1JBQA

Structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate dependent hemeprotein
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
355
structure length
348
Chain Sequence
b'WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATHIONINE BETA-SYNTHASE
publication title Structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate-dependent heme protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 121
structure length 348
sequence length 355
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbqA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jbqA02
3X44A 1J0DA 1FCJA 1Z7YA 3PR2B 2TYSB 4XUGB 1A5AB 2CLEB 4Y6GB 1P5JA 1CW2B 1KFBB 1VE5A 3R0ZA 5E0KB 1KFEB 5B1IA 1J0CA 1BKSB 4HN4B 2ECQA 3X43A 5I7WA 5DBEX 1WTCA 5DVZA 4ZU1X 1D6SA 1V7CA 3T4PA 2CLLB 1KFCB 3VSDA 3FCAA 2O2EA 2Q3BA 4LMAA 1V71A 1C8VB 1Y7LA 1K7FB 4OFXA 3VBEA 2ECOA 1K8ZB 1VB3A 1PWEA 1TDJA 1UINA 4JBLA 4D9CA 3L6BA 1WBJB 1KL7A 1A5SB 1V8ZA 5T6MA 5B36A 2PQMA 2V03A 5I7HA 1J0BA 5IWCA 3L6RA 4HO1X 3L6CA 5KZMB 2EFYA 1K8YB 4L0DA 2CLMB 2ZR8A 3SS9X 2BHTA 1C9DB 1PWHA 2CLOB 4QYSA 3V7NA 3PC3A 1J0AA 4LI3X 1Z7WA 1TJPB 3TBHA 2CLIB 5I7RA 5IXJA 5B3AA 1K3UB 3IQHX 1M54A 5DW3A 4D9EA 5D87A 1O58A 4D9FA 2J9YB 1FUYB 3VSCA 4D97A 3VSAA 5D86A 3IQIX 1QOQB 4H27A 5J5VA 4D8TA 1TZKA 5I7OA 2CLFB 2D1FA 5IW8A 2EGUA 1WKVA 2Q3DA 3FGPA 1BEUB 4L3VA 3DWGA 2Q3CA 5C3UA 2J9XB 1KFJB 3BM5A 1X1QA 2RHGB 4KKXB 4OREX 2RH9B 5D85A 5KINB 3HMKA 5EY5B 1TTPB 2ISQA 5DW0A 2C2GA 2C2BA 4L27A 4NEGA 2DH5A 5CGQB 4D9MA 1C29B 3PC4A 5D84A 4AECA 1VE1A 2GN0A 4HPXB 2GN2A 4LMBA 4PCUA 1UIMA 1KFKB 4D8UA 4D96A 4D9IA 1TZJA 5JISA 5BW6B 4D9NA 1RQXA 4JBNA 4D99A 2ZPUA 1OASA 3AEYA 4COOA 1E5XA 4D92A 2RKBA 1UBSB 1K8XB 5B1HA 4IL5A 3DWIA 3CEPB 3SS7X 3VC3A 3RR2A 1A50B 4I1YA 5HBGA 1J0EA 1WDWB 5JJCA 2DH6A 4ZQCB 2TSYB 3DKIA 2CLHB 3IQGX 4HPJB 3AEXA 2ZSJA 5CVCA 4D8WA 4D9GA 4D9BA 1TZ2A 3PC2A 2GN1A 1TYZA 5I6DA 4NU8X 1CX9B 1QOPB 2BHSA 2WSYB 2JC3A 4AIRA 1TTQB 4L28A 5B53A 3ZEIA 5I7AA 4D9KA 4HT3B 3SPXA 5J43A 1TZMA 4WX2B 2J9ZB 2TRSB 1F2DA 2O2JA 1JBQA 1K7EB 3R0XA 5DBHX 4ZU6X 4F4FA 3IAUA 2CLKB 1K7XB 5B55A 1A5BB
chains in the Genus database with same CATH superfamily
4YAFA 4EHIA 2D5IA 2Q0QA 2IX3A 3O31A 5FI1B 4ALKA 3L01A 5B64A 3D8UA 2YWJA 4D3SA 2QLLA 2XV1A 2CW5A 1WNFA 3KV1A 1RQ7A 2WMYA 2YN0A 4RWZA 4Z9AA 5HMMA 1BHSA 1QHXA 2FW1A 1DIAA 3LQYA 3O3NB 4R1PA 2V96A 1ABBA 1MT3A 1UOEA 2VPQA 4KKVA 1JIJA 3BGWA 3MMXA 5D00A 4MS1A 4DUGD 2Q8NA 4RPLA 4DVGA 4DBLC 3ODPA 3TQFA 3IR7A 2FN7A 1PWEA 1Q2UA 2IYEA 1Q0HA 2FLVA 2FRXA 2HX1A 2OO7A 2QQGA 3FRIA 3MTQA 4JLUA 4CIVA 2G1KA 4DPMA 3VHLB 2CV0A 2RMKA 2EBUA 4M1YA 3ZLUA 1WBJB 2HY7A 3IKLA 4LJ9A 5ICSA 2G04A 1JAZA 4KPUA 3HV0A 4E1VA 1NQXA 4OYRA 4QSMA 4CFSA 1GG8A 5JZBA 1PQUA 4MR9A 3WNCA 1PEAA 3PLNA 2FX2A 1HF3A 1A2KC 3SNHA 1R5JA 1P1HA 4P54A 5FL7D 3T3IA 1Y4ZA 5GZ6A 2F67A 4OQXA 1OKKA 2RH8A 4HK4A 3DE2X 3IEVA 2PSFA 1T5BA 2BR4A 4RKWA 4D0RA 2IPNA 3T7DA 3ZU2A 2PL3A 2MDTA 3KQTA 4LOLA 2PRYA 3KVYA 3OY7A 4C6HA 3U3XA 3ZHXA 1VPLA 1KR2A 1N92A 2A92A 2IP4A 4DY4A 4C78A 1B76A 1T8SA 2Q07A 5E95A 1ZH6A 2IYFA 1GNRA 1O4WA 1TL7C 4A6XA 4UBNA 4DA8A 4HNAA 5L4LA 3OIFA 2JI8A 1P74A 4P3YA 2FQYA 1Y3CE 3MRSA 4I4LA 3IKMB 2COUA 4QTUB 3U44B 2AX4A 3N2IA 3R0QA 5BUQA 3RSHA 1FSFA 6LDHA 4EKGA 3F9RA 4HBZA 1DEOA 4XR4A 2O0LA 5HFJA 5AVYA 3U40A 4U02A 4KN9S 4LV8B 2AXPA 4RTLA 1IEXA 1N3YA 2DHCA 4EYEA 2DECA 4G3XA 1II0A 1FP4A 4P4SA 5FCDA 3JWPA 2YQ4A 3VZCA 5LPNA 1JFFB 3GNLA 3LDHA 4GDFA 3H2YA 3L5OA 4HWRA 1WUJS 3RIEA 4PSCA 2DC1A 4BZPA 4COOA 4F97A 3D3WB 5HXAA 2RGAA 5PGMA 1H2WA 1QWSA 1GZVA 3LBHA 1JJFA 3E35A 5TS2A 3T3EA 1PFYA 1PR5A 2YVQA 2WMOB 2IPXA 3WGTA 3GAAA 3LCJA 3B6EA 1UCFA 4MI9A 1U0FA 4MUNA 1PJLA 5TB5A 4DR7B 2DFLA 1Q19A 3GFQA 1Z4OA 3LI2A 1N7JA 1QMPA 2ODQA 2R6JA 3FPGA 2WTEA 3BIWA 2BEKA 2QLTA 3ZLVA 1Z37A 2ES4A 5EJ9A 3QQPA 4B6SA 2NQTA 3MQ4A 6CHYA 2A0KA 2P6RA 2GZ2A 3C7TA 1PK7A 4JYMA 1IOWA 3C87A 3OM8A 3JAMA 3ZVLA 1RWOA 1MAAA 2G17A 2IGBA 4BLTA 4IF4A 4MS4A 2H63A 3RBXA 2JHPA 2DT8A 2AF4C 4REQB 2YHAA 1E3SA 3F4LA 2F43B 5C1IA 4BNIA 4OQ4A 3MXTA 3SXUA 3RUDA 2ZJBA 4PXYA 1DRUA 2OM6A 3D81A 5D7BA 2FPIA 5EXXA 3FI0A 1T2FA 2VL7A 4LTNA 3ZKAA 4BNZA 1YQXA 4O4JA 3FIUA 1LVGA 3HO1A 3WMFA 4HBGA 2QJWA 2Q7DA 4EW3A 3JQQA 2AUTA 1O94D 5TQ0B 3FHOA 5P8WA 1X8LA 1XR3A 1QU2A 4UZEA 3GJ7A 5DBEX 3QLJA 5L3QB 5LWHA 4ZWNA 1TO6A 3PGLA 2YXBA 2REQA 4I55B 5AHOA 4X20A 4LGVA 3BC1A 3FR7A 4U0JA 2YRFA 1RZRD 1MCZA 2RHCA 2VWPA 1OA1A 4IAOA 4BU0A 1KYZA 5LIRA 1FNDA 2ZAGA 3OZAA 1MO6A 1W0JD 1NSTA 2X0RA 4EB6A 4EJSC 5JFOA 4M1SA 1T5DX 4Z4IA 4GI5A 1MG0A 1T3TA 3ITNA 1SCUB 1CUUA 3HACA 2O8BA 3FN4A 4JB2A 3TUJC 4Q00A 4DKXA 3O8NA 1MA0A 1HFEL 2IP2A 3H9QA 1AS3A 4OA5A 4HNVA 3OPXA 3HCRA 2FX5A 3THXA 1TKAA 4MYSA 5IC4A 1WHSB 3D43A 3ZQKA 2R44A 3G02A 1IY2A 2AFHA 1YBMA 3CRRA 4GC5A 1ISMA 3ITDA 5A5GA 3FSGA 5BRJA 1KOGA 3DO5A 4C05A 5J2UB 1F06A 5ISMA 1YT5A 1PQPA 2NTJA 1QYIA 4DCNA 4P80A 5GZ1A 5EMHA 4N1AA 2HEIA 3F71A 5JI3E 1OWOA 1CQIB 1K0FA 3CY6A 1ORVA 1X13A 4L9SA 4U7DA 4B2LA 1YE8A 1E3QA 3HJTA 3IAS6 2PWYA 3IDFA 4JUDX 4LXHA 4WXRA 2AI1A 2GZ3A 1AV6A 5C3UA 1X92A 2QR2A 4PBSA 2CDNA 