1JBJA

Cd3 epsilon and gamma ectodomain fragment complex in single-chain construct
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
186
structure length
186
Chain Sequence
DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms contributing to T cell receptor signaling and assembly revealed by the solution structure of an ectodomain fragment of the CD3 epsilon gamma heterodimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CD3 Epsilon and gamma Ectodomain Fragment Complex
total genus 18
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2001-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jbjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jbjA01
4P57A 2KPNA 4YBHA 1WIPA 4G6AD 1WEJH 4QRPD 3B9DA 1NCWL 2D31A 3C5ZD 3VG9B 1A6ZA 3T2PA 3AM8A 5D7IB 32C2B 3C8DA 2JJSA 2AI0H 4UILL 3OG4B 3HC0B 4CMMB 3GIZH 5D2NC 3VWKC 1AY1L 2IQAB 3H6JA 4J12A 3ZDXE 4JFYA 3AY4C 3J7HA 3IU3A 5JXEA 3C6LB 1MCOH 3WNLA 3STLA 1XF3A 1N59A 1CF8H 1QEWA 2AERT 1DQQB 4P2OB 4XCEA 5DYOB 5DHYB 5E5MB 1IGCL 4U1NA 2EDNA 3K46A 3NA4A 2X70B 3CUPA 3H9SD 5MEQA 2E7HA 5IB5A 1TQBC 4OJFL 4NQUA 4WFHE 4EXKA 2O5ZL 5BXFB 3TGXA 5I1KL 5JW5A 5T3XD 3O41B 3MLWH 2VDPH 1X7QB 2VITB 3PGFL 4HWNA 5GS0D 4KZEH 1NMBL 4YO0B 2R0KH 3CFKA 4ODSL 5D7JA 4JFXB 1ZLVK 3RVXD 3VGGA 1NFDF 3OMZA 3G9VA 4KJQD 1SEBB 3EZJB 3V5HA 4U33A 2G60H 2E9IA 3MFFB 3GM8A 2EXWC 4M00A 1L7IH 2D7TL 4OLZH 1DQLH 4WI3A 5JUEL 5CSBA 4ZO9A 1C5CH 1J8HB 3V4VH 1L9MA 2CLRB 5E94A 4IRZL 4ZUTA 1KB9J 1UWEH 3OV6A 3SOBL 3MOBL 3PQYE 5I1EH 1JYNA 1EAPA 5EU6E 2XG5A 3GSWB 4X8XA 3SDCD 4HKXB 4U1IA 5DRZB 5DSCB 5FYKH 2LU7A 4HLZG 5MENE 4DVRL 1RZFH 2B7DT 2DF3A 4Y2DB 3X12B 3S88H 3QXAB 3F62A 4OCLC 1AD9A 2OSLB 3D48R 3SCMB 2A83A 3ZYJA 3VFUA 1CN4A 5DMKA 1T7YA 1T1XB 1FVDA 5GZOD 2ZWLT 5MERA 1IL1A 4J1UA 3EO0B 3T4AB 1FCCA 4X6FB 1BGXH 2HT2D 3GMMA 2V2WB 5IBLD 4V1DA 3D2UA 3EYOA 1SMAA 3FQNA 4YXLH 1F90H 2EIDA 5E7BA 4OZ4B 3RIAF 3GSVB 5F1OB 2QSTA 4XNQB 5D1ZC 2DI7A 1ZHBA 4P46A 5CAYB 3UBXG 4NZTH 5IB1A 3DX8B 1TZHB 1FC2D 1LO0H 3L5JA 1SYVB 4LCYB 2XWJB 4OM0L 3NCEB 2XKSA 4N1CA 5F21B 4MA7H 1HYSD 1INQA 4Y16C 5FYJU 1ZVSB 2VXSH 1XGYH 3OB0H 3D39B 4JHBA 3KPRA 4AL8L 4FZ8H 2BVQB 1ZHLA 5DD3H 1TZIA 2JCCA 1RIVH 3BP5A 3C60A 1EVUA 4C57C 4M7JH 1ZLSH 5INCB 4MNGA 4AH2B 1DJSA 3T1FB 2UV3A 1ZA6B 5FM4A 2H6PA 4MD0B 4QRRA 2AJVH 3KLDA 2EC8A 3O3DA 1S7VA 1I8LA 4NO3A 2VLME 4QTHB 3KAAA 1U3YA 4LKCA 3TYGH 4FQLL 1M7IB 1HDMB 4JKMA 4LLQA 5GSVB 1OM3L 1IKNC 2BHYA 2EDXA 1S9WB 2LFGA 4NDMB 3NA9H 3HG1A 2A77L 3VG9C 3AM8C 1N5YH 1DQDL 4MCYB 4MB5A 1OSPH 5GGQL 2CR6A 3EJYD 1TENA 3QUKB 1AD0B 4NN7B 2GT9A 3ZLQC 1I9IL 5JW5B 3WKML 4LRIA 2BVOA 4N90D 3VWKA 1P4LA 1DZBA 4XPBH 1U42A 4UTAL 5GGUB 1HE7A 2ENYA 1JZ5A 2V7HB 2B5IB 5MP6H 4WW1A 4U1NB 3NAAL 4LSRL 1NFDE 4G6KH 4JEGB 1XF3B 1YUHA 5FKAA 4HX1A 1U8LA 3HPJB 4Y2DC 3I02B 5D96B 3RVWC 1YEJL 1GJIA 3RP1A 3DMMC 3RQ3A 1YEHH 3O2VL 1IGML 3D2UD 3VXRB 4TTGA 2DRUA 2X4QA 3BZ4B 3BWAB 3QO0B 5CEYB 5DUMH 2IANA 4MXWL 3WN5C 3V5DA 3MV9B 4NCDA 5D8JH 2ZZUT 1HINH 1Q0YL 3RTQD 4RAHA 4HBCH 1P2CA 2BNUA 5IFAH 3RDTC 1UXSB 1MI5E 2HJFA 4IRJC 3MOAH 5A2IH 1Z5LA 2GY7B 3QZWA 3RUGB 2FRGP 3T4AA 3QFJE 5E0QA 5I16B 3VD5A 1IZKA 1T03L 3MV11 1AJ7H 1CD0A 1EV2E 1PQZA 3OPZL 3X3FL 4C4KO 5I75C 3CK0L 3HI1A 3DMMD 3P0YH 2NY4C 2HFGH 4G5ZH 5DJCA 4KRPB 1SYSB 1SJXA 2AXGA 4I48B 4S1RH 1I7ZA 2ZUWA 4B50A 3KVQA 1YC8A 3FOLA 1EJOL 4E5XB 3QSKB 3OKEB 3VH8G 5JMRA 5KOVC 2QQKL 5SV3A 4Z0BH 3RUGA 3ROLA 2FX7L 3BRFA 2CXKA 3QXVA 1NQBA 3DYPA 4KGJA 1QFWL 3LKRB 4JFEA 3MCKB 2FIKA 3QIWD 1SJHB 4YQXL 1FL5B 5HY9A 1XF5B 3C6SA 2R1XA 4OGZA 5J13B 4I2XA 2W0FA 3MA9H 3NN8B 2WK2A 3MLSH 4OCMC 2IPUG 2GFBA 3TH2T 3V79C 3BE1H 5D2NA 2F5BH 4X4ZA 4FS0A 1KELH 4K3JH 4ELMB 1FN4A 3REVB 3RWIB 4JN2A 2EDJA 5IR1B 4WI4A 3RIFK 3WLWC 3U7YL 1W0WA 3JWDL 3O6LL 2KBGA 3QJHA 3TIDA 1Q9OB 4U0RC 3C5ZB 1B2WL 5ETUA 3ZO0A 2NY0D 1NC4D 5JPMB 5C6PB 3C60C 1EHAA 2AKRA 5E6IB 1W8OA 1Z0MA 2YD3A 3ARBA 4KROD 5ID1A 5L7XL 4GAJH 4F58H 1ZMYA 1VB9A 2Q86A 3T65A 2EDKA 3ECBA 4PRDA 1CE1H 1T20B 4CMHC 4CMMA 5A2JH 2O5ZH 5JXEC 4OFKA 3ARQA 1J0IA 4I1NB 1KCRH 3PGFH 4Y16D 3CMOL 4YHOH 1Y18A 5MEPB 2R0KL 3GJFB 2CUIA 4MXQC 5ICXB 3P77A 4M3JA 1QHPA 2NX5A 1SEQL 1A64A 2YRLA 5B4MD 3HFMH 1F4YH 2G60L 3JWDC 3RWDB 1QRNA 2FNBA 1YDPB 4OGXH 3ZE2E 4WWKD 4KKBC 1QHOA 3MMEA 4OLZL 5JOFB 5JO5A 1QBLH 4X4YA 3HZKB 1R5WA 5CHNA 2FHFA 4Z95L 1JIBA 4D9LH 1I75A 4D9QD 3HE7D 3MOBH 1U8NA 1VPOH 3C2AL 3E6HA 1GOGA 3VXPB 3QIUB 4AENB 2DYPA 4KV5F 4PBWD 5C0RH 1RULH 1G7QB 1YEKL 4PP1C 1F8TL 4MYWB 2A6KB 1U8JB 5T33L 1A3RH 4F2MB 4XMKH 4NKIL 4GXVH 1H15A 4ZAKA 5HHMD 5IESH 4U7SA 1MHEB 1YNTA 4Q6IA 2F53E 4EZMA 5D1ZA 1D5BA 1OTUC 3D39D 4MAUL 4X5XB 1I8MB 4BZ1H 4HW6A 4QHLA 1F90L 3GMRA 4RISH 3HR5B 2EXWD 2PETA 3ROOA 1NUNB 3CXDL 3D0LA 3FQXB 3RUGE 2QQLH 4JVUA 5T1LD 1WZLA 3L95B 4H1LG 3SE3A 1MWAH 4JDVB 1RUPH 4MB3A 1PX4A 1T5WA 3WUWA 1CGXA 3IFNH 2XTJB 1U92B 2ICWI 4PJAB 4F7MA 3Q5TA 5TDNB 1P7QA 1TJGL 2XIDA 1FIEA 1GRWA 1NGPL 2UY7A 2XFXB 4KY1H 2YUXA 4NWUL 1J11A 3DBXA 3H9HB 1DLFH 3D3VB 4Z7UE 4WI8A 2OXGA 4XGZA 4UMGA 4PY8J 5J4MA 5DRZA 2DWEB 3DTXA 4YDVA 5IEKA 2GSGB 1OGAD 4M5ZL 1N0LA 2X9YA 5FHAL 1ZS8A 