCA 1GY6A 1WQLB 3E99A 1D6ZA 2XF3A 3AMOB 1GS3A 3F9SA 4MMYB 2CW9A 5IERA 3HX8A 1Q864 3FCSB 2I9WA 3OWYA 2MC8A 2IA7A 2YFIB 1QAFA 2OWPA 3GZBA 1O7PB 1NB5I 1VQP3 4N6V0 3QRDA 2Y73A 4BTYA 2LQVA 5STDA 1WMOA 1IT8A 3B7CA 2FNQA 1OCVA 2K54A 2E2UA 3VGNA 2QIYA 1Y4KA 4N3VA 1QJGA 4HKVB 1ROAA 2GEYA 3EBYA 5IG3A 1Q824 4KZ1A 2YFLB 2CG1A 2HMJB 5LC6A 5AI1A 4KVHA 3MPHA 3N9HA 4AKYA 1QVG2 1O7MB 1AVKA 1OGXA 3STDA 3OXAA 3CPOA 1VQM3 3NHXA 4GB5A 1IK3A 4XM4A 8CHOA 4EBGA 2W03A 3FH1A 3NQZA 2CFWA 4R9LA 2OOVC 4O3VA 3OWUA 1GD4A 3MYTA 5AEWB 4RNYA 3FG4A 5ELUA 3LTAA 2A15A 4K90B 2OCTA 4HM2B 2C10A 3X42A 1A90A 1FGTA 1LXEA 3SX1A 1Q7Y4 1M904 5I97A 5CF1A 3ECFA 3RGRA 1E3RA 3NUVA 1DMMA 3H51A 2W9QA 2E2TA 2XFTA 4OVMA 4HZBB 3WOFB 1QAKA 1GD3A 1WNHA 2CIUA 2IMJA 3JUOA 4X2OA 3CC73 4O2HA 3M8CA 4HBRA 1N9JA 4KFFA 1F8NA 3F8XA 1A2KA 5EQLA 3CCQ3 5AIFA 2O3OA 3K7CA 4TX4A 4HVNA 3WA2X 1Q42A 1HU9A 3SXXA 5CXOA 2CWUA 3ER7A 4XDVA 2RFRA 3OWSA 5AYSC 2YFJB 1QALA 2GBWB 1AV4A 1AR0A 4HM7B 2WO0A 1FGOA 2WOFA 2K0MA 1DMNA 1FUWA 4H3UA 3DY5A 1OACA 1VQ73 2ZL8A 4HYZA 3CCM3 1T5YA 1IU7A 3EHCA 3F7SA 4WYKB 1UI7A 2FGTA 3CCV3 1JN5B 3UL6A 3DUKA 1N5HA 3LT8A 3S67A 1W5ZA 4CCVA 1OF5A 2E2VA 1DVDA 4IT7A 3NBBA 5IG0A 3V92A 5IG5A 1VQ63 1SJWA 3G8ZA 3MG3A 2B24B 2JQ5A 5FGOA 5AIIA 2CK3H 1DMQA 4L7KA 4PEJA 4EV5A 3BNEA 2KRTA 3F8HA 1HKXA 2BNGA 2O9UX 1OHPA 3GZRA 3KN4A 3T0UA 1STFI 2XRXB 3UB1A 3SOYA 4HM5B 3HIIA 2QEX3 3GZXB 3JUPA 2XR8B 4BTWA 3A76A 1TFOA 3K9MC 3N8BA 1VQ53 3DMCA 3I563 3CPW2 4R1KA 3DGNA 2FXTA 3SVAA 3OV4A 1WMNA 3KSPA 2WGQA 2Z77A 3K0ZA 3U1WA 3KSED 4HM3B 3MSOA 4XBYA 4CDLA 5JPPA 1A2VA 1ZX2A 5D81A 1Q40A 1O7WB 4OK0A 3MWZA 3CC23 1IVVA 3FLJA 4WYKA 3NV0B 5EEOA 5D82A 2YX9A 1DYUA 1OHOA 3SEDA 3CCL3 1YHQ3 1VQ43 1TU5A 3PZWA 3CCJ3 1IV9A 3B8LA 3V99A 2CKFB 1O7GB 4HZ9B 4LZIA 5KP1A 3HK4A 2ML5A 3MKIA 1OUNA 3BLZA 2CH9A 1CQSA 3JVCA 4HM4B 2W9PA 3PCRA 2CWVA 1S5AA 1JN5A 1IQXA 1VZZA 3CCE3 1GYBA 1QVF2 5BVBA 4FR9A 4EC6A 1PFPA 3KFQC 2XSOB 1CEWI 3Q2PA 4XBTA 2ZDJA 5FW5A 4NHFA 3IJEB 1NJI4 5KP3A 1MOLA 4HJLB 1W2ZA 3X3ZA 3CCU3 3EX9A 1S723 1N8R4 5CF2A 3K63A 3HIGA 1VQN3 3WDGB 2HMNB 3F40A 2L4VA 2INXA 3UJMA 4L8PA 4XBXA 1Q40B 3EN1B 1ISKA 3NM7A 1KSIA 2CFKA 1WTHA 1E97A 2P38A 1VQO3 1NO3A 2GXFA 4J9AA 1RRLA 1W01A 1V74A 2PNCA 1STDA 4LMIA 1NU3A 2UX0A 5HGRA 3ROBA 1OPYA 1RN7A 2CFLA 1K41A 4EV2A 2W0QA 1YJW3 3G713 1KC84 1BUQA 1DVCA 1C7HA 1FGQA 1IVWA 3AMOA 1VQL3 2STDA 3L0RA 4FCMA 4WWUC 2XSHB 3CCS3 2W56B 2OTJ3 1D6UA 2Q07A 4BTXA 1NWWA 2WOHA 5DRVA 3JUMA 3O8YA 3VF1A 4L8OA 3DZLA 1IV7A 2V1LA 1O7NB 3EJVA 3CCR3 2LYXA 3J7Yd 1IQYA 4H61A 3LZAA 2GEXA 1JNQA 4RNZA 3LYGA 2CG0A 1SPUA 3LOYA 4FMBA 4QWTA 2OTL3 2W2CA 3DXOA 3CXC2 3VSYA 2D1WA 3BNBA 1D6YA 2MF7A 3V98A 3KZTA 2M7OA 3X3XA 4N6NB 3DM8A 4LEHA 5JPUA 3X3YA 2IUJA 4X2HA 1YIT3 1K9M4 2BMOB 3FG3A 3PS8A 3U97A 3CNXA 1CYVA 1RKYA 3I553 4XB5A 3B4PA 3Q1CA 3X41A 3LMLA 1TFKA 1LVNA 2BHMA 2CFGA 3FG1A 3SOAA 3WOEB 2BMRB 3OW22 1KD14 1IVUA 2WGOA 1RRHA 3UNLA 4RBNA 1YI23 4O8SA 1Q814 4WHAA 3HZPA 2CFDA 1UUVB 3MG2A 4EXRA 3PYJA 1OGZA 4LGQA 4N6MA 4I4KA 4G1MB 3FSDA 1W6YA 1IQ8A 2XGLA 4MJDA 1YJ93 