1YZNA 3FCYA 4X93A 3EB9A 2JLCA 2QAGB 4KCGA 3HN2A 2C5AA 2EX4A 3PUWA 5EVCA 3PDJA 3DW1X 2D4HA 4UVEA 4B7AA 3I32A 4MSUA 4EA8A 4XQCA 3ZIAD 2XVMA 5D7NA 2PX0A 1HT3A 3KWFA 2MR5A 4R31A 5U4QA 3VR4D 4A8JB 3SMQA 1PJRA 1L7PA 3UANA 5KTPA 1II8A 2WE7A 1O6ZA 5BW6B 1S96A 4UBJA 1DKLA 3U9LA 1SCIA 4QQ8A 4EELA 3UMBA 3GV0A 2RGBA 3D7LA 4MDFA 1T1IA 1IK4A 1UK9A 2QY6A 4L4SA 1YRAA 2R2AA 3FDJA 3GBVA 4YJ2A 5I4BA 4E21A 1RJGA 4A2QA 1YRLA 3GCXA 3JVIA 4CF4A 3E9RA 1LFAA 4QOFA 4Q1DA 5LLSA 5JOQA 1M8JA 1V37A 4D9GA 1UBCA 2OP1A 4ND8B 5IP5A 3TFWA 3VXKA 5L4NA 2PUEA 4Z9BA 2Q99A 721PA 3D0QA 2XQFA 3A26A 1RHMA 2QJOA 2GUGA 1B6TA 2NSJA 3JALA 4LIPD 4O2BB 3RFCA 4ETNA 5KNLA 2XBLA 4EA9A 1RJDA 1VJ1A 1JP7A 2QUJA 1SPBS 1AJEA 2IHZA 2XJ4A 5KYKA 4LF5B 5DM4A 3IAM6 3TAXA 2AN3A 4EUHA 2F4VB 3N9IA 4RMIA 4TL6A 1OF1A 3OUZA 5L7YA 2UXCB 3TZLA 1TECE 4ZU6X 3SZGA 3LCRA 2GZ1A 4GZMA 1JA1A 1AC5A 2QRMA 1I9GA 2G8LA 3RS0A 3ER6A 1QO0A 4DSTA 4JXZA 4AB1A 2DWPA 3QELB 1ML3A 3PT5A 4GYJA 3BE5A 1S8AA 4MMZB 1OYOA 2NQ8A 4G5SA 1URPA 4ON9A 1J8YF 3OCXA 1CNMA 4R0VA 4Z9FA 3RT1A 1O57A 2IYPA 4M8KA 3VOBA 2XCRB 2CFTA 3IP5A 1XJQA 1I13A 1XMVA 3LT2A 2DY0A 1W73A 3FTPA 4X7RA 4BMYA 1F4LA 3GCDA 1NJ2A 1YZKA 2YS6A 3Q7IA 4B81A 1UDCA 3LP5A 4AO8A 1GA1A 2B8WA 4LRYA 1TZCA 2AZMA 1YA8A 4PFQA 3PXGA 5G3ZA 2YXNA 3N53A 3UM9A 2XITA 1GDTA 1FJXA 1QZ3A 3HCPA 1DIHA 3NIFB 1JI3A 4TTRA 3PBKA 3I8OA 2C59A 4QUHA 2Q0XA 3KPUA 3W7VA 5J4VA 3JVDA 5LWQA 1UJ2A 5HS4A 1HBJA 2EFHB 1Z17A 1V8OA 4GNRA 5C18A 1IH8A 1T3GA 1NM5A 4IDQA 3C16C 1NV9A 2Q50A 4RFSA 5COQA 4X1YB 4KO2S 5KNDD 5KWIA 3ZU4A 1SC1A 2OC9A 4JWKA 5GWXA 4YCAA 2MYPA 2AQKA 3WL4A 1W0KA 5EJEA 1O5IA 4ZDWA 1OXSC 1SAYA 2VRBA 1FOEB 1NHWA 4NNOA 3S7ZA 4A3SA 3OAAD 4RAOA 2JIZA 1AK9A 1N3IA 1I5OA 1T26A 4C4RA 3ZY4A 4EF5A 1UBKS 4M55A 4FNGA 2NO6A 2Y0BA 3U9SA 1J1UA 2X13A 1A96A 2ZSFA 4WQMA 2Y3IA 3TUZC 4F96A 4Z4QA 5FOSA 3UATA 2H2FA 2OC4A 4B80A 1LQUA 2VDNB 2QM7A 4MKGA 2HF9A 1NXXA 4LF8B 3DLIA 4L5YA 4E0BA 1YJAA 3IOYA 1SVLA 3HG7A 1HE5A 2P40A 1NR7A 4FDVA 4UCWA 4WK2B 4ZOAA 5JATA 4LJSA 4WXHA 2QRUA 3NALA 4BJ1A 5KNCD 1C3OB 2EV9A 4LHSA 4FW9A 2AK3A 3UGTA 1P5ZB 2XUHA 3DEJA 1XLUA 2Y92A 2IXAA 3L04A 3HB4X 1ZN9A 1XYGA 4HQRA 4WECA 5C31A 5IG2A 2ISQA 1VLLA 1YAHA 1E0JA 1OLOA 4BEWA 4L4ZA 2BMWA 3VH2A 2WAYA 1P3Y1 2L18A 4AS2A 4INJA 3HY6A 2KI5A 4XYMA 4YC7A 3RVMA 4ZZ1A 2JLQA 1IJKA 1X8JA 3JQAB 4E12A 1ZJZA 4D4GA 5JC8A 1OR8A 4EHHA 4WN3A 3WFZA 1A76A 3U3MA 2WYVA 1N2IA 1NKTA 2BIFA 4XWGA 3EC2A 2Z1DA 3O1IC 4WUTA 1L7AA 2OZEA 3W8FA 4BUZA 5EPOA 5B1HA 4KIJA 4XUEA 1QFJA 3BYZA 3EODA 4NZPA 5EMMA 5LMNB 2FWIA 1MIOA 2YWDA 3SSAA 3GEEA 2WM8A 1K06A 1HLGA 5CDHA 4B09A 4G4GA 3EMKA 3O3CA 5A1TA 1G5FA 4KAAA 1W75A 1EJ6A 1TJ4A 1HG0A 3DBHA 1Z33A 1CUEA 4GICA 5BMVA 4GPBA 4B1FA 4OP1A 4UBIA 3IODA 2D3TA 5E4FA 3AJDA 3TNLA 3BEDA 2BGLA 1DXYA 4NATA 4UVHA 2FSGA 1DGQA 5UKDA 4JU8A 3KVNA 4H1VA 1TIBA 2OLJA 3WLAA 1GQRA 2NOAA 4XWKA 4MAMA 2Q5HA 4D0LB 1QR2A 4CLOA 2GN4A 3UHJA 1QX4A 1HH4A 4QFDA 4NMXB 1NWCA 1KYQA 1Y8AA 2AI2A 1NVEA 2BFOA 2J31A 2QNRA 4J9UE 3MD0A 5I45A 5IRCD 1Q2XA 3A36A 3ZX5A 2IW3A 2P2SA 3KP1A 1ECCA 2NVUA 2XW6A 4RNDB 5KTKA 3CWZA 2JFYA 1VMKA 4XGKA 4ZEXA 2FR8A 4BRZA 1J00A 1L7XA 4JB3A 2ZEJA 2UUCB 1D1SA 2D3WA 2W4IA 4KXXA 1CDOA 3F1KA 5AJWA 1JGTA 1KH3A 3I2YX 5DDIP 4EG3A 1BCRB 4YCCA 5C5CA 5JJKA 5BP7A 3L79A 1JWAB 2I4RA 3DBRA 1C80A 2GKOA 1D07A 1UBOS 5FRDA 1C41A 2BMVA 4WZAA 3KUCA 2PCJA 3W3AA 1VHWA 3GLTA 4LJ5A 2Q2VA 5CHEA 5TPZA 3TLXA 3AIOA 4B8YA 3EEOA 1JBEA 4NVRA 2HQBA 3E6AA 5EQFA 3R9IA 4H7EA 4ZYZA 5C3MA 1XKTA 3LE8A 2GD0A 2WTBA 4AYXA 2BEJA 1IUNA 2DTDA 1JHQA 1JEOA 1OILA 4MW1A 4RO0A 5BPHA 4YP0A 1O54A 2SBTA 5DIFA 3UJHA 2IU4A 3MILA 2WU8A 2PANA 5EE0A 1KE1A 4YREA 1SHTX 3KM0A 5FV7A 1O08A 4G1MB 3HBNA 2IHVA 2Q29A 1RE0A 4HLCA 4HZUB 3JQEA 4S1WA 1N8TA 1WKCA 4KFCA 5CVEA 3WK6A 1P33A 3GJ4A 1PW7A 4G6ZA 1BIFA 1HDRA 5I7RA 1QE3A 1FP4B 1W4BA 1FDRA 3GEIA 1EB8A 4EHFA 5C8VA 2NYRA 1KYTA 2QTGA 3C74A 2QRKA 3CF4A 5A7FA 3BTSA 2C1XA 3STHA 4BV9A 3OSUA 4N3GA 4M53A 3NJ8A 3V8NA 4MWZA 1MRZA 3BWXA 4K6MA 3LH5A 1DCKA 1VL0A 1ZUNB 4BRWA 2FSUA 4U1RA 2C0QA 5JJ5A 2J3EA 2XHEA 4TROA 3WFIA 3GPBA 1CHNA 3QX9A 3ZE1B 4EFKA 4N40A 3BFPA 4N0DA 5CDTA 3DD1A 3JSAA 4O2BF 3SHFA 5KYXB 3ONWA 1E69A 1KAEA 3LUHA 2NGRA 1UKCA 2FWJA 1A4RA 2RI6A 3O73A 3JTEA 1DX4A 3ZDQA 3RJMA 4D9MA 5C46F 4F3TA 3CMCO 1OU0A 4OP3A 3UHOA 3LIIA 1JDTA 1MMFB 2EZ4A 3ZOZA 1KI2A 1GR0A 1WUKS 3A6GA 4IP0A 3E81A 4Z2YA 3TRKA 3P4UA 4EI7A 4F2WA 2BT4A 1A2BA 3K9GA 3REGA 3RV3A 2UXDB 1K63A 1WF3A 3RWOA 1LD3A 1JDNA 1ECLA 1V96A 1KZ7B 3P27A 5DYWA 5AKGA 4D26A 3FOCA 1YI1A 1OLUA 1G9XA 1X8XA 3SJBA 4PLYA 1RYMA 2DUUA 2W6PA 1EIZA 3I9FA 3IQGX 3Q3EA 2XTJA 3N2LA 1UBNA 1L5KA 1ZMXA 4G5YA 1FSGA 4GLFA 3UAOA 4L8FA 3SNKA 4ER3A 3OEYA 5DGXA 5L9AA 3A6PC 1QHSA 1RLUA 2C2KA 3X2EA 2QV0A 3BREA 4ZZ3A 4ES6A 2IQIA 2REQB 2C9BA 2WUVA 4CN9A 3ZXIA 3ZNNA 5EJIA 2DLCX 4MB6A 4B3BA 1ENZA 1JIUA 3EPHA 2ATEA 1Z39A 2VOJA 2YX1A 3U4HA 1WMEA 3VO9A 1A7KA 2OV8A 2FWMX 1PL7A 2ORYA 3FPFA 4PANA 5AH0A 1SWWA 5JMWA 1SQSA 2EZ9A 2XDAA 5AIAA 5DHFA 4AT1A 1QR6A 2PBRA 4Q15A 2XH8A 4HUQA 1TUBA 4TSFA 4WE3A 2AFIA 3AVPA 3NBZC 4H35A 4IRMA 4Y18A 3THXB 1EGHA 1RWMA 2GVNA 