1JBTA

Crystal structure of ribotoxin restrictocin complexed with a 29-mer sarcin/ricin domain rna analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29-MER SARCIN/RICIN DOMAIN RNA ANALOG
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbtA00
3KCHA 1RN1A 1C54A 1AQZA 2HOHA 1B3SA 1RGLA 4J5KA 4GHOA 5BIRA 1FUSA 1BRIA 1B27A 1BGSA 1RNTA 2GSPA 1BUJA 5GSPA 1I0VA 1I70A 1RGGA 3AHWA 1X1XA 4J5GA 1BNEA 1Q9EA 1RGKA 1BRNL 1BNFA 5RNTA 1UCJA 1HZ1A 1LOYA 4GSPA 5BU4A 1HYFA 1I3IA 1ZGXA 1GMPA 3DH2A 8RNTA 2AAEA 1BRKA 1JBRA 1RGEA 1BAOA 4RNTA 2AADA 1RNBA 1FUTA 1AY7A 3AHSA 2C4BA 2BU4A 1RGAA 1BNIA 3D5IA 1TRQA 1B20A 5HOHA 1RDSA 6RNTA 1FZUA 1UCLA 1CH0A 1BSDA 1A2PA 1I3FA 1YVSA 1BOXA 1B21A 1SARA 1LRAA 9RNTA 1RSNA 1GOUA 7RNTA 1RLSA 1BRJA 4BU4A 1R4YA 1BSAA 1GOVA 3AGOA 3HOHA 1BIRA 1RTUA 4HAAA 1B2ZA 1I2FA 2KF5A 1UCIA 1GMQA 2F4YA 3BU4A 2KF6A 1YGWA 1RCKA 1RGHA 3D5GA 2F56A 1PY3A 1TRPA 2SARA 1MGWA 3SYUA 1B2SA 1X1UA 1BRSA 1LOWA 4HOHA 2RNTA 4BIRA 1BNGA 1X1WA 3AGNA 2KF4A 1FYSA 1BSBA 1TTOA 1IYYA 3GSPA 1RHLA 1BSCA 2F5MA 1I8VA 7GSPA 6GSPA 1BNSA 1I2EA 1RCLA 1X1YA 1I2GA 1DE3A 2RBIA 3BIRA 3URPA 1BRHA 1B2MA 1YNVX 1T2HA 1LOVA 1T2IA 2KAAA 3A5EA 1BVIA 1BNRA 2KF3A 1BSEA 2BIRA 3RNTA 1RMSA 1PYLA 1GOYA 1BRGA 2F5WA 1BNJA 1UCKA 1GMRA 1RGFA 1B2UA 2ZA4A 1B2XA 3WHOA 1G02A 3DGYA 1FW7A 1I0XA 1DETA 3D4AA 3Q3FA 1LNIA 1RGCA 3WR2A 1JBSA 1BU4A 1JBTA 1MGRA 1RN4A 1GSPA 1BANA
chains in the Genus database with same CATH superfamily
1UUVB 3BNBA 1RN1A 2CFGA 4H3UA 2HOHA 3NQZA 1B3SA 5IG0A 1G96A 3CNXA 4J9AA 2CFDA 2W56B 4J5KA 1JNQA 4OK0A 5LC7A 5M18A 2BT3A 1UI8A 3BNCA 5BVBA 3GZYB 3KN4A 4HM0B 1OHOA 1FGQA 4KFEA 1B27A 1HKXA 2GSPA 2GU1A 2W6JH 5A0OB 3LT8A 3EBYA 1I70A 2RGQA 1FGMA 4HZ9B 1X1XA 3EN1B 1GD3A 4J5GA 4KFDA 3CD63 3FGYA 1IVVA 1V58A 1IK3A 3WA3A 1BNFA 3FSDA 4N6UA 5IENA 3DGOA 4K90B 3X3ZA 1FGOA 1YI23 1HZ1A 4O3VA 1PFPA 4KZ1A 4GSPA 4H61A 1DVDA 3JVCA 1K41A 1NWWA 3N8BA 1EUIC 1OF5B 2OOVA 5AYSC 1O7NB 3VSYA 4RZMA 1STFI 2UUGC 1ASKA 4HBRA 1IQ8A 4MMYB 1WQLB 7STDA 3G713 1VQ93 3LTDA 5ELJA 2XFSA 3DZLA 1NNVA 5JPPA 1FUTA 3JUMA 3OWSA 1RGAA 1DMQA 1RDSA 3MG2A 1M904 3GAXA 3SX1A 1BSDA 3V92A 1U5OA 5D83A 2CFLA 1RSNA 1GOUA 3I553 1EKMA 4CCVA 1RLSA 1JKGA 2OQEA 1SJWA 4XB5A 3B7CA 1KSIA 1GOVA 2KRTA 3AGOA 4MMZB 1NO3A 1RTUA 2K0MA 4RNYA 3ZG0A 4BL3A 4I5QA 4HKVB 3U97A 1SQWA 2CW9A 3F7XA 3D5GA 3FKAA 2IYJA 3MPHA 2YFLB 2XH9A 1RJOA 1TRPA 2SARA 1S5AA 1MGWA 3H3HA 2GU3A 1WMNA 5KP1A 2BMRB 1B2SA 1SIHA 1X1UA 3Q1CA 3WMDA 1GY6A 4HM7B 3V98A 1TUHA 4FCJA 4HM6B 5EQLA 4BIRA 2CFWA 2Q07A 2KF4A 2ML6A 2PNCA 4R4KA 1U8CB 3NXJA 1F8NA 3SOAA 1EA2A 3KKGA 4HJLB 5FW5A 3HIIA 1BSCA 3DMCA 1C7HA 6GSPA 1BNSA 3RGAA 1NDOB 3UL5A 3G8ZA 4IPBA 1V57A 3PS8A 1UW1A 4ILFA 4J8TA 3OV4A 3URPA 3CCM3 1FGTA 2ZHXB 4FMBA 2F99A 1UGHI 3CXC2 1DVCA 4ORLA 3EQQB 