1M1K4 6STDA 2C11A 3B4OA 1YVBI 1FGRA 3EQQB 1K28A 2RSXA 2XH9A 3FF2A 1W2B2 1UI8A 3NXJA 4HM0B 5G2GA 1YJN3 1RJOA 1SQWA 1KWIA 2GBXB 1YIJ3 1JB2A 3OX9A 3GRDA 3NM2A 2XGNA 3I0YA 3CME3 3IPTA 3KKGA 2W56A 4FMCA 3RGAA 4RZMA 4MMXB 1MNLA 2F98A 4K1UA 1W6CA 4EYCA 3FGYA 3BNDA 1IDPA 3SLUA 2GU3A 3T8NA 2P09A 3EF8A 1ASKA 3LTCA 1JKGA 5D83A 1IT7A 3HI7A 1JRQA 2OOVA 1UUWB 1ROVA 4O02B 3EE1A 1JB4A 1SIHA 2Y74A 2F99A 4STDA 1N5PA 3PXMA 2F86B 4WP5A 4R4KA 3NQYA 2D42A 4FMAA 4R80A 3F7XA 1KQS2 4OUQA 5JBSA 1EA2A 3Q90A 1N9EA 3NX0A 4FMDA 3RDEA 3F14A 3LT9A 3MHEA 3PCSA 4IPBA 5AEUB 3DGOA 5IEPA 1JKGB 2CC3A 4HM8B 2HMMB 4GL6A 3S29A 3EN8A 1W00A 3K5TA 4J8TA 4MEIA 4K61A 7STDA 1M9GA 4HM6B 3CU3A 3LTBA 1VQ93 2OQEA 2KCDA 3FZWA 1WMPA 2ML6A 2Z6BA 5CK6A 3S27A 3D9RA 4ORLA 3KIIA 4U13A 1ULJB 1TUHA 1FA3A 1L5GB 3G16A 3UL5A 1JV2B 1R4CA 1JB5A 3FF0A 1W6GA 3GAXA 3FKAA 3G6E3 1VQK3 2KXGA 1GY7A 1O7HB 1U5OA 2HMLB 3EB8A 2HMKB 3NBRA 4FCJA 2HMOB 4JF8A 4AKZA 3NV0A 5DREA 3NBJA 1OH0A 1W7CA 3D3LA 3S28A 2P0MA 3CC43 1LNHA 1ULIB 3H3HA 5IEOA 1YGEA 3WMDA 3X40A 3JUNA 1E3VA 1AVLA 4LSOA 5AYRB 1EKMA 2R4IA 4IIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPP A;  6STD A;  3OWU A;  3KE7 A;  3B4O A;  5AIG A;  3B8L A;  3MYT A;  2CKF B;  1ZO2 A;  3EQQ B;  5AEW B;  1NDO B;  1O7G B;  3FF2 A;  2QGU A;  3EBT A;  4HZ9 B;  5KP1 A;  2A15 A;  3HK4 A;  3NXJ A;  3MKI A;  4HM0 B;  5EVH A;  2B1X B;  1OUN A;  3BLZ A;  3CNM A;  5G2G A;  4HM2 B;  1CQS A;  3S5C A;  4HM4 B;  2GBX B;  5TGN A;  4XDW A;  1JB2 A;  3OX9 A;  3GRD A;  3NM2 A;  3I0Y A;  5BXQ A;  1S5A A;  3IPT A;  1JN5 A;  3KKG A;  3RGA A;  1Z1S A;  3ECF A;  5CF1 A;  1VZZ A;  3GWR A;  4RZM A;  3RGR A;  1GYB A;  1E3R A;  3NUV A;  1DMM A;  3H51 A;  2F98 A;  4K1U A;  5BVB A;  4K1V A;  3T8U A;  3FGY A;  2XSO B;  2CHC A;  4HM1 B;  2Z7A A;  1IDP A;  3GZY B;  3MG1 A;  4HZB B;  4MJD A;  4OVM A;  5CLK A;  4Q53 A;  4XBT A;  3ROB A;  3T8N A;  2Z76 A;  5IEN A;  3EF8 A;  5FW5 A;  2IMJ A;  1ASK A;  5D83 A;  1JKG A;  3JUO A;  4X2O A;  5KP3 A;  1OF5 B;  4HJL B;  3M8C A;  5KP4 A;  1UUW B;  3EX9 A;  1JB4 A;  1OHS A;  2F99 A;  3F8X A;  1A2K A;  4STD A;  5CF2 A;  2PZV A;  4LMI A;  5AIF A;  2F86 B;  2HMN B;  3K7C A;  4WP5 A;  3F40 A;  2INX A;  4HVN A;  1QMA A;  4L8P A;  3UJM A;  4XBX A;  1Q40 B;  3EN1 B;  1W02 A;  5AIH A;  1ISK A;  4R9K A;  1Q42 A;  2BMQ B;  5CXO A;  3ER7 A;  1TP6 A;  4XDV A;  3F7X A;  1E97 A;  3JUQ A;  2RFR A;  2GXF A;  3OWS A;  4J9A A;  4OUQ A;  1EA2 A;  1W01 A;  2YFJ B;  3Q90 A;  1STD A;  2RCD A;  1NU3 A;  2UX0 A;  2GBW B;  3EC9 A;  3G0K A;  1AR0 A;  5HGR A;  5IF6 A;  1OPY A;  4HM7 B;  1K41 A;  5IG4 A;  3BB9 A;  3F14 A;  1DMN A;  1EG9 B;  1BUQ A;  3MHE A;  4H3U A;  1C7H A;  1GY5 A;  2RGQ A;  2STD A;  3EHC A;  4FCM A;  4WWU C;  3SED A;  2XSH B;  3F7S A;  4WYK B;  5AEU B;  1JN5 B;  5IEP A;  1JKG B;  1NWW A;  3DUK A;  2HMM B;  4HM8 B;  5DRV A;  1GY6 A;  1OF5 A;  1WQL B;  3E99 A;  3DZL A;  3F9S A;  1GS3 A;  3JUM A;  4L8O A;  5IER A;  3EN8 A;  1O7N B;  1W00 A;  2I9W A;  3EJV A;  3HX8 A;  3OWY A;  4J8T