4J1NA 3AUXA 1QFXA 3VFDA 3PEWA 3CN9A 2PMEA 1WCV1 3LUPA 2DBYA 3II6X 3D4BA 5E6RA 3WKBA 4W5HA 3DL0A 3LNCA 3OE7A 2P2YA 2JGAA 1IAVA 2WSSA 3VVCA 3RSZA 2M32A 2PXXA 3A9VA 3K5PA 4JBHA 3L6BA 1QWOA 2AOXA 3SIRA 5TEVA 1FNMA 1CJCA 1SEPA 3KHKA 3I1IA 3S2UA 5ITVA 3H87A 4CEIA 4PFJA 3EVBA 1WW2A 3NAGA 1W1UA 4E5DA 1NRIA 1TUGA 1CG6A 3IDQA 1TYBE 1A69A 2C9CA 4X45A 3U4DA 2JAXA 4ABYA 1VMIA 4ZYYA 1KOLA 1K27A 2DFKB 3QU2A 1YNOA 1MHPA 6REQB 4MQBA 5KREA 1ZU4A 4EPTA 2P8JA 3H97A 3O1LA 5EPEA 2AC7A 3BWYA 1M6WA 4HEA1 3CFYA 1E9VA 4EG6A 3WKAA 1N6HA 1Z2PX 1PFGA 4MIKA 5JNTA 5BR8B 4URFA 3QNWA 3EAQA 3OT1A 2VFAA 3B9BA 2FRDC 3UT0A 3IQHX 1Y9DA 3L9WA 4D9FA 5HZGA 5JCJA 2J09A 4IXDA 3V80A 5GADl 4DR1B 3DE1X 5LQDA 1X7YB 3LF2A 4RQTA 2XMDA 2J5RA 2GK4A 4BYMA 5B4VA 2KE5A 1Z6ZA 3PVZA 1QTNA 1II8B 1W94A 1SVUA 2DSTA 2FHSA 1LCIA 3DZIA 3K1AA 4F06A 4LZJA 3E9MA 2GK3A 1MVNA 1XTVA 3RDPA 1CF2O 1THMA 4G9EA 4DR6B 4F3CA 3NWOA 1QGED 5D3KA 1BKDR 2JIRA 2XUPA 1KTIA 3H1EA 1QU3A 3UJ8A 3IKVA 3K0AA 1Y3BE 4YQYA 1SBYA 3R7WA 3VYTB 5DCYA 1DFHA 4E11A 4RZ2A 1TO2E 3BF7A 3GVCA 4ZV7A 1XDUA 2WW8A 3I5AA 2IEIA 4JCCA 2RGUA 5ALZA 4B34A 5EGSA 3VAYA 2GN0A 4YT8A 3SR3A 2GPJA 4O25A 1K6IA 1TVMA 2O7QA 3T3HA 1O1YA 1KWGA 3OLYA 4EH1A 3QUTA 2JA2A 1T36A 2PUWA 3HS3A 1U8AA 3IUBA 4IKOA 4JAVC 4BS9A 1CY1A 3VISA 2IYRA 5HM6A 3U19A 1L5WA 3PPVA 1Q1BA 3FKQA 3R1IA 1JLSA 2O14A 5B5SA 4RSMA 4GKAA 4BLSA 3LDAA 3KVRA 1X80B 2WAXA 4JKYA 3V1UA 2O7NA 5HIAA 5EUCA 2GEJA 4DM7A 2DH6A 3RUFA 2NZXA 3ECAA 4A2PA 4F60A 2NP7A 3DAPA 1N2CE 3UG7A 5DEIA 3EGDA 2XUAA 3P9XA 4OXYA 3IGFA 5IFKA 4EPVA 4N5MA 2VNAA 1NL3A 5KSWB 4N54A 3NXSA 1QOPB 3REQB 3F8TA 1LJUA 3RHFA 1ZNYA 2QMZA 4ZOBA 1Q44A 1YV9A 1M1UA 2EJCA 3ZHVA 3QVTA 5BVGB 4WAUA 3QKRA 3CS3A 3MMNA 4ZYXA 5ARCA 4DCOA 1A9XB 1HT1E 2C5EA 4JOQA 4E5MA 4B71A 2IZ5A 2GF2A 3A32A 4IXTA 4Q1AA 3V2IA 1RFLA 1QIGA 3IOBA 1V1RA 2CLKB 4BEBA 1ULZA 2JLUA 1IQUA 2IYWA 4BNDA 1ZD3A 3O8OB 1KEVA 3KYIB 4WVFA 1L3IA 2ZWMA 3EAFA 3G5LA 3VU1A 3R6GA 4ZQIA 4RIIA 4TSRA 1WQ1R 1EAMA 1XF9A 1P62B 3W0LB 1NLZA 2A58A 1DJQA 1SB8A 5BSUA 3LRTA 1Z56C 2AEFA 5COBA 3CLRD 3QEMB 5K3CA 4CT4B 5EIEA 3DHEA 2SHKA 5K8JB 1JHXA 1E1YA 3CEAA 4XDGA 5HE8A 5L7WA 2V97A 1PT5A 3R3VA 1E1MA 2TMGA 2VBGA 8LDHA 1COWA 3H6HA 2PSSA 3D3NA 2WWFA 4L15A 4LC9A 3PRKE 1ZLYA 2PRJA 3KAKA 4C3UA 1Z8NA 2PSJA 4GXNA 5SZJA 4DM4A 3VJKA 3JQRA 4OQLA 3UHAA 5I3CA 4HDKA 3Q5DA 2ZSIA 4HFRA 3TI7A 1BD3A 3K9CA 4AY5A 2RGNC 1CYEA 4H1HA 1SXJB 2B25A 4GM1A 5TPWB 4LA4A 2X7JA 2ZRAA 1DAIA 4Y2SA 1U0OC 4BVAA 3AKDA 4Q3NA 2C0PA 4R5HA 2OB1A 4IWXA 1QC5A 3KPYA 2AEMA 1XEFA 1E4EA 1TEHA 4GO1A 1LPAB 1MG5A 4AY4A 2J9YB 1FUYB 1NX9A 3RSCA 4C5BA 3Q7RA 3ABSB 3QVMA 1OTXA 3I9MA 3SEQA 4DSOA 1O2DA 3UTCA 3F7NA 4XH9B 5BV0A 3CXUA 3G89A 2C00A 4MLPA 5IAEA 1T13A 3T9FA 2VRWA 3LC0A 3QOYA 4L5AA 1H2YA 1VRCA 2DMRA 4OXNA 4ND6A 3W4IA 3VU3A 2QN3A 1RT9A 2GCEA 1EHIA 3WHLA 1HM5A 1DMSA 1KF0A 3HLYA 3ME5A 3I0ZA 2RFLA 3MTJA 4MLDA 4OG2A 4ZVQA 1ZW6A 4D46A 4LZAA 1A1VA 3LLVA 4JITA 2CF6A 5ITZA 1ECFA 2GA8A 5ULLA 3ZXUB 4P2GA 2BP7B 4PCUA 1NN1A 4MKXA 4OP2A 4R68A 2OQVA 4F4CA 5SYNA 1U0SY 4DNFA 2VSNA 5JISA 2GCPA 1T9AA 1LV8A 2XQIA 4URHA 5CJ2A 3WADA 3ZH9B 4PYMA 3DMGA 5JBNA 1T25A 1U3WA 4GT1A 4GXTA 5I9LA 4AN1A 4XJTA 3UMMA 1E6EA 4YRJA 1BMDA 5HGXA 2NVUB 4EK9A 5KTRA 2QM3A 3NGMA 3OJCA 2P9FA 4GRAA 4JJEA 2PWPA 2ZRFA 2I76A 3E48A 4ZARA 4JFAA 1D4OA 3KLOA 4HQFA 4TYMA 3DDUA 3AQ4A 3S5JA 3VJLA 3ZUGA 2QYSA 4CMIB 3QMVA 3KQLA 3SEFA 4GXQA 3KRTA 1PYOA 1EFPA 3WQSB 4D0NA 3T5PA 3DBRB 1L7OA 2DBVO 5I7AA 4BBZA 4WZAB 2XNDA 4NV3A 2Q5FA 1PJCA 4O5OA 1BHO1 3T9AA 3M34A 3WK8A 2JFXA 1S1MA 5E2IA 1U2DA 3WYAA 4IDGA 5ILQA 4P0PB 2LUOA 2Q1WA 2Z1MA 3N5CA 1CRWG 1TTHA 5CVVA 2X0KA 4LKOA 3O2NA 5ECYA 2R1TA 4IX1A 4XXHA 4PSAA 1T2AA 2HDOA 4LF9B 4JJAA 2MYUA 5JSYA 1DG9A 4OUDA 1COZA 3A3YA 3B89A 1Q3KA 3D6NB 4D8YA 2CN1A 3TEMA 3ZD8A 3DZHA 3N2GB 3R9XA 2C4NA 1VB3A 2DHDA 3E5HA 4FFOA 5JDCC 2R6DA 5AMXA 4JKOA 5KYYA 4P83A 1M66A 4Q37A 1ZQ9A 3NVKI 1P61B 4NZMA 1FUKA 2P27A 2X5JO 4Q12A 1EVKA 3EA0A 3NT5A 4NYMQ 1P0IA 3D5TA 2X3YA 1U8ZA 1O9GA 2HN9A 2ZAOA 3PI6A 4HVTA 2PT7A 5JSHA 5C35A 2BSQA 2G1PA 2ZJYA 3CNLA 4JXKA 3V6LA 3OY2A 3RYIA 3ZJ4A 2UVPB 5KHAA 1QZZA 1KNXA 2YZGA 5EOVA 1MGOA 2DX7A 4IZIA 3JQPA 2LVBA 4KMMA 1HORA 2QQEA 2Y2UA 2ZBQA 4DXHA 1XTSA 4HH4A 3UNXA 2AG5A 2OK8A 2W90A 1HTTA 2A78A 1PI3A 1NRJB 1UC4B 2J6BA 3MG9A 1ABEA 3R6DA 3L4KA 2QN2A 1PUXA 3M8KA 4KDCA 3UY4A 1WXGA 1RC8A 1ZS9A 1AQLA 3I72A 4JJ7A 2IE8A 3BK7A 3TLEA 1G63A 4RPGA 1ZJJA 3UT5A 3ZE6A 1C0LA 3B9PA 1CZKA 2HLHA 1Q3TA 4JBIA 2GBGA 2L19A 1GQSA 3VV2A 5C8XA 4YV7A 4RDXA 2CFIA 2QSJA 3SR0A 5K2OA 3H65A 2F4NA 4G9GA 4J0GA 5GGXA 5C7YA 3PQ7A 4KRYA 4CHTA 3P96A 4IHKA 3S8YA 1N2XA 1Q74A 4G86A 3RH0A 4F4HA 2I1QA 2JKVA 4XX0B 4ENPA 1CTQA 5JSZA 3EUWA 1IRIA 3T54A 1GNLA 2CFSA 2XX3A 1DX6A 1ECBA 2O48X 4U3JA 4C6RA 1GIAA 2G70A 3P9RA 4QWWA 1C3VA 1C30A 3ZZ1A 1ADYA 2RC5A 3W8DA 2PH5A 1JYEA 1BMQA 4GGMX 3IAEA 4S2EA 4XYLA 1L8LA 4ZHQB 4FFRA 3K96A 4LDPA 1LW7A 3WBKA 5LQCA 2VBCA 4M60A 2JZOA 2OG1A 4RA9B 1FIUA 4ANFA 1VA5A 3NNNA 1HFWA 1IRXA 2RGEA 3ZHRA 1Q0RA 3A1WA 2PO7A 2IELA 4WNIA 2FW6A 1PYDA 4GPEA 2QL9A 5IBQA 5E6RB 5AOVA 1OZFA 1IM2A 2O4CA 