1JBTA

Crystal structure of ribotoxin restrictocin complexed with a 29-mer sarcin/ricin domain rna analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
molecule keywords 29-MER SARCIN/RICIN DOMAIN RNA ANALOG
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbtA00
1GSPA 3AHWA 5RNTA 1RTUA 3SYUA 1B2XA 2F4YA 3DH2A 1RMSA 1RCKA 1B2MA 1I2GA 3Q3FA 1LOVA 5GSPA 1GOVA 1BOXA 3AGNA 4BU4A 2KAAA 1BNSA 1FUSA 1YGWA 4J5KA 4HOHA 7GSPA 1FZUA 4BIRA 1B2ZA 2RBIA 1RGLA 1I8VA 3A5EA 1BIRA 1PY3A 1BNGA 3AHSA 1BRGA 1RGAA 1RNTA 1TRPA 1X1UA 1I70A 1BUJA 1A2PA 1MGRA 1B21A 9RNTA 3D5GA 1RDSA 1LRAA 1RGHA 1UCIA 2AAEA 1UCKA 1RGFA 1FUTA 2GSPA 1GMQA 1BAOA 1RCLA 1T2HA 1BRNL 4RNTA 1HYFA 1LOYA 1BSEA 2SARA 4GSPA 1BSCA 1RNBA 1GMRA 1DETA 1BU4A 1BRKA 1X1YA 1RGGA 1X1XA 4J5GA 1YVSA 2AADA 1X1WA 1GMPA 5BU4A 2KF3A 1BSDA 1I0XA 3WHOA 1B2SA 1B27A 1YNVX 3RNTA 4GHOA 1C54A 3KCHA 1I2FA 1B2UA 3D5IA 3URPA 1FW7A 1BRIA 1ZGXA 1T2IA 3DGYA 1TRQA 1RGCA 1BRJA 1BGSA 1GOYA 1BNIA 1AY7A 1RSNA 1RHLA 1SARA 2KF6A 1RGKA 3WR2A 1CH0A 2BIRA 6RNTA 1MGWA 2RNTA 1GOUA 1BRSA 1JBTA 1B20A 1HZ1A 1I3FA 2F56A 3BIRA 1B3SA 1PYLA 1BVIA 1TTOA 1BNRA 3GSPA 1I3IA 1RLSA 1R4YA 5HOHA 3D4AA 1BNFA 1RN4A 3BU4A 5BIRA 1LOWA 1JBSA 1BSBA 1LNIA 2HOHA 3HOHA 1FYSA 1IYYA 1G02A 1UCLA 1Q9EA 1AQZA 1I2EA 2ZA4A 1I0VA 7RNTA 1BANA 1RGEA 8RNTA 1BRHA 1JBRA 2C4BA 1RN1A 6GSPA 1BSAA 1UCJA 3AGOA 2F5WA 2KF5A 2BU4A 2KF4A 1DE3A 1BNEA 4HAAA 2F5MA 1BNJA
chains in the Genus database with same CATH superfamily
1WMOA 1GSPA 3DGLA 5RNTA 1OHPA 3TDGA 1W4NA 1TUHA 4G1MB 4JRFA 4RNYA 5G1LA 3QK9A 4ZM8A 4STDA 4HM1B 3Q3FA 1C7HA 4BU4A 3CC43 1WMPA 4LZIA 2P0MA 5AIHA 3KSPA 5AYSC 1FUSA 2W03A 3FLJA 4I5QA 4J5KA 2RSXA 7GSPA 1FZUA 3MPHA 1YJN3 1MWUA 3EBYA 3A5EA 2QA43 1PFPA 3LTBA 1BNGA 2RGQA 1IK3A 4EBGA 2XRXB 2XSHB 3LTAA 1JB2A 2CG0A 1IVXA 3SOAA 2BMOB 1IV7A 5IG0A 1OCVA 9RNTA 3D5GA 1W00A 1RDSA 1VQP3 1TFOA 2QGUA 4HYZA 3ZG0A 1VZZA 1FGOA 2AAEA 2Z77A 1UCKA 3KIIA 1TFKA 2Z76A 4K90B 1UW1A 1GMQA 2LYXA 4GB5A 1T2HA 2P05A 5IF6A 4KVHA 3VGNA 5CXOA 1BSEA 1GS3A 2W6JH 3F14A 