1JBEA

1.08 a structure of apo-chey reveals meta-active conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
126
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A distinct meta-active conformation in the 1.1-A resolution structure of wild-type ApoCheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CHEY
total genus 47
structure length 126
sequence length 128
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbeA00
3OQNA 4ML3A 2VYCA 4N76A 4YS6A 4RU1A 3Q7RA 4IILA 3MQ4A 2F8SA 3LTEA 2FEPA 1LJUA 1P8AA 1U2QA 3KTOA 3NNNA 1NXTA 5PNTA 4P1ZA 4W5QA 4W5NA 4MYRA 4FB4A 2KYRA 1A2OA 3A10A 3RVPA 4MS1B 5GQSA 1H9CA 5TPWB 5JNRA 4MR9B 2FMKA 3HJFA 4MR9A 4EVQA 4GNRA 2PE5A 4EYOA 2FMIA 3N0WA 2E4YA 4Q6WA 1GCGA 4Q7EA 2QZJA 1NXVA 2P9HA 1VKRA 4LE0A 4DN6A 3SG0A 3EAFA 1L5YA 1Z26A 3BREA 5TPZA 3GRCA 2QU7A 2PUDA 3H5OA 4N03A 4P98A 5CNJA 1BVHA 1ZESA 3UUGA 4RK4A 4L85A 4Z4GA 5EWJB 1P6UA 4S05A 4KK3A 1HEYA 3RQIA 2HQRA 5KI6A 3LUHA 5TQ0A 2WB4A 5FBHA 3KCNA 3M9XA 5TQ0B 3G85A 3T95A 3FFWA 4KPYA 3JVIA 3O1HB 2B4AA 2A9PA 1ZH4A 4DADA 3DGEC 3K4HA 3LFTA 4RV5A 1TLFA 1URPA 3DBIA 2H3HA 1QPZA 1U2PA 4IMIB 4N47A 1M2FA 3TD9A 1K68A 1USKA 2ZWMA 2IPNA 3B2NA 3JTEA 3QELB 4G0OA 1W25A 4MLCA 3I09A 4O5AA 4WXEA 2PUEA 1M5TA 4G0ZA 5TQ2B 1JBEA 1MVOA 3FGZA 4RK5A 1LJLA 5GOTA 2FW0A 5HQJA 1YMUA 3OO0A 4TN5A 3LKVA 3RVJA 4XASA 2I6FA 3HDVA 3MMNA 4WXMA 4RWEA 3ROTA 3RVRA 3QEKA 3T38A 2PUCA 5FWYB 2JRLA 2JK1A 4RK1A 4LE1A 5FWYA 3RVOA 3DLHA 2IPMA 1NATA 3KJXA 1F51E 3LOPA 3EGCA 4Z9BA 1DJMA 5JNUA 1P6QA 1ABEA 2IKSA 3HDGA 2ID9A 1QQBA 1ZH2A 2JCGA 3HK2A 1DBWA 2LUOA 3BRSA 4JA2A 4UHKA 5TPZD 2FQXA 5IEBA 1FFGA 3UK0A 3N0XA 3ILHA 2TMYA 3H6HA 5HM6A 3IP7A 3Q9SA 1SRRA 2FN8A 1NY5A 5DTEA 4ZPJA 4RKRA 2V0NA 3OMWA 3LUKA 2HQBA 4RXTA 1VPWA 2NZUG 3HZHA 8ABPA 2FQYA 4KQ9A 3I5AA 1TMYA 1DCMA 4N0PA 3RVLA 5E3JA 1EWVA 1R8JA 4MRMB 5F64A 5KC8A 4NCAA 2AYZA 1DCKA 4MQEB 3HEBA 1YMVA 2IPAB 4MLDA 4Z4HA 5BR1A 1GUBA 2E4ZA 2IOYA 3D02A 1UDRA 3A3KA 3NNDA 4M88A 3KLOA 3TX6A 3ILYA 3T8YA 4OLBA 4ETMA 4MQFB 5C5CA 5IEJA 4G0PA 3C3KA 3OMXA 1DCFA 3BILA 3O21A 3TB6A 4MS3A 1K66A 3QLUA 5EWMA 2E4VA 4W5OA 3H75A 3KSMA 4H3HB 2ZAYA 3OLWA 4L4UA 3H5WA 1RZRA 1SD5A 3MM4A 1PNRA 2CWDA 3QX8A 2L17A 5KQGA 5DLEA 2QVGA 1JYEA 2JVIA 2CHFA 3O1IC 5TE9A 1E6LA 5IUKC 1ZN2A 4KRFA 1TVMA 2N9UA 2PUBA 2PL9A 2JVJA 3EQZA 2WY2D 3O1JC 4UHJA 4MS4A 3IP6A 1JYFA 5TQJA 1Z17A 3GYBA 3JY6A 3M6MD 3TMYA 1JHZA 2W42A 2GWRA 5IBQA 4PYRA 3H1FA 4LDZA 1EFAA 2J48A 2FVYA 1ISSA 4XXHA 1QMPA 2HSGA 2HPHA 1ISRA 4RXMA 2PAFA 3NHMA 4HNRA 4KNYA 1KGSA 2NT4A 3SM9A 4EYKA 5IUNC 3R0JA 3F7NA 1YIOA 2A9RA 2Q5CA 3E3MA 3DGFC 3ROFA 4EGSA 2MSKA 4S04A 1A0OA 1SXHA 2FSPA 1DP4A 1DBQA 2GX6A 2LBPA 1JLKA 4Z4FA 4OLAA 1W9HA 4CBVA 3SAJA 1QO0A 2ID7A 3GL9A 1Z16A 4YV7A 5IULC 3UKJA 3NBMA 5BQ3A 1FQWA 2L18A 2NT3A 3O2JA 5ED4A 2MYNA 2A9QA 3OLZA 4HYEA 4D6XA 1KRXA 1NXWA 5D2CA 1D4ZA 1VLZA 3N75A 4Z9AA 4TMYA 1RNLA 1ZVVA 4RK0A 5C5EA 3JVDA 3N8IA 5JNVA 1ZY2A 5FBKA 3KG2A 4YRZA 1EAYA 1J56A 1QQAA 4B09A 1BDJA 2PJUA 1I3CA 1JDPA 2XDYA 7ABPA 1LBIA 2AYXA 3HS3A 3LUJA 1ZITA 4IRXA 4OTZA 2E4WA 4Q6BA 5IC5A 1T34A 4W5TA 2E4XA 1YTUA 4H3KB 2PUGA 5EWLB 3P9YA 5FWXB 4Z99A 1E6KA 4G0MA 1EHCA 3QLTA 1LK0A 2WJAA 3OLVA 2RJNA 3CU5A 3L49A 4RSMA 2NZVG 1JH9A 3H5LA 3H5IA 4OG2A 4IGAA 3URMA 3F73A 2IDMA 1D5WA 6ABPA 3H6GA 3KHTA 4YGXB 3H1EA 1BDIA 1CYEA 2JBAB 4E7OA 5B3JC 3LUDA 3HUUA 4F12A 1GUDA 1AB6A 3LKBA 3BRQA 1PUXA 4KREA 4HNQA 3KKEA 1JWLA 1MB3A 3RH0A 2L19A 2PUAA 3QLVA 1EWKA 3CG0A 4G0QA 4MS1A 4O1IA 4ETIA 3NNSA 1USIA 5TPWA 2JVKA 4G0XA 1JFSA 2FLKA 3FFTA 5CNIA 5DKFA 4NV3A 1ZGGA 2FMHA 3EJWA 3N6VA 4HNSA 1EWTA 3C3MA 5JNSA 2OQRA 4NCBA 1KRWA 2FTKE 1M2EA 5IUJC 4MRMA 4JB0A 3OQOA 1P2FA 3DLBA 1CEYA 1NTRA 3EQ2A 3KS9A 4MQEA 4PEVA 3IPCA 3H5TA 4FE7A 4F06A 4Z4EA 3HCWA 1BA2A 2DRIA 3GA5A 3KLNA 5KQLA 1B00A 3A0RB 2LP4Y 2RDMA 4QPJC 3I42A 4ETNA 2PUFA 1Z12A 1JFTA 1GLGA 3S99A 4MPTA 4NICA 3Q7SA 4YP9A 4JP1A 1TM2A 3GBPA 3JPYA 1U0SY 3KYJB 3EULA 3CZCA 2FKAA 1JL3A 3MF4A 3HUTA 1D1PA 2QV0A 4IF4A 5I4CA 4PZ0A 3EDCA 1MIHA 3CLKA 1IIBA 1D2AA 1DC7A 1PNTA 4WWHA 5CNKA 4KV7A 1CHNA 2FLWA 1DC8A 2LIVA 3O2SB 4G97A 2M98A 1U04A 5B3JA 1QP0A 4WZZA 1APBA 4G86A 5JS1A 3TO5A 5KC9A 2CHEA 4XFKA 1PEAA 3KYIB 4RKQA 4MR7B 3C6QA 3GV0A 5TQ2A 1NXXA 2MYPA 4KQCA 4EYGA 2QXYA 4KMRA 4EUKA 3O2QB 4YLEA 2MSLA 3M9WA 4OBBA 4D74A 2HJ9A 3IP5A 3LUAA 5DCLA 2YHAA 4PE5B 2BGGA 4EY3A 4G0YA 1Z13A 4LRQA 5BRAA 4RY9A 1USGA 3MYYA 5DGCA 4Y9TA 4ZMRA 2MYUA 1DZ3A 3OLYA 4TLMB 5CNMA 4QICA 4RXUA 4OATA 4RZSA 3MA0A 3QEMB 1RPJA 4KK4A 1S8NA 3MIZA 3CFYA 4JB2A 3VNBA 3SY8A 2GI4A 4WT7A 3SNKA 2NUBA 3F6PA 2WRZA 3CNBA 1YVUA 3O75A 4XARA 3GBVA 1RXEA 1A04A 1OXKB 4ZMSA 6CHYA 3FMVA 1QNLA 3E61A 2B1JA 3LMKA 3Q7TA 3QX9A 3GWGA 4MR8B 2L2QA 4RY8A 3T6KA 3OM1A 1SXGA 2FQWA 1GCAA 2IPLA 2YHBA 4Z4IA 2WJWA 4Z4CA 1NXOA 4ZJPA 2IYNA 1WETA 1XWWA 1RZRD 1E6MA 4YWHA 2CD7A 1SXIA 3HV2A 1YK0A 3OLXA 1NXPA 2R47A 1QO0D 2H0AA 3H5VA 1FFWA 3CG4A 4F3TA 4JASB 3IPAA 3EODA 4YCSA 1AB5A 1MB0A 3LUCA 2FMFA 1VRVA 3L6UA 1YS7A 5FWXA 1E2BA 2LPMA 2O20A 5EWJA 5CHYA 2E4UA 4JOQA 1ZDMA 5IX8A 1PHRA 2R48A 3SQNA 2FEKA 4MQFA 3HO1A 