3E9ZA 3KKZA 3FZYA 4KEAA 4LJ8A 4YIHA 2HWUA 5CXQA 1USKA 2EWMA 2J0EA 5F5LA 3RVNA 2R6CA 4QHSA 1MGPA 3ABOB 5DBHX 3VPDA 2C7OA 3NBAA 4YYEA 3IDOA 3TMKA 3IKTA 3FHTA 2HZ7A 4RJJA 4JLDA 2A1UA 1KVUA 3T7SA 1ZPDA 3AJEA 7REQA 4YJGA 4WDRA 3RT7A 1ZAYA 3DCIA 1NU8A 2FV8A 4MB0A 1VE5A 3LX5A 3AKEA 3TI9A 3F3KA 3TLYA 4BP3A 1LRLA 2YIDA 4AAYA 4CKWA 2VATA 2YQZA 3RUCA 3WA7A 2W9XA 4RXTA 3ZHYA 2CEKA 5HK9A 3ZQUA 3GGDA 5LMUB 5C52B 2X0EA 3HCBA 1VHQA 3SX4A 1U5BB 1RTKA 3AB8A 1ZINA 5TNXA 1BAPA 2BR5A 4PZLA 5C8YB 5JS8A 5KYWB 1GWNA 4MVJH 4PFKA 3HM2A 3K1AB 4L16A 4L02A 4EY7A 4H15A 4URYR 2RIPA 3CX6A 1D0SA 1T2UA 5BMVF 2BFEA 3KKLA 3ZBQA 1UEJA 2AG6A 1EVYA 2I80A 3AFOA 3BMQB 4I0WB 4KBGA 5CVUA 5DLYA 5K3DA 4BP9A 2CXUA 5FA5A 1T9GS 2FUCA 4FYPA 3K0AB 3WISA 4KH1A 4BO2A 2TMYA 4E32A 4F4UA 5AW1A 3D3JA 4NF2A 4IWYA 1F8UA 1P0MA 3K2EA 1ISSA 3JVVA 1OBVA 4LDNA 2X7XA 4UNPA 4RIHA 1ZCJA 3AI3A 4AJ9A 5C8ZA 3BXGA 3HSYA 1AKEA 221PA 4NZ9A 5AUNB 3GP5A 3C3MA 5CT9A 2XGJA 2QR3A 1XQYA 2PX5A 2AXNA 2RCYA 2B0CA 1T36B 2W2OA 1V8FA 3B13B 2OOSA 5CNIA 3KPWA 2IYUA 4EW1A 1A9OA 1ZP6A 4TKUA 4LC1A 1T9CA 2L2QA 3TAUA 2P0AA 3DVAA 3K71B 2KQUA 2NTNA 1ODKA 1HA3A 3SVLA 2QENA 1BEEA 2KB0A 3BRWD 5SZIA 5BR7A 2I6XA 1Q21A 5KVSA 3M82A 5MN6A 2GJ8A 4RHFA 3ZGOA 1JFRA 1WABA 1XAGA 1I80A 2ZB7A 1KKUA 4I1IA 2X5XA 4DRXA 2GPNA 2QJTA 3EGDB 1FNCA 1TKRA 3RBAA 3O7MA 1N9GA 2AN5A 2OMEA 1UK6A 2VAVA 4D80A 4DDTA 2V6FA 2X7HA 1YONA 4LQLA 4DWJA 4Z51A 1NQ5A 2ZKIA 4PPYA 1J1IA 5IDVA 4YH1A 3ADPA 3FYHA 1E1CA 5KYUB 4UCQA 4NJEA 5BYJA 3GL9A 5CA0A 1C2YA 5AQ1A 2FRVA 5B7QA 2W6ID 3IHWA 4P81A 3VNQA 1L5OA 3BXHA 1EXDA 4KW7A 3AFGA 3IERA 5CB8A 3CRZA 3QENA 5JXHA 5LZ9A 1M8PA 1NMXA 4CMKA 1IK6A 3QUBA 4BNDB 2BFPA 5ALDA 2JGKA 4V1CI 2R8OA 1WQ3A 3QKWA 4ESHA 3COYA 4TRNA 5AW2A 3PC8A 2GYYA 3D6MA 4PTLA 5K0LA 1QO9A 1JR6A 4KR7A 2GPTA 3VPFA 2FJPA 3G23A 3FMGA 1SOUA 3GMTA 4M83A 2G9ZA 4K9RA 2VUSA 4OK6A 3BTOA 5F52A 3T7AA 4P3OA 3DAHA 5CPBA 3PJRA 1LI4A 1Y4SA 2WT4A 3EH2A 1UXJA 1QGYA 4OOEA 2WIKA 3E27A 2GHRA 3MCZA 4RACA 2EG9A 1W44A 1R9JA 4JUAA 3VNVA 3OCCA 3GDWA 1E2UA 4M1KA 3RSFA 1EBBA 3DUFA 1H9AA 4RD0A 3EVFA 3QFTA 4O02B 5BV7A 3E5MA 4MVJG 5EZ5A 4CTJA 4HDKB 1YASA 4MRNA 4YAWA 3WQQA 3ZHOA 4B6GA 4P4LA 1EJ0A 4QDUA 5LA6B 1HDYA 2L17A 3KHSA 3WGOA 1VOTA 4CM5A 1XQ6A 2WYHA 2CXRA 3H1TA 5LIPA 4AKGA 1Z73A 3ACDA 1F3OA 2H4JA 2DM6A 3PUJA 5AVUA 4FD3A 3TSWA 3U1BA 4DY6A 3F67A 1QC5B 3EWNA 1D2CA 2F00A 5DCWA 3IP3A 3GH3A 3QOFA 1UC8A 1WY7A 4XSHA 3F3MA 5LU8A 2XNHA 3H5NA 5CLQA 3GLKA 1RPJA 1WETA 1Y3AA 2OQIA 2QL6A 4CV1A 4LNUA 3QY0A 2XF8A 4B5LA 5F3WB 1SVKA 1BE6A 4ZOCA 2W37A 1PNQA 3OPMA 2VK8A 1RWXA 4YAUA 1QS0B 2Z4SA 3OQNA 3M1AA 2K7ZA 4QUIA 4FGKA 1L7NA 4NZNA 4RY0A 1N2OA 9GPBA 3SZLA 4TWAA 1GFIA 1XJ5A 1CZNA 4DUYB 1PU2A 5JALA 3RAEC 1LPMA 4QOHA 2YZNA 2VP6A 1P4SA 4TVBA 3RVLA 2IXBA 2XMSA 1CY2A 3MINA 2GCOA 2IJGX 3P9SA 1DRWA 3NC4A 3EDRA 2LBPA 3QU4A 1CQJA 2J6HA 4B0PA 1NDUA 4HGYA 1SULA 1R4MB 2PZGA 4I50A 4MW5A 5BN3B 1WXFA 1QH1B 4C04A 5FAXA 1CUIA 1CERA 1AKTA 3EUEA 4FYYA 5J58A 2LR0A 3K8OE 1UWKA 3RO7A 3SZUA 4QPJC 4ZALA 1UKBA 2Q2NA 2JHGA 1PTKA 3IB6A 1F7UA 3NHKA 4OREX 1FX0A 1CUWA 1JHUA 5DF1A 4NLLA 1FW6A 2A4KA 1EGMB 3WL7A 5F2NA 3LPDA 4TS3A 2VDMB 3G0IA 4QT0A 5I7SA 4PWYA 2FPPA 3M6FA 1VJGA 3QXJA 5IAKA 1PWYE 4LX8A 4ARVA 1H5NA 2ORIA 1Z0DA 1XHFA 1OA0A 3FVVA 4KHZA 1WE2A 5H02A 3RYFB 1BQ4A 4UXHA 1YRWA 4PYKA 3VO2A 2OV4A 2GEBA 4CMBA 3SLRA 4MUEA 4Y0NA 4DQLA 3F3YA 1I9CA 1JG4A 4OQEA 4WOKA 1GN9A 3ENQA 4XD7D 5A5DA 4TV9A 3O93A 3DCNA 4BP8A 3H84A 4G0OA 4P33A 2O20A 1X9HA 121PA 1INLA 3GT0A 4RF4A 4AY3A 1FQOA 4H6WA 1BNCA 2JHCA 4XB1A 5JYBA 4LCBA 1CWUA 3C1OA 1A50B 1SOWA 2DR3A 5FWYB 5AUOB 1G291 2BGIA 1U65A 3B7PA 1WQ4A 4F5YA 5BYKA 3GFOA 1KC1A 4H0FA 4AULA 2FW7A 1IEWA 3GZJA 1NVVR 4W5RA 3OMXA 2IYSA 2Q5LA 1ICEA 2QG4A 4FK8A 2JCGA 2ZJ8A 3JWJA 1HE2A 1W581 1NBAA 2A5DA 2O6HA 3PFIA 3ZEIA 1SKMA 3D3KA 4OLFA 1CPYA 4F4IA 2JLWA 2WAMA 1Y5MA 3CKMA 2ADFA 4ZJUA 1EEHA 3Q98A 4C5CA 4E5VA 1X1EA 3QOWA 1FXSA 2BRUA 3E5NA 1LY1A 4H6VA 1UBHS 3ROFA 3TR5A 4G89A 1Z7YA 4LISA 2BLLA 5JCXA 4YY3B 2D54A 4F7DA 3AR6A 3G6WA 3WRWA 5JU6A 1J6UA 4TVKA 3CLUC 3RF7A 4CQMA 4WLUA 3HFSA 3KUXA 2PGXA 3RYIB 4QWMA 4HYEA 4JI2B 4F85A 2YWBA 2PRKA 2W2KB 2Z95A 3TLKA 3JZFA 3FAKA 3K9WA 3L7LA 3NHMA 4NYJR 7MDHA 4OLHA 3E8XA 3Q5GA 3QPBA 5F5XA 1WG8A 4BNWA 2WJ3A 1UF9A 3I6MA 4UNSA 5G0UA 2P4UA 1R0BA 3DW3X 1TD1A 2MYNA 3QTTA 3EG5A 4TXLA 3AILA 1DUVG 2F1HA 1P1RA 5DYTA 4C03A 1Y0BA 2C9DA 4G2TA 4D4IA 4V38A 3PEFA 1CF9A 1XALA 1PJ4A 3BG5A 4R1QA 1XZMA 2PGDA 3V1LA 5ILOA 1JEQA 4U8GA 5DHAA 1QZXA 4X00A 4NBUA 5C4IA 3TIXB 4YMLA 4GLBA 3DBVO 1KS2A 5KHOC 1TXGA 4KQ1A 5EWJA 4HDNA 1JFTA 2FFBA 4MWTA 3C3JA 3LS2A 4KQJA 4EPRA 2QRZA 2OSBA 4BB0A 2AMFA 1ZM7A 2WUWE 1JEYA 2YN4A 1PZNA 4OTZA 2B69A 2W98A 3H8SA 3UWDA 5LP1A 3M3HA 4QEKA 4F3NA 5J4LA 4BGVA 1M6VA 2ZRJA 1Q1EA 1I36A 4G63A 4GOND 3CVJA 4OHCA 5AI5A 5GM2A 3NH6A 3BGOS 1L9KA 1UWLA 5CJJA 3ZZ0A 3WRVA 1L7RA 3EIXA 4XPIA 4BN0A 4I5GA 5B6JA 2V3WA 2A4MA 1YGYA 1FL9A 4EBFA 4JKIA 1CZHA 1DINA 4N9QA 1JAIA 3FBTA 3GUVA 3AB7A 3O4IA 1KO8A 2OG2A 5EMKA 4K9SA 4OHOA 1PZFA 1LPBB 4F91B 2MSLA 4UATA 4M1TA 3UUEA 3M4XA 1R0SA 3NAMA 4AO6A 4WI1A 