1UI7A 3MWZA 1VQ93 1MWTA 3NUVA 4KFDA 1KC84 1NJI4 1X1YA 1GYBA 2W56B 3KN4A 1X1XA 3CCR3 3NBRA 3CCL3 3LZAA 1US1A 4XM4A 2AADA 3DM8A 1GMPA 1KSIA 2KF3A 1NWWA 2PNCA 3B4OA 3FF2A 3KKGA 3KE7A 3NV0A 1K734 2KXGA 1IVUA 3B7CA 3EBTA 3H51A 4HM3B 1JB5A 3ROBA 2BMQB 1HKXA 1OGXA 1IV9A 3DMCA 1K28A 3FG3A 4CCVA 3KCHA 3PCRA 3D5IA 1S5AA 1BRIA 3H3HA 5LC7A 4R80A 7STDA 1O7HB 2OOVC 2HMLB 3DGYA 3HIIA 3PXMA 1TRQA 1ZO2A 1RGCA 4HKVB 3OXAA 1BGSA 5D82A 2BHMA 1OGZA 2CFWA 1SARA 1RHLA 3JUMA 1RGKA 4OK0A 5G1KA 1MOLA 3LH4A 1N9JA 1YGEA 5IEOA 3OV4A 1U8CB 2W56A 2F56A 4TX4A 3NXJA 4AEQA 3K9MC 1G0TA 3GZXB 1B3SA 3LT8A 3CXC2 1LNHA 2F98A 4N6NB 5G2GA 1BVIA 3EHCA 3I0YA 3NBJA 3K7CA 3G713 1WMNA 1Q864 1OHOA 1R4YA 3U97A 3D4AA 1BNFA 1GY7A 1RN4A 3DXOA 4RZMA 2PZVA 5BIRA 4X2OA 3CCS3 4NREA 5DRVA 1VQQA 3B8LA 2CIUA 1LNIA 1STDA 3GAXA 3G8ZA 3HOHA 4CDLA 1KD14 3G4S3 1VQ63 1Q9EA 1JV2B 4U13A 2MF7A 3K5TA 4HM8B 1BANA 1RGEA 2C10A 1JKGB 1Q7HA 1EG9B 4KT3B 3S67A 1ULJB 3N54B 2M7OA 4L8OA 2F5WA 1E3VA 3BLZA 1STFI 1BNEA 2J8XB 3X41A 1D6UA 3NQZA 2F5MA 4HZ9B 2XGNA 4AKZA 1BUQA 3CMA3 4KFEA 1MWSA 1D6YA 1QAFA 1RTUA 2F4YA 2WGOA 3DH2A 4XBXA 1RCKA 3BB9A 4HM0B 1YJW3 2FGTA 4PEJA 4WHAA 3OWYA 1ROVA 3UL6A 5GSPA 3T0UA 3IMAB 1M1XB 3EC9A 2UX0A 4EC6A 3AMOB 1YGWA 4HM5B 1Q814 4HOHA 1Q824 5M1AA 4BIRA 1B2ZA 2XEPA 3K63A 4WFOA 2QIYA 2XR8B 3HX8A 6STDA 4FMBA 1R4CA 1BIRA 3KFQC 3DY5A 1SIIA 1RGAA 1X1UA 2ML6A 1I70A 4ORLA 3CNXA 1A2PA 4XDVA 1JKGA 5CF2A 3IPTA 2XGLA 4LSOA 4MMYB 5HOHA 4CPKA 3F8HA 1CEWI 3PYJA 1RKYA 5AEUB 2KRTA 4NHFA 1T3BA 1ROAA 1DMMA 1RCLA 2L4VA 1BRNL 1HYFA 1WNHA 4FCMA 2WOFA 1Q40A 2V1LA 2FNQA 4LEHA 1DVDA 2CX1A 1DETA 2W04A 4XB5A 3WDGB 2HMJB 3G0KA 2E2TA 4WP5A 2K54A 3AMOA 1YI23 1QALA 1W2B2 1BSDA 3LYGA 1IQYA 4IT7A 1ASKA 1IT8A 2RCDA 1VQ73 3WHOA 1B2SA 2CKFB 2B1XB 3SEDA 3GZRA 1YNVX 3NQYA 3MG3A 4N6MA 4FCJA 3RNTA 3HIGA 1SJWA 3EE1A 3D9RA 1JZDA 1O7NB 5A0OB 2YFIB 3I563 1C54A 1I2FA 4N3VA 1VQK3 4CJNA 5ELUA 4GL6A 1T2IA 1CYVA 3CME3 4IIAA 1WTHA 1PU4A 2OTL3 4BL2A 4LYLB 5FW5A 2GBWB 3K0ZA 2R4IA 2IA7A 3PZWA 1CH0A 2CFDA 6RNTA 1GOUA 