1JBEA

1.08 a structure of apo-chey reveals meta-active conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
126
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CHEY
publication title A distinct meta-active conformation in the 1.1-A resolution structure of wild-type ApoCheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 47
structure length 126
sequence length 128
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbeA00
1R8JA 4L4UA 3T8YA 3UKJA 2QZJA 4F06A 3KHTA 1FQWA 2XDYA 4RK0A 1HEYA 4RY9A 3OM0A 1CHNA 2E4XA 3IP7A 1QKKA 2PUEA 2WMYA 2IPMA 4RK6A 3OQMA 1YK1A 1M5UA 4LDAA 4EYKA 5DCLA 1LJLA 2R48A 3Q9SA 2MYNA 4DADA 4DN6A 4G0OA 8ABPA 5JNVA 3SM9A 2QW1A 3I5AA 3HO1A 1QP4A 5B3JC 1YTUA 3HCWA 1YS6A 3Q41A 2Q5CA 1EWVA 3IDOA 2RGYA 1JYFA 4HNQA 2PLNA 1DC8A 1JYEA 1RXIA 3HEBA 5T3YA 1JX6A 4PYRA 2WJWA 4KQ9A 2E4YA 1NY5A 4OG2A 2PUFA 3NNDA 3H5VA 3LMKA 2E4UA 3C6QA 2MYTA 4PEVA 4KRFA 1ZESA 3CRNA 5DTEA 3H5OA 1LBIA 3N0XA 4ZMRA 4RSMA 3HXMA 1VRVA 4KREA 4CBVA 3GL9A 3B2NA 1VPWA 2CWDA 4KNYA 1KRWA 2QXYA 1E6KA 3A0UA 3QLUC 5CHYA 5FWYA 3H1FA 4JA2A 3JVDA 1SXHA 1DCFA 4LE1A 1W25A 4Z99A 3KG2A 1PEYA 3KKEA 3O1JC 1MB3A 3N8IA 3RVQA 2FVYA 3EGCA 1E2BA 2LBPA 1Z17A 3MYYA 4RXMA 1S8NA 3JPWA 1QO0A 1GUDA 4RY0A 4WXEA 3RVJA 2JVKA 5PNTA 4H60A 2IPAB 4KVFA 3OLVA 4O1IA 3CKMA 1FFWA 2IDMA 3IP6A 1I3CA 4MR9A 3URMA 4Z4HA 1DJMA 5KQMA 3LFTA 2M1ZA 4RZSA 2KYRA 1ZY2A 2L2QA 1FSPA 1MAVA 2JVIA 4O5AA 1VKRA 2V0NA 3W9SA 2F8SA 1FFGA 3A0RB 2JRLA 2E4WA 2L19A 1M2FA 1DC7A 2FN8A 2CHFA 1NATA 2HSGA 1GCAA 3H5WA 5E3JA 3SG0A 3TMYA 1YK0A 1P8AA 2MYPA 2FXIA 4MPTA 1RXEA 2WWVD 1ZAYA 3LUHA 4P98A 2A9RA 5FWXA 1E6LA 4E7PA 3O21A 3MIZA 1CEYA 1JLKA 1QMPA 2IPNA 4NV3A 1L5ZA 3OLYA 2AYZA 2FEWB 1RPJA 2H3HA 3TB6A 5IEBA 2PUDA 2JCGA 4WXMA 4XASA 4H3KB 3H1GA 4MS3A 4MR8B 5JNWA 3GRCA 5EWLB 1VLZA 2FQYA 2R4QA 1DZ3A 2A9PA 3ROFA 4D74A 3O1HB 4YV7A 4JAVC 4WUTA 2FMKA 2VUHB 2YHAA 3M9XA 4DQDA 5KI6A 4Z0NA 4Z4EA 3JS5A 1Z26A 1ZH2A 3IP9A 2F8TA 3H75A 1U04A 5JS2A 3CNBA 1AB6A 2M98A 3I09A 1ISRA 1JBEA 3L6UA 4MYRA 1D4ZA 5TQ2A 1MIHA 4B09A 3FDFA 3JVIA 5TQ0B 3M9WA 4JOQA 3Q7SA 3EQ2A 4ZMSA 2JVJA 3TD9A 1Z16A 1EWTA 1LK0A 2QU7A 4MS4A 1TM2A 4MRMB 3CHYA 3HS3A 3LKBA 2J48A 1WETA 1M2EA 5D2CA 1CYEA 3DLHA 2FQWA 4PE5B 1XHFA 5KWSA 3O75A 3GYBA 1J56A 1QPZA 1D5WA 4XLTA 1ZGGA 3FMVA 1JF8A 2JBAA 4P1ZA 4RU1A 4GPAA 3CS3A 1OXKB 2ZAYA 1AB5A 4TN5A 1YVUA 4MS1B 1Z2EA 3DGEC 3O2JA 5JNRA 4G0YA 4RV5A 4WWHA 3HZHA 4ZYLA 4EYOA 2PE5A 3QELA 4XARA 4O1HA 3HVRA 5C5EA 2QSJA 3QLVA 1QP7A 2PKXA 3GV0A 5CNKA 4Z4FA 3MM4A 1JFVA 3R0JA 5ABPA 4TLLB 1F51E 1A2OA 2FEPA 3LKVA 3DLBA 3GT7A 2RDMA 4IMIB 5CNIA 5FBHA 1DBPA 2R25B 3OMXA 2FLKA 3BRSA 5BRAA 3Q7RA 5EWMA 3BILA 3JTEA 4Q6WA 2P9HA 2GWRA 4ZPJA 4MR7B 3HSYA 4YR7A 6CHYA 1BDHA 3BREA 4KV7A 3LUGA 4EVQA 1BDJA 4XXHA 1NXTA 5IEJA 5IUKC 1Z12A 1IIBA 1USGA 2GKGA 4RK1A 5HM6A 2FEKA 3FFWA 3QLTA 3E3MA 4QYMA 3KJXA 3RVMA 4MQEB 3LUAA 2TMYA 5TQJA 1D1PA 2JK1A 2VUIB 4NCAA 3KLNA 1BDIA 4MLCA 3VNBA 3SQNA 1P6UA 3OLZA 4G0QA 1A0OA 4EUKA 2GBPA 3T38A 5EWJB 2R47A 1SRRA 2WB4A 5TPWA 3S99A 4IMJB 1QO0D 3VNAA 5DGCA 3DGFC 5EWLA 2IKSA 1E6MA 1B00A 1YMUA 3H5TA 1APBA 1DG9A 3FFXA 3HV2A 3RVRA 2IYNA 4G0XA 4WT7A 3SNKA 3HJFA 4RKRA 3QEMA 4MGEA 1ZVVA 2B4AA 4N76A 1P6QA 2PL1A 3LTEA 1Y1LA 2IPLA 3RVNA 5TPZA 4ZJPA 4RK5A 4Y9TA 2FN9A 1JFTA 5ED4A 2IOYA 3LUJA 1ZH4A 3H5LA 1L5YA 4Z4GA 3HDGA 5GQSA 1USKA 2PUCA 2GX6A 4E7OA 4RXUA 3HUTA 4YWHA 4RK4A 3D8UA 4KK3A 3RVKA 5JNTA 2W42A 1TMYA 3OLWA 4YCSA 4PZ0A 4MQFA 2HQOA 4GNRA 1U0SY 3KSMA 3N75A 3RQIA 3KYIB 4IGAA 4EYQA 4KK4A 4IF4A 2NUBA 3UUGA 1TVMA 4QICA 1EAYA 1ZHHA 3EULA 3H1EA 3Q7TA 2FLWA 5F64A 2I6FA 1GUBA 1LBHA 4JB2A 1USIA 4OATA 4YLEA 1RZRD 3M6MD 4RK7A 3SAJA 4RKQA 3BBLA 1BAPA 3ROTA 3I42A 1YMVA 4RDCA 4Z4IA 1RZRA 3NNSA 2E4ZA 5B3JA 3O2SB 3KYJB 2QR3A 1JDPA 3N6VA 3OLXA 1GLGA 5FWYB 1Z2DA 3OQNA 1NXSA 3SY8A 4YRZA 1BVHA 2MSWA 3HM9A 4W5QA 5CNMA 1QQAA 3ILHA 4FE7A 4NCBA 2O20A 2OENG 3N0RA 1ZN2A 3I45A 3LUCA 5HSGA 4LX8A 2GI4A 4UHKA 4EY3A 5I4CA 1EHCA 1MB0A 2WRZA 5BQ3A 2PUGA 1P2FA 2HQRA 3OO1A 3G1WA 3T6KA 3P9YA 3A3KA 3QEKA 1DCKA 4MR9B 3HK2A 3QLUA 3JPYA 1PNRA 1DRKA 1ZITA 5IUJC 1C4WA 3EODA 1YIOA 4W5OA 4LE2A 4HNSA 2HJ9A 4EGSA 2FMHA 1KGSA 3EDCA 4QYWA 4ETNA 5HKOA 3IPCA 3QX8A 4TLMB 2QV0A 4ETIA 1GCGA 4F11A 4RWEA 2FMIA 1MVOA 4WZZA 5FWXB 4NQRA 4M88A 5KC9A 3GBPA 2LUOA 4YS6A 3KCNA 3RH0A 5KQGA 4LDZA 1D2AA 2HQBA 2RJOA 3CFYA 4MS3B 3OM1A 1KMIY 1W9HA 1JDNA 4F8JA 1JL3A 1NXPA 2ID7A 4G0PA 4KFCA 3L49A 1OXBB 2WY2D 3TX6A 5BRJA 3F73A 3DBIA 5TE9A 5TQ2B 1TLFA 3IP5A 4UHJA 5KC8A 5HQJA 1Z18A 5DLEA 2DRIA 2NT3A 1K66A 4OBBA 1QNLA 3CG0A 5IC5A 2A9QA 2FW0A 1NTRA 2AYXA 2FMFA 1NXWA 4G86A 4OTZA 4YP9A 5JNUA 3HDVA 3CU5A 3OMWA 4LRQA 3C3MA 2FKAA 4KZKA 4MS4B 4Q6BA 2ZWMA 4G97A 4IILA 3CTPA 3C3WA 4RS3A 3KTOA 4PICA 5IUNC 4LE0A 3T95A 6ABPA 4KPYA 2LP4Y 1YS7A 4ML3A 4W5RA 1PUXA 1RNLA 4MR8A 2LIVA 1PNTA 1U8TA 4F3TA 4RY8A 1QQBA 2JBAB 5TPZD 2PUBA 4XFKA 1ABFA 2MSKA 3H6HA 1JWLA 3A10A 2P4UA 1Z13A 1A04A 3RVOA 5GOTA 3GBVA 1NXXA 1UDRA 1XWWA 1URPA 2H0AA 3O1IC 3QELB 1NXOA 1JH9A 4JP1A 5JNSA 2HPHA 2WJAA 4TMYA 2NZUG 1SXGA 3EAFA 3F6PA 3MA0A 