3A4VA 2VTKA 3ZDYB 2YJ3A 5DU2A 4E33A 2GYWA 4Z54A 1AV7A 1Y33E 1YI8A 1NLMA 3KB2A 2H3EA 2EW1A 4N39A 5H8WA 4V0OA 2WVHA 2ZPUA 1ZYUA 5AW3A 1H1DA 3I04A 5TXGA 4DLKA 1RRVA 3ERCA 3W5IA 2D1SA 3GLFE 3E9YA 2ODTX 2PZKA 2I62A 4HN2A 2FWBA 3DBLA 1BWSA 1PZMA 1JHRA 2ZYWX 4P1ZA 1LU9A 3NNDA 1ACJA 4QDJA 1JQBA 5BWNA 1RXUA 4RHUA 4WEQA 4KSYA 1ZK0A 3TAHA 3R5SA 1VYTA 1U9YA 4BJHB 4ZICA 1T0PA 1PQ4A 1V7PC 4EG8A 5JR3A 1MB4A 4DJ5X 4KE8A 1L3CA 1VBKA 1V11A 2B0JA 3RI3A 3FJOA 4IIDA 2GFHA 3VSEA 4RJ2A 5K8UA 4LRWA 4MHTA 1E9FA 5KBYA 4BQEA 3FHCB 1QUEA 3RS5A 3EBPA 1TW3A 2W2NA 2WIAA 1Z28A 2ENUA 2J9ZB 4H7HA 4XWAA 2IYYA 1YTLA 1Z4QA 5ELXA 1YS9A 4HADA 4WW0A 3ZK9A 3IUPA 4RADA 5IVDA 4ARIA 2AXEA 3EC1A 3QPVA 3ZWNA 1LWOA 2QI9F 2V5AA 3PT9A 5JJIA 5BWLA 3OZUA 3D3QA 1ESZA 3OP4A 1TGVA 2BFEB 1V45E 3H4VA 1YB7A 2OV2A 3CLKA 4LCJA 1GKYA 4H7PA 4IDBA 2R0QC 4LJLA 3ZWMA 3TSCA 3EZFA 4YWHA 4KVAA 4RIEA 2A9OA 1M0EA 3BRQA 4QXMA 1JT9A 1N5MA 1YIOA 3AUKA 2QL5A 4F56A 1W36D 4C43A 1XL1A 3ZHQA 2JLBA 4PG8A 4X91A 5SY4A 3JATB 4HQOA 2LDBA 4UC0A 1TO1E 4OQFA 5JS2A 2ZTLA 2EBWA 4QRHA 2WTNA 4I5FA 2VDQB 3QF7A 2Q27A 4QPCA 5BT8A 3L6RA 2M98A 3DVAB 1AQJA 3HXKA 4Q9JA 1XCJA 5ENZA 1WO8A 3LFHA 1YULA 3V4SA 2I9KA 2B1JA 4CEJA 4LBVA 4G84A 1RIIA 3QV2A 4XM2A 5IJZA 4QBGB 4TWIA 4UE3S 3ETJA 1XO1A 4X1OA 1JT2A 3DPUA 2BL4A 1D5CA 2QIPA 2AR7A 6GPBA 3EIFA 5TGDA 2AA3A 1EFUA 3ZIAA 4CCYA 5TSDA 4WGGA 1N9GB 4YP1A 3MM4A 3EGCA 2WD8A 4D56A 4DE5A 4P7FA 1LF5A 3TLGB 3EGIA 4WJKB 2VNSA 1E9DA 1OB2A 1JPVA 4BNFA 1DHTA 5JECA 3ZCVA 5JH7A 1E1CB 4NBTA 4UM8B 3T5MA 3F9CA 1OT3A 4QKQA 4QU9A 4TSKA 1NI4B 1DC3A 1Z74A 3W06A 2F3PA 4PNEA 1NIPA 2WJZB 3RJTA 5JXIA 2BBOA 2OD7A 3FPBA 4UOEA 1QGUB 4F0JA 4L0QA 3QKSB 4KMRA 4PCLA 1B7GO 3AVWA 3PGMA 4L5IA 1EZ1A 4V0MA 5JUWA 4OX9B 3QFRA 1KI1A 4L27A 2RHWA 3HCWA 1VPTA 2JGMA 1NR5A 1D3AA 1SQ0A 1TCUA 2WG1A 3F7OA 3FNHA 3Q2IA 4IH1A 2NZ8A 3OTHA 4QPNA 1Y1LA 4D96A 2NMVA 2GH1A 4Q4LA 2H2DA 2FPKA 1UPXA 2FVYA 3B3JA 4MINA 4PEVA 1X1DA 4BX9A 1M9NA 2HNBA 3JYLA 3DMYA 4LQ4A 2WJWA 2I7DA 2HA5A 1FFXB 2E49A 3DDCA 2FVXA 3D6VA 3FHJA 3KCQA 4YWJA 2GPWA 2K7FA 3DUFB 4QTXA 1MORA 4DLWA 2ZR0A 1P72A 4GHWA 4UNRA 4HAXA 3KQPA 3FOFC 3K0KA 3C45A 2DR2A 1XP5A 2WM3A 1JQJC 4AG6A 4B3XA 1CEQA 2R48A 1YZFA 4Q01A 1KPIA 1HZZC 2D5LA 4TLDA 3WLLA 1ULAA 1JFLA 3JS5A 1UEIA 1PWZA 3HRHA 2PX4A 5DNVA 4E70A 4PXSA 5DGTA 3PWKA 4AKEA 3SG0A 1GJRA 2XQGA 3DV0A 3GRYA 1KRHA 1YOVB 3WSVA 2C3PA 1XTPA 2FW0A 2VF8A 1Y7PA 4J16A 3RSLA 3V4VB 3DAFA 1EDZA 4AJ2A 5IMBA 4CKEA 4GEGA 2JVIA 1TAQA 4LXXA 4QUDA 5AXAA 4CF3A 3TGLA 1N75A 3Q8LA 4CNQA 4EG0A 3SZ3A 1IZ0A 2VTEA 3MBKA 2ZTVA 4QPDA 5E2AA 4ROTA 2G7ZA 4V24A 5E7QA 4WUVA 3AEUA 3DLPX 2AN4A 3DOHA 4FZVA 3MINB 4MR7B 2JLXA 5A4DA 2BFWA 2IC5A 5JPCA 4ED9A 2HU5A 4JBLA 1E63A 2XB2A 4H3KB 3BTVA 1BFDA 2B7BA 1WCIA 1OXTA 2WQZA 2Z2YA 1ARZA 2ZITA 1A8HA 3QPWA 3RF6A 4AXBA 4EP1A 3A2MA 1GL7A 4I2VA 4S04A 5EPUA 3LGAA 1CUVA 2W43A 3O1JC 4UHCA 4CN8A 1MRSA 2HA6A 4JLPA 4D9JA 2ZR8A 3G17A 4RFLA 5H81A 4BLWA 1QLHA 1RXIA 3NP7A 1GYPA 4M6WA 5H0IA 3CLTD 4YTEA 3TL3A 4QU8A 4LW8A 1NHGA 1BU5A 2Q3EA 4K2AA 4KPGA 1KSGA 4NG4A 5AW0A 2PL5A 3HKBA 1RZVA 3FYCA 5EP4A 5EERA 4NBNA 2FN8A 3VR2A 4BNTA 4AZWA 3V8PA 4HXGA 1S02A 3DC7A 3F2VA 4GS5A 2EEZA 4RHYA 2QLJA 3PKIA 1B73A 4L7QA 3DQQA 4TV9B 3WSTA 1TZKA 3EXFA 4B2IA 3GNSA 1B8VA 2BGTA 2ZFUA 4WL0A 4EGFA 3RRBA 1P0QA 1VI5A 2ZQYA 4IVNA 4UAJA 3NMUF 2ZB2A 1N2CB 3QMMA 2YXEA 4DARA 3T3OA 1B15A 4J6FA 3FKJA 3JQ8A 4ZAFA 1L5SA 4Z7OB 5HYVA 3IPYA 4XPZA 2NXJA 1F6WA 1W2GA 2C2GA 3GEBA 2G9VA 3FMVA 3Q41A 5EE9A 5FOWA 3AERA 4ICIA 3WLFA 1P7VA 4DQDA 4QTZA 1UJBA 4U6QA 1E1QD 4EY5A 5CGQB 4D9HA 5K8TA 3VDMA 1K5DA 1V4VA 2AHOA 2EX0A 2ZYHA 4CM8A 2JHFA 2HC9A 2P30A 1NP7A 2VHZA 1ZGAA 4OJTA 5KOIA 4NICA 3LECA 4Z9YA 3GRPA 1C1DA 1F0PA 3CUSA 1KS9A 5B58T 2CJYA 1EK1A 1GPWB 2FJUA 3Q3JB 4FFWA 4HR7A 4KBYA 2RKBA 3CEMA 1LH0A 3GPCA 4QLBA 1WS6A 2EBFX 2JIQA 2Y1WA 3E3LA 1ONSA 4F7WA 1U2EA 5LQSA 1IFXA 1TYAE 4UTXA 5G3YA 2BKXA 3OF5A 4C2BA 5IM5A 1ZVKA 2GXQA 3B2NA 3OFSA 1F8GA 2GEUA 1VXOA 1YS6A 2CL6X 3BSFA 1GO2A 4CYMA 5DHUA 3WOVA 2E18A 4RBNA 4RMHA 1AQIA 1EZZA 1VPEA 2VWGA 2XT0A 4FZRA 4H1UA 2FQXA 2NXNA 3IP9A 5E3HA 3OC0A 1WMAA 2HV9A 4CHGA 4OYLA 1HLPA 3RFVA 4AIRA 2J3MA 4J0CA 1M83A 2HJHA 3KEGA 4D42A 1JG6A 4L4RA 1C1YA 4CDNA 2K2WA 2PL9A 2ROQA 3E58A 3NHFA 4Q7MB 3CJRA 3AVVA 4WX2B 2FGKA 2VPWA 1H0KA 2B5WA 1QH0A 4PPFA 3TRHA 1TA9A 4G97A 3EVZA 1QGAA 4GOMD 1I24A 1Q0UA 3B3FA 3M49A 4QQNA 2BEVB 4QDZA 4R9VA 3EG9A 2GTHA 3C6QA 3CVOA 4H7FA 3ACBA 5ALPA 4E09A 2EP5A 1R6AA 4F1JA 2PYZA 4R71A 4BO7A 2VYVD 3MJSA 2G5GX 3HP1A 1ZK1A 3EIWA 1PTJC 2RIRA 3B53X 2YYZA 4INAA 1Z75A 5BSRA 1E7QA 2DT5A 4BWYA 3W2IA 1Q1AA 5CA0F 1ZA1A 2VP3A 2R84A 3ESZA 4XLZA 4DLNA 3MZ0A 3KIPA 1BN7A 1DOAA 1PD0A 5DTIA 3PTLA 3KSAC 4HEA6 2XCSB 1F20A 3GWZA 5JAUA 1IEQA 1IM5A 5EQTA 4A0SA 5CFZA 3PDUA 4DV1B 2AC2A 1M2HA 5SZHB 3WYEA 5JTUA 1P4HA 4JODA 3ANMA 3QBJA 1VHDA 4XLTA 2OYCA 4CLRB 3IIKA 3QW2A 1GPAA 1MIHA 4RJTA 4MW7A 4RVCA 3D4PA 5J4YA 5KX5B 1I6KA 4A0RA 3DQZA 1K5HA 1YJQA 1Z7EA 5SV2A 4JCOA 3JQ9C 5ICEA 2E3JA 4JI5B 1DRJA 1YDGA 5EWMA 1KSHA 5D87A 2BSAA 3PGJA 2QTTA 3LXRA 3MIZA 3RVSA 2HK7A 1CUZA 2D2VA 1F5NA 