1JBEA

1.08 a structure of apo-chey reveals meta-active conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
126
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CHEY
publication title A distinct meta-active conformation in the 1.1-A resolution structure of wild-type ApoCheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 47
structure length 126
sequence length 128
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbeA00
3H6GA 5KC9A 4ETIA 4RKQA 2NT3A 4MR9B 1SD5A 3EULA 4L85A 3H5IA 3LTEA 5KQPA 4NICA 4KMRA 1VRVA 2FTKE 5GQSA 5IULC 1JH9A 4Z4EA 5DLEA 4ZYLA 3LKBA 1Y1LA 3IP9A 2E4WA 3QEMA 2A9RA 2OENG 4F06A 4KV7A 4RK4A 5C5CA 2CHFA 1Z17A 3JVDA 3SNKA 1JYEA 3IDOA 4OBBA 2GKGA 2M98A 4D74A 5B3JC 3A0UA 3LMKA 3LUJA 1XHEA 4KZKA 5TQ0A 4MLDA 1DCKA 3EAFA 3GV0A 1Z26A 3I42A 5BRAA 4KRFA 3OMWA 1XHFA 1IIBA 4OTZA 3T6KA 3NNSA 4G0YA 4GNRA 3OLWA 1U8TA 2IOYA 4MLCA 3MIZA 1Z25A 1JDPA 4IMJB 4Z0NA 5JNRA 3URMA 2ZWMA 1PHRA 3O75A 4N0QA 4M88A 4YP9A 2Q5CA 1RZRD 1MB3A 4PZ0A 4W5QA 5IEJA 2TMYA 5HKOA 1ZGZA 1BAPA 1Z16A 1YVUA 4KNYA 6ABPA 3DLHA 3S99A 4JAVC 7ABPA 3H5LA 4RY0A 4EY3A 4IF4A 2MYUA 2YHBA 3Q9SA 4MS4A 4B09A 1EAYA 1D1QA 1NXOA 1ZY2A 2WMYA 3N8IA 5KWSA 5TPWB 5HM6A 3CU5A 1T34A 4XAQA 4Y9TA 2QVGA 4EYGA 1W9HA 1Z2EA 2MSWA 3LUFA 3MF4A 5FWYB 4YWHA 2HPHA 1EWTA 4Z99A 4FE7A 4QYWA 4LE1A 4G0PA 1QPZA 4JB2A 1CEYA 2FQWA 3DLBA 5KQGA 2R4QA 3MYYA 1P6QA 3HO1A 3BRQA 3M9XA 3DGFC 4OATA 1EFAA 1JFSA 1JX6A 2AYXA 3HSYA 4MS1A 1FFGA 3LUKA 3DGEC 3NHZA 4LE0A 4OLBA 3N6VA 5JS1A 1A0OA 3C6QA 3HS3A 5FWXB 4YS6A 3GBVA 3N0WA 2FW0A 2PL1A 1DRKA 1M2FA 1ZH2A 4S04A 4XASA 1SXGA 5ED4A 5DTEA 5TE9A 4KREA 3OQNA 3SG0A 4EVQA 3I45A 4Z9BA 3KYJB 3Q7SA 3DZDA 1ZITA 3O1IC 2P4UA 3OQMA 5B3JA 2VUHB 3HZHA 4IRXA 2HQRA 3NNDA 2RJOA 1C0EA 3GYBA 3QK7A 3EJWA 3OO1A 2VUIB 5FBKA 4N0PA 2QW1A 3CG0A 1Z15A 2DRIA 3H1EA 4ETNA 1Z18A 4MRMB 3LUCA 5TPZA 1GUBA 1URPA 4QICA 4RZSA 3EQ2A 1JWLA 1L5ZA 1ISSA 3CZCA 1FQWA 1RPJA 4MQEB 1BVHA 4RS3A 1PEAA 2QZJA 4TLLB 4MQFB 2QVCA 2PL9A 4HNSA 3I5AA 3FFTA 3IPAA 3HJFA 4TLMB 3RQIA 4N76A 2HQBA 3N53A 1DRJA 4IGAA 5IEBA 1E6MA 4RK6A 8ABPA 4RWEA 5EWJA 1LBIA 3EGCA 5JNVA 3I09A 3G1WA 1KRWA 3KG2A 2WRZA 4MR7B 5EWLA 3RVPA 3GRCA 3HV2A 4G0OA 5KI6A 3F6PA 1PNRA 2PUAA 5F64A 1BDIA 1RNLA 1ZN2A 3Q15C 4G0ZA 2YHAA 4JA2A 3HVRA 3C3KA 3LUDA 3UK0A 3LKVA 9ABPA 1KMIY 4MPTA 2FN9A 3MMNA 5ABPA 1GLGA 3QX8A 4NCBA 1QKKA 5BQ3A 3CLKA 4PYRA 2IYNA 2HSGA 4PE5B 1NY5A 2MSLA 2O20A 3JY6A 3ROTA 3QEKA 1M5UA 3N75A 4KQCA 4UHKA 5TPWA 2VK2A 2JVKA 1DBWA 1TMYA 1D1PA 3CTPA 4RK1A 4WXMA 5FWYA 4W5NA 2IDMA 5DGCA 4F8JA 1NXPA 4Z9AA 3A3KA 1P8AA 1JLKA 3CFYA 2CWDA 2WY2D 2J48A 4WWHA 3HK2A 2JBAB 2KYRA 1JFVA 4MS3B 1L5YA 5GOTA 3FFXA 2NZUG 1K68A 4JASB 1ZGGA 2L18A 1B00A 1QQBA 4EYQA 2XDYA 5T7BA 4MR8B 3F6CA 4KPYA 1BDHA 1CYEA 2H0AA 1U0SY 2ID9A 4F12A 4XFKA 2E4VA 3A10A 2NT4A 1M2EA 3RVSA 2FMHA 4F3TA 5IUNC 1C4WA 3L49A 3CS3A 2PUDA 4PICA 4H3HB 3UKJA 3T8YA 4KFCA 4EVRA 1QO0A 3QELB 3E3MA 4YO7A 4CBVA 2GX6A 3CG4A 2IPLA 5KQMA 3B2NA 1ZESA 4MQEA 1PEYA 3KLOA 2F8SA 1EHCA 2B1JA 1RXIA 1ZAYA 1K66A 1U04A 3GBPA 4XXHA 3H5WA 3EQZA 1USGA 1J56A 4LRQA 1F51E 3OQOA 1QP4A 1NXSA 2FQYA 1SRRA 2QXYA 3H1FA 3ROFA 2IPNA 5TQ2B 4EUKA 4OG2A 1OXKB 3HM9A 1QP0A 2E4ZA 3OO0A 4MAAA 3IPCA 4Z4HA 1A04A 1PNTA 2P9HA 3E61A 1QMPA 5KQLA 1HEYA 1S8NA 5IBQA 4YR7A 2FEKA 2L2QA 2FSPA 2M1ZA 1U2PA 3QX9A 2FMIA 5IC5A 1Z2DA 3CHYA 2R25B 3O1JC 2PJUA 4XARA 3LOPA 1KRXA 3R0JA 2FKAA 4RXUA 4TMYA 1A2OA 1EWKA 1SXIA 5C5EA 2PLNA 4P98A 2OQRA 2RJNA 4ZJPA 3QEMB 1NTRA 1FFSA 1UDRA 1AB5A 4O5AA 3KCNA 3SM9A 5T3YA 3G85A 4MR9A 5I4CA 2GBPA 4ETMA 3GWGA 4LZLA 2FMKA 3FDFA 3SQNA 1MAVA 4N47A 1P6UA 2JBAA 1YS7A 1D2AA 3QLUC 3HUTA 4Z4CA 3IP5A 3MM4A 5CNIA 3TX6A 1NATA 2LP4Y 3Q7TA 3SY8A 1XWWA 1TM2A 1DP4A 2FXIA 3HUUA 3TD9A 4RU1A 4N03A 5IUKC 1QQAA 5CNKA 1YS6A 2A9QA 5HSGA 3LUGA 5FBHA 3HDVA 4H3KB 3O2JA 3A0RB 3ILYA 1E6LA 1ABFA 4RKRA 3CRNA 1QNLA 3H75A 3RVMA 1TVMA 3UUGA 1KGSA 4MS4B 3RVNA 4IMIB 4S05A 5CNJA 3OM1A 4HNQA 4Q6WA 4G0MA 2MSKA 4EVSA 3GL9A 3ILHA 1M5TA 2I6FA 2JVJA 4KQ9A 1NXXA 1YMVA 2FVYA 3K9CA 3Q7RA 5TPZD 5BRJA 3KKEA 3F7NA 4W5RA 3O21A 1RXEA 2FMFA 3C97A 1JHZA 2L17A 3JS5A 4ZMSA 4MS1B 1APBA 2E4UA 5JS2A 1Z12A 1ZDMA 1ABEA 2JK1A 1DBPA 2E4YA 4H60A 3TB6A 4NCAA 1W25A 4RSMA 1JYFA 2MYNA 1DC8A 1FSPA 3BREA 1JDNA 5JNTA 1LK0A 3P9YA 1NXTA 4G0XA 4N41A 5CHYA 2F8TA 1ZVVA 5TQ2A 1CHNA 2GI4A 1F4VA 1WETA 1EWVA 4QPJC 4DN6A 2PUBA 4XLTA 4LX8A 1JFTA 3N0RA 4W5TA 3NNNA 4PEVA 3RH0A 1DZ3A 3JPWA 5FWXA 1PUXA 1TLFA 5EWMB 2LUOA 2E4XA 3HCWA 4FE4A 1RZRA 1LJUA 3C3WA 3HDGA 5DCLA 3SAJA 4O1IA 1D5WA 3JTEA 3RVJA 3M6MD 3QLUA 3JPYA 2H3HA 3H5OA 1LBHA 3K4HA 4OLAA 4E7OA 3LFTA 1TJYA 3BBLA 4UHJA 4YGXB 4G0QA 3KTOA 1H9CA 1GCGA 1R8JA 3N0XA 2A9PA 4Q6BA 2FQXA 4ZPJA 3EDCA 5PNTA 3FFWA 3QLTA 3BILA 1Z13A 3KLNA 4WT7A 4MRMA 4RK5A 1ISRA 4YRZA 4GPAA 1MIHA 1LJLA 3H5VA 2PUEA 1YK0A 3C3MA 3IP6A 2LPMA 4RXMA 2X7XA 5EWJB 4RV5A 2PUFA 2QV0A 4KK3A 3H1GA 5EWLB 1JL3A 4MQFA 3KHTA 2IKSA 2V0NA 3M9WA 4LDAA 1I3CA 3TMYA 4LDZA 5TQJA 2ZAYA 2ID7A 3RVLA 2MYTA 2WWVD 2FEPA 1DCFA 1VLZA 2PAFA 4MR7A 1YMUA 2HJ9A 1YTUA 4RK7A 1BA2A 5HQJA 5JNSA 4E7PA 