3RDEA 2B24B 2H0IA 3FF0A 5AIIA 1V74A 4DKIA 1JBTA 1HZ1A 3FG4A 4HVNA 2SBLA 1D6ZA 4EYCA 1LVNA 2OWPA 2Q07A 2ZDJA 1EQKA 4WYKB 1JN5B 1PYLA 3OWSA 1K8A4 4X2HA 5D81A 1EKMA 1OF5B 2WOHA 1IVVA 2ZL8A 4XBTA 2MC8A 1GD3A 2XF3A 4N6OB 3BU4A 4JF8A 1MWRA 3FCSB 1UDII 3EX9A 3WODG 3KSED 3EB8A 1MNLA 2HOHA 1V58A 2YFLB 3OW22 4R9LA 2W2CA 1DYUA 1G02A 1Y4KA 2UUGC 3OX9A 1YVBI 3LXUX 1I2EA 2A15A 3V99A 3X40A 4EW5A 1QAKA 2C11A 1JRQA 1BRHA 1JBRA 3S28A 3ZFZA 2Z6BA 1BSAA 3AGOA 4MMZB 2CG1A 3SXXA 4MMXB 5AEWB 1FUWA 1OH0A 2LQVA 4NPBA 4XDWA 3ZG5A 2RFRA 2I9WA 1ULIB 3CU3A 3T8NA 1BNJA 1M904 1J2BA 2P0XA 3F7SA 3AHWA 4O3VA 1VQL3 3CCU3 4IPBA 1B2XA 1T5YA 4EV2A 1WQLB 1RJOA 4FCZA 1RMSA 4K61A 1B2MA 2L1SA 3LOYA 3G16A 3CC73 2F86B 1BOXA 2P09A 5IEPA 3G6E3 1N8R4 1CYUA 3NHXA 2KAAA 1OF5A 3MSOA 1FGTA 2W0QA 3CNMA 2RBIA 2XFTA 3V98A 2E2VA 1YIJ3 2WO0A 4K1VA 3CCQ3 3EJVA 5JPPA 1PY3A 1SPUA 1GD4A 3LTDA 4HM7B 5EEOA 2ML5A 3AHSA 1BRGA 1TRPA 3GWRA 4H3UA 1DVCA 2ZHXB 2OTJ3 3DGNA 2W9QA 1N5PA 3D3LA 1LOXA 3VSYA 1HU9A 1IQXA 4H61A 1LRAA 2CX0A 3UB1A 1NU3A 1RRHA 2GU1A 2CFKA 4L7KA 1UI8A 4XBYA 4EV5A 2GSPA 3CC23 3NV0B 1LOYA 2YFJB 4GSPA 2D42A 1BSCA 1TIJA 5KP3A 2HMNB 1RNBA 5AYRB 4EXRA 5AIFA 1BU4A 1BRKA 3D79A 2JQ5A 5IW9A 3FSDA 4HJLB 4J5GA 4BTWA 1JNQA 3F7XA 1QMAA 3BNEA 3STDA 5BU4A 3BNCA 2Y74A 5I97A 1O7GB 3Q2PA 2F99A 5KP1A 1A2VA 4FMDA 3DGMA 4R9KA 1YHQ3 3WA2X 4MEIA 1N8QA 1OHSA 1UGHI 1B27A 4WWUC 4GHOA 5DREA 3ECFA 5JPUA 1ISKA 2CWTA 1SIHA 3CCJ3 1VQM3 4J9AA 5IG3A 1Q42A 2XH9A 1LXEA 3T8UA 3FGYA 2R41A 1B2UA 4RBNA 2HMKB 3URPA 3X3YA 1FW7A 5CF1A 5LC6A 1DMQA 1NB5I 4K1UA 1IDPA 1O7WB 3F40A 3S27A 5ELJA 1BNIA 1RSNA 2KF6A 3ALAA 2CW9A 1W02A 4HBRA 4KFFA 1ZS7A 3FZWA 3CCM3 1GY5A 3N9HA 3UJMA 4FR9A 3U1WA 2QEX3 1B20A 3E99A 1TU5A 1VQ83 5M19A 2CC3A 1NB3I 3A76A 3RGAA 1W6CA 2XSOB 3CPOA 1K41A 3PS8A 1S723 1TTOA 4R4KA 5HGRA 3EN8A 1BNRA 3GSPA 4R1KA 1I3IA 1RLSA 1ZX2A 1RN7A 5D83A 1O7MB 1Q7Y4 1JBSA 1FA3A 4FMAA 1RRLA 3FG1A 3PGBA 3J7Yd 5IG4A 1VQN3 2JDIH 3PCSA 2Y73A 3GZBA 1GY6A 4N6TA 1M9GA 1YIT3 3CD63 1IYYA 2XFSA 2GEYA 1AVKA 1AQZA 1TJDA 2GEXA 