4NZJA 4X7TA 3O6FD 2C3GA 4HGKC 1I8LC 5HDLA 3ARUA 1S5HA 4Z7VE 4UBDD 4NFCA 2XRAL 4POUB 3O0RH 1EBPA 4NSKB 2HG5B 3KJ6H 5EOTB 1PFCA 4NHCL 3WFBL 2FCBA 4RDQF 2ESVD 1JGLH 4R26L 2O26U 2NY7H 5I76A 4NQEB 2BY1A 4ESKA 4G7VL 4Y4HC 4JVPA 2ZJSL 4NC0B 4AJ0A 1KT2B 5F7MC 1N7ML 3K2UH 1VDGA 1OP3H 2A6DB 4R97B 1FNGB 3H2WA 2OZ4H 5EDXA 2VITA 1HXMA 1P69B 1AGFB 4YZFF 4LP4A 2XTLA 2IAMA 4IDJL 5DTFB 5GGQH 1I1CA 3GSXB 5F97E 3EBAA 1QTYT 1YNLL 3CFDA 3LD8C 2EDYA 5E2UL 4QRRD 3WKMH 5FV1L 1LGVA 3S36H 5B39G 1ODAA 4OM1H 1BHGA 3HKFA 1T89A 1I7RA 5DURB 4M4RA 4OFYA 5IGXH 4MJ4A 2BVPB 4NM8L 4R97C 4LIQE 1I3UA 4TVPE 1F11A 1U9KA 1F3DH 4NSKA 3IJSA 2NXZC 4NNYA 1AKJA 5JIPA 4LSPH 4EI5D 3KPOA 2DM3A 4U05A 1X5FA 5FECB 5I19H 3IJHB 3N1GC 1J1XL 5HI4C 4LPXA 4W6YB 1E4XL 1D6EA 1VGEL 3ULUH 2VMFA 4YIQB 1I1AC 1FLTX 2DQFB 3DBXB 1PJ9A 1RSFA 3PWVB 1Q8MA 2FD6L 1FIGL 3ILPB 3RGVA 1ADQH 2KKQA 4P46D 1Q0YH 1IEBA 4MHHI 4QRPB 4DN3L 4IEFB 4MD4A 4MJ5B 1I7RB 2GY5A 1INEL 4Y4KA 1JPSH 5D7LB 1ND0B 1GOHA 4PJCB 3AXLB 4JKKA 4JPIB 3PGDB 4XBPB 4Z0XA 3QDJA 4CNIB 5SWZB 5JHLL 3LEXB 1TCMA 1I9EA 1BOGA 1JTPA 3ROOB 5I1JL 3FFDA 3CK0H 3S97C 4I9WD 3IDNB 4LLUA 3L7FA 4JVWA 2A6DA 1UKSA 5FECA 5ADOH 2NTFA 1KT2A 2FSEB 4OLYL 1X5KA 3BD5A 1E4WH 4F2MA 4HSQA 3G5VB 3RBSA 5I1CH 1B0RA 5I1LB 4N0UA 5A2FA 3PV6A 3CJJA 3JTSA 4PJCE 5IB3B 1X4YA 3P4MA 4AEIH 1DBJL 3GO1L 4J2XA 2AV7B 1MOEA 4PRBA 3VFWA 3QHFL 3ESVF 2DIAA 2JJWA 4R7DA 3DSNA 3BKJH 4PJIF 1JWUB 3KPQB 4U6YB 5IW6A 4UQ2B 5GJSH 4DVBA 5BW7C 2XZQH 1G7MB 4LPCA 4MXVF 1DR9A 3TN0D 5C0NC 1LO3L 2IFGA 3WIIH 4KK6C 4X7SL 2NY1B 3BE1L 1BF8A 4GOSA 1UKQA 1P1ZB 1UM6L 3MV9D 1KSRA 3UPAA 1WBXB 1LO4L 3P0GB 1QRNB 3N1PC 3C5JB 1JFQH 2EO1A 3NCYS 1HH6B 5TDNA 4KRNA 2NR6C 5D9SB 3C5SB 3VXSB 4CU7A 5I1GL 3S37H 2DKSA 5DJ8A 4TUOA 4AK1A 3H9SA 2GJ6B 4M5YH 3LSOB 4U0QB 1NGXB 5TFSL 3IU4L 3PQYB 2ZP0T 4XRCA 4IOIB 1FNSH 4X80L 3O4OC 2BX5A 2DJ4A 2GCYA 4ZUWA 3ESUF 2FO4B 1XT5A 4YWGH 4HG4K 1FFRA 4KC3B 3QPQD 3GJEA 1I9JH 4X8JA 5AD0B 2NZ9C 3OXSA 1I8MA 2CIKA 2EYSA 5IEKB 1J0JA 4HV8B 4YEFA 5DJXA 3EJJX 1PZ5B 4WU7A 1I3VA 1NJ9B 3UYRL 1KULA 2XZZA 3Q48A 3NMEA 2VABA 4NO5A 4RFEA 1DVFC 3TC9A 5I15H 1CE6B 2EH8H 1AGDB 3HFML 5ANME 3F7VB 4Y7MA 3I6LD 4OGXL 5GRVK 3EKCA 5IQ9A 5I66A 2GJZB 4W4NA 1BEYH 3QIUA 5HHOA 2A1WL 3KYAA 2EEBA 1O7SA 4Y88A 3BXNA 1N8ZA 2FEDD 1QBLL 3KPTA 3B9KC 7CGTA 2YZ1A 5GRJH 4TYUA 3MV7D 3CSPA 5T5NG 1WLHA 4DAGL 5KW9L 1HKLH 4APQD 3GMPA 1A2YA 1VPOL 3BQUA 2I9LA 4U6XB 1L0XA 1YDPA 1KCLA 1RULL 3D0VA 4LNRA 3DURB 5C0CD 5BVPH 3BPCA 5C09E 1DCLA 4IDLA 4Y16B 2R9HD 3FO9A 3O2DH 4PPTA 1DBML 4HWBH 5DD6B 4HF5H 4KDWA 4ELKA 3WUWG 4Z77A 4IS6A 4OB5H 1AR2A 1L9NA 4GKSA 4AENA 2OL3B 1MLBB 3Q5OA 3O3BA 5IEHB 2Z92B 3RU8L 4D9RE 2CIIA 2Q86B 3T65B 4HLJA 1M7XA 1KJ3L 4MX7A 4XCFL 5I1IH 3CXDH 4ZAKC 1D3CA 1OP3K 3MV01 2EDFA 4OF5A 1Z9MA 1KF9B 4JB9L 4ZDHA 2FYYA 2D03H 3RGVD 3QIBA 5J3HC 2XA3A 2RFXB 5J13C 2BNUB 3QG6B 4OIBA 3WIHH 4TSBH 5F70A 1G9EA 5CLWA 4DUWA 2EC9U 3MV9A 1TQCB 8FABB 4XP9H 4LRNH 1YY9C 4PJCF 3P77B 2HMIC 1S7XB 2FX9H 5EC2A 3PWPE 1N3NB 2ZOLB 4LVOC 4JZJC 4EDWH 3QO0A 4XC3L 2XQYG 5E99L 3WS6A 2BDNL 3IFPB 3OR6B 4S1SL 1U3ZA 3G5YA 1CGVA 4YAQA 4PV8B 4R4FL 3KPLA 1I7UA 4M1DL 2E7LC 5B22A 2G2RB 1LEGA 1BZ7B 2P8LA 4KUZL 3LKNA 3QI9C 5ID1B 1RJCA 3ARBB 3L5HA 1MCWW 4P2QE 1JPFA 2NY4B 4P9ML 4DWHA 1G9MH 1NCWH 2P43B 4OF8A 4OF3A 3BPNC 2C1PB 2PTVA 3VWKB 3FOLB 4LSQL 1AO7A 4PGJA 4M43H 2R4SL 5C09B 1OP5K 4XH2A 1AXIB 1S9XA 3UPCA 5KSBA 2GFBB 4O02L 3X3GH 4HJGA 5TE4L 4XB7A 5EA0H 3FB7B 2Y06L 1KIPB 4WI5A 1QVOA 3QXTA 1IM3A 3CFBA 1S8DA 4OM1L 4WWKC 3ZDXF 1NL0L 1BIHA 2F8XC 1WVZA 2R1WA 1VADB 3GSQA 1QSEB 5INDB 4NKDB 1GHFL 1JF1A 3U4EA 4LPUA 2H26A 4JE4B 3S35H 4P2OD 2RBLA 5DVKA 1H3VA 1PEZA 3UXFA 3VE0A 4LSPL 3FB7A 5DK2A 3CSYA 3E6FB 3OR7B 1RZIA 4WENB 2DB8A 3HCVA 3UTTA 2BY0A 3SE4C 4YE4H 1OAQH 3K74B 4OQ1A 4P48A 3I02A 3V7MA 1FAIL 2Z8SA 5K9JH 3HNTL 3MNVA 1FIGH 1X5LA 1PKQE 2VL4A 1LD9A 3I6KB 3RY5A 1INQB 4WW1B 2NY0C 1INEH 1PG7W 2YPKB 1FLRH 1T5XB 4PRIE 3L1OH 4YR6A 1RZFL 3T0BA 1BZ7A 2P8LB 1HZHL 4DTGH 4OBSA 3P4OA 4PTTA 5EU6D 4MLSA 1J1PH 5E56A 1A1OA 4MCYA 3BWAA 5FO8A 1MRFH 4ORGB 1XCQB 5I73B 3EO0A 1P6FA 3UP1A 2FB4L 1M05B 5T3ZL 4P4KB 2R1XB 4DGVL 5CSGA 4C83A 1MCDA 5KG9A 5KS9A 3G5XB 1ZLWH 4BKLA 5I1CL 1ZEAL 5JIHA 3TFKD 4WU5B 3V6ZB 1S7VB 1GGBL 5GGTL 4HUXB 4BSJA 1N2RA 3IJYB 2IALB 1LWRA 1EHNA 5DS8B 2YEZB 3CC5A 1OGAA 5TGBB 4QF1B 5HSFA 1LE5A 3V4UH 3OKEA 1M6OB 5E9DB 2BVOB 3CXHK 1NBYB 3HG1E 4X6EA 1CYGA 2GITB 4N8VB 4BZ2L 3K8LA 1G7PA 1YMMB 4UT9H 1QRND 3X13B 5HD8C 4ZTOH 1MCSA 2DI9A 5KSAB 5TQ2L 3QCTL 3KDMB 3VD7A 2UUDH 4Y16A 4PJ9B 1BP3B 4P2QD 4MNQA 3RTQC 5SX4I 3G5ZB 1O0VA 1NDMB 2X4OA 4OUUA 2I9LB 1ZTXH 1FVCB 4HC1A 3VXQB 1B88A 3GZKA 1B4JH 5C07E 4G6FB 3CUPB 1LP9A 3TYGL 3GMMB 3KLHC 4NYLB 1LD9B 1T80A 2F58L 4QCIA 3RWCB 3IGAA 5L6YH 5EZJB 4XWGL 4P4KD 4L9DA 4Y2DD 3NA9L 1YN7B 4MQ7B 1CE6A 2XZAL 1FGNH 4RFEB 4XVTL 5FCSH 1SQ2N 3B9KA 4I5BB 2WANA 3EFFB 1AKJD 1P4LB 3P11H 4MA1C 1A9EB 1DVFA 2Y6SC 3B2UC 4PJDF 4P46B 3GSNL 3BRGC 1NUDA 3IDJB 3QUKA 4UI2A 4PRID 4LDOB 4OLVH 3QQ3B 1P5VA 3OB8A 5MENB 4WTZG 1ZGLA 1D7FA 3O2VH 1F3DJ 4ODXA 4JRXA 4EBQH 5C0BD 5DMKB 5E08H 5D9SA 5EU7C 2ZSVB 