5BR1A 3VNAA 2L19A 4YLEA 4YCSA 1JBEA 4ZMRA 2MYPA 4RXTA 5DKFA 3FGZA 2IPAB 4L4UA 3OLZA 3H5TA 4JB0A 2CD7A 3OM0A 2PMCA 3NBMA 1SXHA 3QLVC 4JOQA 1QO0D 2WJAA 3GA5A 4RY9A 4WZZA 4FB4A 2PKXA 3KSMA 5IUJC 1JF8A 4IILA 5IX8A 1OXBB 4P1ZA 3TO5A 1USIA 1BDJA 2WJWA 4Z4GA 1YK1A 1E6KA 1ZH4A 2WB4A 2JRLA 4WXEA 5TQ0B 3DBIA 3D02A 4HNRA 1MVOA 3MQ4A 3H6HA 2QR3A 4MS3A 1GCAA 1YIOA 2FN8A 4NQRA 3W9SA 5KC8A 1AB6A 4EYOA 4G86A 4KK4A 2BGGA 4O1HA 3RVOA 4TN5A 2LBPA 4MR8A 3L6UA 5EWMA 5JNWA 3KS9A 5CNMA 2PE5A 2GWRA 3CNBA 4Z4FA 2LIVA 3O1HB 3HEBA 1E2BA 3VNBA 4ML3A 3BRSA 3LUHA 3RVKA 1QP7A 1DBQA 1GUDA 3KYIB 5E3JA 4G97A 4HYEA 3Q41A 2W42A 4LE2A 2CHEA 3KJXA 2JB9A 4MGEA 3MA0A 4DADA 3FMVA 1USKA 2PUCA 1VKRA 1P2FA 4DQDA 4WUTA 4MYRA 1FFWA 3JVIA 4D6YA 3LUAA 2PUGA 5D2CA 2R47A 2FLKA 2NUBA 4Z4IA 3QELA 1MB0A 2A9OA 3OLXA 3GT7A 4YV7A 3OLYA 4NV3A 4QYMA 2AYZA 3CKMA 3T38A 2N9UA 4RY8A 3O2SB 4KVFA 4EYKA 2FEWB 2HQOA 2B4AA 1DC7A 2QU7A 1NXVA 3EODA 1DCMA 1ZHHA 2JCGA 3CZ5A 3F73A 1DJMA 1D4ZA 3RVRA 2FLWA 2IPMA 3QLVA 2NZVG 4F11A 2VYCA 4JP1A 1DG9A 4RK0A 1NXWA 4D6XA 3HXMA 2QSJA 2RDMA 6CHYA 3RVQA 2R48A 3IP7A 4EGSA 2JVIA 3NHMA 3O2QB 3OMXA 5JNUA 3OLVA 1VPWA 4Q7EA 2RGYA 3D8UA 3O74A 3T95A 4W5OA 1U2QA 4RDCA
chains in the Genus database with same CATH superfamily
3ZR4B 5T41A 5KC9A 1BZYA 1FYDA 4OQZA 5FAKA 1BYUA 4RADA 2NT3A 1JQDA 2O1SA 4N40A 3ZHZA 2ODNA 3DE1X 3JQFA 1QOZA 1Y63A 2POCA 4ZCQA 3MHTA 4HG2A 3Q3IA 4GUAA 5FA5A 4CR7A 1VRVA 2Q46A 3IOCA 2YYYA 4WINA 3AESA 3EGEA 4QD3A 3V2UA 4UFPA 4ZOBA 3H4IA 3ZCVA 4UBJA 4E33A 3RFFA 4BCBA 4KV7A 4N5LA 2BGMA 4HWRA 5K0FA 3BXZA 3GWZA 1M2NA 1KAEA 3OOJA 5J2TA 3IMEA 1PGJA 3OCYA 2D5AA 5EMLA 1GZHB 1N3YA 4D79A 2QZSA 2EFDB 4YQFA 2XT0A 2Y0EA 3HU5A 3WI7A 2PBFA 5IANA 4WLVA 3L8CA 1H2XA 3F3SA 4CM1A 4CM6A 5JC1A 4NIMA 4X1IB 4M6WB 4M99A 4WADA 3VR1A 5LP1A 3DZ8A 5D3MA 1Y82A 2IOYA 1O95A 3AB3A 3DR5A 4GSKA 5L7WA 1MORA 1FMLA 5CFQA 5L7YA 2FMXA 4I1RA 1RHUA 3D1VA 4IJQA 1U9YA 3PSHA 3EUWA 1E0SA 2OSBA 1PDWA 3T5DA 3OZ7A 2OZKA 3NALA 2OOKA 3OWXA 4KTVE 2B37A 4ESEA 5LYYA 3HA7A 1TF7A 1X13A 4UAVA 4NU6A 3LK7A 4P7JA 1MAAA 5IAOA 2QTGA 2ZUBA 4IF4A 1X19A 3SMVA 3H1TA 1E7SA 4S0XA 1TZBA 3LVRE 4ZIRA 3ZH9B 3A31A 1E3EA 1JEQB 1Q57A 2AK2A 3DHNA 4IG4A 4IDBA 4X71A 5DI9A 4RHEA 2RI0A 1UQUA 2JA2A 3SJZA 2RKOA 3I01A 4QDUA 1RWOA 3DWEX 4NCKA 1KAGA 1O3YA 4PG7A 4EYGA 2HPHA 2QXUA 2HK6A 4D4IA 2WWRA 1TT5A 1U3WA 2JFZA 1FP6A 4LE1A 4KQ6A 2ATCA 4RM3A 1NDHA 1F0YA 2XCIA 1J8QA 1OU4A 2I7XA 2ZTMA 1YS4A 5IF3A 3U31A 3V2GA 4IUCS 3ZQJA 1KFCB 5IK2D 1D4FA 3SYTA 2AW5A 2A88A 1E60A 4PRYA 3STTA 1E9EA 5I9MA 2GAAA 4JDUA 4KR7A 3SE7A 3C7CB 2XVAA 4YACA 4Z2AA 4RDIA 4NMWA 4PGHA 4UVGA 3C6QA 3GG2A 4UHCA 4YRQA 3FVWA 5JH7B 4GKVA 4NPHA 3IKVA 3SIPA 2ZREA 1NL3A 2WKQA 3RVKA 1DRKA 2IXTA 2PVSA 3LNTA 4XASA 2CLHB 2C8LA 5TE9A 1P4SA 1KMQA 3I23A 4ZPXA 2EHDA 4WL0A 3FOFC 1QHIA 3OOHA 5I4IA 5B3JA 3A25A 3F7OA 4WY2A 3DONA 5DCYA 3GRUA 1M6WA 3QY9A 2XNDA 1USUA 3EJWA 2BFMA 1GPNA 3IEIA 4IEEA 1W1WA 5EYPA 4JKOA 1I2MA 5KYYB 1Q0UA 1GGKA 3L7KA 4LYAA 3NB0A 1ZM2A 2QE7D 1E6CA 3TQRA 4JJ8A 1FTYA 4G4JA 4RZSA 5LZ4A 3Q98A 2PBRA 5KKCA 4YT4A 3MEQA 3I1IA 3PUYA 3V7FA 1GRNA 3TNYA 2C8KA 4I5EA 2OEPA 3TI9A 1YZGA 2Q49A 1M3SA 3A6ZA 5FB3A 4L4RA 5BN4A 2XTZA 3FFTA 3FOWA 1B23P 2XAAA 5EQTA 4S0ZA 4N76A 2ZZMA 1JE1A 4IGAA 4ZXPA 1ZKMA 1MKYA 3G1TA 2H7XA 2NVUB 2AX4A 4RWZA 4EO7A 1HLFA 4P4TA 2AEFA 2H4XA 4HUQA 3PXCX 4B17A 5JHGB 4JA2A 1MU0A 2EF0A 2NUAB 2YN0A 5J47A 1XDWA 4YUZA 2NU9B 1FLAA 4NBTA 4U63A 5LQSA 1Z7WA 4FN4A 1DLJA 1I8TA 1G16A 1WV1A 4X0EA 2H11A 3ZV3A 3ORFA 4B5KA 3FTPA 7MDHA 4O4LA 2P62A 4CQNA 4IEFB 2WD8A 1OAAA 1TO2E 4PPYA 3MCAA 4YP5A 1Y33E 2WU3A 3UWKA 5LQJA 3TQHA 3UUEA 4YJ2A 1EX1A 3CCBA 2JLQA 3H2SA 5FO0A 3GJRA 3CFYA 3LT5A 5C3MA 2GA8A 3AK4A 1Q15A 1NW3A 2X86A 1E5VA 4Q3EA 3U0BA 1TD1A 3A36A 2VUUA 1CS0A 4XQCA 1DPGA 3H8SA 3JVEA 2NXNA 2ERYA 3HBJA 5GOTA 1FYEA 4XVQA 1K68A 4FEYA 1N1EA 1P2BA 2JCVA 3TTUA 1KPIA 2XRFA 3RUFA 3SF0A 4P4LA 4BP3A 4UPVA 4CETA 4OQMA 3UMGA 2XDYA 3RIHA 2QMHA 3QU4A 4P3KA 5T7BA 1SN7A 3B53X 1UBGA 3FMIA 1U0SY 2OP0A 2OG1A 2ZJAA 1W0KA 3FYUA 1WHSA 3L3BA 1E0DA 5AMXA 4DG9A 1BDBA 5L3QB 3K0CC 3U3XA 5AK5A 5IM4F 1V26A 4DCMA 1IVYA 4HC4A 3EWSA 1XPOA 4JS0A 2HLPA 4HQRA 3DBVO 4CV2A 3NI2A 4ATNA 4IMRA 2H1OA 4FEGA 3UC9A 5I7AA 1FS6A 5T6MA 4WOCA 2PYIA 4TV8A 1R6XA 5I3ZA 1XELA 4TQAA 3KT8A 4XI9A 4MDYA 3Q6NA 3NCTA 4X6LA 4B33A 1IHXA 4EFKA 3A1EA 2VDQB 2XMRA 1P4GA 4RV4A 1EMDA 1KJNA 1RXIA 4EEKA 4OXNA 4PYJA 2NMVA 1LPOA 1JXMA 1FW6A 2A1UB 3BIXA 4F9FA 3U61B 4QOIA 3LCMA 1J56A 2C4UA 5HA5A 5FBZA 5GGYA 3PJRA 3FRHA 2YYZA 4D9KA 1EGQA 1UAGA 3BRCA 4A6PA 2PGXA 1JG4A 1IHDA 1RE0A 3E7FA 3AXSA 4K5QA 2C3OA 1HGXA 1U7PA 4YJ3A 2W90A 4C5AA 4Z9FA 4Z4HA 1MHTA 1PNTA 1R0KA 1XTIA 2C1XA 3DTVA 2E4AA 1ZC3A 3ESYA 3AU9A 4ZGBA 3MQ2A 1M1YE 1B6SA 4XRRA 2OQVA 3EAQA 4F3NA 4B2YA 1J09A 1JQEA 1U9IC 4KAJA 3W4JA 4D8TA 5F5LA 4BU1A 4EUSA 2OCIA 1FDWA 2BRUC 2QRQA 3I3SR 5D7NA 3OU7A 4DBVO 4IVQA 4JOSA 1I7DA 1OW3B 4KW7A 2JJ1D 3J81A 5LWHA 2AZTA 3WO1A 3R3ZA 4LJAA 1P29A 1ZBDA 4ZJPA 1A5AB 2VHEA 1PUIA 1QLWA 3CQ9A 4ND8B 3VPGA 3GU3A 5HF5A 4BLWA 1WHTA 2OCXA 2GXQA 3FNFA 5BT8A 1WSDA 5FJJA 