5TQ0A 4N41A 3FFTA 3N0WA 4XAQA 2FTKE 3H6GA 3F6CA 4Z9AA 4N03A 5C5CA 5T7BA 2VYCA 3LOPA 4OLAA 3QX9A 1EWKA 4RXTA 3H5IA 5EWMB 1U2QA 4L85A 4IRXA 4MRMA 3RVSA 2YHBA 4H3HB 1XHEA 2L17A 2LPMA 3K4HA 1QP0A 4Q7EA 3LUKA 3GWGA 2L18A 3QLVC 4Z9BA 1T34A 4N47A 3DZDA 1ABEA 5JS1A 3OQOA 4LZLA 3CG4A 3NBMA 1K68A 2RJNA 2N9UA 3BRQA 2JB9A 1KRXA 4G0ZA 3GA5A 4MS1A 1DRJA 3EQZA 2E4VA 1DCMA 4KMRA 3CZ5A 1PHRA 4S04A 1C0EA 7ABPA 1DBWA 3FGZA 2PJUA 3MQ4A 5IULC 4YGXB 1BA2A 3ILYA 4W5TA 2NT4A 4EVRA 4D6XA 3C3KA 1PEAA 2X7XA 3RVPA 3LUDA 3NHZA 1FFSA 5TPWB 4W5NA 5IBQA 3QK7A 4EYGA 3KLOA 4G0MA 4D6YA 9ABPA 2FSPA 3QEMB 1EFAA 1SD5A 3O74A 1M5TA 3MMNA 4HNRA 4F12A 2VK2A 5DKFA 1SXIA 5BR1A 1U2PA 2PMCA 2FQXA 4QPJC 3MF4A 1TJYA 4MR7A 1DP4A 4S05A 3OO0A 3KS9A 5KQPA 3NNNA 3Q15C 3N53A 2A9OA 3HUUA 2CHEA 3E61A 3O2QB 4EVSA 3NHMA 3RVLA 2B1JA 3C97A 2PL9A 4MQEA 1F4VA 3CLKA 4KQCA 3EJWA 1H9CA 2MYUA 4NICA 4MQFB 3UK0A 2CD7A 2MSLA 4FB4A 1JFSA 3F7NA 3G85A 3IPAA 3LUFA 3TO5A 1ZDMA 1DBQA 3D02A 1LJUA 4OLBA 4JB0A 1Z15A 1JHZA 4N0PA 4MAAA 2NZVG 2PAFA 5EWJA 2BGGA 4HYEA 5IX8A 1D1QA 1NXVA 3CZCA 4FE4A 2ID9A 1ZGZA 1Z25A 2QVGA 4JASB 5FBKA 4MLDA 4Z4CA 2QVCA 5CNJA 5KQLA 4N0QA 4YO7A 1ISSA 4ETMA 2OQRA 2PUAA 3K9CA 3JY6A
chains in the Genus database with same CATH superfamily
5FFNA 1GT91 2HRBA 4D3YA 3I8SA 4L76A 4PZPA 2RI6A 4B0OA 5LMUB 3L0PA 3RKRA 1F5NA 4YVFA 1D2EA 4JBWA 1C50A 1E18A 3UWDA 3U3XA 2DR0A 2AEJA 4BMVA 4LN1A 1M5UA 2HF2A 4LVUA 1EFCA 1RWKA 4UPVA 2MYNA 5ALDA 2DHRA 3GUYA 3VMMA 3G7NA 1THTA 3SM9A 8ABPA 4BB9A 2EV9A 5ES3A 3IEVA 4DIFA 5A2QA 1UC8A 2OBYA 4ZDIA 1Y42X 1JYFA 4UMDA 4C7MA 4EJSC 3NTQA 4XWWA 3RW9A 1IQUA 2GLTA 2IBTA 2BHNA 4J8PA 1C1DA 4JSTA 4NAHA 4PYRA 3RIEA 1OFTA 3WNZA 3IMGA 4LHZA 4OG2A 4C6TB 2HMVA 4B79A 2V5UA 4FWBA 3RTGA 1T2NA 3DDOA 4PRYA 1E3IA 5CLLA 2A67A 3TGWA 4A0SA 4EHKA 4MDEA 2IDKA 2OP1A 5DTEA 3ZE6A 3MJDA 2GCOB 4C7JA 1U8FO 2WIFA 3EG9B 5K51A 2WQ6A 4FN4A 2X0DA 1NBHA 3CR3C 4ND6A 2AJCA 2JD2A 2ZE6A 4P3NA 3N8GA 3OZXA 5TF0A 4F56A 3T34A 4YN3A 1YI8A 5LU9A 1E3DA 1IVNA 2BOVA 1V3VA 3O1JC 3BSWA 5EI5A 5KWJA 2CJPA 3LO5A 1U63A 3ASZA 3TUZC 1P0CA 1XXHE 3GI1A 2PX2A 3QSYA 2AN4A 5BNFA 3FCAA 1T2EA 2JVKA 2UZAA 3WG9A 4YMUA 5LDGA 1M0WA 2XF8A 3E3OA 4O1IA 4UFNA 4GO1A 4YMHA 3AOEA 2OHHA 3D3QA 3W90A 2MDTA 5KJ1A 2DTDA 3LFTA 1ZAKA 2GEFA 4G4JA 4B3BA 3BFVA 3PNOA 1KI7A 4BZPA 1GG9A 2IEBA 5F9MA 2JRLA 1PR4A 4L27A 4P5PA 1VKOA 4NBSA 1STOA 4PLVA 3I1FA 2GAIA 2JZNA 3VO1A 1R15A 4HCJA 1A76A 4IMRA 1MO5A 5BSTA 2IEYA 4URWR 1E3QA 4MPTA 1J5XA 1X7YB 2J9XB 9LDTA 2VBIA 2A9RA 2RAUA 3ASUA 5ALGA 4GX2A 4JODA 5DNUA 1QU2A 5JARA 1XCLA 4EHLA 1WPQA 1QFZA 4GEKA 3LDAA 5KKAA 3TSCA 4MVWA 5H0IA 2OECA 1EUQA 3AY6A 1G5PA 4OCZA 3IV7A 3EPJA 1DZ3A 3NANA 5TSDA 5JJIA 3GPDG 3I83A 4NL4H 4BVKA 4WESB 1BH2A 4H7EA 1KNQA 1KXJA 2Q1TA 3LKDA 1SIOA 5JCOA 4C4PA 1ECPA 4Q1EA 4C7VA 1DRUA 3C15C 3M6IA 1O77A 3BEOA 4FGKA 4NMMA 2FPWA 3A4YA 3T5CA 3WJ7A 2O2IA 4C14A 3MLEA 3R0QA 3E7XA 1ZC4A 3VX3A 4ZGBA 2OC9A 3IAHA 4LSGA 3CEHA 4WTOA 5TQ2A 2VA9A 2BR4A 4QGAA 1P0FA 1WB6A 5HE9A 5JMTA 1PV4A 4C7KA 1HX7A 1BXRA 2R1TA 1DX6A 3SSNA 3UJAA 5K4GA 1THMA 1G38A 1JBQA 1WW2A 1K7YA 1SO8A 4UDNA 5JCXA 3BL8A 4QU9A 1KWGA 1PZGA 3N7TA 4B9AA 4KRXA 3R3WA 3QOYA 4XPZA 1Z16A 1I5EA 2XWQA 4HQNA 1LK0A 2IOHA 3IT1A 5EP3A 1UADA 2GJAA 4EB6A 4PO8A 1QGAA 3T1QA 1YS4A 4AG6A 1JJAA 1TOAA 1WETA 3OURA 2CXRA 3DUWA 1J0AA 1XF1A 3UQYS 4C20A 2A2ZA 2DYKA 3QUCA 1WHTA 1LSSA 4IX1A 4QUGA 5LU8A 5KHAA 4CCAA 2WM8A 3O38A 5I8PA 2OCPA 1KJIA 4GPAA 1X13A 4BCBA 3V80A 3AR3A 4ALIA 1Q1AA 3V4RA 4G07A 1B3BA 2EW2A 3H86A 2A30A 4HPJB 4ZYLA 5K5EA 4EFMA 3A9RA 1SCIA 2QN9A 3C5VA 2FW1A 4KO2S 5CB4F 2HU7A 5KX5A 4DV7B 1QP7A 2WU1A 2WIDA 3DJFA 1M2WA 5EEHA 3U40A 4EYSA 3MM4A 3N8HA 3I61A 5ABPA 4JVSB 4AMGA 3LKVA 1I7QB 3FG9A 3MFQA 3DLBA 2EATA 1WSWA 3TM5A 5CNIA 5FBHA 2B35A 1P74A 4I3HA 3AHIA 3ETCA 5T6BA 3RC1A 5KTSA 2VN8A 2ERCA 2VSYA 1GY8A 1G19A 2LCFA 3OF3A 3KDAA 1HFEL 4RGYA 4Q6WA 5EWMA 1AQJA 2CNNA 3OPQA 3FW1A 4DCOA 3UMVA 1N2BA 4M83A 4YR7A 2ONZA 5GZ3A 2P2SA 3S6JA 4EVQA 3GLHA 3JZMA 2GRAA 1RPTA 1KDOA 1AHHA 1T3LA 2IPXA 1IONA 1QG6A 2ATVA 2QLNA 1DX4A 5ECYA 3W7VA 3MHTA 4J43A 3M49A 5AP9A 1FJ2A 2LVBA 5KYNA 1C9MA 1CRZA 1XQXA 1EUDA 1TRKA 1OTYA 4G23A 2JAQA 2NUPA 1R0ZA 3R7NA 2XRZA 3P8ZA 4M87A 4DZRA 1RJFA 1XLVA 3OZEA 2NZYA 4L0QA 3AETA 1UFQA 1LFDB 3E22A 4TQ9A 4TWBA 5D87A 4NLLA 1P6UA 2AOTA 2C5GA 4G0QA 3KFLA 3D8SA 2C4KA 3BWBA 3KOOA 4M6WA 5EMKA 3FMPB 4K9DA 1MH9A 4WCFA 2GYVA 3H2SA 1QYCA 2H31A 2P9BA 5C9ZA 3FVWA 1X86B 5FULA 2YN2A 3ICVA 4EG4A 1E6MA 5ICEA 5A4AA 2CHVA 2PS9A 1H93A 4DLSA 1FUYB 1F12A 2G7ZA 3S68A 4WT7A 3K0AB 1Y4UA 3K9WA 3KOWA 1ISHA 2XNCA 3KELA 3KKNA 3Q3VA 4G25A 1Y6RA 4RF5A 4XCXA 2E48A 3M6XA 4M1ZA 5DLQC 4MVJA 4Y2UA 3TI9A 1G20E 3DUFA 2RONA 1JNYA 2VHQA 4AJ4A 4Z7JA 1JPVA 1OZ0A 4XYBA 4M21A 4YGYA 3W7BA 7REQA 2GUWA 2ZUUA 3I6BA 4LY3A 2DAPA 2QMYA 5ALHA 1Y4AE 3O7WA 3LSYA 1M8KA 2FDXA 4PCLA 3UHFA 4OGLA 2CNBA 4QTTB 4BMPB 5B2EA 2QPAA 2WU4A 5AK3A 3SQLA 1QRUA 3GG2A 5BSFA 2PUCA 2GX6A 4B48A 3ZE7A 2CB0A 1CNEA 3D8UA 3X1ZA 1EKXA 2FF5A 4NI5A 3T5TA 5A1JA 2XUGA 2W42A 3OLWA 3ZGVA 5DYIA 1M2KA 3Q87B 4Z9YA 5LBTA 3KSMA 1GARA 