2ZA4A 1I0VA 4N6UA 4HZBB 4BTYA 3NM7A 4O8SA 1RN1A 1U5OA 1UGIA 1UCJA 4HM4B 1EEJA 1UUGB 2IMJA 3BNDA 3V92A 1VQO3 2KF5A 5BXQA 2BU4A 2KF4A 5FGOA 1DE3A 2CK3H 1Z1SA 3DGOA 2YX9A 2IUJA 3OWUA 3F8XA 2H0HA 1A2KA 1OPYA 3I553 2K3DA 2IY2A 3SYUA 5AI1A 5M18A 2HMOB 2GU3A 3MKIA 2GBXB 1FGRA 1I2GA 3SVAA 5CLKA 1M1K4 3GZYB 2STDA 1LOVA 4L8PA 1GOVA 1N5HA 2D1WA 3AGNA 4I4KA 4RNZA 1LQGC 3CCV3 3JUNA 3M8CA 1BNSA 3SOYA 3UNLA 1IT7A 3FKAA 2BNGA 3WOEB 8CHOA 3EF8A 1E97A 1RGLA 1OUNA 3WA3A 1FGQA 1QVG2 1I8VA 1FGMA 2FXTA 3B4PA 3JUPA 1K9M4 1W6YA 3BNBA 2CFGA 1RNTA 1W5ZA 2CWUA 1YJ93 1BUJA 1A67A 1MGRA 1KWIA 1NNVA 1IU7A 2WGQA 1B21A 1O7PB 2W9PA 3HI7A 2BT3A 3JUQA 4O02B 3GRDA 3SLUA 4BL3A 2INXA 1KQS2 2K0MA 1RGHA 1UCIA 3MG2A 3F9SA 1F8NA 1RGFA 3FH1A 3X3XA 5IERA 2BMRB 1FUTA 4J8TA 3X3ZA 1BAOA 4BTXA 3CCE3 4RNTA 1OACA 3JVCA 1L5GB 1QJGA 2SARA 1GMRA 5EQLA 1QVF2 1EA2A 1JZOA 1RGGA 3EN1B 3LMLA 1YVSA 2IUKA 4O2HA 3LTCA 3QRDA 1X1WA 4AKYA 3VF1A 3ER7A 4LGQA 1W01A 4OUQA 1IVWA 1I0XA 1IQ8A 5AIGA 4HM2B 3HZPA 1Q40B 1NO3A 3NBBA 2P38A 2GXFA 4LMIA 1W6GA 1W2ZA 5KP4A 4ILFA 3WOFB 3N8BA 2KCDA 2IYJA 1ZGXA 1AVLA 5EVHA 1UUVB 5STDA 3RGRA 4QWTA 1UUWB 3X42A 1W7CA 4N6V0 2Z7AA 5IENA 3CPW2 4WYKA 1BRJA 1V57A 4FMCA 1GOYA 3EQQB 1AY7A 3WR2A 1A90A 3S29A 2OCTA 2BIRA 1MGWA 1EUIC 4Q53A 3L0RA 2RNTA 3WMDA 1BRSA 2UGIA 4KZ1A 3NM2A 1JB4A 1SQWA 1CQSA 1I3FA 2CHCA 2CH9A 5BVBA 5JBSA 5CK6A 2H0GA 3O8YA 3BIRA 4N6LA 2HMMB 3SX1A 3HK4A 1AV4A 2E2UA 1TP6A 1LQMB 2BO9B 4OVMA 3IJEB 2CWVA 2OQEC 1LOWA 2O3OA 3MG1A 4MJDA 1BSBA 1N9EA 1JJ22 4HM6B 1G96A 1FYSA 5TGNA 1UCLA 3KZTA 5IG5A 2O9UX 3MHEA 1JN5A 1E3RA 2OQEA 1AR0A 7RNTA 8RNTA 3UL5A 1VQ53 1NDOB 2C4BA 3LT9A 3Q1CA 1DMNA 3NX0A 2OOVA 3S5CA 6GSPA 3JUOA 2CFLA 1VQ43 4HAAA 3MYTA 3DZLA 3DUKA 3Q90A
chains in the Genus database with same CATH topology