1Z29A 2C9ZA 1Z0JA 3QNUA 3ZWXA 4QRDA 4LF8B 2FGJA 1DI0A 2B8EA 2FE1A 2PR2A 2VFAA 3FDFA 4JZKA 4KX5A 4AURA 4DCNA 3KQLA 3WLEA 4RTRA 5K1ZA 2QY9A 1XVLA 4RQAA 3CN9A 3ZW7A 3PC8A 2O06A 2ZB4A 4BBJA 2BM9A 4EHJA 3K0SA 1Y5IA 1GCIA 1G2OA 1SQ5A 4I55B 1G3QA 1NM5C 4HQKA 5AM4A 1HM5A 4Q37A 4B32A 3UVEA 3UMJA 4IJ6A 4PLYA 3LUGA 3HDVA 3HH8A 4M55A 4H3KB 3LVBA 3WLQA 3ZPXA 2QN2A 3ETGA 3QKRB 1E1NA 3FXAA 2NPIA 2P2DA 5T3UA 2XY4A 3FPEA 3IL2A 3P26A 2OO5C 1PGPA 2QT1A 1PG5A 2CL0X 3ET4A 2X19A 3D8BA 4QHSA 1LPMA 3TBFA 3DP7A 1FDSA 2V3VA 4H4CA 2KM1A 1ESDA 3R5KA 5DIZA 4C2AA 3ILHA 1NJ1A 2H59A 2GPSA 3MJFA 3DFMA 3NHRA 4JGIA 4H6WA 4UU7A 4LQ4A 4D4LA 1IWPB 2Q6VA 2Y8EA 3E3OA 5IF9A 1VKZA 3EW7A 4RNCA 3F6SA 5EEHA 1I4OA 4NBWA 4BX8A 2WWIA 3KC2A 4IH9A 1HT3A 1QO7A 4TKVB 4WIAA 1XPUA 2DLDA 3WZMA 3OHPA 1ABEA 1NJGA 2Y1LA 4JNCA 1L5WA 4M4SA 4JI6B 3INTA 5JAUA 5EKDA 3WK5A 1DB3A 1YZKA 3DMFA 3NWBA 3O4GA 4B0OA 1BHJA 1VG1A 1AHIA 2AEJA 7REQB 4CEIB 2B4KA 4BJ1A 3ZJYA 3BSWA 3C5VA 2ZULA 4UTXA 5LJLA 4AJ4A 2FMUA 2J30A 4MX8A 1MTOA 3CNOA 3TD2A 4ZTUB 2SKEA 2CBXA 1N2EA 1FSSA 2G9VA 2HU7A 2P68A 4LSGA 2WFMA 3NBZC 5C81A 2D7JA 1L5LA 2W98A 1TU3A 2JIRA 2VQDA 5F52A 3E03A 1Q0ZA 4XJSA 1R3UA 2Q50A 2ZTHA 1US8A 3A9WA 4JYBA 5CGZA 5CR9A 3TNLA 3TQTA 4RAOA 1WZEA 5IHPA 3KTFA 5EJFA 2AFHA 4OX9B 4QBIA 2DLCX 3O84A 2NZWA 4GP7A 2OHFA 4QOGA 5IVPA 3T1YB 1A5SB 5FA8A 5KNCH 3ACCA 1JJIA 1ECBA 3AEKA 1U0BB 3QMVA 4KN8A 3LFTA 2OQ2A 1QH8A 3CVWA 1EVEA 3KWFA 1KNQA 4KQXA 2VUSA 4C08A 1C1XB 5TY0A 3UMBA 4GSYA 1AKEA 1NX9A 3RTEA 1D04A 2JBHA 5GJVC 1XXHE 1N9ZA 1GPDG 3N28A 3Q1LA 4OHKA 5G41A 1FBNA 5L4SA 2ZYTX 4HDMB 1F9AA 3Q3CA 4YMIA 1BGXT 4O8ZA 3RIXA 1EEXB 3NIBA 4TZKA 3WMRA 2H9YA 2XE7A 4BB5A 3TNJA 1QCZA 1ESMA 2HIHA 4M1YA 2N3ZA 3PKJA 1IEVA 4LDAA 3UBTA 3ZV4A 2QWXA 4YHBA 4D9CA 3O83A 2XH8A 2GILA 3AVQA 1THTA 3QGMA 2OV6A 4U5XA 1G98A 2Z2KA 5D5PA 1SHKA 2FW9A 3DFUA 5BXQC 1GGNA 2FEPA 3AIIA 3VMFA 4V0SA 4GC9A 2PAFA 1O58A 1NF3A 2JC3A 1SU4A 4YB8A 5H8WA 3FHJA 2ACWA 2CLDX 4OP1A 1X2EA 5BR1A 4FTWA 5EXDA 1HOTA 2WAOA 3F5FA 3VNAA 3UHAA 4B4DA 1CR6A 4BNWA 3FVVA 1SXJE 4ZMRA 1XJCA 2MYPA 3PHIA 1X38A 4ND2A 1L7DA 1BXGA 1RKVA 3L02A 3LQYA 4UC0A 2B5WA 3K8ZA 4WX2B 1Q95A 5FL7A 4CQLA 5JROA 3UICA 4JB0A 3HJRA 4DZZA 1NE2A 6ADHA 4I4NA 5H02A 2X8WA 5AO9A 3WSVA 1X7YA 2ZCJA 1JJVA 2NV0A 1FS4A 4KQ2A 1NYRA 3PNBA 2CLOB 4KUGA 4ZT7A 3B78A 1FRVA 2C0CA 4ZT3A 3DV2A 3WXBA 3H13A 4AZWA 5IUJC 2X5NA 4HPXB 1CF4A 4WHMA 1CY2A 4MWTA 1H05A 3MRXA 2BAGA 3QWFA 2LR0A 2WJWA 2AX3A 1TPZA 1U7HA 1WMAA 2ZG6A 2HJHA 4IHQA 3L1KA 3TDMA 1DMRA 1LZLA 2HHLA 2JRLA 3NHWA 4WXEA 4EHKA 5HMLA 2ZDHA 4EEXA 1VL1A 5E8JA 5TF4A 2X0FA 1T8UA 5L45A 1DIHA 4JCOA 4DIEA 3BRWA 5EIWA 3UJCA 4E22A 5I47A 3COZA 3FNEA 1ZOSA 1VOTA 1Q44A 2LCFA 3IDAA 4CE6A 4DLYA 3UV6A 1OPRA 4O4HF 5ADWA 4R1NA 3WO0A 4MR8A 1F6WA 1SJ9A 1XTJA 5KVAA 1XK6A 1RRVA 2XUKA 3LO5A 3TR6A 3ANXA 4GR4A 3F2VA 2D1FA 3C74A 3QVTA 3LLSA 1ZD3A 3FKJA 3HVJA 1TRKA 3AF5A 2ONZA 1PR3A 4EFNA 1DBQA 2HLDD 2ZW9A 2YY7A 1BMFD 3C3DA 3HCBA 2AKEA 1HWYA 2TYSB 4LDPA 1GA6A 1VG8A 4AB1A 1BEZA 2QEQA 3CJQA 4NTZA 2QB5A 3PBKA 3CUVA 4U2GA 2WP0A 2CLLB 4K9LA 1MAWA 3ESAA 3MFYA 4QT4A 1VKRA 5ALQA 2BVNA 4ZVNA 4DUGD 5KTTA 1RWVA 2G5GX 2OYCA 1XLTA 2IT1A 5HBGA 4WJLA 4A0SA 3FVTA 1UMBA 3ETDA 2O6LA 4US1R 1G8MA 3MPUA 2E9SA 4Z8YA 4OFBA 5ELLA 4YV7A 1HQDA 1FFXA 3W6PA 1Y6JA 2QLFA 3JU3A 2AYZA 4WOBA 4BJ3A 4C6TB 4BNUA 3EA0A 2ZTUA 1A9QA 1DQZA 1POXA 2B4AA 2HQOA 2M9MA 2QTFA 1M75A 1U2EA 4KSYA 1IB0A 1JIJA 2H1FA 2ZI3A 1IJFA 1PQYA 3N9IA 3F73A 2OFWA 2VF5X 1E1CB 4GVPA 3AEUA 3U2QA 1SIOA 3S5UA 4Y2XA 3VR5A 2G82A 2IQ5A 2XGOA 2XSZD 4ZAWA 3LBAA 3R23A 2Q4EA 3KB1A 6YASA 1EVIA 3TXYA 2YIJA 3WLKX 2XDQB 4FYYA 5L4LA 3BIFA 5HCUA 3TIFA 4R51A 2IELA 2CLKB 3T7DA 2RGYA 1HE1C 3EPLA 3HVHA 3H4VA 1JDTA 4L4YA 3K20A 2V5VA 4GKAA 4QKQA 5IXSA 5KJCA 4KPFC 1WG8A 2DFLA 2Y1WA 4L85A 3BK1A 4NENB 5NLLA 4LDQA 1FVXA 2CVHA 4NICA 1QGAA 3O7WA 2WAYA 4K9DA 4F04A 4N1AA 1M9NA 3T7IA 5A9RA 3QEMA 4C0WA 4OHXA 5C5CA 4ZK6A 2PLFA 4R6WA 1Z17A 3VH3A 4D8VA 3V8NA 5KSWB 5ER9A 4F7WA 3U44B 2IS6A 3ZHOA 3DPUA 4LK2A 4CQJA 3OPVA 1GTMA 2P77A 3TEFA 4YUVA 3E4CA 1N2BA 4BMCA 2FEXA 3EUAA 1CKEA 3R7SA 1AH2A 3FJOA 3UJ6A 3NNSA 3ZVRA 2WG0A 3CUEF 2ZWPA 4K6FA 2CUZA 3EY4A 5H83A 1E7WA 4IMJB 3D9QX 2BR5A 4MUXA 1YRWA 5MFZA 3IEVA 1JDUA 1UJ6A 1IONA 1ACJA 5J2UA 3W6NA 1MB3A 4PZ0A 2X9NA 4K40A 5EZYA 4RORA 2MTBA 2QAGC 3NVAA 5EE5B 7ABPA 3WRYA 4DDKA 1NRWA 2YHBA 5MGNA 1Z0AA 3O31A 2ZT6A 5ALZA 2Q2NA 2GESA 3G8CA 3OP1A 4JSRA 2B25A 2KLBA 4FUTA 4PYMA 5F1KA 1MH1A 3ZS9A 1UDBA 1PFGA 1IXZA 2AQKA 2A0FA 5CFNA 3RBVA 1CB7A 1HZZA 3HB9A 4YPFA 4RPIA 4YWHA 4MUJA 4UUAA 3K0FA 2K4MA 3U9LA 3FKSA 3QOYA 1VJCA 2ZVQX 3KBOA 3ADCA 4AKIA 3KPJA 5IC4A 1PJZA 1V8DA 2X8AA 2XBLA 3NCHA 3H0EA 4INJA 3TTSA 1EEHA 4ARIA 1VJRA 1E18A 3OQIB 5EIFA 3LC2O 4JITA 3BWEA 1SCBA 4PQGA 4YY3B 3HSYA 4MA4A 3K9NA 5FI5A 1CQXA 1NVBA 2HTFA 2WNSA 3M5WA 3W4IA 5A3RA 2GTPA 3BEOA 4GX5A 5CXSA 1QGUA 3USZA 1UFQA 4B2PA 3BC1A 1QX3A 4RD1A 4R05A 3T1VA 5DYWA 1SG6A 1E5QA 4X65B 4CTJA 3DD5A 4Q03A 2DGDA 2XJ4A 3TTVA 5JOQA 1HZJA 4A2PA 1HEUA 1EUCB 1RYZA 3R5HA 1SBZA 2ADMA 2J6BA 4FHZA 2H07A 2PX8A 2QP3A 5C1DA 