1MOLA 3EB8A 1TFOA 3RGRA 3HI7A 3FZWA 3D79A 4OUQA 1CEWI 1TFKA 5M19A 3V99A 1O7MB 1LNHA 2GBXB 3BNDA 3FG1A 3JUPA 3N9HA 3GZXB 1UCKA 1VQQA 1GMRA 3LH4A 1NJI4 4EW5A 3F8HA 4IT7A 2CX0A 3PZWA 4K61A 2W0QA 1B2XA 3NBJA 2CFKA 1N9JA 3DGYA 4EBGA 2QA43 2W9PA 1QVG2 5AEWB 5CF2A 1YGEA 1JBSA 1QALA 4N6NB 1RKYA 4LGQA 3J7Yd 1MGRA 3SYUA 3OW22 3KCHA 1CQSA 1OH0A 1RGLA 4FMCA 5HGRA 4IIAA 1JB5A 1QAKA 4GHOA 5BIRA 3B8LA 1M1K4 3L0RA 3CCR3 4BTWA 1BGSA 3CCS3 1BUJA 3EHCA 1TJDA 1CYUA 1NB3I 2D42A 5AYRB 3FCSB 1T3BA 1M1XB 2ZDJA 2CWVA 3S5CA 3X42A 4AKZA 2SBLA 3K9MC 4HZBB 3CCE3 1RRHA 1WNHA 1VQK3 4XM4A 1DYUA 1LVNA 3K5TA 3AMOA 1GMPA 3OWYA 8RNTA 2K3DA 3SVAA 3KSPA 1S723 2MF7A 3DY5A 5JPUA 3CCJ3 1BAOA 1UUGB 1WMOA 2CG0A 2LYXA 3DUKA 4R1KA 4L8PA 3DM8A 1JZOA 3Q90A 3EN8A 3AHSA 2BU4A 1Y4KA 1W5ZA 4PEJA 1VQ53 3A76A 4O2HA 1YHQ3 1B20A 4I4KA 3S28A 6RNTA 4LZIA 2XRXB 2OCTA 1ZS7A 3LMLA 4HM1B 1KD14 1IV9A 4L7KA 1A2PA 3G4S3 3GZBA 2INXA 2WO0A 1K8A4 5IW9A 3FLJA 2R41A 4R9LA 1YIT3 2KXGA 1ULJB 3X41A 1R4YA 1GS3A 4BL2A 3HOHA 2HMJB 2J8XB 2E2VA 3KE7A 4JRFA 2P0XA 3CCV3 4LMIA 8CHOA 3BU4A 2KF6A 1Q814 1YVBI 1RCKA 1WTHA 1KWIA 1RGHA 1W6YA 2O9UX 3SEDA 3FH1A 1RN7A 4OVMA 1Z1SA 3LTAA 2B24B 1A90A 2QIYA 4HM5B 2P05A 1LOWA 3BLZA 4FR9A 5EEOA 2HMLB 2RNTA 3AGNA 3S27A 2XSOB 1T5YA 4X2HA 1IVXA 3X3XA 1IYYA 3GSPA 1RHLA 3Q2PA 1J2BA 3LTBA 1JN5A 4NPBA 3GZRA 1JV2B 1JKGB 1RCLA 1W2ZA 5CLKA 3I0YA 1JB2A 3WA2X 3F14A 4LEHA 1HU9A 2UGIA 1FGRA 3BB9A 2RBIA 3BIRA 4QWTA 1DE3A 4G1MB 5D81A 1BRHA 3CU3A 3NM2A 3NQYA 4K1VA 5AI1A 1R4CA 2Y73A 2OOVC 3ZFZA 3OX9A 2E2TA 3CC23 1BVIA 4HVNA 2MC8A 1BSEA 3CCL3 1YJN3 1PYLA 4ZM8A 3NHXA 1O7PB 4N6MA 4FCZA 1GOYA 3F8XA 4STDA 2F5WA 3NBBA 1BNJA 3WDGB 3MYTA 3NUVA 1W6CA 1RGFA 1B2UA 5AIHA 5IG4A 2BMOB 2ZA4A 2H0IA 5DREA 1NB5I 2CWUA 4KFFA 1EEJA 3HZPA 1FW7A 1I0XA 2FNQA 2YFJB 3B4OA 3D4AA 3UNLA 1BUQA 1STDA 4HM2B 2CIUA 1MWUA 3PYJA 1JBTA 3ZG5A 1V74A 5AEUB 5CK6A 1C54A 3QRDA 4LSOA 1W02A 2OQEC 1K734 4EV2A 1FUSA 2WGQA 2HMOB 1BRIA 1RNTA 3DGNA 5IF6A 1OGXA 3K0ZA 2E2UA 5G1LA 5GSPA 1W00A 2XGNA 1N8QA 1IQYA 4XBTA 3CCU3 3AHWA 4EYCA 1YIJ3 2RSXA 2W9QA 4HM8B 3CNMA 1BNEA 1Q9EA 1BRNL 2R4IA 2Y74A 3QK9A 5KP3A 5RNTA 3PCRA 1OPYA 1OCVA 1ULIB 2CX1A 1E3RA 2C10A 4K1UA 5ELUA 3FF2A 1OHPA 5G1KA 3EBTA 3T8UA 5BU4A 1A2VA 2P09A 1W2B2 2V1LA 4HM4B 1PU4A 1VQ63 3U1WA 3ROBA 3D9RA 5IG5A 3LXUX 1IT8A 1K9M4 2AAEA 1WMPA 3FG3A 1JBRA 3MWZA 1GYBA 4O02B 3B4PA 3WOEB 4CJNA 1RGEA 4GL6A 3UJMA 1JJ22 2D1WA 2AADA 1TIJA 1LQMB 1AY7A 2C4BA 1SPUA 1OUNA 1ZX2A 3KFQC 2XEPA 3IJEB 1UGIA 4EC6A 2K54A 2XFTA 1YVSA 3ALAA 1BOXA 1LXEA 1TU5A 6STDA 2BMQB 7RNTA 3EF8A 3EC9A 2STDA 1AR0A 2ML5A 4BU4A 2CKFB 1BSAA 3ECFA 1BIRA 4HAAA 3JUOA 1UCIA 1GMQA 2F4YA 3MSOA 4WWUC 1Q864 1YGWA 3AMOB 3LTCA 1OGZA 2F56A 4EV5A 2CC3A 1IT7A 2WGOA 1PY3A 1Q42A 5IEOA 3CPW2 1OHSA 4EXRA 5CXOA 1YJ93 1MWSA 