1JBEA

1.08 a structure of apo-chey reveals meta-active conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
126
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CHEY
publication title A distinct meta-active conformation in the 1.1-A resolution structure of wild-type ApoCheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 47
structure length 126
sequence length 128
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbeA00
1DP4A 3RVRA 1Z16A 3K9CA 4F12A 1RNLA 2KYRA 3LFTA 4ZJPA 3MYYA 1DCFA 4MLDA 4Z99A 3IP6A 1NXPA 2MSLA 1D1QA 5ABPA 2NT3A 3EAFA 1U04A 1W9HA 3LUKA 3HCWA 2ID9A 2YHBA 2P9HA 1EHCA 1JLKA 1XHEA 3RH0A 4G0OA 4N0PA 4P1ZA 1XHFA 4YR7A 1EAYA 4EGSA 4EYOA 4W5QA 3E61A 3O74A 1GLGA 3QLUA 4MR7B 2H3HA 4HNRA 4KK3A 4N47A 4Y9TA 5KI6A 1M2FA 1JFSA 2FMKA 2A9QA 3HDGA 4H3KB 4QYWA 1U2QA 5BQ3A 2B4AA 2IKSA 3CLKA 4OATA 3QLTA 3A3KA 4D6XA 3F6PA 1NXVA 3N0WA 4MS4A 3SAJA 2WB4A 1PEAA 4G0PA 3GT7A 2NT4A 2XDYA 3ILYA 3KHTA 2PUBA 5E3JA 2QR3A 1BDHA 2PKXA 3D8UA 4UHKA 3QX9A 3SQNA 4Z4CA 1FSPA 4YV7A 2E4YA 2YHAA 3Q15C 2PUEA 1ZDMA 4YGXB 5TQJA 1F4VA 1M5UA 4JA2A 5CNJA 1ZAYA 3T95A 4LX8A 4HYEA 4MS1A 1DBWA 5JNWA 1FFWA 2E4VA 4XARA 3TX6A 3HK2A 4HNSA 1KMIY 4LDZA 1LJUA 2HQOA 4EVRA 4W5TA 1NXSA 4YS6A 3QEMA 1A0OA 4MGEA 1YMVA 3RVOA 4Z4HA 3R0JA 3GBVA 4YRZA 5TPWA 4MAAA 1PHRA 3FGZA 3OLYA 4N76A 2FEKA 3DZDA 4B09A 3C3MA 3EODA 1UDRA 2GKGA 2PAFA 1KRXA 1ZH2A 1ZHHA 2JRLA 4UHJA 1YK1A 3GBPA 3H5OA 4GPAA 1PUXA 1Z2EA 4IGAA 3MF4A 1QP4A 3RVLA 3CKMA 4IF4A 1APBA 4OTZA 2WY2D 4O1IA 4EYQA 3I42A 1JDPA 4Q6WA 3VNAA 4JASB 1ZGGA 2M1ZA 3G85A 5KWSA 3KKEA 3CHYA 4W5NA 5CNMA 1BAPA 2HQRA 1EWKA 2IYNA 3DGEC 1YTUA 3RVPA 3H5VA 1K68A 4WUTA 2M98A 3Q41A 5IULC 3RVNA 3O75A 4O1HA 1DJMA 1LK0A 4MR8B 2HQBA 2OQRA 1LBIA 1ZH4A 4FE4A 1ZN2A 3I09A 4OBBA 1VRVA 1A2OA 3DLBA 4Z4FA 1RZRD 4F3TA 4LDAA 5I4CA 3MQ4A 4XLTA 2QXYA 1QQAA 3RVMA 2L18A 2R25B 3KJXA 5EWMB 3GA5A 2JBAB 1M5TA 2JK1A 1OXBB 3QEMB 1DC7A 3H75A 4M88A 1Z17A 3OMXA 3L49A 4GNRA 5FWXB 3SNKA 1QP0A 4KQCA 2IPLA 4KVFA 1GUBA 5KC9A 4NV3A 1D1PA 1HEYA 1FFSA 1ZGZA 3H5WA 1DCKA 1Z18A 3N6VA 4EYKA 5DTEA 2A9PA 3FMVA 3RVQA 2FLKA 4ETNA 3MIZA 2QW1A 5HSGA 4DADA 1P2FA 1E6KA 3BILA 3P9YA 4Z0NA 1SXHA 7ABPA 2B1JA 1JDNA 1NXXA 3NHZA 3D02A 4Z4IA 4KREA 2N9UA 2A9RA 2FMFA 4JB0A 3IP5A 1IIBA 3RVJA 2JVKA 2VK2A 2JB9A 3EJWA 3LKBA 1QO0A 3OLXA 1VLZA 4LE0A 4MR9B 5DGCA 1ZITA 5TPZD 4CBVA 3DLHA 3I45A 2FW0A 1USGA 5EWLB 4IMIB 5IX8A 1GCGA 5JNSA 1Z26A 3H6GA 3OM0A 1BA2A 3HS3A 4TMYA 3Q7TA 5TPZA 4RK7A 3I5AA 3M9WA 1GUDA 2ID7A 2FXIA 3A10A 3O1IC 4LE2A 5TQ0B 4Z9BA 2CWDA 3HUTA 3KSMA 2P4UA 4RXTA 3QX8A 4L85A 3OLWA 2PMCA 2GBPA 1TM2A 2JVJA 2WMYA 1AB6A 4G86A 5KQGA 2PUFA 3GRCA 2QZJA 4RK0A 2PL9A 4MRMB 4RKRA 4XXHA 4QPJC 2WJAA 1BDIA 3UUGA 4H3HB 1QMPA 4LE1A 3LUHA 3OO0A 2E4UA 2PUCA 2MYUA 3OLVA 2QSJA 2L17A 3ILHA 1QKKA 5GOTA 3RQIA 1MB3A 5ED4A 3LOPA 2AYZA 1JYEA 4MR8A 4RY8A 4RU1A 4F06A 2LIVA 4O5AA 3OQOA 4YCSA 4RSMA 5DLEA 4HNQA 3KTOA 4RK1A 3NNSA 3OO1A 1S8NA 4WWHA 4QICA 3RVKA 3LUAA 3HXMA 3KS9A 3UKJA 3KLNA 1EWVA 5EWMA 5TQ2A 1I3CA 2JBAA 1ABEA 1KGSA 3H5IA 4YO7A 4E7OA 2FVYA 1QP7A 3HEBA 4XFKA 4XAQA 4KNYA 5FWXA 3EGCA 3IPAA 2R47A 2R48A 3O2SB 3LUDA 5HM6A 5CNIA 5C5CA 3EDCA 6CHYA 4EUKA 5KQMA 3LUFA 5TE9A 1DC8A 4JOQA 3L6UA 4EVSA 3FFTA 1AB5A 3W9SA 3IPCA 3GWGA 3QELB 4WXEA 2PLNA 5FBKA 2FEPA 2TMYA 4PZ0A 5KQLA 3JS5A 3GV0A 2A9OA 1YS6A 3EQ2A 3HUUA 3KYIB 3QK7A 3OQMA 2JVIA 1Z12A 5KQPA 4G97A 2GX6A 4TLMB 2FSPA 1A04A 5D2CA 4MQFA 3SY8A 5JNUA 4MR9A 4S04A 5JNVA 4EVQA 4W5OA 1EWTA 5EWLA 1YIOA 2FMIA 3IDOA 2L2QA 3HV2A 1SXIA 1TJYA 2F8SA 1JFVA 4RY0A 1H9CA 3OMWA 5TQ0A 3CZCA 4RS3A 3F73A 5B3JC 4N0QA 2NZUG 1JL3A 2QVGA 4ETIA 5F64A 1JYFA 5EWJA 1J56A 3IP7A 3LUGA 4RWEA 1FQWA 1JH9A 1USIA 5FWYB 2X7XA 3K4HA 3MA0A 4RXUA 3Q9SA 5IUJC 4LRQA 4D74A 2FQWA 2WJWA 4MRMA 3HJFA 1P8AA 1USKA 5TQ2B 2E4ZA 1C0EA 1SRRA 1Z15A 2PUDA 5T7BA 3NNNA 2PUGA 1JX6A 4S05A 1BVHA 2FMHA 1E2BA 1URPA 3B2NA 2RDMA 3MMNA 5B3JA 5BRAA 1LJLA 2IPAB 1ZVVA 3E3MA 4JP1A 4PYRA 4XASA 2ZAYA 4MLCA 8ABPA 5HKOA 3KYJB 3FFWA 1DBPA 3HO1A 1U8TA 4RK5A 1DBQA 1K66A 3UK0A 1MAVA 3KLOA 3JPYA 4RY9A 4PE5B 2CHEA 3NHMA 4RXMA 1L5ZA 1QO0D 3OLZA 2QV0A 3Q7RA 1D2AA 1E6LA 3MM4A 5IUKC 4OLAA 4KQ9A 3QEKA 4MQFB 5GQSA 4TLLB 2E4WA 3NBMA 3LUCA 3C6QA 4NICA 1D4ZA 4RK6A 5IC5A 4EY3A 4PEVA 3H1GA 4RDCA 4ZYLA 3CNBA 1BDJA 3TMYA 4FB4A 2R4QA 4RZSA 5IEBA 5BRJA 5PNTA 5EWJB 3N75A 4IILA 1YVUA 3QELA 1XWWA 2O20A 3EULA 3HM9A 3QLUC 4Z4EA 2W42A 1LBHA 3ROFA 4F11A 1CEYA 1ISSA 4ZMRA 5HQJA 3CG4A 3BRSA 4Q7EA 1CHNA 4LZLA 1CYEA 4F8JA 3JPWA 3CFYA 3H5TA 2AYXA 3FFXA 3IP9A 1U2PA 3HSYA 5CNKA 2MSWA 4DN6A 1ABFA 2GI4A 1YK0A 3M9XA 1W25A 1MB0A 3HZHA 2OENG 1D5WA 3O2JA 2ZWMA 4DQDA 3H5LA 3CRNA 3N0XA 5JS2A 2LBPA 2LUOA 1P6QA 1JFTA 3HDVA 1NXWA 6ABPA 2HJ9A 1TLFA 1NXTA 5KC8A 2H0AA 3LMKA 5FWYA 2IPMA 3QLVC 1RXEA 3GL9A 4KZKA 3LTEA 3EQZA 2WRZA 3CTPA 1MVOA 4ZPJA 4Z9AA 1NATA 3BRQA 3G1WA 3KG2A 2CD7A 4YLEA 2I6FA 1DCMA 2VYCA 3JVDA 4IMJB 4MYRA 4OG2A 3JY6A 1MIHA 1TVMA 3GYBA 3Q7SA 4YWHA 4D6YA 2MYPA 2VUIB 3CU5A 3T6KA 3T38A 2V0NA 2QVCA 4H60A 3QLVA 1FFGA 1M2EA 3C3KA 1R8JA 3VNBA 1JF8A 2FQXA 5BR1A 4MQEB 