A;  7STD A;  2YFI B;  4HM6 B;  3CU3 A;  2OWP A;  3GZB A;  3LZA A;  2GEX A;  5IG0 A;  1O7P B;  5IG5 A;  3LYG A;  3FZW A;  1SJW A;  3G8Z A;  3MG3 A;  2B24 B;  2W2C A;  3DXO A;  2JQ5 A;  5CK6 A;  5AII A;  3D9R A;  5STD A;  4ORL A;  3VSY A;  4U13 A;  1ULJ B;  1TUH A;  3B7C A;  1DMQ A;  4L7K A;  3G16 A;  4PEJ A;  3KZT A;  1OCV A;  2K54 A;  5JPU A;  3DM8 A;  4LEH A;  3F8H A;  3VGN A;  1JB5 A;  1HKX A;  2BNG A;  2QIY A;  1OHP A;  3FF0 A;  3FKA A;  3GZR A;  4N3V A;  2XRX B;  4X2H A;  3SOY A;  4HM5 B;  2BMO B;  1QJG A;  4HKV B;  3CNX A;  3GZX B;  3JUP A;  2GEY A;  4XB5 A;  2XR8 B;  3B4P A;  3A76 A;  1GY7 A;  1O7H B;  3EBY A;  5IG3 A;  2YFL B;  2HMJ B;  1U5O A;  2HML B;  3DMC A;  5AI1 A;  4KVH A;  3SOA A;  2BMR B;  2HMK B;  3NBR A;  4FCJ A;  4R1K A;  2HMO B;  3OV4 A;  1O7M B;  1OGX A;  3NV0 A;  5DRE A;  3KSP A;  1OH0 A;  3STD A;  3OXA A;  2Z77 A;  3CPO A;  3UNL A;  3K0Z A;  4HM3 B;  3HZP A;  3MSO A;  4XBY A;  3NHX A;  1UUV B;  4GB5 A;  1ZX2 A;  5D81 A;  4XM4 A;  3MG2 A;  4CDL A;  8CHO A;  4LGQ A;  1OGZ A;  1O7W B;  1Q40 A;  1ULI B;  3H3H A;  4I4K A;  5IEO A;  3WMD A;  3JUN A;  3FLJ A;  4WYK A;  1E3V A;  3NV0 B;  5D82 A;  3FSD A;  1W6Y A;  4R9L A;  1OHO A;  3FH1 A;  2R4I A;  4IIA A; 
#chains in the Genus database with same CATH topology
 3KE7 A;  5AIG A;  9RNT A;  3IMA B;  1JBR A;  3A5E A;  1W4N A;  1ZO2 A;  6RNT A;  3WA3 A;  1TIJ A;  1NDO B;  5BU4 A;  2QGU A;  3EBT A;  2QA4 3;  1VQO 3;  5EVH A;  1JJ2 2;  2B1X B;  3ALA A;  3CNM A;  5ELJ A;  3S5C A;  2F4Y A;  1A67 A;  3DGL A;  4XDW A;  1LOV A;  5TGN A;  1A2P A;  2BO9 B;  2P0X A;  1J2B A;  3WOD G;  5BXQ A;  2P05 A;  2XFS A;  4BL2 A;  1EQK A;  5LC7 A;  1Z1S A;  1K8A 4;  1RGL A;  1RNT A;  1YGW A;  2XEP A;  3GWR A;  1UGH I;  4FCZ A;  1AY7 A;  4K1V A;  3T8U A;  1SII A;  2CHC A;  4HM1 B;  2Z7A A;  3GZY B;  3MG1 A;  5CLK A;  1UW1 A;  4Q53 A;  5IEN A;  2Z76 A;  1RGH A;  1VQ8 3;  1NB3 I;  2W6J H;  3TDG A;  1RCL A;  1HZ1 A;  4MMZ B;  5A0O B;  1OF5 B;  3QK9 A;  5KP4 A;  1IYY A;  5IW9 A;  1PU4 A;  3LTD A;  4N6U A;  1OHS A;  1U8C B;  1US1 A;  2PZV A;  3PGB A;  2W04 A;  2OQE C;  4BIR A;  4N6L A;  4LYL B;  2BT3 A;  1QMA A;  2SBL A;  4KFE A;  5AIH A;  1W02 A;  4J5K A;  3CMA 3;  4R9K A;  4WFO A;  2BMQ B;  1N8Q A;  1K73 4;  1B2X A;  1TP6 A;  4KFD A;  3JUQ A;  5G1K A;  1CYU A;  1G96 A;  1BSC A;  4KT3 B;  3EC9 A;  2RCD A;  3G0K A;  3G4S 3;  1RN4 A;  1X1X A;  5IF6 A;  4N6O B;  2KF3 A;  3DGM A;  3Q3F A;  4N6T A;  4RNT A;  5IG4 A;  1RGF A;  3BB9 A;  4NPB A;  3N54 B;  1EG9 B;  1LOX A;  1IVX A;  4AEQ A;  1M1X B;  2IUK A;  1GY5 A;  1FGM A;  1DE3 A;  4ZM8 A;  2JDI H;  2RGQ A;  3CD6 3;  4NRE A;  2GU1 A;  3WR2 A;  3LXU X;  1ZGX A;  4JRF A;  2CWT A;  3LH4 A;  3BNC A;  1GY6 A;  1WQL B;  2XF3 A;  1D6Z A;  2IYJ A;  3AMO B;  1GS3 A;  3E99 A;  3F9S A;  2CW9 A;  4MMY B;  3HX8 A;  5IER A;  3FCS B;  2I9W A;  3OWY A;  2MC8 A;  2IA7 A;  2J8X B;  5M18 A;  2YFI B;  1UGI A;  1QAF A;  2OWP A;  3GZB A;  1O7P B;  1NB5 I;  2KF4 A;  1CH0 A;  1VQP 3;  4N6V 0;  3QRD