1GSPA 3AHWA 5RNTA 1RTUA 3SYUA 1B2XA 2F4YA 3DH2A 1RMSA 1RCKA 1B2MA 1I2GA 3Q3FA 1LOVA 5GSPA 1GOVA 1BOXA 3AGNA 4BU4A 2KAAA 1BNSA 1FUSA 1YGWA 4J5KA 4HOHA 7GSPA 1FZUA 4BIRA 1B2ZA 2RBIA 1RGLA 1I8VA 3A5EA 1BIRA 1PY3A 1BNGA 3AHSA 1BRGA 1RGAA 1RNTA 1TRPA 1X1UA 1I70A 1BUJA 1A2PA 1MGRA 1B21A 9RNTA 3D5GA 1RDSA 1LRAA 1RGHA 1UCIA 2AAEA 1UCKA 1RGFA 1FUTA 2GSPA 1GMQA 1BAOA 1RCLA 1T2HA 1BRNL 4RNTA 1HYFA 1LOYA 1BSEA 2SARA 4GSPA 1BSCA 1RNBA 1GMRA 1DETA 1BU4A 1BRKA 1X1YA 1RGGA 1X1XA 4J5GA 1YVSA 2AADA 1X1WA 1GMPA 5BU4A 2KF3A 1BSDA 1I0XA 3WHOA 1B2SA 1B27A 1YNVX 3RNTA 4GHOA 1C54A 3KCHA 1I2FA 1B2UA 3D5IA 3URPA 1FW7A 1BRIA 1ZGXA 1T2IA 3DGYA 1TRQA 1RGCA 1BRJA 1BGSA 1GOYA 1BNIA 1AY7A 1RSNA 1RHLA 1SARA 2KF6A 1RGKA 3WR2A 1CH0A 2BIRA 6RNTA 1MGWA 2RNTA 1GOUA 1BRSA 1JBTA 1B20A 1HZ1A 1I3FA 2F56A 3BIRA 1B3SA 1PYLA 1BVIA 1TTOA 1BNRA 3GSPA 1I3IA 1RLSA 1R4YA 5HOHA 3D4AA 1BNFA 1RN4A 3BU4A 5BIRA 1LOWA 1JBSA 1BSBA 1LNIA 2HOHA 3HOHA 1FYSA 1IYYA 1G02A 1UCLA 1Q9EA 1AQZA 1I2EA 2ZA4A 1I0VA 7RNTA 1BANA 1RGEA 8RNTA 1BRHA 1JBRA 2C4BA 1RN1A 6GSPA 1BSAA 1UCJA 3AGOA 2F5WA 2KF5A 2BU4A 2KF4A 1DE3A 1BNEA 4HAAA 2F5MA 1BNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSP A;  3AHW A;  5RNT A;  1RTU A;  3SYU A;  1B2X A;  2F4Y A;  3DH2 A;  1RMS A;  1RCK A;  1B2M A;  1I2G A;  3Q3F A;  1LOV A;  5GSP A;  1GOV A;  1BOX A;  3AGN A;  4BU4 A;  2KAA A;  1BNS A;  1FUS A;  1YGW A;  4J5K A;  4HOH A;  7GSP A;  1FZU A;  4BIR A;  1B2Z A;  2RBI A;  1RGL A;  1I8V A;  3A5E A;  1BIR A;  1PY3 A;  1BNG A;  3AHS A;  1BRG A;  1RGA A;  1RNT A;  1TRP A;  1X1U A;  1I70 A;  1BUJ A;  1A2P A;  1MGR A;  1B21 A;  9RNT A;  3D5G A;  1RDS A;  1LRA A;  1RGH A;  1UCI A;  2AAE A;  1UCK A;  1RGF A;  1FUT A;  2GSP A;  1GMQ A;  1BAO A;  1RCL A;  1T2H A;  1BRN L;  4RNT A;  1HYF A;  1LOY A;  1BSE A;  2SAR A;  4GSP A;  1BSC A;  1RNB A;  1GMR A;  1DET A;  1BU4 A;  1BRK A;  1X1Y A;  1RGG A;  1X1X A;  4J5G A;  1YVS A;  2AAD A;  1X1W A;  1GMP A;  5BU4 A;  2KF3 A;  1BSD A;  1I0X A;  3WHO A;  1B2S A;  1B27 A;  1YNV X;  3RNT A;  4GHO A;  1C54 A;  3KCH A;  1I2F A;  1B2U A;  3D5I A;  3URP A;  1FW7 A;  1BRI A;  1ZGX A;  1T2I A;  3DGY A;  1TRQ A;  1RGC A;  1BRJ A;  1BGS A;  1GOY A;  1BNI A;  1AY7 A;  1RSN A;  1RHL A;  1SAR A;  2KF6 A;  1RGK A;  3WR2 A;  