2OENG 3W9SA 2R4QA 4FE4A 3GT7A 1FFSA 3A0UA 5EWMB 4MS3B 3C97A 3QLUC 3QLVC 4N0QA 4W5RA 4H60A 4WUTA 4YR7A 1JX6A 2P4UA 1F4VA 2F8TA 4RK7A 2JBAA 2MSWA 1MAVA 4KZKA 3RVSA 2VUHB 1DRJA 1JDNA 3RVKA 1DG9A 3HM9A 4MR7A 5BRJA 1L5ZA 2FEWB 4MS4B 3CRNA 3QK7A 4KFCA 3C3WA 3OO1A 2WWVD 3H1GA 3VNAA 3LUGA 2GKGA 4F8JA 1RXIA 4EVRA 1ZGZA 3OM0A 5KWSA 1DRKA 5JS2A 5ABPA 4RK6A 1Z25A 1QP4A 2WMYA 1FSPA 4IMJB 3CTPA 2FXIA 2QVCA 1ABFA 2MYTA 4MGEA 1QKKA 1XHFA 3CZ5A 4D6YA 1NXSA 2FN9A 4DQDA 4QYMA 1QP7A 5JNTA 4LDAA 3Q41A 2RJOA 4E7PA 1YK1A 2M1ZA 5T7BA 1Z15A 2QSJA 3RVMA 1Z2DA 4ZYLA 1XHEA 3D8UA 3FFXA 2JB9A 3JS5A 3O74A 2QR3A 3G1WA 3K9CA 2VUIB 5HSGA 4PICA 3RVQA 5T3YA 1D1QA 4XAQA 4N41A 2A9OA 4LX8A 5KQPA 2GBPA 1C4WA 3FDFA 4RDCA 2PKXA 4JAVC 4MR8A 4LZLA 4EVSA 4RY0A 3BBLA 1ZAYA 2PMCA 2PL1A 1TJYA 9ABPA 1JFVA 3N0RA 1ZHHA 3Q15C 4KVFA 1U8TA 1PEYA 4EYQA 1BAPA 3N53A 3DZDA 1JF8A 1Y1LA 4GPAA 3QELA 3RVNA 5HKOA 5KQMA 3LUFA 1C0EA 4Z0NA 1Z2EA 2R25B 1YS6A 3CKMA 1M5UA 3HSYA 1LBHA 3NHZA 3OQMA 1DBPA 1KMIY 4NQRA 5EWLA 4YO7A 3JPWA 1BDHA 1OXBB 3F6CA 4QYWA 2HQOA 4F11A 3IDOA 3I45A 2X7XA 2RGYA 4O1HA 3HXMA 2PLNA 1Z18A 2VK2A 5JNWA 3CHYA 4TLLB 4XLTA 2QW1A 3IP9A 4MAAA 4RS3A 3HVRA 4LE2A 3CS3A 3QEMA
chains in the Genus database with same CATH superfamily
3JALA 1EM8B 1JKMA 1T3LA 2GRAA 1TVEA 3Q0TA 5EJEA 1XFDA 1L7MA 2OP1A 2V97A 3KU1A 2Q29A 4UM7A 1QG2A 4L4SA 4NG5A 5BYBA 1D9XA 1GRNA 1NBMD 5IC4A 3BOSA 1B7GO 3VHXB 4ZJYA 3LCRA 2GGSA 4CMBA 1EA5A 2B8JA 1XTJA 4IG4A 4OP3A 4FDVA 3V32A 4MS1B 2ZI9A 1Z5GA 5TPWB 4MR9B 3UVEA 4B2LA 4F4CA 2COEA 3IEMA 5KYNA 1CUZA 1E69A 1WXHA 2VDWB 3EASA 1BGWA 1RR6A 3O0DA 5ALSA 2OAEA 4XKJA 1WV1A 3LTNC 3DAFA 4EPVA 221PA 1RQRA 3MJ4A 4Q7EA 3WTCA 5P21A 3SE7A 2P9HA 3KE8A 1VJDA 2GASA 4DN6A 13PKA 3GEPA 1XOIA 1Z26A 3QI2A 3VM6A 3TLGA 4RHTA 3UMGA 1EZZA 1R64A 1GTMA 3QKUA 2EKBA 3VPCA 4FDTA 1XZLA 1ZESA 1NMQA 3M81A 1L4NA 1OLOA 2NADA 1XNRB 1Y8QA 2QMEA 2EGHA 3LI2A 4KK3A 1G8JA 3FLMA 4H7DA 4B73A 4M0KA 2C58A 3DV9A 3HACA 2WWYA 1BXZA 1CUEA 2G70A 3D0RA 3R3ZA 2B4AA 2CK3A 2CLLB 2QY6A 4LRXA 3MCTA 4WADA 5ALXA 1CRQA 4UM8B 3WADA 4E51A 3DGEC 1PX0A 4JKOA 1LS1A 2E55A 3E3AA 3E7XA 1G9TA 4HWSA 3L1HA 3KWJA 4ENQA 4Z4QA 2H3HA 2PTGA 3SYMA 5FP0A 4H0FA 3R7SA 1GYPA 1PR2A 3T0IA 3TQOA 4YV0A 3K0SA 3R0XA 5DTRA 1K68A 4XW2A 1TTHA 2AEFA 3BXXA 1I30A 4GP9A 2ZATA 5JD4A 3E27A 6AT1A 4JJ7A 3MCUA 3OTWA 3ZY2A 3C1TA 1MVOA 2G08A 1P1CA 4DGSA 4V0MA 1TADA 3TDMA 1NVFA 3OO0A 6Q21A 1RXVA 2SICE 4E46A 3PFGA 2PMEA 2BFAA 2PMFA 3DWIA 3U3RA 4EJ6A 1H5NA 4GT1A 1PJRA 4FCVA 4QT4A 5JFOA 1NRWA 2EL9A 3LPAA 1PQYA 1TAHA 5FTNA 3VU1A 3DKKA 4DT1A 1JR4A 1OOEA 1Z29A 4F4IA 4M36A 4UBOA 3K35A 3QH4A 1PDWA 2G1PA 3O8RA 3S8YA 3EGWA 3R8XA 3K4PA 4BGVA 4D8UA 4G0VA 2ZRNA 2EZ9A 4NRDA 2B1RA 1KI6A 1FFGA 1GTZA 1ZMRA 1FX1A 5LBTA 1YZLA 4RO0A 1TEZA 2CD9A 2IODA 1M2VA 4GM0A 4IJ6A 4XDZA 5FNVA 3WDKA 2QL6A 1H8EA 4A6PA 3PGVA 4DCNA 4IDFA 1PI3A 1ZGBA 3JQ8B 2PV0A 5B58T 1UMDA 1XT6A 1HFWA 1RYFA 2CLEB 3C45A 4EG3A 3LQ2A 5HRAA 3UMMA 2VZ0A 3KCQA 2FSGA 5E6SA 2WAXA 4FOOA 3Q7IA 4HDKB 4OYYA 3HGMA 4PW0A 2Q8PA 2X9GA 3ZDXB 4C4XA 4CF4A 1W5EA 4YT8A 4PG7A 5CDFE 4N48A 1JTVA 4WASA 4DJDC 1KAQA 1ZA1A 1CJSA 2PWPA 2WSSD 4JX9A 2ZSFA 4NE9A 4OJNA 1XD2A 3T5CA 2C4UA 3F7OA 4IKEA 3RPEA 4FCTA 3BWEA 4XVUA 2JD0A 3O4RA 1XEFA 3DA8A 2P6MA 3ASUA 3ZV4A 3UPTA 2PXHA 4HX2A 3ZWKA 2EJWA 1TUGA 5DGDA 2GBLC 2GN1A 1WZUA 3KVYA 1YDEA 3FN4A 2XB8A 2LTAA 1TA4A 1YR7A 2FOLA 2W00A 1RQ7A 4S1TA 3U3OA 2BW0A 3N76A 3N87A 2ZUUA 2BGNA 4Q9DA 3G0HA 4QBFA 5CB4A 1YQWA 4F86A 1C80A 2XUFA 2DLDA 3JQ7A 1X7YA 5AVOA 1VZ3A 1O87A 5C5CA 1ES9A 1MA0A 3GJ8A 2Q7DA 2VHQA 4HSGA 2R00C 1ETUA 2GCOB 4TKUA 1PX2A 2D13A 2QW8A 5EPEA 1C50A 3KV3O 1EG2A 1JLLA 2XUPA 3OJ0A 3K0BA 2UUOA 4NOKA 1Q3HA 3INNA 3BRWA 3F71A 3SIRA 5ADHA 2GEFA 5DSXA 2I4LA 2JVIA 3FCOA 3GLSA 1M6HA 5A62A 1H6AA 1E6LA 2FGJA 4UCWA 4ZHQF 4MUGA 1ULHA 2N9UA 1H3FA 5DEIA 4YUYA 4OX9B 4Q7JB 5FYDA 4XM1A 4BXOB 3V1KA 3IP6A 4LK2A 4X1IA 1QR6A 1V3QE 1JHYA 3NHSA 4MYSA 4RELA 2A4KA 4Q4DA 3SBDA 2JLZA 2PSDA 2MSNA 4I5DA 2YFYA 4WKBA 1U11A 1WM1A 4MVJG 3GF4A 1V9SA 3MJEA 3WKAA 4RXMA 3HV0A 4RZ2A 2ZQYA 3SM9A 2GPYA 1H2BA 2AT1A 4CV2A 5BSGA 2C7QA 3UT0A 3SXUA 2OFFA 1QFSA 2ZYWX 3DE0X 2MSKA 3OFJA 4ZQCB 3RAFC 3PX7A 2O8EB 2YJTD 5EP2A 2ZCUA 1QE5A 5FB3A 1DCTA 4WZBE 2OO3A 1PP4A 3I01A 4LRSB 4NCXA 4Q7MB 1L5NA 4B81A 4CBVA 4BNLA 5C8XA 5JHHB 4KR2A 4LWQA 4JR2A 5EHXA 4F5YA 1GARA 1VE7A 2J9RA 4I9UA 2FP4B 1JSCA 1XO1A 1MEEA 4K05A 5AOAA 3TSAA 3BGDA 4ES6A 2H9IA 4ZO6A 3GGDA 1ISGA 2JJ8A 1ZNWA 1QU3A 3AERB 3CF2A 3KUDA 2W83A 4RZQA 4YRLA 1U98A 4MW5A 3NHKA 3QY0A 1W35A 4KXUA 3GLVA 5FLEX 1PBTA 4Q93A 3EXFA 4Y6OA 1KMHB 2A33A 2NVUA 3B1YA 2C31A 2O8CB 2NSHA 5JG7A 1SK9A 2XUAA 4HZUA 2JEOA 1TF5A 3H11A 2FDXA 4BBPA 1Z7EA 5JAQA 3FCYA 4LF6B 1OGYA 1F1BA 1GR0A 1UBRS 1QCZA 3F6RA 4XWGA 4DYHA 5IT5A 2IX9A 3KB2A 4QHTA 1MEJA 1XTUA 1FS5A 1XWFA 2BONA 3OJXA 3RVJA 4ZYWA 1T0BA 2OORA 5HA5A 2ISSD 3ZVLA 5A5DA 3DLCA 3KVVA 1XQ6A 2YRFA 1RAHA 2NUTB 3IURA 3WQBA 1GZDA 4TZ6A 2OZVA 1KEKA 1ZS9A 2P65A 1SKMA 1E1DA 2FWBA 4H18A 3OLVA 4QQRA 2ZUDA 3C8HA 1VI6A 1QE3A 1COZA 2PX8A 2J46A 5AI0A 2WWIA 3ZE0B 2YWHA 2IU0A 4HXGA 