2WOOA 2VSXA 2ADFA 4NARA 2NU8B 3M70A 3VYUB 4CCYB 3EOZA 1G3IA 4NOJA 3JD1A 2VBGA 3L0OA 5AVXA 2B92A 3RAEC 2C0PA 3HBFA 1IZ0A 3JQ9A 3NVDA 1XL0A 4TT3A 1FDWA 2PZBA 3B6IA 5FP0A 3TAUA 1LBHA 1T2UA 3JV7A 2G0NA 1G3QA 2ZJ6A 1L4MA 1U31A 3K6JA 3W6NA 1JRLA 3NAZA 2GEDA 2I8LA 3B5IA 3EIEA 3AZPA 1LV7A 3BBLA 5HQ3B 3GAMA 2V58A 3PXCX 4DXDA 4DT1B 3SKYA 4FK8A 4ARZA 4BQOA 1YR6A 4FHEA 4DL9A 1GTVA 1ENZA 1ZU5A 1E92A 4AP6A 3GCWA 3R3XA 1VTKA 2G09A 4GR4A 1H69A 5FWYB 2NO4A 2OORC 3RIGA 1LWOA 1GTZA 1HSZA 1TM5E 2DPYA 2F9LA 3EZGA 3FJ1A 4QZVA 5KNCD 5LPNA 5BVGA 3WGUA 1CFZA 1EA7A 1ZN2A 2DERA 1BVYF 1HTBA 3Q5EA 3UNXA 3AO0B 4GMKA 1NKSA 1WCIA 3ZQ4A 6REQB 3CF4G 3DMHA 2XD9A 3O6VA 3I92A 3PKZA 4GAEA 5HFJA 1Y34E 1TW2A 2BUCA 3BKWA 3OKAA 2ZE7A 4MEBA 1A7UA 4P58A 4B3JA 2O0LA 2PQ2A 1QTNA 2O3RA 2ZRPA 3C98A 4H7PA 4CM9A 4E5KA 4HI0E 3VSEA 3VTZA 1CXZA 2QRVB 5CVJA 4EBFA 1HT1E 1TJPB 2P4SA 3HZOA 2HA0A 4RD2A 1R4ZA 1NBMA 2HZBA 5AVQA 4KN9S 1MGOA 1I32A 5EHXA 3TOXA 2QGNA 4MKRA 3AEUB 4DSZA 1CW2B 2OPHA 3N39C 2JHCA 4E1AA 4M9XA 4UJ5A 1YJAA 1C8VB 2QJTA 4LDZA 1KOLA 4G9EA 1JEYA 1UC5B 1XMOB 3RUHA 1PLJA 1QYRA 2QAGA 2EYQA 4JI5B 2JFHA 1PJCA 4K40A 2RGGA 1RW4A 3GOHA 3M4YA 3ESQA 4JKOA 2CHUA 2GEVA 1ZNWA 2QM3A 4I4CA 1FW8A 3R6LA 1T9AA 2GKSA 1OHHA 2ZI3A 3IVAA 2ZYGA 1RKQA 2CFCA 3A2NA 4YUXA 1SBQA 3BSSA 3F3KA 5AFSA 4KFCA 2H8GA 1DKQA 4YDRA 3ROGA 1GNRA 3L1UA 5BRJA 5E9AA 1J1UA 1R64A 1EVEA 3HCEA 3NBAA 1E1DA 2V7UA 3GC6A 2Z5VA 4RTPA 1JMKC 3KXIA 4K0KB 4NCIA 3GUCA 3H18A 4IEFB 3B3QA 4LXQA 4QT0A 4QDZA 4CTOA 5AXAA 1WX1A 4YUYA 5J2UA 3HLYA 2Y0DA 4R68A 3D3NA 3GFPA 1JBKA 2HV9A 5AVKA 1KYIA 2VT3A 1WV1A 1QGED 2X4LA 2ZTVA 3X2EA 2UAGA 5CEJA 2EBWA 3NBQA 1L9XA 4NOKA 4XE5A 3K0SA 2A0XA 2RJ3A 1BYUA 4PHCA 5D3QA 4CIVA 2NU8A 3RNLA 1N0HA 4HC4A 4KLAA 1GLNA 3NC1C 2AEFA 4KXQA 3IPLA 4W5NA 4TTSA 4R1OA 4B6JA 1PUXA 1R8YA 3GDOA 4BNNA 1W5TA 4CTJA 1PNTA 5EMNA 2DPHA 2JH3A 2VJNA 3H13A 1UBGA 1VL8A 3GZTB 3AZQA 1XDZA 3L4BA 1KJ8A 3AL2A 3LPLA 3QJ5A 4I14A 2B4RO 4CG3A 1BNCA 3QF7A 3RVOA 3VVLA 3W78A 4DT1A 1BHJA 1FPMA 4M1EA 2R4TA 3DBHA 1FUKA 2VQDA 4OXNA 1PJ8A 3CZRA 4N3AA 3DL2A 4CKEB 4KAJA 1N9GA 2YYSA 4UVIA 4NE9A 4X44A 2FSIA 1SXGA 2F55A 2HCRA 3GNQA 5TQ0A 2WLTA 4F6RB 1F2UB 1V48A 5AJWA 1X39A 2XA2A 2CF6A 4E32A 3EB9A 5TV2A 3WRXC 1NVUQ 1CKEA 4KYIB 3ZOKA 4K81B 5JJLA 1U2QA 4BMNA 3IQWA 4IOJA 3EIWA 4GLOA 3RFUA 3SJAA 1UAAA 1V47A 4XEHA 1YBVA 4AJ1A 3F78A 4LW8A 3FRHA 1VPDA 4V0SA 3RTEA 3FOWA 4N5NA 1DAIA 1W6UA 2JI8A 2PX5A 4NE2A 4ZI7B 4Y6QA 1Q7CA 1RPNA 2IYLD 4DMCA 3RS9A 2UUBB 4LJSA 3IQIX 2CK3D 2IQ5A 4BZZA 2RH8A 4DUGA 2YV5A 3NYWA 2K87A 2VDLB 1R0XA 5L4NA 2GD6A 5LP6F 1I7PA 5FHRA 4F2PA 1IE3A 1QCYA 1DRJA 1P7WA 4MS1A 4UZEA 5JG7A 5WRFA 1LPNA 4Q47A 3U1TA 1LGYA 1Z36A 2JJ1D 2YQZA 3WIBA 4QSHA 1VM6A 2BGUA 1HL7A 2PJUA 3MOGA 2G6TA 3N3BC 3HFGA 4AJPA 2AMVA 3W5SA 4XJSA 4LF7B 1Z2OX 2FDRA 1NQUA 1RWPA 2JFOA 3BAZA 4G9BA 4MULA 2EGHA 1PT6A 1YDGA 1Y4SA 2DC1A 4HXGA 4AY6A 3IMFA 4M55A 4LQCA 1OC4A 4FW8A 3GT0A 2IL1A 2QLJA 1VG1A 3K92A 2OXTA 3F0TA 3D6VA 4BNVA 2X1LA 4X45A 1Y1TA 4XZ3A 1EX6A 1YS1X 2ONYA 2QTFA 4LHXA 5C3MA 2ZRDA 2FGJA 1JFRA 1J0EA 2H4FA 2PBZA 3QBDA 2PXAA 4NY1A 4OFBA 1PVOA 4QQ8A 1Q84A 2PMCA 1ATIA 2Q2WA 3UATA 3V2UA 4D97A 1U8UA 3QX3A 1P2BA 3E9QA 4K9NA 5KQPA 3NNNA 2SCUA 1P4JA 4K1LA 1SVIA 1OFUA 4X5OA 2GD1O 3RTDA 2SKEA 2XE4A 3H87A 1R4MB 1M6EX 3FF1A 5JWOA 3QYPA 3QOXA 3FE2A 4E30A 1NQOA 4B76A 1HNXB 4M1TA 3TO5A 1LU9A 3FROA 3RU9A 4NFYA 1WPXA 3LBAA 4U5QA 1S4QA 1XMXA 3HVJA 4JB0A 4WKCA 1MH1A 4BFCA 1EFLA 2DFVA 4F85A 4R1PA 4KUEA 1GDHA 3A70A 3JVEA 4D3SA 3LX5A 3PEFA 4AZ3B 1E1CA 3BEDA 2ID9A 3OZRA 3E4DA 1UPAA 3PZRA 3Q2KA 1AK1A 3I1YA 2OWEA 1ZO8A 4FBMA 4F46A 2FUG1 2G8LA 4FJ1A 4NCJA 5FBVB 1M2VB 4BHTA 5CNJA 1QQTA 2Q5HA 3DOJA 4I4LA 2QBYA 1P3JA 4RJIA 3OF5A 4QUKA 2PSFA 16PKA 3WKCA 1K63A 4KVZA 5HUQA 3S1SA 2OMEA 3CLRC 1PGPA 3KT6A 4LG1A 1A95A 1VFPA 4BECA 1LJ8A 4CKEA 4DDHA 2D5IA 1FDTA 3QMPA 4V38A 5LQKA 1Q11A 1UZUA 2HMWA 5E9JA 2B5WA 1VPTA 4E33A 5BV0A 1VRCA 3OJCA 1U2TA 2YOFA 4QDOA 4KPUB 4S1NA 5CPFA 3U26A 1P72A 2YYYA 4NMHA 2RHOA 4OA8A 2VKQA 1YK1A 3JAWA 5EXEA 4HOYA 2H6EA 4ID3A 3D8HA 3Q9SA 4L2IA 1HT0A 5EJ8A 1DS6A 4JL8A 4MRNA 5BNIA 1J21A 4ZAYA 4R9RA 3N2GA 1VJ1A 3U9SA 4HNVA 1A7KA 3P0JA 2QVYX 1L5SA 5L3RA 3TTSA 2ZBVA 2V7WA 2PLNA 2Z4RA 2FP4B 2H00A 3I4FA 2ZYDA 4NS4A 1SCUB 1QHEA 1YCFA 2VPWA 2HSJA 1QC5A 4DLLA 4L5BA 1JSZA 1N33B 4Y6SA 2YJNA 3RS7A 3ZCTA 3R41A 4NMXB 3LGSA 4IWXA 3RJ9A 1VHLA 2EX4A 4LRUA 3LC0A 4M9RA 1YMQA 1AKVA 1B6RA 1XA3A 1U99A 1VRVA 2GZ3A 2HPZA 3DLPX 3GDWA 1BCRB 1GWNA 3L0ZA 3GL9A 1POWA 4AZWA 2I66A 3BL5A 3TCKA 5AVTA 2UUAB 2LKDA 3BE4A 2H8KA 3D6TB 4GMDA 4LV8B 1NHWA 5CHYA 2WW8A 4GYYA 2FPPB 3NBXX 5HNKA 3MT7A 2JAWA 4LE1A 4Z99A 1G0NA 2I5PO 3PI6A 1U7PA 1G3RA 3O8LA 4G1CA 4TZKA 3FOZA 3K96A 4UNSA 3MJRA 1ZI8A 3A3YA 4L6CA 2RKBA 5CA0B 1YT5A 2REQA 1XZNA 2IXDA 3BD8A 2IVFA 5A7FA 1C30B 1NVFA 5JDCA 1KH2A 1Z17A 3DXZA 5LD2B 1EDDA 1CS0A 2J8ZA 2NVUA 5PNTA 1EGQA 1V7ZA 5ESXA 3ZNOA 2QQ5A 1J8YF 1TEZA 2A1UA 3KWJA 3EEQA 3DDUA 2HYIC 1CLEA 5G0VA 1VKRA 1ZUNA 2SBTA 4LXIA 3EZ9A 2L19A 4WASA 1M2FA 1ZJ5A 5FBLB 2YHIB 2BSAA 3DDHA 1F6DA 3F9CA 5AI0A 2AEMA 4AJ2A 