3NO4A 3PP8A 3D4IA 2VUHB 2UZ3A 2XXAB 4Y9DA 1IZ7A 1KK1A 3D8RA 4KR2A 3GLHA 3MPOA 3BB1A 3BQMB 4R16A 1ZWLA 2AD5A 1YKFA 4HQ0A 3E15A 3R7WB 3CG0A 1I32A 3BGIA 1SCAA 4FYIA 4I66A 3A1NA 3ZJ4A 4R2MA 4DARA 4YRNA 1QVVA 2VDPB 3HPRA 4L6AA 4AX8A 1VJDA 3E22A 4PGAA 3CF2A 3A1VA 2WTUA 1D09A 2R44A 4E3WA 1A9ZA 3TQFA 4CFYA 1GNVA 3BWBA 3FCXA 1K9SA 3IIJA 2WM9B 4AICA 4NDAA 3IOYA 4EYSA 3P0IA 2PU5A 3IR6A 1NUTA 4P3XA 4EB6B 1XP8A 4R2JA 2B4RO 3KELA 2XRYA 1CUFA 5C34B 4NL4H 2FPSA 2FV8A 1REQA 1YQGA 2FPMA 3HV2A 4PYOA 3W8FA 2WIDA 1NQ5A 3AC0A 3F6EX 4OJKA 5JSZB 2RHHA 3JASA 1ETHA 4YECA 4XCQA 5AVQA 3KT3A 5GZ3A 5EQDA 3LSTA 1P3JA 1YVRA 1NT2A 2ETVA 2H06A 5KVSA 3MMNA 4R2WA 5ABPA 4PZDA 1YQQA 4WNAA 2HFJA 3P5BA 4PYRA 2ZJ8A 1USVA 4QHYA 3NORA 4PE5B 1SK8A 1NY5A 4RA9A 3SZLA 2J5XA 1OXXK 3QX7A 2WNHA 1FNBA 3AFGA 4KKXB 3AOGA 3ADDA 1ISHA 1PD0A 2GXUA 1CUXA 2J08A 2ZETA 3UGTA 5IFLA 4NMXB 1PTJA 3C7DB 5EG5A 5FWYA 4PLTA 4HNVA 2BZ1A 1M72A 3OUUA 1XFDA 3A4IA 4NJEB 4R68A 2UZAA 4U9IS 3RLFA 1JLKA 2BR3A 4MRAA 2HCTA 3W2TA 1ZUWA 1UJ2A 4MGYR 4C7KA 3SFTA 4G4IA 4EPXA 4CLOA 3JQCA 2W71A 2VDUE 3SVLA 1MIOA 3FZYA 2OD2A 2CKDA 1NUSA 1JFVA 2ZS7A 1GQQA 1KQPA 5M2QA 3PEFA 1UPAA 3TRJA 1VHDA 2FSUA 3ZJTA 5E2AA 1O08A 5KEIA 1CDDA 3GDHA 2A0KA 4RUKA 2BGUA 1K5GA 3F6CA 5KO2A 1S9HA 3BE5A 4F12A 1MX3A 3W8RA 3UXEA 2C4HA 4L2IA 4V3CA 4MWBA 3JAKA 2IV7A 2R8ZA 1KZHA 1HL7A 3TKYA 4PLZA 3GN1A 4HO1X 4A8TA 2FCRA 3O4JA 4PAWA 1M2EA 4IRMA 2BGTA 1MQSA 4WBNB 3IP1A 2JJ2A 3RRXA 3TMAA 4EY4A 1UBKS 2QN1A 3B3QA 2PX2A 3IUPA 1VFNA 2HJGA 2BFAA 3UEOA 2MDTA 2XLBA 3A9UA 4HXYA 4Y0AA 1H2HA 1CZKA 2H65A 2JGJA 4MVWA 1JZQA 5BSWA 5JO0A 1XDZA 5K45A 4WN9A 3DBRB 1YDWA 2P9FA 3MJTA 4HX5A 5H7XA 5AW5A 3VC3A 1K75A 1DBVO 3DZJA 4V02A 4O25A 4TYMA 4XYGA 2NYAA 1M34A 5DGHA 5DM0A 1M76A 5KYVA 4O2AF 3V3KA 4K0RA 2C2GA 1EFTA 1V7CA 3PIDA 5TVGA 5KQMA 3OU2A 3IQWA 3F4BA 5G0UA 3EXG2 4YV0A 2JLXA 3PXUA 2ZT5A 4EI8A 2XKBA 2ZRHA 3AU8A 3HY4A 1R0YA 2B34A 3R7LA 2X8JA 2DBRA 3GBPA 2VRWA 3D0KA 3I2KA 3OC0A 3PK0A 2AG0A 3HKBA 3I12A 1GGMA 3T5BA 2XMPA 4LJYA 2GZ3A 5COAA 1RLUA 1V11B 4QBHA 1HYGA 4OQYA 4DL9A 4YK7A 3RHTA 1I24A 1LK5A 3LGXA 3LYLA 5ICEA 5B53A 4J7UA 3OO0A 4DJ5X 2H4ZA 5DCUA 1WNFA 2SICE 1E79A 2PZMA 3K0KA 5GVRA 4D02A 1ZR2A 1OQAA 1PVOA 3FPLA 3ILVA 2L2QA 2M1ZA 3AW9A 1QB7A 1Z08A 3MJSA 3QX9A 5IZCA 2CT8A 4DREA 4PLCA 4AFNA 4V24A 2C3UA 1DV2A 1WUYA 1DRUA 4B48A 2J6IA 4CQMD 1U0RA 3ONFA 2HOQA 3A2NA 1ULHA 4FHEA 2GJAA 1T5LA 1PNQA 1IHPA 5L3SB 3OTQA 2DSNA 2Z56A 3AESB 2PLNA 1CJVC 5F4ZA 2FR8C 4Y67A 4BO0A 1CUGA 2V8BA 4NFYA 3WWCA 2DFPA 5K0TA 5DNYB 4I1YA 3ZDXB 4RHUA 1QHHA 5J2TB 3D54D 1ZG3A 2DETA 4G37A 1MRNA 3H0CA 3WDMA 2IPXA 4YRJA 4PGGA 3V4OA 5DOZA 1MRSA 1QDLB 2A33A 1O89A 3EBOA 3OX3A 2E49A 3MWLA 5BN3A 3IP5A 4P7FA 3UY4A 1V7QA 2J07A 1G21A 3E7PA 1Z8FA 4ZRMA 1XWWA 4AD8A 3D3QA 2ZROA 4KFUA 5DHSA 3FNIA 2FZ4A 1ZK3A 1MDBA 4R2LA 4IHKA 4Q1CA 1PZGA 2JGLA 2IE8A 5HUQA 4N6GA 3IO5A 4GICA 2F67A 4OFWA 1KJZA 1X7DA 4DSTA 1GDDA 4RYDA 3I0NA 2BTOA 1QNLA 3NHLA 3OE7A 3UUGA 2WQ7A 5KYUB 3GRKA 3UJPA 2C1ZA 3I62A 1EAMA 2C88A 1SVUA 3MAGA 1TKRA 1XZEA 1M74A 2NYUA 3IT0A 4I4IA 4ZIRB 3VNVA 5TMEA 4QUJA 4N7RA 4EP1A 3SPXA 2HRBA 3WL5A 1K27A 1RXWA 1UQRA 3DMDA 1RQ7A 1RZ3A 4K1XA 5BUQA 3PLNA 1Z8DA 4M60A 4D0SA 2DH6A 3QP9A 1H4TA 2HB6A 5CEEA 2BH9A 3AFIA 5HFAA 2ZGVA 2IUTA 1H6AA 3L07A 2IW1A 2WJ6A 4GX1A 2BKAA 4YCNA 2GXAA 5T4BA 2AFIE 2WHEA 4NPCA 4B43A 4EPTA 4NCAA 5KOHA 3KEGA 1U0FA 3N2ZB 1L4UA 3PGJA 4HY3A 3KO8A 3FYCA 2DWQA 4O0LA 5JZVA 3V7UA 5EUMA 1PZFA 3O5AA 3RS3A 5CHYA 1SUEA 3QVUA 4LKRA 3V2HA 1H8EA 2WAAA 1W5BA 4I0WB 4X20A 4QG7A 4YCAA 1EP2B 3VU0A 5JFGA 2PUBA 5ADVA 5AHWA 3VU9B 5AXBA 4PEVA 2PZGA 1X7ZA 3QYJA 5JAMA 3TJRA 4LNUA 2FZWA 4FE4A 3BJIC 1A96A 5EHXA 3C3AA 2VCYA 1W2GA 1LRLA 1QJ4A 5DCLA 3X0DA 2YXLA 3S4YA 4JXXA 2R9VA 3WP0A 3QU7A 5A4KA 2BR4A 2V45A 5HG0A 3M6MD 3QBVA 4BNVA 1ZUNB 4L51A 3DBOB 1SCKA 2QDKA 2XOKD 4V0MA 5EYPB 3LZCA 1UZLA 1LX6A 5G53C 1TJYA 3JVVA 4CMBA 1M1YB 2WMDA 2IPOA 3NM5A 3ABQB 2G1KA 3EHDA 2UZ1A 3V4FA 3GPBA 1H9CA 1R8JA 3E5MA 5A9SA 3OPXA 1TKCA 2PJRA 1WBJB 1IZZA 1JFFB 2QUJA 2OO3A 4ENTA 2YKGA 1ZGCA 3HXKA 3B13B 1D6NA 4NCJA 1EGHA 4WT7A 5CT9A 1P1HA 5BN4B 3RU3A 4Y6SA 4YRZA 5JUWA 4HDOB 4L78A 2RC5A 4LYHA 1K6JA 3C3MA 2GTIA 2ZYIA 1I01A 4RVNA 2SKDA 5DNEA 5K6RA 4HB2A 3HYTA 5KNBA 2PFKA 2ZRIA 1FBTA 1D9ZA 2BEUB 4HUQB 1ULUA 2AVNA 2CDBA 4U2DA 1L5SA 3PQ8A 2VP4A 5DWQA 1NX6A 4A2QA 4F96A 1V5WA 2PX0A 3DSRA 1HT2E 1UOPA 1UBHS 1P45A 1YMUA 2VTEA 1FNSA 4XB6B 4PQYA 5HQJA 1E77A 2A0YA 4IHJA 4P7GA 4R84A 2PRSA 1TM5E 2HREA 4N3CA 1NMYA 1RACA 1WXEA 4O4LB 3RS7A 4JL6A 1CUVA 3SHOA 3ZOZA 2BMAA 4AX4A 4GI7A 3EXHA 4UVHA 1O6CA 2DFVA 3EGVA 2P5SA 2REBA 2RG7A 1OZAA 1EHIA 2PN1A 2Y1GA 1ADYA 1UDXA 2GCIA 4IXTA 1NN5A 1TGYA 2A4MA 3ETCA 1T8SA 1Z28A 2HI0A 3H42B 4JIGA 4Y2RA 2D59A 3AI1A 1N3LA 5HIJA 3WGIA 1QU3A 4BUJA 4OX9Y 2M6RA 5LXTA 5B6IA 1GZ7A 1TD9A 2A94A 2WINI 4HAXA 3H9UA 5EJ7A 5J4VA 2RGRA 3M4XA 1NVVQ 5ECWA 3R7BA 5I7RA 2IU4A 2ZSEA 2RJ3A 2ECOA 4QOHA 3AYZB 4BLVA 4FGKA 1GCOA 3A06A 3ENNA 4WY5A 4YQZA 2NP6A 1YIOA 3JQFC 5HWSA 4C78A 2Q1SA 4YASA 3VO1A 2E87A 4OB6A 3I04A 4LOHA 2VO1A 3WGNA 3SHFA 2AOTB 3HFGA 2IUUA 