4YRZA 2ID8A 2NO4A 3NHPA 4QJ5A 1XC7A 1JHAA 1P7CA 2JASA 1E77A 1B42A 2W8ZA 4L75A 4MOWA 5EXPA 2BF7A 3CBQA 2NUTA 1T5LA 2CNNA 1YS2X 4QQFA 3DC2A 5CR9A 1RWNA 1W6RA 2OFFA 1GTG1 3U7IA 3WJAA 4D4KA 2DTEA 3FR8A 1SG6A 3H05A 4IKPA 3DBLB 1GPMA 1ZX1A 2G88A 3KSMA 1W5FA 3A3PA 5T64A 4AC9A 2PGJA 1BWRA 2XDQA 4O6VA 3G2LA 4QDOA 1HPLA 3EVAA 3S70A 3CUEF 4K28A 1LJ8A 1R6TA 1JXQA 3D6HA 4ZI2A 3UMGA 2EL7A 2JNWA 3KLNA 3DXZA 3FZGA 4MEJA 1IMJA 3PEVA 4CR8A 5EHGA 4D6XA 5F7JA 5B6IA 1DBIA 3CEPB 2GBPA 3EPJA 5GAJA 2PV7A 3IXLA 4RPIA 3UICA 3O4HA 3K0FA 2VYNA 4WCFA 3KTAB 4H31A 3BTUA 3P19A 2CLHB 3VOTA 4M0CA 3ZDEA 5B4TA 2XRMA 4MI3A 4D4MA 2W7TA 1J8QA 1HURA 2P65A 2QRHA 3NRCA 3S1AB 1EFVA 4C7OB 1CVLA 4M8NE 3L92A 1XROA 3TKAA 1OCEA 2W6OA 1RLTA 1VLMA 2HIHA 3C5EA 3GLHA 4NCNA 1RKXA 2AKEA 1E2GA 3HJGA 4HDAA 1J25A 4KDRA 3WBJA 3O7WA 4GI3A 4BQQA 4I4CA 1PG2A 2NYVA 4L6CA 1CUSA 4X84A 2O07A 2EZ8A 4EAQA 1CK4A 4HGRA 3OTGA 1VIVA 2DCMA 4QOJA 3M6AA 5F1KA 2QBYA 3SE0A 4POOA 3A7EA 4ZO7A 3EXHC 3FYUB 4LV6A 3TVYA 5DNCA 5JEEA 1VG8A 2VJKA 3L7AA 3M1YA 1RC1A 1XVIA 5BURA 5JWHA 1QB7A 4YRIA 5JRZA 2XE6A 1IEVA 1YK1A 4TMWA 3IKJA 2B34A 2FOXA 2R7MA 4XIYA 5LC1A 2C2WA 2QOEA 3FFTA 4MV8A 2GJAA 3EQ8A 4MKRA 1JKJB 4N0QA 3PKJA 1N4AA 1BDIA 2VYQA 1RLOA 4MPPA 1LSUA 4A5SA 5HQ3A 2BM1A 4RFVA 1KFCB 4YRMA 1EVLA 1KYWA 1BYUA 2VN8A 4LJ4A 4TV9F 4IBOA 4DV4B 1UDRA 4LWZA 4TWJA 5H82A 4OGKA 3GUZA 2YXLA 2C4UA 1QONA 1DXOA 1ZGCA 2KX7A 2R1VA 4B4DA 2EF0A 1XOIA 4AJIA 5T6BA 4OL9A 4BO9A 4GYWA 1YRBA 1JE1A 2ZE7A 5JEDA 5JH7B 4IKEA 1U0HC 1XLTC 1IOZA 2ONKA 3FNBA 4IJQA 1YVRA 3WL6A 1Z5UA 3BKWA 3V3TA 3NHAA 5KDOA 2W2PA 3ZU3A 1SZJG 3P0EA 4UMEA 5FYDA 5GV8A 4FTWA 1NBHA 1PK8A 5EEHA 4LHXA 1MUUA 4D45A 1HY3A 4MITA 5CUQA 2Q4RA 4JJ6A 2HRCA 3RYHB 2BF4A 2ATXA 2J0UA 4TTPA 5FUQA 4BKRA 1ZEMA 1LDBA 4JC0A 1J23A 4RNCA 2ZJZA 4JD5A 3TF5A 3H1GA 3QLUA 2G4CA 2R4TA 5DSZA 3VZDA 1EX1A 2RI1A 4O33A 5F5NA 3TW8A 2DPXA 2R68A 4PZAA 3HXOA 1Q7GA 1W4LA 3DPSA 1VP9A 4C6TB 1Q0TA 1WZ2A 2PZEA 4FEEA 3SYRA 1TTTA 1EKXA 4QICA 1GUDA 1RIFA 2FMTA 2VP9A 5A6VA 5FNVA 2RGGA 1P7WA 4KXUA 1DEKA 1IL0A 5DW0A 5K4HA 4EW6A 1UKZA 8ABPA 4ZRNA 3OA2A 2VZ0A 1O9BA 1R6VA 5IJXA 1I6LA 1VGRA 1ZNWA 4I3HA 2PUAA 2IXEA 4TXHA 4FOSA 1Q16A 3ZVRA 3W8EA 1S01A 3LK6A 1UZLA 2A9VA 4JLKA 5HQTA 2C7QA 1ZU5A 4QYIB 1KGDA 4NOKA 4QHTA 2XEDA 4GM0A 2VPPA 2VJBA 4E51A 2BZGA 2NU8B 4BEVA 4OL0A 5HBGA 2B83A 2POQX 1VE7A 4JJZA 4OQQA 4TUYA 1NUHA 3IUYA 4D44A 3SZRA 5IKXA 1IY9A 4KGDA 1D6NA 4C7VA 4JJ8A 4NBVA 3W2TA 4CKYA 4EUFA 1GV1A 2JGDB 1ZEJA 3NAZA 5FWXB 1DQRA 3R7FA 2C04A 1WBBA 5IJ0B 4LYYA 3W3AH 4NU8X 5I6DA 3UMSA 3OQJA 3Q9UA 1IWOA 3TVDA 2EKPA 2IZ1A 5DH9A 3T7RA 4AW9A 3GK3A 2V6BA 4M76B 3UH0A 4C4SA 1U90A 4Y2JA 1E5VA 1L5VA 3AEUB 3UHPA 1RYFA 1RCUA 3UFBA 2VRNA 1PFWA 3JYOA 5JAZA 3TLZA 4DLXA 1C0IA 4P6VF 2J87A 1JBQA 4F4FA 4GLLA 3NPMA 3ZYZA 1WCIB 2HO5A 4EVRA 2F1IA 3CISA 3OMWA 3L7OA 5KUTA 1G0NA 2YH2A 3Q3CA 4Q3BA 4B3IA 3OJWA 3EVNA 2D13A 3C3BA 3CUVA 1A3CA 3QUQA 3IUSA 4D7AA 1KA9H 1HRKA 2ZZKA 4KE9A 4M6WB 1EI9A 3T61A 3WIEA 4DC9A 2I71A 5CYFA 4BEJA 3FPCA 2H48A 1R8SA 3ESDA 2NO5A 4PZZA 2Q3BA 4EJ0A 3PQCA 2DJIA 2JKYA 2WMDA 3KZVA 3UMRA 2QNIA 3I4LA 3PI7A 3G7UA 3N0TA 4X8MA 4F1WA 1OXXK 3V8RA 2YHIB 2MHCA 1V8ZA 3EFEA 3OZWA 2C3OA 1ZIPA 1ZHHA 1XT6A 4KQCA 4G36A 4ND1A 4UEOA 4BMNA 3HQ4O 1W85B 1SUBA 3KT8A 4G65A 1JDBB 1AB6A 2Z5VA 3HWRA 2ONJA 1FNNA 5IU6A 2ZDGA 2B20A 2OO5A 1WSDA 3JQ8B 1JQDA 1JL3A 3CR7A 4ZDIA 1Q7CA 4BV2A 1E1DA 1T1SA 4KN6A 2ZRPA 2X77A 3KUKA 1YZ3A 1U2QA 1SZDA 5J1TB 4K81B 1VMEA 4W6QA 1YR9A 2PKEA 5IXJA 4YAIA 4CT5A 4DV3B 1NFQA 4QZVA 5DM70 5CIWA 4CM8B 4ZJZA 8ADHA 2XIQA 9LDBA 1JAHA 4FXPA 2GD2A 4XRRA 1ULBA 4II3A 3IP1A 2PA3A 2R6GA 4D8TA 4NBSA 5BSGA 3BDAA 4BOYA 4GP9A 2HR1A 4B35A 1E2LA 2SKEA 3PGXA 3TE7A 2Y68A 2DUMA 2FWPA 4IUCS 4EB3A 2ZM5A 2VK4A 1A4IA 3WDMA 2BVNA 1N6OA 1T10A 2EATA 2NZYA 4WVLA 1IBSA 1M33A 2V74B 3IYLW 3QYFA 1HK7A 2DYKA 1YMUA 4R0NA 1XCLA 1XCMA 2NO7A 4N03A 4TT8A 5M3BA 3OE4A 4QXQA 5C5EA 1P75A 3NX4A 3KQYA 1NW7A 3R5XA 3R7LA 4JI3B 1A95A 2C2BA 2V54A 3M6XA 4RKFA 5G1NA 4A9AA 2N46A 2WF6A 5LXTA 3KCNA 2IK8A 3QXGA 3VYUB 1GZUA 1NP3A 1E99A 3C6KA 3DEKA 2FKAA 4O2RA 4YDHB 3CLSC 1GL9B 3GNQA 4LUCA 2RHHA 4UUAA 1IZ9A 4PY2A 4DA7A 3BWCA 3GOHA 1WOMA 4TZ6A 1N7GA 2CVOA 4O1MA 1LI7A 3DOUA 4ND5A 1PL8A 3EBLA 1JRLA 1T91A 1EAYA 3TOCA 1PGOA 5DN6D 1YL6A 1ESDA 1IM8A 3P0HA 3PFGA 1V2GA 1NG9A 2R11A 1E1RD 3OZDA 2HUNA 1DKQA 3ZHSA 2Q8QA 2ASVA 1F2TA 2OORA 3RROA 2H1IA 3FMOB 3EG9B 3O8BA 3ZNOA 2O5VA 4AZ0B 3MWLA 1XMOB 4BDSA 4P36A 1PQWA 3TSYA 1NU6A 1N1MA 2HWXA 5CLGA 1TTQB 3V42A 4C21A 1KI6B 4W63A 5A2QA 5HF8A 2BMEA 1OT5A 1QIEA 1ZK3A 2JGLA 4TTVA 5JH7F 4QULA 4FVTA 2WF9A 2Z57A 2ZGVA 3KYCB 1T9HA 1F2DA 4TTAA 3K15A 4I19A 5IKMA 2J85A 5LDGA 2P6MA 4ESOA 1H2RS 1A0OA 3ZEAA 5FUWA 2A0FA 2CLEB 2IHTA 3C3XA 4Y9DA 2P4QA 3VVBA 2OY0A 2F55A 5U4XA 4CDMA 3ZYCA 1NN3A 1M2JA 2HCTA 4G5XA 4BMCA 3NB0A 4OGFA 2Q0SA 1EHYA 3DAOA 5I7WA 1MENA 1V7CA 4H9GA 1J9ZA 4XM0A 4DNPA 4EHBA 5A3QA 5BUZA 4GLOA 5KOJA 1QOZA 2L69A 4CIWA 1MN6A 2XCQA 4PSKA 2XUKA 3KSDO 4PG6A 3ND8A 5C1BA 1M7HA 3OLWA 3GO4A 4AMGA 4B3SB 2X5NA 3EZ7A 4G8BA 2ZJ3A 5EWMB 2FSPA 1U8TA 5ALLA 3M2PA 