A;  2Y73 A;  4BTY A;  2LQV A;  5STD A;  1WMO A;  1IT8 A;  1BRH A;  2RBI A;  3B7C A;  1LQG C;  2FNQ A;  1OCV A;  2K54 A;  2C4B A;  2E2U A;  1YNV X;  1B2S A;  3VGN A;  2QIY A;  1Y4K A;  4N3V A;  1QJG A;  4HKV B;  1ROA A;  2GEY A;  1NNV A;  3EBY A;  5IG3 A;  1Q82 4;  4KZ1 A;  2YFL B;  2CG1 A;  2HMJ B;  5LC6 A;  5AI1 A;  1RCK A;  4KVH A;  3MPH A;  3N9H A;  1BAO A;  4AKY A;  1BRK A;  1QVG 2;  1MWR A;  1O7M B;  1AVK A;  1OGX A;  3STD A;  6GSP A;  3OXA A;  3CPO A;  1G0T A;  1VQM 3;  3NHX A;  4GB5 A;  1IK3 A;  4XM4 A;  2R41 A;  8CHO A;  4EBG A;  1GOV A;  2SAR A;  2W03 A;  3FH1 A;  3NQZ A;  8RNT A;  2CFW A;  4R9L A;  1BSD A;  2OOV C;  3KCH A;  4O3V A;  3OWU A;  1GD4 A;  3MYT A;  5AEW B;  4RNY A;  3FG4 A;  1I0V A;  3LTA A;  5ELU A;  2A15 A;  4EW5 A;  4K90 B;  1I2G A;  2OCT A;  2UGI A;  1RGA A;  2C10 A;  4HM2 B;  3X42 A;  1A90 A;  1BNG A;  1BU4 A;  1FGT A;  1LXE A;  3SX1 A;  1Q7Y 4;  1M90 4;  5I97 A;  5CF1 A;  3ECF A;  3RGR A;  1RGC A;  1E3R A;  3NUV A;  1DMM A;  3H51 A;  2W9Q A;  1BSB A;  2E2T A;  2HOH A;  4I5Q A;  2XFT A;  4OVM A;  1LOW A;  4HZB B;  3DH2 A;  1QAK A;  3WOF B;  1GD3 A;  1WNH A;  2CIU A;  2IMJ A;  2BIR A;  4DKI A;  3JUO A;  4X2O A;  3CC7 3;  4O2H A;  3M8C A;  4HBR A;  1N9J A;  4KFF A;  4GSP A;  1F8N A;  3F8X A;  1A2K A;  5EQL A;  3CCQ 3;  5AIF A;  2O3O A;  3K7C A;  4CPK A;  2KF6 A;  1JBT A;  4TX4 A;  4HVN A;  3WA2 X;  1TJD A;  1RLS A;  1VQQ A;  1BRN L;  1Q42 A;  1HU9 A;  3ZG0 A;  3SXX A;  1JZD A;  1TTO A;  2CWU A;  3ER7 A;  4XDV A;  5CXO A;  2RFR A;  3OWS A;  5AYS C;  1UCL A;  2YFJ B;  1QAL A;  2GBW B;  1AV4 A;  1AR0 A;  1LQM B;  1BAN A;  4HM7 B;  2WO0 A;  1EUI C;  1FGO A;  2WOF A;  2K0M A;  1DMN A;  1FUW A;  1GOU A;  4H3U A;  1T2H A;  3DY5 A;  1OAC A;  1VQ7 3;  2ZL8 A;  4HYZ A;  3CCM 3;  1T5Y A;  1IU7 A;  3EHC A;  3BIR A;  1Q86 4;  2ZA4 A;  1I3I A;  3F7S A;  1UI7 A;  2FGT A;  4WYK B;  3CCV 3;  1JN5 B;  3UL6 A;  5HOH A;  3DUK A;  1N5H A;  3LT8 A;  3S67 A;  1W5Z A;  4CCV A;  1OF5 A;  2E2V A;  1DVD A;  4IT7 A;  2KAA A;  3RNT A;  3NBB A;  5IG0 A;  3AGN A;  3V92 A;  5IG5 A;  1VQ6 3;  1SJW A;  3G8Z A;  3MG3 A;  1BNE A;  2B24 B;  2RNT A;  2JQ5 A;  4J5G A;  5AII A;  5FGO A;  4CJN A;  2CK3 H;  1BNF A;  1DMQ A;  1I2E A;  4L7K A;  4PEJ A;  5GSP A;  4EV5 A;  3BNE A;  2KRT A;  3SYU A;  3D79 A;  1BNS A;  3F8H A;  1HKX A;  2BNG A;  2O9U X;  1OHP A;  3GZR A;  3KN4 A;  3T0U A;  1STF I;  2XRX B;  3UB1 A;  3SOY A;  4HM5 B;  3HII A;  2QEX 3;  3GZX B;  3JUP A;  2XR8 B;  3URP A;  3A76 A;  4BTW A;  1TFO A;  3K9M C;  3N8B A;  1I0X A;  1VQ5 3;  3DMC A;  3I56 3;  3CPW 2;  3ZG5 A;  4R1K A;  3DGN A;  2FXT A;  3SVA A;  4BL3 A;  3OV4 A;  1WMN A;  1LNI A;  3KSP A;  2WGQ A;  1I8V A;  2Z77 A;  3K0Z A;  3U1W A;  3KSE D;  1EEJ A;  3MSO A;  4HM3 B;  4XBY A;  4CDL A;  1A2V A;  1ZX2 A;  5D81 A;  5JPP A;  1BSA A;  1Q40 A;  1O7W B;  4OK0 A;  5M19 A;  3MWZ A;  3CC2 3;  1IVV A;  3FLJ A;  4WYK A;  1UCK A;  3NV0 B;  5EEO A;  5D82 A;  2YX9 A;  1DYU A;  3GSP A;  1Q9E A;  1OHO A;  3SED A;  3CCL 