1BRSA 1VQP3 3DGMA 1AVLA 4HOHA 2B1XB 3E99A 1BNGA 4Q53A 1X1WA 5LC6A 4RBNA 4MMXB 4WHAA 3X40A 4AKYA 2ZL8A 3CCQ3 4TX4A 1VQ83 3VGNA 1TTOA 2CWTA 1N5PA 2CHCA 1RRLA 3N54B 3PXMA 1FUWA 1O7HB 2M7OA 4FMDA 2PZVA 2F5MA 7GSPA 1US1A 1YJW3 3M8CA 3SOYA 3G6E3 2GEYA 2IA7A 3UB1A 2UX0A 1X1YA 2W56A 3F7SA 1VQ43 4N6LA 3GRDA 3TDGA 1VQL3 2IY2A 5D82A 3T8NA 5EVHA 3FG4A 1JRQA 2P0MA 3MKIA 1YNVX 1T2HA 1B2MA 1T2IA 3BNEA 3A5EA 3NX0A 2KF3A 5STDA 1MWTA 2BIRA 5M1AA 1MNLA 3RNTA 2XR8B 4MJDA 4CPKA 1BRGA 2IMJA 3WHOA 2OTJ3 1EG9B 3HIGA 3NV0A 1OF5A 2C11A 1DETA 3NV0B 3DXOA 1LNIA 1RGCA 1UDII 3NM7A 1UI7A 1D6YA 1AV4A 2Z76A 1RN4A 1JN5B 1BANA 1N8R4 1K28A 2Z77A 5BXQA 1AQZA 4KT3B 1D6UA 4CDLA 1KC84 3WOFB 5JBSA 3MHEA 3G16A 5KP4A 5G2GA 4R9KA 1VQN3 1VQ73 3K63A 2HMKB 3IMAB 3PGBA 1I0VA 1N5HA 1RGGA 2GBWB 3D3LA 4NREA 1G0TA 3NBRA 1RGKA 2JQ5A 3OWUA 2LQVA 1GD4A 1QMAA 1UCJA 1DMMA 4JF8A 4XBXA 5TGNA 1IVUA 1LOYA 4O8SA 2A15A 3SLUA 1E97A 1IVWA 3LYGA 4FCMA 3STDA 2CK3H 2H0GA 3MG1A 1I3IA 1HYFA 1CYVA 2P38A 4LYLB 1Q824 2XGLA 1ZGXA 1A67A 3DH2A 2BO9B 4XDVA 2HMNB 1BRKA 2HMMB 3WODG 4R80A 4RNTA 1RNBA 3EE1A 1TP6A 3O8YA 1M9GA 3PCSA 4N6TA 2OWPA 2I9WA 3I563 4BTXA 1IQXA 1BNIA 3D5IA 3T0UA 1TRQA 2L4VA 4N6V0 5HOHA 4WP5A 1FZUA 1UCLA 1CH0A 2QEX3 1E3VA 4N6OB 1JZDA 1I3FA 3H51A 1B21A 3EJVA 1SARA 1LRAA 1SIIA 9RNTA 3CC43 2CH9A 5I97A 1BRJA 3DGLA 1VZZA 2RCDA 2GEXA 3LZAA 4HYZA 3X3YA 1ZO2A 1FA3A 1B2ZA 1I2FA 2KF5A 1W4NA 3S29A 5IG3A 4XDWA 3CPOA 2O3OA 2H0HA 4N3VA 3F9SA 4GB5A 4XBYA 1KQS2 3F40A 3GWRA 4U13A 1QJGA 1A2KA 3CC73 1IDPA 5AIIA 3SXXA 3FF0A 1ISKA 1MWRA 1ROVA 2W2CA 3LOYA 1VQO3 3JUNA 3RDEA 1FYSA 1BSBA 3S67A 3UL6A 1W7CA 1GY7A 2L1SA 3HX8A 3LT9A 4MEIA 4WFOA 1QVF2 2Z7AA 5IERA 4L8OA 4BTYA 1O7WB 1O7GB 2YX9A 2W03A 2WOHA 1VQM3 1I8VA 2IUJA 2RFRA 4FMAA 2WOFA 1I2EA 1QAFA 3G0KA 2CG1A 2BNGA 3VF1A 2IUKA 5CF1A 1GY5A 5AIGA 4DKIA 1I2GA 3CME3 3MG3A 3OXAA 4WYKA 1OACA 2F98A 2XF3A 1EQKA 1JB4A 1N9EA 2BHMA 1UUWB 2QGUA 4WYKB 5IEPA 1DMNA 1LOVA 1L5GB 2FXTA 3K7CA 2KAAA 2Z6BA 1LQGC 1ROAA 4NHFA 3CMA3 1BNRA 5AIFA 1AVKA 2XSHB 1RMSA 1NU3A 1W6GA 3HK4A 2OTL3 3KIIA 1D6ZA 5FGOA 1IU7A 2FGTA 4KVHA 4AEQA 2F86B 3EX9A 1Q7Y4 1W01A 4X2OA 1Q40A 5DRVA 1G02A 3KSED 3KZTA 1Q40B 2W04A 2YFIB 3ER7A 1Q7HA 3Q3FA 1LOXA 2KCDA 2JDIH 3WR2A 3JUQA 1IV7A 1BU4A 4HM3B 2GXFA 4RNZA 3IPTA 1GSPA
chains in the Genus database with same CATH topology
3KCHA 1RN1A 1C54A 1AQZA 2HOHA 1B3SA 1RGLA 4J5KA 4GHOA 5BIRA 1FUSA 1BRIA 1B27A 1BGSA 1RNTA 2GSPA 1BUJA 5GSPA 1I0VA 1I70A 1RGGA 3AHWA 1X1XA 4J5GA 1BNEA 1Q9EA 1RGKA 1BRNL 1BNFA 5RNTA 1UCJA 1HZ1A 1LOYA 4GSPA 5BU4A 1HYFA 1I3IA 1ZGXA 1GMPA 3DH2A 8RNTA 2AAEA 1BRKA 1JBRA 1RGEA 1BAOA 4RNTA 2AADA 1RNBA 1FUTA 1AY7A 3AHSA 2C4BA 2BU4A 1RGAA 1BNIA 3D5IA 1TRQA 1B20A 5HOHA 1RDSA 6RNTA 1FZUA 1UCLA 1CH0A 1BSDA 1A2PA 1I3FA 1YVSA 1BOXA 