4KQ3H 5FO9B 4HWBL 3FO0H 1MY5A 1IAIL 1JPTL 1D9KC 1XCTA 4NO3B 1CT8B 4Y2DA 3X12A 3RL2A 4WFHD 4ZXBB 4YNYA 4PREA 1QSZA 1RUAH 3U1SH 1KLFA 4H26A 2HH0H 2ZUTA 4RRPG 3CFJA 4JRXE 5I8EB 1D5ZB 1NSNH 4MJIA 2R56H 4UQ2A 1KJ3H 2AEQH 3O11A 2DQUH 5DYOA 5E5MA 5IMMB 3HUJE 4R7DB 1D5MB 5EN2A 4GMSH 4LQFH 1ZANL 4D94A 3TESA 3VG0H 1PY4A 1WAAF 3OPZH 1B6UA 3MO1B 1AO7D 1F6LL 3VFGL 2CRYA 2L4OA 5DEFA 3V5HB 1CQKA 1K4DB 4XVSH 1R3HA 2PUQT 3BEWA 4S1RL 1FQ9C 3VFNA 2A6IA 2W0KA 3DGGA 2E7LA 1FE8H 32C2A 2BNQA 2VLKB 4L3ED 4M6AA 2QKIA 3DX7B 2D31B 2WAHA 3RPIA 5ESVA 2DQTH 1A7QH 2BDNH 1JF5A 3TM6A 3F58L 5FYJE 4YH6A 1LEKB 1T2QL 2H9GB 3QG6A 3NPSC 3WJJA 3L3HB 2Y07H 5E8PB 5L2JA 5GQBA 4NKOB 5L88L 3BZFA 4GG6E 3T3PE 1RZ8A 5GRYA 4FA8A 3AB0B 4UOW0 2C1OA 4HGWB 1G9ML 1MREL 5EC1A 2UZIH 5BOZG 3MLSL 3MV8D 1IGFH 1LNUA 1MLBA 5KVEH 1VERA 2Q7YA 4C4KT 1GOFA 2QSQA 4JFZL 4OT1H 3HG1D 5DXWA 4Q9QH 4ODHL 1T0NA 1KB5L 3JWDH 3SDCC 4ELKB 1AIFA 3QDGE 4MDJB 3BIKB 4HJJH 3WE6B 4MWFB 5HVHB 1KLGB 4OCSH 4NKDA 3MRLB 3K1KC 3G6JE 4KJWC 1OVZA 2BMKA 1YQ2A 5EWIL 2BSED 4OKVA 2ZCHL 4JN1L 4M6MH 4NGHH 4TUJA 4P5MA 2P49B 1NL0H 1PKQB 4BH7A 1NANH 4LLMB 4HUWA 1CE1L 2RHEA 3ARRA 2NX5E 1U8IA 1SEBA 5J12C 1HEZB 2K7QA 2BFVH 3BXNB 4TSCH 3CMOH 1FFOA 2CRMA 1U95A 2AV1A 2BNRA 2MMXA 4U1MA 2BC4A 5D96C 1OHQA 1OW0C 5D2LB 3HZVA 3O8XB 3N1MC 4DGYH 4U1LB 4Y5XB 4YE4L 4X6CA 4NIKB 4P2OA 3FFCA 4H20H 1JPFB 3ULUF 1PZ5A 2AJZA 5IJVA 4PGDB 5DWUL 4BSWA 1NCBH 4Y8AA 1HHIA 4X8JB 5AD0A 1RU9H 2V9QA 3NH7L 5KTEH 2NCMA 4GJTB 3P73B 2A38A 3FQTB 1S7TA 4JREB 5C0RL 1BF2A 3I3BA 4EJ1C 2QSCL 1HH9B 3KLHD 5D2LE 5B39A 4OI8A 4YDVB 4MD5A 3S9DB 4D0CB 2LU3A 3GK8L 4W70A 4BFIA 2VXTH 3BT2H 3FT4B 4DCQA 4I2XE 1DN2A 2FB4H 3MUGA 3C5JA 1REIA 4RGNB 2VE6A 2VUOA 3BH8A 2F9BT 3ARGD 1Q9KB 1NAMB 5T1LB 5ALBH 4F3FA 5I71C 1A7BA 4EIZC 4N0FB 1DFBL 1LHZA 2BNQB 3INUL 3ZL4H 4Q6IC 3GRWH 3MLTA 5ERWA 1AGCB 4HC1H 2OL3A 1JHKH 3WD5L 2DQDL 4IS6B 1JGDB 1A7OH 2FECL 3B9VA 3FONB 5GGSY 3MX0A 4IIQC 5E6ID 1D5MA 5C0AB 3HB3C 2NTFB 4HK0B 5IK3B 3HLAA 1A1NB 1U91A 1QFUL 2F15A 3DRQB 3G08B 4XI5D 5TQ2H 5FAAA 3DO7A 2DQGH 5HGDB 1OF2A 1ORSB 4P23C 4WUUA 3SN6N 3Q5YA 4LQ1A 3AREA 4KDVA 5DJ2B 4WHTB 4JDZB 4Z7UF 1YPZF 4C56B 1U95B 5CBEB 1OD9A 1AGCA 1SBSL 4KRPC 3KJ6L 5H35A 3P40A 3IXTB 4MQXD 2AEPH 4ZFOB 5HHOB 5FXCH 1BJMA 2J3SA 3OZ9H 2J5LC 2PO6C 3GBML 4DZBB 1FP5A 3FZUC 3S5LA 1OP9A 1IEBB 4GRMB 4YHPB 1JL8A 4OZIE 4G8EA 4E0RB 3RTQA 2F58H 3B9EA 3LMJH 3ILPA 3IETB 5I74C 3PWVA 4TQEL 4HKJA 2FLBT 1R3IL 2NY3C 5EOCL 1U8MB 1Z3GL 4EOWH 3LQAH 3VFVA 2FR4A 4L3AA 3SDCA 3MXVL 4FXLA 4F7PB 1CDHA 3MLYL 1HH9A 4J23A 4XMLL 5EIQA 4CVUA 5KAQF 4PJ7A 1Q94A 4OLUL 2IAMC 3O9WC 4YLQT 3SKMB 4RQQB 3VRJA 3GSNH 4OCRH 2P48B 1WJ3A 4PRHE 3OBAA 2MPAL 2UWEB 3BPLC 2DBLL 4RMQA 3LZFL 4O2EB 1T89C 5SWZD 3QWRA 1QP1A 3TWCH 5ETUB 4XTRC 4N8CL 1HI6A 3ULUE 3H0TA 5ECJE 3QP3A 2AGJL 5E1HB 5H37H 1A6TB 1NCAL 4Z7VF 1UH3A 1KFAH 4MB4A 2VDRL 1WWCA 1OAYL 1RZJL 1Q1JL 3RNKA 2AJ3B 1L0QA 4ZPTB 4X9HA 3D85B 3U1SL 5HGGS 3TBYA 4HIJB 1F2QA 2IH1A 5LWYL 3ETBF 5BRZE 3T2QA 15C8L 2AEQL 4R96B 2MCPL 3U9PH 2FIKB 1S7QB 4JM4H 1MFCL 4J3XA 2HG5A 2Y25A 4K9EL 3W0WA 1VACA 3MLUL 4H1LB 3VFGH 3WE6A 1VKXA 3NIFE 2VLKD 4L1DA 4L3EB 3CFJB 4QF1A 4QRRE 2PYFA 2X1WL 3JTTB 3D9AL 2DQCH 5KSUB 2MHAA 4HT1L 1I8IA 3G04B 4MMXC 4JZOA 2JJUA 4X7CC 4M9OA 4UUJB 2L7JA 4XPTL 2X5PA 4OZIB 3HI5L 4D9QE 5T1KA 43CAB 1RZ7L 2HT4C 5IT2H 5MI0B 2JKXA 4KK8D 3QHFH 5IMOA 3W9DA 4EVNA 1BIIA 3OAZK 4Z7VB 5AUMB 2WV3A 5CJXA 4ORGA 5L88H 1CXKA 3TIEA 2VRAA 2JJTA 2P5WD 2XZQL 4HMDA 3KYKL 1P2CB 2CUHA 3TT1H 4LSUL 1S7SA 5J3HD 2MTPA 3PWJB 4PJIE 1UM6H 5GGRA 5BRZB 4L8BA 5I1DA 3NZHL 4LBEB 4N9GA 5FF6A 1MIEL 1V5JA 1I85A 3DSFL 4NO2A 1MHEA 2P8PA 3UBXA 4HJJL 1BBDH 2LVEA 5BJTA 1I8KB 2HFFB 3MO1A 4K8RH 4KKCC 5IUSA 1DQTA 1F4XL 1LE9B 1TJIH 3PDOB 5EWIH 2G5BA 2QJDA 2WBKA 3ZHLA 2ZCHH 4M6ML 1FFPB 5BV7H 3VFSB 4MJID 2F54E 3EYUH 4Z7NF 3TN0B 1HYRC 4MCZA 1TTGA 4S1QL 1O7VA 1QO3A 1UXWB 4DFHA 3FT2B 5EU6A 2B2XH 3LB6C 2HN7A 1MPAL 3QUXD 2DL2A 4P9HL 4JJ5A 3AS3A 3HG1B 5FGBC 1TJHL 2FEDC 2AQ1A 1ZHNA 3LHPH 5DR5H 5FYKE 1MCHA 3ALPA 2BXZA 4WVRA 2QSVA 5D1QB 1AGEB 2ID5A 3BPOB 5C09A 2VDNL 3QA3B 4NC2B 4QXTA 4OFYD 1HKLL 2ZG3A 3I6LE 1IE5A 4D0BA 2C1PA 1VHPA 2PW1A 2A9NL 5JQ6H 3VXSD 3QDMA 3EUUA 1TFHA 5J12B 3LCYA 3U2SB 3GK8H 3EFDH 3BP7B 3DYOA 3ULVE 3QUZD 4X6CF 1NKRA 4OD1L 1RUQL 4XZUA 4KTDH 4B41A 1I1FA 1TCRB 2HA1A 4N1HB 4YHZL 5IW1B 1FN4B 3REVA 2PR4L 2IPKA 3MRIA 2WLZA 5EO0B 1FG2B 3E0GA 2FBOJ 4KJYB 3JWOH 1KIUA 4Z7WF 2ADJB 5EULV 2EC9T 5I1IL 2W0FB 3RVVD 4HG4J 4IIQB 5JW4R 4K3DL 4I3SH 3MUHL 4H1LH 3KXFE 4A6YL 1NDMA 2J6EH 3BP7A 3U7WH 3EYQC 1JHKL 3QIWB 2DQIL 2RFXA 4LP5A 5FHBL 3VRIA 1PEWA 3W5NA 2IMMA 1INDH 1KJ2H 4LRNL 4DFIA 1BPVA 5J56B 2FX9L 4F7CA 1BM3H 3QDMD 4K8RC 2EDEA 3MRQA 1QFHA 4DZ8A 4X0KA 3QIBC 1AP2B 1MSPA 4PRHB 35C8H 3HC3H 5E99H 3HAEA 6CGTA 3SCMA 5B3NA 4YHYB 1XR8B 2DQGL 1N5AB 5I17A 3QXAA 1G7PB 1RJYB 1M7DB 4JFQB 1BVLA 1HKFA 1EZVX 3VE0B 3IKCB 3WIHA 4UV4L 3MNWA 4KU1A 3QZWB 2GKIA 1GGIL 5ENWA 1CTNA 4U6XA 2CJUL 5DJZB 2JJTC 4RGMC 5D93B 2VZSA 4U6TA 4WDIB 1LK2B 3HRZA 5TH2A 4P4KA 1ZT1A 4GG8A 2M1KA 3N1QC 1IEAB 3HTLX 3S8WA 5EOCH 4C58B 1OAZL 5EA0L 