2D2EA 4C9BA 2EWMA 3IR5A 2G77B 4HTFB 3PCRB 2H4HA 4XYLA 5JS8A 4IDCA 2OD2A 1ORIA 2EU8A 3TN7A 3FOBA 5DN6D 5LOVF 5T8KA 2WYVA 1AKQA 5JYCA 4F7WA 3CM0A 4YR9A 1KYTA 1JQ5A 1TRHA 1VJTA 1LEHA 5JPDA 4G5RA 2DHCA 5FPYA 2H57A 3GRCA 1B8PA 2MINA 5FL7D 2UZ3A 2P9GA 2R4QA 1GKKA 4BAUA 2AXPA 1HYGA 4QJBA 5JAQA 1KDZA 3U7GA 1MQ9A 1PG2A 2R8XA 3AUKA 1OBOA 4JVOA 1W36B 1U4OA 1WMSA 3AEKB 5EHIA 3SR3A 1LA2A 3FR7A 3HUFA 3KQVA 1IJEA 2BBSA 4TLEA 2X1VA 2FMTA 3H75A 4PNHA 4JOSA 5HW0A 3IT2A 1NUSA 5BMOA 2FRVA 2X6TA 5IJ9B 1TYDE 3ISTA 5FAXA 5SY9A 5K6RA 4NCKA 3FNBA 4PO9A 1DOHA 2IDJA 5HRAA 3K2EA 1S3IA 1KWKA 2IH4A 2H5JA 3BWCA 1KZGB 3EZXA 4HBZA 4BBJA 3CONA 2FFHA 1G17A 1GFWA 1SG0A 4XUDA 5BN3B 1UP7A 1PI3A 3CX6A 1I36A 2JDIA 2Z58A 3AHCA 3GEEA 4A4DA 2QL9A 1L8LA 4N7MA 2PSSA 3H19A 4M9UA 2UXDB 4HB2A 4ZT3A 4CIYA 4ZRNA 4CQMB 3JATA 4UEQA 1J2UA 2NV0A 2ZLBA 2A14A 3H4MA 3HCOA 3KV3O 4MVJI 2DY1A 5EUMA 4FUQA 5AW5A 1DIRA 2V03A 1IB6A 2VHEA 4ZQHA 4IKEA 1H5UA 1QPZA 2V5VA 4ZOLA 1JF8A 1R5OA 4O0MA 2GEJA 2H4YA 2JA1A 1EXWA 4OQ4A 4RU1A 3L7CA 2ACKA 3I5YA 2Q2QA 1X7WB 3C0KA 3OE1A 1AKNA 3DE4X 5AI4A 4IKPA 1Z8DA 3AFOA 3RBVA 1UKAA 2Y99A 1GA4A 3U62A 3D43A 1O95C 4M54A 4FZ3A 4JVMA 3IUQA 3NFRA 4FZRA 4Y6RA 4MQUA 4GMHA 1CY8A 3W3ZB 1NR7A 5ALKA 3TLYA 5L4LA 3LPAA 4MAFA 1RHQA 3BWDD 2ZSAA 4FE3A 5JAHA 3DFMA 3WRYA 2HDHA 3C8DA 1QYXA 2FEPA 3V2IA 4YMSA 2XZLA 3GT7A 1KYYA 3D7LA 3GP5A 3ZTTA 5JJKA 4BUCA 2B4QA 2MSEB 4JKYA 3BTUA 1KJQA 4PCAA 4BQPA 3AC0A 1N36B 3F49S 1L5VA 3G9ZA 1E3TA 3EVBA 3GT4A 1UDBA 2AJBA 4FX5A 4EUFA 4O8ZA 5D1NA 3Q0EA 1E62A 4IX9A 1SHJA 2HMSA 2WAAA 3L77A 3PNVA 1JDBC 2GK7A 2VEDA 1XWFA 2IEIA 1NXTA 2O2YA 3HEAA 3LG2A 3R5KA 4R5HA 4A36A 5EIFA 4ICIA 1RPZA 1A9PA 5HM6A 1V26A 2EFEB 3DTVD 4PS1A 4RFSA 3LW7A 2AWNA 4N1AA 2Y1KA 3P0RA 4XGQA 4ZO7A 3UJHA 1T1EA 3ZEAA 4YPVA 2FFJA 2FZVA 1NM5C 4QUEA 4TWIA 3SMQA 4D7AA 4YT4A 3GJSA 1Q0HA 4DUZB 1HTTA 4RD3A 4G5YA 3ZXIA 2J9GA 5EXDA 2OZEA 4D26A 1MDFA 3ELDA 2C2OA 4JJGA 3ZWVA 2YWEA 3FOCA 4IS2A 2CLLB 4BKMA 2P5YA 2R47A 4HEHA 2ZI6A 1NW6A 4IW3B 5BWCA 3VNAA 2ZRGA 2AV6A 5K6AC 3I73A 3KWMA 4KQ2A 3OZFA 3V33A 4OUDA 3SNKA 3U3KA 2X0KA 3SNHA 5EZ5A 3RRBA 1M2GA 3L6EA 3N86A 2OEPA 2IPLA 3W1WA 5EUCA 1OQAA 4FBLA 5JH7B 1WXWA 3N2YA 3P2KA 3ZHSA 3DC2A 2DLCX 3BJIC 1XHLA 2N75A 4NS1A 2Q9BA 1K7CA 3CMCO 1XZDA 3S4YA 3VH3A 1AC5A 3ZNPA 3FOEC 3CVVA 5AICA 3AEQA 2Q1SA 3KXPA 4IS3A 5KCMA 3PUIA 4KACA 2QRMA 3O0DA 3SJZA 1YC5A 1QK3A 1H1LB 1C7FA 3N8KA 3VAZA 2YJ6A 4U8GA 5JQGA 5F76A 3QFHA 3N75A 4MOWA 1NG9A 4JLPA 1OAAA 2EBUA 2N3ZA 3ASVA 3M5WA 1LDBA 2ZJYA 4TKVA 3HR7A 2P6OA 3V48A 1R8SA 2P4QA 4XWTA 4Y9DA 3ETEA 1GPKA 3U31A 5EJ5A 4OQQA 2FEAA 3EW7A 1Z83A 3MQ2A 3NYRA 1MOZA 2VTDA 4NOLA 2D5CA 3LP8A 4YRJA 2W71A 3STHA 3OT1A 1XQ9A 1YR3A 2PFKA 1MJ5A 3HCDA 4FR0A 1OI7A 1EFRD 1W30A 1L5HB 4TXMA 4C29A 1TD1A 4CT0A 1RLTA 4LJKA 1CBUA 2WKPA 3RAPR 3BN3A 3RANA 3WWOA 1Z3IX 3WGQA 2JIZD 3U4DA 5AJTA 4M0MA 3U56A 4I55A 1IXSB 1MPTA 1WCWA 2YV3A 2ZJ4A 2WUDA 4JENA 2YV2A 4LEIA 4JI0B 4WBNA 3GRZA 4ZOEA 2HWXA 3CTMA 1RBQA 3VOTA 5KYGA 1TCCA 5AKGA 1FUUA 1ORVA 3AI3A 3NH9A 1VGRA 4RIIA 4D96A 2G1AA 4Q00A 5CNMA 3R3SA 3N0RA 2OO3A 5CLQA 4F2WA 3LIPA 1EUYA 5K6TA 4XGKA 1RM4A 3W1EA 1MAUA 4IBOA 4X62B 1FTSA 4BASA 2O1SA 5I9NA 5JEEA 4Q3OA 2FX5A 3UMSA 2CLFB 2GCGA 4NR0A 1ZSVA 2G9QA 4E5SA 4RIHA 3GR6A 1DADA 4JC0A 2C2HA 1VG0B 4QLBA 3EWSA 1H0RA 1T43A 4IIVA 5BT8A 4M0FA 4YIHA 2PVPA 1J2JA 4WNCA 5HKOA 2Y1LA 2DBVO 4TLMB 4L0CA 1S2IA 1KZ9A 4B4KA 1Q95A 3NXKA 1UPFA 2CC2A 1V35A 3B3FA 4IWNA 4DOMA 1HEUA 3HJTA 2A0YA 2PR7A 2BFEA 3SYMA 4D9MA 4WA7A 4OHWA 3RH0A 1Y7TA 5A03A 4MUGA 2WJ3A 3AOEC 2GB4A 5TRTA 3AYXB 3ILVA 4FGSA 5TEWA 3L8CA 3FWYA 4L7QA 3V1YA 5KYTA 1HOXA 2OZLB 2X5XA 5AW9A 3SIRA 1ZGHA 2OGZA 3WC4A 1QIMA 5HF8A 3VU0A 2ID7A 1P3DA 1M73E 2Y0BA 3DWGA 2FK7A 3HZRA 3K0CA 1AT1A 3IMKA 4RC9A 4DEXA 1EUCA 2ZIXA 3PEEA 4KQFA 3TJRA 4G0PA 1Y3DE 4KWEA 4B5LA 4A23A 1G2OA 3FCYA 3OP4A 3U4MA 1EEXB 4LS3A 1ZZEA 2O14A 2IT1A 3HYLA 4QATA 3A6JA 1K89A 3OESA 1WNTA 2ODPA 2GUGA 2PSJA 2XUZA 3DBIA 5F35A 4BUJA 2HYDA 2Q62A 4MVJG 2F3RA 3ZE2B 3AKZA 4A8TA 4N5IX 3DW1X 3E5MA 1RWOA 2XHEA 4K3UA 3PC7A 4QGFA 2AEEA 3UO8B 4UTPA 2WD8A 1F6WA 2I22A 3AFMA 1DKUA 4RHUA 3VR2D 2FMFA 1RYEA 4JKIA 3A4IA 1XI2A 3P0FA 1EE9A 1NSYA 4L22A 1VDMA 3HDVA 1L1FA 4G1BA 3AWDA 1S2OA 4HRAA 3TE7A 3MJSA 5JCOC 4OQZA 4Z49A 2O52A 3KVOA 3AF0A 3PSAA 4BX2A 1ST3A 5EG5A 3B6JA 3E1KA 1M8GA 3FLMA 5KYXA 3WMWA 4CLOB 5IUNC 3KVNA 3MN1A 2PK3A 5EJEA 1SXJD 1BC5A 1QYDA 3D6JA 3VR0A 3W3AH 3SICE 3CLTC 2FR1A 1LVUA 4HGNA 4MR8A 3TB4A 2RD2A 4TWRA 1DAMA 4YJGA 2OHGA 5FA5A 3IHKA 3O8OA 3UXHA 1FFYA 2A86A 1FNDA 1V11A 3QEOA 3OJFA 1XRLA 3DPSA 1T29A 2YZ2A 2A0UA 5ECDA 1A04A 3K1AA 4YP0A 2JLBA 4B71A 4CODB 2ZP1A 5JC1A 1BCSB 1UDRA 1VMKA 1JNXX 1XZMA 2YVQA 2RB4A 2B98A 3EFBA 3NI2A 5HFAA 4BLRA 5KTYA 2NSHA 5ALVA 2RC6A 3DMTA 3NGMA 1I7SB 4OI1A 5CAEA 4CTNA 3D8TA 1YZUA 3RTCA 4CEIB 4IKOA 2J4FA 1YB6A 2QP9X 3N0WA 3ZBQA 1DLIA 2BCGY 4JBYA 3WNBA 3RYCB 1OPXA 2FZ4A 1SUDA 1N6KA 3HG7A 2ODNA 4X63A 4X91A 5AWFC 3JQAA 3WGJA 5KTKA 5C52B 2C7RA 3DR5A 4TSRA 3DLAA 3V4ZA 4MUAA 4BLVA 1P91A 4ENWA 1ZGJA 1FL9A 5CD1A 4MRMA 2OXCA 4RNDB 1PD1A 2LPMA 1N7IA 