3IDSA 4BMCA 3HYTA 3WOHA 5KQRA 4CEJA 4N0DA 2LE0A 4TYQA 4YGXB 5TQVA 4PX9A 3RNLA 1NQTA 2ZYAA 1B0AA 1TJ3A 2J3JA 3HDHA 2GAAA 3EPRA 3IBFA 1KMMA 1XR3A 4BNTA 4B5KA 1MTOA 2SECE 4BUCA 3UG7A 4DCUA 2YVKA 2JH8A 1QFJA 4D3SA 4DCTA 5B7PA 4W7HA 4DA8A 4D26A 4IF6A 1KZ9A 2G40A 1Z06A 3PUXA 4V0LA 2PUAA 3U3KA 3CG0A 4G0QA 3TE6A 5BV2P 1YZQA 4LAFA 5AKLA 5I8PA 5JAUA 5FAKA 5TPWA 5CFPA 4ESVA 3KZMA 3AEXA 4YRSA 2YX1A 5G4LA 2FMHA 2HWYA 3EZFA 1EWTA 1MBZA 1UP7A 4IFTA 4IFIA 3WZLA 4ALIA 3DT6A 3VR3A 2C5LA 3I9NA 2JLSA 4G23A 1X1RA 3GDOA 4HEQA 1IOLA 5JWHA 1KEUA 3B1JA 3H7AA 4J1NA 4M60A 2WJVA 1N77A 4ILEA 1GRQA 3O84A 2GUGA 4KWHA 7GPBA 3PNPA 3OUTA 2DRIA 4K81B 2PVPA 4NAUA 3K9FC 4PNEA 3TEMA 1RRCA 1UPUA 4JFAA 2ZJ5A 2H07A 2RDMA 2ZG6A 3PEFA 4PM4A 3EVGA 1L5HB 3QF4B 3I42A 2OQ2A 1ZGAA 3I6MA 3THYB 3EZNA 1BEZA 2C3UA 3Q7SA 4L5IA 4HYYA 3GVPA 1E5DA 4ZVTA 3VR1A 4DUYB 1LPNA 2RGWA 4R2WA 1UEXC 1W49A 2EP7A 3F5SA 4IM7A 3P0JA 1NJFA 4NENA 3JAMA 3A1DA 5JMPA 2IHNA 1I7PA 3SIWA 1Y9JA 5AKGA 1SB9A 2XE6A 1QHSA 3KTFA 1RHMA 1YJBA 4WWHA 2OYRA 3V8PA 4K9NA 2LIVA 1DC8A 2TRSB 1V35A 4QIHA 2AXEA 1ENZA 3ZBTA 4M76B 3SEAA 1FRVA 4RQAA 3ABIA 3NW9A 3VMFA 4N3CA 1PL8A 1YAHA 2R0QC 1E9CA 2LWIA 4KFTA 4QNRA 2VJQA 2YOGA 4BATA 1FTWA 1Z6AA 3ZDDA 2I4OA 1H6BA 4RJ2A 2V6BA 2BT4A 2MYPA 4OB6A 2Z8YA 3G2HA 4CKWA 4V38A 1GPJA 1ADYA 3DNFA 3H2SA 2IZ1A 4LVCA 2R6ZA 4EUKA 4CUZA 4L27A 5AKEA 3RAPR 4DANA 5JHGB 5K0EA 2PV7A 5YASA 3SFZA 3LT5A 2MHCA 1VE1A 1MH1A 3OU2A 4RBNA 1YE5A 2O8NA 2YASA 2ZRFA 4BMZA 2BEWB 3SXUB 3CX3A 3AUYA 3TWOA 1CIJA 5JY1A 4ZMRA 1VE3A 3DHWC 5KTPA 3WK4A 2X0EA 2NX2A 4TLMB 1SCUB 1SUEA 2P11A 3EQ8A 3X1JA 1WX1A 1ADFA 1A50B 3B3JA 4OATA 4UE2A 4FGJA 4WLUA 3STVA 5IKPA 1NR7A 3AY0A 3FUWA 4LXGA 3U40A 2J5RA 1RWQA 1VM6A 2DT8A 2WTEA 4U2FA 4GMHA 1KE1A 4C6SA 2EGGA 2GO1A 3I5MA 3CZQA 5CG1A 4O29A 4DV2B 1K7XB 1K06A 3N5KA 2PG3A 4F5EA 4QQ8A 2VRBA 3GQVA 5DLQC 2VXYA 4EAAA 1UPXA 2L2QA 4GR9A 3NXKA 5MHTA 3CF0A 2J9FA 3GCWA 3LQKA 3IAM1 4XWYA 3M5WA 4PQYA 2YMMA 1A7KA 1F14A 4DNQA 2LR0A 4YWHA 1SY7A 2C0PA 4GMGA 3V6LA 2B4KA 1JA0A 3W2TA 1KHHA 1UZLA 1WUIS 3MUEA 4GRIA 4XR4A 2NVUB 3SVZA 2YXLA 4DR6B 4CCAA 3EPKA 3QVKA 1JGTA 3VVLA 2Z3ZA 4MULA 1MO4A 4RIHA 1JFFB 4F92B 3HBLA 4ZKDA 1RLOA 1HC7A 2OMEA 4QDZA 1Y3DE 2UVQA 3CE9A 3LUCA 3S29A 1VRVA 4LI3X 4NMWA 4BHTA 4ZI7A 3QP9A 3ITDA 2FETA 3KPJA 1Q0RA 3EE6A 4OJMX 5C9ZA 1EFTA 1UIRA 3K6SB 3EQ6A 2E18A 3SQNA 5AVYA 2A0YA 3U81A 2WUDA 1XCLA 3RRJA 2VQ6A 2CBGA 2PGDA 4E70A 2UZ3A 1H93A 4B85A 2PXAA 3KOWA 3C24A 4ZI5A 3DDHA 2EG9A 3NASA 4L2IB 2GA8A 1RJ9B 5CVJA 1QO9A 3WAKA 4EZBA 2HC9A 2WPDD 1P7YA 2QJOA 4TWRA 2NAFA 4C2TA 5KZMB 3GH1A 2YY6A 3F5DA 3B7WA 2A35A 5CVDA 1PGNA 4KXYA 2H4JA 5KYYA 1CB0A 2O2DA 2RHMA 4XQEA 3RVKA 4MS4B 3B5JA 2ZSBA 5CXSA 1R7RA 3OO1A 1KYYA 1W30A 2E21A 1NM5A 4A1OA 4YJ2F 1Y63A 4F8JA 2BFBA 4GGOA 3UM9A 4R0MA 4GLFA 1OWNA 4ZGWA 5TMDA 3QPVA 4JVLA 5DBIA 1G18A 3NM4A 4LHVA 2OHVA 1K97A 3HO8A 4MAMA 2XIJA 4H6XA 5IDQA 2MYTA 4M9RA 1IHXA 1KXJA 3TNDA 4HAVA 5F1PA 3VH3A 4KPGA 4OXIA 4LDAA 1WOYA 4U8HA 4CM8A 3TG2A 5AICA 3ZGZA 1XMOB 2AWOA 4OGGA 1T1SA 3AB3A 2JB9A 1OXMA 1HDYA 3LLSA 4I9GA 3QNUA 4CDNA 3VHRA 1BKDR 3Q85A 2F48A 3QVWA 3K9CA 2QJTA 4NU5A 5TGDA 821PA 2CZGA 3CLSD 4IIXA 1TU3A 1WB6A 2HIMA 4K7JA 4XUDA 3T9EA 2HA0A 2J07A 2PMWB 1X7ZA 1J8YF 2Q27A 2PKXA 3GLFB 1NXQA 2DBRA 2IP4A 3BGVA 3KUCA 1XDUA 3KOXA 1WAMA 4IBOA 2IS4A 4TL6A 1ZAYA 2PMCA 1NW9B 2PN1A 3PUVA 2IUTA 1YS2X 1FNNA 1L8QA 3HDTA 1DQRA 4QASA 4KVFA 4ONEA 4ZDWA 5DOVA 5BQ5A 2PYIA 4WLVA 3GMSA 2W93A 3CLVA 2ZI5A 3RVNA 1YOVB 4D43A 2W8BB 5KQMA 3HL4A 3AR8A 1NI3A 5ADWA 1JU9A 5C53B 1YJAA 1FFXB 2XPCA 3MJHA 4JMPA 1T2VA 4UJ5A 4OQXA 3RI3A 2R1UA 3U3ZA 1Y6QA 3C6KA 2NXJA 3OQMA 1KDPA 1E3EA 2RIRA 2G80A 3DP7A 4TL8A 3T1YB 3GARA 2VAVA 4LQDA 2V59A 4QQKA 3G68A 2FW8A 4AJPA 4KQMA 4KPFC 2GDZA 1NC1A 1PJSA 2QS9A 2XITA 3D6VA 1PTKA 3SSNA 3WISA 4F04A 1EDDA 3LL7A 3QOFA 3DYBA 1XZGA 4FFRA 1CQIB 1O77A 3HVIA 4IGEA 4RFSA 3AQ4A 1E7YA 2EKPA 2HXYA 1DMRA 1IB6A 1QKJA 1J5PA 1IULA 3X1DA 1A7UA 2HPZA 1JQJC 2PX5A 1ZVKA 3WC4A 5HKKA 5KDDA 2QL7A 4RCYA 5JSQA 1K1EA 1AY0A 2Z8ZA 2HCFA 3H16A 5SZHB 3UMFA 2WJ3A 3SK0A 2D2IA 3Q7RA 4GPIB 1GGMA 1Z37A 2JAXA 2JLCA 4FILA 4NFLA 1ST2A 1TK2A 2X0RA 3G9XA 4Y2QA 3TZBA 1P0CA 2NU9B 4I66A 4MYHA 4IDAA 2QRQA 4ZYZA 1HYBA 3GAFA 5ILGA 4EBBA 2IYWA 2H4YA 3FTDA 1FYEA 5HF9A 3RADC 2JLRA 2AEEA 1BTOA 1P1KA 1T9CA 2ZSKA 2F1JA 1C9MA 1ECCA 1X7GA 1KF0A 2WMDA 3EVDA 3F2VA 4LDJA 4ZQBA 1JDJA 4LGMA 3VQTA 4EYEA 1DV2A 1ECGA 4IUBS 2M6LA 1U0HC 5A02A 5AP9A 1N36B 1IBSA 2GEDA 3OBIA 3AHFA 1AXGA 4KSYA 2XUKA 4BMOB 4DSOA 2ODQA 4LTNA 1L5YA 3WKBA 2IEDA 2YWXA 1CW2B 4JLUA 1CUBA 2EFDB 2DR3A 4HDSA 4P4SA 3H5OA 4R2KA 4V24A 4WZBB 2ZJ7A 1AVTA 3P9SA 3UA4A 4EVIA 3QPWA 3QHAA 2D5IA 1DIOB 2DPLA 4DLXA 5EWJB 3DTVD 1GTSA 4IAOA 1BS9A 4ITRC 1MA3A 5L4LA 1E92A 3GJYA 3LUHA 1Z5ZA 4D0SA 3G85A 1YE8A 3L1UA 4AJ1A 1E62A 4REMA 4LY9A 3MWFA 3TLCA 3P9PA 3GJ5A 3EB9A 4M22A 5M34A 3JV7A 1IU9A 4LYJA 1NU6A 4YQEA 2X8JB 3ORHA 2ODNA 3BH7A 4RV5A 4RVGA 1U3WA 5AHKA 5GONB 4ESEA 3JWPA 5CD9A 3NHLA 4H9GA 3TNYA 1U2PA 1ZPDA 4FD3A 2IW3A 1GXSA 1W29A 5LXTB 3QHPA 1L4LA 4QT0A 2ZWMA 3H83A 3ZZ0A 3WGZA 