1CH0 A;  2BIR A;  6RNT A;  1MGW A;  2RNT A;  1GOU A;  1BRS A;  1JBT A;  1B20 A;  1HZ1 A;  1I3F A;  2F56 A;  3BIR A;  1B3S A;  1PYL A;  1BVI A;  1TTO A;  1BNR A;  3GSP A;  1I3I A;  1RLS A;  1R4Y A;  5HOH A;  3D4A A;  1BNF A;  1RN4 A;  3BU4 A;  5BIR A;  1LOW A;  1JBS A;  1BSB A;  1LNI A;  2HOH A;  3HOH A;  1FYS A;  1IYY A;  1G02 A;  1UCL A;  1Q9E A;  1AQZ A;  1I2E A;  2ZA4 A;  1I0V A;  7RNT A;  1BAN A;  1RGE A;  8RNT A;  1BRH A;  1JBR A;  2C4B A;  1RN1 A;  6GSP A;  1BSA A;  1UCJ A;  3AGO A;  2F5W A;  2KF5 A;  2BU4 A;  2KF4 A;  1DE3 A;  1BNE A;  4HAA A;  2F5M A;  1BNJ A; 
#chains in the Genus database with same CATH topology
 1WMO A;  1GSP A;  3DGL A;  5RNT A;  1OHP A;  3TDG A;  1W4N A;  1TUH A;  4G1M B;  4JRF A;  4RNY A;  5G1L A;  3QK9 A;  4ZM8 A;  4STD A;  4HM1 B;  3Q3F A;  1C7H A;  4BU4 A;  3CC4 3;  1WMP A;  4LZI A;  2P0M A;  5AIH A;  3KSP A;  5AYS C;  1FUS A;  2W03 A;  3FLJ A;  4I5Q A;  4J5K A;  2RSX A;  7GSP A;  1FZU A;  3MPH A;  1YJN 3;  1MWU A;  3EBY A;  3A5E A;  2QA4 3;  1PFP A;  3LTB A;  1BNG A;  2RGQ A;  1IK3 A;  4EBG A;  2XRX B;  2XSH B;  3LTA A;  1JB2 A;  2CG0 A;  1IVX A;  3SOA A;  2BMO B;  1IV7 A;  5IG0 A;  1OCV A;  9RNT A;  3D5G A;  1W00 A;  1RDS A;  1VQP 3;  1TFO A;  2QGU A;  4HYZ A;  3ZG0 A;  1VZZ A;  1FGO A;  2AAE A;  2Z77 A;  1UCK A;  3KII A;  1TFK A;  2Z76 A;  4K90 B;  1UW1 A;  1GMQ A;  2LYX A;  4GB5 A;  1T2H A;  2P05 A;  5IF6 A;  4KVH A;  3VGN A;  5CXO A;  1BSE A;  1GS3 A;  2W6J H;  3F14 A;  1UI7 A;  3MWZ A;  1VQ9 3;  1MWT A;  3NUV A;  4KFD A;  1KC8 4;  1NJI 4;  1X1Y A;  1GYB A;  2W56 B;  3KN4 A;  1X1X A;  3CCR 3;  3NBR A;  3CCL 3;  3LZA A;  1US1 A;  4XM4 A;  2AAD A;  3DM8 A;  1GMP A;  1KSI A;  2KF3 A;  1NWW A;  2PNC A;  3B4O A;  3FF2 A;  3KKG A;  3KE7 A;  3NV0 A;  1K73 4;  2KXG A;  1IVU A;  3B7C A;  3EBT A;  3H51 A;  4HM3 B;  1JB5 A;  3ROB A;  2BMQ B;  1HKX A;  1OGX A;  1IV9 A;  3DMC A;  1K28 A;  3FG3 A;  4CCV A;  3KCH A;  3PCR A;  3D5I A;  1S5A A;  1BRI A;  3H3H A;  5LC7 A;  4R80 A;  7STD A;  