1PNTA 3A0UA 1EFAA 2RJNA 2LP4Y 4G0QA 4G0XA 3M6MD 3O21A 1WETA 3F7NA 1NY5A 1L5YA 4Z4GA 3F6CA 4P98A 1Y1LA 4JB2A 4ETMA 1Z13A 2IPNA 1OXKB 2MYTA 3C97A 4WXMA 4G0MA 2F8TA 4ZMSA 3FDFA 4RK4A 2E4XA 2NZVG 3BREA 1F51E 3OM1A 3T8YA 1QPZA 1PEYA 1U0SY 4NQRA 3H6HA 3S99A 4MS3A 4TN5A 3H1FA 3CG0A 4KK4A 4NCAA 4QYMA 3KCNA 2HSGA 4KRFA 2FTKE 2HPHA 5JNRA 4E7PA 2PJUA 5IBQA 2VUHB 5IEJA 4WT7A 4N41A 4RKQA 3TD9A 4IRXA 5FBHA 4W5RA 2NUBA 5DKFA 2PUAA 1TMYA 1ZESA 4KFCA 4FE7A 1DG9A 1Z2DA 3A0RB 5JS1A 3DBIA 4MS4B 1YMUA 4Q6BA 4WZZA 2FKAA 1QNLA 1ZY2A 3O2QB 2LPMA 4JAVC 3TB6A 5JNTA 3URMA 4NCBA 2DRIA 9ABPA 3SM9A 5T3YA 1JBEA 3CS3A 2CHFA 3DGFC 1SXGA 2GWRA 4L4UA 5DCLA 4PICA 2IDMA 4OLBA 5C5EA 1B00A 2J48A 4G0ZA 4MR7A 2FLWA 3O1HB 1RZRA 3H1EA 4MS1B 3N0RA 1QQBA 1Z25A 5CHYA 2FQYA 1RXIA 2FN8A 3BBLA 3O1JC 2PL1A 3N53A 3OQNA 2WWVD 1NXOA 1VKRA 4KV7A 2MYNA 1DRJA 4ML3A 3HVRA 5IUNC 2RGYA 5TPWB 2PE5A 1NTRA 2JCGA 4KMRA 3RVSA 4G0YA 1ISRA 4MPTA 3TO5A 2MSKA 2Q5CA 3C3WA 3N8IA 2L19A 1SD5A 4MS3B 3SG0A 1KRWA 1T34A 3ROTA 1JHZA 1VPWA 1C4WA 1DZ3A 3LKVA 4RV5A 3CZ5A 2IOYA 3NNDA 1P6UA 1DRKA 3JVIA 2QU7A 4EYGA 3JTEA 3LUJA 4N03A 1PNRA 4MQEA 2RJOA 4KPYA 1E6MA 4YP9A 2BGGA 2FN9A 1RPJA 1JWLA 1YS7A 2FEWB 1GCAA
chains in the Genus database with same CATH superfamily
3T15A 1G291 4JVLA 2EJCA 1UK8A 2ZSAA 4AIIA 3S81A 4N12A 1BWQA 4YDRA 5EJ8A 3FDXA 5CYFA 4MLDA 2QGNA 3BKWA 3DEAA 5E4FA 1N7IA 4DKXA 4LMPA 3QVOA 1YQWA 2GCOB 1T9CA 4KACA 5D7NA 5AHWA 4UXHA 2I76A 4H15A 2ZREA 5CLQA 4IHKA 2CLHB 2YHBA 3G8BA 4K9KA 3CA8A 1M6EX 2A86A 2RAPA 4MHSA 3ZE1B 5JEEA 1CJBA 3NWJA 2FFJA 1RTTA 1JSLA 4UBKA 4DJDC 1QXSA 2QT1A 3HA7A 2FX5A 3EXEB 4RPHA 2L42A 3G6KA 3GNSA 3GLIA 1FRVA 4N47A 1R4AA 3TINA 3TRHA 2ETVA 2HIGA 3TZQA 3FOWA 3I9FA 3U9TA 4AF8A 4DBLE 2WTEA 4N8SA 4Y30A 3TDNA 2WTUA 2GPWA 3VH4A 4EMUA 1ETHA 1DVRA 1MTOA 2ZSDA 3I05A 4RMGA 4KR6A 1WD5A 4I1IA 4OFBA 3F6PA 3WB2A 4PF1A 4ZT5A 6REQB 2W4QA 4JUAA 2REBA 3TBHA 4AULA 4UCFA 4CEHA 3F5FA 1BJTA 1RZ3A 4W9NC 1IFXA 5D1NA 4JI0B 2Q0QA 3FYSA 5HFAA 1XWFA 2PMFA 3LX8A 3RAGA 4A03A 5ALVA 3SQNA 1E60A 1HNZB 3DHWC 2QJFA 4RAQA 5A5DA 5HKBA 4HI0E 1WF3A 3ICCA 1VP3A 1IVYA 4JY7A 3T1QA 5TQJA 4UPEA 2FDXA 2X0IA 2WF7A 1Z6QA 2OPHA 3IR6A 4HYEA 4CCWA 1VMAA 1KMIY 4INAA 4JC0A 4QEZA 5K1ZA 5SICE 1ILEA 1ZJ5A 7REQA 2DR2A 4DA0A 1L5WA 1CR1A 4JX8A 1YR7A 4P58A 4PBRA 2J30A 4AO7A 4Q9LA 1XPRA 1DL5A 1AGPA 2WTXA 3HKCA 2IF2A 5TPWA 1YZQA 4MAAA 1MJ5A 1FX0B 2EGHA 3FKQA 2UXCB 2Z4TA 1PO7A 5ALRA 4DBZA 3OP4A 4ZA2A 1RAFA 4R2WA 4G4GA 5DPMA 2IBSA 3ZW7A 2QM7A 3UV3A 3FBTA 3R3SA 1A9RA 3PD0A 5IAEA 3KKZA 1P39A 1SOUA 4TKUB 4U8HA 1ENZA 421PA 1GPDG 2WY2D 2RHOA 4WOPA 3A31A 1K6EA 4GSYA 3SSNA 3ENVA 5JLAA 1QWOA 5FHRA 1GIAA 2EBWA 2WA1A 2X7JA 3ZBPA 2JLXA 5JANA 1ZLYA 2B37A 4YFYA 1OREA 3A6DA 5LBIA 1T1JA 2NVUA 1LB1B 4B4KA 2NU8A 2WUWE 3EZ6A 4ON9A 3F3SA 3ZLBA 4WNYA 2QJWA 2XODA 1EDDA 2VC2B 4IGFA 3DG9A 5KVCA 1U8FO 3O26A 4AFNA 1IK4A 3FCOA 3O75A 4CDRA 3GYGA 4ABTA 4AMVA 1X7WA 4BMVA 4B33A 2HQBA 3I9V1 1H1TA 1UBJS 1XP5A 3SS9X 4H7FA 3DOJA 1AKUA 5I7AA 3OY7A 1CEEA 3AVPA 2FRDC 2B6HA 5I4CA 4GUDA 3UANA 5A03A 3LHDA 3VDXA 2AOXA 5FV4A 2N1BA 3M0EA 3DBLB 1DTWB 4N1AA 4PX9A 4FYXA 4TVSA 1QUFA 3HKDB 1TRHA 4MVCA 4HRVA 2HXSA 3P2YA 4RQUA 4GNRA 4J0QA 1HT1E 5IDVA 5LC1A 1YDWA 1Z06A 3CPSA 4KQCA 3VBCA 1XQVA 3WWPA 4OK5A 1MT0A 2EFCB 4R7TA 3WWCA 1ZM4A 4UMFA 2H2GA 4LFBB 2BGLA 4PYMA 1VA4A 2VLIA 3IPRA 1T9AA 2AIRA 3R7WB 3U80A 5A62A 1KO1A 1VKOA 2X86A 3QVWA 5ALGA 4QTYA 3SKVA 1JT2A 4O2RA 1Z5VA 2J8ZA 3X44A 4AQDA 4V3BA 3FRHA 3PDJA 5J5CA 1MG0A 2BKXA 3CTMA 1UADA 3AL3A 2JGKA 4EQZA 2W4IA 5AKLA 3GEGA 4PC2A 4U6SA 3VR3D 1TA0A 4RDIA 2A9RA 4TS1A 3WO1A 3IP5A 5JH7F 2YZGA 1A8QA 5C8YF 2WM2A 2D4HA 2J31A 2WFAA 1JA9A 1KPHA 2XIQA 1E5XA 1BCRB 5T4BA 3QXXA 1ZOIA 4EUNA 5B1IA 4TXNA 1EXNA 1JHRA 3MT7A 1JR4A 1MJFA 3PEVA 3REQB 4NHEA 2RGEA 3OU6A 1SQFA 1T35A 4I4IA 3MWDA 5MFPA 2HDOA 2I34A 1UWCA 1ZD9A 2W6PA 2XQGA 3D54D 4OMFG 2OHOA 3LG2A 3SVZA 2C7VA 3IAXA 5LQDA 3PF8A 1BMFA 4WDRA 2R8YA 1OY1A 1LLCA 1YTLA 1XMOB 2I3AA 1KJZA 1YA8A 1VIYA 2A78A 1UPUA 4LV8B 2FPLA 1EP2B 3DWEX 3PIRA 4X20A 5AKZA 2Y1DA 4GSKA 5EERA 2OXEA 1DKNA 2VJMB 1PJCA 3H19A 1I1HA 4KN9S 4UCWA 4B7AA 1NVFA 3WAJA 4MULA 2JG3A 1WUTA 1QMPA 4LE1A 3GLSA 4DIOA 3F47A 4JZYA 2V7EA 3C3AA 4KLRA 2C7OA 4QWWA 2Z83A 1TD9A 1DAFA 2A7XA 2DECA 3MIIA 4RHCA 4NDNE 5HYVA 4H59A 1FZTA 3ABQB 4C0BA 5AJUA 1USUA 4R2LA 1D0SA 4ZQBA 1GNLA 3GD5A 3SICE 1RE0A 2ROQA 3L06A 4NLLA 2JGAA 4Z0TA 1T43A 1Q92A 2R1ZA 1E4VA 1JTVA 3KKNA 3SIWA 1N7HA 3TD2A 1O6BA 1XRJA 3I39X 3PHBE 4RK1A 2ZSEA 5EESA 3A4VA 1LNQA 4TS4A 4KODA 3Q7EA 2KJQA 2PZJA 3MWYW 5TQ2A 4ZZ1A 4EM6A 4G8BA 3UJCA 4Z53A 3IT0A 3A9RA 1M2HA 1QP7A 5FBLB 3ZDDA 3EXIB 3WP1B 2D5CA 2C2GA 3TOVA 3PA6A 1AV6A 2KX7A 2XYGA 1MU0A 2YFQA 1E1QA 3I52A 3IV9A 3ND6A 1UAAA 3CNLA 1TEZA 3NVMB 1IQUA 2XNKA 3K9BA 2C57A 4HAOA 2HHLA 4F93B 2D3TA 4ASUA 3TOZA 1B74A 3CNOA 1OH8A 4RDXA 1QK3A 5A4IS 3RUPA 3NG1A 2BEVA 3BJZA 4OJMX 3E8MA 4UVEA 4B82A 4D4JA 4EJFA 2WWFA 2G7MC 3S27A 3WADA 3RK4A 5LXTB 1O97C 1RRPA 5FTKA 2BFEB 4LZAA 4OHUA 4L8GA 3H1PA 2HMUA 1FLDA 2WYVA 4BVLA 3ABOB 4UZFA 4G0WA 5JZMA 3TRDA 2FLVA 4MR9A 4NJEB 