1B21A 1SARA 1LRAA 9RNTA 1RSNA 1GOUA 7RNTA 1RLSA 1BRJA 4BU4A 1R4YA 1BSAA 1GOVA 3AGOA 3HOHA 1BIRA 1RTUA 4HAAA 1B2ZA 1I2FA 2KF5A 1UCIA 1GMQA 2F4YA 3BU4A 2KF6A 1YGWA 1RCKA 1RGHA 3D5GA 2F56A 1PY3A 1TRPA 2SARA 1MGWA 3SYUA 1B2SA 1X1UA 1BRSA 1LOWA 4HOHA 2RNTA 4BIRA 1BNGA 1X1WA 3AGNA 2KF4A 1FYSA 1BSBA 1TTOA 1IYYA 3GSPA 1RHLA 1BSCA 2F5MA 1I8VA 7GSPA 6GSPA 1BNSA 1I2EA 1RCLA 1X1YA 1I2GA 1DE3A 2RBIA 3BIRA 3URPA 1BRHA 1B2MA 1YNVX 1T2HA 1LOVA 1T2IA 2KAAA 3A5EA 1BVIA 1BNRA 2KF3A 1BSEA 2BIRA 3RNTA 1RMSA 1PYLA 1GOYA 1BRGA 2F5WA 1BNJA 1UCKA 1GMRA 1RGFA 1B2UA 2ZA4A 1B2XA 3WHOA 1G02A 3DGYA 1FW7A 1I0XA 1DETA 3D4AA 3Q3FA 1LNIA 1RGCA 3WR2A 1JBSA 1BU4A 1JBTA 1MGRA 1RN4A 1GSPA 1BANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCH A;  1RN1 A;  1C54 A;  1AQZ A;  2HOH A;  1B3S A;  1RGL A;  4J5K A;  4GHO A;  5BIR A;  1FUS A;  1BRI A;  1B27 A;  1BGS A;  1RNT A;  2GSP A;  1BUJ A;  5GSP A;  1I0V A;  1I70 A;  1RGG A;  3AHW A;  1X1X A;  4J5G A;  1BNE A;  1Q9E A;  1RGK A;  1BRN L;  1BNF A;  5RNT A;  1UCJ A;  1HZ1 A;  1LOY A;  4GSP A;  5BU4 A;  1HYF A;  1I3I A;  1ZGX A;  1GMP A;  3DH2 A;  8RNT A;  2AAE A;  1BRK A;  1JBR A;  1RGE A;  1BAO A;  4RNT A;  2AAD A;  1RNB A;  1FUT A;  1AY7 A;  3AHS A;  2C4B A;  2BU4 A;  1RGA A;  1BNI A;  3D5I A;  1TRQ A;  1B20 A;  5HOH A;  1RDS A;  6RNT A;  1FZU A;  1UCL A;  1CH0 A;  1BSD A;  1A2P A;  1I3F A;  1YVS A;  1BOX A;  1B21 A;  1SAR A;  1LRA A;  9RNT A;  1RSN A;  1GOU A;  7RNT A;  1RLS A;  1BRJ A;  4BU4 A;  1R4Y A;  1BSA A;  1GOV A;  3AGO A;  3HOH A;  1BIR A;  1RTU A;  4HAA A;  1B2Z A;  1I2F A;  2KF5 A;  1UCI A;  1GMQ A;  2F4Y A;  3BU4 A;  2KF6 A;  1YGW A;  1RCK A;  1RGH A;  3D5G A;  2F56 A;  1PY3 A;  1TRP A;  2SAR A;  1MGW A;  3SYU A;  1B2S A;  1X1U A;  1BRS A;  1LOW A;  4HOH A;  2RNT A;  4BIR A;  1BNG A;  1X1W A;  3AGN A;  2KF4 A;  1FYS A;  1BSB A;  1TTO A;  1IYY A;  3GSP A;  1RHL A;  1BSC A;  2F5M A;  1I8V A;  7GSP A;  6GSP A;  1BNS A;  1I2E A;  1RCL A;  1X1Y A;  1I2G A;  1DE3 A;  2RBI A;  3BIR A;  3URP A;  1BRH A;  1B2M A;  1YNV X;  1T2H A;  1LOV A;  1T2I A;  2KAA A;  3A5E A;  1BVI A;  1BNR A;  2KF3 A;  1BSE A;  2BIR A;  3RNT A;  1RMS A;  1PYL A;  1GOY A;  1BRG A;  2F5W A;  1BNJ A;  1UCK A;  1GMR A;  1RGF A;  1B2U A;  2ZA4 A;  1B2X A;  3WHO A;  1G02 A;  3DGY A;  1FW7 A;  1I0X A;  1DET A;  3D4A A;  3Q3F A;  1LNI A;  1RGC A;  3WR2 A;  1JBS A;  1BU4 A;  1JBT A;  1MGR A;  1RN4 A;  1GSP A;  1BAN A; 
#chains in the Genus database with same CATH topology