3;  1YHQ 3;  1VQ4 3;  1TU5 A;  3PZW A;  1Q7H A;  1MWT A;  3CCJ 3;  1IV9 A;  3B8L A;  3V99 A;  2CKF B;  2CX0 A;  1FW7 A;  1O7G B;  4HZ9 B;  4ILF A;  4LZI A;  5KP1 A;  3HK4 A;  2ML5 A;  3MKI A;  1RTU A;  1OUN A;  3BLZ A;  5RNT A;  2CH9 A;  1CQS A;  3JVC A;  1BNI A;  4HM4 B;  1BRJ A;  1HYF A;  2W9P A;  3PCR A;  1BVI A;  2CWV A;  1S5A A;  1JN5 A;  1I70 A;  2CX1 A;  1IQX A;  1FZU A;  1VZZ A;  3CCE 3;  1GYB A;  1QVF 2;  5BVB A;  4FR9 A;  3D5I A;  4EC6 A;  1PFP A;  3KFQ C;  2XSO B;  1CEW I;  3Q2P A;  1MGR A;  4XBT A;  2ZDJ A;  5FW5 A;  4NHF A;  1BRG A;  3IJE B;  2F5W A;  1NJI 4;  2IY2 A;  3WHO A;  5KP3 A;  1MOL A;  4HJL B;  1W2Z A;  1BGS A;  1T3B A;  3X3Z A;  2BU4 A;  3CCU 3;  3EX9 A;  1S72 3;  1RNB A;  1N8R 4;  5CF2 A;  1BRI A;  3HIG A;  3K63 A;  1BRS A;  1X1Y A;  1VQN 3;  3WDG B;  2HMN B;  5BIR A;  3F40 A;  2L4V A;  2INX A;  3UJM A;  4L8P A;  4XBX A;  1Q40 B;  3EN1 B;  1ISK A;  1RGK A;  3NM7 A;  1BOX A;  1KSI A;  1PYL A;  1WTH A;  1E97 A;  1FYS A;  2CFK A;  1NO3 A;  1I2F A;  2GXF A;  2P38 A;  3HOH A;  2GSP A;  1RRL A;  4J9A A;  1W01 A;  1V74 A;  2PNC A;  1STD A;  4LMI A;  1NU3 A;  2UX0 A;  5HGR A;  1B2U A;  3ROB A;  1OPY A;  1RN7 A;  2CFL A;  1K41 A;  4EV2 A;  2W0Q A;  1YJW 3;  1FUS A;  3G71 3;  1KC8 4;  1DVC A;  1BUQ A;  1C7H A;  1FUT A;  1IVW A;  1FGQ A;  3AMO A;  1JBS A;  1VQL 3;  2STD A;  3L0R A;  4FCM A;  4WWU C;  2XSH B;  3CCS 3;  2W56 B;  2OTJ 3;  1D6U A;  2Q07 A;  4BTX A;  1NWW A;  1B27 A;  1V58 A;  2WOH A;  5DRV A;  3JUM A;  3O8Y A;  3VF1 A;  4L8O A;  1GMP A;  3DZL A;  3ZFZ A;  1IV7 A;  2V1L A;  1ZS7 A;  1O7N B;  3EJV A;  1LOY A;  1UUG B;  2LYX A;  3J7Y d;  1IQY A;  3CCR 3;  2KF5 A;  4H61 A;  3LZA A;  2GEX A;  1JNQ A;  4RNZ A;  1T2I A;  3LYG A;  2CG0 A;  1JZO A;  1SPU A;  3LOY A;  4FMB A;  4QWT A;  1UCJ A;  2OTL 3;  2W2C A;  3DXO A;  2L1S A;  3CXC 2;  1GOY A;  3VSY A;  1X1W A;  2D1W A;  1D6Y A;  3BNB A;  2MF7 A;  3V98 A;  4BU4 A;  3KZT A;  1SAR A;  2M7O A;  3X3X A;  4N6N B;  3DM8 A;  4LEH A;  5JPU A;  1MWU A;  3X3Y A;  2IUJ A;  4X2H A;  1YIT 3;  1K9M 4;  2BMO B;  3FG3 A;  3PS8 A;  4HAA A;  3CNX A;  1CYV A;  3U97 A;  1RKY A;  4XB5 A;  3I55 3;  3B4P A;  3Q1C A;  2K3D A;  3X41 A;  3LML A;  1TFK A;  1LVN A;  2BHM A;  2CFG A;  3FG1 A;  3SOA A;  3WOE B;  2BMR B;  3OW2 2;  1KD1 4;  1IVU A;  2WGO A;  1RRH A;  3UNL A;  4RBN A;  3AHW A;  1YI2 3;  5G1L A;  4O8S A;  4GHO A;  1Q81 4;  2AAD A;  3HZP A;  2CFD A;  4WHA A;  1UUV B;  1TRQ A;  1RSN A;  3MG2 A;  4EXR A;  3PYJ A;  1OGZ A;  4LGQ A;  4N6M A;  4I4K A;  3AGO A;  1RN1 A;  4G1M B;  2F5M A;  3FSD A;  1W6Y A;  2H0G A;  1IQ8 A;  2XGL A;  4MJD A;  1V57 A;  1YJ9 3;  1M1K 4;  6STD A;  2C11 A;  3B4O A;  1YVB I;  1FGR A;  3EQQ B;  1K28 A;  2RSX A;  2XH9 A;  3FF2 A;  1R4Y A;  1W2B 2;  1UI8 A;  1LRA A;  3NXJ A;  4HM0 B;  5G2G A;  1UDI I;  1RJO A;  1YJN 3;  1SQW A;  1KWI A;  2GBX B;  1YIJ 3;  1JB2 A;  3OX9 A;  3GRD A;  3NM2 A;  2XGN A;  3I0Y A;  3CME 3;  3IPT A;  3KKG A;  1I3F A;  2W56 A;  4FMC A;  3RGA A;  1AQZ A;  4RZM