4AZ3B 3L6DA 2ODWA 1GFWA 4UULA 2C03A 4AQDA 1AHIA 1RVV1 4LS3A 4M1EA 2WNSA 3ZV3A 4C2UA 2GCNA 3B52X 5E3JA 3JWGA 2B4KA 1QF6A 1WL8A 3BICA 3ETEA 4JJGA 3T95A 1EM8A 2NUTB 4JI1B 3SYNA 5IZCC 1PDVA 4EUSA 5K0ZA 2ZUFA 1LK7A 3OLQA 4KUHA 4WLNA 5FUXA 2AEEA 4PRLA 1J21A 2LRHA 2YV5A 3IAAA 3DG9A 1M0SA 4ZT2A 2P68A 3G8YA 5LOVB 3OPYI 3B6ZA 4MV7A 4MVXA 1CE8A 4QARA 5DZSA 4OKSA 3IXMA 1ZKMA 1QVVA 4KVGA 1GUAA 1BXRB 1A8UA 2RHBA 3ZVKA 2HEGA 3LXXA 4KAFA 3CF6R 4PC7A 3RQIA 3NWEA 3U13A 4HNHA 3GWGA 4BAUA 3LW8A 4EHDA 1R10A 2CVZA 2GNPA 3PNQA 3D0KA 4I66A 5AXBA 3SE7A 4L6AA 3RC8A 4US0R 1M6YA 2ZOSA 3A1SA 1A7JA 2IZOA 3BM5A 3HEMA 4J91A 1TC1A 2FPSA 5ADVA 3HA7A 3BBPA 3RRZA 4MIEA 2WU4A 2IIPA 3P20A 4J0FA 1BQ3A 4B6PA 5IM4A 3LQRA 2AKYA 5M5BA 4UEWA 3AI1A 2UUBB 1FDSA 2GWRA 2ZZMA 4U2EA 4HY3A 4K9DA 4YMUA 3S6JA 2J8ZA 3PD0A 2AE2A 4QBTA 4B82A 5A9SA 1VE3A 3UV3A 2XSZD 1TNDA 3MTEA 3K9LA 4RLHA 1UQUA 2YVKA 4KIFA 1FUIA 3UUWA 2Q3JA 1KYYA 1Y9AA 1VJ0A 3V32A 1F48A 3CTPA 5JNUA 1UZNA 4D99A 1ZJYA 3BIXA 3T1VA 1HEIA 1N1DA 3KB1A 4JVSB 2Y77A 4OM7A 2QBYB 2CD9A 2NVWA 3LBNA 1PZEA 1J99A 2ZAIA 1TK2A 4MEBA 1R15A 3RFXA 1QDEA 3FE2A 4B8ZA 2AJDA 4JBYA 4GNKA 2Z6UA 2P0YA 2PIAA 2Q7XA 2H2GA 2UAGA 1YO6A 5AVXA 4A0GA 1KP3A 2IUEA 3LTNC 4EG5A 1L0BA 1W88A 4DV2B 2CCJA 1ESEA 2EW8A 2JDID 2NU9A 1NF3A 4CRWB 4AMVA 5F7OA 1D2GA 2GO7A 2VKQA 2O5CA 5FQOA 4ZT6A 3FDFA 3K94A 3O75A 3CR8A 4IMJB 4D5GA 3U3DA 4HLUA 2RAPA 3QE2A 1PS0A 1DHRA 1LSSA 5JXGA 2EWVA 2RBGA 3FAZA 4GIBA 3G82C 4YRNA 1ZD1A 3CNBA 3M5CA 2MTBA 3I2IA 3GG9A 3WWEA 4IDDA 3GX1A 3KTOA 4ENWA 1DPGA 5DVZA 2FEXA 4DJJA 3VTAA 2WC1A 1AKQA 1GN8A 3O8DA 2P9TA 1E6CA 3G9QA 1DTSA 4FEGA 4OBBA 4B2PA 1B3RA 2GERA 2V59A 4FDUA 4FZ5A 4KN5A 4YP9A 2FFJA 2Z4TA 2V0CA 4R2MA 2V6JA 3B2EA 2HHJA 5AIBA 1L1RA 1VKHA 1YBFA 4UBOA 3AF4A 4WN9B 2B6NA 1L5NA 2RGRA 1G8PA 2V5VA 4CU5A 2A1TS 2ET6A 2FG5A 4QOIA 4ZAYA 1H6DA 4GE0A 3TW8B 3DMRA 4R2IA 4C88A 3IILA 2IXDA 4AK9A 4DPKA 1E2BA 1E2HA 1MAHA 3BZBA 3R75A 1DKOA 2BFCB 5DOZA 4L0DA 3EZGA 5EC8A 3TJMA 1W1WA 2PKYX 4DWWA 3X1XA 1IUOA 5F33A 2CNWD 1I7DA 4HDSA 2Z2IA 4K9MA 5KKAA 5T7BA 3PNLA 1FXUA 1MC8A 2QKYA 4F5DA 3AF5A 1DZ3A 5BN4A 1R4NB 1NBMA 2ZTMA 3TBHA 3E7XA 3MTDA 2D62A 3ROKA 3OU6A 1MX9A 5E1BA 4DBLE 4ZCRA 4UMFA 4GYKA 7ABPA 4QAJA 4IDFA 5IDQA 4QVGA 2YV4A 5E0OA 3THWB 4UXIA 3NWPA 5CDFA 5FKJA 4CM3A 2HPAA 1KOJA 3MJHA 3S99A 2FMKA 4P4UA 2OAGA 5DLPA 4MIOA 4CMEA 4L3VA 2V7XA 3SC6A 1A04A 1Q22A 4EY3A 3D02A 2QD4A 3GZTB 2WT9A 3VAZA 4AS1A 2G71A 1O5TA 1N78A 1DNPA 4H3VA 2WKQA 4IIUA 1EEXB 4C76A 1JJAA 4CMCA 2EFGA 4V1CB 4V2IA 5CDSA 5IVHA 2BTQA 1YD7A 2GHTA 3P71T 3UWOA 3K0SA 3HLKA 4Y1RB 4YI5A 2ONCA 1BW9A 5JRDS 1CDDA 3G0GA 2OGWA 3OOWA 5K3EA 5K9ZA 2O8FA 4RETA 1M2KA 3GCZA 4F6LA 3KHTA 3NM6B 2VF2A 2VF5X 3LPAA 2WYWA 3NJRA 5FHRA 3H0CA 3RB8A 4KXQA 3VQTA 3OLZA 3KDPA 2B82A 3F3SA 1VJDA 3L6OO 2GJKA 4IL5A 1U1FA 2WVGA 4OBWA 1CVIA 5ER6A 3DAGA 3DOIA 3PENA 3VH3A 3WBBA 2OV6A 3ETCA 2AFRA 4EY4A 3CSSA 2KBFA 4RIFA 1BE0A 4DDVA 3D2CA 4NBLA 1G17A 2OBYA 2QLNA 1PLJA 1UJCA 1M1NA 3OOSA 1BTOA 1U7XA 3U4QA 4LRUA 1EVIA 2W8BA 4XGIA 3N2YA 1GCUA 3FWZA 5EESA 4CBVA 4RVGA 3STYA 3D4LA 3WYCA 5EGNA 3KFVA 1Q3HA 3W8NA 3WRXC 4HNUA 4HTAA 3LD9A 4MEAA 4HC4A 4DRZA 5JZMA 1N0IA 3VNBA 3PDHA 1G2QA 2Y99A 5E6UB 2C2HA 2HA4A 4YCBA 1ISFA 4AP5A 1RRCA 3DLHA 4DQXA 4ONEA 1E2KA 2C20A 2HA3A 4Q3EA 4XAQA 2IS1A 2O3TA 2P9YA 1FRZA 2JFGA 3IUNA 5LOVF 1E1LA 4E2YA 4BQIA 1QLJA 1KIAA 3PNPA 4RZUA 1MH1A 2NU6A 3PFNA 1BGXT 3K3PA 4FFLA 3OEWA 1LLDA 1ANKA 2EFDB 4RPCA 4ZVSA 5AJHA 3VBCA 1RLIA 4PYNA 1OYYA 2KYRA 3ADOA 3C14C 4V0LA 1XTZA 3A4TA 2ZVDA 1KI3A 1ZZGA 4RHXA 2BEUA 2I6GA 3PZBA 1CY8A 1MOSA 2I6TA 4RS4A 3U09A 1V47A 4IJ6A 3V4RA 2ZBRA 3U3ZA 1JXMA 2WZQA 1NWHA 1RSZA 3ZCXA 2RGYA 4JOSA 2ZM6B 3RAFC 2VQFB 1OFVA 3I05A 1ZONA 3L1VA 1P7ZA 4RLFA 1OU4A 1KDTA 1QSGA 1VKZA 1PG0A 1K1EA 3THOA 1PZGA 3JR3A 1XKXA 5DK6A 2AMVA 3I45A 3WTCA 1UPUA 1R6UA 1WJGA 4PZYA 3AL2A 4DMRA 4YMIA 1ATIA 2ZJ0A 4B87A 2X6RA 3WJ1A 4TMFA 2KW5A 3SF8A 2C99A 2B1GA 4JFRA 5CBPA 4X1IA 3GLIA 3LSTA 4O0LA 1WZIA 2GJ9A 4RQAA 1M54A 3FOEC 2OE2A 3ZW8A 1OWLA 5ALRA 3HVHA 4IICA 3WRYA 2WRZA 3H04A 3PNBA 4HJRA 5D5HA 4ZP1A 1I7NA 4RK6A 4O08A 2AQHA 3GJZA 5EXDA 4FZ3A 2OEPA 5ESRA 3WLNA 5SY9A 2QTFA 1OVGA 4HUJA 3A8TA 4OQMA 3KO8A 1YTUA 4IQ0A 2JFHA 4BMDA 3VR6D 3EW9A 1GSAA 4Q9LA 4PSDA 1O7JA 4DAEA 5ELLA 4BECA 3O4FA 4B75A 2QPLA 4LRXA 2R65A 1E18A 2H00A 4NEQA 3USCS 1D09A 3D1JA 2QT0A 3PDIB 4MS3B 1WOYA 3WK9A 1E7WA 2Z8YA 1QYCA 3PXAA 4RD2A 4PHGA 3UENA 4GMDA 4PX3A 1KFKB 1Z7GA 2HNAA 1W34A 4EPWA 2CY0A 1RAEA 1SH7A 5BXYA 2V1XA 5KJ6A 2FWNA 4IOJA 4UE2A 1EUYA 3T5CA 2AFVA 2AJ8A 4K5QA 4R8SA 2YJ6A 4GAEA 3NHUA 1KDOA 3P9CA 3JV7A 2PU5A 3KOMA 2DFNA 1KO7A 5HDQA 3E9CA 1I1NA 1WZNA 3L4EA 2BFDA 4HPJB 2H51A 4OKIA 1S9HA 2ZIAA 3K9NA 3LDGA 4JOBA 1U2PA 4S12A 4Q9IA 5GINE 2O8DA 3M6MD 4H7IA 1SURA 5B7PA 4DILA 2OCGA 4HEHA 2OHOA 1K3TA 4QUAA 3B12A 4TV8A 2JRCA 5AOAA 4UUOA 3C41J 1NFFA 1R50A 2ZYAA 4V0QA 4WV3A 2TRSB 4CKXA 2P9ZA 3FNQA 4KXYA 4N8EA 4KKXB 3N8GA 1U4OA 4X7MA 1PFQA 5DXAA 4BNKA 1GKKA 5AK6A 4EF4A 3MCTA 3L0SA 4GVXA 3WNZA 4RTOA 3P2KA 1CRLA 2VSXA 4BZQA 2ID9A 4M98A 3V4ZA 1YOBA 2RARA 4IOKA 2OTCA 5KU1A 