 1UUV B;  3BNB A;  1RN1 A;  2CFG A;  4H3U A;  2HOH A;  3NQZ A;  1B3S A;  5IG0 A;  1G96 A;  3CNX A;  4J9A A;  2CFD A;  2W56 B;  4J5K A;  1JNQ A;  4OK0 A;  5LC7 A;  5M18 A;  2BT3 A;  1UI8 A;  3BNC A;  5BVB A;  3GZY B;  3KN4 A;  4HM0 B;  1OHO A;  1FGQ A;  4KFE A;  1B27 A;  1HKX A;  2GSP A;  2GU1 A;  2W6J H;  5A0O B;  3LT8 A;  3EBY A;  1I70 A;  2RGQ A;  1FGM A;  4HZ9 B;  1X1X A;  3EN1 B;  1GD3 A;  4J5G A;  4KFD A;  3CD6 3;  3FGY A;  1IVV A;  1V58 A;  1IK3 A;  3WA3 A;  1BNF A;  3FSD A;  4N6U A;  5IEN A;  3DGO A;  4K90 B;  3X3Z A;  1FGO A;  1YI2 3;  1HZ1 A;  4O3V A;  1PFP A;  4KZ1 A;  4GSP A;  4H61 A;  1DVD A;  3JVC A;  1K41 A;  1NWW A;  3N8B A;  1EUI C;  1OF5 B;  2OOV A;  5AYS C;  1O7N B;  3VSY A;  4RZM A;  1STF I;  2UUG C;  1ASK A;  4HBR A;  1IQ8 A;  4MMY B;  1WQL B;  7STD A;  3G71 3;  1VQ9 3;  3LTD A;  5ELJ A;  2XFS A;  3DZL A;  1NNV A;  5JPP A;  1FUT A;  3JUM A;  3OWS A;  1RGA A;  1DMQ A;  1RDS A;  3MG2 A;  1M90 4;  3GAX A;  3SX1 A;  1BSD A;  3V92 A;  1U5O A;  5D83 A;  2CFL A;  1RSN A;  1GOU A;  3I55 3;  1EKM A;  4CCV A;  1RLS A;  1JKG A;  2OQE A;  1SJW A;  4XB5 A;  3B7C A;  1KSI A;  1GOV A;  2KRT A;  3AGO A;  4MMZ B;  1NO3 A;  1RTU A;  2K0M A;  4RNY A;  3ZG0 A;  4BL3 A;  4I5Q A;  4HKV B;  3U97 A;  1SQW A;  2CW9 A;  3F7X A;  3D5G A;  3FKA A;  2IYJ A;  3MPH A;  2YFL B;  2XH9 A;  1RJO A;  1TRP A;  2SAR A;  1S5A A;  1MGW A;  3H3H A;  2GU3 A;  1WMN A;  5KP1 A;  2BMR B;  1B2S A;  1SIH A;  1X1U A;  3Q1C A;  3WMD A;  1GY6 A;  4HM7 B;  3V98 A;  1TUH A;  4FCJ A;  4HM6 B;  5EQL A;  4BIR A;  2CFW A;  2Q07 A;  2KF4 A;  2ML6 A;  2PNC A;  4R4K A;  1U8C B;  3NXJ A;  1F8N A;  3SOA A;  1EA2 A;  3KKG A;  4HJL B;  5FW5 A;  3HII A;  1BSC A;  3DMC A;  1C7H A;  6GSP A;  1BNS A;  3RGA A;  1NDO B;  3UL5 A;  3G8Z A;  4IPB A;  1V57 A;  3PS8 A;  1UW1 A;  4ILF A;  4J8T A;  3OV4 A;  3URP A;  3CCM 3;  1FGT A;  2ZHX B;  4FMB A;  2F99 A;  1UGH I;  3CXC 2;  1DVC A;  4ORL A;  3EQQ B;  1MOL A;  3EB8 A;  1TFO A;  3RGR A;  3HI7 A;  3FZW A;  3D79 A;  4OUQ A;  1CEW I;  1TFK A;  5M19 A;  3V99 A;  1O7M B;  1LNH A;  2GBX B;  3BND A;  3FG1 A;  3JUP A;  3N9H A;  3GZX B;  1UCK A;  1VQQ A;  1GMR A;  3LH4 A;  1NJI 4;  4EW5 A;  3F8H A;  4IT7 A;  2CX0 A;  3PZW A;  4K61 A;  2W0Q A;  1B2X A;  3NBJ A;  2CFK A;  1N9J A;  3DGY A;  4EBG A;  2QA4 3;  2W9P A;  1QVG 2;  5AEW B;  5CF2 A;  1YGE A;  1JBS A;  1QAL A;  4N6N B;  1RKY A;  4LGQ A;  3J7Y d;  1MGR A;  3SYU A;  3OW2 2;  3KCH A;  1CQS A;  1OH0 A;  1RGL A;  4FMC A;  5HGR A;  4IIA A;  1JB5 A;  1QAK A;  4GHO A;  5BIR A;  3B8L A;  1M1K 4;  3L0R A;  3CCR 3;  4BTW A;  1BGS A;  3CCS 3;  1BUJ A;  3EHC A;  1TJD A;  1CYU A;  1NB3 I;  2D42 A;  5AYR B;  3FCS B;  1T3B A;  1M1X B;  2ZDJ A;  2CWV A;  3S5C A;  3X42 A;  4AKZ A;  2SBL A;  3K9M C;  4HZB B;  3CCE 3;  1RRH A;  1WNH A;  1VQK 3;  4XM4 A;  1DYU A;  1LVN A;  3K5T A;  3AMO A;  1GMP A;  3OWY A;  8RNT A;  2K3D A;  3SVA A;  3KSP A;  1S72 3;  2MF7 A;  3DY5 A;  5JPU A;  3CCJ 3;  1BAO A;  1UUG B;  1WMO A;  2CG0 A;  2LYX