4MLCA 1EB8A 3AYXB 1KJYA 3B6MA 5F21A 4RHCA 4ZZ3A 1S1MA 2CDNA 4H3VA 1ZR4A 5JYEA 1RS0A 2FW0A 2JL1A 2C9YA 2NO9A 3OFSA 4B3BA 4BRZA 2GN8A 1AO0A 3BQMB 3RVRA 2I87A 3VTFA 3I6YA 5FWYB 2JK1A 3BXHA 2V6IA 2I9KA 4MHSA 3RVOA 4RULA 4PANA 3K1JA 1OXVA 4Q3DA 1W581 1HE8B 3DAPA 1MNAA 1D3AA 3N6RA 4JMLA 5CJ2A 1NR1A 3G7NA 4ZT3A 2NTYC 4BRUA 5C8YA 3OX4A 4D41A 4DJTA 2XE4A 4RJLA 3X2SA 2NP7A 3BRSA 1GSHA 1KC1A 2JIZA 3DEIA 2OD9A 4OQQA 3VU9B 4ASUA 4PG8A 1E1LA 1I4LD 1AV6A 2MU1A 4ZREA 2J9ZB 5H3HA 2ZR8A 3FBTA 2IOHA 4AK9A 4DQVA 4EI2A 4PC7A 4MV7A 1PWZA 4BFWA 3V9AA 9ATCA 5DBHX 2DKOA 3GEGA 4N65A 4BO1A 5HM6A 1F7VA 4PO9A 5ICMA 3KQWA 3FF4A 2O8FA 4G1EB 1ZIPA 2PKQP 4J2HA 3LRPA 4HWPA 1NUSA 4NNPA 4Y9DA 5DTEA 3OMWA 1AO3A 4DRZA 4ZDJA 3OQHA 1EMDA 4G5OA 4KV9A 4PY2A 5BWLA 8ABPA 1X7XA 1IUOA 5G53C 4BP8A 3WI7A 4IG9A 3E2IA 4IRMA 4X93A 1DCMA 2WKWA 5EP4A 3O83A 1W5TA 4ZT2A 4QTYA 3IV6A 4KR7A 5AI5A 4FFPA 4S1OA 5JRJA 1I3LA 1KAGA 3F97A 4KH1A 1LGYA 4RENA 1CIPA 1J2JA 1FQOA 2E37A 1DFGA 2V7QA 3E82A 3IFSA 5ICGA 2VLBA 3FDIA 1O1YA 1S8AA 2QYHA 1ZJ4A 3H3FA 4X3CA 1GUBA 3SHVA 1CU1A 1QM5A 4CG1A 1I10A 1Y7TA 1SOWA 3A2NA 1PQ4A 2XMQA 4ZI7B 1QRSA 5CBPB 1U1GA 2WTAA 4XCQA 2HMYB 5LZ2A 3AVYA 2Q2QA 3KKQA 2RBEA 2YZNA 2JIBA 5LN1A 4CL0A 3RU7A 1LI7A 2WU3A 3DTTA 1VOTA 1QUFA 3N2ZB 3CPSA 1KDZA 5JCJA 3T1OA 3ZV7A 4BVGA 5CFLA 2FY8A 1DCFA 3FDXA 3NDIA 3O21A 4O4HA 1XMIA 5GAJA 5JADA 1KOLA 4ERNA 3CEJA 5JZ9A 1O7JA 3GMTA 3QZUA 5D6OA 4CTOA 4RFVA 2HRZA 4KP7A 2ZJ1A 1MOZA 1PZFA 2CYBA 2M1XA 4JLNA 1BH2A 2H5JA 4RL4A 4TWIA 4L8FA 5DLEA 3UTDA 1VSTA 3KDPA 2W2KB 2OPHA 4JI0B 2QL9A 1WW3A 1ZMOA 4KRFA 2XAUA 1FU4A 3D59A 1MAUA 2WMOB 3HYNA 1ESZA 5G4KB 1JYFA 3RGWS 4IY1A 1JHZA 2GWRA 2H92A 1ZCJA 2WVAA 4KE8A 5EQTA 1NUUA 1XRPA 3X2FA 1TT7A 2I7TA 2Q3BA 3QG1A 5LU9A 4Q9HA 1XF1A 1KJIA 1Z39A 2QTRA 1UANA 2Y6UA 4LNHA 3L46A 4J90A 2NT4A 3WAGA 4YXWA 1QMGA 3QV1A 1JAYA 2CC2A 2HREA 4LBYA 1YIOA 1U7DA 3RS9A 4BO4A 3RJTA 2F9LA 4B80A 3ENWA 4OA8A 3SMVA 3ME5A 1NQUA 1MT0A 4MV8A 2GX6A 5BNFA 3B13B 4ZKEA 3QFSA 1QDUA 1DJNA 1Q84A 4K2AA 4CM4A 4OLAA 5DE3A 1EE2A 1YU6A 3GCGA 3KJFA 1OFVA 1PFYA 1BVUA 1GCOA 1YCGA 1V47A 2ID7A 1IM5A 3AZQA 4UXHA 5A7HA 3I58A 3HP1A 3AP2A 3RU2A 3CUSA 3FVTA 4CU5A 3VKWA 4ZEVA 5JQWA 4KBFA 5AW1A 3BL5A 3ISVA 3NJ4A 2V9CA 1UQTA 4HUQB 4HJXA 2BYTA 2VK1A 3A4VA 2NIPA 3CB4A 3BAFA 3OZBA 4PIMA 4ZZIA 1SULA 3D6FA 3RFTA 1I1QB 4OJQA 4REOA 1T8YA 3RIHA 4GBJA 4DNXA 5E2BA 4UQPA 2IU3A 4GMXA 4TV8A 5JNVA 3MILA 2VSYA 4P22A 4HEHA 5DXFA 5AXBA 2C9CA 4JKIA 3ORYA 5FUWA 3WKDA 4JOSA 1FDVA 2ZE8A 3QQPA 3VYTB 4P0QB 2B1GA 2G9UA 1DKRA 1MGOA 2I3DA 2IXBA 4WI1A 5AJTA 4UFPA 1HDZA 1YTLA 1GHTA 1KZGB 2NUAB 2DF8A 3BVPA 3L0PA 4LMPA 2JGDB 4KLNA 4LJAA 2KBEA 5H8WA 3ZHYA 4UU1A 3KE9A 2W37A 2XWQA 4OYRA 3DQPA 3I52A 1DOZA 2YW9A 4P9NA 3PE3A 2JIDA 5KYGA 3IEIA 2DZDA 1NDUA 2VTEA 3CRRA 2HM7A 4M1QA 3HBJA 1EHCA 3LPNA 2GN2A 4MWOA 3V9PA 1BGXT 1AK1A 1SHKA 5TMPA 1BIFA 1RWKA 1EFUA 4P0PB 3CKKA 3W7BA 1I5OA 3JQQA 3P9QA 1Y1PA 5KYXB 1X8XA 1CJUC 3IR5A 3THSA 4HUJA 4HDRA 1S96A 1SIWA 3URMA 4YAJA 1V7QA 3GZTB 4WK4B 1M8GA 5FEMA 1MJGM 1FY2A 3HI6A 5BNTA 1OI7A 1QRRA 5KYVA 4DLAA 1RD4A 5DLDA 3HUUA 2BCJQ 2E48A 4ZVMA 1N8SA 3UN1A 4D81A 2LXNA 1J00A 3KOZA 1CSEE 2GHTA 2VF4X 3RARA 3W5SA 4UQLA 3BXOA 1EWKA 3T7TA 1EX1A 5LUAA 1NYTA 2PAAA 2APJA 1ZUNA 3HA3A 2DXIA 1QZTA 5T64A 5AYVA 2F90A 4TVOA 1M2EA 3ZJ5A 2ZIVB 1H9BA 2RK4A 3GY0A 3N74A 5IUJC 2H4XA 4QDTA 1HRKA 3RRYA 4B7AA 1O0SA 4Y2VA 4IDCA 1T5LA 3A26A 1AF7A 4H77A 4Z1MA 4P31A 4F06A 2ZUWA 4MPJA 3IESA 1EX6A 2UVDA 3KLNA 5L7YA 4XSGA 4O2BF 1RQGA 3C41J 5LBUA 3FJYA 1ZRSA 1C9EA 4CLHA 1TRHA 4WEQA 2M32A 5E7IA 4EZIA 1P18A 1T2DA 2QRPA 1JFTA 2O5CA 1XZIA 2XOKD 4A5SA 3CLSC 1S7CA 1TQDA 5F9MA 4DBVO 1GPAA 3KYJB 3RUIA 3EULA 4YROA 2IPOA 3NO4A 5KYTA 2CW5A 2YNMA 3KUKA 1MC5A 3ICCA 5DISB 3VR5H 5IMBA 4Q24A 1EWYA 3GHYA 4R2JA 2WDZA 3AUUA 2CBZA 4RAOA 4S0XA 1U8FO 5HCIA 2C83A 2QU8A 3GRYA 2OXFA 2YV1A 5LQUA 1JU4A 4C0JA 4MGKR 2QVZX 2VP9A 4ITVA 4EQ6B 4Y7DA 1RMQA 2VT6A 1B4DA 3C7AA 5TNXA 4KTVE 4RD6A 4XX0B 4KXMA 4GBGA 2FUCA 2XWPA 4MR7B 5ICEA 1PYGA 1SQ0A 1XLVA 3GV0A 2GT1A 3OZVA 4B2IA 1ZJJA 4Z3KA 2C3MA 3C15C 4GZ5A 2XOEA 3ZWVA 2N1MA 1POWA 2FN7A 4IRUB 4QODA 5C1PA 3O2QB 2DQZA 1UFVA 4P53A 3VYWA 3R8CA 3OPYA 1UM8A 3HY3A 3FZEA 4RORA 5ETJA 1X7WA 2MSDB 3CNNA 2O1XA 8MHTA 1F2DA 5D6NA 3OVMA 3ZWMA 2BZ0A 5BRAA 4LSMA 5KNBH 3RIGA 1GZUA 1Q0QA 3A2LA 3E3OA 3NDJA 5HK9A 1A7AA 1D6MA 1XRJA 1YVEI 2Z9BA 3OEEA 3N8KA 1M0SA 2OV1A 1Q77A 1KK1A 3IS3A 4UOZA 3AVXA 2H4WA 2JARA 3M5PA 4UE3S 3N07A 5FR2A 4CI0B 3CFYA 5DHQA 4DMGA 5IW8A 3I5UA 1ISPA 3BCHA 3RC3A 3TIFA 4RMIA 1YZHA 1N3IA 1VIVA 1XZJA 2NSJA 3KXPA 4R8RA 4XARA 5EE5B 5EYPB 4FC7A 1R2QA 1MW9X 4E5PA 4X91A 5F1KA 4GI3A 3QX9A 4RY8A 4HGZA 4NJEA 4BO0A 3T6KA 1NLMA 2B30A 2J9YB 3NAGA 5KU7A 3D6NB 3AKZA 5BSEA 3SM3A 3PF9A 1SOVA 5DTIA 3LOUA 3ZD7A 4YT5A 4TRNA 3GLHB 4L16A 3AJDA 1ORRA 3VTZA 4HDNA 4LWPA 1QZUA 3OLXA 3ESRA 5FOSA 3GRFA 1HPLA 2Q3JA 1Y3BE 2B6NA 4D4GA 1LPPA 2FZWA 3H5VA 1XCOA 2AJLI 3Q1KA 4LFCB 2VYQA 3V8RA 3RC8A 1OWMA 2ZK7A 4JC4A 2BC9A 2FX2A 4WJKB 5AHRA 1HEIA 1UIMA 1IN4A 1RI4A 3BERA 2Q7OE 3L6UA 1WUTA 2XV1A 3GJ0A 1BG6A 3IO3A 