1S7WB 3RKDC 2EH7L 1MQKL 5D1XD 4LVHB 3CFKB 2ILLA 5ANMB 1G7LA 5GGSB 3M07A 1I1FB 1TCRA 1TNNA 5FKAB 2Q8BL 4LAQL 3MA7A 4EKXA 1QBML 5FM8A 1GHFH 3MREA 1NPUA 4ZS6D 4U3CA 1ZVYA 1P6AB 5FYLE 4HPOL 5CP7A 1MF2H 2DLTA 1EO5A 4WWKA 43C9B 4P2QB 3QYCA 5JR1H 3BGAA 1FNLA 3OAUH 1ROWA 4JFYB 4NWTH 3GHBH 5ANMA 5GGSA 4ELMA 2FO4A 1RZIB 4ZUWB 2VDRH 4M93C 1BFVH 1OAYH 4FFYH 5CD5C 5LQBL 3MR9B 1FL5A 1UACH 5ALCL 5HY9B 1JZ8A 1T7WA 3W0WE 3MCKA 1T0MA 4DKEL 5LAXB 4G80A 5FYKD 1RIUL 4NQVB 1QSVA 3ARBD 4GO6B 4NP4H 4AEHL 1N6QL 2LABA 3VGBA 2WM0A 4L3CA 1HQRA 1CFQA 5F7KC 3SDAD 1HZHH 3IKCA 3W39B 3PWUB 3QFJB 4JQXC 3UTZB 1HCFX 4PRPB 5E1AB 1VGKB 1OT2A 5A1AA 4XH2B 4KUCF 2GIYA 5D7KD 3VFWB 3WFEL 5F8QC 4U1HA 4JPVL 3ZKXB 3BDYH 4OCWH 4WW2C 4Z5RB 4HWEH 1WIUA 1QACA 3MGOA 4JFOA 5KSBF 5D4QA 1BMGA 3HE6B 5GGTH 3BPCB 1NEZG 3KWWB 3LN4A 1CFVL 3L7FB 1P7HL 5KOMC 5DJAA 5DQDL 1CIUA 3ARED 2RIKA 3STZA 4YGAB 2DMBA 2ORBL 1IAKA 1ZSDA 3QB7C 1XIWA 1W72L 1I85C 2APXA 4UIMB 4OAWB 5C0BE 2HLAA 3VFOB 1M71B 2B4CL 5CFHA 1KEGH 4ZPVB 1IRAY 4M8QB 1ES0B 4OIIL 2QQQA 4JPIA 4JANB 4YBQC 1FO0B 3BVNB 3U4AA 1T22A 2WMPA 4M62H 1V3LA 2P5WE 2ICEA 5MERB 1MIEH 3QCTH 4NO0B 3T0EA 1DUYA 1FVEA 3KPPA 1CL7I 1UJ3A 4NQTA 2ZG1A 4XP6H 3U0TA 4OZFA 3BO8B 5DZOA 5L8JB 3VFRA 5TJWK 5J9PB 4HPYH 4LVHC 4HIIA 3TPUB 3RZCA 3GSUA 1JHLL 1MHPL 3V0WL 1ZTXL 2IC2A 1P4IH 2B5IC 2VDLH 3BISA 3KLAB 4HKZA 3MJ9L 5C3TA 3QFDA 4N0UE 5DD1H 2OP4H 4YDLB 3DHMA 1E6OL 5BV7L 1C5BL 1W2KT 1A02N 4IMKC 3ZZ1A 3O3AB 3OJMB 4S1QH 1QRNE 4XWGH 2OJZL 4Y5VA 5C92A 2NNAA 4WI9A 1JNHB 4PLNC 1DL7L 2H32A 3HE7C 3HZYA 1A3QA 5F7DB 5HI3C 1FGNL 5L0QB 4GXUN 1KENL 4L3EE 3RKDD 2QHRH 4R90H 5F7YC 2HFEA 1MFDH 2IH3A 3DUUA 2CKBH 3D85A 4LKCB 4J3WA 1Y6NR 1MVUA 3D0VB 4W6WB 2VLRE 1LQSR 4KKBD 2VR4A 4OZFG 1I7TB 4QEGA 5LGHL 1A1MB 5F6IC 1K6QL 1MLCB 3JSSA 3ULSA 1FHGA 4JY6B 5IW6B 4CW1A 5JW4M 2X09A 1OSZB 4XCEB 3BJ91 4KKLD 4NFBA 2A74B 3N9GL 5I66B 5IQ9B 2NY3B 3HZYB 2AV7A 1JNHA 4DKFH 4OI9A 3ARDD 1B0RB 1SY6H 2ED7A 3BGFC 2RQ8A 3FO1B 3QAZC 1A22B 3M17A 3QIBD 4X7TB 1YEGL 4K8RD 2FECI 5LVEA 2PR4H 2I07A 4ODUB 3VFVB 2FR4B 2VN4A 2OJEA 1NSNL 3LN9A 1UCBL 2R56L 3TJHD 2V5TA 1KJMB 5ITFA 5EFIA 1ZANH 5AYUH 2AAVA 2EYRA 4HK3N 2Z0BA 2XNAB 3EGSA 5BO1H 5E9DE 1UB5B 4Z7VA 4PJAA 4F7MB 4DZBA 1GPOL 5CD3B 2GJ6A 4IHOB 12E8H 1A6WL 3B8SA 2XXCB 5DMGC 4NNPH 4LCWA 2DQEH 1N4XL 1IGIL 3EJZC 3EOAA 3MRPA 35C8L 4U0RB 5D71L 1KJMA 3QWRD 1S9VA 2ICWJ 1U3HA 2NW2A 7FABL 1YPZA 4CU8A 2QQNL 3VGFA 5GGVH 5HDOA 5HVWA 5KVDL 3HLAB 5HHOE 5A2KH 3KPOB 3LKOB 4X99B 3S35X 4QY8A 1VACB 5C0AA 1L7TH 1F4WL 4LLDB 1I4FB 3SJVD 3HE6C 5ACZB 4UV4H 4JFOB 1YEEL 4JRYB 1A3LH 1UWXH 4PB0H 4Z5RA 5GS1C 4AY0A 4WTWA 5HYIA 5E8OB 1CG9B 4H88L 2GTZB 4PJIA 3PG2A 1XF2A 1KUMA 2IBGA 4Y5XC 4GKNA 5FUCC 1HSAA 2FBJH 3MLTB 5AWNH 3PDGA 4EEEA 3LKSA 4QGTA 4IRJD 5J6HB 4BQ9A 4Y5YC 2IBZY 4U1SA 1BOYA 1OAZH 2IAMB 5DTFA 4NO0D 5F9WB 3MCG1 5BVJA 2EH7H 2YN5A 3T0EC 4JHWL 5F1KC 1HI6B 1UA6L 2OL3H 5F93C 3QDJD 2UZYB 4X9BA 4NGHL 2VLRA 3ILQC 4CNIA 1YQVL 2F54A 4XCYB 2W92A 4PJ5A 5DURD 5HYSB 1ND0A 1GC1H 4KDTA 3V6OA 3G6JF 4P0DA 5B39B 4LVNC 3X14A 3EO1B 4UOJA 5HTSA 4AQOA 4TSCL 5EOTA 1FL6A 3AVEA 1FFNB 1QNZH 2X41A 2RB8A 1Z0NA 3OAUL 3I9GL 1FG9C 1D5IH 3O6ML 5IJKA 2LV4A 4RA0C 4QXGH 4MAYA 4TRPH 5E6IA 1NEZB 3GMLB 3Q6FB 4OFPA 2CKNA 4GG6F 4HMEA 3OXRB 4X6CB 4K2UL 5KN5B 1N64L 2X4NB 4P57B 5ALCH 5CILL 3R8BB 3S3SA 3T0VA 4X6DA 4P2YA 2BHUA 4XAWL 2B20A 5ELIA 5KTEL 3OKOA 3SO5A 5DVOA 2APWA 2J8UA 3K4AA 1C1EH 3MOQA 4NCC1 4YFDB 3TNMA 4M8QA 5DDHB 3MJ6A 4WTZA 4WHYG 3O2WH 4LMQI 3BMWA 2ZKHL 4QHNB 2FIRT 1CG9A 2HT3D 4EUPH 4BH7B 3BT2L 5EUKB 2CKBA 4Z7OF 3G6JB 4I8DA 3SDYH 5IHUL 5ACZA 1WQVT 5IWLA 2BRRH 4XBEL 2VLMD 2MOVA 2EE6A 4HIEA 4BSVB 1YEFL 5ALBL 5KSAC 4JQXA 4GW1B 4Y4KD 4GQ9H 3MGOB 4O58L 3VGAB 5DQJB 1U8JA 4G6JH 3BSZH 5KVFL 4ZUSB 1LILA 2GUOB 3QEHB 3GRWL 4RMWA 4YNYB 2DQJH 1G7QA 2IPUK 4J3TA 3EDKA 1CT8A 4UIKH 4NCC2 4K3EH 3VD3A 5DJCB 1ZHKA 1XGPB 3G9AB 3WD5H 5FEBA 3CDYA 4JHAL 2DBJA 4BZYA 5JDJA 3ZSTA 4KQ4H 3OSKA 5I16A 1RZ8B 1ZT4B 4K23L 4DKAA 1WFUA 1QSFB 4JZNB 4N0YH 3SKJL 3MRBA 5DQ9B 4BUGA 3C9NB 4U7KA 3LVEA 4LOUC 3JXAA 1P7QD 4J8RA 2OMBA 2R15A 1XIWC 3MR9A 3O3EA 4HS3A 4IIQA 3H9YA 4J3VA 2EDHA 3S3JA 2EDTA 3VDAA 4D0CA 2H45A 3U48A 3RVUD 2ZG2A 3W81A 1RZKH 3VFNB 1R3HB 5ISZA 4Y5VC 4ISVA 2HKHH 5DEFB 4MS8C 1YN6A 2IAMD 2VOTA 3GI8L 3U46A 4NKQB 4FHBD 1KB5B 2OJZH 1B0GA 1H0DB 2VQ1B 1U8KB 3T0DA 2E27L 1YNTB 1IARB 1TVHA 4OZIF 3TVMC 4U1LA 4M7KL 4Y5XA 4PJEE 2OR9L 4EOWL 2NY3D 1NCCH 3O8XA 5E5RB 4D0BB 3L5XH 3L3JB 3MXVH 5FOJA 2VC2L 1QUNA 2DQHH 3VXQA 4LHQB 1KV3A 1CICB 1MCFA 3BZDA 5LBSL 1AD0A 4RGNC 4NQXB 2I5YL 3MZGB 3RZWA 4FFVD 2P5EE 5FO9A 5HHME 3ES6A 4PJHE 3J8F7 3GSNB 3PUCA 1ZHNB 3C8KA 1EERB 3BHBA 4P5TD 4KRPD 1BFOB 4XPAH 3B2VL 3NCCB 2ZPKH 4BYHA 6FABL 4WCYH 2HN7B 4YDIL 1U41A 4RBPK 4PUBL 3GUTA 3MRNB 4HXAH 2ADIA 2Z8WC 4M6NL 2P7TB 4NUJA 2XZCH 4PJXE 3T1FA 4MDJA 1JK8A 3HB3D 3QULA 5E6IC 5JXAL 2YD8A 1FFPA 3ARDB 2VDQH 1UCBH 4BFEA 15C8H 3HAEB 4FABL 3R8QA 4JM4L 3PGCA 4LF3A 4DZ8B 4JG1H 5BJTB 1H8SA 4K9EH 4Z7OE 3JV0A 5CSZA 1HOCA 1YYMH 3SQOL 4NYLA 3QHZL 1I1RA 4UINL 4B53A 4G6AC 4IRSB 3V5KB 1BQLH 3LEYH 1Q9OA 4M7LT 1LP9F 1ED3A 