4IIJA 1C7QA 1RP1A 2C42A 3FF4A 3ZHXA 4E51A 3W34A 1G18A 2YWXA 3LRTA 1IOLA 4INAA 1CULC 1XZLA 1LVUA 2AR7A 2M1XA 3BRSA 1S2GA 2ZKIA 1ZIYA 3EXG1 1GUDA 4LIPD 3VPCA 2BGRA 3OE4A 2ECKA 3QKWA 3N2LA 3A05A 3ZYZA 2W42A 3GX1A 4CQMB 2JB9A 4PNEA 4MV1A 2XHEA 1I0IA 4BB9A 4KRYA 3PYXA 1PFKA 1O95C 3MWGA 4G4SP 3BWMA 4EB0A 4BS9A 5EXEA 4JYMA 3WNVA 1PFYA 5DW0A 3V4RA 3ED5A 3TCNA 2VHTA 3DMNA 1YMQA 4FP9A 4UNNA 1KJYA 3GPIA 2VWPA 1XYVA 4KO1S 4EKGA 5CH3A 3L5OA 1UKZA 1Z5UA 3AUAA 4J4BA 4PBSA 2QVBA 5B7GA 1GADO 1UFOA 1FFDA 5EHNA 3TG8A 4INOA 1UEIA 1G3IA 2JCGA 1C0LA 1JQ3A 1XXHB 5A1TA 5IXJA 1A7JA 2VNSA 1GL3A 2OCYC 3L7MA 4PQFA 5BQ5A 4B6SA 2XI4A 3DTVB 3GLVA 3G7NA 2P3SA 3DT9A 3GT3A 2FPPA 4J8PA 5DXJA 3PQ4A 3TPCA 2P9CA 4E21A 4XYMA 2GSWA 4ZMBA 3PXDA 3OZSA 1C8BA 2ZEJA 3DDWA 3KT6A 2YJ3A 4RIGA 3PJEA 3NVDA 3GLGB 3GP8A 4TYQA 1RBMA 5G0TA 4DBLE 3HJCA 3JSAA 2I6QA 4RMHA 2CXQA 4FUQA 3PR1A 4GYWA 1YQ9A 3URKA 2NZ8A 5JQGA 2X4LA 1XNHA 2AQIA 2VHUA 3CSSA 3FPSA 5DW3A 1H2AS 3FBWA 1KBOA 5C4IA 2FK8A 3MCVA 4XM1A 3BFXA 5F12A 1YS2X 3AY7A 1E2LA 2QLJA 2ZE6A 4PZUA 2P1RA 4EABA 5GQSA 1VP9A 3MSXA 2JCXA 5HEKA 5B3LA 3ERCA 4TUYF 2PZEA 4RK4A 4W5NA 4FLFA 2BFBB 4GQAA 1T9AA 1VL6A 5IKPA 5B3JC 4MDHA 3A0UA 1KE1A 3H17A 1XHEA 1Q83A 2HBQA 1VKNA 2JIMA 1WCYA 4IEIA 1Z26A 1GT6A 3QQ5A 4HAZA 4HCJA 1D0IA 5JJ5A 1CUAA 3TZCA 3O4IA 1XHFA 4J0IA 8GPBA 3SLRA 1KWGA 4KE6A 4O4HB 1X14A 2YDXA 3F3MA 3D0RA 4RE5A 2W2TA 1W4ZA 4KXFB 2OV2A 4QTUB 1KDVA 3VNSA 1U2SA 4M88A 1XTPA 1D8AA 1B2RA 4IHJF 5SZJA 1KDOA 4M7OA 5EMHA 4DCJA 5AUOB 3HB4X 4AI6A 3U3KA 5A4IS 3FNHA 3OEHD 4L5YA 5A3VA 2IDJA 3Q9UA 5I51A 1NU8A 1O94D 3L8GA 1GSOA 1CBUA 3DLCA 2P5TB 3U7EB 4C0XA 3CZPA 1IY2A 1HFWA 2SCUB 5DXAA 1IWOA 2ODEA 2VHZA 1C9EA 3LXMA 4QYXA 5CH8A 2FG6C 1RP7A 1T4GA 1X8KA 4AKSA 4XAQA 2QRNA 4DXHA 4N9QA 1Z5WA 2AB0A 2N46A 5LQKA 4IUDS 1DARA 2Y9PB 1GAWA 1W5EA 2OVFA 4JT2A 5D87A 2Q0XA 5LXTF 3VZSA 1FDRA 2A78A 3OZXA 4U5QA 4DIBA 3QKSA 4BGEA 5AVWA 4M1WA 1TW3A 2QL6A 1NVTA 4EG6A 1RIFA 4LYDA 5JJKA 4R8VA 3M9XA 4R0NA 4J75A 4I2NA 2GN9A 4BFZA 4OQEA 2ZUFA 4DSNA 1L7PA 2AE2A 3V42A 2WV9A 2YJ5A 3T4XA 4A7PA 2GO7A 4Y2SA 1M5RA 4BO9A 1HRDA 2Z5GA 4AK9A 2A3NA 3O3CA 3J7TA 2RHTA 3A8TA 1T15A 3CUTA 3ICVA 3K73O 3OP4A 2RSLA 4PF1A 4XDHA 3T1QA 4AN4A 2X0JA 5LUBA 3TTYA 2AZ4A 1LQTA 4IIJF 3X3HA 2QG9A 3HACA 3MS7A 3P9RA 2JLWA 4IIYA 1JJBA 1LGYA 4HQ6A 1HT0A 4KPGA 2C2KA 2JKYA 3AEKB 4G5OA 4MULA 4EAQA 1XQXA 5LWQA 3OQMA 1JHRA 1GPJA 5EKUA 3E58A 2OSVA 2G77B 2DCMA 4W6QA 2IEDA 1ZIPA 3IELA 3RHFA 2C4WA 4ALMA 5DSZA 2FEAA 3EDMA 3FPHA 1Z15A 1M2JA 2HU8A 2X22A 1EFRD 3CXRA 3DEFA 1GPUA 1QS0A 2CB0A 3A70A 3PFCA 4QTYA 5GY7A 4R9VA 1T26A 2ZB8A 3FYUC 2JAUA 3T3MB 4YMGA 3FPKA 4J49A 4LKOA 1F2DA 2FAXA 4L72A 2YC4C 3RPEA 3UTDA 3RRYA 3ULKA 1Y1PA 1P61B 3K96A 3FYTA 2WKRA 4HDNB 4UUOA 2QZJA 3V48A 5BMOA 3J7AC 3B1VA 5DBHX 2I6SA 2QRVA 2D5IA 3I76A 3G9QA 2NU7B 1W88B 3MXTA 4HF7A 1E6MA 3FI0A 2FSSA 3DUFA 4BWGA 2AT1A 3D6VA 3M4ZA 1N6NA 1R8QA 3G1WA 2WWGA 3GJSA 1KPHA 2IY8A 3K4QA 3M3HA 3SP1A 1RMQA 3VDNB 4LF9B 3QPBA 3H8JA 4CR6A 1K6IA 2BEVB 3KETA 1SG0A 3LXXA 3U4AA 2HKIA 1Q16A 3CN7A 5D5HA 3ZWOA 1PRYA 1GTG1 1KDTA 2DF8A 3U6BA 3DJFA 2Z2YA 1U0GA 1X3LA 2JZOA 2NQ8A 3EFBA 4BQFA 5C2JB 4HVAA 4DV2B 5JD4A 3CWCA 2Q3EA 3AH8A 3JWJA 4CQLB 1EXNA 5HJ7A 3SN6A 4A8JA 4OP3A 1C9KA 2HV8A 2PRZA 3VGJA 4MMYB 1P2DA 4IIVA 4FNMA 5DHFA 2GFHA 1X7YB 2PS3A 2YXPX 4H4DA 1R6VA 2V03A 4DV5B 1A2QA 4BUZA 3WXMA 1PLLA 2AOXA 3ICCA 3KHUA 3U3MA 1RD4A 3ZU4A 1D1PA 2V6FA 1D0VA 1RYDA 3PQ7A 1S8OA 1J8FA 4Z9AA 5B4VA 5BNIA 1GAQA 4XUGB 5E6SB 3ZZMA 1Y48E 1TRHA 3NVMB 3OI7A 4IS2A 2TMKA 2WYHA 1E1DA 2QD4A 1P91A 1SG9A 2I6TA 2J48A 2R8OA 2X0RA 3F8SA 1YZLA 3NJRA 5AKZA 2KYRA 2C00A 2P9QA 4OKIA 3CY6A 3OC6A 4MKRA 1YB1A 1YL7A 2NZUG 4BTEA 5LMCA 1NWHA 1ZGGA 1GKIA 3LH5A 2L18A 2R86A 3ZK8A 1VLLA 3COVA 4YALA 5ELMA 2V98A 4LY3A 3WK4A 3BH6A 2PAAA 3GR6A 1E1QA 1DDOA 1UQTA 3HWX1 4L8WB 4MR8B 3BZBA 1KVUA 2O3JA 2RGGA 1F0NA 4I1IA 4KN6A 1XMSA 2ZIUB 4RQUA 3UOGA 4C5BA 4MJ7A 3RW9A 4AMBA 4BTLA 5ILOA 3JQ9C 4C1NA 3EFOA 3IBCA 1P9RA 2RIPA 3HADA 4E5PA 5KTKA 3D8HA 3PC8C 3FAZA 5IAAA 1N0VC 3U4IA 4QNMA 1JXQA 4KQFA 5LBUA 2GBCA 4F92B 2JI7A 4MVJP 3ZCRA 2GKSA 3WVNA 4D42A 3N05A 2KBEA 4G9GA 4W9MC 1KETA 3PCXA 1SAYA 1UMBB 2V7PA 2CSUA 3MLAA 3MOGA 1FVFA 3ROZA 4EVRA 5JCJD 4L5CA 4Y2QA 4GQIA 1VRWA 3VR6D 3CLUC 3N6RA 1EGVB 3V8PA 2XZTA 4QYTA 3PFBA 3NTVA 3ZHSA 2PMDA 4RPKA 3UANA 1KSFX 4PC2A 2F8SA 4ZA2A 5C8ZA 4M1EA 1E3QA 2YV3A 2ZFUA 4A26A 2VPZA 1ZAYA 2W93A 2FGKA 4MQUA 1J2RA 2JPDA 1M67A 1CJBA 2PS9A 2Q99A 2YOFA 3W6ZA 3M5PA 4BVBA 5B2EA 1POWA 1S5PA 1UBMS 3I6YA 3EQZA 1OWPA 1IATA 1Y89A 1DJPA 2PGOA 2QRKA 2PSJA 1T1RA 2VT3A 3FB4A 3JARB 5ALLA 4C30A 1I5RA 2HHCA 5GPBA 5FDFA 3BHJA 1QP4A 3ETEA 2ZLBA 3KP1A 4R2XA 4WRRA 3P4XA 3RS4A 3ZJVA 1LVGA 1VLMA 2JL1A 3DDHA 1W49A 1L4NA 1N5LA 3HDYA 1IB6A 2AC2A 4MAAA 4UOZA 3KNZA 5SV2A 4YRCA 3AM1A 3I2YX 4BEBA 4URXR 4O6VA 4JKYA 5LPNA 5H4GA 3E4DA 1IULA 3LECA 4CM4B 5T4EA 2FMIA 3AVXA 1XF9A 2NVOA 1ML4A 4IIFA 5D3ZA 2XAUA 3CGWA 4FD2A 3T7EA 1AK2A 1PE0A 3CXUA 3R0JA 3KAQA 4FX2A 1EWYA 4WNYA 1YNOA 4CFZA 1RXVA 4JYPA 2Q6TA 2WIAA 4QBGB 1RTTA 9LDBA 3OLQA 4BVHA 5JXJA 