3OWHA 4QXMA 3W1VA 3C6YA 4QXQA 4OGLA 4F1JA 3O0TA 6REQA 5CT6A 2YIDA 1U2DC 1X8LA 1Y48E 2CFTA 3KR2A 4MQBA 2DLCX 3KQHA 5DGTA 2UZ0A 1RJDA 3ZV5A 3CPHA 1QANA 2ZB3A 4EI9A 4O4HB 3GVHA 4KGDA 5DHSA 4HJRA 4B4WA 1J99A 3CYFA 5EWMB 1AT1A 2QLBA 3V42A 4TSRA 3L7KA 1G17A 4C7BA 5K3FA 5KHLB 4ACAA 4E5SA 2I3BA 3V1TC 3AF5A 1U5CA 2ZXEA 3GJ7A 3HQ4O 4X7BA 4ZOEA 4ZVKA 1NSFA 2Y66A 2ZVQX 1O8CA 3IVXA 3T1HB 1V48A 2F8TA 3DVLA 2PBZA 1CUSA 4LYGA 2IS2A 4BV9A 5KIAA 1IJFA 1G8SA 3LU1A 5BVHA 3N2EA 4TUYB 3NVMB 2VUHB 3L7OA 2GDJA 5LB2A 2FEWB 3FWKA 4GZ3A 1BQEA 4WV3A 3ORQA 1C29B 4W8HA 5LU8A 3DDNA 2XB2A 5K2MA 3QUTA 2E49A 3KUUA 4OQZA 5I7OA 3FHLA 4C4PA 4G8DA 1Z33A 2GJSA 3WLHA 2NN3C 2Y76A 4WLOA 2XA1A 3AR7A 1OLXA 4W9NA 2R2AA 2G67A 5F3RA 5I7FA 3GLQA 4DC0A 4CTMA 3O2NA 1RRMA 2FN9A 1VCOA 4QYMA 3PRHA 1ITZA 2EIHA 3BN3A 4L9WA 1I4OA 1O4WA 1TD1A 1XLUA 3Q41A 4E30A 2P4SA 3FPAA 4I1UA 1NNLA 2WAMA 1F9EA 2OYSA 1F8GA 4TWBA 4Q47A 3ZVNA 3JD1A 2A3RA 4EA6A 3CPEA 4ACBA 1YR1A 1GGHA 4YR9A 2G28A 3U3MA 4DGQA 3AI3A 4Q21A 1YJQA 3VXKA 2WAOA 4YREA 4BDSA 1AV7A 3FDFA 5FFNA 4WVLA 1G98A 2OV2A 5AJVB 1LC3A 5FYQA 5G0TA 1T2NA 5B2FA 4JI7B 3QOYA 4LW8A 3O4FA 1GPUA 3TLAA 3AJRA 5HS6A 2VHZA 1NDHA 3NTOA 4M0FA 2C59A 3TW6A 4GRDA 5L3SB 5JWOA 3AFHA 3IE1A 1H4QA 3VR2D 1A69A 4KL8S 4LIPD 4LRUA 5JSZB 3M9LA 3V1UA 1UT8A 1NJ6A 1S3SA 2BDTA 1QCDA 1TC2A 1U8TA 2DTXA 3C6XA 5ARDA 3TZEA 1XIVA 3PR1A 3H9UA 4P83A 2O2GA 4GIBA 4ZI7F 5LPNA 1FRZA 3OC6A 2CUTA 1E2LA 1JDSA 3A6KA 3RAGA 1EDZA 4FGSA 5JVDF 3HB9A 3I2KA 4OEHA 1G9XA 3PZRA 2JA2A 3GIDA 3OKPA 3P9ZA 1QVZA 4NQRA 1V7ZA 1VG8A 3C6ZA 4IJ5A 5K8LA 2DCMA 1ZFNA 2AF4C 4XPZA 3FH0A 1B0UA 1N0UA 4PRKA 3SYNA 4X20A 3CZ9A 4I99A 2HBZA 1PNVA 2UV8A 4UTXA 4AXXA 4DIUA 5KNCH 1DLIA 3AUKA 1IE3A 1VFNA 3OQVA 4P86A 3NFYA 5I8ZA 2E89A 5HUHA 3IP9A 4D97A 2IBSA 4NEGA 2ZIXB 1SVUA 1CUVA 3AV3A 1BHO1 1KJJA 4YUZA 2MDTA 4HEJA 4PHGA 5B58C 3PD7A 5IJ0B 2HUNA 2WG0A 4ADSG 4XIGS 3V34A 1XDGA 4YJ2A 4PVDA 3W0LB 2H59A 3QJ5A 4DVGA 1FSFA 4DLPA 4X8LA 1UMDB 3QIAA 1CP3A 3QX7A 3VYVA 5LP6A 4INAA 3SHQA 2P6PA 4AJKA 4GLOA 4O02B 3GLRA 6YASA 4HDKA 1G59A 3ELUA 5HWSA 1GGFA 1PZNA 3GHHA 3HJFA 5GMOA 1E8MA 4JLMA 4PZUA 4RCVA 4FC6A 2QXTA 3RS4A 3IIIA 4CKEB 1U2DA 2JH3A 2QB5A 3M49A 2VUTA 3H19A 4FFWA 4Q6WA 3WMXA 3B82A 3VVCA 4O2AF 2QI9C 4Q19A 1QGUA 4M8IA 4BLVA 5A03A 3PCXA 2YR0A 2MR6A 3M6UA 1X7DA 2J33A 4WKCA 1IJKA 3DO6A 4R1UA 4DCMA 4JQYA 3B70A 3NBZC 1SXPA 5T5QA 4K0RA 3AVQA 2IX3A 4BB6A 5AMXA 3ADDA 1LU9A 3LCJA 2WWXA 4F5ZA 5JV5A 1YJ5A 2H7CA 2Z6VA 3R0ZA 2X0KA 3GJRA 3QW2A 5ESWA 4BFVA 4Q3KA 3AIMA 3OZGA 2CXRA 2FPLA 3W04A 3HTXA 4EITA 4MRSA 5GM2A 2WB4A 1W0KD 4YP1A 3NWOA 4UNNA 3T4EA 4KPYA 1M34E 2A5JA 2CF5A 5AW9A 3O1HB 2V5VA 3CKYA 5HPYB 1WXIA 4XFDA 3F4LA 2RARA 1PQWA 2VQEB 2EW1A 5F73A 3ZS9A 4JWKA 4DSZA 4BLWA 1D2NA 3UJ6A 3CIFA 1R8QA 1GYRA 3DOFA 1A5SB 3C1OA 1IEVA 2ZOSA 3J80A 5EZYF 1NMSA 2WVJA 3TD9A 1RW4A 2AMFA 3RVLA 4TMZA 3JTEA 3KVNA 1OZHA 1FVXA 1CD5A 3MWLA 1B2RA 4JLPA 1M5TA 1Z6YA 3FDZB 1AXRA 4AZVA 5HYVA 2AFIE 2OUKA 3HKCA 4I46A 3RJZA 3FAKA 2UYQA 3FWHA 3UATA 1HY3A 4IH4A 3MMNA 4WXMA 3TKAA 4D4JA 5BSVA 3Q10A 4KPEC 1K6XA 3UFXB 4FKMA 3LSTA 2W11A 2OHXA 1W85A 1L6RA 1A9TA 1OLXB 3CCCA 3PE6A 1KZ7B 4G81A 2XR1A 4Y8VA 3N05A 1QRTA 1QIMA 4RA9A 1DJMA 3PQFA 4IFEA 4RV9A 1R1DA 4DA9A 1B74A 2LUOA 2L42A 3UPDA 1AMUA 4GI5A 5I7VA 1YZYA 2EWMA 2WKQA 2J87A 3CLRD 3FMFA 2A58A 3MWKA 3OIFA 1IBLB 5ADUS 5D3MA 1NUQA 1RKQA 2DHRA 2PLRA 1Q74A 1YQQA 4WKPA 3W34A 4MH0R 1Z5UA 1LK7A 3TTSA 4FYMA 2NU8A 4M9ZA 4C6TB 4LBWA 3AUJB 2OYCA 1T9DA 3X0DA 4D4KA 3VPSA 1VGQA 1WP4A 3ZX4A 4DLLA 5CLFA 3ICQB 1BYIA 2DM6A 1H22A 4Q9JA 1MQ8B 3CXRA 3N5CA 1E96A 5LKRA 3OE1A 2RFLA 2RHGB 1RKXA 3WYAA 4LC0A 1XAJA 1MO6A 2XUZA 3S1AA 2HBYA 1IQ0A 3M4JA 2WB2A 3FW1A 1JQAA 4XVQA 1DCKA 1V8BA 1YMVA 2H1WA 4P2GA 3R7WA 2TMDA 4BNDA 4ZA2A 2IPAB 4X1KA 5T41A 4A8HA 2WTXA 3U5ZB 1ONBA 4EMBA 4ZOLB 2GYVA 4OXYA 4YCJA 5K01A 2VBGA 2FEXA 4PG4A 3T7SA 5FUMA 3LDGA 2GCGA 3PR3A 1UZUA 4YK7A 2F2TA 1RJEA 4FINA 2Z2KA 5HDBB 3LHSA 5KTSA 1KORA 2WT9A 3LM8A 4RV4A 1R0WA 4FYKA 3EZLA 1GFZA 3C3XA 4G0PA 4JS0A 4AVYA 2DCUA 4X1OA 3VR6A 4DR7B 2I1VB 3OF3A 2FUNB 5DN6D 3R3UA 1UWCA 3QLUA 4ZVLA 3FNRA 3M4ZA 1LF0A 4W82A 3PJGA 1K8XB 3SYRA 1J8MF 3UJ8A 2C4TA 2FNAA 2AX3A 3IC5A 4B6JA 1YSCA 5TEVA 4DXDA 3ZY6A 2VO1A 3PX2A 5TE9A 2O2SA 5IUKC 2CYAA 1JT2A 1RXUA 3CH6A 4D3XA 1G2QA 3HHEA 4MTLA 2R62A 1DS6A 2GTIA 1T3HA 4RA6B 2Z3WA 1E7WA 3OLQA 3FPLA 2O14A 2HGSA 2FX3A 1V5GA 4FUTA 4C43A 1AZLA 1ECJA 2ISQA 1HOTA 3K5WA 3NM5A 3LVFO 2J48A 1IXKA 2QD5A 3DDSA 1M83A 3FVWA 5B4VA 1ORIA 1N2JA 3FCXA 2OC9A 3REQB 3D3EA 4HAXA 2NTVA 4GEKA 4K40A 3FBWA 1XCMA 1SKUA 5CURA 3U80A 2Q5CA 4DMFA 4GP6A 4QFDA 5G40A 4JP8A 1L6IA 3SKVA 1QHEA 3OCUA 2VYVD 3WLKX 2IXFA 1YQEA 5MDHA 1UPAA 4BPBA 1J25A 1YRLA 2SBTA 3TCNA 3ZDBA 4G89A 3WQHA 1JLKA 2YZ7A 2DWUA 1AKEA 4D9IA 5BPHA 2PZEA 4N5IX 2ZRPA 2DTDA 4D8VA 4DEYA 1Y5MA 1YU9A 1SKYE 3LNCA 4NDAA 4TOIA 3FKJA 3GJSA 1Y6JA 2WIDA 2ZRGA 1UXJA 4HL6A 1QHNA 1E2UA 4BN0A 3NBAA 2WJPA 1USVA 2V6MA 3EOBI 1IRXA 4IP0A 4Z9AA 4TMYA 5JJKA 1KYIA 3KEMA 4CETA 3VO2A 2OBLA 3AJ8A 1KMHA 3T5MA 1Q2UA 2C0QA 4CU2A 5JSFA 3EMBA 4O59O 2XDYA 4AF6A 