A;  3DUK A;  4R1K A;  4L8P A;  3DM8 A;  1JZO A;  3Q90 A;  3EN8 A;  3AHS A;  2BU4 A;  1Y4K A;  1W5Z A;  4PEJ A;  1VQ5 3;  3A76 A;  4O2H A;  1YHQ 3;  1B20 A;  4I4K A;  3S28 A;  6RNT A;  4LZI A;  2XRX B;  2OCT A;  1ZS7 A;  3LML A;  4HM1 B;  1KD1 4;  1IV9 A;  4L7K A;  1A2P A;  3G4S 3;  3GZB A;  2INX A;  2WO0 A;  1K8A 4;  5IW9 A;  3FLJ A;  2R41 A;  4R9L A;  1YIT 3;  2KXG A;  1ULJ B;  3X41 A;  1R4Y A;  1GS3 A;  4BL2 A;  3HOH A;  2HMJ B;  2J8X B;  2E2V A;  3KE7 A;  4JRF A;  2P0X A;  3CCV 3;  4LMI A;  8CHO A;  3BU4 A;  2KF6 A;  1Q81 4;  1YVB I;  1RCK A;  1WTH A;  1KWI A;  1RGH A;  1W6Y A;  2O9U X;  3SED A;  3FH1 A;  1RN7 A;  4OVM A;  1Z1S A;  3LTA A;  2B24 B;  1A90 A;  2QIY A;  4HM5 B;  2P05 A;  1LOW A;  3BLZ A;  4FR9 A;  5EEO A;  2HML B;  2RNT A;  3AGN A;  3S27 A;  2XSO B;  1T5Y A;  4X2H A;  1IVX A;  3X3X A;  1IYY A;  3GSP A;  1RHL A;  3Q2P A;  1J2B A;  3LTB A;  1JN5 A;  4NPB A;  3GZR A;  1JV2 B;  1JKG B;  1RCL A;  1W2Z A;  5CLK A;  3I0Y A;  1JB2 A;  3WA2 X;  3F14 A;  4LEH A;  1HU9 A;  2UGI A;  1FGR A;  3BB9 A;  2RBI A;  3BIR A;  4QWT A;  1DE3 A;  4G1M B;  5D81 A;  1BRH A;  3CU3 A;  3NM2 A;  3NQY A;  4K1V A;  5AI1 A;  1R4C A;  2Y73 A;  2OOV C;  3ZFZ A;  3OX9 A;  2E2T A;  3CC2 3;  1BVI A;  4HVN A;  2MC8 A;  1BSE A;  3CCL 3;  1YJN 3;  1PYL A;  4ZM8 A;  3NHX A;  1O7P B;  4N6M A;  4FCZ A;  1GOY A;  3F8X A;  4STD A;  2F5W A;  3NBB A;  1BNJ A;  3WDG B;  3MYT A;  3NUV A;  1W6C A;  1RGF A;  1B2U A;  5AIH A;  5IG4 A;  2BMO B;  2ZA4 A;  2H0I A;  5DRE A;  1NB5 I;  2CWU A;  4KFF A;  1EEJ A;  3HZP A;  1FW7 A;  1I0X A;  2FNQ A;  2YFJ B;  3B4O A;  3D4A A;  3UNL A;  1BUQ A;  1STD A;  4HM2 B;  2CIU A;  1MWU A;  3PYJ A;  1JBT A;  3ZG5 A;  1V74 A;  5AEU B;  5CK6 A;  1C54 A;  3QRD A;  4LSO A;  1W02 A;  2OQE C;  1K73 4;  4EV2 A;  1FUS A;  2WGQ A;  2HMO B;  1BRI A;  1RNT A;  3DGN A;  5IF6 A;  1OGX A;  3K0Z A;  2E2U A;  5G1L A;  5GSP A;  1W00 A;  2XGN A;  1N8Q A;  1IQY A;  4XBT A;  3CCU 3;  3AHW A;  4EYC A;  1YIJ 3;  2RSX A;  2W9Q A;  4HM8 B;  3CNM A;  1BNE A;  1Q9E A;  1BRN L;  2R4I A;  2Y74 A;  3QK9 A;  5KP3 A;  5RNT A;  3PCR A;  1OPY A;  1OCV A;  1ULI B;  2CX1 A;  1E3R A;  2C10 A;  4K1U A;  5ELU A;  3FF2 A;  1OHP A;  5G1K A;  3EBT A;  3T8U A;  5BU4 A;  1A2V A;  2P09 A;  1W2B 2;  2V1L A;  4HM4 B;  1PU4 A;  1VQ6 3;  3U1W A;  3ROB A;  3D9R A;  5IG5 A;  3LXU X;  1IT8 A;  1K9M 4;  2AAE A;  1WMP A;  3FG3 A;  1JBR A;  3MWZ A;  1GYB A;  4O02 B;  3B4P A;  3WOE B;  4CJN A;  1RGE A;  4GL6 A;  3UJM A;  1JJ2 2;  2D1W A;  2AAD A;  1TIJ A;  1LQM B;  1AY7 A;  2C4B A;  1SPU A;  1OUN A;  1ZX2 A;  3KFQ C;  2XEP A;  3IJE B;  1UGI A;  4EC6 A;  2K54 A;  2XFT A;  1YVS A;  3ALA A;  1BOX A;  1LXE A;  1TU5 A;  6STD A;  2BMQ B;  7RNT A;  3EF8 A;  3EC9 A;  