1XTSA 2QX6A 4L8VA 1E1NA 4OY3A 1JG1A 2L69A 5ESDA 2CHQA 3PPXA 4H0NA 4EA9A 3BFPA 1T4BA 1WM1A 2VRCD 1EE1A 2CXQA 2PGNA 2YJ5A 2QZ9A 2WYIA 8AT1A 5CLJA 1GKYA 3H42B 4DMGA 1BDBA 5BNTA 2NUAB 4FFPA 2GCEA 2X8JB 3MQFA 3QNUA 4RPKA 4HNUA 2EKQA 2I4LA 5JMWA 4DFDA 1XNQB 1FYWA 3V7YA 4J07A 5BN4A 3PR2B 3DTVB 4BKPA 2NYRA 2PUVA 2BHSA 2MTBA 2DE0X 1EQAA 1BA2A 4BEVA 1T3TA 2BCJQ 4KKVA 1COWD 2FPGA 1PG0A 2JG3A 1DIOB 2VTEA 1CB7A 1YSCA 3FUXA 1VA4A 1Z7WA 3MVEA 1J8DA 4Z0HO 4C3VA 4CR6A 1TX4B 1B42A 2H06A 3LXMA 4LOIA 1Y8ZA 2D0IA 5AUQA 1FLDA 1FUEA 2P1ZA 1KQOA 1TIBA 3IAAA 3O8BA 4QQFA 2JIRA 3PP8A 3E81A 4TUYA 2Q50A 3C7TA 2HMTA 5B4VA 2QK4A 1SXIA 4KRYA 5KJ6A 5FL7A 2WAOA 2FQXA 2YBEA 4HAVA 4F6LA 2ETVA 5KYWB 3IXLA 1BFKA 2JH9A 2XXBA 4RTNA 4LOHA 4J9VA 1RLMA 3TFQA 3WAGA 2AFVA 2A9OA 1G64A 5CB4B 4WCFC 3RVDA 1P7YA 5ESRA 2J09A 2EL7A 4KMMA 5JPCA 1SUEA 5AOAA 2BEVB 3RRNA 3RJ5A 3H0KA 4K9MA 1KPIA 1A2BA 4FCVA 5FAKA 3GEGA 1FY2A 2ANCA 4PFQA 3G23A 5D6OA 5LYYA 1G3MA 4A2CA 1Y3CE 1XKTA 4CU5A 3EYWA 2CSXA 4BBPA 1JPNA 3OTIA 3H3FA 1CQIB 4ZVUA 5JECA 1WXHA 4MAAA 5GM2A 1KZYC 1P0MA 3ZXUB 1Y9EA 1BE1A 2FJPA 3ETLA 1D1QA 4FOTA 4G41A 3SDZA 4BXOB 1G8JA 3GCGA 1QK4A 1QRDA 2E9SA 2JHGA 3IMCA 3QUTA 4JASB 4ZV9A 4DNXA 4MLDA 1VIDA 4Y2HA 3BGIA 2CV0A 2UUPA 4CMGA 4BRSA 5EPOA 5A4MS 1W85A 2VQSA 5ALEA 1OZGA 5HYVA 1WSDA 4GOKA 2FZGA 2R8EA 2PMWB 3U0BA 4X93A 4OJMX 2XKBA 4EYEA 3O31A 1N6OA 2XTJA 3C16C 4ZT4A 1GNTA 1DKOA 3K9CA 1VIVA 3JQ9C 4X90A 4NC9A 4IHJA 3A2MA 4ER0A 3W5BA 4A0RA 4GXRA 3RWOA 3UG7A 3PI7A 1E2GA 5DHPA 3UGQA 3ZJ4A 3D7NA 4L9RA 3D3KA 4RZHA 2X0FA 2BN4A 2AXEA 2E37A 3A4MA 3MWJA 1K6MA 1KO8A 5JNWA 2Z6UA 1M1XB 1XD8A 4C3UA 1J0XO 2DOKA 1DU4A 2I65A 3A05A 1OYWA 2QW1A 4WK2B 4S2EA 1G7SA 3DZGA 2OYCA 1YTUA 4PYQA 3T1HB 1SBZA 3BDIA 3LPDA 4MI9A 4ZRDA 2Q46A 1M2OB 5G0UA 3AIIA 3PITA 1KAMA 4GT1A 2O4CA 2E4YA 3P97A 3AQIA 4X1KA 3VUEA 2R1ZA 4GUDA 2Q28A 3DKPA 5HOEA 4P5EA 2VSOA 2JW5A 4G5XA 4O4HA 3C1TA 3ZG6A 1MO3A 2NUAA 1QP8A 2B9VA 3T54A 4BFYA 1X9HA 2DFPA 2I4OA 3PFBA 3JARB 1MB9A 4F0JA 4EF6A 3ESXA 2IE8A 4DYVA 2NADA 1WUYA 3BRWA 2G1PA 3L7KA 3G8DA 4CBVA 3IBTA 5M34A 3GEHA 2GS9A 1E2NA 2XYHA 4L5AA 1VSTA 1V7PC 5ALOA 4UD6A 4DV2B 2RBEA 3BC1A 4F2DA 4MUEA 5FYQA 1EVZA 3K8OE 1TM7E 3QHAA 3CKKA 4HN9A 4IM7A 4OK5A 2PUHA 3RU7A 3GMDA 3K2IA 1P60A 2YHSA 1DQZA 1E2LA 2LV8A 1B0PA 3E9MA 2P1DA 5FLYA 3AFIA 3ZK9A 2LBPA 3HBJA 4D81A 5JS7A 3JPWA 5FB3A 1WV0A 2Q6LA 1RRVA 3E5NA 4ALMA 4LV5B 4R2LA 3ESBA 3UUEA 1GZDA 4RHYA 3IP6A 4Q1AA 3K0EA 4RMHA 4RJJA 1ZR4A 4PC7A 1LRLA 3H8SA 1ZEJA 4CM1A 4P4SA 4U7FA 2QAGC 3RLIA 4AJNA 2BP7B 4C08A 5EYPA 1T6XA 2IP2A 2ZR9A 1M2JA 2FCRA 3FPHA 2VJMB 3IPYA 3CUYA 3OEHD 1FNCA 4P84A 3ZGLA 3K70B 2IZ0A 3HA5A 4YQYA 5JVDF 4LTNA 2QUBA 3Q9UA 5SZIA 2ZR8A 3X1MA 2YFYA 1ADCA 4KCGA 4LGCA 4TZ6A 2OG2A 3O8NA 1JKFA 2V0CA 1D0SA 5A6SB 3PHGA 3RC9A 4QBFA 3RYHB 1XMIA 3TB6A 5BOSB 1XDUA 3DBLB 4UM5A 5IEBA 2PUDA 3REGA 2WC1A 4TTAA 1UQTA 1WVMA 2AIRA 3Q2IA 3SFVA 4AROA 4PC1A 4ETWA 2FQYA 3B3GA 1UQUA 2WDZA 4BFZA 4LC9A 1SXJB 4JAVC 1XEAA 2IGBA 1KE1A 2A35A 3KYDB 4LBZA 3RBAA 1FMLA 1F4PA 3EQ9A 2VT6A 4K28A 3CCCA 6Q21A 3MGAA 5IXSA 1CY7A 4EW1A 3TGLA 3L0BA 4X1OA 4DBLE 2YS7A 3PNQA 4MYRA 1AA9A 2JIZA 4AS2A 2X9QA 1YDEA 4D45A 1YIDA 3QVTA 1ZU4A 1SPXA 1QBGA 1KAEA 2CXUA 5LZ7A 3K73O 2X23A 2XMRA 3EGOA 5SV2A 1FXWA 2FUNB 3L4BC 1HE2A 2FF7A 2ZU6A 3F4BA 1ZRNA 4HJXA 1OVGA 1IN5A 5AO9A 3SVZA 1X1TA 2WTEA 1VSUA 2IY9A 3BD9A 4C4TA 4DM7A 2B8EA 2J48A 3KXKA 3UAVA 2IX3A 2HA4A 4C04A 2JAXA 2OQ2A 4E2WA 2GPSA 3B20A 4U8HA 3O75A 4F3KA 1PF7E 4LF8B 1I7LA 2O8CA 5J1TB 1G55A 1YZGA 2PT9A 3LUPA 3O9VA 4P1ZA 3CS3A 3OPNA 3JQGA 1L7AA 2ECFA 3FLBA 2P1RA 1VLHA 2DBYA 2FX2A 3NETA 3NJ4A 3HP7A 1XVVA 1R6AA 2I2BA 3H65A 2XCRB 3PSHA 4QWMA 2LW7A 2B25A 4JUAA 5F52A 4E22A 1R0BA 3HVRA 3UB3A 5JRZA 1MMFB 2BBWA 2M6RA 3KR9A 3G9TA 4IV0A 1WG8A 4TVBA 3TOZA 2X9LA 3QU4A 1XTUA 4E11A 1ORWA 1D9ZA 1IMOA 2A9JA 1JB1A 4H6XA 5FLXA 2I6GA 2HHJA 2HFKA 4EP1A 4C7OB 2EFDB 2ZSBA 1I4EB 10MHA 2GM4A 3C5EA 2CLSA 3LHDA 1IHPA 4MYUA 1R2QA 2B6HA 3A4TA 3MTIA 3ZWAA 4QDJA 3IJ5A 2HMAA 4G26A 3W0LB 4YAIA 4Y2VA 4OYRA 3L9WA 5JMPA 1D03A 5FTMA 2C58A 3B5JA 5B2FA 1B8VA 3COSA 3I12A 1VHQA 2IQIA 1N3LA 3E0QA 5C0OE 2BD0A 3V1NA 1E1QA 1XNRB 2IXBA 2O8VA 3H9EO 4RKWA 4RK1A 2FEKA 3GA0A 5EMMA 4CL2A 5AVOA 3SZLA 1UKZA 5T41A 3I1JA 5C5IA 5KPDA 1M0EA 1PQUA 1NLMA 1BG6A 3VR2A 3LL4A 1B0ZA 4MX8A 3RRYA 1PS8A 2DH5A 3B1VA 4E4TA 4DDVA 1N6HA 4DNPA 2ODWA 2PH3A 3JWEA 4AVYA 4JHLA 1ZH6A 4MV8A 1N4AA 2F8LA 1W94A 1AVTA 1YB2A 2YWXA 3QPUA 4RHCA 3GDFA 2VUTA 4WBSA 2G80A 2QS9A 4ZOBA 4PN3A 3GO4A 3L6CA 5ALRA 3T5BA 2P6NA 3TX2A 3WYNA 3TGPA 4G89A 1XK6A 3ECAA 4ZQFA 1P2SA 5DNAA 3CCFA 3D31A 3LOUA 4KFSA 3QEMA 4ODIA 1T5TA 2X9VA 4MJ7A 4QBHA 3DV0B 5LP6B 3IUJA 3CBQA 1QDEA 3IQXA 5IZCA 4MPPA 3U3ZA 1YA8A 3LTEA 1TZKA 4CIBA 1DV1A 2Q6VA 4ZI7F 3FFAA 1JAZA 5KSPA 4YBZA 2YV1A 3QOWA 3GHYA 2AKYA 3WGVA 3C14C 1JG6A 1WUHS 2NO1A 2NYVA 1VSBA 3DMFA 2FWRA 1F1BA 3HJNA 4OSPA 1MCZA 4HUTA 5KOJB 3H5LA 1AHNA 2JI7A 3HDGA 2E49A 4CG0A 2DFNA 4D0SA 3DFKA 4IO0A 2QM0A 2H07A 3ENQA 2VCYA 2JHPA 3EXHC 2G0AA 4OA5A 2NV2B 2B5OA 2WD7B 2HQ1A 2D7DA 4GNRA 1K6XA 1QTRA 4B8WA 2VAPA 