2FSHA 2VSOA 3AVTA 3QEMB 4GRDA 5EJ4A 2BEJA 3KCNA 2WHXA 1N3BA 4CIVA 1A9SA 1ENPA 2PS1A 2YJZA 5JALA 1M2VA 4URUR 3ZV6A 2RHBA 2VHCA 2F9FA 4QPZA 3R0ZA 2PUHA 4JB8A 4ZAXA 1X8LA 3D7KA 5AYVA 4I4CA 4QODA 1KYQA 1QZTA 3GNTA 3WWEA 4ZDJA 9LDTA 3H7AA 2XUQA 3BWVA 2FKNA 5ALVA 4YJGA 4KNVA 1ZM9A 2QJOA 1JA9A 1BS9A 2QSUA 2C9BA 3EAGA 4MUKA 1AS0A 3OJWA 3UW1A 4OUDB 1QQAA 3EBLA 2GNAA 1X1QA 3L6EA 1M73E 2D2IA 4AZTA 1IM5A 4BWYA 1W36D 4TKLA 5HSGA 5JHHB 4LGVA 2W2VA 4HL6A 1L1EA 2C82A 1QTIA 1SNYA 1U9JA 1OBVA 2RGNA 3TVTA 3ILYA 3VO2A 3W5CA 4DF3A 4DMHA 4EAAA 3W3AH 3GAMA 1LY1A 1ODKA 3NPMA 5BYKA 4X95A 3AZQA 4A6EA 3VVCA 3GFQA 4PLGA 2PZKA 1QORA 1R0LA 4XB2A 4LXTA 5E7QA 1HDOA 1H65A 1IY8A 4JL8A 4Q3KA 2WIGA 1WQ3A 1G38A 1DJNA 2VA8A 2P2SA 4KAAA 4ER0A 2OFXA 1X7XA 3K0FB 4O2AB 4D7AA 5KWJA 3NC1C 5IJWA 3ELDA 5AJYA 5TMBA 1FC0A 5KU1A 4DV3B 2DTXA 1PFQA 2PKWA 5F5XA 4MYHA 1J97A 1QHNA 4GRAA 4MRVA 1VJTA 4UE3S 4WK0B 2Q4OA 3P9IA 2FMFA 3UWPA 4F6CA 1VPEA 1JHZA 2WWFA 3FI9A 1H94A 1V8BA 3GY0A 4IDAA 2JK1A 1T9HA 4YXWA 3AFHA 2JI8A 3BMQA 4HDKB 2ACVA 5FOWA 1QGUB 1PJLA 3B38A 1VBNA 2H7VA 3BFVA 1Y5NA 4UMFA 5JNTA 3GT4A 4RETA 4G0XA 3QE0A 4QGGA 3ZD9A 3TOCA 1UZUA 3O8DA 1GGVA 2HRRA 1MAUA 3GZ4A 4D3FA 4S1OA 1T5HX 4EW2A 4ZDWA 1A69A 5CT5A 3R3SA 2EFYA 4BN5A 4OGKA 2IIQA 2IYRA 2CJWA 1RWMA 2PXXA 1ORWA 2CCJA 4KLAA 4RFLA 1HR0B 2ZJ6A 5MF6A 3BWYA 3GLHB 1KTIA 4NBVA 2VPQA 2O4CA 4O1IA 4R7TA 2WT9A 3CZ9A 2BYTA 4G9EA 1T9BA 1U80A 3FMGA 4LWQA 4RZ2A 5BV2P 1DC4A 3QLUA 4K7JA 3A6JA 5AI9A 3TEJA 1I3OA 2IS2A 1OROA 2AEEA 3UMSA 5IJ9A 3S2IA 2YR0A 4OB8A 4R9RA 4B40A 2UYCA 2GEDA 3ENKA 1L3IA 4M1TA 1Y8AA 1S2MA 3KE8A 4IZIA 3U37A 3WGUA 3DKIA 3GUYA 3H1PA 3HP4A 5LVAA 3CKYA 4OLHA 1X1BA 2EYQA 1NI5A 2ZJOA 3JYOA 1HDIA 2R5WA 4ID9A 3ZCSA 1XN4A 1N2CB 2DE0X 3FBGA 3MTQA 5C8DA 1F8XA 2EERA 1NI3A 4IHAA 1Z13A 1ZQ1A 1QKJA 4K9NA 4DSAA 1Y4ZA 3I5XA 1K88A 1I4DD 4BQRA 2GFQA 3I8SA 4GBMA 4Y1RA 5JNLA 1AQLA 4RXMA 1P3Y1 2FPXA 5CPFA 3VPDA 4OUKX 4H59A 4RV5A 1REQB 1HG1A 3LKZA 1JL3A 3F0TA 3H4MA 4HAOA 5DXFA 4OA5A 5CMLA 4D4HA 3IJPA 4UU0A 1CC1S 4LEIA 4MVJA 1XLTC 3ZGXA 3DJYA 3C6BA 3FM9A 2UVDA 4KVAA 5A6SB 1FB5A 4WNAB 4E5DA 1QSGA 1GU1A 4PNPA 3OAAA 1ICIA 4DV0B 1EXDA 4E7PA 3NGMA 3OOWA 4RA9B 1IDOA 5ES3A 3B1JA 3TLGA 4H1WA 1P44A 1KMHA 2ALJA 2VYQA 1OGJA 2J3LA 3I9NA 5L95A 3DFFA 5F3RA 4OMUA 5I8WA 2J9XB 4RPGA 1A4IA 3GNSA 4K9MA 3H5TA 3H18A 4NMMA 3VV2A 1SXHA 4JOQA 2FUEA 3FH0A 5CITA 3E7WA 4A23A 1G66A 5ILQA 5JSFA 2DXIA 5AKXA 1P5ZB 4IJWA 2H2FA 1MIOB 3N6XA 5G1OA 1HDEA 1NUUA 4AF8A 3LKDA 1ZL2A 2I29A 4S35A 3Q7QA 4R8RA 3PRKE 1BDJA 1FY2A 1FIUA 3KJQA 3WWOA 3AR5A 1RZVA 1ZH4A 4GI5A 2GASA 3WLRA 3KLPX 4HXGA 1N6KA 5EINA 1PX0A 4OQDA 4KSCA 5K8IA 3IIKA 3AUXA 3SKXA 3GEGA 1W4CA 3HKDA 3DLIA 5E0KB 2UYYA 1GCAA 2VXBA 2ZZKA 4L2IB 5CM9C 2K2QB 3K7EA 3Q72A 3S27A 2AFIB 3HWSA 3W1EA 2HIGA 3BD9A 1ECGA 2GK4A 2DBVO 4G86A 3QWAA 3R9IA 3RVOA 4W7HA 4V0LA 3DF9A 1KJIA 2JJQA 3B6IA 1NBWB 5DHUA 3PCRB 4BGVA 1E2BA 2ZIXA 3BERA 2R96A 4G8DA 4QRHA 1U4NA 5DP2A 1ZXXA 5AXCA 4DANA 1WP4A 3LI2A 5K3EA 2JIDA 2ZJ0A 1SVLA 5A5EA 2DUUA 4HYEA 1LEHA 1SBHA 2CL5A 2AR9A 2H0RA 3MA0A 3A1DA 4H7EA 1W4AA 1P2FA 3GRZA 4WUTA 1FPMA 1R1DA 4PFJA 1KZYC 1YSCA 1Z7EA 2CL7X 2E85A 3HBNA 4GGPA 4PAOA 1PR4A 4QVGA 5ALIA 2RG1A 3B60A 2BH2A 4L22A 4M21A 1HX7A 3IPLA 4E5NA 4H16A 1SEPA 2WHRA 3E23A 1MB0A 2NAFA 2QSYA 1X1TA 2X8JB 2ZYRA 2Y0BA 4KNWA 4EA6A 3SKYA 4TZ0A 1KBQA 3SEZA 3HKBB 3Q4GA 1YXMA 3L0IB 4K6KA 4L8GA 5CPBA 3WRYC 1P62B 3R5XA 4MUAA 1GNTA 3L8FA 1DCMA 2CDRA 1WKCA 2QLNA 4U2EA 1EJBA 1HA3A 3M2TA 4HNHA 3LT0A 2ENUA 4RF4A 5EPOA 1HZZC 2Z9CA 2IYVA 2J33A 2WMOB 2X13A 4ZZ1A 2X77A 4YX9A 1W36B 5E4YA 3H4TA 4QUIA 2QR2A 4B7CA 5LMZA 4FLEA 3EWAA 4JBWA 1KF0A 1XFAA 3B6ZA 1ODJA 3RVQA 4AG5A 4DLTA 3QF4A 4EGSA 3ZE1B 4LNHA 4D9NA 4EITA 2P8SA 2I1LA 3GJ5A 1GV1A 1OFHA 3T5GA 2OUIA 2YHSA 5C0OE 3D6AA 5ALUA 3SEFA 2C9MA 2C5FA 4LJ8A 2PH7A 4WZ6A 1ULSA 4Y0NA 4HGPA 2G0NA 1KC3A 5CX4A 2AGVA 3RYCB 4ETIA 3DL7A 1O54A 1V9SA 4H1TA 3LTEA 3ZDDA 3MWDA 2HJRA 2ZUSA 2VDWA 4G8BA 1AURA 1MFPA 2WKWA 4QQ8A 1RPAA 2HWYA 1HL3A 1VA4A 1PX2A 2CK3A 1GPAA 4EBBA 4GOLD 3JQ7A 4LJLA 2IXDA 4UHBA 3CNHA 4MNTA 3UK6A 1L1QA 1G21B 1CNFA 1KR2A 3ZWVA 2Q5JA 5IAGA 2HH9A 2R751 1IEXA 2DFKB 3A3YA 3N2GB 2NZJA 1DEXA 3LQKA 5I9TA 2Q5FA 2OD7A 3HVKA 4N3NA 4REQB 1J9EA 1H4VB 13PKA 1ZMXA 5E95A 4KRXA 3S2UA 3PPVA 3QNMA 3DFIA 2XUDA 3EF3A 2CFIA 3MIZA 1PG0A 2P79A 4HNAB 3PWSA 5JECA 4BWFB 5NULA 1U4SA 2OBYA 3AM4A 3H5NA 4M1QA 4OCZA 1BW9A 2AZMA 2I6XA 3EIFA 1WCIA 2D4HA 3OJLA 2ZATA 4HRAA 4C4XA 2VPWA 5JBQA 4W5QA 1N8KA 5IXYA 2GNOA 1Z16A 3GNQA 4D3DA 2Q0QA 2C7OA 5DGXA 3W6OA 1XRPA 3C3BA 1A8UA 1XU4A 4XIFA 1B14A 1K06A 1ZL0A 3NIDB 1G4AE 4OB7A 4KGXA 3CIFA 3RQSA 1G2IA 3AHIA 3ZLTA 2VS1A 4S2UA 4MVJG 3N8IA 1FDTA 3SOZA 4PZAA 1QDUA 2GEUA 4KBGA 3HDTA 3STVA 4MSUA 2DFNA 2FPGB 3JQ8A 4IQ4A 1DBRA 1SB8A 1W9HA 1NW6A 3JSXA 3U7IA 2EV9A 3UKOA 5L3VA 1H4SA 1ND5A 2C04A 4JXKA 4KWIA 3MWEB 5KOHB 3ZGVA 4JEHA 1YFZA 4NYJR 5GOZA 2I80A 4NHEA 1LC3A 2P5YA 4OA8A 1SBQA 1R15A 2ZRPA 1NURA 3LYHA 2FJUA 4L07A 1FFYA 1TEVA 1VZ2A 1WX1A 1SCNE 4X20B 4EG4A 3O82A 1CY4A 2FA9A 3NYQA 1SVNA 2Z3ZA 4FMDF 1QFXA 2F1IA 2XMSA 