A;  1BSE A;  1BIR A;  1MNL A;  1RMS A;  2F98 A;  4K1U A;  4MMX B;  1W6C A;  4EYC A;  3FGY A;  3BND A;  1IDP A;  3SLU A;  2GU3 A;  3T8N A;  1B21 A;  2P09 A;  3EF8 A;  1ASK A;  3LTC A;  1JKG A;  5D83 A;  1GSP A;  1IT7 A;  3HI7 A;  1JRQ A;  2OOV A;  1UUW B;  1ROV A;  4O02 B;  3EE1 A;  1JB4 A;  1SIH A;  2Y74 A;  2F99 A;  2UUG C;  4STD A;  1N5P A;  3PXM A;  2F86 B;  4WP5 A;  4R4K A;  3NQY A;  2H0I A;  2D42 A;  4FMA A;  4R80 A;  2F56 A;  3F7X A;  1KQS 2;  1BNJ A;  4OUQ A;  5JBS A;  1EA2 A;  3Q90 A;  1N9E A;  1UCI A;  1GMQ A;  3NX0 A;  4FMD A;  3RDE A;  3F14 A;  3LT9 A;  3MHE A;  3PCS A;  1G02 A;  4IPB A;  1B2Z A;  1TRP A;  2H0H A;  1MWS A;  5AEU B;  3DGO A;  5IEP A;  1JKG B;  2CC3 A;  4HM8 B;  2HMM B;  4GL6 A;  1B3S A;  4HOH A;  3S29 A;  5M1A A;  3EN8 A;  1W00 A;  3K5T A;  4J8T A;  4MEI A;  4K61 A;  7STD A;  1M9G A;  4HM6 B;  3CU3 A;  3LTB A;  1VQ9 3;  1C54 A;  2OQE A;  1BNR A;  2KCD A;  1PY3 A;  3FZW A;  1B20 A;  1WMP A;  3BU4 A;  2ML6 A;  2Z6B A;  5CK6 A;  3S27 A;  3D9R A;  4ORL A;  2AAE A;  3KII A;  4U13 A;  1ULJ B;  1TUH A;  1FA3 A;  1L5G B;  3G16 A;  3UL5 A;  1BUJ A;  1RGE A;  1JV2 B;  1GMR A;  1JB5 A;  1R4C A;  1W6G A;  3FF0 A;  3FKA A;  3GAX A;  1RHL A;  3D5G A;  3G6E 3;  1VQK 3;  2KXG A;  1GY7 A;  1O7H B;  1YVS A;  1MGW A;  1DET A;  1U5O A;  2HML B;  3EB8 A;  3D4A A;  2ZHX B;  2HMK B;  3NBR A;  4FCJ A;  2HMO B;  4JF8 A;  4AKZ A;  3NV0 A;  5DRE A;  3NBJ A;  1OH0 A;  1W7C A;  3D3L A;  3S28 A;  2P0M A;  3CC4 3;  1LNH A;  1ULI B;  1X1U A;  3H3H A;  1B2M A;  5IEO A;  1YGE A;  3WMD A;  1RGG A;  3JUN A;  3X40 A;  3AHS A;  1E3V A;  1AVL A;  3DGY A;  4LSO A;  5AYR B;  1RDS A;  7RNT A;  7GSP A;  1EKM A;  2R4I A;  4IIA A; 
#chains in the Genus database with same CATH homology
 3KE7 A;  5AIG A;  3IMA B;  1W4N A;  1ZO2 A;  3WA3 A;  1TIJ A;  1NDO B;  2QGU A;  3EBT A;  2QA4 3;  5EVH A;  1JJ2 2;  2B1X B;  3ALA A;  3CNM A;  5ELJ A;  3S5C A;  1A67 A;  3DGL A;  4XDW A;  5TGN A;  1J2B A;  2BO9 B;  2P0X A;  3WOD G;  5BXQ A;  2P05 A;  2XFS A;  1EQK A;  5LC7 A;  1Z1S A;  1K8A 4;  3GWR A;  2XEP A;  4FCZ A;  4K1V A;  3T8U A;  1SII A;  2CHC A;  4HM1 B;  2Z7A A;  3GZY B;  3MG1 A;  5CLK A;  1UW1 A;  4Q53 A;  5IEN A;  2Z76 A;  1VQ8 3;  1NB3 I;  2W6J H;  3TDG A;  4MMZ B;  5A0O B;  1OF5 B;  3QK9 A;  5KP4 A;  5IW9 A;  1PU4 A;  3LTD A;  4N6U A;  1OHS A;  1U8C B;  1US1 A;  2PZV A;  3PGB A;  2W04 A;  2OQE C;  4N6L A;  2BT3 A;  1QMA A;  2SBL A;  4KFE A;  5AIH A;  1W02 A;  3CMA 3;  4R9K A;  4WFO A;  2BMQ B;  1N8Q A;  1K73 4;  1TP6 A;  4KFD A;  3JUQ A;  1CYU A;  1G96 A;  3EC9 A;  2RCD A;  3G0K A;  3G4S 3;  5IF6 A;  4N6O B;  3DGM A;  4N6T A;  5IG4 A;  3BB9 A;  3N54 B;  1EG9 B;  1LOX A;  1IVX A;  4AEQ A;  1M1X B;  2IUK A;  1GY5 A;  1FGM A;  4ZM8 A;  2JDI H;  2RGQ A;  3CD6 3;  4NRE A;  2GU1 A;  3LXU X;  4JRF A;  2CWT A;  3LH4 A;  3BNC A;  1GY6 A;  1WQL B;  3E99 A;  1D6Z A;  2XF3 A;  3AMO B;  1GS3 A;  3F9S A;  4MMY B;  2CW9 A;  5IER A;  3HX8 A;  1Q86 4;  3FCS B;  2I9W A;  3OWY A;  2MC8 A;  2IA7 