2STD A;  1AR0 A;  2ML5 A;  4BU4 A;  2CKF B;  1BSA A;  3ECF A;  1BIR A;  4HAA A;  3JUO A;  1UCI A;  1GMQ A;  2F4Y A;  3MSO A;  4WWU C;  1Q86 4;  1YGW A;  3AMO B;  3LTC A;  1OGZ A;  2F56 A;  4EV5 A;  2CC3 A;  1IT7 A;  2WGO A;  1PY3 A;  1Q42 A;  5IEO A;  3CPW 2;  1OHS A;  4EXR A;  5CXO A;  1YJ9 3;  1MWS A;  1BRS A;  1VQP 3;  3DGM A;  1AVL A;  4HOH A;  2B1X B;  3E99 A;  1BNG A;  4Q53 A;  1X1W A;  5LC6 A;  4RBN A;  4MMX B;  4WHA A;  3X40 A;  4AKY A;  2ZL8 A;  3CCQ 3;  4TX4 A;  1VQ8 3;  3VGN A;  1TTO A;  2CWT A;  1N5P A;  2CHC A;  1RRL A;  3N54 B;  3PXM A;  1FUW A;  1O7H B;  2M7O A;  4FMD A;  2PZV A;  2F5M A;  7GSP A;  1US1 A;  1YJW 3;  3M8C A;  3SOY A;  3G6E 3;  2GEY A;  2IA7 A;  3UB1 A;  2UX0 A;  1X1Y A;  2W56 A;  3F7S A;  1VQ4 3;  4N6L A;  3GRD A;  3TDG A;  1VQL 3;  2IY2 A;  5D82 A;  3T8N A;  5EVH A;  3FG4 A;  1JRQ A;  2P0M A;  3MKI A;  1YNV X;  1T2H A;  1B2M A;  1T2I A;  3BNE A;  3A5E A;  3NX0 A;  2KF3 A;  5STD A;  1MWT A;  2BIR A;  5M1A A;  1MNL A;  3RNT A;  2XR8 B;  4MJD A;  4CPK A;  1BRG A;  2IMJ A;  3WHO A;  2OTJ 3;  1EG9 B;  3HIG A;  3NV0 A;  1OF5 A;  2C11 A;  1DET A;  3NV0 B;  3DXO A;  1LNI A;  1RGC A;  1UDI I;  3NM7 A;  1UI7 A;  1D6Y A;  1AV4 A;  2Z76 A;  1RN4 A;  1JN5 B;  1BAN A;  1N8R 4;  1K28 A;  2Z77 A;  5BXQ A;  1AQZ A;  4KT3 B;  1D6U A;  4CDL A;  1KC8 4;  3WOF B;  5JBS A;  3MHE A;  3G16 A;  5KP4 A;  5G2G A;  4R9K A;  1VQN 3;  1VQ7 3;  3K63 A;  2HMK B;  3IMA B;  3PGB A;  1I0V A;  1N5H A;  1RGG A;  2GBW B;  3D3L A;  4NRE A;  1G0T A;  3NBR A;  1RGK A;  2JQ5 A;  3OWU A;  2LQV A;  1GD4 A;  1QMA A;  1UCJ A;  1DMM A;  4JF8 A;  4XBX A;  5TGN A;  1IVU A;  1LOY A;  4O8S A;  2A15 A;  3SLU A;  1E97 A;  1IVW A;  3LYG A;  4FCM A;  3STD A;  2CK3 H;  2H0G A;  3MG1 A;  1I3I A;  1HYF A;  1CYV A;  2P38 A;  4LYL B;  1Q82 4;  2XGL A;  1ZGX A;  1A67 A;  3DH2 A;  2BO9 B;  4XDV A;  2HMN B;  1BRK A;  2HMM B;  3WOD G;  4R80 A;  4RNT A;  1RNB A;  3EE1 A;  1TP6 A;  3O8Y A;  1M9G A;  3PCS A;  4N6T A;  2OWP A;  2I9W A;  3I56 3;  4BTX A;  1IQX A;  1BNI A;  3D5I A;  3T0U A;  1TRQ A;  2L4V A;  4N6V 0;  5HOH A;  4WP5 A;  1FZU A;  1UCL A;  1CH0 A;  2QEX 3;  1E3V A;  4N6O B;  1JZD A;  1I3F A;  3H51 A;  1B21 A;  3EJV A;  1SAR A;  1LRA A;  1SII A;  9RNT A;  3CC4 3;  2CH9 A;  5I97 A;  1BRJ A;  3DGL A;  1VZZ A;  2RCD A;  2GEX A;  3LZA A;  4HYZ A;  3X3Y A;  1ZO2 A;  1FA3 A;  1B2Z A;  1I2F A;  2KF5 A;  1W4N A;  3S29 A;  5IG3 A;  4XDW A;  3CPO A;  2O3O A;  2H0H A;  4N3V A;  3F9S A;  4GB5 A;  4XBY A;  1KQS 2;  3F40 A;  3GWR A;  4U13 A;  1QJG A;  1A2K A;  3CC7 3;  1IDP A;  5AII A;  3SXX A;  3FF0 A;  1ISK A;  1MWR A;  1ROV A;  2W2C A;  3LOY A;  1VQO 3;  3JUN A;  3RDE A;  1FYS A;  1BSB A;  3S67 A;  3UL6 A;  1W7C A;  1GY7 A;  2L1S A;  