5MHTA 1X7ZB 1DS6A 1TVKA 1OKKA 1PTJC 1Q0SA 3RSCA 2QTAA 3N0WA 4LNUB 3USES 4AZ3A 5KTPA 3BH0A 3PWKA 4C05A 1XTUA 2K5UA 4GO1A 1DOZA 2IHBA 4RA6A 4OHZA 3WLJA 4AMVA 1MENA 2H7CA 3DCNA 3V1MA 3LT1A 4XD7D 4YGYA 4WA8A 4WJKB 3FUWA 2AK3A 4WOPA 2P78A 4YI5A 4EOGA 1GQOA 1M2WA 2UZ1B 4PYNA 1DXOA 1BS1A 3KV3O 3FRJA 1QIKA 4L7QA 4Y8VA 4B6OA 5A9SB 3K6KA 4OAOA 2Y6UA 1ZMOA 4IINA 1UKVY 2P0EA 5FPSA 4TLEA 4S1WA 5DYTA 4TUYB 4XEHA 4JYAB 3R8XA 3TPFA 4OSEA 2YNMD 4OIFA 4CUJA 3K9FC 4B84A 2BFPA 5BQOA 3BXHA 3QMMA 1KBZA 3KZVA 1A7UA 3U9TA 4CIXA 1COWD 1EU1A 1Z5OA 1NOJA 1QCYA 1XMJA 1LNQA 1SQ6A 2FN7A 4GXRA 3SZOA 1DEKA 1V43A 4QATA 4TV9F 3RQIA 3TNDA 3VKUA 4B3SB 1OXTA 4WFIA 4TTIA 3W5IA 3IB6A 3NXKA 4M46A 4I36A 5CHEA 1FLDA 4FOOA 1LBIA 5FV7A 3RC3A 4LF6B 2XUFA 1NNEA 2F3TA 3GLUA 5DRYA 3RVPA 3D8NA 4A16A 5KUTA 4IHJB 2HSZA 3DLAA 3HR8A 4EY7A 2VG8A 3GJYA 5FQOA 4DLXA 5M29A 1DT3A 1CF2O 2WFAA 4HVTA 4R31A 2O19A 3F96A 4FGLA 1ODLA 4HFMA 4U2CA 3EXHB 1G7CA 2ET6A 3M0EA 1NLZA 3QX8A 3NLLA 2VPPA 5CM8B 5B12A 5I7FA 3OT1B 3UAOA 2AOUA 3BIJA 1CUEA 3CLKA 1T8PA 2FZCA 3OE1A 2GCGA 2Z9DA 1XVAA 5D7BA 3QBDA 4OSPA 1X80B 4U7GA 4BO4A 1GLVA 3S8EA 1QE3A 1OX4A 2BWJA 1R0WA 1DKQA 1Q12A 2C07A 2RAFA 1ANKA 3K1TA 1G20A 2IYWA 4IGKA 4JBLA 1WW8A 4AM8A 4NULA 1IJEA 1ECLA 4CCAA 3P0JA 5AW3A 5LXTB 1U8UA 2PMBA 2IDMA 3VOBA 1M1UA 3COYA 4A9AA 5JCPA 3A3KA 5B36A 2HBRA 1P8AA 4J0DA 4KMSA 4UMVA 5D86A 5KNDH 1GZ5A 2IH4A 5MDHA 1KKUA 1OLSA 1BU8A 3GEHA 2BGNA 1S7CA 3NHAA 4R98A 4TXNA 4U9HS 4ZOQI 5IZCC 1OB5A 3TQQA 1ORIA 3EB9A 5H82A 4NYMQ 1L8AA 2YS6A 1HUQA 1L5YA 5TMPA 2EJCA 3EX7C 1NAIA 3E1SA 3K0AA 1PQWA 1S96A 3GLRA 2FW1A 2BFDA 4PHTA 2O5CA 5BSRA 3HC7A 1K5PA 1EM6A 5CG1A 4DIMA 2RAVA 3SK0A 1JKXA 4INPA 1NBEA 3R5FA 4IIJB 3VR4H 5J1SB 2Z1NA 2H0AA 1FUIA 3CKLA 3DTNA 2VDKB 2QMUA 4FW9A 3RHZA 4X93A 5E2IA 1BVYF 2Y93A 4E1AA 1Y7LA 1V8FA 5B1YA 2HIAA 1NVWQ 3RSSA 3P4YA 4G0VA 4L95C 2W7TA 4G41A 3UJDA 1F4PA 2R60A 3TTXA 1ZICA 2GZHA 3L49A 1M0WA 5PGMA 4YMVA 1QZZA 4HAIA 4F5ZA 1I2CA 2AHOA 3Q9LA 1XJ0A 1QIEA 5JY6A 2QJRA 3RAEC 2LNDA 2W00A 3PHLA 4P3PA 3WHLA 4KFCA 2O7VA 1W6UA 4N12A 5EEGA 1UXKA 1L3BA 1CVLA 3GJ8A 4GECA 1TCVA 4HN2A 4PU0A 1V8ZA 1AKVA 4W4TA 2HD4A 5DX0A 2H29A 3E8XA 5FEMA 4CWAA 4F4JA 4LRYA 1SH7A 5CYPA 3QH4A 1F7UA 2XJ9A 3Q6IA 3GHYA 3PDIA 4UAJA 2PUWA 1UBFA 5SYAA 2VOJA 4LC1A 2FPPB 2CYAA 2WLSA 1PQPA 3HRHA 4H7FA 1V16A 1XO1A 4RKWA 5JR3A 4P3OA 3WL3A 2QXYA 4D82A 1JQ5A 1JS1X 3WIOA 3N0TA 4JJAA 1OXKB 1QP0A 2PBLA 3ZDBA 2E4ZA 3U3JA 3LX4A 1GZUA 3OCWA 2X0IA 4JQYA 1GY8A 1JV2B 2QJWA 4NU0A 5JDCA 1ES9A 5FNVA 4F8YA 1TB4A 3Q2KA 4WXRA 4RULA 4GZ5A 1S2IA 1AUOA 4F91B 4CIAA 1EUDB 4MI9A 1CNMA 5EP2A 1O5TA 5JBIA 2UVQA 4GWLA 3SBXA 2VH2A 2C03A 3LOPA 1KRXA 4DIUA 2ACEA 1EINA 4HEA1 3K15A 2BUAA 3WZ2A 4QL3A 2G88A 4R9NA 1O97D 1XRRA 5AVTA 5LQRA 1Z6ZA 5DTRA 1JAXA 2YWCA 3ZGYA 4LOJA 1ZRNA 1Z75A 4F2GA 5DBEX 4GYJA 3WGHA 3PUIA 1EVLA 1U0EA 4PO3X 2YICA 3X1DA 4ETMA 1VE3A 1QFZA 3ZGNA 5JYBA 1Q11A 1L9KA 2HK9A 3PIIA 1BE6A 3OQOA 4M9RA 2W5UA 1TF2A 5EJIA 5KIAA 4XLZA 3KDSE 1JEOA 2WUEA 3CJTA 4LSMA 4ENVA 1JPJA 3W9UA 2IUEA 4KO4S 1F3OA 1T4MA 3B1ZA 2HDWA 3G49A 4FSDA 1YTLA 4LW8A 2BFFA 4WN3A 1E3WA 4WVLA 4JP2A 3IIIA 3HO6A 3TXAA 2P4SA 4MXDA 2JFBA 3QOFA 1L3CA 1Q0LA 3EASA 4A92A 4X9XA 1YGYA 4A0RA 3DCYA 4IWYA 3BICA 3E0XA 3QWHA 4D3SA 4LY9A 1O1YA 4KMMA 1FFAA 2CN1A 1E2PA 3A0RB 5E7MA 4DVGA 5K0BA 1AJEA 3FJ1A 3NTRA 3P9NA 3RVMA 4CIDA 4BBAA 1SOVA 1W4LA 5FWNA 4UNPA 5C8YF 4G56A 2B21A 4HNQA 4ND4A 2OAGA 3HJGA 3U5TA 3T3NA 1XQYA 3WYNA 2HR1A 3EC2A 4QGAA 1G5QA 5EJ2A 4LOIA 3HJTA 1U5AA 5C7YA 2P0AA 3LHSA 4ZJUA 5IPFA 2ADFA 2VCHA 5LP6A 1RDFA 1KEEB 5BW5A 1A9XA 1L4BA 1PN3A 3OBIA 4MPRA 2R6JA 1KXJA 2O1EA 3FDXA 3MTGA 4IFBA 2Q1TA 1KEPA 1Q0RA 3ZH2A 3SX0A 1XA3A 1KA9H 3JWPA 4HFJA 4W5RA 1VRCA 1KZ9A 2KQUA 2NG1A 2M6LA 4Z0TA 4Q48A 2WE7A 2Y2UA 3A58B 4EIWA 2L17A 3SSMA 5C1BA 1HYBA 2BHRA 3UJNA 3NTOA 4FOLA 5HS6A 5JAIA 4RSMA 2GJ9A 1P7YA 3EXHC 4FR0A 2QBYA 1YBFA 4Y0VA 1FNCA 3G59A 3E9CA 3BJRA 3OZBA 4H15A 3R6LA 1C4KA 4LGCA 2OB1A 4HAYA 2WD7B 5DN9A 4J03A 3TFQA 3U4HA 2GN6A 4BMPB 4G5RA 4OOFA 4DN6A 3L7LA 2J3QA 3NNNA 5BWOA 3UJBA 2YH2A 4LAFA 4BX3A 2Y1XA 1IPHA 3H2ZA 2ZJBA 3KJFA 2G8LA 1PUXA 2OBLA 2EQBA 4AMGA 4M22A 1RRGA 4JU8A 3ZI4A 2NLOA 4REMA 3PQ5A 2RH9B 5HZMA 3DPIA 5ERGB 1AGRA 2OV8A 4E4RA 1QS0B 1KI4A 1ZGAA 3BTOA 2ZYWX 2JD1A 3LQRA 3KVVA 3BBLA 4I8IA 5EIBD 5A2GA 1E1RA 2FW6A 5FO1A 3HDQA 4GR9A 2IL1A 3O9ZA 3DKRA 5LSAA 1N2OA 1P5RA 4A3SA 1FLVA 3IV6A 1S1MA 3PZRA 4PN3A 3V7WA 5C1OA 3QOWA 3FFWA 3ZBPA 2B83A 2J4FA 3GUVA 3HA5A 2QRVB 4BJ5A 1F6BA 3H5VA 2AG1A 2PX6A 1KDZA 5K4GA 3DUFB 1E2HA 5K4HA 1QC5B 3IR5A 4O1MA 6AT1A 3MB8A 3VNRA 3TLEA 2F2TA 4KK3A 3PGMA 3B1KA 2UU9B 4B3XA 2PUFA 2OXFA 2OFPA 4I9GA 2YZ2A 4RD4A 4RJLA 4XWTA 1CHDA 1VBKA 1E2KA 4PAMA 2C5EA 1W59A 4LDZA 3VC1A 1N5OX 1BJRE 3AG6A 2ID7A 2QVZX 3EC1A 2R6CA 2Q9BA 2VT2A 1YE3A 3E8MA 5FNVF 1IJBA 5AQEA 4RJTA 1YTUA 4V0QA 4A8JB 5HTOA 4YV1A 5C3UA 3UYKA 4M0KA 3N5KA 1ADCA 1YNSA 3H11A 5H81A 1DADA 2R1VB 1R6TA 1UJBA 2C20A 1VGQA 3FZGA 2XWSA 3GXBA 4HK4A 5ALHA 3OLZA 4BKOA 1VMKA 4MWSA 2ZSIA 5BQXA 1QO0D 2E0IA 2LGJA 1DINA 2EIHA 1CDZA 1ODCA 2AJ8A 1G3UA 3WRXA 1FXUA 