5JW3H 1W0WB 4Q0XH 2PTTB 2X4OB 3ALXA 3GMNB 4QRQA 4Z78A 2X4QB 5E8EA 4JLRB 1QFOA 5IT2L 1BIIB 1HOCB 2L0DA 2X40A 3BW9A 5CLTA 3DXAD 4GMTH 3VJ6A 3MUZ1 1MAJA 2YSSB 4LGRB 1Q9WB 1MJ8L 1A3LL 1MCEA 3WN5B 1VFUA 5HGBA 3NFSL 2DOCA 4HHAA 2EZ0D 1NBYA 4LARH 5A16A 3KPRE 3WXVL 3W39A 3CFIC 4MVBD 4PJBB 3D3VE 4Z7UB 3QEQB 3ELAT 2MWCA 2FBJL 4POYA 2YPLD 3DSFH 3LQZA 3I84A 5FK9A 3TZVC 3VH8A 5ID0A 2AXGB 5HYJE 3V0VA 1IAIM 3BEVB 1SYSA 3FB5A 5HYJB 2ZSVA 2HYMA 4KXZI 2AK4B 4P2CG 5CEZD 1IGYB 1ZGLB 5MENA 3BD3A 4P4RB 1FZOA 1S9YB 5IQ7L 3NIFF 4ONHB 1JCKA 3HAEG 3DV6B 3TCLA 1CLZL 4PJEF 4M4PA 2AI0L 4JO1H 3T8XA 3LQZB 3S5LG 5ACLA 5F1NA 4PLJD 4MDIB 3IVKA 2B2XL 4R8WH 5KVGL 3EAKA 2NTSP 5INCA 3M8OL 1OB1B 3TVMD 1KIQA 1TJHH 3MBXH 4TRPL 5JLZA 1WT5A 4X9FA 1P4BL 3UC0H 3W2DL 2VZUA 2ZUSA 5DO2C 2X9WA 5IF0B 4ONGH 5I1AA 2GQHA 4JFDE 1NC2D 1ZT7A 5DF0A 4F57H 5FYJH 3UPRB 5HGHA 4N5ED 3D39E 3W11D 2Q76A 4LCUA 4MAYC 1I3GH 3V4PH 2XWJA 3WFDH 3LN5B 4MSWB 4Y1AE 3RVUC 4DUVA 3WV0A 4PTUA 2A9NH 2XWBB 5JQ6L 4PJXF 2D7QA 2P5WB 5CZVL 5GS0L 5EPMA 3ARXA 1XIWD 3O2WL 2GT9B 3G5ZA 3OKNB 3EFDL 1XMWA 4OZHE 4PJ8B 3UZQA 3ARFB 2OTPA 4CAGA 3EYOB 3CFBB 4GS7C 4RCAA 1FSKB 2C4FT 4YK4B 4YHZH 1MCPL 5EORL 1AXSB 3UCRA 4WGVB 3FQWA 3HAEH 2I9TA 4Z7NE 2KDGA 3JWOL 4NJ9L 3SGEI 5CKAA 4HQQH 3MACL 3GNMH 1FNEB 2VXQH 4LVEA 4O5LL 2NY1C 3BSZL 4KZDL 4UUJA 1A6PA 3GJFK 4K3DH 4AIZA 4I3SL 3QEHA 5EOQH 3MLRH 5CZXC 4JPKL 3TJEH 1ZA6A 4R3SB 1YEIL 1E28B 3L3DB 5DD6A 4AH2A 5D7LD 3DRQA 2DQIH 2H3NA 2EEDA 2J2ZA 2VR9A 5IG7B 5EZIH 4PRHD 3SDAA 4K23H 3PL6A 3WHXB 2C9AA 5DMJB 2V17L 1KCSL 3QUYA 4X5LA 5DJYB 4QGYA 5K59F 1GGCL 3GMQB 4ZXBD 1QOKA 3UAJD 1MCWM 1FDLL 1ZLUH 2WUCL 3GSNA 3MRFB 1AQDA 2VZVA 5FO8B 2YOCA 3CXHJ 2FGWL 5C08D 3Q3GB 2HLFD 2BVUA 5F7LB 1JHTB 4KK9C 1AHWB 5IVZB 5IB1B 4UAOC 1NAMA 1F3JA 3T2OA 2H8PB 5FKPB 2BSTB 4X6CE 4U2ZA 2WUBL 3D69B 4EI6A 3GI8H 1EPFA 4DCQB 1K4CA 1HILA 1T83A 1OD7A 2C7UB 1NEZA 3Q6FA 3O8XC 2WIMA 1BZ9B 4D8PA 1RIVL 4E41D 3IU3B 3OKDB 4Z7WE 4XAKE 3GSOB 4H8WC 4B7LA 2A83B 1ZLSL 5FYLL 1KXTB 4UNTA 4OFDA 1NCCL 1FFNA 1I1AB 2GCYB 3OR7A 4D0DB 2R0WH 3AS2A 2COQA 2OQJA 2NW3A 3N06B 4G8FA 3DUHA 4K71C 3DPBA 3GMOB 5B38A 3GSWA 5EH1A 4L9LA 1KLUA 2VDOL 5HHNB 4TNVK 5C0JA 5HBBA 2HFTA 2AJSH 4HKBB 3CIQA 3BYYA 1CDUA 4HPOH 4R4BA 5DQ9A 1BFOA 3T0ED 4YHML 5GRZA 4X6DE 2YPVL 4PJ9C 3TN0A 2EKJA 2NY2B 1KIPA 5TPWL 4PUBH 3ZKND 4HXAL 2FO1A 2VTFA 3MLVH 2IEPA 5ACMA 4UNUA 4UTAH 3PIQA 4FFYL 2G5BB 1KN2H 5EIVA 3AREB 2DLFH 5DJ2A 2OMNA 4MXVE 5JXAH 4M7ZB 4ZOBA 4ZUSA 5TF0A 4G6KL 1A14H 1NC2B 2RJMA 5I8CA 2MCG1 1OOAA 5I75B 2BMKB 3B3IB 2J8UE 4Y0GA 5IK3A 3HE6D 1TVHB 3OXRA 4V1DD 2VZ1A 1N6QH 5D5MF 4BSVA 1HHKA 5HYQA 1F4HA 1IGMH 1N59B 1MHHB 3SQOH 2QR0B 1EGJL 4MAYB 4HV8A 2ZUYA 4I0PD 1CFNB 1T0NB 2VUYA 4XVJL 2YWZA 3WKNA 4WW2B 5DUML 4GKZA 1CWVA 4F9LC 4MZ2A 1BQLL 2FJGB 2IJ0C 1U2CA 2E5EA 4FN0A 1MIMH 3WFEH 3G5YB 3TIEB 3U7AA 1XGRB 3R1GL 5F1IA 1E6JH 4XRCB 2WP3T 3U36A 3VFMB 1KTDB 5D6CA 3LPFA 5I18L 1G0YR 3MOAL 1FYHB 4WV1C 3IDYB 5T5NF 4X6DB 4ZSOA 3VI4F 4APQA 5JZ7D 2MNUA 3ISWA 5ITFB 4AMKL 5KSBE 4UOW1 5KSUA 2L7UA 2PCPB 3WEXA 4L8DA 4UU9B 3K81A 4O9HH 5FDWB 3QEQD 4YGVB 4W6XB 5C6TH 4OIIH 1HHHA 3MRHB 1MI5B 2R0LL 2AEIT 2Z9TA 1A7RH 3EDJA 2CGRH 1IVLA 3EW3B 4KAQH 2FX7H 1PYWA 3GRWA 5SWSE 1UENA 4PJBF 3JWOC 1VFBA 5E03A 1TXKA 1MHPH 4FFWC 3V0WH 4JFHE 4YQXH 1P4IL 4KKLC 3EHBC 2B0SH 1WBYA 1O5DT 1KJVB 3DOSA 5DD1L 2WWKO 4GRLA 3CD4A 1E6OH 1UJ3C 4I18A 4XCNA 5LGKA 1FYTD 5EIIB 2EYTB 2LAAA 3CCHB 4PGCA 1KIRB 4K3JL 4YFLI 5D5MB 1B6DA 4PJHA 3PWNA 3HUJB 4DQOH 4NRYB 1HSAB 1DTUA 3TNMB 4OUOA 2F53A 1WICA 4NOBA 3DX6B 4JRXB 4IMKA 1T83C 4UDTA 1MCQA 5HI3D 3UZEA 1UB5A 3NCYP 4ZFGL 5L9DL 3NCMA 3KR3H 4ODTL 1WZ1H 1NBVH 4ONGL 1QSED 4LL9A 3OKMA 3WFHB 2KUTA 1IBGL 2ERJB 1ZLWK 5C0JB 3SJVE 2XXMB 4LASL 5A2LH 3GMOA 4X6DF 3BKML 3SJVB 4LSSH 4OZHA 4PLOB 1T3FB 1AIFB 4ERSL 3JWNC 1PY9A 3BUYB 4ODWA 3KXFD 1KYOJ 4Q9BA 4YHOL 1G7IB 5HDQH 2KL6A 2OTUB 3LD8B 1DBAH 3QH3A 3N9GH 5DHXB 4UQ3A 4GT7A 1FL3A 5EO1A 1XF1A 1SM3H 5IBUG 3H9SB 3WUWB 3QJFA 4KTEL 4MA3B 1YMME 5I30H 4QKXB 1HILB 1OP5H 5IB2B 1QLEH 4ZD3H 4CW1B 1MCPH 5D5ME 1EBAA 1CD8A 2XKNA 1G1YA 4Z95H 4D9LL 2H8PA 2ZUQC 2Y36H 4N5UA 4HIXH 4NJ9H 4DJMA 2BCKB 2AJYH 2QADD 4O5LH 2YKLL 2RCSL 2QKIB 4M3KB 3OGCB 2CDEB 2AQ2A 1RK1A 3MLRL 1GZQB 4JPKH 5BO1L 1F3RB 5FDYA 2FWOB 2YXMA 1VFBB 1CXIA 3GMQA 2DL9A 5DRNA 4OD3H 3U30C 2NQCA 3P4MB 1JGDA 12E8L 3QUYB 3QUZA 4G8IA 2VLJA 2BSSA 3RNQB 1KGCE 4YHIB 3NVQA 2DQEL 3IDIB 1QZ1A 4JGMA 5DEGB 5EN2B 4BZ1L 1I4FA 3EIFA 4ZYKB 4RISL 4E9LA 4X99A 4RFNB 3OGCA 4UU9A 3L3DA 1E28A 1XH3B 2WUCH 4FZEH 4NBZB 3TBTA 1HQRB 3FT3A 4G9FB 4HKZB 1MWAL 1SJEB 3U6RB 5EZOL 5J57B 1RUPL 1GC1C 3QUYC 4NQVA 5JORA 3RWDA 2V5MA 2V9RA 4PB0L 5KJRH 1AR1D 3ARFD 5A3IC 1ORQB 4H88H 4PB9L 4ODXB 4KY1L 1EEYB 4PJBE 1XGQA 3ARVA 2YD1A 2VO5A 3CGTA 2EDDA 1X6LA 3GJFA 3NFNB 4P2RB 3ZYZA 4F37K 3HI6L 4XHJD 5D2NE 4QRPE 1NCUA 1CVRA 4ZODA 2DD8L 2CUMA 2EEAA 1DVFB 1UGNA 4AQ1B 3H9SE 3STZB 1CFNA 4PJEB 2XRAH 2HTLD 1UVQB 4FQHB 1KCVL 4JG0L 5HHPB 2DKMA 3ARSA 1YQVH 3P30H 2FDBP 2Z35B 4OQTL 4Y5YA 4HIIB 3TPUA 3X11B 1MHCB 2YD5A 4JAMA 3QJHB 1MQ8A 1OARH 1WIOA 5B21A 3QPQC 3UO1H 4OZFB 1UJ3B 