1V6SA 3GDWA 3GVHA 5BNZA 4WMLA 2HCFA 2HRQA 3U3ZA 3DOIA 5HZHA 1R8XA 3NI2A 1AXGA 2HHHB 2CNLA 2E6UX 3BT7A 3N2GB 1C8BA 4FVTA 4R1SA 4CJXA 3OZCA 2IXAA 1KVQA 2V5AA 3OQPA 4BQNA 3B1ZA 5D5QA 3F73A 2OT3B 2IGTA 3UC5A 1E5LA 4QZVA 5IAAA 1QG6A 3I53A 3TTWA 5EIWA 2B6NA 3P94A 4YAOA 1SVSA 5B53A 5C35A 3HO8A 1HGXA 3KSRA 1SG6A 3ANNA 2CK3A 2OBYA 2MMCA 1EX9A 1F3LA 3PL1A 2FPGA 2AHRA 2FEXA 5ES3A 2EJVA 1XVLA 3AI3A 3OZTA 5I9MA 3QLEA 4PPQA 4C30A 4PG7A 3WLTA 2GCEA 2IOQA 2KLHA 1WVIA 2G7ZA 2YWJA 2YY7A 2K87A 3R8XA 2HB6A 3O94A 4BYMA 3FVRA 3HR4A 2OYCA 2PA0A 2PUGA 3IMCA 1P45A 5B57C 1FFHA 3N2YA 1PZEA 4FOOA 5IXSA 2PNFA 3B2NA 4M0MA 4QQNA 3TLCA 1O9BA 2GVDC 3KB2A 5CFZA 2CN1A 1WABA 4ZOQI 2YC2C 3WNZA 2JFZA 4BLPA 4CQNA 2Y66A 2JAOA 2NACA 3F5SA 2JDIA 4FGZA 1YACA 4EB8A 1PFQA 1SK9A 2NYRA 4GICA 5J3JA 1OI3A 1Y5RA 4L6CA 4NU5A 4PYNA 4JXZA 2CHEA 2QLBA 1NBIA 4U2EA 3ZVNA 4NFSA 4RVCA 5MDHA 1ECGA 1UBFA 2J4FA 1DT3A 2NIPA 4GX1A 1LLQA 1X87A 3EXG2 1XF1A 2FFAA 2H29A 1CY0A 3MYRA 5AT1A 3K0SA 3N58A 3LFHA 5AP9A 5BQPA 4YP1A 2QN9A 3Q3IA 4NICA 4UU1A 1HC7A 5CGZA 2YN0A 1HZZC 4EMBA 3NCHA 2W8BB 2QI9C 3GFOA 1DEKA 1YRWA 3P0FA 1G64A 4TYPA 5BYAA 3IPLA 2EW8A 4RBNA 4EY7A 5JSZA 2QY9A 3HEMA 2ECKA 4DBLC 4BEJA 1SPXA 1OKKA 3WGGA 3CUKA 3W05A 1JNYA 2AJDA 1SVMA 3EULA 1M2GA 4J7XA 1Z7BA 4Q34A 2D1TA 1U1GA 2GNPA 2AZDA 4RPKA 3DOUA 4TQ9A 3IAUA 1RYFA 1WPGA 5IJ9A 2F6RA 2ZB4A 4IOJA 1N6LA 3BH0A 3SC4A 2HM7A 4QDUA 1E8DA 3WICA 5LOVA 2G5GX 1I01A 1ZIPA 4V38A 4NEQA 4GKVA 1CYEA 1BWRA 3P27A 2UUPA 2F9LA 1KDVA 3H1TA 1PG0A 5KKNB 5B2FA 3IB6A 2AN5A 2Z9BA 5IANA 3CINA 5DW3A 3QOWA 3HTXA 2WYUA 3BEOA 4RVSA 3N2KB 1YDEA 2AXQA 2E9SA 4HXYA 3I1IA 3PFCA 4NZOA 2GNAA 2OK7A 3IMGA 5ALMA 1BOOA 3CZRA 4BO5A 5CD9A 3GDHA 4DQDA 2KW5A 2R1TA 1BXZA 4U5QA 2JJQA 2EWVA 4BUZA 4AZ0A 4ZYTA 3N0XA 3RT9A 1AX9A 1P6QA 2ZWIA 2ZI4A 2ZUTA 3RBZA 1AK9A 1MORA 3VVCA 3ZVKA 1N2SA 5HCIA 4YIHA 3Q2KA 4V02A 2JI7A 4KZKA 4WESA 4ZI3A 4AZ3B 1DUIA 1TVCA 2R8ZA 2PS3A 2Q1YA 3TOCA 1P60A 1E2MA 4A0FA 3PITA 2DT5A 3ITDA 3QOXA 4DARA 4N0EA 4OYRA 4QASA 4YLEA 3CNNA 2IHKA 1QFZA 4G5YA 3V6MA 3ZCQA 3H99A 1AK1A 3HFGA 3S2SA 3D4PA 1O1YA 5FTNA 5HIAA 3LLUA 2VRCD 1J1ZA 3ORYA 5EE3A 4M1MA 4IVNA 3VJRA 4HZGA 1K2WA 1Z7GA 1W2GA 1HQKA 3NLLA 1ULAA 3TR6A 1XTSA 2HHJA 3ZWNA 5A02A 4WJLA 1QIGA 1TUEA 2FQXA 2UZ3A 1GV1A 1H66A 3JD3A 4EG5A 2VP5A 2WFLA 3KAKA 1RM5A 4JLAA 2BLLA 3WL7A 4ZCMA 1U1CA 4ZK2A 5ADHA 2Q07A 3QKRB 2HIHA 1MDFA 2BGKA 3KR9A 3F6CA 4P98A 2YHIB 3ICWA 2QUAA 1KZHA 1VG1A 2IPNA 1CDOA 4F9TA 3U0VA 3HJFA 4DR4B 5KU7A 3KHSA 1GITA 4LVUA 2F8TA 2J9XB 4I3GA 4QELA 4EGQA 1EUDB 4ID3A 3NCTA 4PZUA 1CQIB 5JT1A 4MV9A 4B3RB 3GRFA 3VSAA 3CCBA 3C5HA 3NPMA 3PQ2A 4C4SA 3LXXA 3NGLA 3PKIA 5KJCA 4HEA6 1NC1A 2HIMA 4Q82A 1RC8A 3VO2A 1YZ3A 2DHRA 2HSGA 1QUEA 3H9GA 4MI9A 4CMCA 4KRFA 3H4VA 3UPTA 5C0OE 5JNRA 3NEAA 3X0DA 5CEJA 1RWXA 2VZ8A 3C1AA 2YFKA 2IYWA 3N0VA 3PE3A 3NBFA 5DTJA 1H1LA 1M1YB 1UBEA 1XMVA 2FWRA 4LHXA 1L7EA 3AOEA 1FTSA 5BUSA 5AK6A 1DWOA 4LQ4A 2C2KA 3QQ5A 4FQ7A 4Y2TA 4XRGA 1NIPA 1GYRA 1QX3A 1NQVA 1Y8RB 4HRXA 4MS4B 4P7KA 4Y1FA 3KU4A 2RI6A 2V7QD 5L8VA 1WEKA 2PLRA 4IUDS 2UZIR 1TLTA 4H1UA 3LQ4A 5HA5A 3KK0A 5B5SA 3UHJA 3W79A 2QHXA 4D4HA 3T1TA 2JLSA 3AERA 3BS4A 5IAOA 3PPVA 1AGYA 2ZYTX 4OJNA 1KO7A 4HEHA 4YCDA 2H5JA 4X6YA 5F4BA 1S2NA 1CCWA 3V7FA 1KEEB 2H17A 1G4HA 1YJBA 2XSZA 2FAXA 2P3SA 5JRJA 1V45E 5ILOA 1RZRA 2D0PB 1XZPA 3E0QA 4HTFA 2FQYA 4CCAA 2EL9A 1SG0A 1NQUA 2I91A 3VH1A 2OL4A 3HVRA 4R3NA 3K6SA 4UZSA 3P96A 1P44A 1KK3A 5I7FA 4BV3A 4UFOA 5K45A 3SYNA 1P1CA 1V1MA 3VSBA 4BX0A 5GZ3A 4G0YA 5HP4A 2FP4A 4LGCA 2MSKA 1BS2A 2CDBA 3KU1A 1RADA 4MP8A 2VH2A 1TOAA 4TV8A 2B1RA 4MQBA 4BQPA 1XXHA 2G72A 3NETA 2WWHA 5IBRA 3GCZA 1EX6A 4ADSG 1JBQA 4K6MA 2I1QA 2PJRA 3GC6A 3DPSA 5BQ5A 3DMFA 4D79A 4UHDA 2HJWA 1R3UA 4JR1A 3F74A 3USZA 1I7PA 1RHQA 1YSCA 3WLPA 4A27A 2HKIA 3AHDA 2HRCA 1KAMA 5SV2A 4JT4A 4PG4A 2DH5A 4F12A 5FI1B 3JZFA 2IYLD 2G4CA 3GLKA 5BR8B 3RE1A 2VJDA 3AEQB 3F7TA 2LGJA 1WZIA 3D3WB 2PT6A 1Z28A 3U17A 3BN3A 1SA0A 2O8EA 1QHXA 2R8XA 3PC3A 4C1NA 4HB2A 1RVV1 3L93A 3D7SA 2CFOA 4P1ZA 1HE5A 2PUJA 4H6XA 2RKBA 2JJ1D 4NESA 1M66A 4HRAA 4LOIA 5J63A 3NVDA 5J59A 2P4EA 1N5KA 1EFVA 1JPVA 4OXYA 4TMTA 2GARA 3CVVA 3C6XA 4KXVA 1IZ9A 1XKTA 3KTFA 4V0MA 1ECJA 2C7PA 1JFFB 5KTRA 2HU2A 3N59A 2UVQA 1J7KA 1TCCA 1VGQA 1AA9A 5UKDA 2OV6A 4KAAA 2I99A 3A3KA 3HDQA 1QKJA 3SAJA 3D31A 2FOLA 4GX5A 4DC0A 2QUHA 4DG5A 4DV3B 4R9NA 2AQIA 2E89A 1FLNA 3LVBA 2ECOA 1N8KA 3KHTA 3WRYA 1XQ6A 2RGXA 1M1NA 3NBUA 3G8YA 2W2QA 4YT5A 3CBGA 3QFFA 4K6GA 1TGVA 5CTJA 4XGIA 4RKEA 4G9GA 4BMOB 4OJKA 2M6RA 3NDBB 5JEDA 2OOSA 2YHAA 2QIPA 2ZBFA 3ZIUA 2DQYA 2XZTA 5EE9A 4AO6A 4KXYA 2IYXA 4YGXB 4E14A 5AD1A 2C98A 2ZRMA 1DMSA 3GB9A 3TZKA 3CRQA 2G77B 2D5AA 4A1FA 3S1AB 3QEMA 1YE3A 2OZKA 4US0R 1FUYB 1QYDA 1SHZA 2CNBA 1E4EA 1KI8A 2Z6QA 4KGVA 1GY8A 1Q22A 3A4MA 4TV9F 1K0FA 1GJRA 1S2GA 3SCZA 3N8GA 2CDNA 2GJ8A 4JODA 5G0WA 4MPPA 1UFRA 2FEKA 3OFVA 1PCXA 4EO7A 3BK1A 3C48A 4G5GA 1GUYA 3WLEA 4H9GA 3R09A 4RFVA 3BBPA 2EF0A 1BWPA 2CXOA 2V59A 3EGXB 1ZR4A 3RF6A 1Y9ZA 5JSQA 3FMIA 1TQHA 3OEED 3LBYA 4CM3A 4IGIA 3HHEA 3WS7A 3BIOA 4OQQA 1YL5A 