4D9GA 1EVEA 1RCFA 2AYXA 1XNJA 2F3TA 2H4ZA 2Z4TA 1UBJS 3CUTA 4XTCS 1G7RA 2VLIA 2JLBA 1ZITA 4YJ3A 2EAUA 1PTJA 5IHXA 2VJOA 4Q6BA 1G4HA 2WAYA 1JIXA 3ZW7A 5DHTA 3MJSA 2I4TA 5IK2D 1GG9A 5CIWA 1A9XB 5ALYA 5JRDS 1E32A 1J22A 2P1ZA 3GXOA 2Q6IA 5BMVF 2XDWA 2RKWA 1KS9A 3QLTA 3SHFA 3UFXA 3IQXA 2WT4A 1ZOPA 2YC2C 2BGIA 2P8JA 2RG1A 2PL3A 3HFGA 3JQ9A 4RW0A 4DIOA 2RJNA 3FCEA 1RI5A 2ZIXA 4QWWA 4B79A 3AB7A 4KR6A 1KEEB 2O3SA 3UWSA 3NORA 3ZHOA 2RGNC 3THRA 1T15A 3KWLA 3AMVA 3I9V6 1H6CA 2WYOA 2ZSUA 4IWYA 1LV8A 5DMHA 5B3JC 4Q3EA 3BZBA 5D3MB 2EIXA 1WSAA 5JANA 4DCSA 5EP1A 3VH1A 5B5SA 1D7AA 1SQ6A 3BRQA 1X3LA 3L0OA 4EG4A 2BR5A 2GVDC 2V5AA 1RRPA 1QG0A 3QLVA 3Q98A 2GAIA 3PGXA 4HLUC 5KBYA 2BTQA 3ZWPA 4JNCA 2GM5A 1TKBA 3HRIA 1ML4A 3KQLA 1D04A 2CLMB 1UK9A 2PQ2A 4E5UA 3A3YA 2ZXUA 2OQRA 4DXAA 3G2QA 1A9QA 2A3NA 3GGOA 2BZ1A 4JQSA 3RBXA 1AUQA 2PKEA 2XUOA 4MRMA 2PSEA 4Z51A 1OE0A 3PXEA 3EQ2A 4Z4EA 1MX3A 5EJ4A 1GWNA 3C7CB 3TIVA 1I9GA 1G55A 1YRWA 4XD7D 3T7DA 3IQIX 5DNVA 5AIBA 1NVGA 4FGLA 4EB6A 1GPH1 5CLHA 3CRMA 1Y89A 1T35A 2VRCA 5DNUA 1U0SY 3CZCA 2FKAA 2XUDA 3L8EA 4HXFB 2W6IA 4IQ0A 3EJ6A 4R83A 1NT2A 3AR4A 4TV8F 5LMZA 2Q1SA 4I4NA 3SCZA 1V16B 1NJ5A 5AJYA 1KIFA 2G0AA 1PV4A 2KLBA 1FE8A 1ZVMA 3RHSA 1QWOA 3H99A 1CHNA 1DX6A 4JIMA 4J7XA 2G9ZA 3SFTA 1WTCA 1C8LA 2BHRA 4HMPA 2D5AA 3E03A 2G8LA 4HQ6A 5JVDB 2J3QA 1Q22A 5CIYA 4BO8A 4IZ6A 1RWVA 4XWTA 1L4BA 3CNLA 1JV2B 1IJBA 4BV2A 1ZUD1 2JK0A 3NETA 4OGKA 1NT4A 4J43A 4MRPA 1W1UA 1DAFA 3EOAI 2ODEA 4GUDA 1LNQA 3ACCA 3IUEA 1Y1QA 5BYAA 5BSUA 1QB7A 4J0GA 4J0FA 2WFLB 1OX6A 5FPQA 5D5HA 1FTNA 1T6XA 3CWZA 3MT9A 4OGWA 4PE5B 1Z28A 3H18A 4OP1A 4EY3A 3R5KA 4JYCA 1IHUA 3HVJA 3KYBA 5FI3A 1WLSA 1UWLA 2A7QA 3HP7A 4BUZA 5AM2A 3OLYA 1T25A 2R60A 3GZ4A 3MAJA 3AI7A 1XTIA 3IBYA 4QICA 4R7GA 1N7GA 4MGZR 2E5WA 1JT9A 5F1YA 1IN8A 4MQUA 4WK0B 3TLKA 3HKDB 3SP1A 2EFCB 2EOAA 1CE8B 4HQNA 2I2WA 2VSXA 2OB2A 4FEAA 4LRWA 4NAHA 4WCDA 2IRWA 2NG1A 3PXAA 5B7GA 2Q1TA 1BMTA 5K0BA 4EA7A 5K0NA 3G2NA 1P2SA 4LOJA 4ZMSA 1C5KA 2DVMA 4TM8A 3PFWO 4HRAA 1IBKB 1O95D 5UKDA 1FFDA 1G6Q1 1XXHE 2I2FA 1XVLA 2D1SA 4BTLA 1DIGA 1MJNA 2G17A 4GUAA 2OGWA 2QG6A 3C3PA 3DNPA 3EIFA 2EZUA 1XWWA 2EJVA 4I2NA 4KQXA 2IL1A 1JDVA 4UKDA 4YC7A 5KSZA 2IP1A 2C4NA 1T9BA 2VKQA 1C1YA 2RSLA 1AIPA 4N8EA 3BDAA 1FUIA 3P45A 1RWXA 1MR3F 1KYWA 4YCAA 5A5VA 3H2IA 2OBYA 3AX6A 4N5LA 2OLEA 3K0HA 4BNDB 3G0OA 2DUUA 2H2GA 2I91A 3EMDA 2QE7D 2P9YA 3VZRA 4U2DA 1JMKC 4YMLA 3WQRA 1Z34A 4H59A 4NNJA 4JYMA 3MIIA 4I3HA 4U7DA 3TMKA 1AS3A 4OGFA 4TZTA 4YQZA 5EHGA 1S4QA 2ZUEA 1LD3A 3B38A 3KPYA 2X23A 1P31A 4XIYA 4JCCA 2GARA 4BLQA 2GN9A 3GFBA 2EX0A 1PE0A 1WVMA 1G19A 2AFHB 4RFSB 1NX6A 5G0UA 5G1NA 2B61A 1OD6A 2NYUA 2OCLA 2ZROA 3C97A 4PAQA 1Q7CA 3TNFA 3SJCA 4FQ8A 5EZYB 1XDZA 1XMJA 1USWA 3H2YA 1QYWA 1DC6A 4PN7A 2VF2A 1NKTA 1ISIA 3DSRA 5AQEA 1R4MA 2RH9B 5H83A 4CL8A 3ZUPA 3H0KA 1SUCA 2DERA 5E8RA 1FTGA 3M6LA 4K6MA 1SC6A 1G4AE 3SLGA 3B7GA 2WUFA 4Z1MD 5LLTA 1N9GA 1I3KA 2OFWA 1GJRA 3IUPA 2WWVD 3CPJB 4IMPA 4E88A 2AXNA 1WXFA 3CLUD 4BE7B 3BA6A 4PPYA 4ZXFA 1WPRA 4BGUA 3TSWA 1R0SA 2ZFUA 4KLCA 2BF4A 3TPFA 5IJXA 4JNKA 1VSVA 5HG0A 3BSFA 4YRGA 3OF2A 2YWEA 1G2OA 1YIDA 4W63A 5I7SA 4PHCA 5I7AA 4N3NA 2ONCA 5L3QA 5AVZA 2G4LA 2GEBA 1E0JA 1DQSA 1JU3A 3PHIA 2YJ6A 5T8KC 4ALNA 2NO4A 2DQSA 1ECBA 4PIVA 1ZI8A 8ADHA 4V0KA 1DPGA 4HS4A 4BQNA 1UOOA 2VUIB 3U7HB 3L6EA 2ZWVA 2WU8A 4PTLA 5CB6A 4FN5A 4KIJA 1D1QA 1EVQA 2A9OA 1YAJA 5K3DA 4MW4A 5K0SA 4RNDB 1P2TA 2CFIA 4M7PA 1CS4C 3WGNA 2BV3A 2RIPA 4TTPA 2ERYA 4ON9A 2B37A 3A58B 4DA0A 3W7AA 2H2DA 3S2EA 1E5XA 3I39X 1AH2A 1UXGA 1Z6TA 4EGCB 3F67A 4K1XA 4P7KA 4BX8A 1JFVA 2IOFK 3AFGA 1OAOA 4CQLB 1H2AS 2R6R1 3VH4A 2R6AA 3A7DA 2LD4A 3WIOA 1QVVA 4EJMA 2OV8A 3CUVA 1YJXA 5TGTA 4F4FA 1R0LA 5HKOA 5BR8B 4JODA 4E5NA 1C0EA 3SJAA 1ZHFA 2W0SA 3E4CA 3I12A 1UFKA 1UMBB 4KEAA 2NV6A 5EIBD 1M5UA 2QA5A 2RHCA 4KVAA 3FROA 3D4OA 5JMTA 2E5LB 2B98A 1O58A 1NG9A 1JBKA 1UBNA 5G1PA 1AGXA 2AG8A 5IBCA 1GA1A 2WFLA 3KEOA 4R9RA 1REQB 4F11A 3FX2A 4NYMR 3OCJA 4D8YA 1FJHA 1GN8A 2X7XA 5K3AA 1Z18A 2VK2A 3IDZA 1N5JA 1Q92A 2VYFA 3EVFA 2X9QA 2Y1WA 1SCDA 1U5BB 2BP7A 2QNRA 3IAS1 1Z8HA 3OX1A 4ND6A 4HH1A 4C0WA 1Y4SA 1RIFA 4M0MA 4MW9A 3REGA 4GVPA 5LYJA 3I2GA 4QGGA 1CEXA 5AESA 1J42A 5E7JA 2IIQA 4IILA 5JPCA 2VSFA 5HKAA 1YB5A 3PHCA 3B9RA 1Z5PA 5KJEA 1E4YA 3AI2A 1N5LA 2O8FB 1RM3A 5C1IA 1A2OA 2OM6A 5DN6A 1ISFA 5AUPB 3KJZA 5DGHA 1Q7GA 3UMVA 4QVKA 1O0BA 4EJSA 2AMLA 2IVFA 1H9CA 4FSXA 5SY9A 3HEMA 3PYLA 2YHUA 4UE6A 3DL0A 3DAOA 1YFZA 4AJEA 1WKVA 1I3NA 3VC2A 1PGOA 3B12A 1WDMA 5ER6A 3BMNA 4BGIA 4CNBA 1DKMA 5CXUA 2KB0A 2GZRA 1NXVA 5DX0A 4FJ1A 1UQUA 4J0KA 4KCGA 4KC0A 4NK4A 3JAKA 1R6TA 4D9MA 1QYVA 2JGMA 1Y6RA 2VHEA 4HDSB 2C8JA 4NH0A 1JLMA 4QXOA 3SJUA 1TQ8A 2C54A 2HO5A 9LDTA 3ZQJA 2EFJA 3NWPA 1L7DA 5IFLA 2X9VA 1P4RA 2HNAA 2HX1A 3EG9B 3QPBA 2SKEA 1BX3A 4RK4A 4OCZA 3WL4A 2Z4RA 3HDYA 4IMRA 4NECA 2OPBA 3K5PA 3X1XA 1G41A 1QHFA 3ZCXA 3PQ3A 1IFXA 3ETGA 4G4SP 3CY6A 5K6AC 1K9VF 1EB9A 2MSEB 3KCNA 1KPHA 3FFWA 2X1LA 2D6FA 3NKLA 4NEQA 1RQPA 4RWZA 5J4VA 4YV1A 3ZD6A 4NBSA 3WLJA 2PZAA 4TTVA 2VF5X 5KCZA 4EENA 4NZ9A 1UAYA 