1O7H B;  2OOV C;  2HML B;  3DGY A;  3HII A;  3PXM A;  1TRQ A;  1ZO2 A;  1RGC A;  4HKV B;  3OXA A;  1BGS A;  5D82 A;  2BHM A;  1OGZ A;  2CFW A;  1SAR A;  1RHL A;  3JUM A;  1RGK A;  4OK0 A;  5G1K A;  1MOL A;  3LH4 A;  1N9J A;  1YGE A;  5IEO A;  3OV4 A;  1U8C B;  2W56 A;  2F56 A;  4TX4 A;  3NXJ A;  4AEQ A;  3K9M C;  1G0T A;  3GZX B;  1B3S A;  3LT8 A;  3CXC 2;  1LNH A;  2F98 A;  4N6N B;  5G2G A;  1BVI A;  3EHC A;  3I0Y A;  3NBJ A;  3K7C A;  3G71 3;  1WMN A;  1Q86 4;  1OHO A;  1R4Y A;  3U97 A;  3D4A A;  1BNF A;  1GY7 A;  1RN4 A;  3DXO A;  4RZM A;  2PZV A;  5BIR A;  4X2O A;  3CCS 3;  4NRE A;  5DRV A;  1VQQ A;  3B8L A;  2CIU A;  1LNI A;  1STD A;  3GAX A;  3G8Z A;  3HOH A;  4CDL A;  1KD1 4;  3G4S 3;  1VQ6 3;  1Q9E A;  1JV2 B;  4U13 A;  2MF7 A;  3K5T A;  4HM8 B;  1BAN A;  1RGE A;  2C10 A;  1JKG B;  1Q7H A;  1EG9 B;  4KT3 B;  3S67 A;  1ULJ B;  3N54 B;  2M7O A;  4L8O A;  2F5W A;  1E3V A;  3BLZ A;  1STF I;  1BNE A;  2J8X B;  3X41 A;  1D6U A;  3NQZ A;  2F5M A;  4HZ9 B;  2XGN A;  4AKZ A;  1BUQ A;  3CMA 3;  4KFE A;  1MWS A;  1D6Y A;  1QAF A;  1RTU A;  2F4Y A;  2WGO A;  3DH2 A;  4XBX A;  1RCK A;  3BB9 A;  4HM0 B;  1YJW 3;  2FGT A;  4PEJ A;  4WHA A;  3OWY A;  1ROV A;  3UL6 A;  5GSP A;  3T0U A;  3IMA B;  1M1X B;  3EC9 A;  2UX0 A;  4EC6 A;  3AMO B;  1YGW A;  4HM5 B;  1Q81 4;  4HOH A;  1Q82 4;  5M1A A;  4BIR A;  1B2Z A;  2XEP A;  3K63 A;  4WFO A;  2QIY A;  2XR8 B;  3HX8 A;  6STD A;  4FMB A;  1R4C A;  1BIR A;  3KFQ C;  3DY5 A;  1SII A;  1RGA A;  1X1U A;  2ML6 A;  1I70 A;  4ORL A;  3CNX A;  1A2P A;  4XDV A;  1JKG A;  5CF2 A;  3IPT A;  2XGL A;  4LSO A;  4MMY B;  5HOH A;  4CPK A;  3F8H A;  1CEW I;  3PYJ A;  1RKY A;  5AEU B;  2KRT A;  4NHF A;  1T3B A;  1ROA A;  1DMM A;  1RCL A;  2L4V A;  1BRN L;  1HYF A;  1WNH A;  4FCM A;  2WOF A;  1Q40 A;  2V1L A;  2FNQ A;  4LEH A;  1DVD A;  2CX1 A;  1DET A;  2W04 A;  4XB5 A;  3WDG B;  2HMJ B;  3G0K A;  2E2T A;  4WP5 A;  2K54 A;  3AMO A;  1YI2 3;  1QAL A;  1W2B 2;  1BSD A;  3LYG A;  1IQY A;  4IT7 A;  1ASK