1JDBC 3RABA 3K5IA 5IS2A 2ODEA 3PWKA 2H2IA 1AO3A 2QZ9A 1F60A 1NV8A 5GGYA 1P2GA 3F3YA 3LCVB 2PU5A 3W9YA 5AKKA 3FHTA 2VNHA 3ZJYA 5JR3A 1O57A 2JATA 1NU6A 4JHXA 4A2WA 5KNBA 2IH2A 1I2ZA 4DPKA 2WJIA 5CYOA 1AZWA 3VR1A 2IV2X 2B2CA 1J21A 1QBKC 3JQAD 2HBRA 3JV7A 4DQXA 2UDPA 4S2UA 1GQOA 3GUUA 1ZN2A 4Z4FA 5HKKD 2Z9CA 2C94A 2IY9A 2FPMA 1SGWA 3IBYA 3VVLA 3U6BA 1I9CA 3R9XA 2ZIVB 4BO7A 1L5LA 1VL2A 2L18A 3LXMA 2DUMA 1NYLA 4HMPA 1V8ZA 4QGGA 3W78A 3PPXA 3DNMA 1U6JA 2K5UA 2CUZA 3H75A 3HL0A 3U7QA 4FBMA 4E5SA 1H0KA 1R6VA 4LHSA 4BVAA 1PJAA 2VBCA 2XQFA 3PUYA 4OBWA 2RGRA 2EZ4A 2H54A 4J1SA 1EFRD 1FFSA 1ZGZA 2HGSA 4H3SA 4XQGA 1IHPA 3HPRA 3IOMA 3AL0C 1Z18A 4HB3A 3HNPA 2HCJB 1U3CA 3RYFB 2P1ZA 4EYKA 1ZM7A 1C3EA 3THOA 2P8SA 3EH1A 4P5PA 2GPSA 3P9YA 1U3VA 1EAMA 1DLIA 2KSQA 2NV0A 2V7VA 3B1KA 3HUFA 3QKWA 4TMWA 4V0RA 5K8UA 1GRNA 3DZJA 4AN4A 5BVGA 5KZMB 4UD6A 5ESRA 1IY1A 5PGMA 4Q93A 3U0BA 3B6IA 5GADl 3OMLA 2DHQA 2O5EA 1RWMA 3RSLA 2E49A 3WNVA 4BCCA 4DM4A 2VK2A 3UBMA 4ENWA 1QZZA 3ER8A 2I8AA 4M8IA 1O0SA 4I3FA 1L3BA 3W8NA 3IUNA 3K09A 1LRLA 1BA2A 4K9QA 1TPZA 1PR9A 5JD4A 3AVWA 2A2ZA 4WZBE 3E4CA 1FJXA 2WIGA 4H16A 4PX2A 1GFWA 2A3RA 3RR2A 4D43A 2C0PA 2CWDA 2XCOA 2EEZA 2Y0DA 5JCJA 5LBUA 1BNCA 2JVJA 3I9JA 3MT9A 3OTWA 4UMDA 2CKMA 4CKBA 3X1DA 4DOMA 1T0IA 2PYZA 2IXTA 3B7GA 1H8HD 1AB6A 4M36A 5F1PA 2Z30A 3P9KA 4GL4A 2IDZA 3OSUA 4UVGA 5ALWA 3ZX4A 1CT9A 4B6JA 4DNPA 4F7DA 5IC4A 4B85A 2UYQA 2ZVPX 5DASA 4X1KB 3AW8A 1F8XA 2QNIA 1AXEA 3KB1A 5BURA 2VDWB 3JR7A 2BGNA 3TSYA 4AJKA 4PHHA 1ZK2A 4PCVA 4DLSA 5DP2A 1YU6A 5H9VA 3FLBA 1ZK3A 4HQLA 1H5NA 1U3FA 2HRZA 4X93A 3U31A 4B8ZA 1CUDA 3ESQA 5FFMA 1XZKA 2WFZA 3IXLA 1T3GA 3RYTC 2V7GA 2Z5GA 4O5AA 1TX4B 2WYHA 4E5DA 1JLLB 2ZSKA 2HN9A 2V8BA 3SSOA 4EQ6B 5KMGB 3OQOA 2XB2A 3GPDG 1XC7A 2G1UA 2O8VA 3SEFA 1ZHOA 3I1YA 1U6KA 2Y0CA 5KOHB 3KTOA 3OX1A 1O94A 4LNUA 2CZGA 3TZLA 3OT1B 3PHJA 1UJMA 4MVYA 3T9AA 2ACKA 5LIRA 3UKJA 1XQ9A 3AG5A 3FWZA 1D2EA 1PAUA 2JBAA 3N8KA 4M8SA 5EWMA 5KYUA 1OZFA 3H0KA 3G2OA 3OEHD 4F6CA 4MUIA 2Z95A 3TZCA 1BE6A 3V3TA 2ZW9A 4AO8A 2B83A 3LCRA 3QFSA 3HCRA 1GTRA 1Q16A 1NAHA 4CT4B 3HCAA 4IVQA 4LJ7A 5KYYA 2VDLB 5K3CA 4R5MA 3FLAA 4D8VA 1LY1A 3OHSX 2DUUA 4NEHB 4B3SB 3DZKA 4ALLA 2GQ0A 1KOJA 3IIIA 3LS2A 4NFYA 2XJ9A 5I47A 5KQMA 2RI0A 3VDNB 1W4CA 4IJ5A 1GSAA 1G4UR 5CHEA 3WWDA 2HLPA 4F0JA 4Z6KA 1PWYE 2QMZA 4O02B 5KTTA 3EQ2A 1CRPA 3M3PA 3QXHA 4KQ6A 3E9NA 1Q0PA 3EUEA 2DFDA 4Q4JA 4FW8A 4UUMA 5CW1A 5M29A 3OCZA 1EDBA 2P4HX 3G1TA 3PQ6A 1IXRC 5EVCA 3F2VA 2J33A 4U3JA 5ESXA 5EXXA 4NZNA 4S3MA 4ZO4A 3EVDA 1ZUIA 3LYUA 5BN3A 3IKTA 1DKPA 4RY0A 4KR3A 1NI4B 3VM6A 4HDMB 4D7AA 1UC4B 4E70A 1DS6A 1UJBA 4LSGA 5DP1A 5K3BA 2QOEA 4ETIA 3QKIA 4ALKA 1NYTA 5ETJA 1DFIA 1F2UB 1QIDA 5AVZA 4WX2B 1S0UA 3CX8A 4JITA 3RRXA 3GCDA 3JASA 4V1CI 4XEUA 2HWXA 5DH9A 3WLNA 1QTQA 4GZLA 1Z7EA 2YMQA 3DBHA 4Y6PA 3MMPA 1LX7A 3S0JA 4ESVA 1L8LA 1B14A 1QFJA 5CLIA 5AI6A 5TQ2B 1NLMA 1O6ZA 4GM1A 4OV6B 3W06A 3NHLA 3DD5A 3TI7A 1FYXA 4NZ9A 2ZXFA 4KQGA 3HGTA 3KOMA 3G5LA 3RTEA 1Q7RA 3VZBA 2COEA 2R85A 4JLBA 4CMJA 3F8SA 3SC6A 3L0CA 1EIWA 4JJZA 4LQLA 3EOAI 1TCAA 3PJFA 1QGZA 1I2CA 4JL8A 4A73A 1ZBQA 3DT8A 1NQXA 4IVPA 4RD0A 3SZOA 3UJ9A 3K73O 2OSBA 3NBKA 2HBQA 2BF4A 2BN4A 5JTUA 1AQLA 2W71A 2BGJA 2RH8A 3UK0A 3WYFA 1KHTA 1MAVA 3ZD8A 1YB7A 3D43A 5DU2A 3ED5A 4C03A 5CX1A 1BQEA 5CVJA 1CJSA 1OIXA 3ZIDA 4IZOA 4OMCA 5IN4A 1O4VA 2PD4A 1WKBA 2QV0A 3OLZA 4F8EA 1SU4A 2WWIA 3EQ8A 5F3WB 2ZI6A 3IGFA 4KQ9A 2AJLI 5DBOA 1YHYA 4TZ6A 1Z5OA 3P7MA 2RMKA 4UQOA 5FBRB 5FFFA 5SZIA 3I6MA 2WW8A 4KYIB 5CT9A 1O9GA 1OIWA 2WV9A 2YMLA 3OG9A 3ROGA 3OFND 3OZIA 1AZTA 1PTJC 5HZGA 2GN9A 1G21B 3B3QA 1RU3A 4G25A 4XSGA 1YJ8A 3EC2A 4FJ0A 1KI1A 1V11B 3HP7A 2B4RO 4KO4S 4NJMA 4TROA 5IEBA 4IDQA 2RSLA 2W6MA 2I4LA 6Q21A 3CRZA 4IW3B 1JAIA 2JLUA 3SMVA 1WDLA 3EDRA 3MNFA 1XEWY 4LYGA 1F6DA 1HSOA 1M8GA 4FCTA 4LBWA 4A2CA 2JGIA 2JIRA 3MLBA 2DTDA 4K9OA 1FIUA 1CEYA 3EH2A 4EZBA 4F1KA 1GHTA 2GH1A 5JYCA 3NH6A 1U5CA 2C7RA 1KY4A 3HGQA 4AP9A 1EHIA 1XRRA 1Q6ZA 3DFMA 4KE6A 2NAFA 5EHNA 2ICAA 1GLVA 2CWWA 3ED1A 5BT8A 2VF4X 1TVKA 3U7JA 1ZJ4A 3ROEA 1IHYA 1N0WA 3DYIA 4MYTA 2G80A 2P75A 3AINA 2DB3A 3WLOA 4UHBA 3GDOA 2Q3MA 2W2TA 3OKAA 4G23A 1D5WA 1X77A 5BVHA 2N46A 4Y0VA 2CNKA 5IAGA 5ENVA 4R1TA 4QQRA 2BM9A 1NXWA 4MHTA 1NXTA 1LDYA 3PIIA 3DOEA 4AUNA 4LDRA 1ESNA 4NOKA 2RHRA 2PZMA 3R74A 1STOA 1ECBA 2DBVO 3P0HA 3SZRA 2I54A 2NP6A 3U26A 2JPDA 2HZ7A 2YWHA 3JAKA 4ZRDA 3W1WA 1GGMA 4R1LA 3I6ZA 5EE0A 4ZCIA 1PT5A 4KWTA 2P9ZA 5EJ2A 3TAUA 1T26A 2FP3A 5HKAA 1QLHA 3HN2A 3NDPA 2OV3A 4JLMA 4XH9B 3LP6A 5E0KB 3QUBA 5B3LA 4D9JA 3INNA 1ZD2P 3RUDA 3X1MA 3VNBA 1R8JA 3QQPA 4UZEA 2V9PA 4AWXA 4G8JA 4DLWA 1LPSA 1WUKS 1XTQA 1JKMA 3D4OA 3QJYA 3PFWO 3T7AA 3OPXA 5IJ9B 1Z4OA 3KEQA 2GM4A 4I1VA 4F60A 3IIKA 1DINA 3Q98A 4X6XA 3I2FA 3VNSA 1PFUA 5DX8A 1V4NA 2ZBGA 1IMJA 1ZVQA 2N3ZA 4YUAA 1XVUA 2YYSA 1NOIA 3I04A 4CGYA 3DAHA 1ZN9A 1HORA 3GP3A 2XDQA 3OJCA 3TNYA 4F2PA 3RG2A 1RWNA 4O0LA 4TTAA 1KQNA 3OM1A 2NO9A 1QIIA 1X1CA 4IJQA 4OXXA 3T1YB 1OXUA 2XWSA 3C24A 4TL8A 4CM8B 3O4HA 5DBEX 4N3GA 3GGSA 2XCRB 4NPHA 1N34B 2Q1TA 1VI6A 1Q95A 2A1IA 