4FB5A 5JVDA 4R41A 1ZWKA 2JCXA 2ZJFA 4WOJA 5AWFC 1UBFA 1Q1QA 4ZZ1A 3J81A 1QRUA 4BKPA 3A2KA 3QA9A 3QMPA 3FYCA 2AOTB 1OFGA 3D3NA 5DYTA 4NC9A 4G0ZA 3T15A 5DGXA 1XQVA 4LOAA 4Q4AA 3MLAA 2I6FA 1N8KA 4OSOA 1K92A 3ZZMA 1OIXA 2HU7A 3B51X 3KTAB 3ZXXA 2D0IA 4URUR 3RB8A 3FYSA 2ATCA 4V2IA 1NATA 3DKPA 1U8CB 1Z2CA 3WQQA 2FN3A 4HWOA 5EJIA 3K70D 3IAFA 1IZ7A 4E1VA 4A36A 2Q4EA 3EGCA 2AWNA 4KACA 1YVDA 2CCGA 5LR6A 1ABEA 2IKSA 1NJ8A 2Y68A 4J16C 2Z2IA 1F8YA 2Q9UA 2OBXA 5EXTA 5CYPA 2PGJA 5BY2A 3HK2A 4V2UA 5EMMA 2C3OA 2DG2A 5TPZD 4CXMA 1CR0A 1CUXA 5LM3A 2X15A 3UK0A 1JIQA 3ZJ4A 3ZN2A 1MXHA 3QXHA 3UANA 3E9YA 2HJWA 1DARA 1SCJA 3ANTA 5E7QA 3ZWAA 3ESYA 4AS2A 4UTRA 3MSXA 4D56A 2ZRAA 5HQ3A 1BX1A 1LPMA 2BL4A 1M8KA 4X54A 4HNHA 1NRIA 1LBTA 2H1OA 2NOAA 4H7EA 3KBBA 3SBXA 3SX2A 2CUZA 4GLBA 3DL7A 3C8UA 1UF9A 3SU8A 4PCUA 1U4NA 5JEEA 5HCNA 2YJ3A 4RIFA 4AF8A 1E6EA 1E3IA 4NMLA 3WYGA 3HJHA 5F64A 2AYZA 2C03A 2W43A 1C2YA 2NUAA 5F2EA 4PYJA 4Z4HA 4AWBA 3PDHA 5DGIA 3A6LA 1P0MA 1N2CE 4HNTA 2CY0A 2GNOA 1GTVA 1L7PA 2IOYA 4G56A 4DYVA 5A0VA 3I83A 3S2UA 3TX6A 4M1EA 4YUXA 1D0IA 1HQCA 3MRVA 4K3VA 1G9SA 4D3FA 1Z6ZA 3O91A 4XSVA 4GX1A 3TQHA 1PR4A 3HYCA 1UWVA 3DW1X 3QKTA 4HBGA 4OK5A 4QAJA 3BXZA 2IHYA 4PR3A 3BEDA 1F12A 2Y1DA 3K6JA 3RHFA 3WBJA 1IXRC 3QUBA 3ZV6A 4ALJA 3PDIA 1ZGJA 4P33A 4N5MA 9MHTA 2JH9A 1M34A 1K66A 1ZJ6A 4J4BA 1XZEA 3L7AA 4R7TA 5ESRA 5B1HA 3TR6A 3ZZTA 1M66A 5KYXA 3ETLA 1H05A 1YR3A 3P8ZA 4AD8A 4KE6A 4PGAA 5BN5A 1YCHA 2GZDA 3P96A 4JHLA 1AKWA 2CVZA 1FS6A 4MB0A 5F3DA 1K4MA 4LOHA 1MB9A 3IPYA 3DMRA 3W4KA 1G20A 4D9FA 5BW5A 3AVWA 4D6PA 2VQFB 3AR9A 3W5UA 2HT6A 1CLEA 4XGIA 2WP0A 2YC4C 4RD0A 5CLLA 3ONNA 4BMDA 1TVMA 2PUBA 2WY2D 4LHZA 1CZNA 3GYBA 3DEZA 3ZHSA 2XEDA 3ZLUA 2W2TA 1NM5C 2C98A 4K5QA 3N8HA 3U2QA 5BWNA 1A95A 1VJ1A 2GH1A 4TS9A 2PU5A 4M1WA 2BGLA 4HNRA 1H5QA 1TZ2A 1ZISA 3NYRA 4HQKA 1GNQA 4EKYA 3KK0A 2QBYA 4KNYA 1ST3A 5JFGA 2YFKA 5JTUA 4HNAB 4BN4A 4C22A 1QFMA 2IYVA 4OUKX 1NHWA 3ESDA 4FI3C 3IELA 1PZMA 3PZBA 3KZCA 1DP4A 2Q3DA 5D5QA 4QPNA 1DBQA 3DZ8A 4YRFA 4EDFA 3I73A 1RC0A 3X3HA 4YXWD 2V55B 2RONA 4ZXPA 4JOCA 2XDQA 4P3YA 2MCFA 1C0PA 1CR2A 2FAXA 1JLHA 2XMCA 3O3MB 4KWCA 4AG5A 1N9KA 4ENVA 3AEQA 3JQAD 5BYKA 4AS3A 2PZGA 4XDYA 4ISBA 1CUJA 2ETXA 2PGOA 2J31A 1L5LA 4DWOA 2OB1A 3IHLA 2D2XA 2CVPA 1OY1A 3ROMA 5EJ6A 3L82B 4OH1A 2BFFB 1GTG1 2J5XA 4GOND 3ZCPA 2P7IA 5JDIA 1OBCA 3SC2A 2R5NA 4ZYXA 1ZY2A 1O6FA 4P4LA 2VAWA 3MUFA 2PMKA 5GIOE 5AXAA 1EE9A 3BPSA 2ACEA 2JLVA 4UOQA 2D5LA 3TRIA 4KODA 1PN3A 3ZG6A 1JDPA 1YGPA 4WOBA 1CUGA 7ABPA 1OKKA 3F5FA 3IE0A 4H2DA 3W4JA 1Y6GA 1F1JA 3AESB 3DVAA 3AYZB 2YIVX 7AT1A 3T61A 2R6JA 1P17A 4A0RA 1FEZA 2OLJA 4IOKA 3PC2A 3H4MA 4Q4AB 3WYFA 4FYYA 1I2DA 2P3OA 1M7BA 5JY6A 1JJIA 2HF7A 3L8FA 5D7BA 4CF7A 4IFBA 1CUHA 4BGEA 3BORA 2OO7A 3DB2A 2ANCA 2YDXA 1Q12A 5K51A 3VRHA 1F5SA 3LF1A 3W2IA 1M1YB 2FFHA 4BLSA 5AK6A 5FLXA 4HNVA 1GU1A 3VJKA 5BSHA 5JD6A 1EIZA 2B4RO 4TT3D 5DK4A 4RF2A 1EFRA 3ETCA 5COAA 1M75A 3CJQA 3H1EA 4QTTB 4FLMA 4E15A 4E7OA 2BJWA 1XZMA 5EG5A 2DMRA 4A2WA 2Q3MA 5A4KA 3DWFA 4LG1A 1FLNA 3F6SA 1OV4A 4A0SA 3ZVMA 1TVCA 3QPCA 3IGFA 1NW7A 4WERA 4DQUA 1K0FA 4AXBA 2GF2A 1UPCA 2HCRA 3Q6MA 2NV2B 2WINI 2IITA 5KSWB 1QJ4A 2QK4A 4I55B 1W88B 2ERCA 1USIA 2E0IA 4I4TF 5HF6A 3SS8A 5JASA 1Y5RA 3O4GA 4EKIA 4BVJA 4UU8A 3LWZA 4U3JA 1DJPA 5EIOA 2WJIA 5H70A 5C4GB 1U99A 2IE0A 3H9EO 1EFCA 2R86A 3AY7A 4BLUA 4JJKA 5DW3A 3ILXA 4J0QA 1OLSA 2DPMA 2J4CA 1EZ4A 4KGZA 3JTMA 4RIGA 4PSCA 3CO5A 5CTAA 5TSDA 3U31A 2H7YA 4B0PA 4BEWA 2XA9A 2P2CA 5F23A 5H1YA 1VHLA 5U4XA 3EXAA 3IBGA 4IHKA 4G01B 2EZ8A 1I7SB 1OGIA 2GB4A 1KZ6A 3GPIA 4O8ZA 2PT5A 4KQJA 1OLUB 4JP1A 4Y18A 1Y5LA 1N8TA 4V0RA 1WHSA 1C2TA 1RMTA 5EY5B 3MXTA 1JRLA 1JI0A 4EL0A 3CLKA 4JB3A 1PG5A 4AJNA 1E79D 2CLSA 1QZXA 5CNKA 4YRTA 3F6YA 3GYGA 2WF8A 1BE8A 3VSEA 2EDAA 2BM0A 4DNFA 2IY8A 4Y2HA 1WUYA 2VPTA 2RGRA 2JJQA 4K86A 3A1VA 1BVRA 3C7KA 1P9NA 3C3DA 4LZAA 3SHTA 1UODA 3GRPA 2AJ8A 2H2WA 2A0FA 3TO5A 1BFDA 1EUDA 3V2HA 2QYOA 4BX9A 3VAAA 4IQ4A 2O48X 1VMEA 4QDUA 2Q6LA 1P77A 1SVNA 2CHQA 3C3YA 2M6KA 4Z8XA 1NBWB 2GVNA 4W1SA 2NQ8A 3RROA 4CT5A 1GAJA 3EEOA 1RWPA 2X5OA 2OSBA 4GFDA 4S24A 4YDRA 3M9WA 3Q7QA 3UWPA 3AHEA 3D7KA 1QK5A 1S9DA 1T5BA 1GCUA 2WWFA 1HSZA 2Q45A 3Q12A 5IYZF 1LCIA 1CHDA 1E7RA 2HBQA 4HVAA 4PYNA 3DS8A 1X77A 3O9MA 4WJLA 1AA9A 2A2ZA 4LRQA 3BS4A 1YS4A 2B25A 4FSDA 3RTBA 5AW2A 3WFZA 1GSOA 1JKJB 5CG2A 1NKSA 1OBFO 3U7GA 2CYCA 1CDOA 2C2YA 3JAWA 4QOSA 3RS2A 1ZEMA 2O07A 3PL1A 5L3ZA 1JPVA 2G25A 2ORIA 4PZLA 4RLHA 3KZ1E 1UMCB 2BMFA 4KYIB 3QU7A 1TO1E 1C7RA 1A04A 3I3OA 3TUJC 1UC5B 1X42A 5A7FA 1UBGA 1VLQA 3GLGA 2B1JA 1N6NA 3A6JA 2OFPA 3OQIA 3GCDA 3WLTA 2HD4A 3LK7A 4BS9A 3HZZA 1K6MA 4XOUA 1LBSA 2QRGA 1NXOA 5L3SA 3DMDA 5H0IA 1H9AA 1NVTA 5EGSA 3RYTC 1F4LA 4IJQA 1SK8A 3Q3CA 5J59A 2BMWA 5H7XA 2BM8A 1X1DA 1ZJWA 1V25A 1EDEA 1TB4A 3C74A 3D2CA 4P36A 2PTHA 2IUUA 1R5NA 3OZRA 2GNAA 2H54A 1LV7A 2F1KA 4P7GA 4R3WA 5ERGB 1GAXA 5AHOA 2GBLA 3U4QB 3W5JA 4JJ8A 2HNBA 4CR8A 2IVZA 4JIGA 2Y0BA 4IQGA 5BN4A 3UUWA 1U9JA 2G36A 1MZPA 1FXWA 5BNIA 3KYDA 3A9CA 4UDOA 4HADA 5CHYA 5HHTA 4QATA 4IJUA 4TRMA 