A;  2YFI B;  1QAF A;  2OWP A;  3GZB A;  1O7P B;  1NB5 I;  1VQP 3;  4N6V 0;  3QRD A;  2Y73 A;  4BTY A;  2LQV A;  5STD A;  1WMO A;  1IT8 A;  3B7C A;  2FNQ A;  1OCV A;  2K54 A;  2E2U A;  3VGN A;  2QIY A;  1Y4K A;  4N3V A;  1QJG A;  4HKV B;  1ROA A;  2GEY A;  3EBY A;  5IG3 A;  1Q82 4;  4KZ1 A;  2YFL B;  2CG1 A;  2HMJ B;  5LC6 A;  5AI1 A;  4KVH A;  3MPH A;  3N9H A;  4AKY A;  1QVG 2;  1O7M B;  1AVK A;  1OGX A;  3STD A;  3OXA A;  3CPO A;  1VQM 3;  3NHX A;  4GB5 A;  1IK3 A;  4XM4 A;  8CHO A;  4EBG A;  2W03 A;  3FH1 A;  3NQZ A;  2CFW A;  4R9L A;  2OOV C;  4O3V A;  3OWU A;  1GD4 A;  3MYT A;  5AEW B;  4RNY A;  3FG4 A;  5ELU A;  3LTA A;  2A15 A;  4K90 B;  2OCT A;  4HM2 B;  2C10 A;  3X42 A;  1A90 A;  1FGT A;  1LXE A;  3SX1 A;  1Q7Y 4;  1M90 4;  5I97 A;  5CF1 A;  3ECF A;  3RGR A;  1E3R A;  3NUV A;  1DMM A;  3H51 A;  2W9Q A;  2E2T A;  2XFT A;  4OVM A;  4HZB B;  3WOF B;  1QAK A;  1GD3 A;  1WNH A;  2CIU A;  2IMJ A;  3JUO A;  4X2O A;  3CC7 3;  4O2H A;  3M8C A;  4HBR A;  1N9J A;  4KFF A;  1F8N A;  3F8X A;  1A2K A;  5EQL A;  3CCQ 3;  5AIF A;  2O3O A;  3K7C A;  4TX4 A;  4HVN A;  3WA2 X;  1Q42 A;  1HU9 A;  3SXX A;  5CXO A;  2CWU A;  3ER7 A;  4XDV A;  2RFR A;  3OWS A;  5AYS C;  2YFJ B;  1QAL A;  2GBW B;  1AV4 A;  1AR0 A;  4HM7 B;  2WO0 A;  1FGO A;  2WOF A;  2K0M A;  1DMN A;  1FUW A;  4H3U A;  3DY5 A;  1OAC A;  1VQ7 3;  2ZL8 A;  4HYZ A;  3CCM 3;  1T5Y A;  1IU7 A;  3EHC A;  3F7S A;  4WYK B;  1UI7 A;  2FGT A;  3CCV 3;  1JN5 B;  3UL6 A;  3DUK A;  1N5H A;  3LT8 A;  3S67 A;  1W5Z A;  4CCV A;  1OF5 A;  2E2V A;  1DVD A;  4IT7 A;  3NBB A;  5IG0 A;  3V92 A;  5IG5 A;  1VQ6 3;  1SJW A;  3G8Z A;  3MG3 A;  2B24 B;  2JQ5 A;  5FGO A;  5AII A;  2CK3 H;  1DMQ A;  4L7K A;  4PEJ A;  4EV5 A;  3BNE A;  2KRT A;  3F8H A;  1HKX A;  2BNG A;  2O9U X;  1OHP A;  3GZR A;  3KN4 A;  3T0U A;  1STF I;  2XRX B;  3UB1 A;  3SOY A;  4HM5 B;  3HII A;  2QEX 3;  3GZX B;  3JUP A;  2XR8 B;  4BTW A;  3A76 A;  1TFO A;  3K9M C;  3N8B A;  1VQ5 3;  3DMC A;  3I56 3;  3CPW 2;  4R1K A;  3DGN A;  2FXT A;  3SVA A;  3OV4 A;  1WMN A;  3KSP A;  2WGQ A;  2Z77 A;  3K0Z A;  3U1W A;  3KSE D;  4HM3 B;  3MSO A;  4XBY A;  4CDL A;  5JPP A;  1A2V A;  1ZX2 A;  5D81 A;  1Q40 A;  1O7W B;  4OK0 A;  3MWZ A;  3CC2 3;  1IVV A;  3FLJ A;  4WYK A;  3NV0 B;  5EEO A;  5D82 A;  2YX9 A;  1DYU A;  1OHO A;  3SED A;  3CCL 3;  1YHQ 3;  1VQ4 3;  1TU5 A;  3PZW A;  3CCJ 3;  1IV9 A;  3B8L A;  3V99 A;  2CKF B;  1O7G B;  4HZ9 B;  4LZI A;  5KP1 A;  3HK4 A;  2ML5 A;  3MKI A;  1OUN A;  3BLZ A;  2CH9 A;  1CQS A;  3JVC A;  4HM4 B;  2W9P A;  3PCR A;  2CWV A;  1S5A A;  1JN5 A;  1IQX A;  1VZZ A;  3CCE 3;  1GYB A;  1QVF 2;  5BVB A;  4FR9 A;  4EC6 A;  1PFP A;  3KFQ C;  2XSO B;  1CEW I;  3Q2P A;  4XBT A;  2ZDJ A;  5FW5 A;  4NHF A;  3IJE B;  1NJI 4;  5KP3 A;  1MOL A;  4HJL B;  1W2Z A;  3X3Z A;  3CCU 3;  3EX9 A;  1S72 3;  1N8R 4;  5CF2 A;  3K63 A;  3HIG A;  1VQN 3;  3WDG B;  2HMN B;  3F40 A;  2L4V A;  2INX A;  3UJM A;  4L8P A;  4XBX A;  1Q40 B;  3EN1 B;  1ISK A;  3NM7 A;  1KSI