3HB4X 4P84A 3IDAA 4C2TA 3KKKA 4P35A 2JAPA 4AZ0B 1C9DB 1CF2O 1DEHA 2CJWA 2EBFX 5B4TA 3PFGA 3UJAA 4D3YA 2JHGA 3ZE7A 4JJ8A 1ZSVA 4DHWA 3QEBZ 4ND4A 2DM6A 3DNPA 3DVAB 1UZUA 4P93A 2HPAA 5A7HA 1IQRA 3S8YA 1AUXA 3EW7A 3OOYA 1N1EA 4OLFA 5J4VA 1U9IA 1BRTA 2Z6VA 2GJ9A 5CMLA 4R8MA 3NM4A 3QF7A 2FJPA 2I3BA 1E89A 2KPOA 1WZEA 3M9LA 3SHWA 1DUVG 1PG2A 5JNTA 1MEEA 4OHPA 2DBZA 1EB8A 1WUYA 2DRIA 2JZNA 3ESXA 4LJLA 3NYQA 5E6SA 5AJXA 3IVRA 3LSTA 4LBYA 1WBDA 3TQIA 4JT9A 3GLGA 3W7AA 3KAQA 4PU0A 3M4XA 3U3KA 4UFNA 1Z75A 4NRDA 1ZL2A 3VYSB 2VHWA 5DN6D 4ZAWA 3SWWA 5AVJA 2PKRA 2WFLB 4BL5A 3C7CB 1Z25A 3W6UA 4XI9A 2RGBA 2ZAGA 1B6GA 4UJ3A 3IXQA 2G04A 2JFQA 4MUKA 3GEHA 2XI4A 1ZGCA 1R4MB 1GOTA 4ZICA 3QW4B 4OK6A 3TLJA 4FMPA 1WU8A 4WGGA 1U7OA 3CF4G 1K5PA 2CLLB 2QLMA 2VDQB 4LPSA 3HRIA 1B73A 1NLYA 2P35A 3T61A 4U2KA 1TAGA 4BO2A 4XYGA 1R0YA 1SD5A 4EJ2A 5LMNB 3VUEA 1PWHA 5GMOA 4I5FA 3VZPA 3TW0A 1JEQB 1G4AE 1ZA1A 4YPOA 5ICCA 2JLYA 3E18A 3OFJA 2ZIXB 5F52A 3M83A 3DB1A 1FYDA 3S3TA 2XNDA 5HQTA 2FQQA 4GBMA 2IE0A 2AR0A 3ZNPA 2ZIFA 2DBRA 4IIJF 3CUEF 3HH8A 2FEWB 8OHMA 2A9VA 3K1ZA 4X8MA 2PNJA 2AFHE 4F4JA 2PZKA 1YQDA 2QD3A 3R4VA 5L53A 2WG2A 5BY2A 3HJRA 5K9ZA 1XDDA 3EFEA 4TWAA 2X22A 3BRWA 4P54A 2HREA 2WKWA 3KT3A 5C18A 2CV1A 1EHCA 2DSNA 2I87A 2NUTA 4I1YA 1SBQA 2GOYA 2VWHA 1E3EA 1JH8A 2FHPA 3GVPA 4K9DA 3P9ZA 4EGSA 4DDWA 1OT5A 3PUVA 4W5QA 3SJZA 5IT4A 1DCTA 1RJ9A 2PVCA 4UDYX 1SCJA 3ZHXA 1YNSA 2OPBA 4CCYA 2E3JA 3TZBA 1M2FA 4RVNA 2IU0A 1PQUA 2GHIA 3TR5A 1FS4A 4F86A 5FRDA 2PSHA 3L6DA 4OATA 3QLTA 1R6DA 4M76B 3BSWA 1M8JA 3F4LA 1G38A 3N2IA 4I55F 1N6OA 4KVZA 2PSEA 1P7PA 1XYYA 5ELMA 4ZZIA 2WJPA 2P3OA 2FP4B 3G7SA 1JKJB 3PE4A 1JYSA 3BX1A 3RAPR 3UOWA 3IP1A 4UHKA 1YGPA 3STTA 4EHDA 5A9SA 4FOPA 2GERA 2O5VA 2VH5R 2JCVA 1J9EA 2DPHA 8GPBA 2VNKA 2BH9A 3BB3A 2KQUA 1M5UA 3LPCA 2FCAA 3ASUA 3BRCA 3TFWA 1U6IA 1NBMA 1FFWA 2HT1A 1Y6FA 1JA0A 4D3XA 3IULA 5E8RA 1C30A 3Q3EA 4MGYR 1QZ3A 2OWEA 1A0OA 2DFNA 3A7DA 3GLTA 2C8VA 3I4FA 3KP1A 5SZHB 5HGJA 5A4MS 1XKLA 1P2TA 2H4FA 4TRMA 4KBYA 4N9WA 3RJZA 3RAEC 2P9BA 2VJYA 1OVMA 3DZDA 1RXSA 4FCWA 1SA0B 3GY0A 4C22A 1ZH2A 1LPBB 2FUG1 5FO0A 4LDJA 1CRWG 4OGFA 3HB9A 3KYCB 3PCXA 4ICIA 4K3UA 4YRJA 3DDOA 3M3HA 4BNFA 4C87A 2UYHA 1DELA 3TJMA 1OILA 1UMBA 2DEUA 1E6CA 1N2OA 1TB4A 4O1IA 2HMYB 4KIFA 3W8RA 4EYQA 3KNZA 5KWEA 1C8LA 4NNOA 4DB2A 4DB4A 3GFTA 3OTHA 4Q7KA 1T24A 3MSXA 3QMVA 1DO8A 3FLMA 1FL9A 4IQGA 2C61A 1IVNA 1EBBA 2IYNA 4ZYYA 3FMPB 4D0RA 4QOFA 3PGVA 2G5PA 3ACCA 4YWJA 2PXHA 1HEIA 1YUMA 4RETA 3RBXA 4IO0A 3BCHA 3DBRA 4Q39A 5CFRA 2NVBA 4URHA 3P52A 1B43A 4RYLA 1NQTA 4LYAA 1MEOA 4RTNA 1EE1A 1M1NB 3D6HA 3HKEB 3A6PC 3VKGA 5LP6C 2JHAA 1QHNA 4QTTB 5AR1A 3DLBA 2PX4A 4AURA 4I19A 3RF7A 3RS5A 3NR2A 1JG3A 5EMNA 4B17A 1THZA 4XPIA 2YXLA 3VPGA 1XCPA 4AN1A 1QE5A 4OI2A 5L95A 1P9NA 3I32A 1H3NA 5CTAA 2WM3A 3HMKA 3RRYA 1FFXB 3M4YA 1W88A 2GAFA 3N8DA 1CUHA 2ZYHA 4A23A 4DLPA 3DV2A 4HUJA 1N9GA 3BGVA 3MZ0A 3QEMB 4AJOA 1E4EB 4IHJB 5LA6A 1QP0A 2WNIA 2YRFA 1E99A 3AVQA 3WK8A 1I4LD 3ETDA 2V96A 3UWMA 2X1VA 3H5WA 4C3ZA 4FDMA 4OHZA 4HT3B 1DAOA 4JS0A 1BQ4A 5EHIA 3CNEA 1CUUA 3ZGNA 3MIZA 1E6KA 4Z0NA 1E0SA 1H5UA 4B6RA 3AM1A 2EFEB 1SB9A 5HE8A 2PDAA 5BV8A 2ZRFA 3NHZA 2XOXA 3HABA 4II2A 5HRCA 4O2BA 4B31A 1LKZA 3EBLA 4J1QA 4BGVA 4NBRA 2Z57A 4MA5A 2DFTA 1EKXA 2O0HA 2FN3A 4CV2A 4G2NA 2SKCA 4HNUA 3AR2A 3Q9UA 3OTOB 5J2UF 5HK8A 1VLZA 2VK8A 5GGXA 3QMWA 4ZDWA 5DI3B 1MDBA 3RO7A 2EZUA 5L3SB 3FRJA 1C4OA 1JXMA 1K6MA 4FD2A 4UULA 3H6GA 3V3KA 5DYNA 4EATA 1EXVA 1BMFD 3EG9A 3NXKA 2Q9CA 3AETB 3KZXA 1W46A 2QDKA 3LRXA 1DXHA 4HCJA 3OOHA 4XCVA 2YFHA 4NARA 1Z6TA 3ZZUA 3B7PA 4RXTA 3W77A 1Y5IA 2B1GA 4L85A 4P5DA 5EQDA 4E03A 3V8VA 4OY3A 1TM2A 1A4XA 4L0DA 1QORA 3C5EA 4EAQA 2WMYA 4DQLA 4L4RA 5AO9A 1RPAA 1BA3A 1AM4D 3WSWA 1MUUA 2R1VB 3HYSA 3LZDA 1VTKA 3CW2A 3FCEA 1XYVA 4MX8A 2I9KA 3A1VA 4B3IA 4DR5B 3HADA 2ZQ5A 3SVTA 5DF1A 3GO4A 1QH9A 3PUWA 4K8OA 2JA1A 3DXXA 4BNMA 2VJCA 2R6CA 2XOKA 4ZD6A 1TTQB 1XVTA 2BGIA 3ACBA 3QPAA 4JT2A 1JALA 4ESEA 1E2GA 3OM9A 4A0RA 5BXQC 3U4DA 5FF9A 1X2BA 4MROA 5EZ6B 4Y9DA 3RNLA 5JS8A 3ADPA 2VK4A 1DO2A 1UR5A 1JEJA 1KJJA 1ZLXA 2IBMA 4RSMA 2R6JA 4HFNA 1M8PA 3WVNA 2VJNA 3V55A 4HNGA 3MWKA 2EWWA 1XFAA 3TZHA 1CQPA 5BNTA 1JHOA 3RVKA 1Q2UA 3LUAA 3QF4B 3FPAA 1IB0A 4ZODA 1FNCA 3TPFA 3Q40A 4TRNA 2AMYA 3RBVA 2GUWA 3OCWA 4KAXA 1T2AA 2ZBRA 5ILQA 1C3VA 4J91A 1E1QD 2WZDA 4LKOA 1ZFNA 1EBFA 3A9SA 1NR1A 2J9ZB 3P4UA 4HVCA 2QW0X 4C4TA 2AFIB 2R48A 1SUDA 2I8LA 2OAQ1 2PSSA 3OOWA 3T34A 4ASUD 3BD6A 3E22B 4FFSA 4XYMA 3CSUA 2VTBB 1MT3A 2QE6A 1EFPB 1S2IA 1DNPA 2QRZA 2QVXX 1V5WA 3DUWA 2PWAA 4WFKA 2HA5A 1FYWA 3VGJA 2A92A 4N01A 3GH3A 4PFSA 5DM1A 5HBRA 2CVZA 3AF0A 3IPCA 2HJVA 3WK7A 3R9WA 1XFDA 2WPDA 4AM8A 4OYYA 2O1SA 2Y1WA 4CKBB 2YZMA 3AP1A 3GEMA 1M34E 3RYIB 4YCLA 3K4PA 2P3QA 1E58A 4OHKA 1Z4IA 2PX3A 1OAAA 3C15C 2PEYA 4MUEA 4Z7NB 1Z12A 3UMRA 4CTMA 1PBTA 2HMVA 4C88A 1TQ4A 1E2QA 1W4AA 3OUZA 4LDPA 2WABA 2AFRA 5EIOA 1BD3A 3G9ZA 4YTEA 1RQRA 5DHRA 3DFZA 1E1NA 1KIMA 4L08A 1IOLA 3EFOA 1MW8X 1JFVA 2C77A 5KNBH 4AL4A 4AJNA 3DE7X 1JJVA 2PRZA 4HUQB 1I3KA 3MC1A 4JBXA 4TVOA 