5I47A 2C97A 1LF5A 821PA 1P9RA 5BW5A 1CQJA 3QU2A 2X58A 4BIMA 2XNSA 2W2NA 1CX9B 3E27A 4EKGA 5ICGA 3STXA 1U1FA 3QIVA 3FCOA 5C7IO 4PU0A 2PWZA 3H1EA 4IO1A 3ZD6A 1X3SA 2DT5A 4KYTA 1CIJA 1BXZA 3KWFA 2CMKA 2L82A 2H16A 3QUAA 4LHEA 1U6JA 5A9SA 1H1TA 4XR9A 4RKQA 2F59A 1G8AA 3JQQA 3PXUA 3NHYA 3R8XA 3MTBA 3UW1A 4BCCA 1PT5A 2FQQA 4NV0A 3ZJUA 1HT3A 1K5HA 4TTRA 1U7WA 2BMFA 1D4AA 2HQSA 3G8BA 1RQLA 4MV3A 2E4ZA 3X43A 3D8RA 2OKCA 5FXMA 3T3HA 5CW2A 5I9LA 4R9SA 2VZ0A 1EDOA 2RH9B 2ZI4A 3R5XA 2EFCB 4ISBA 3K9QO 3THWB 1BS9A 2IBMA 4O63O 3OQNA 2VRWA 1YB5A 1E9DA 1ILWA 3KFXA 4CU2A 4GI3A 1KAOA 3PV0A 1RADA 2PHZA 4YQZA 1JI3A 2OENG 4YT2A 1BS1A 2ZROA 5EJMA 3PX7A 4C7OA 3MCZA 2YWHA 1VBMA 5BQ3A 1ESCA 1E2UA 3GELA 2JANA 3PUKA 2BTOA 2OBLA 1F60A 3FBWA 4OAQA 1NYLA 2M9MA 2G36A 3TE6A 4B7CA 2B21A 1DRKA 2G9UA 2O2DA 2D2XA 2C4TA 1J2TA 1LX7A 2IXGA 3W8RA 4KH1A 4LAFA 5EIAA 5HTKA 4G5SA 4U6QA 1A27A 4NJOA 1V5FA 4EGSA 4EHHA 2ZSKA 4BS9A 2BEUA 4ETNA 4OKNA 4YRGA 3IFSA 1M34A 1Q20A 3I72A 3ZX5A 2IHKA 4K9RA 5JDCC 4O4LF 4RWEA 2ASEA 4UTOA 4E14A 4HATA 1PS0A 4WVFA 2V0GA 4ZI3A 3G5UA 1PR2A 2KSQA 2XYGA 4G9GA 3NHJA 3R23A 3WMGA 4EG8A 3WYCA 1FNNA 1X3LA 3FDXA 4NSNA 4XD2A 5E0KB 1B0AA 3ET4A 2NO7A 3AUSA 3TEJA 3PDIA 5C1DA 1CRPA 1NP7A 1O97D 4U7JA 1GG5A 3DP7A 1M1ZA 2Q41A 2VJKA 5REQA 2P8JA 4Q3EA 4KOAA 3CBGA 2RCYA 2FETA 2NAFA 2NP7A 2XTNA 3SDBA 4N7JA 2BFOA 1V1RA 4DR6B 1R5NA 5AR1A 5FNVA 5L3ZA 2WY2D 1WPGA 3EIFA 3L05A 2WKWA 4GM4A 4G4GA 4MWBA 5L9AA 2YKGA 3LQ1A 1HQYE 3WHLA 7MHTA 2ZRQA 2JHFA 4EO4A 5T8KC 1OV6A 3OIDA 3I8OA 4KNWA 3LY9A 1RXWA 3OM9A 1QZXA 3X3HA 1MP0A 5A5FA 2P4HX 4OQXA 4XUGB 2JIMA 1NTRA 1MKYA 2ZPUA 1UFRA 2YC2C 3VR3A 2WUFA 2VYND 3ORFA 3SSOA 1CIVA 4JWTA 1C3LA 3WTBA 4JLMA 4ROSA 2W58A 4Z9XA 3VPFA 1ULBA 5I8ZA 1XTBA 4KXXA 3LBYA 3A1UA 1B7GO 3KTOA 2C61A 3BZUA 1FX0A 4OOFA 2FG5A 5AJYA 1ULHA 4TKLA 4EL5A 4QUDA 5C81A 3K30A 4DCPA 3DLTA 2WTUA 3NRJA 1GRVA 5AXBA 5CFQA 3T0GA 4ARSA 1WXFA 1ZRMA 2OZKA 2BW0A 1NG1A 4E1BA 4EM6A 5TIIA 4X7PA 1Y8QA 2MSKA 4F3YA 3FMGA 1YS2X 3VO8A 5KNCH 4JI4B 2NPIA 1OTHA 5I7SA 3TF5A 1W8DA 2OFPA 2WDPA 1ZOLA 2V7XA 1KJYA 1PJRA 4I2NA 5DW3A 3BWYA 4TLBA 4JP1A 4A92A 4H4EA 4BJHB 3S7ZA 2G5PA 2UZ1A 3EGXB 1LK7A 1ORHA 5LOVB 3N6XA 3LA6A 4GH5A 4F1WA 2D5LA 1ZXLA 2IOQA 2W6ID 4YRPA 1BMQA 2WJ4A 1SD1A 1JYSA 1YV9A 5DLYA 4BLUA 4C4RA 1ZL2A 1RRCA 5JS6A 4V39A 4PSAA 4N82A 3REOA 3AJ9A 1GKIA 2R7NA 1GNVA 2Z83A 3AW8A 4MGHA 1XTTA 3DCJA 1DX9A 3HB9A 4IDPA 1NQ5A 2QDXA 1UP6A 2HSZA 2IU4A 1XHEA 3FKQA 4HYTA 4TT8A 4TVKA 2I55A 3CEJA 1A72A 4NRDA 1X0XA 2VSNA 2WJIA 4YJ3A 1WBJB 2L18A 5LZ5A 3RS5A 4EI9A 4O2BA 2DXIA 3OQHA 4IJMA 5F98A 3B1YA 4N47A 1GPYA 1WVIA 2WT9A 3HB0A 4H1VA 3RASA 3WRYC 1VB5A 2N9UA 3C3YA 5E6RB 4YLYA 5KIAA 3PQ4A 2X7JA 3LTNC 1YQGA 1QF7A 2PIDA 1FQOA 2ZCUA 2V7VA 4E5NA 2ZYRA 1SKBA 4YT8A 4BCDA 3E48A 5DX8A 5JMOA 3B70A 1D2CA 4JJEA 4KG7A 3S1LA 4O29A 2VNHA 1YQDA 4RQBA 3UM9A 4DUYB 1Y63A 3HYCA 1PUJA 2LGJA 4CI9A 1FFSA 4DREA 5CDUA 5CFMA 2QV7A 4QPPA 4LQDA 5G4KB 4BGDA 1FTWA 3QK7A 1QCDA 4HAWA 4JEIA 2RK6A 3EXEA 3SJUA 3ZVMA 4EQ6A 3A11A 4D6YA 1XKXA 1JVNA 2FZ5A 2QUJA 4L02A 1SD5A 3A4LA 3UEOA 4D9NA 1W0CA 2ZM5A 4B3IA 2Y67A 3ELBA 2I76A 3X0DA 2NMVA 1IULA 4JI7B 4EHFA 1TJYA 3EXFB 1INLA 1ZA2A 5AIBA 1SCBA 1C81A 2WKSA 3BXHA 3OO0A 4KITB 1UM8A 1OFHA 2AE1A 1O6BA 3M5DA 2PS0A 1T1GA 4WERA 3VFDA 2IZ7A 1C14A 2RHLA 3QV1A 1TQ4A 1SFRA 3LLVA 3NHMA 4NYIR 4PGMA 2C7VA 3MCTA 5E2BA 3O2NA 1J7JA 1YDMA 4JC5A 2J3LA 1FXSA 3HYSA 1CR1A 2MYUA 2Z1DA 3C6ZA 3IQHX 4U2EA 5EJGA 2CNWD 2MSLA 3I6MA 5AXDA 3IPAA 5BN5B 4AS3A 5CFZA 1OXMA 4NAUA 1DBQA 4M99A 4POOA 2QT0A 4DR3B 3V8PA 3B8HA 4B5KA 4PQRA 3U44A 3TW8B 5EWJA 4DZTA 2ZBUA 4Q12A 2WUWE 3UPDA 2VVTA 3AW9A 1TJ4A 2NM0A 2VYVD 4NFLA 1MC1A 1RWVA 1X1AA 2CLIB 2HIAA 2K7ZA 3M5CA 2OB1A 5B2ZA 2GN0A 4ZGGA 3KOMA 2D1SA 3DFUA 1CUWA 1M10A 3EGWA 4RF4A 1IG3A 5J4KA 5AKZA 1TMOA 3L8YA 4QECA 5DOVA 3GN2A 5JTTA 4L08A 3AWIA 1PDVA 1JA1A 4KWTA 5CW1A 1MZPA 1IH8A 3PE6A 3O8CA 4CEJA 3GARA 2HI0A 4KJZA 3ORSA 3R3UA 5U4QA 4V1CI 1KI2A 2P2NA 3R5JA 4K9PA 4TRRA 1NX6A 1KIMA 3A7DA 4US1R 4B2YA 4TV9A 3H2GA 2QUAA 2PBFA 4RK6A 3LVQE 4LNAA 4EMUA 2MJLA 4LDAA 3OQMA 2R48A 4XFDA 1WZ2A 3IDFA 1K8RA 2WT8A 3QRWA 5DBEX 4I1OA 4CHTA 4ZWNA 1LV8A 4MVXA 2GCPA 4IR7A 4JK3A 5EJ4A 3HO1A 1T2VA 3LH5A 4U1RA 2RE8A 2Q5CA 4AJIA 3GT3A 4BMYA 4D9FA 2QYHA 4OQFA 3MAJA 1PFYA 1OGJA 4X6XA 1JSLA 2X8WA 4NPHA 1LD3A 3T94A 4J3JA 3KQYA 3JD2A 2VXOA 3VZBA 3E0XA 3LMKA 1WJGA 2E4UA 3CX8A 4DAEA 3P9QA 5IT5A 1GL6A 1M2HA 4MWEA 4OYYA 3UZUA 1TKCA 3P19A 3CJRA 3QBVA 3EMVA 3QY9A 1E4YA 4LJRA 2QSZA 4UVDA 2CUZA 5LQNA 2RHTA 5E1BA 3T5MA 4EAAA 1LRKA 4WLUA 4OYHA 4REQB 3MJ4A 3KG2A 1AZSC 3AX6A 4K6HA 3A4NA 3WL8A 3A9UA 1RKUA 4A5SA 3H2BA 4WDRA 4DBZA 3HL0A 1QE5A 4AJJA 1SKUA 4GPBA 2YHUA 3RVJA 4PQYA 1L7XA 4C0LA 1Y3AA 2G3YA 4D92A 1NFRA 1QFYA 1CUGA 2YXPX 4DIEA 3TUJC 4FEEA 4PLPA 2IDMA 3D2BA 1I3CA 3NOXA 3QJGA 1J42A 4YRBA 1TQ6A 5K8LA 4GNKA 4FD3A 3B60A 1HKUA 2KYRA 3E23A 2R1VA 1RACA 3ODGA 3W9SA 3GUHA 4Y1RA 5LVAA 5BWOA 4FYWA 2YCBA 2BIFA 5F7ZA 1XP5A 1GGNA 2WZBA 5H82A 4US2R 4TS9A 4XYGA 1G18A 3SG0A 3OZVA 2P6RA 3AP1A 3JQ7B 1XXLA 3K0CC 3OUZA 4RFVA 2ZCJA 3I2YX 