2XN9A 2D7PA 3BPOC 3UYPA 3CX5K 1CGSH 2DIJA 4K3GA 4KHTL 2M26A 4IDJH 1T1WB 2APVA 1ES0A 5L2KD 2A0LC 2LQRA 5B8CC 2P8MB 3UTZA 4QXGL 4BK5A 4I0PB 5E2UH 3GSXA 1V3MA 1FGVL 2N1KA 1CF8L 4L3CB 4P5MB 5DUBA 1IGCH 1CXLA 1AO7E 2MKWA 5I0DA 3PHSA 1N64H 4HKBA 4JFFD 4KRLB 4JR9H 4R4ND 2WZPD 4GW4B 1BD2D 4MNQE 4PJ9A 5I1KH 3TN0C 1A14L 5SWQB 4MWFA 5DJ0A 3CLEH 2DKUA 4AM0A 3F12A 3TCXA 2IGFH 5GXBB 4ODSH 4MAYD 1YMMD 1I7ZB 2NNAB 2N7BA 2J8OA 4U1HB 3W11C 2Z91A 5KSBB 4N5EC 1J1XH 1II4E 1ZVHA 1RJYA 2AJXH 1S5HB 5FCUL 1XR9A 3EYSH 2PW2B 3GBLA 4X5WA 1FFQA 2CRIA 2D7TH 1Q9LA 1WCBA 2C1OB 1MIML 4JFDA 3ULVL 5IHUH 3SDYL 2AKRB 1F58H 5A16B 4EN3D 4NKOA 4IRZH 3TO2A 3U9UB 3RX5A 4PR5A 1V05A 2VAAA 1KN4H 4G80B 3JZ7A 2VNCA 5I9QB 1BVKA 4NKMB 1X3DA 5KVFH 2F74A 1AHWA 5IVZA 1JHTA 4NN5B 1JUFA 4NO0A 3T0EB 2G2RA 3Q1SH 3MGTA 1G7LB 4HIHB 4UIKL 4AMKH 5I1JH 4NZUL 1S7WA 2IAND 2D9CA 3RVVC 3B6SA 1AQDB 5T5FH 1WZMA 5FOBB 4NQCE 1UM4L 1KPRA 4KQ4L 3I6GA 3QQ9C 1CK0H 4DK6A 4JFEB 4YR6B 3G6AB 4XPGL 4PJDE 3QUZC 2CGRL 3Q0HA 2CDGA 1HHKB 5GJTL 5DVNA 5HYQB 1DBJH 3TO2B 3U9UA 2C3VA 1CXFA 5LJYH 5EBWA 4XX1G 2W38A 2YXFA 3FFCD 3RY4A 1F00I 3PGCB 4LF3B 2JF1A 3I2CH 4JFQA 4ZXBA 4OSUH 4I48A 4PJDA 3GBNL 3RWEA 3GB7B 1NGZB 5T3XL 4AL8H 4YC2B 3FQRB 2WBJD 3R06A 4WEBL 4Y4FD 2WIIA 4QHKJ 2P7TA 5TH2B 4FOMA 2Q7NA 5JOFA 2NXZB 4NJAL 3LRGA 2DLGA 4R4BB 3SKNB 1CICC 5BZWB 2YC1A 4M7KH 1KPUB 3FFCE 3HUJF 5D72H 1CGWA 4ZO6A 5TFSH 3ULUC 4XPHH 3TO4A 4QRUB 1TMCB 4HAFA 5EPMB 4X80H 1WBZB 3KR3L 1WZ1L 4HUUA 4ODTH 3U83A 3GMPB 3OWEA 4BH8B 1WAAE 4LGSB 3SGDI 4P99A 1KEML 5CJOH 3TBVB 2I5YH 1IBGH 4YXKL 3QRGH 3FQRA 3UTSD 4Y4HD 2ADFH 1LEIA 1S3KL 1R5IB 4YX2H 2QV2A 3GB7A 3OQ3B 4W81A 3PP4L 3GIVB 4LSSL 2G9HB 1VFAA 4NN6C 4ERSH 1AO7B 3PDOA 4WUUD 1UKTA 2GTWB 3GSOA 3NTCL 4XPAL 2HFFA 2ESVB 1OSPL 4KKCD 4XC1L 4YDIH 4P3DA 4PJ8D 3O6FC 4UTBL 1FPTH 4RA3A 1IM9D 5DK0A 3QDMB 3BX7C 5HVHC 5GGUA 4RGNE 3T3PF 5I30L 1TZHA 5IFJB 4L8CA 1FYTB 4HFUH 4XP1L 4YXHH 2J8HA 5CP3H 4WWID 3KLSA 1NFDB 2UVEA 4KH2A 1XF4A 3ZT7A 5C0CB 4R0LB 5IFHH 3QO1B 1R5IA 1NFIA 1XEDA 1YEJH 2YKLH 1C12A 2RCSH 3PQYA 2VLRD 1ONQB 1ZT1B 4GG8B 1IL1B 4O2FB 1BLNA 1C5DA 4F15C 3K8MA 1BJ8A 3MBED 2RR3A 1YYML 3CFCL 2E9BA 3IRPX 3LKRA 1DBMH 4RGND 5LG1A 5ICYB 4JFPA 4OD3L 1WBXA 4L29B 4N8VA 3SEPA 5CIPB 4QRRB 4RDQG 4Q0XL 1GVIA 3BN3B 3PJSA 2X7LB 1XH3A 3QG7L 1IQWL 1U8OB 4PJHF 5EOCJ 2OS7A 2Q6WA 4QXUH 2FJFB 3BMVA 4V1DE 2H2PD 3OKLA 2CIIB 2IF7A 3M45A 4QNPF 3VA6A 3K8KA 5EO9A 3QPXL 4PP1D 1JRHI 4GMTL 4MLIA 4U6HA 2X6MA 3UTQB 5FUOL 2ADGB 3MFFA 1F97A 2VH5H 3TA3D 4XP9L 2VIRA 4PJFB 3U0WH 3LV3B 3MJ8A 3A0OA 1A1OB 4PB9H 4U7MA 4PJ8A 2YPLB 2H1PH 4JM2F 4P49A 2D9QB 3V6FB 4XC3H 5D70H 1QO3B 1A6TA 4Z0BL 4PRIA 5CJQH 3GHEH 3H9ZA 4M1DH 3FFDB 2BNRD 5IB4A 4NQCD 1MAML 3MXWL 3E8UH 4MCZB 2X44D 3LN5A 3WFZA 4XTRD 4N8VG 5FOBA 1KPVA 2ITCA 4TNWF 3T0AA 5AUMA 1HSBA 5H2BA 5D2LF 1LMKA 1T1XA 1KCVH 3MA9L 3TA3C 3VFUB 4TOYH 3P30L 3VCLB 3O9WD 1LP9E 3HCVB 1OARL 4PP2B 2O5YH 3UO1L 5DK2B 5FA3A 5B8CA 4KKAD 2XG4A 3U7YH 4LSQH 1CGSL 5I0ZA 2VAJA 2R4SH 1IFHL 4OF7A 4YK4C 5GISL 4QT5A 3CVIH 2H26B 3M8OH 3OXSB 2Y06H 5GRUL 4I4WB 2EICA 3MUJA 1QFPA 5I6XB 1H3GA 1P4BH 3QXDA 1J18A 1J8HA 3D25B 4M1GH 5DRXB 1TVBA 2V5SA 2HT3C 4GAJL 4F58L 3K2MC 5D7JC 4F57L 3L6FA 4JR9L 5FYJL 3VXOB 3W9DB 5IMOB 5JMOC 4HH8A 3MBEC 2YR3A 1KCRL 3CLEL 5H35B 2V2TA 3QDHA 1NBZA 3F6IA 4MQXC 2GSIB 3FB6B 1JZ3A 5F88A 3BEVA 3WFDL 5D93C 3DECA 5D5MA 5I6XC 5K9OB 1YMHB 1S7UB 3O3DB 1I8IB 4WFGD 2EE2A 4WUUB 3BDBA 1CCZA 5AZEL 1P84K 4LPYA 2YHGA 1A0QH 4IM8A 4Z7UA 1KC5H 5J6HA 4WHYH 1YPZE 3NIDE 5FUZL 3MNZB 3VXNA 1WV7T 4L8SB 1OTTC 5CBAB 3O45A 4ZYKA 4F7TA 5K9JL 3HNTH 4LCIH 3ULVH 4N0RA 3NPZB 3FQUB 3S3PA 3SKOB 1BX2A 4JCLA 4OZHF 4GRWB 1AHWC 5F3BA 2MQCA 4R96A 3SGEH 3VJ6B 5TDPB 4P23B 1MHCA 3G5VA 2NY4D 4KZDH 4JLRA 1JZ4A 2E6JA 1YEKH 4EN3A 4KKNA 1F8TH 3TJEL 3KYNB 4ZMAT 2YUZA 4N9GB 1EEZA 4NZUH 1A3RL 1FNFA 5GS2D 1YEIH 1J1PL 1A6ZB 1G9MC 3ILQD 3PWJA 4GXVL 1MRFL 5DFVC 8FABA 2YD4A 1UM4H 2XPGB 1URLA 1QR1B 4DGVH 3ARGC 1EHLL 1MCJA 4LAJH 2Y72A 5K9KA 3ULUD 5GRXG 1QLFB 1P7QB 1OLLA 2CMRL 5IB2A 4ZDHB 3RL1A 1UWGL 4EVNB 5DD5L 3QJFB 2C5DC 4GLRH 3PNWA 1EEYA 1KTDA 1GGBH 2QQLL 4MD5B 5D6CB 5DA4A 5GJTH 4TVPL 4Y4FC 1J8KA 4F33B 1H8OA 3P9WB 3WBDA 3RGVB 4OZIA 2FGWH 4DGIL 2KQMA 3KPNA 5F89A 3IFNL 3HRPA 1U93B 3I2CL 3DXAA 4BZ2H 4OSUL 4Z77B 4NQEE 2D0HA 1TJGH 4UT9L 5HGDA 4Z76B 3GBNH 5KAQG 3QEGH 1HNFA 1TITA 5A40E 1A5FH 4OTXL 4UV7L 5ITBH 5F7WC 3RFZC 3VW3H 2EIZB 2P5EB 3DIFB 5F6IB 2A9MH 5GSRB 1JMXA 4KI1A 2E7BA 4KMTH 5I8CB 2A6KA 2VWEC 1CLCA 1AI1H 3NGBB 4JFHD 1JWMB 2JIXD 3S5LB 3VD4A 4K71B 4XPHL 5DVLA 4HULB 3QQ9D 3V52L 5DMGD 5GZNC 2F53B 3S96A 4WEUD 2DWDA 4HIJA 3WFBH 4RX4D 4KPHL 4OZGB 1X5XA 3B9AA 3O4LB 3OHXB 4R26H 1FSKC 2NMSA 5CJOL 5JOPE 1U6AL 4YXKH 2UYLB 2PYED 5JDSA 1JGVH 4EQ2A 1N7MH 1ORSA 3K2UL 2X4SB 5IB5B 4LHUG 3G08A 4ZUVB 4FP8H 2LTQC 4PBVC 3HNVL 2ZUXA 4KJWD 3KPSD 5E70A 1X5JA 5K59E 2ZCLH 2ITDB 4YHMH 2YD9A 4XVTH 2YPVH 5ICXA 1EZVY 5F72S 5IKCB 2CQVA 5DUPL 3VXME 3S36L 3MLVL 3FQTA 5JPNB 3VFTB 3MRHA 5C0CE 4WIQA 1CI5A 3MRGB 4NM8H 1NANI 3LEVH 4JFEE 3C2SA 1U8MA 1HYSC 1MJ7H 1T1ZB 5ADPL 4OLVL 4XGZB 3RL1B 3NIDF 4NHUB 