3UWOA 5ITZA 1BFKA 1V7ZA 5HTOA 2IDKA 2N0SA 1A8PA 4JELA 5EQJB 1DQYA 3HYLA 4ZVLA 7YASA 5ICFA 2OO5C 3HXTA 1JEYB 1MO5A 5BWOA 2J3QA 5AESA 1SD1A 4BRUA 5E7MA 4RCZA 3JVUA 2C07A 2VQEB 1HNWB 4PZEA 2HUPA 3IL2A 2PKQP 3A1FA 2WJWA 3LIIA 3S70A 1UEJA 4RYDA 1HYEA 3KPUA 5KYVA 4LZPA 1SXJE 3H3XA 5K6TA 4OHFA 3DO6A 3GJ6A 2C2WA 4EHIA 3R8CA 4B45A 5H5JA 1JX6A 1IBSA 2Z4SA 3K9WA 3RWOA 1G5HA 3PQDA 5JDIC 4CGZA 2RDMA 1QHYA 1Y1RA 1ZVVA 4L8VA 4J0FA 2QTNA 2JDID 4QNNA 1COZA 1JTEA 1UIMA 5HKOA 2XF8A 2QG6A 1NW5A 1OT3A 2XQJA 2ZJ2A 4ZHSA 2OORC 3FFWA 1C9YA 1FY2A 2V1UA 2Q7OE 3WK4A 3D6FA 4O4HB 5BW5A 2P7HA 4F4UA 4KQHA 4AMUA 1FMLA 3KHKA 4JCCA 3BFXA 1MMFB 3JQBA 3B85A 3CBQA 3D5EA 3NGMA 4QQFA 5LQRA 1P6XA 4YJ3A 4EK9A 1V8DA 1TZCA 2SHKA 3I5UA 4BZPA 2IP1A 3K2IA 1X3LA 3VKWA 4N8DA 2WUVA 4C89A 4M8NE 4C6HA 4DLRA 4ZYWA 1RSZA 4NCIA 5DBFA 1RKXA 3R5KA 2XKKA 4JV5B 2GBGA 1BGXT 2NZWA 3HCNA 1OKKD 3WKCA 3CNBA 5I6DA 1CJUC 1GDDA 1PR4A 2I8CA 4BX8A 5K0TA 1VFPA 2ESRA 4I8DA 1LQ2A 1LPOA 4D99A 5C4GB 2FWIA 1XPOA 2PL3A 3FPHA 1SCIA 3GLUA 3M4ZA 3N75A 5H3CA 1FMJA 2XUFA 1JP7A 1THGA 1SULA 1TK2A 4MRNA 2YYYA 2Z09A 5E3IA 4ZRMA 3RSZA 5U9CA 5HF5A 2GBIA 1S2DA 3WDMA 4ZMRA 3B13B 4P92A 5C7LO 3CJRA 4GWKA 4QDKA 4Q7EA 1W75A 3HDJA 4O2AB 4E2XA 1VSTA 3Q3JB 3PR1A 4EYSA 1KK0A 4ZHQF 5GIOE 4GM0A 1M10A 3N76A 1VKNA 2BMFA 3AUJB 3FUVA 4M55A 4YJFA 1ISGA 3MGGA 5F9FA 3QWHA 1KTIA 5E6UA 4DN6A 1CFZA 1T15A 2WMDA 1E9DA 4COKA 4ZGBA 1XN4A 3Q8WA 1JG6A 1G19A 1AGRA 1N2XA 3W8DA 3PX7A 2GBLC 4GMHA 2MTBA 3CRNA 2D4AA 4RTQA 3C3DA 4OI1A 3R5SA 3HDVA 2WTNA 3DCJA 2IEBA 3M82A 5CX1B 1RJEA 4WKBA 4KX3A 3MS2A 4MVXA 4S1OA 4LSZA 4ZTZB 1W47A 1YH3A 4DDKA 4J0GA 3NX4A 3M6FA 4IMPA 1KI4A 1NY6A 3RRBA 1TZKA 4FHFA 1YB5A 2RCYA 2PX0A 3UBTA 1E5VA 4X9XA 2V3CC 3E7FA 3LYLA 3KSAC 3V2IA 1DWQA 3MBOA 5F1OA 4LXQA 3X1JA 5JMTA 2Z1DA 2PS9A 1QH8B 4WKOA 4PZ9A 3KAPA 5F2EA 5P21A 3K32A 1KS9A 2XUJA 2VAWA 4BNYA 3T38A 3VYWA 3U7RA 4JGBA 4OQZA 2WE7A 1FFGA 3CY6A 3KHUA 2O8DA 4QJIA 3IQFA 4WK4B 3TVTA 2IBTA 2DY1A 4JJKA 4KMMA 5BW8A 5A3SA 1IHOA 4U9UA 4EPTA 2XMGA 1VBKA 2ZYWX 3E48A 5ICMA 1WQ4A 1TTHA 5LVAA 1K8YB 3OPMA 1GQRA 1C0IA 2Q6IA 2C00A 4OD0A 5IU6A 3FBWA 1A5AB 3EVBA 4LVOA 4Q4CA 1NVWQ 2MYTA 1GUAA 4D5GA 3U62A 3ZH9B 1BQ3A 1UM9B 1ZD3A 1TVKB 4M0PA 3A27A 3TDMA 2D1YA 3VH3A 1EJBA 3ZWXA 4H4DA 3D4BA 3KQOA 5BYKA 3N86A 4MNTA 4FGLA 3RTDA 4I1UA 4OB6A 2JI6A 3QVUA 4JEMA 2GM3A 2OKCA 4M0LA 4MS3A 3W2GA 1TFRA 1I1OA 3FCSB 2I03A 5BVHB 4KK4A 3P0IA 4BVHA 2I6XA 3TCKA 4PLYA 3A2MA 3QVGB 2PKEA 5FADA 3TSCA 2I2BA 3GGPA 3ONVA 3IO5A 4IHAA 3TW8A 1LF0A 3BL6A 3BTSA 1WP9A 4IIUA 3TNJA 3SBDA 1ZL0A 3AB8A 3BMNA 2BRUA 3DAYA 4PSUA 1ZAKA 3IAM1 2WUEA 2RBEA 2XMCA 2ZJAA 2MWMA 1Z73A 3PI6A 3Q6MA 3WNDA 1S02A 1IVSA 1I4EB 3E3AA 1VRWA 2JGRA 1E20A 4WZZA 2FKAA 3X3HA 1MOQA 3A6FA 4F21A 2P3LA 2XWQA 4AECA 4ZWNA 1RYMA 1MD9A 1U5BA 4BE9A 5G4KA 5J5VA 1Z5PA 4XX0A 1D6JA 2IHYA 3H7IA 3T9DA 5CBPA 5GV8A 3AZOA 2GN6A 3L8DA 4Q66C 2ZRLA 5TGDA 5AUNB 2QX8A 4HWTA 2OLJA 4E6EA 5JMWA 2JZOA 3ZX5A 2WTAA 2CJFA 4JLVA 3ZEIA 3V7WA 4CLHA 4RE6A 1G8SA 2GPNA 5DHFA 1EGQA 1H6AA 5L4SA 1SC1A 1D07A 2GN4A 3DAFA 1DEAA 3N6XA 2WD7B 2YIMA 4YMIA 3L4SO 5ALEA 3AF6A 1BS9A 1V9SA 2AMJA 5EZYB 3K1JA 5GJCA 2JNWA 2DFPA 3PDHA 1R9MA 2OSVA 1PTKA 4YRPA 1AUVA 1E3MA 2JFBA 5ALIA 3F71A 5AKJA 4CMIA 1VL8A 2JASA 4F91B 1Y34E 4O1MA 4HEJA 4FWTA 1A7UA 2GDZA 4GMGA 3RUCA 5K2OA 1O0BA 1A88A 2WZQA 3NBYC 1GNPA 4TKMA 5FFNA 1ORDA 2ZU6A 2V9ZA 3I12A 1M2OB 2VTEA 4B40A 1T1SA 4CWAA 5JAIA 4JI8B 5TMDA 3RKRA 1I14A 2V0CA 3KQWA 4RHTA 2P9YA 3SBEA 3C4VA 1AN0A 4D8WA 3R9KA 4DZRA 4YP9A 3ZDBA 5CH5A 1U4OA 3P2MA 4MDEA 1KOFA 1Z4NA 3DMRA 1PZMA 5EXTA 1CUAA 1XDSA 1XXHE 3TOSA 1OI2A 2BKEA 1MLDA 2HAEA 2OHGA 3E1GA 3K16A 3SC2A 1CRZA 1VIDA 3GRRA 4XIYA 4F6LA 1XEFA 1KP3A 1XRMA 4DZZA 4UTVA 2Z43A 4G1UC 3PHIA 4C2AA 1T9KA 4ZREA 2PO7A 4TMFA 4BB9A 4YDHB 3R20A 5IRCD 1D5CA 3SI7A 1TUBA 3LW8A 5HRAA 2P9HA 3FR8A 1JLKA 1GXSB 2VTVA 3JYHA 3GHYA 5DTQA 3RT1A 3WMRA 1VSBA 4BBPA 4E5KA 3GLGB 4J16A 1P1BA 4IJVA 4JI7B 1EUCA 1A8HA 1HM5A 2VPQA 1MTZA 5GVRA 3TXYA 2HMAA 5C46F 4I6GA 4QNRA 3KVOA 2FJ0A 3Q4GA 4A0HA 2QMHA 1XD2B 2V6JA 2A9QA 5KVVA 5CIQA 2CE2X 4NU6A 4PSCA 5BQ3A 1OXSC 3RIMA 3TWOA 1N5JA 1ZM3A 1MZVA 2FW7A 3T4UA 3M4JA 4M89A 4V0ME 1WB4A 1PEAA 5A1JA 1YHNA 4C08A 5A2QA 5I5EA 3EIQA 3GT7A 3HBLA 4QFDA 2NT4A 1A95A 5CVCA 1GTSA 1R0ZA 4OXNA 1OZ0A 2YWDA 2PBLA 4IFBA 4BVGA 4PLTA 1FSPA 1U0EA 5DYTA 4R4JA 1ENYA 2CL7X 4EW1A 3OZUA 3I8OA 3ZY5A 1OMOA 1MCZA 1QB8A 2RI1A 3AGQA 4TMKA 3U1VA 5BMVF 4ES6A 2GHTA 1EINA 2G0AA 3ESAA 5JECA 1Y3FE 3DA8A 3MCTA 2ZS7A 3VNQA 4AKGA 5KQSA 1V16B 2GO1A 1MAUA 1OLSB 3AHIA 4UCQA 4K40A 4E33A 4IEIA 4DQVA 2GCGA 3V48A 4M54A 4NYJR 4P3NA 4C2UA 4KXFB 3PTLA 4BNVA 1DHTA 2VQ6A 4QA9A 4AZSA 3WK6A 3QVLA 1E2LA 1MB2A 3BFPA 3LVRE 4M6WB 4H3VA 4JK3A 2BBSA 3D6VA 4HS9A 2HSDA 1FE8A 2OV2A 3MF4A 1G41A 3THYA 3RVLA 1XXLA 3CKMA 4TXMA 1SXJC 2VKTA 4BKMA 3LJKA 4QFMA 5J9FA 1RBYA 1GADO 1FNMA 1LSOA 2FWBA 5I7VA 5KNBD 1RZVA 4DYDA 4NF2A 3VR4A 1LI5A 1BE1A 2HQRA 1U2TA 1HDEA 1CVIA 4MI6A 3TQHA 1KAHA 2G17A 1P5FA 1I94B 3S5UA 4U7TB 3R7FA 4IINA 4PBSA 1LZLA 1M8FA 1U0GA 1Y5NA 4HDNA 3REGA 1GPLA 3I61A 2O06A 