3AF3A 3R0ZA 2D7CA 1RFGE 2H4XA 5A7GA 1QV7A 2IHUA 2IIVA 3KJIA 2P0EA 3R5FA 4X63A 3CH4B 4ND4A 1P2UA 4DLYA 1XQWA 2GAAA 4OXKA 4KO3S 5K0EA 4Y6RA 3O9ZA 2Q3FA 4PZEA 1PT8A 3AFHA 4RJIA 1XIVA 2QLMA 2EKQA 4CU2A 5LJLA 3GOQA 5AJTA 3SXJA 1IN5A 1XVVA 1FDTA 3IOMA 5BWBA 3E0XA 4CF7A 3WL8A 3OBIA 4Q7EA 4WT7A 4RUKA 5DTRA 3RRJA 5THQA 4F9GA 4EL5A 5ICCA 4TUYF 1Q0LA 3KEOA 2PQMA 1WMSA 3EE6A 3TW0A 3JWIA 5HJ5A 2OV1A 1EFCA 2NAFA 3ZCRA 4FJ0A 1M1YE 2AS0A 2G7MC 1H05A 4I1RA 1L5QA 3ENVA 3DF7A 4QGAA 3LNTA 3PR3A 4B4UA 4GKBA 4U00A 3MF4A 4B79A 3OZVA 4JGIA 4GLJA 2E7ZA 2QJRA 1AKVA 1LC3A 4BZWA 1G41A 3U4QB 1G16A 3QVLA 3EWSA 3B1KA 4UU8A 1ZRSA 3WZMA 3BMXA 1BJTA 4DA9A 1E60A 1QHFA 1W96A 4IF6A 1XZQA 4KOAA 3RT9A 3DNPA 2ZSEA 5BW5A 3K8YA 3HEBA 3NKFA 4JLMA 4RF5A 5BOSA 1LEHA 3W9BA 5FLXA 3VNUA 3GVXA 1BGVA 4G5OA 1OHHD 2RHTA 3FNGA 2H52A 2NU7A 3FVRA 4O1HA 4OYHA 5HJEA 3GHYA 3HXLA 1MC4A 2DOKA 2J08A 3ZLJA 4YUAA 4KK4A 3HTXA 2CK3A 5J5AA 3EC7A 3U81A 2AF3C 1ODSA 2BR3A 3OVMA 3P52A 4Y7CA 1G3IA 2O3RA 1QG4A 1T2CA 1V5IA 2QQ0A 4J4TA 3N70A 4C5AA 5K3AA 3INGA 3GGCA 2WF8A 2VLIA 3ZJYA 1JU9A 1P81A 3BB3A 4KI0A 2JFFA 2R8EA 4F3YA 3IQFA 4KVFA 4G0YA 2NU9B 2QN7A 4IGAA 1RAFA 2WJ4A 2IUYA 3O5AA 3D6JA 2BISA 4DM3A 3QLVA 3ZJUA 1QNLA 1C9JA 4ZCMA 1SUEA 5LFAA 2W6JA 5T4FA 1Z62A 4NE2A 1ZXBA 3ZV5A 3IB3A 3SD7A 5JLJA 5E6SA 3WXBA 4LTMA 1D2MA 1XZBA 3FHLA 3ZCSA 5KTSA 3BE4A 2IE0A 1N6NA 1D8TA 1M2GA 2DPYA 2IXFA 2R97A 3U7RA 3ZXXA 4WOCA 3AVYA 2BH2A 3UJ7A 1ACMA 1XEXA 3KXPA 1SXQA 3G8CA 4KWIA 4ER5A 4EKEA 3UPDA 5LP6B 1UC5B 3INRA 1ZN8A 3PCRB 4CM4B 3E1GA 1N2EA 3EZ2A 1W4CA 4YR9A 1P1FA 1VC2A 4ZT7A 5JAHA 4HZIA 1U2TA 2WWIA 4LJKA 4FFBB 4Y9SA 3ZV4A 4EFDA 2ZBEA 4D9KA 5GOTA 1RKVA 3HVUA 3O9VA 2A3NA 1ZHOA 1D2AA 3RS8A 1RCFA 2V4ZA 1REQA 2XUDA 1K68A 4KXMA 2WD9A 1MVOA 4MW0A 5J40A 1WPGA 2A7QA 2ZT8A 2K6GA 3A1VA 3D8RA 4Q47A 5FEUA 3EVDA 5SYMA 3KUDA 5A5EA 2I4NA 4JB0A 3N2KA 4BFLA 3GLGE 3HXQA 5JO0A 1VKNA 3WHKA 4U4AA 3SQOA 4DSAA 1EUDB 2G09A 3DHYA 4NMLA 1E3JA 3LGSA 1GYRA 1VG0B 1FLNA 4WKBA 5LXTF 1VIYA 1V1MA 4JB8A 2K87A 4HDSB 3VZRA 2GOYA 1FMJA 3LRXA 2NT4A 3R3UA 3TJZA 3DDOA 3OZSA 3GJ5A 4Z49A 3PFCA 3TK1A 3VBEA 2FFHA 2VSFA 4YROA 3WGLA 4EITA 2UUAB 2O19A 1OFUX 3NOQA 3EZ9A 3HA3A 4AWBA 1G20A 3A1UA 2W0SA 4IIVA 4DB4A 2G08A 3UCXA 3ZGVA 2XCTB 1CEEA 2IUSA 4Y2RA 5CM8B 3NYWA 1ONOA 3GGOA 3E8SA 3QMPA 3TCXB 1VIMA 1O96B 3VNAA 3UKDA 4FGUA 4AKTA 1RKQA 5FBQB 3IXQA 1Z5WA 3N7TA 1I4OA 1UODA 3RREA 3SC2A 2C31A 1NM5C 1OY1A 2H5LA 3JASA 4R8LA 1N6RA 5H68A 3C48A 1T3ZA 1U0RA 4WXMA 4UNIA 2UV8A 3RCBA 1UJ5A 2XGGA 2R66A 3GT4A 1RKUA 1ZOPA 2AYYA 4QEDA 5DI9A 3ZXSA 3LXMA 4AFNA 2HTFA 3PHCA 2GD1O 1R6XA 3BMOA 4LSMA 2NZVG 3FCCA 2ZKLA 3ILHA 3MJVA 3VI4B 1WCWA 2O8FB 5GZ3A 4FFMA 4HAOA 5EMNA 1SPXA 4MQLA 4PTYA 3BJIC 3WLKX 2ZTUA 5G0WA 1K9SA 5DJ5A 3MCWA 3PQEA 2H6EA 1JZTA 1ORDA 2PZ8A 3EUAA 4ZRMA 3KXLA 2J3JA 2QMHA 1K4YA 3NTUA 4RL4A 3LAWA 5B4UA 1DG1G 1E2DA 4CGZA 2XDWA 1EDBA 4QBIA 3PX2A 4W1RA 2O3SA 2KMLA 4JEUA 4BZZA 2YWXA 4G4SP 1FYVA 1B8PA 4BWVA 1RHJA 4WBXC 4EYGA 1IY1A 4M1MA 1NYRA 3W4JA 3BFXA 1M1NB 2ZULA 3AR3A 4O4HA 2KLBA 1GFZA 4JJIA 2J7KA 3D7KA 4M87A 3UK7A 3BQNB 3TM5A 4Y6OA 1KDRA 2CYBA 2ARKA 3UUFA 1Z5VA 3VO1A 3TTWA 1A5ZA 1L5HA 4QG7A 4YUZA 3I2JA 5IYZA 4Q9KA 4JP3A 4LY0A 3G1TA 4UUNA 3JY6A 1WPQA 1S2NA 5LLDA 5IAGA 2ZIGA 1D03A 2QX4A 1P80A 2XLCA 1QH8A 1OZHA 1WDWB 3IPAA 4X8HA 3KSZO 2FHPA 2V4UA 4HGZA 4PS0A 3WYFA 1YJCA 1Y48E 2FMIA 3BORA 4RAQA 1YZTA 3V48A 2PZLA 1L4FA 1Q1NA 1N6IA 1X3SA 1XU4A 3KB6A 4G1CA 4R98A 5EJ2A 3D8BA 1NVBA 1ZD5A 1YR8A 2BKAA 4DIKA 3AX6A 5JC1A 2QD5A 2QLBA 1DQPA 2A9PA 1DAGA 5A4FS 4QQKA 5C7OO 5IN5A 2UZIR 1O87A 2VUIB 1EA7A 2CVFA 5CTJA 5F76A 5GONA 2BEUB 3NUGA 3IVRA 4MROA 1Q1GA 5J23A 3QYJA 3QG5A 1T6BY 2HBRA 1ZO8A 2D7JA 5CVJA 3AGQA 1M75A 4QEZA 4ZK2A 2JARA 1Z0IA 3LMKA 4FI3F 4FDAA 621PA 2W0MA 3U0BA 5C80A 4REMA 1LZLA 421PA 3ZGXA 5MFPA 3F73A 1KFBB 2W71A 3DTNA 3I52A 4WDQA 1NQWA 1U8CB 1IJBA 3LC1O 3MPOA 4H59A 1I7PA 4NG5A 3A3KA 3EOBI 1WKBA 2FR8C 1U8FO 3LPMA 4OI1A 4YK7A 3HU3A 1C3XA 2G9RA 3IEXA 1F51E 2HQ1A 2C54A 2X8JA 4X3PA 4DMHA 1KDVA 1B41A 2GNOA 4XVRA 2I65A 5F77A 3NWJA 4FSDA 4X1IB 5K0CA 1XAIA 3KQNA 1V95A 1RABA 1GITA 1T2NA 1YS1X 1YRQA 1FVXA 2BFBB 4U9UA 2HDHA 3RK0A 4TOIA 4LHZA 4PV7A 5FNZA 1K8RA 3WGHA 1KIFA 2PMWB 3P9PA 4J2TA 4Z0NA 2HYIC 1US8A 2IYLD 1VIAA 3W6UA 4R3NA 1EUQA 2ADOA 2M9MA 3KE9A 1MV5A 1W5EA 1XTUA 3HKEB 4MGZR 3SGLA 1OWNA 4MCAA 5AHWA 2ZWAA 1ZA2A 5EA2A 2EIXA 1DOZA 5DHRA 4EHJA 3GCWA 3ILVA 4X92A 1DAKA 2QTVA 3VR5D 3LCCA 4LNHA 1GV0A 2Q46A 3DLAA 4XFJA 3MUOA 1NAIA 1ZMTA 1Z2CA 2GB4A 1SXHA 2QRVA 3GUCA 1Q15A 3KLMX 5J3JA 1QQTA 2FX3A 2O2CA 3EK2A 1FYFA 2YIVX 1H3NA 3BUSA 3I2KA 4TTSA 1G8AA 1R88A 1VFNA 2JZNA 5CPFA 1M6HA 2F3QA 4XJXA 4E94A 3I01A 5FBLB 2PUBA 3OF2A 4PVDA 2P2CA 1XZJA 3TCNA 1IOLA 1Z4LA 3AG6A 1BDBA 4YRCA 4UAVA 2ODEA 1XMXA 1VJ5A 1T5HX 3PQDA 3WL5A 1SA0B 5CX1A 4GX1A 4RORA 2ZK7A 1XZEA 5K20A 5IUNC 2PMFA 3E4DA 3HSKA 1BMTA 2EJWA 5F2EA 3C7KA 2O1EA 5D51S 4BTVA 2R5WA 1TRKA 3WAGA 1HYGA 1DIBA 2PJUA 4Q4HA 1CY6A 2G0NA 2MR6A 4MX8A 1KK1A 3UK6A 3V1NA 1GCAA 2WAOA 2O8DB 4RPJA 3WG9A 2YIMA 4Y1FA 3KKMA 5JCOA 3TZ6A 4U9IS 3MFQA 2XE4A 3URMA 4X8LA </