3HX8 A;  3LT9 A;  4MEI A;  4WFO A;  1QVF 2;  2Z7A A;  5IER A;  4L8O A;  4BTY A;  1O7W B;  1O7G B;  2YX9 A;  2W03 A;  2WOH A;  1VQM 3;  1I8V A;  2IUJ A;  2RFR A;  4FMA A;  2WOF A;  1I2E A;  1QAF A;  3G0K A;  2CG1 A;  2BNG A;  3VF1 A;  2IUK A;  5CF1 A;  1GY5 A;  5AIG A;  4DKI A;  1I2G A;  3CME 3;  3MG3 A;  3OXA A;  4WYK A;  1OAC A;  2F98 A;  2XF3 A;  1EQK A;  1JB4 A;  1N9E A;  2BHM A;  1UUW B;  2QGU A;  4WYK B;  5IEP A;  1DMN A;  1LOV A;  1L5G B;  2FXT A;  3K7C A;  2KAA A;  2Z6B A;  1LQG C;  1ROA A;  4NHF A;  3CMA 3;  1BNR A;  5AIF A;  1AVK A;  2XSH B;  1RMS A;  1NU3 A;  1W6G A;  3HK4 A;  2OTL 3;  3KII A;  1D6Z A;  5FGO A;  1IU7 A;  2FGT A;  4KVH A;  4AEQ A;  2F86 B;  3EX9 A;  1Q7Y 4;  1W01 A;  4X2O A;  1Q40 A;  5DRV A;  1G02 A;  3KSE D;  3KZT A;  1Q40 B;  2W04 A;  2YFI B;  3ER7 A;  1Q7H A;  3Q3F A;  1LOX A;  2KCD A;  2JDI H;  3WR2 A;  3JUQ A;  1IV7 A;  1BU4 A;  4HM3 B;  2GXF A;  4RNZ A;  3IPT A;  1GSP A; 
#chains in the Genus database with same CATH homology
 3KCH A;  1RN1 A;  1C54 A;  1AQZ A;  2HOH A;  1B3S A;  1RGL A;  4J5K A;  4GHO A;  5BIR A;  1FUS A;  1BRI A;  1B27 A;  1BGS A;  1RNT A;  2GSP A;  1BUJ A;  5GSP A;  1I0V A;  1I70 A;  1RGG A;  3AHW A;  1X1X A;  4J5G A;  1BNE A;  1Q9E A;  1RGK A;  1BRN L;  1BNF A;  5RNT A;  1UCJ A;  1HZ1 A;  1LOY A;  4GSP A;  5BU4 A;  1HYF A;  1I3I A;  1ZGX A;  1GMP A;  3DH2 A;  8RNT A;  2AAE A;  1BRK A;  1JBR A;  1RGE A;  1BAO A;  4RNT A;  2AAD A;  1RNB A;  1FUT A;  1AY7 A;  3AHS A;  2C4B A;  2BU4 A;  1RGA A;  1BNI A;  3D5I A;  1TRQ A;  1B20 A;  5HOH A;  1RDS A;  6RNT A;  1FZU A;  1UCL A;  1CH0 A;  1BSD A;  1A2P A;  1I3F A;  1YVS A;  1BOX A;  1B21 A;  1SAR A;  1LRA A;  9RNT A;  1RSN A;  1GOU A;  7RNT A;  1RLS A;  1BRJ A;  4BU4 A;  1R4Y A;  1BSA A;  1GOV A;  3AGO A;  3HOH A;  1BIR A;  1RTU A;  4HAA A;  1B2Z A;  1I2F A;  2KF5 A;  1UCI A;  1GMQ A;  2F4Y A;  3BU4 A;  2KF6 A;  1YGW A;  1RCK A;  1RGH A;  3D5G A;  2F56 A;  1PY3 A;  1TRP A;  2SAR A;  1MGW A;  3SYU A;  1B2S A;  1X1U A;  1BRS A;  1LOW A;  4HOH A;  2RNT A;  4BIR A;  1BNG A;  1X1W A;  3AGN A;  2KF4 A;  1FYS A;  1BSB A;  1TTO A;  1IYY A;  3GSP A;  1RHL A;  1BSC A;  2F5M A;  1I8V A;  7GSP A;  6GSP A;  1BNS A;  1I2E A;  1RCL A;  1X1Y A;  1I2G A;  1DE3 A;  2RBI A;  3BIR A;  3URP A;  1BRH A;  1B2M A;  1YNV X;  1T2H A;  1LOV A;  1T2I A;  2KAA A;  3A5E A;  1BVI A;  1BNR A;  2KF3 A;  1BSE A;  2BIR A;  3RNT A;  1RMS A;  1PYL A;  1GOY A;  1BRG A;  2F5W A;  1BNJ A;  1UCK A;  1GMR A;  1RGF A;  1B2U A;  2ZA4 A;  1B2X A;  3WHO A;  1G02 A;  3DGY A;  1FW7 A;  1I0X A;  1DET A;  3D4A A;  3Q3F A;  1LNI A;  1RGC A;  3WR2 A;  1JBS A;  1BU4 A;  1JBT A;  1MGR A;  1RN4 A;  1GSP A;  1BAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...