2J4DA 4LI0A 4OU4A 1LBQA 3FHJA 5BWCA 3RHFA 4G5QA 2XVAA 1XDGA 3T0FA 1G2PA 1ORTA 3A9TA 4IRMA 3WK9A 3UAVA 2XZOA 5JSUA 1N2HA 4LDAA 1NKVA 1IJFA 2UYCA 1HX7A 2IX3A 3GFRA 1MZPA 3DAPA 4PVCA 9GPBA 3U44A 3L4BA 2AA3A 1OZAA 3Q5EA 5FQNA 4WADA 4B3FX 3D5TA 4BE4A 4Z9YA 2DWCA 4YMVA 2IPOA 4EF6A 4EI8A 4OA5A 1DSSG 3WYDA 4EJ6A 5HUHA 1A96A 4BEWA 4KOEC 1B0UA 2ZIEA 1NYRA 4P2GA 4CKCA 1I5OA 3DLPX 1SURA 1D1PA 1UMDA 3CCFA 3KKPA 3S8EA 4K8RB 1DG1G 2EL7A 3AVYA 3TX2A 5C8YA 2FLKA 3V1TC 5J4KA 2PIAA 1Y82A 1SBCA 1ECPA 2D5BA 1ADYA 1DV2A 2IDJA 3QE3A 4JP2A 7ABPA 1P4AA 3A36A 1AKMA 3RKUA 3NC1C 4JYMA 1UBUS 2Y2UA 2HTFA 5DNEA 1LA2A 3QKUA 1W0JA 1DT5A 4RQTA 4WLEA 4QDXA 1A8IA 1JAZA 3WGHA 1JIUA 4HDRB 5ALNA 1GGJA 5ISMA 3JARA 3MELA 4LN1A 4E13A 2BZ1A 1LSSA 1CRQA 2W0MA 1AQIA 2WJZB 5FLYA 5T8KA 3A2NA 4BEVA 4EOGA 4DV2B 1W93A 2ORYA 1XNQB 4LVCA 5DM60 5JCJD 2JLZA 2HPZA 2V65A 2Y68A 1KY2A 1QZXA 1VZ3A 3DBRB 1DRUA 4V2IA 5BSRA 3T41A 4RAOA 4DCGA 5HUQA 5TQ0B 5AHOA 3UAOA 1QM5A 3ETLA 5B12A 4LXYA 3DM9B 5JSKA 3RU7A 4HYQA 4GFDA 1KEPA 4DY4A 1TYZA 3GUYA 3FTNA 3Q12A 4FPXA 1NQ5A 2CLSA 3Q9LA 4X7BA 1G20E 1LDNA 1LUAA 1E9SA 3PA8A 1MGOA 3OD5A 4LRWA 3VC3A 2PUFA 1ZM2A 4RK0A 4RTLA 4RKRA 2EQAA 4DJFC 1CUEA 1RP1A 2WMOB 3GN2A 3S2YA 2CLCX 1FP1D 1FU7A 2ZDQA 4V0LA 2PBZA 4I46A 3LBIA 2GGSA 1UPBA 4XR4A 1D6SA 1PW5A 2BHLA 4ENRA 1P9RA 5YASA 3LC7O 3LQKA 4O2LA 2PZEA 4F5ZA 2M6SA 1MB3A 3AF1A 1YXMA 2BFWA 3L2OB 4XTCS 3BVPA 3DWGA 4BN5A 4MR8A 4F06A 3MG9A 2FSFA 1O94D 1IQPA 3FPFA 4L9RA 4YJHA 3SZGA 2PGOA 3SVLA 2HA4A 4C7BA 1QGOA 3OTGA 4G84A 4QLAA 2ZIWB 3NIFB 3HBNA 4Q3EA 3HR8A 3A3OA 4O2BB 2W6ZA 2D7JA 5TR9A 5CEEA 3BQNB 1JKXA 1T3ZA 1G3UA 2EBHX 2H5EA 1ABEA 3QPUA 1N1GA 1RAEA 2QTRA 4V03A 1ZRHA 1IAVA 4NDZA 1N0UA 4YK7A 2OXRA 4CTKA 2C9OA 4IIGA 1HT0A 3VHXA 1FX1A 1QHHB 4C0WA 2NVOA 4EJSA 2RE8A 1V39A 2F2TA 3PIDA 1UODA 5IH3A 3ICOA 1PR6A 3NBZC 4II7A 3NASA 5EYPB 3SEZA 3U3MA 2R60A 3O4GA 4PGMA 4R1NA 4I5IA 3H0EA 5EJIA 5F5NA 5LWHA 2FG6C 3OCUA 1HG0A 4HFRA 5BN5A 4EBFA 1YB4A 4OHXA 1EVEA 1A9XA 4TMVA 1NSFA 5DOZA 4UBJA 3PXCX 2VSYA 4XDYA 5KQLA 1DJPA 3UWDA 3LHSA 3NHFA 4ENVA 3KYIB 4RLSA 4ZT7A 1ODTC 2UAGA 3H05A 4TLMB 4V0KA 1W0CA 2A59A 2C78A 4FONA 1R37A 4KO3S 4OXRA 1TTTA 1LLUA 5C4IA 3C45A 4E6PA 4B43A 5CM9C 4PS0A 2EERA 3FUXA 4GLBA 3T9CA 3WGTA 4ZCTA 3JSAA 4XDZA 2GPTA 3RGWS 4ZYUA 3T5BA 3PLRA 1OWLA 3OMWA 3E53A 5BORA 3C7AA 2JRCA 5C31A 3VISA 2C5EA 2RC6A 1BHO1 3JQ7A 1R5JA 3NUGA 3V46A 1C7JA 2J5XA 3MTQA 2X6TA 3IP7A 3LUGA 2FSUA 3EFBA 3C4JA 5CM2Z 4OGLA 4YP6A 4XSHA 5GV7A 1IXZA 3S28A 2PZBA 1RC1A 1UC5B 4O4LA 4WCDA 5K2MA 5T4EA 4P9NA 3OIUA 3UFXA 4BVFA 3QX3A 4MRMA 2ZJZA 1UK7A 1DIHA 4R2MA 4ZQCB 3ONWA 4KSBA 5JSFA 4TXJA 1E2JA 2PUDA 1C4XA 3AP2A 4FOSA 3NNNA 1LBTA 1SCBA 1EVIA 1Q1NA 1Z0IA 1XMJA 3CX3A 2VZ0A 1B8UA 1NWCA 2C4NA 4MVJE 1SKMA 4D44A 1JQ5A 3ECCA 5JNLA 2Q3CA 2XEDA 1F2TA 4HL6A 5K51A 2A33A 4BPRA 5I51A 3LRTA 2IEDA 1M2JA 1J97A 2VFAA 1XA3A 2RC5A 2YJ6A 4D82A 3RRFA 1X1BA 4JB8A 5AYVA 3KXLA 1K66A 3AH8A 3VZRA 2C3OA 3I0NA 4HV4A 3FW1A 4UNRA 2NZ8A 4OL9A 1GCIA 1OH7A 1GNVA 4GOXA 1DQPA 2CB9A 4DWJA 3LU1A 5HWSA 3B9QA 5KSOA 1A2KC 3AR9A 3E05A 4TZKA 4D6PA 3NYIA 2HJHA 1WTCA 3L77A 4C6SA 2FMXA 3BGOS 5JC8A 2ZJ3A 3G9XA 2WHPB 3EPKA 4TLLB 3UG7A 1VCHA 1VIAA 5JJIA 4I4TF 2XCSB 1AHNA 2GD1O 1GEGA 1ENOA 1NVVR 2D1RA 2OCXA 3ELUA 3KSZO 4JUFA 4E94A 3H1GA 1NG9A 2XTMA 4IY1A 3T5CA 1AG9A 1KVTA 3K0CC 1JEOA 4IIVA 2GETA 4DDTA 2DFVA 1YR2A 1XAIA 1U9JA 4ZVTA 5ARBA 2RGDA 3R8FA 1WM1A 2ZS8A 3HLTA 3JQ9A 1W52X 4FS3A 1JG4A 2BFPA 1QDLB 4UMVA 3FOEC 1WXFA 1H2XA 2FK8A 2EZ9A 2H0RA 2OK8A 2O48X 3GOHA 5AM3A 1JQJC 1R9GA 4MV3A 4G9BA 4I4LA 2HHCA 5DIZA 3JPWA 4YRCA 1W6UA 2J1LA 2ZZKA 3ONEA 2VAPA 3D6MA 2GVZC 3IP9A 1U2PA 3ESRA 3JQFA 1DIGA 4MO9A 5DHSA 3RSGA 5A4JA 3Q3CA 5ALPA 1ABFA 3B1JA 1VB5A 3G6WA 3U4QB 1HH4A 1YK0A 3K35A 4E2FA 2PKCA 2JAUA 2JFGA 3U7IA 3WRYC 3OKFA 1W85A 2WE8A 4CTNA 3AR7A 5F7JA 4JSTA 5K3AA 5EE5B 3R5FA 1HOXA 4P4SB 4CT5A 2UXDB 1KZGB 4G4SP 4L1KA 1Y7HA 3FZEA 1UDAA 4MPJA 2XBLA 2D6FA 2D8MA 1W2HA 4ER0A 2DULA 5HF9A 3IHKA 3MB5A 2IYRA 5BUCA 1TAHA 3H8SA 2SKEA 3LCMA 1Y4AE 3EQ6A 3BRQA 2XKJE 4MW0A 3G2MA 5C51B 3NTQA 4GI2A 1P3DA 1N5OX 2CD7A 2EV9A 3G5MA 3PR3A 4BMCA 1FVHA 4E1BA 3GCGA 3KWFA 1SY7A 4H7EA 1G7SA 3O3NB 4QHTA 3PSAA 1C8KA 3G7UA 1UK9A 4IPTA 4ENUA 3PLAE 1E9EA 2PTHA 4LRSB 4I5DA 2LWIA 3ZY6A 3A1TA 2EHDA 4E51A 1VE9A 1Z8FA 2BFDB 3QVMA 4MQEB 1NVAA 4OKIA 3WX0A 1JSXA 2RGUA 4ZT4A 3QXSA 2H1CA 2FPPB 4GD3Q 5TXGA 4O25A 3ASVA 3HEAA 4UHEA 4YEDA 1WETA 4LZNA 1MBZA 3RYHA 3SFTA 4XA8A 5B58C 1UFOA 3TK1A 2QAGB 5F4ZA 4PSVA 4BY9E 5F1KA 1BEUB 1O96A 2F55A 1QPBA 2VPXA 4MLPA 3AKDA 4GQBA 3Q8XB 5C8XA 2AF3C 2MSCB 2DKNA 3O0TA 1CY7A 1EGAA 4BTLA 1PUJA 1JGTA 3OQVA 2OZLA 3GGDA 2MR5A 2I33A 4ZIRB 1KU6A 4HVAA 4R1MA 1VCIA 4I0WB 1KI2A 3WSTA 2WDPA 3K9LA 3U56A 4HDSB 5LZ7A 5KX5B 1NVUQ 4MDHA 4Z8YA 4DFDA 5LU9A 4OI0A 1UDBA 4F38A 1ETUA 3MT0A 1H9AA 1TI7A 3OE4A 3LYHA 4NNPA 3WLQA 4XD7A 3NHJA 4D0SA 1U7TA 4L3VA 3DXYA 5DO9A 1ICIA 1O8BA 5M2QA 2VNJA 1QFMA 1MA3A 4U7DA 3OHMA 1NNEA 1C7FA 2FPSA 2SNIE 5GVSA 4FYJA 4ZU3A 2FU5C 2UZ0A 3EWAA 2AD1A 1RWQA 3H8WA 4N3NA 5TJHA 1P1RA 4LV5B 4TQAA 3JVVA 4JAVC 5AW0A 