5KWEA 1ZNQO 5E6UA 2ZS7A 1I0IA 3PVSA 1XRSB 3AUAA 3UMGA 5DM70 1OWPA 3DNFA 3HUDA 1YJXA 2ZDHA 4PS0A 1RSZA 2X9NA 2HRQA 1CD5A 3O26A 1ULSA 4URFA 1TJNA 4FP9A 3ZY3A 1F06A 3AV0B 3D4LA 1OVMA 1OXSC 3LBNA 3HADA 3FBGA 5BVHA 1KEPA 1CZNA 4WUTA 5CA1F 5FI1B 4EA6A 1U7TA 3R6TA 4TVOA 4Z86A 3U7RA 1PT9A 3EOBI 3LCMA 5I5GA 2I67A 4ZQBA 4NMWA 5ALNA 2LZ0A 2QY9A 4ERNA 4ZK6A 4BVLA 1DAEA 2O8DB 3QYJA 1CY4A 1DC4A 3ELUA 3G0IA 1TT5B 1YR8A 1T25A 4O2AA 3A6DA 3SCZA 3CO5A 1Z82A 4E31A 4P3PA 2FZEA 1T24A 4G84A 3VHQA 1YBFA 1DBVO 1ZONA 2JVJA 3F6BX 3SGLA 3DYVA 4MS4A 2XCLA 3DZKA 3CRVA 1RYNA 1IY8A 1KI6B 1Z0KA 4GVXA 1UBKS 5DN9A 4DZZA 3U80A 2QQGA 2GHRA 3IELA 3PWTA 1Q0ZA 4AY5A 4BN4A 2RHHA 3UKDA 5F7OA 3RIHA 1PO7A 3DMTC 3MRXA 3FHJA 1E9AA 2P9YA 4H31A 4M9CA 3WBBA 4Z8XA 2Z57A 4X84A 4EUNA 1VECA 2ILTA 2C5AA 3F1KA 3WXMA 1D7AA 2VAVA 4HDQB 3AONB 2VRBA 3NU1A 1SKYB 2CNLA 1HRKA 2VJQA 3IR6A 4CMIB 2I4RA 1LZLA 3E5RA 2J1LA 1GPWB 1RI2A 3K1JA 5EKXA 2G1KA 4C07A 1E0AA 1D2NA 1GJRA 5T4EA 1PSZA 3QLVA 2VDJA 3W06A 4YALA 1KAQA 2OCXA 3L7DA 1WB9A 4IIJA 3PPYA 2WILA 3C4QA 4IMIB 4JLWA 9MHTA 3ETJA 1KP9A 3IAXA 4X94A 2AN9A 1ABBA 5KCZA 2H1WA 2WTMA 3EGDA 4RA9B 4RJKA 4WSOA 1U2GA 4IYRA 1G8MA 4HFNA 3TPCA 3PGMA 2R60A 1F4LA 1X7ZB 1WY7A 2VJCA 2BKEA 4ZDWA 3WB0A 1YL6A 5CJJA 1I9CA 4KBYA 4XXHA 3UW3A 3GRYA 2BTQB 2XT6A 3UWSA 3WLOA 3DKRA 4UATA 2CZQA 1W5BA 2X6QA 4EW2A 1ITZA 1SH7A 2VBFA 3H11B 5JFOA 1LC3A 4L6AA 2BFFA 3UKOA 1LKZA 2YOGA 4FXOA 3CRQA 3UG6A 3LUAA 4GP6A 5CDGA 1VFNA 4LNHA 5T4FA 4B2IA 4K9LA 5B3LA 1LBTA 1U3VA 1U11A 2K2WA 3VU3A 4MCAA 3PXXA 4TWZA 5B6IA 4UEWA 1XRQA 5JXWA 2DT8A 2VHWA 3NYIA 1EUZA 2VYNA 3I0NA 3U16A 4MV4A 4YCAA 3S27A 4TS3A 5HXAA 3PX2A 2VHYA 4X3OA 5K01A 5BOVA 1NMQA 1CJVC 1JAXA 2EFHB 3FNEA 3DGFC 3HCPA 4IL5A 1NONA 1SG6A 2I2FA 4D0NA 3R3YA 5BV7A 5JZ9A 3DWFA 3NTXA 2VZLA 5E2AA 4XFJA 2JNWA 1WWKA 4Q3KA 4Y67A 3RVBA 1GZ4A 2J67A 3LFHA 1CUAA 1DEHA 3QG5A 3QOFA 3UJBA 3UA3A 1G59A 2BEWB 2PL1A 2PDAA 4XRRA 1Y1LA 1F3LA 1WXEA 1SEVA 1U4NA 2YYAA 4LK2A 1I3MA 3DXYA 4N3GA 3RVNA 3WWYA 4WAUA 4WXRA 4NBTA 4BMXA 4R0MA 2BE7A 2JFQA 1CWUA 4AWBA 1HNWB 4PGHA 4AUKA 3TZ6A 4CRWB 3LUJA 4XGNA 3AQ4A 2H59A 1V2GA 4Z2AA 1E69A 3OOHA 4Y2YA 3ELYA 3BMOA 3Q1KA 3GGSA 4NCAA 3RUPA 1GXSB 1V43A 4LXYA 2FB9A 1HRDA 5G1NA 4KJXA 1GCIA 1KDTA 1BE0A 1EH5A 2QN7A 4F3RA 5ELXA 3AFNA 3QXJA 4ZICA 2W6IA 1PQPA 3NBFA 4RA6A 4M98A 3TQTA 1A7JA 4HY3A 2PWPA 2FPIA 1QRSA 3PFNA 2GO1A 3GCDA 3KYBA 3OKFA 1LPBB 1HDXA 3K9HA 3RROA 3Q7TA 4ACAA 4ZEMA 1CRLA 2C54A 1GUBA 4LXXA 3QBTA 4OQEA 3UAZA 3ZWDA 5BP7A 1CQPA 2DR2A 3GEMA 1L5LA 4C87A 4F4DA 3D64A 4QNNA 3M33A 4TROA 3WZ2A 4M37A 4BNYA 1GFIA 4N6OA 3PXGA 4HZUA 4RVOA 1FSZA 2OCGA 1SUIA 4X1IB 3UICA 5LIRA 4GXTA 3IA7A 3WO1A 4BVAA 3PUVA 3OPYB 2QR3A 2PZGA 3ME5A 2R6CA 1DIHA 1U8YA 4F4HA 3SYNA 2EQAA 1H23A 3BSFA 4PPQA 2IITA 1NE7A 1Z2DA 3TBKA 1G6OA 1EJ6A 1NXSA 4CM7A 4QLAA 5GV7A 2PRJA 2EZ8A 4OREX 3F67A 4HWSA 1Y9AA 1HZJA 4HP8A 4QOSA 3DOUA 1A4IA 4R5MA 3O82A 5IP5A 4ZVTA 4QXAA 3T3GA 2GI4A 1U98A 2CB9A 1NF3A 1SUCA 2NO9A 4JGBA 1T3ZA 1U0JA 2BZSA 2P0YA 2P9ZA 3ANSA 3PXDA 3Q0TA 3DVLA 1GQOA 5DT2A 1HMPA 1US8B 1G291 4GFDA 5CM8B 3WWPA 3ERCA 1IHYA 1JQEA 3PQ7A 1W19A 2G25A 2I99A 4HXFB 4R31A 3EGIA 1H0KA 1I1QB 5HK8A 2NP6A 4JQSA 4JEHA 3KQMA 4PPGA 1F0PA 1R50A 5C51B 1KZ1A 3O8QB 1LK5A 3VV3A 2XMZA 1CUXA 1U1EA 1Y0BA 1YIOA 5LA6F 1JU9A 4KFRA 4PN7A 1AJEA 2PA3A 5H4GA 4NH4A 2X77A 3ZHYA 3GUUA 4I36A 4DDKA 1KZHA 3H4TA 4UNNA 5DH9A 3TTTA 4AFNA 4BNWA 3CZAA 3NOOA 3IE1A 5G41A 5FWXB 3VA7A 3UJNA 1P1RA 2DVMA 2IYXA 4OBXA 3EF1A 1ADFA 4KYUA 3KCNA 4BVBA 1JDTA 2FUG6 3EAQA 2ZJ8A 3CPEA 3OSZA 1UJNA 3SZMA 1YJCA 1UKCA 1Q19A 1U0HC 2OKGA 2PEYA 3MINB 2Y6VA 2A6PA 3CFYA 4DARA 1AMOA 1CRWG 3FZEA 3FCCA 3UFBA 1JL3A 4GGMX 1EZ4A 3ZW8A 5LL6P 5BQFA 1UANA 3DXFA 3N28A 1ULAA 2X8AA 1S8FA 1I4TD 4E6PA 4PFKA 2OM2A 3QTTA 2O8EA 1Z4NA 1ECGA 1MX9A 2XNHA 5IABA 1PJZA 5JOQA 1RLJA 3M6WA 3OCWA 1A98A 2IP4A 3LCVB 3Q0IA 2JGMA 3P9RA 1YAJA 2IW1A 5AOCA 1WD7A 2H1VA 1TLFA 3BJZA 2A9VA 4OBBA 4K6GA 3G2IA 3JQBA 3TAXA 1N75A 1NFQA 3VM6A 3IKTA 3DTYA 3L1HA 3PPIA 1QFXA 4RADA 4CLXA 5B12A 4A15A 2BSQA 3TQRA 1KO4A 1O58A 1SA0A 2I4IA 2MU1A 3TG8A 2AHRA 2DB3A 1KEUA 4INAA 4KZKA 4JGIA 3Q11A 3O0TA 3OY7A 5D86A 3CZPA 1VBFA 2RG7A 3JWIA 1KDYA 2QYTA 1ZJWA 1Z6TA 2XADA 4QTZA 3SXUA 1X92A 4UBKA 1N2EA 2P5TB 3AP2A 1OIXA 1DVRA 1PK9A 3OEEA 2AKAB 3SOZA 1GAXA 2NSDA 1J0BA 1L1RA 2DWOA 4HDKB 2H18A 1QCZA 3OJ0A 3VTFA 5FO0A 3WK9A 4EUHA 1QQBA 1ZICA 3D81A 1JLLA 2AN5A 1W35A 4P7KA 2W9XA 3W2TA 5B55A 3GLGB 1LSJA 3VKGA 4Q1DA 2LIPA 1W4ZA 4CKWA 4BV2A 3ZV7A 2PRKA 4RACA 2XRMA 5EXTA 3I04A 2ZUFA 3CLUD 3ZE0B 5TMPA 2JLRA 5JVDB 4M9QA 3QY0A 4JHXA 4CYMA 2ZRNA 5B57C 3UTDA 3O9MA 2B37A 2QQFA 4BLTA 2H1FA 2Q45A 1KU0A 2OBBA 2Q07A 3T3OA 1O89A 3FFBA 1BSVA 4X6UA 4U3JB 1KSJA 2Q4BA 3WXBA 3KLBA 3ZCSA 3F6CA 3IC5A 3HKEA 3IDZA 4JYZA 5D3MB 1T2DA 1JEQB 2X5KO 5U9CA 5EIHA 5KTNA 2XQGA 3NS7A 2W2LA 2P62A 3ZNQA 2YHBA 3WQRA 5BSWA 2X5NA 4IEIA 4YMGA 3DC7A 2VYQA 4GI5A 4AICA 2A1TS 4IY1A 3PIIA 4UCQA 2WHPA 3KUKA 1MC5A 2FR8C 2J0UB 2PN1A 3GZNA 5LLTA 1I14A 1G41A 4W99A 4C4SA 3Q8KA 1D9XA 4IXDA 1LTKA 2ISQA 2XCUA 3GA5A 4LBYA 1IY9A 3EIHA 4WN9A 