A;  2CFK A;  1WTH A;  1E97 A;  2P38 A;  1VQO 3;  1NO3 A;  2GXF A;  4J9A A;  1RRL A;  1W01 A;  1V74 A;  2PNC A;  1STD A;  4LMI A;  1NU3 A;  2UX0 A;  5HGR A;  3ROB A;  1OPY A;  1RN7 A;  2CFL A;  1K41 A;  4EV2 A;  2W0Q A;  1YJW 3;  3G71 3;  1KC8 4;  1BUQ A;  1DVC A;  1C7H A;  1FGQ A;  1IVW A;  3AMO A;  1VQL 3;  2STD A;  3L0R A;  4FCM A;  4WWU C;  2XSH B;  3CCS 3;  2W56 B;  2OTJ 3;  1D6U A;  2Q07 A;  4BTX A;  1NWW A;  2WOH A;  5DRV A;  3JUM A;  3O8Y A;  3VF1 A;  4L8O A;  3DZL A;  1IV7 A;  2V1L A;  1O7N B;  3EJV A;  3CCR 3;  2LYX A;  3J7Y d;  1IQY A;  4H61 A;  3LZA A;  2GEX A;  1JNQ A;  4RNZ A;  3LYG A;  2CG0 A;  1SPU A;  3LOY A;  4FMB A;  4QWT A;  2OTL 3;  2W2C A;  3DXO A;  3CXC 2;  3VSY A;  2D1W A;  3BNB A;  1D6Y A;  2MF7 A;  3V98 A;  3KZT A;  2M7O A;  3X3X A;  4N6N B;  3DM8 A;  4LEH A;  5JPU A;  3X3Y A;  2IUJ A;  4X2H A;  1YIT 3;  1K9M 4;  2BMO B;  3FG3 A;  3PS8 A;  3U97 A;  3CNX A;  1CYV A;  1RKY A;  3I55 3;  4XB5 A;  3B4P A;  3Q1C A;  3X41 A;  3LML A;  1TFK A;  1LVN A;  2BHM A;  2CFG A;  3FG1 A;  3SOA A;  3WOE B;  2BMR B;  3OW2 2;  1KD1 4;  1IVU A;  2WGO A;  1RRH A;  3UNL A;  4RBN A;  1YI2 3;  4O8S A;  1Q81 4;  4WHA A;  3HZP A;  2CFD A;  1UUV B;  3MG2 A;  4EXR A;  3PYJ A;  1OGZ A;  4LGQ A;  4N6M A;  4I4K A;  4G1M B;  3FSD A;  1W6Y A;  1IQ8 A;  2XGL A;  4MJD A;  1YJ9 3;  1M1K 4;  6STD A;  2C11 A;  3B4O A;  1YVB I;  1FGR A;  3EQQ B;  1K28 A;  2RSX A;  2XH9 A;  3FF2 A;  1W2B 2;  1UI8 A;  3NXJ A;  4HM0 B;  5G2G A;  1YJN 3;  1RJO A;  1SQW A;  1KWI A;  2GBX B;  1YIJ 3;  1JB2 A;  3OX9 A;  3GRD A;  3NM2 A;  2XGN A;  3I0Y A;  3CME 3;  3IPT A;  3KKG A;  2W56 A;  4FMC A;  3RGA A;  4RZM A;  4MMX B;  1MNL A;  2F98 A;  4K1U A;  1W6C A;  4EYC A;  3FGY A;  3BND A;  1IDP A;  3SLU A;  2GU3 A;  3T8N A;  2P09 A;  3EF8 A;  1ASK A;  3LTC A;  1JKG A;  5D83 A;  1IT7 A;  3HI7 A;  1JRQ A;  2OOV A;  1UUW B;  1ROV A;  4O02 B;  3EE1 A;  1JB4 A;  1SIH A;  2Y74 A;  2F99 A;  4STD A;  1N5P A;  3PXM A;  2F86 B;  4WP5 A;  4R4K A;  3NQY A;  2D42 A;  4FMA A;  4R80 A;  3F7X A;  1KQS 2;  4OUQ A;  5JBS A;  1EA2 A;  3Q90 A;  1N9E A;  3NX0 A;  4FMD A;  3RDE A;  3F14 A;  3LT9 A;  3MHE A;  3PCS A;  4IPB A;  5AEU B;  3DGO A;  5IEP A;  1JKG B;  2CC3 A;  4HM8 B;  2HMM B;  4GL6 A;  3S29 A;  3EN8 A;  1W00 A;  3K5T A;  4J8T A;  4MEI A;  4K61 A;  7STD A;  1M9G A;  4HM6 B;  3CU3 A;  3LTB A;  1VQ9 3;  2OQE A;  2KCD A;  3FZW A;  1WMP A;  2ML6 A;  2Z6B A;  5CK6 A;  3S27 A;  3D9R A;  4ORL A;  3KII A;  4U13 A;  1ULJ B;  1TUH A;  1FA3 A;  1L5G B;  3G16 A;  3UL5 A;  1JV2 B;  1R4C A;  1JB5 A;  3FF0 A;  1W6G A;  3GAX A;  3FKA A;  3G6E 3;  1VQK 3;  2KXG A;  1GY7 A;  1O7H B;  1U5O A;  2HML B;  3EB8 A;  2HMK B;  3NBR A;  4FCJ A;  2HMO B;  4JF8 A;  4AKZ A;  3NV0 A;  5DRE A;  3NBJ A;  1OH0 A;  1W7C A;  3D3L A;  3S28 A;  2P0M A;  3CC4 3;  1LNH A;  1ULI B;  3H3H A;  5IEO A;  1YGE A;  3WMD A;  3X40 A;  3JUN A;  1E3V A;  1AVL A;  4LSO A;  5AYR B;  1EKM A;  2R4I A;  4IIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...