2Y1LA 5AICA 1XROA 5G1NA 3VTFA 5DYYA 3REOA 2HL6A 2PGDA 2CF5A 1UZAA 2VF5X 4Y6OA 4PLZA 3DGFC 3OLQA 2HSZA 3OKCA 2OZVA 4L6AA 4MWBA 3ROPA 4JKOA 1NNUA 2L69A 4KQ2A 1JVBA 3RV4A 2OR3A 3F49S 2A30A 4MR7A 5EUMA 3MXTA 5E3HA 2CHQA 1ZNQO 3YASA 3NRCA 3OPQA 1R64A 1WRBA 3D6UA 3CIFA 1H5QA 3BJEA 3AY7A 3TI9A 3FDIA 3O1JC 4I5EA 3N53A 3OQNA 1ADJA 1BU8A 3DVSX 1E3QA 2QQGA 4ISCA 4OQMA 1GAJA 1DRJA 3IAS6 4WOBA 2MINA 2F62A 3CZAA 4MB6A 4TWIA 3PXBA 1ZSYA 1LBSA 4OKSA 4Z0HO 1T2UA 3H18A 2XZPA 1TT7A 1VI2A 1ISRA 4U63A 5JO0A 3EEOA 1WZCA 3UMBA 1V48A 4MS3B 2BH2A 2BCGY 4X97A 4EG6A 3VA7A 2VDKB 2PX8A 2XNDD 2Y99A 4LS3A 4KGZA 2CYAA 1IPHA 4G1VA 1MOZA 4PLCA 1PJTA 1Q6YA 2IOYA 2XYRA 4PYLA 1O54A 5JG7A 4E5VA 3LUJA 4C4YA 3V9PA 2REXB 3GVCA 3K2QA 3WWZA 3P45A 2F3QA 4AJJA 2BGWA 2A0XA 2FN9A 2VP0A 2NU6A 4LHYA 1YS7A 3N2LA 1FXWA 2II6A 2PQMA 4HGNA 4RGVA 3EOBI 2QM0A 1DOZA 3N6RA 3WGNA 4I99A 3RVRA 4UTPA 5A4FS 3BRWD 5K5EA 1UXHA 1JHXA 2QMOA 2VS1A 4ZJPA 1AS2A 1DCFA 2AYYA 4WCFB 2V5UA 2FDCA 2V8OA 1IN7A 1ZGHA 2ZRHA 2Q49A 2XB6A 4DIFA 1JVNA 2E6KA 1UEXC 2Q8PA 3DQQA 3QWIA 3TRJA 3HCWA 5AXBA 5CLJA 1R4NB 3DCNA 3QG1A 1AZSC 4BNGA 5KHOC 4G0OA 3G1UA 1EUYA 1H23A 2GYVA 3UT5A 4BB5A 4F9FA 1SQ5A 1X9IA 2BZ0A 2OCLA 3CW8X 3G9UA 3HYTA 3P2OA 4R8LA 5IVDA 4EO4A 4R7GA 1CS0A 1C2TA 1UJNA 3AR8A 3RV3A 3CF2A 1SXQA 5IF3A 2JEZA 4RTOA 1H4QA 1OU4A 1O94C 1T8RA 4Y18A 5B1HA 3AHCA 3IEXA 4XJXA 1NQWA 4E5UA 2IP4A 3GXBA 4EFMA 4IM7A 2CV2A 3UA3A 2AJCA 4CV3A 2CL6X 4QUJA 2ZRBA 3STYA 5TC4A 1P61B 4D6XA 1DJNA 4J2TA 4A4DA 1A69A 3F0TA 2QSUA 2WNHA 3PWSA 5EHZA 5G3YA 4G0PA 3ESZA 1MO6A 2GEJA 2XDYA 1IU9A 2AX3A 3JALA 4BC1A 3FIUA 3FRIA 1IEWA 2JIQA 3QX9A 4HADA 4TT3A 5IDQA 1ATIA 1WHSA 1Y1PA 1Y4DE 1YR6A 2DU8A 3ZWWA 1NBMD 3U7FB 3Q15C 1SCUA 2VHVA 1JSZA 4TV9A 1KH1A 1YRQA 5ALLA 4B3TB 2CUKA 2XBUA 3FOZA 1XTZA 1U80A 4IG9A 4KJZA 1YA6A 2G28A 1FU8A 4QOHA 3L7YA 3PYMA 5DNAA 4XARA 1AMOA 1C1DB 3KXKA 1D2GA 1GP2A 1L5GB 4EG1A 2ZRQA 3K0EA 5J23A 2YZ7A 3FDJA 2GLXA 1WQ3A 1FNDA 4BLOA 5I9BA 4XVCA 1QVWA 5G0UA 2JFPA 3SC2B 2I6GA 1QG0A 2NP7A 3AFHA 1EQAA 3K4QA 1JUDA 4YI3A 5IM5A 1A8SA 1KO4A 1F5SA 4NAVA 4E08A 1A5SB 2VBGA 2VJOA 3KZNA 5JD6A 3EUWA 4AZVA 4E0BA 4I1PA 2AG5A 4RJJA 3MGAA 4X1YA 5L9AA 2XBMA 2I62A 4E15A 3TVYA 4U39A 4GMKA 2YXEA 1Z2EA 4W9RA 2VPYA 4R69A 3T3EA 1IBCA 2O6HA 1QP4A 3KQQA 3VKFA 2QTFA 1DC6A 3OTIA 4IF4A 1K4YA 1S1MA 3Q9NA 3OJWA 1OZGA 1KMNA 1PYGA 1SAYA 2QVBA 3A9CA 3B70A 3ZLTA 5IZCC 1AQ6A 4J0HA 2O5CA 2CNNA 5AHKA 1CRLA 1I3MA 2BFOA 1V47A 1GRCA 1E2KA 3HU2A 2VHCA 2PLAA 4JJ4A 4M83A 1CVLA 4W7HA 4YT2A 1TIKA 4FT2A 1HFWA 2Z08A 5L4NA 3WB9A 2XOEA 4JP5A 2D1QA 1NJ2A 4PGAA 5FBZA 4EHAA 3Q2OA 2QL9A 2AF4C 3GAFA 4C6TB 2I4NA 1FP4B 1RLJA 2H52A 3DVQX 1WDWB 4CLOA 1LK0A 4EMSA 4YRLA 5F77A 2ZVDA 5KAPA 3IAFA 5B1EA 4RTSA 2PSDA 4RELA 2WC1A 4RPCA 5ALUA 1BS1A 3BK2A 2O9JA 3QFRA 1X0VA 4KZPA 2EP8A 2X4GA 1A77A 2NWQA 4HB4A 4P33A 4CL3A 4V24A 1WB6A 3K9NA 1K7YA 2OGTA 4G63A 4NBSA 4E3WA 1M0SA 2QS9A 3TQTA 3I92A 2R25B 1VMKA 4O4IB 1I0LA 3RC2A 1MG5A 2P5TB 2ACWA 4CG1A 3E9DA 4LXIA 2Z9DA 1DC7A 4IEEA 4ZANA 1Z17A 3WKBA 3K5HA 3MJRA 4AXXA 2BKVA 4LHVA 5IEJA 2WAYA 1OU0A 2C92A 3DMHA 3OE5A 1DQRA 4U2CA 4D8YA 3CF0A 4ZTUB 1FCJA 4K03A 2XWBF 2O2DA 3SIXA 2PKWA 4BVEA 2Q1XA 5T4FA 4ANFA 1BU5A 3PTZA 3LM8A 5LLDA 1FTGA 1V3QE 5G1PA 1NXXA 3OJOA 2A5GA 3VDRA 1JKIA 2KHZA 5EJEA 3WO0A 2R8PA 1QF7A 1GQSA 4UNSA 4QU9A 3I04M 1VIVA 4QAJA 1W5EA 3DNFA 3I83A 4M0KA 2ATVA 1D04A 3VHLB 3P9QA 1U0HC 1NW6A 2OM2A 2UUBB 2ZM5A 4JC4A 4IDBA 3ZD9A 4BBZA 5DGCA 1ZWKA 3UMYA 4TSFA 3UZUA 3TTSA 1UBKS 1KP2A 5FUMA 1T9BA 1GN8A 4B75A 5TPZA 1EJ0A 2FPIA 1P18A 4LHZA 4TKVA 1GUDA 3ZG6A 1J22A 2LV8A 4TOIA 1K3FA 3A10A 4LE2A 2O2SA 1UXOA 1US8A 3IPYA 4X61A 2GASA 4GBED 4OXIA 4KGDA 1OWNA 3I58A 4GUAA 3WHLA 5DNYB 1FTWA 3GZJA 1R1DA 1D1SA 4B3HA 4UVIA 4BV8A 3H2GA 5DBIA 5KQGA 1NSTA 2QZJA 1SIBE 3BXZA 1KYQA 4MYCA 3CNQS 1Q91A 3L4JA 2XOKD 4O8ZA 4J75A 4KGXA 3VO9A 2G8LA 2WF8A 3FYUA 3LY8A 4IJWA 1U8ZA 2WAAA 1JR6A 3LUHA 1GFSA 4RJIA 3RRJA 1E3SA 4DVJA 3EW9A 3CQ9A 3C3JA 5GOTA 3WKDA 2ZT6A 3EA5A 3QENA 1X7DA 4WOCA 4EFNA 5LOVF 4D2IA 3NHAA 2HA3A 4DGQA 2R00A 3GLHA 3BMQB 1VBMA 1YI1A 3KPJA 4NIMA 3VU9B 4BCDA 3WXMA 3SP1A 4AWBA 1U0TA 2W7TA 3IOYA 1RDFA 2JIBA 3QLJA 1Q50A 4YCSA 1S3GA 3VTKA 4UBLA 4KL8S 1X9GA 2P9GA 2AN1A 1NZDA 1O0CA 3D0OA 4REQB 5HF8A 4TTSA 1DRVA 3GIDA 1ZIOA 1KQ3A 2VDVE 3HVHA 4UOEA 1UK6A 3FAKA 4NXNB 2GAAA 3CXRA 3GQBA 1MJGM 3NHRA 1VYTA 1ISPA 1F0YA 1TC1A 2ZWPA 3DTTA 4HLUC 3RC1A 4LX0A 1C4KA 3A6HA 4MEBA 4D4LA 4MAMA 4E4YA 1AQNA 3HEBA 1W87A 4KH1A 3MWEB 1QYCA 4BQOA 221PA 4LZJA 2EGGA 2D54A 2FF5A 3LP8A 2ZM6B 3JQ6A 1DFGA 3ZV3A 5A4DA 5A05A 3MTBA 1N6NA 3ANSA 3PU6A 3VBEA 3K2EA 4A6DA 3AI1A 2GK4A 2WPDD 4G6ZA 4P82A 4PS1A 5A5VA 1DQSA 3NAMA 2O50A 3WIDA 3QA3E 4ZVPA 3MJSA 4WVFA 3INTA 5NULA 2YWGA 3CRMA 3ZQKA 2EKDA 1YASA 2HIAA 2PSJA 1II8B 2R4UA 1WX1A 4INJA 2VCYA 2VLBA 3FXAA 4DNQA 3VZSA 4PYKA 3BXFA 4N18A 5IDXA 1S3FA 3AKCA 4L2IB 3S29A 3SSMA 3HUUA 4DQUA 4CM6A 4LJ9A 5KYTA 2OCBA 2L82A 4HAZA 5ALJA 1E3LA 3I72A 3GEBA 3VJMA 4OKNA 3IBSA 4OP1A 1KZ4A 4Q47A 3E5HA 2AXNA 3IT2A 4MUJA 1KMHA 2DH6A 4NX2A 5EP3A 5D85A 4B71A 1PF7E 1YIOA 2QZS<