1D6VL 2ITDA 5IIEA 3H9HA 3OKMB 4TPRH 4EBQL 1EGJH 1P1ZA 2J8UF 4D9RD 2WW8A 2UUDK 3T0EE 2EDOA 3R0MA 1G7MA 1UYWH 3VFMA 3KYNA 1WITA 3MRRA 3UTSE 1P84J 3HMXA 3KPQA 4U6YA 5DMIH 1ADQL 3R1GH 2NLJA 3KNBB 1S7TB 5E2WH 5GZOC 4PJHB 1RUKH 5I18H 3RAJL 1MCRA 1JPSL 4HUWB 4WI2A 4QXUL 3WL9A 3WIFA 3GMRB 3HN3A 3QDGB 1VFOA 1G7HA 1HHIB 1ACZA 4GMSL 5EIIA 4GRLD 5JHLH 4JRYA 2ATKB 5DGRA 3FQUA 5GSRA 4LNVA 4F7TB 2X10A 5C9JA 4RMRA 4QO1A 4PJ8C 2WSKA 5DJDB 1FV1A 4H0GA 4P5TB 3QCUL 5F9JA 2W1NA 3P0VL 3VI4E 1T04A 1KXQE 1MJJB 3IDXL 4I3GA 1MJUH 1MH5A 1H3UA 5ADOL 1FORH 1MNUH 4XNUH 5CJ8A 3DXAB 3V2AR 2H1PL 1PDKA 2BVYA 4MZ3A 1ZOXA 4LCCC 1EXUA 3A6BL 2GSIA 2DQTL 4LPVA 3FMGH 5ERWB 3F58H 4PG2C 2OTWB 1MAMH 3GO1H 3E8UL 3MXWH 2D4DA 1AXSA 4YBQD 5MEOA 2YA0A 2RGSA 3EGSB 1QD0A 3QQ3A 5IOPA 4E42A 4HUMB 5BZDA 5CJ5A 2ATPB 3SE9H 3NOIA 1CS6A 1GIGH 3MROB 3QUYD 2UZIL 1J8HD 1N6UA 1LO3H 4H5SB 4CDHA 1HXYB 5IV2A 3ULVF 2OYPA 4LCWD 5KVEL 1T21A 5T1DH 4PTUB 3IRZA 5CWSA 2WBJC 3LIZL 3NCFB 4CRPA 1JFQL 3BPLB 5E4EC 3MYJB 5I1GH 1PGRB 4GKOA 2XV6B 1A6AB 5D7LE 1RQ5A 4M5YL 3CVIL 3MGAA 5GISH 3VCLA 3CSGA 1FL6B 2NY6B 4OCSL 3LDBB 5L9DH 1FNSL 3AGVA 1KJ2B 1Q72H 4PY8I 5E7FA 3MBEA 2R2EA 5EBMB 4ACPA 4D8PB 1I9JL 4K94L 1P5UA 3SY0A 5BS0D 3LKQA 1JYVA 3OG6B 2ARJQ 3BKMH 1OAXL 4NT6A 5B38G 1VEPA 3BP6B 4OUUB 5F7HA 3V6FA 1DBAL 3FN3A 2JJVA 1MVUB 1T4KB 4ORZC 2UY6A 3OHXA 5JHDA 4XCCL 5AZEH 4HK3J 1A0QL 4AIXA 5F9OL 2VL5A 2X1OA 5CINH 4DGYL 5HGAA 1R3JA 4C54A 4PS4L 5FV2A 1HNGA 4ZD3L 3FB5B 5DWUH 4JQIH 5EO9B 1VESA 1JYWA 3MRLA 3NFPB 4MNHB 5IG7A 4NBYB 4EN3C 1RU9L 3ROLB 4X6EB 4CN6A 1A4JB 1JRHL 1WUNT 4GLRI 4JKLA 4P3CH 4XVUD 5DS8A 5TDOB 4EXPX 1N2RB 3IJYA 1MFEL 5JTWA 3B9KB 3RL2B 3N85H 4K55A 4NRZA 5J1AB 3SDDB 4HS6B 1HHJA 4ZOAA 4R2GC 1EHXA 3TFKC 3ZT6A 4DN4L 3QNXA 2V9TA 4P5KB 1EHLH 3UTPD 3EOBB 1NKOA 3PP3H 2JTDA 1H3TA 1NFIB 1JGEA 3TT3H 3QO1A 5DD5H 3VRIB 3MFGB 3L3HA 2IFFL 2HKFH 3CX2A 4FZEL 3RHWF 2EE3A 5IB4B 4L4TB 5DI8B 1K3ZA 3IDGA 4P9HC 3VMPA 1IGTA 3BDXA 1X5IA 4PRIB 5EZOH 4DGIH 1FVCA 1I9RH 3ZDZE 3RRQA 4XNQA 4OGAC 4JKPL 4TSBL 3RIAK 4WRLA 1T2XA 4Q6IB 3D2UB 5KJRL 1FG2A 1H15B 4ZAKB 3EOBA 1RZGB 2XY1A 1FBIL 4UT6L 4ALAL 1FNHA 1X5AA 2VISB 1W0YT 4UV7H 3S4SB 4EDWL 4NM4H 5I1AB 2KZ1B 3WHXA 5EZJA 3UTTB 2PXYD 1I3RB 3BGMA 4DOHB 2DD8H 2ICWB 4AT6B 3OKLB 1K9TA 3P3YA 4PRPA 3CLFH 4GAYA 3C6LC 4LCWE 1M6OA 1J7VR 4Y4HA 5E9DA 5L2KB 3H7LA 2LTQB 4P3WA 1AE6H 4JG0H 2JK5B 1JV5A 2BY3A 3QNZA 1EX0A 5HJ3B 3SDXB 3RI5K 3MLXH 2V2XA 1WWBX 2ICES 1U6AH 3GBMH 3JUYA 4BM7A 1KPUA 3D18B 5F88B 1CLYH 3FB6A 5JZ7C 5GIRB 1S8DB 3UEZA 2SEBB 4LSTH 1FZOB 3AMLA 4OZFH 1ZLUK 2HRPL 2WIIB 4M43L 1R3IH 4OF6A 1ONQA 2ZCLL 2YMXL 4O02H 3X3GL 2G5RA 2WLYA 2WBJA 2VKWA 4QWWD 5C0CA 4PV9A 3RKPA 3LQAL 2CH8A 2WBWB 4FG6D 5DUPH 3F5WA 3BQUD 1JV5B 5HJ3A 3SHSA 4F37F 4CVXB 3CFEA 4OLWH 2EDWA 3HMXH 3LKPA 4LSVH 2OI9B 5K9QG 4J3SA 2YPKA 2J6EA 2QLVB 1WC7A 3MV7A 5H37G 2J5LB 5DK0B 4X98A 5HHMB 3QUMA 1T2JA 3DUSA 4J6RH 1QG3A 1U8KA 2MPAH 3S35L 4MA8L 4PP2A 3GSUB 3MNVB 5ADPH 4HZAA 3UPRA 2X4UB 1D6VH 2YD2A 3QWOB 4QOKA 1FCGA 2XQYK 1NGWA 1ULVA 4JJHA 1IKFL 1E4XI 2AJXL 4Y4FB 5FCUH 2AGJH 4QYOA 3CSYB 3E6FA 3EYSL 4HDIA 1NUGA 1FAIH 3GMNA 1BBJA 3P4OB 4PTTB 3F65A 5EU5B 3PHQA 2NXYC 3C6SB 3V6OE 1JUFB 4XX1E 1G6RL 2VLJE 4JRYD 5E2WL 4RFOL 1NCTA 4WTXA 2XICA 3PV7A 3LN4B 3OAZH 5BZDB 1KN4L 1DBBH 2HTKC 4ONHA 3L1OL 3SKNA 3ZHDA 5IVNA 1MCLA 4PYGA 3RGVC 5JW4Q 1N26A 1AQKL 2OX5A 3KDMA 2EKSB 3S37X 1Y6MR 3R06B 3IB4A 4HBQA 1R5VA 5M94B 3IFOA 1BVLB 4HJGB 5DT1L 2DMCA 5T5FL 4HS6A 3FN9A 1EXUB 3VA2C 2B1AH 1QQDA 3MCLL 5LCVL 3PWPB 4HT1H 3QDJE 1MNUL 1Z9OA 4XNUL 4NUGL 5DD0L 3UYOD 4PLKC 1TDQA 1XAUA 3GM0A 1DBKH 3JTTA 4FNLL 1ZGLM 3PWUA 3QFJA 1CDCA 4PJBA 5CP3A 4K7PH 2X7LA 3FMGL 3K4DA 1RIHL 5EBWB 1YJDL 3WNPA 3IAGC 2R39A 1JF1B 4HIEB 3DURA 2CLRA 3V6ZA 4FG6C 5IMKB 4C56E 4UB0L 1TLKA 5EB9A 3V5DB 3SE9L 3BESR 4G42A 1J1OH 4KUCD 3CH1A 5J1TC 3BD4A 5LGJA 5C07D 5BW7A 1QSFE 1TPXB 4NQDD 2DM4A 5E24E 3QWOA 4QOKB 4NJAH 3FHQA 5FGCB 1BBDL 3IF1A 1CTOA 3LKQB 4GBXD 1YJDC 1YYLL 3QIBB 1F4XH 3CDCA 3EOYG 3RIFF 3RWGA 3C6LD 1NAMH 4NQED 3DVGB 2X89D 3QEUB 2DS4A 1B4JL 4PD4K 2PW1B 1PX3A 5JA8B 2CDFA 3UMTA 2BY2A 2PXYC 3C6LA 5J7CC 2ESVA 3LRSA 3EYUL 2EIEA 3H3KA 3QRGL 2NZ9D 1S3KH 3F5WB 2VERN 5DFTA 1OAXH 1RURL 4ISVB 1YY8A 4ZO8A 2APBA 3QULB 1NGXA 3LSOA 4PRPE 1XGTA 1CLOH 4OGAD 4MNGE 1W0VB 3C5SA 5FM5M 3VXSA 5C0FB 2NR6D 5EU3A 1S7RA 5CINL 1VADA 2FGZA 5E2TH 3CH8A 2N4IA 4EUPG 2MFNA 1LO5B 5IOPB 2E7CA 4HFUL 2FYYB 3BHBB 3MRDA 5MEOB 2VLKE 3DROB 4POZC 2NY5H 5J8OA 4ZUUA 1KNOB 4C59B 1WFOA 4M61A 3OKKA 2VXUH 5L0QC 1T1WA 3BAEH 1ZHKB 3QFJD 5FUCE 3B8YA 2Q87A 2K3TA 4PRBB 4PJDB 3CFCH 2XT1B 3RBGA 3N85L 5IB3A 1AP2A 2D7OA 4KQ3L 1RJLA 3D39A 4YBLC 1G6RA 3FO0L 3MRQB 1JPTH 4U1KA 5SX5K 3QUXB 1RUQH 5DO2D 2EIZA 2P5EA 4KTDL 2PKDA 1RUAL 2CK0L 4LCYA 3U4BH 3RGHA 4L4JA 2I27N 5DLML 1DDHA 5FYLD 4ZOEA 5CZKA 1IQWH 3BWUC 3G6JA 3G6AA 2Y9RT 3BQUB 3U46B 1IGTB 1MY7A 5EUKA 2DQUL 3OJDB 4PLJC 2VLLA 4BELD 3REWA 3CDFA 1NCNA 2HKFL 2R8SH 1I7UB 1AFVL 3UJJL 5ISZB 2ADJA 3VG0L 5IBTH 3VXUB 2O5XH 4F15B 5GGTA 4PJ9D 2ENSA 3BYTA 3QNYA 4Y4KB 2DTML 4WY7L 3MRJB 4ZQKB 4XVSL 1T7ZA 3U0WL 1Q9KA 4LHUB 3RJQB 