1EVZA 1R12A 1A5BB 3D2LA 3OFVA 3SIXA 1ZGHA 1L4UA 2J5QA 2ZB2A 5NLLA 4ZICA 5KYWA 2C0CA 4HDMB 4BNVA 1Q57A 3ESCA 3M3HA 2ZWIA 3F4BA 4TKUB 1GAWA 1Q91A 5E4FA 3P9NA 4FFNA 2RI0A 4YRBA 4AULA 1NI4B 3PFCA 3UWKA 4H60A 4HT3B 3LY5A 2I99A 4L57A 1IN5A 2XNSA 3SBOA 1T1RA 1EHIA 1P9RA 4ECAA 4ER0A 4RK7A 4FJ0A 1Q0ZA 5FI1B 3V2UA 4LFAB 2VQ3A 4PQFA 4MI6A 4L15A 4TUYA 4E2WA 3RRMA 1FUEA 5BVHB 2DB3A 2C5SA 1V1MB 3HM9A 1BXRA 3G5LA 1W59A 4L5YA 3ZCSA 3CRNA 2FUKA 1Z35A 2ZI4A 3WFJA 1DO0A 2ZB8A 4YMHA 4RTKA 1RBQA 1WUHS 2N3ZA 3HEAA 2HQ1A 1X74A 2MR5A 4REQA 1RBMA 4OQFA 4ZEWA 1KKLA 1SNYA 3LUBA 4MOWA 1YBHA 5IG2A 1A4UA 4D6YA 3U4AA 1VBNA 1OASA 3O4HA 2X13A 4KSBA 1QP7A 3DFFA 1M2HA 3I0NA 5DT2A 2I7VA 5JC1A 1OYVA 2M1ZA 5EPUA 3ZXSA 3PTAA 4YAWA 3CW9A 2R5WA 4N39A 3FFXA 3O74A 5E9JA 2BD0A 1TW2A 4I4LA 3U16A 4C4ZA 1V1JA 1J1UA 1C7ZA 4G1CA 3U1BA 1H2FA 5T57A 4YONB 1BH6A 2J0UB 4G63A 1IXSB 2EF0A 3GA0A 1VRWA 3JASA 1K7FB 4FHCA 4JAVC 3HR7A 3K0FA 4UU0A 1WXEA 1WZIA 1YACA 4EGQA 4IS3A 3FI0A 1ZZEA 1KEPA 4JSTA 2PL1A 4PZ9A 4GMDA 5A3SA 2ZU0C 3RTCA 2OM2A 4HRXA 3I53A 3V55A 9ABPA 3REFA 3C5VA 4MUKA 3Q15C 5LWHA 2HHHB 3DOIA 4JH0A 3TD6A 1XN1A 2PA0A 3SXPA 4GPAA 5BV7A 5JMOA 1J0XO 3WJ1A 3KEFA 3LUFA 4EG0A 1GQQA 2VRWA 3KB6A 3WL7A 4Z1OA 3H1AA 3RBVA 4C76A 4AAYA 2C7VA 1ATZA 1E3WB 1KQOA 3I01M 2PHZA 2R68A 3LT2A 1FX0B 3DWEX 1QFZA 1RDFA 3ND9A 5EWLA 3W05A 4BAZA 2CNNA 1U9ZA 1P0IA 4MUAA 1F06A 3ESXA 2A9FA 3IKVA 4HDOB 1VE6A 2FI1A 3CHYA 4QUJA 3DQZA 2I4RA 1QK3A 5BOVA 4NJMA 5A1TA 5G41A 1A8UA 4LE2A 2ZGVA 3GT3A 2ALJA 5L95A 4ML3A 5IM4F 1UBSB 4ZHSA 3O73A 1TRKA 3M6WA 1E2JA 2V6JA 3KALA 2R6HA 3M89A 2ZSIA 1EXNA 3MT8A 3PNSA 3UEOA 4DLVA 2JGNA 3FGPA 4LTDA 1IVNA 1C7EA 1UBLS 2XHZA 3A6HA 4MKGA 1ZXBA 2JJ2A 2VP6A 2BDEA 4O2RA 1KKUA 3WTBA 4LI0A 1AQNA 1NMXA 3I4LA 3VISA 1CY0A 2GMWA 1AQYA 3JQGB 2IIVA 5DNDA 4UBKA 3WKCA 1CZRA 5EUCA 3CA8A 1PJAA 2C2XA 5EMLA 5A3VA 4K88A 1WG8A 1JNXX 1NZDA 1T5TA 2H1SA 1PLKA 4RUKA 3BC1A 3W6ZA 3O5AA 2J09A 3HZOA 3R0IA 4A7PA 4EYOA 2PY6A 5B4TA 5TS3A 3Q40A 4JJZA 2VCYA 3KC2A 1KTVA 4PLVA 1IY0A 3HCOA 4Y9SA 2CJWA 1OLSB 1E2IA 1EGAA 1TM4E 2SNIE 3I2YX 1PYOA 3MBIA 2RHLA 3QPAA 2QT1A 4PCVA 1MP0A 4PCAA 2Q5FA 3C14C 5LC1A 2ZI6A 1BFUA 3G9QA 4FW9A 3NC4A 5K4AA 1T3GA 1BVHA 3UUGA 4Z4GA 1PRYA 3KYDB 2JI4A 4KSCA 2AGVA 2NM0A 4S05A 3TOXA 4ZVVA 2HQRA 4UULA 4C0AC 4DCJA 1E4EB 4FOPA 2O8DB 2WNHA 2DH6A 5KTNA 3M9XA 4ANFA 2IYFA 5AXCA 3DHYA 2ZS8A 4AJ4A 2VYVA 3OIWA 4YUAA 3B85A 2NAPA 4NULA 1NI4A 4KR9A 1ZEJA 4FGWA 1A8IA 3UFBA 3MLEA 5B6PA 1SG9A 4IUCS 1FF9A 4GWLA 4EUHA 1Q0TA 3V8MA 2O1WA 4F2HA 4ZCTA 5A06A 2OAQ1 3B52X 4F46A 4WXEA 4RY2A 1GUFA 2C88A 2RHBA 4M1TA 2BGWA 1LH0A 4JP2A 3PFBA 4Y2UA 3DOEA 1GAEO 5AR1A 1VE5A 2DUWA 5HQJA 2AN3A 3O8CA 4TN5A 2IYAA 2ZRCA 4M55A 1NP6A 3GCXA 3UC9A 1Q0PA 4KJXA 4FYJA 5CFQA 4N9QA 2BFCB 3ZNOA 3KSAC 3IBTA 1H2WA 4JBGA 3HE3A 1MU0A 5JCJD 3QOXA 5HILA 4FDMA 5C1DA 4A8JB 3KJXA 4E5DA 2ZB7A 1YHYA 3QXJA 5F78A 2EATA 2WJ4A 4RYLA 2B7LA 2JEZA 4KHPB 1T13A 1M1YE 1QAMA 1V26A 3TZCA 3JAWB 1Y3FE 1JHDA 3VO8A 2VPIA 3VR3D 4P3NA 2H0QA 2HZ7A 3C8MA 1GVNB 2AI2A 1P9LA 4LSWA 2XBMA 3PIIA 4NOMA 3LCVB 3N0XA 3R09A 3NOOA 3RTEA 4COOA 5JS8A 3SNHA 4X5OA 1CS0B 2Q5EA 3IUSA 3GUCA 2ES4A 4PSAA 4II2A 2V74B 1M8JA 3QVOA 2D1QA 4JYBA 1SBNE 3V1YA 2PYDA 2ZRBA 3ZHZA 3PEYA 1M2JA 3DEHA 4JGGA 3VZDA 4JJEA 3DF7A 3OMLA 1SHUX 5B64A 1KOGA 1QHGA 2YJZA 4PRLA 3O8DA 2DBZA 3CUEF 1JSRA 2PD4A 4QC2A 4KQ9A 4BLPA 1S2GA 1ZSVA 5FTJA 1M5RA 1E2NA 3K8ZA 4MWGA 5FBZA 3I9OA 1EUCB 4C30A 1JR3D 2AX4A 2FE4A 2H1RA 1YQDA 1TEXA 2WZBA 4WBXC 5I47A 5KC8A 1M73E 4MVJD 1J8VA 3HEBA 4MVJM 3JR7A 1T91A 1UPFA 2QSUA 4B3JA 5FPSA 4JLWA 1H94A 5GTDA 2BFEA 4F12A 4JJIA 1THTA 4OHVA 1NVDA 3NIWA 4M8SA 4QXRA 1K0UA 4ZANA 2BM9A 4C4TA 2WYIA 1UDBA 1ZOSA 2Y8EA 4M54A 1CFJA 1GZVA 1VYTA 4D9BA 3RRFA 3D4LA 1YQGA 1D2MA 3AKEA 3BH0A 3OIDA 2OCYC 4KB5A 4Z0TA 3ZE2B 4EECA 1GZ3A 1B41A 1NBMA 3PRYA 1EFHA 3F96A 1I13A 3F9CA 3MHPA 3O7MA 5AW0A 4DM7A 2IXTA 4XD7A 1ZMTA 2RGAA 1GQYA 2RHRA 5AVUA 4CQMA 3FKSD 4ZTUB 1ZH0A 1U0NA 4H3HB 2AQ8A 2P6NA 4X63A 1GL7A 1UKZA 1W1IA 2XOKA 3LA8A 4C4SA 5JJCA 3B3GA 2L17A 2BELA 1MOQA 4QGAA 2VJDA 2WG2A 3ESQA 1PD0A 1PLLA 2QTAA 3ADOA 3GLUA 1GN9A 1LWNA 2CL6X 2VTDA 5G2OA 2P69A 3IALA 3PWSA 4DA6A 2V58A 1BXRB 4ZZ2A 5AVQA 2ZE6A 3G9TA 1DEHA 3MCZA 5IF3A 1DXOA 5H3CA 1YXMA 1WSDA 3GFGA 5IBQA 1JIUA 4BJ5A 4C05A 1F6DA 3V4PB 2Z09A 4X65B 3MMSA 4K8RB 1KHTA 1F0PA 2HLPA 1LFAA 5L3RA 4LVOA 2RHWA 3H9QA 4RQBA 1JE0A 1MV8A 4PYKA 3TX2A 3FLEA 4BQFA 1ORHA 2JGIA 3D5EA 5IUNC 2FSIA 4N49A 4CHTA 4Q4HA 2W2QA 4L50A 5LQMA 2G8NA 3STXA 1TCBA 1TZKA 2E6UX 2FSPA 3DDCA 3IQHX 4JV5B 4PLTA 2XF8A 1ODTC 4XJTA 3V5NA 4CM8B 4P4TA 4F4JA 3ZVKA 3HVUA 3H8VA 1L2TA 4XIIA 4JUDX 1EK1A 2PSJA 5K0CA 2OXCA 1AKRA 4X6YA 3FR7A 3AEUB 4RABA 3GLIA 1LTKA 4BX3A 4XUGB 2O5RA 5IXJA 3BGIA 1U7ZA 5IAJA 1F8FA 3CX8A 1NXWA 3LRTA 3FTCA 5CYOA 3U3XA 3BX1A 3GK3A 5CCEA 1QKIA 1NVBA 4DCVA 3FNGA 2W98A 4EPRA 1WVIA 2B3TA 2ZR9A 1THGA 4MUHA 3NBKA 4ABTA 4F3KA 1HGXA 5FBKA 1H4SA 3OA0A 1EVYA 4RVUA 3TH5A 4B09A 2OV6A 1I3CA 3JR3A 3KBOA 4UJ3A 1PR3A 2V7BA 3NTVA 4NYIR 5FPTA 3B89A 1P72A 1UJNA 1MX9A 1VB5A 4GL2A 1O94A 2W8BA 3MHTA 3P2MA