3AVTA 1DQSA 2V6JA 4KMRA 1TCBA 3FJYA 4GZLA 5U1PA 4P3KA 2J33A 3E7FA 3V1LA 1B93A 1H2RS 4NJMA 4GBED 2FRDA 4TRNA 4HX2A 1JQKA 5KVSA 2IA5A 3LY5A 5LJIA 3IL2A 1UDXA 3BMCA 2RGRA 5BSHA 2X7XA 3K9NA 1NR5A 4WY8A 5LXTF 4ZZ0A 1EP2B 2AOVA 3OQ1A 4Q1VA 4BN5A 4MDFA 2F43B 4OU5A 1Q22A 4H7KA 4OHXA 1QSGA 5FI0B 2C94A 4G0MA 4JQCA 1R88A 4MTCA 4REOA 1PV1A 1Q3TA 1GGFA 3L0YA 3R7FA 3H4IA 2VK2A 5DKFA 2OAQ1 2J6HA 3U4GA 1NAIA 1UFVA 3LRXA 1QHGA 1ZUIA 1G6KA 4EENA 5DI9A 1V4NA 2GZSA 3T5DA 4B34A 4CXMA 3ACBA 2G9RA 5HVNA 2AA3A 3C70A 1P31A 4X6YA 2OBFA 2ZRMA 2CHEA 3HSKA 3KOXA 4DRXA 3FCEA 2OYSA 3RIYA 5CX1A 1R0WA 1EM6A 4O8CA 3TZEA 1JR3D 5KSZA 1MFPA 1OIWA 2ZPAA 1TIPA 2FWPA 3DV2A 4U2CA 3RT9A 2P2ZA 1U3GA 3Q10A 2JJ8A 1TEXA 2ODEA 1JHXA 3BZWA 2VZ8A 5IZCC 4PCVA 1W1IA 1LQ2A 2VHTA 3LXRA 3ZLBA 1I4DD 3K0BA 4R7GA 3M82A 1Z15A 2PAFA 3QKRB 1AK9A 4LRSB 1OA0A 1T4GA 4HYEA 2MMGA 5JXJA 3S1AA 1UMCB 2BHRA 4BWYA 1I51A 5J2TF 4WACA 1EB9A 2ZJ7A 5FBKA 3IEMA 4YP7A 2X13A 1KZ7B 1AF7A 1XZEA 1XP8A 3CZ4A 1ZQ1A 1D4FA 3Q7QA 2LTAA 3V8VA 3DYIA 3ESYA 1M1YB 4CMEA 1T9DA 1YL7A 2XOKD 3BXPA 4P38A 1U7HA 4QODA 5DNDA 4ZVLA 2O8BB 1UJ2A 1XBTA 5NULA 1BTOA 3UXYA 2XKAA 2ATCA 5E7MA 2OP0A 2QZJA 3M83A 2RGWA 1QDLB 2ZBEA 3FPBA 1ECBA 3NASA 3SX0A 4L50A 2OVBA 2IIBA 2J08A 2XDWA 3OM0A 4P53A 3GQBB 5FUXA 5JCJD 1MJFA 3C2QA 1WBDA 4NEHB 5T64A 4JQZA 6PFKA 2PRZA 4P32A 2QNBA 1ZUD1 2YZGA 1VPVA 2PR2A 1V16B 3CE6A 4ALJA 4CLRA 4GZ5A 2WJYA 5JNVA 1YDHA 2RHBA 2GPAA 1GTMA 3QPWA 2UVPA 3HCWA 2XXJA 3DEYX 1DI0A 1DMRA 1GGHA 3OFND 3CUKA 1N2CE 2RHJA 2XQVA 3IDOA 4ZHQF 2IS1A 3AR4A 4DUPA 2H5IA 4FCWA 3LBFA 1YQWA 1QHSA 5J59A 5B7PA 5KJCA 2DETA 4KH0A 3TLGA 1VYHA 4EY6A 2GTPA 2J5BA 3FA2A 3MSCA 4FLFA 2MYTA 1C5KA 3DPUA 1JMVA 1Q3HA 2DPGA 2C2YA 4WZBE 3SJ7A 4TYNA 3NKVA 3ILXA 3GFQA 5DHSA 2QTVB 3DHVA 3OX1A 5F12A 3VR4A 3MTGA 5B1EA 1WRBA 4KNYA 1KRWA 4V0LA 2FFRA 4WOCA 5KOHB 4LNUA 1DC3A 4WINA 3KL2A 2DBQA 4JFRA 4G4IA 5L3QA 1T0UA 1I7NA 1PEYA 1ZNZA 3QUQA 3KM0A 2Z1MA 4WXPA 5DBGA 2D06A 1ETHA 2V7BA 5IHPA 5LKRA 2ZIGA 5GONA 1P1FA 3LRPA 2WMOB 1U28A 3EQ6A 2Z8YM 3EQ8A 4JU9A 1JGTA 2ZR7A 1G21A 4MWZA 3AL0C 1HA3A 5COAA 2TSYB 2Y76A 3U7EB 4H60A 4EOGA 1HDRA 5FRDA 2Q0QA 3Q3IA 4GPD1 4CUJA 2QRZA 2AW5A 3DNPA 4MR9A 1V1MA 3Q3JB 1K5GA 4FFBB 4S3MA 3UMYA 1E79A 1P45A 3NWOA 3COJA 3LX8A 2ORIA 1ZM3A 3OUUA 3I9NA 4KC0A 3KQTA 3TCXB 3W6PA 3CF2A 3KSAC 1P8AA 1JH8A 2BSXA 3N9IA 1U81A 1Y4ZA 1AOXA 3KZNA 3V4OA 1A9XB 1F38A 1KH3A 3QPBA 4MKHA 4CJXA 2HHHB 1GGMA 3O21A 5A5DA 2R3SA 2P6PA 1QE3A 2HN9A 2P3SA 1KKUA 3G79A 2DBZA 4ZZ2A 1N2HA 1USUA 2QRHA 1Q1BA 2H3HA 2JGNA 3D0KA 2G0TA 3HRKA 2EJBA 2TMGA 3LYLA 4D9HA 3TLBA 3JXEA 4H3SA 1DG1G 1TEHA 3RRJA 5J58A 1XMQB 2IEDA 1VHDA 5AXCA 5K9ZA 1EHYA 3IUPA 3GNLA 3GFGA 4M89A 4YDHB 2Q9CA 2EVWX 3C3AA 5AW7A 1KHTA 1QS0A 1SIBE 1XD2B 3FUUA 5KO2A 4BKUA 2IS2A 1CETA 2O8BA 4O4LB 1U04A 1ESZA 1J9ZA 3K5HA 3I09A 2OHXA 1RPAA 4UPEA 5FL3A 4JSRA 4EKEA 2ZYAA 4FJ0A 1OBHA 4Q4AB 3G9QA 3SBDA 3HSSA 4UBMA 1MW9X 2F4NA 2FEXA 1X8LA 2CJXA 3EIOA 2GLXA 4XVRA 3JR3A 1DKMA 5KVAA 3TM4A 2VT2A 3CX7A 3AHDA 3ZHRA 3QVMA 4JV5B 1EXDA 3TQIA 2ZUTA 5CB6A 2YDXA 5JD4A 3E1SA 3B1WA 5K0BA 4MIYA 1TM2A 1H6BA 3C39A 1JAHA 1JHRA 1XTPA 4QPNA 4KXYA 3HS3A 5EJFA 3NT4A 4BGUA 2GXAA 3I28A 1XXHA 4Q9NA 2Y1XA 3FH0A 2ZBRA 1ZLYA 3UMFA 1P5JA 1W0JD 3NUZA 4YP5A 3W9YA 5FR2A 3WGIA 2OTCA 4GMFA 3R3ZA 5IANA 4ZV4A 1Q7RA 3A6HA 3MWDB 3QVWA 1M6WA 4PG4A 2Z9BA 4AURA 3U1BA 4O3MA 1SHUX 1EQ2A 1N5MA 1XZAA 3K1YA 1SULA 1XCJA 1P5HA 4HRYA 4CDGA 4ZOAA 2HA3A 5A06A 3GEBA 3O2JA 3V34A 2CBZA 4NNJA 5CM2Z 3LT5A 1U0LA 4DRZA 4KXFB 1K6EA 3EOAI 3L7BA 1U02A 2C9MA 2RGBA 1X1RA 4M1OA 4X60A 4KGZA 1NUHA 4XARA 1PAUA 5H3CA 3OX4A 2RGDA 1SMKA 4BQQA 4IIEA 5H1YA 3ZLVA 4CGZA 4U2FA 1XDDA 4YV0A 4A10A 1IZYA 4L72A 1LSOA 1W0KD 2BZ0A 4ZT2A 3FZQA 4LDRA 1BA3A 3REQA 3R6WA 1XMJA 4H4CA 1JKJB 1PX0A 2EDCA 4L8FA 3BRSA 3WHIA 4HAZA 3DOIA 2HWWA 4R8KA 5L40A 1XTKA 4EHNA 4UARA 3BILA 2ODTX 4TKZA 3PRKE 2FMUA 3K53A 5BURA 2GGSA 5BMVA 1EP1B 1FNBA 2XNDA 3UBTA 1WSAA 1JQAA 3A8TA 1LB1B 1KYWA 3HACA 4S24A 4BIIA 1A7AA 3CN7A 3HJCA 4FINA 4S12A 2YFQA 3AEYA 3WYBA 4AXXA 3UT5B 2QR2A 2A8YA 2EZ9A 4QYMA 5A9RA 2WTXA 3JX9A 2QE7D 2VHXA 1NVAA 2TMYA 3IB3A 2NZ8A 3QZUA 4TVSA 1R1DA 3FIJA 2JK1A 5AVUA 5HMMA 1ZSYA 5ED0A 2AJDA 2NXCA 4EJMA 2XUIA 1SCKA 1T6YA 3D9QX 3TTWA 2M6SA 3TOCA 1OMOA 2NTVA 5LFAA 3U7HB 4WLFA 1RVV1 4EUEA 1I4OA 4TTJA 1ZX1A 4UU0A 3ELWA 1UM9B 2CVPA 4IUDS 4NENB 2EAUA 3CW8X 1B00A 3H5TA 3A32A 4IICA 4QDUA 3FCUB 3FFXA 1T1JA 3KJIA 2NXJA 4R1LA 5HE8A 1X1QA 1JHPA 1B8OA 3RYIB 5DBHX 4MGEA 2CL7X 1EDZA 3SJBA 5FNZA 3E3AA 5J3JA 4IIGA 1VJ0A 1LXCA 1P75A 1G4AE 1H2ZA 2ROQA 2RHRA 4B35A 3A9TA 5AJVB 1DIGA 1ZP6A 1GSHA 1P4GA 2W6QA 4HK4A 1M1UA 2QIPA 3CRZA 5ALLA 1C9YA 2Q49A 4ZZ1A 5BSEA 4V0ME 1GCOA 1R8XA 3VQTA 1E1MA 1L4LA 4N65A 4C21A 3C6KA 3K94A 3S40A 2J9YB 2JLVA 3A1NA 4I46A 2ATXA 3GYGA 2NU6B 1D4OA 3MLBA 5JY6A 2APJA 2PQMA 3ZU6A 3LCRA 5CDTA 4MQFA 4UAJA 4E5DA 4CM8A 5JBNA 1PEDA 5B7GA 2PL5A 4IJ5A 3RQIA 3TL2A 5I5EA 5JALA 3CPSA 2EERA 2OD9A 3FR8A 1V3TA 1EVJA 3I2FA 1SHZA 4RH3A 1WUJS 1IOWA 3IIMA 3QM1A 4KODA 1DG3A 3ABQB 4K7JA 1XOIA 3DR3A 4XDGA 5TJ9A 5BNZA 1FFDA 1PDOA