1BM3L 5DRWB 1OAUL 2DJUA 1KG0A 3MUGB 4LU5H 2JE8A 1CU4H 2AK1L 5CJQL 3GHEL 1T3FA 1T2QH 3SJVA 4M1CD 5DJXB 2CK2A 3IJHA 3KPSA 5HI4D 1KTKE 2OBGA 2XN9D 3LS4H 4EUPB 1KBGL 1H9VA 5I73C 3WS6C 1CFSA 3IJSB 3DLQR 1RHHA 1OPGL 1AE6L 1ZGLP 4HH9B 4MJ2A 3ABZA 2PYEE 5DJ6A 4TOYL 3WUZA 1K85A 4IOIA 2GUOA 3QQ4A 3O8XD 2HVKB 4MA1B 5C7XL 1CLYL 2FWOA 5D1QC 2O5YL 1DQJA 5DJ0B 2F54B 4XCYA 5DHVH 1HH6A 4PRNA 4JFZH 1T0PB 4OT1L 4Q9QL 3JV5A 2ERJC 5JHDB 4ODHH 2GJ6D 2VDKH 3T09A 2O93L 3ULSB 5HHXH 3QEQE 5EU6B 3IDNA 1PLGH 2BCKA 3BP6A 1A2YB 3A6CL 3D1MC 3W82A 5C0IA 4S10A 1WWAX 2HJLB 3HS0A 4JN1H 3PGDA 4XBPA 4Z0XB 5JQHC 4GKNB 1QEWB 4LAQH 2Q8BH 4XP5L 5FO7B 1WISA 4F80A 4PJIB 3I50L 4XHQA 4NRXA 5C09D 4DK3A 4UQ3B 1I8KA 4OKVB 4Y5VB 3X11A 1A6AA 2GJJA 2QADB 25C8H 4NO5B 3SGJC 2IANE 3QISA 2UVFA 3MLZH 2OTUA 4PY7B 1IC5L 5C0DA 3H3PH 1R3KB 5HHPA 3AAZB 2IG2L 4WNQB 3HPLB 4LFHG 2C4XA 4YBLB 3SDCB 4ZFFA 3DTXB 4HUVB 1CIDA 1EUUA 1JF6A 2X05A 3GI9H 4L1HA 2CIKB 2EYSB 1QPXA 3BKYL 5L8KB 1BFVL 1G9NH 1U93A 3TBWB 3RDTA 5HHQB 3LEXA 5GHWH 4LHUA 1LNUB 3H8NA 1NCBL 2NPLX 4DKEH 2CPCA 5I8KH 5AG9A 3WS3B 3NH7H 1U92A 4GAFB 4P5TC 1MCIA 4MJ5A 1T5WB 4AEHH 1ZLVH 5D7SH 1ORQA 2QSCH 3DGCR 3L95A 4JRYE 3PWNB 4ETQA 1QR4A 2W91A 3V0AC 1JNLL 5F96L 4C56A 3MRKA 3TZVB 2AS5M 1QR1A 2VXTL 1NLDH 1OF2B 4IRJA 4M93B 4D3CH 5DJAB 3TBTB 3MCLH 3DO7B 2JLLA 2GW5A 5F6HJ 4XNXL 4NUGH 1OTUD 4XNMB 5F71A 1ACYH 4ZFZA 1JNNH 2OXHA 4OCWL 2CMRH 3TV3H 5CJXC 3DO3A 1DQJB 4P59L 1K4DA 4GFTB 1UWGH 4R0LC 5JIKA 3E3QC 3RA7L 3INUH 3ZL4L 5I76B 4TVPH 1T6WA 3QDGA 1HHGB 4G8GA 2NXYB 4KJPD 3VWJD 4HC1L 3T77B 4MS8D 3FL7A 4UB0H 4O51B 1B0WA 1QFWI 4BJLA 2BNQE 2Q6WB 5GPRA 2ORBH 4PJFE 3MQIA 1MFAL 1U8OA 1U3HD 3PJSB 3DROA 2X42A 1A1MA 4HD9A 1V7NH 1AGFA 1S7UA 1HIMH 2JB6A 4APQB 4JFFB 4KMTL 4U1JB 5IIEB 1R6VA 3ARGB 4U3XA 5B4MC 1DN0B 1KLUB 5D7LA 3WNKA 5BS0A 3V52H 4MD4B 4RNRA 2H32B 1SBSH 2F54D 4O4YH 1NAML 5IHZA 4RQQA 4KPHH 3NIGF 2OP4L 2EYRB 3BRDA 3KYMA 1CDJA 1C5BH 5JXED 1OCWH 2OM5A 4WFED 1G7IA 5DHVB 4EUPA 1JGVL 4MVBC 2GI7A 5FGBA 4OJFH 4E41A 1FZJA 4D2NA 2AABH 2F19L 3HNVH 4OV5B 2F8VA 2VDPL 4NQCA 1IAMA 1NMBH 1T6VN 4HLZH 3FO1A 3BOVA 3C5ZA 1DEEB 2G75A 3FRPA 4HFWA 3IETA 4XMPL 1MFDL 5D2LA 4TVSa 2CKBL 4NRXB 2F5AH 3IFLH 4U1MB 5ESAB 5H2BB 2G9HA 5FO7A 1X44A 4H8WH 2GAZA 1MUJB 5LGHH 2HJKB 1KPVB 1Q0XH 2QBWA 3GSRA 3OKKB 1IEAA 4FQQA 5CBEA 3LEVL 2HJLA 3HS0B 1ZSDB 4JDZA 3HR5A 2DBLH 4GSDL 3MODL 5DJYA 3BAEL 3LZFH 4HUUB 3CZFA 1GZPB 5DFVD 3EYVA 1U91B 5FYKL 3K0WA 4PRAB 2CXGA 2AVGA 1CGTA 5LKNA 2VDMH 1SY6L 2YUWA 4FQXA 3RWJB 3RWFA 2X4TB 1RZJH 4PJ7F 3UTQA 3BP4B 4D0DA 3PWPA 3S98A 1PG7H 1I1AA 2FL5A 5LWYH 2FATL 1FNEA 2V5YA 5FIEA 1MI5A 1VGKA 1ADQA 4F33A 5EC1B 3FQWB 1MFCH 4M1CC 4X9IA 5BRZD 4N0FA 3VFPA 2V7NB 1EGJA 4GG6B 4RMUA 4UZGA 4WFFE 4HUXA 5JPMA 5T3XE 2RAMA 2WINA 2BOCA 3RZCD 4LCCB 1WTGT 5DRWA 1UFUA 3P9LA 3DV4B 5ICYA 3TIDB 1A6WH 4XT1C 1PAMA 3D9AH 1F5WA 3THMH 1N4XH 1TNMA 1OAUH 3PHQB 1AC6A 2VXSL 1IGIH 3SE3C 2ICEB 1XGYL 1EEZB 3O4LE 1BBJB 4O2FA 4MSWA 4XPTH 3BVNA 1CU4L 1XCQA 3VXUA 1RZ7H 3BKCL 2QQNH 5DD3L 2HLAB 3VXRA 1BD2A 1EMTH 1XF5A 3LS4L 1KBGH 1L7TL 2WP3O 5J11C 2I60L 3RVWD 1XFPA 4RIRA 1PD6A 2VAAB 1MHHA 4PG2A 3O4LD 3FTGA 2YRPA 1JZ2A 4KGLA 3MV9E 4X98B 3QRFM 4KKAC 2DLEA 3LY6A 3IDYC 4CN4A 3VXMB 3HZVB 1UM5H 3LKPB 2R2BB 3TO4D 2VDKL 2ESVE 3DMMB 1YMHA 5K9OA 2ED8A 4HEME 1Y0LB 4C56D 1NBZB 4BFGA 2V2TB 3EJYC 5CIPH 5IW3A 4K8RL 5IVXB 5D1QA 3NN8A 1DQDH 3L3KA 1R24A 3I75A 2CO7B 4UT7L 2OL3L 1KNOA 3L5IA 4POZD 3UDWA 1I9IH 4LLMA 5EBLB 4LLVB 5SWQA 4HS8H 1GC1L 2ARWA 2R0ZL 5HYJA 4XPBL 5IMKA 3TLRA 1U58A 1JJUA 2V2XB 3V0VB 1A21A 4LKXB 1FRGL 1UXWA 3TPKA 1A9EA 3MNWB 1RVFH 5HHNA 2WWKT 1NAKL 1QNZL 5TF1L 1QVOB 5HYFA 4MNGB 5MHSE 4WO4D 1UCTA 3IYLW 2DLIA 3L3KB 1A7NH 4XCCH 2IG2H 4I5BA 1YEHL 3BGMB 1I3RA 1K2DB 1UB6A 1YY8B 5D7KE 2JCCB 3BKYH 3WSQL 1CBVL 1JI2A 4PS4H 4PRHA 3MZTA 1J0YA 3SGJA 1IQDA 1R5VB 4Q2ZA 2VISA 4Y4KC 3BW9B 3IKKA 1OW0A 5CP7B 5GHWL 2AK4D 4JQIL 4ZNEA 1KIQB 3CSBA 3QUMB 1UWXK 1OB1A 2DDQL 4P2OC 5DMYA 1C1EL 1JRHH 4P3CL 1LEKA 3DX8A 1X4XA 5F1NB 3L7EB 1ZHBB 4QLRA 2X4PA 2IANB 4TNVF 5IVOA 4HWUA 1WFNA 4DEPC 4N0CD 1NLDL 3CPLB 4JM2B 4JFDD 3VI3F 1MCCA 4DN4H 4ZS7L 3NFNA 3MRIB 3ZYIA 1HWGB 4OBRA 4P5KA 4JREC 2Q8AL 3NPSB 3TV3L 1EJOH 4MJIE 4OIAA 4DKDC 4O58H 3MV8A 5T3ZD 4G3YL 2IFFH 1YMMA 4Q74A 3SDAB 1U8HB 3DUSB 2GITA 1RFDL 4WI6A 2A2QT 1I9RL 2APTA 4A6YH 4K3EL 5I8EA 1G7JA 2J6EL 1OGAB 5TGBA 2NZIA 3DX9A 4JHAH 4ZUTB 1S5IL 1IT9H 3QA3A 4QXTB 3QDGD 1K8IB 3ZDZF 1PG7X 4A2LA 4YHIA 3QI9D 1V7MH 3VGHA 1SBBA 2LU4A 3HC3L 2BNQD 2BERA 3NABH 3RX8A 1BLNB 1OGTA 3HE7B 2VWEE 1C12B 4KJQC 5ILTL 4QRQB 3T2NL 1XF4B 1NFDA 4L4TD 4YJZL 1OGAE 2EXYD 5J6GA 1X7QA 2EDLA 3K80A 3SDXA 2YWYA 2PYEA 4XXDA 2NXYD 1X5ZA 4KI5F 4NT6B 2XWBA 1RY7B 3AREC 3VDBA 4AT6A 4OD2A 4P3DB 1TZIB 3O81A 2AABL 2FX8H 2O61A 1YN7A 2HP4A 2R29L 5C0GB 1CR9H 1YN6B 2OR9H 4HX1B 5C9KA 1AD9B 2OSLA 2P44B 5C07A 1SHMA 4XMPH 4CU6A 1MFBH 3LH2H 4V2CB 1SEQH 4OV5A 2DIBA 3L3IA 4OZHB 1GAFL 3AS1A 4H8WL 4RMTA 4E41B 2R9HC 1UVQA 2DLHA 4KXZH 1A4JA 3MRNA 3BQUC 1Q0XL 3C5ZC 3IDGB 5J6GB 3DV6A 1KXVC 2YC1B 2BOBA 2FJHA 3B2VH 4V1DB 3QCVL 3K7UA 2PTUA 4HWZB 4KHXH 3WO4C <