4D4JA 4V2UA 4FCVA 3C16C 4QASA 1GFWA 3SMQA 2ZUEA 3PUVA 1JKJB 4G0NA 1MA0A 1XVUA 3GLKA 4P1ZA 2IC5A 2DX7A 2INGX 4FZRA 4MGKR 5HFNA 1KOLA 4EJSA 4K9PA 4OV6B 1BEUB 4JWKA 4O3FA 4FM9A 2C95A 1P5FA 3L1UA 4BMSA 1E3JA 2EFCB 1YHZA 4JT4A 4DR3B 3D6HA 1IK6A 2XNJA 3H1BA 2OP1A 5LU8A 3P19A 2A5FA 4I4TF 1R9GA 1DX9A 4JLSA 3ZDAA 3AETA 1JEYB 2C94A 5DM1A 4L8LA 1J1UA 3W8NA 5CLLA 3KS9A 4WQMA 1FFCA 4AKHA 2GWRA 1QZXA 3CRQA 5CVDA 4B82A 3O1HB 1U9CA 1UEXC 1FNNA 1XTTA 1H9BA 1NHGA 2POQX 1T5OA 4P83A 3AI3A 3DZKA 1LRJA 4DAEA 2YRWA 3HXOA 3GLQA 4NYIR 4PG5A 3LWNA 3UPTA 3AHJA 3RF6A 1QIFA 3DB2A 1JU9A 3NIWA 5LP6F 2VTBA 2HCBA 2O57A 4P84A 1RI3A 2EJTA 1I10A 4OVKA 2CJFA 4U7PB 1H3EA 4A0GA 3ID6C 2XNDD 1WZIA 6LDHA 4CKWA 2DECA 5K7SA 2BM8A 2AJDA 4GZMA 3FOEC 4V1CA 1BXRB 3G2QA 5D2CA 4FKBA 2XIJA 4LXIA 5KJ6A 1F38A 1ONSA 2FSVA 4N0DA 5DGIA 5CBPB 4AKTA 3DZHA 3QEAZ 2I9KA 2W6IA 1YC2A 1YA4A 2BMWA 1NNUA 3HWWA 2JAOA 3L4BA 3LGAA 3NRCA 3C1AA 1SOAA 5HJ5A 1CFJA 2ZM6B 1JR3A 3DMPA 3NHKA 4OU4A 5JXWA 3KB6A 4IFTA 4JVSB 1JW9B 2CY0A 4HQNA 4ER7A 4JP1A 4LN1A 5AHOA 2JFYA 3DO5A 1X3SA 5K0SA 2B99A 4RK0A 5AJZA 1GNLA 2QSJA 4I5DA 3EZ6A 4PSKA 3PF8A 1R0XA 4MW9A 4LVCA 3JQBA 1KQNA 4ZRNA 2O8BB 1XZ8A 3QE4A 3RYFA 3DCJA 2JGKA 5JNUA 4F3CA 2UKDA 4Z49A 4EZEA 4Q7EA 3HP1A 2RARA 4IDDA 3T95A 3UJ9A 1NN0A 2YQ4A 3L0DA 4RDCA 2JGEA 1TK3A 4MV9A 4C3VA 4ZV4A 2GD0A 1TYEB 5IVKA 1YRYE 1C7ZA 2A9VA 1V5IA 1U1IA 2O4UX 1XCLA 1M2VB 3FSEA 4I81A 3S0JA 1V71A 4DIDA 4YT5A 1NBMA 2XCQA 4GMFA 5DLEA 5L9AA 2OM6A 5DASA 1Q3HA 2PT5A 3HR4A 4MRRA 1A1SA 2OENG 2CMKA 4PPQA 3CVVA 4Q1FA 5C4MA 1I3KA 3IVGA 3OCXA 4KOAA 1PV1A 5KSOA 2W0SA 3DHVA 3IEKA 1V95A 3W7AA 4LS3A 3TE6A 2WSLA 3O9MA 2OB2A 5FXMA 2BFNA 4KZKA 4EJ0A 1PZEA 3ZWAA 4QGFA 4CLEA 2FX2A 4KRFA 2PY6A 3SYMA 3PU6A 2JW5A 4QUKA 5G1PA 3BSFA 4AY5A 2ZKLA 5CFZA 1ZNZA 5AOCA 4WZBA 1TMGE 2WVAA 4Z0NA 3YASA 1HMYA 2ZWMA 3I8XA 5HZGA 2V96A 2HDNB 3Q11A 1GO2A 4TTSA 1GZ6A 1VE7A 3NHPA 4WPGA 3R3YA 4MVYA 4ZQBA 3ZI0A 1RCFA 2JGIA 4E09A 5HKOA 2Q1YA 2Z09A 3L41A 3DLHA 4DLWA 3I3OA 2X1VA 1FXSA 4JAVC 1IUKA 1E4EA 3ER8A 3FB1A 4I46A 3NIFB 1X7XB 4Q3AA 3WL8A 4KXUA 2ISQA 4B09A 3SF8B 4TM8A 4FCWA 2XUZA 1AGXA 2FP3A 1SD1A 1RHKA 3ZZ1A 4V0NA 4FFBA 3R3XA 3BGWA 3HL0A 1I0ZA 4TS4A 1UH5A 2R6R1 3W5HA 1G291 4B2IA 1L7VC 2VTBB 1VL2A 3NBFA 2WB2A 4AKGA 2V7TA 3N3AC 3MUNA 4TN1A 1JSCA 1OLXB 5FJIA 3ZKWA 2AI1A 1NVUQ 2K2WA 3ENZA 3SHQA 3NHBA 5AM5A 1ECJA 2FUCA 5I7SA 4BNDA 3VJRA 4CPDA 5JPIA 1E63A 1FRFS 2WJ4A 5FPTA 5A06A 4A8JC 2PWYA 5BMVA 4MS1A 1JG6A 3F8TA 1QVRA 4KWHA 4MZXA 1RPNA 3KXPA 2R8RA 2PVPA 1TIPA 3NDJA 2CJWB 4Y1EA 1Q0QA 1BGWA 1Y6RA 1J07A 5HGJA 3Q9NA 4AUEA 4FEAA 1JG1A 3RB8A 5EKSA 2B3TA 4LYGA 4MV6A 3KWMA 2PH1A 4AIRA 1LU9A 2WE8A 5IJ9B 1EG2A 4E11A 2OMEA 4JC0A 1HKHA 3ENVA 3RASA 5K20A 1JIXA 3D43A 4JBIA 1WUTA 3Q1KA 1D8TA 4AW9A 3EVGA 3MS2A 3TS1A 1NMSA 3MJDA 4IS3A 2VHQA 2EW8A 3ANSA 5TGDA 4EFDA 2GNPA 3MTJA 1Y3FE 3CF6R 1MC8A 1AZSC 1XDSA 2O07A 3KFXA 1Z18A 1N5IA 2AZDA 2IYSA 2R7KA 1CR0A 2Y0DA 1I2ZA 4ERNA 1CF9A 5TPZA 2AG5A 1PZMA 2JHAA 4Y1RB 1JWLA 1XDDA 1QTRA 3WLSA 4NS4A 3ZJ5A 3N3BC 2R5NA 5DYIA 3IDFA 1IDN1 1K63A 4O33A 3HJUA 2ORVA 3UWSA 1TTTA 1QYXA 4QXRA 4HNSA 2H4HA 1GN9A 2ONKA 2W6PA 4EARA 4DQKA 5FX2A 1E4OA 2K6GA 5L6MB 4MH0R 2HAEA 5D1NA 2VJNA 1M0SA 3EGCA 5JNVA 1IQRA 2WF5A 1X42A 3SDBA 1J06A 4YT8A 3M82A 4RL4A 1LFAA 3UMFA 5BWCA 1PS0A 4OH7A 4TT3A 3M8KA 4L16A 2EDAA 4QU0A 3IXMA 3OZVA 3TLGB 5GINE 3L4KA 1IUNA 3GUZA 4EEZA 3JYNA 3KTAB 1QWSA 1Q91A 2OECA 3B52X 3EJ6A 4NCBA 1EFPA 3SXUB 4QEDA 4IQ8A 3F2IA 1AMOA 1CSEE 3AR2A 3T0IA 4DYHA 4JHLA 3NHYA 2J0UB 4WK6A 4Q3CA 1T5SA 4F86A 1MQ9A 4XD2A 4NMHA 1G7SA 1TUIA 2B9EA 1M34E 2AQ8A 2H8KA 2VLBA 4AG6A 1EK1A 4CN8A 2Y1FA 3F71A 2HJSA 2V6JA 1AGPA 2B8JA 4ARSA 4CMKA 5EFOA 3ZJUA 3CRRA 2VAVA 4LJ7A 1J99A 2QX8A 2C2ZA 4NOLA 4ZJYA 5K8TA 2IXEA 2LW7A 1UXHA 3R6GA 3EK2A 3USCS 2Z8XA 3QFCA 4CHGA 2DBQA 4TWZA 5JMWA 2F43B 1DDIA 2EJVA 3WMGA 5AKLA 2JBAB 1NFRA 1VP3A 2O6HA 2NPOA 4FMDB 4RF2A 2OHXA 4TLAA 1QRDA 3ZBTA 3B7WA 3G68A 3HKEB 1RKXA 3P71T 5BSVA 2PL3A 2XQGA 1QQBA 4Q47A 3BTSA 1EJ6A 1YFKA 2PO5A 3L8HA 1CYEA 2PXAA 3OA2A 1I6KA 1R5NA 4QOJA 2A0UA 2BKXA 3GZNA 3KM0A 1OVGA 1W94A 3HRIA 1X94A 3NDRA 1OCEA 3BKXA 4X8OA 5ESDA 4HEHA 2FJ0A 3ZHRA 5HIKA 2E4VA 3IQGX 3TX2A 2B0CA 3VPBA 2EX1A 3W5JA 1GKYA 4ASUD 1PDVA 2GF0A 3W90A 3KR2A 4BNFA 2O5RA 3UWOA 4DCCA 1RRCA 4ZYUA 4RTOA 3DOFA 1H0HA 1GXSA 1VIVA 3TRDA 2J9FA 1D07A 4PICA 4KFSA 2I4IA 5H16A 5IWCA 4W82A 5CGQB 3TVYA 4F72A 4FYXA 2I4OA 4CCSA 4OJTA 3L93A 3PNPA 1F2UB 4LZJA 5KNLA 2CVQA 3LCRA 2RGNC 4U39A 4DMFA 2C7QA 4ACBA 1L5RA 1E8MA 2FDCA 4UTPA 3C3PA 4K81B 3SNHA 1RLMA 4Q3OA 2GWHA 3KHKA 1NONA 1RQLA 4DNXA 4TV9B 3O3NB 5AOBA 5AICA 4PG6A 1PG2A 3LUBA 4QLBA 5B7NA 3JWEA 1G19A 1TDJA 5FFNA 3GBSA 1LTQA 4ZDKA 5HKLA 5GM1A 2QN6A 3KL2A 1R4NA 3MRSA 3NC4A 2IPNA 4ZP1A 5SZIA 4DT1A 3TVDA 2WWXA 3UMVA 2ZRBA 3SCZA 4FIZA 1KP2A 1ISPA 2PLWA 4UNSA 4BL5A 1SOUA 1ESEA 3FLAA 4CU5A 4P6VF 3EQ9A 5FHRA 3PFWO 4WKPA 3WDSA 3OTIA 2JAQA 1DKPA 1CY1A 1DNPA 3RV4A 1S2NA 4C0KA 2QVXX 4Y2HA 1X8JA 2O7RA 1IAQA 3EXFA 3MTDA 3T41A 4DMCA 4UJ5A 3MWDB 2Q62A 2VDWB 4DV7B 2WJHA 4C4RA 3F8WA 4W5HA 4F56A 2OCBA