A;  1IT8 A;  2RCD A;  1VQ7 3;  3WHO A;  1B2S A;  2CKF B;  2B1X B;  3SED A;  3GZR A;  1YNV X;  3NQY A;  3MG3 A;  4N6M A;  4FCJ A;  3RNT A;  3HIG A;  1SJW A;  3EE1 A;  3D9R A;  1JZD A;  1O7N B;  5A0O B;  2YFI B;  3I56 3;  1C54 A;  1I2F A;  4N3V A;  1VQK 3;  4CJN A;  5ELU A;  4GL6 A;  1T2I A;  1CYV A;  3CME 3;  4IIA A;  1WTH A;  1PU4 A;  2OTL 3;  4BL2 A;  4LYL B;  5FW5 A;  2GBW B;  3K0Z A;  2R4I A;  2IA7 A;  3PZW A;  1CH0 A;  2CFD A;  6RNT A;  1GOU A;  3RDE A;  2B24 B;  2H0I A;  3FF0 A;  5AII A;  1V74 A;  4DKI A;  1JBT A;  1HZ1 A;  3FG4 A;  4HVN A;  2SBL A;  1D6Z A;  4EYC A;  1LVN A;  2OWP A;  2Q07 A;  2ZDJ A;  1EQK A;  4WYK B;  1JN5 B;  1PYL A;  3OWS A;  1K8A 4;  4X2H A;  5D81 A;  1EKM A;  1OF5 B;  2WOH A;  1IVV A;  2ZL8 A;  4XBT A;  2MC8 A;  1GD3 A;  2XF3 A;  4N6O B;  3BU4 A;  4JF8 A;  1MWR A;  3FCS B;  1UDI I;  3EX9 A;  3WOD G;  3KSE D;  3EB8 A;  1MNL A;  2HOH A;  1V58 A;  2YFL B;  3OW2 2;  4R9L A;  2W2C A;  1DYU A;  1G02 A;  1Y4K A;  2UUG C;  3OX9 A;  1YVB I;  3LXU X;  1I2E A;  2A15 A;  3V99 A;  3X40 A;  4EW5 A;  1QAK A;  2C11 A;  1JRQ A;  1BRH A;  1JBR A;  3S28 A;  3ZFZ A;  2Z6B A;  1BSA A;  3AGO A;  4MMZ B;  2CG1 A;  3SXX A;  4MMX B;  5AEW B;  1FUW A;  1OH0 A;  2LQV A;  4NPB A;  4XDW A;  3ZG5 A;  2RFR A;  2I9W A;  1ULI B;  3CU3 A;  3T8N A;  1BNJ A;  1M90 4;  1J2B A;  2P0X A;  3F7S A;  3AHW A;  4O3V A;  1VQL 3;  3CCU 3;  4IPB A;  1B2X A;  1T5Y A;  4EV2 A;  1WQL B;  1RJO A;  4FCZ A;  1RMS A;  4K61 A;  1B2M A;  2L1S A;  3LOY A;  3G16 A;  3CC7 3;  2F86 B;  1BOX A;  2P09 A;  5IEP A;  3G6E 3;  1N8R 4;  1CYU A;  3NHX A;  2KAA A;  1OF5 A;  3MSO A;  1FGT A;  2W0Q A;  3CNM A;  2RBI A;  2XFT A;  3V98 A;  2E2V A;  1YIJ 3;  2WO0 A;  4K1V A;  3CCQ 3;  3EJV A;  5JPP A;  1PY3 A;  1SPU A;  1GD4 A;  3LTD A;  4HM7 B;  5EEO A;  2ML5 A;  3AHS A;  1BRG A;  1TRP A;  3GWR A;  4H3U A;  1DVC A;  2ZHX B;  2OTJ 3;  3DGN A;  2W9Q A;  1N5P A;  3D3L A;  1LOX A;  3VSY A;  1HU9 A;  1IQX A;  4H61 A;  1LRA A;  2CX0 A;  3UB1 A;  1NU3 A;  1RRH A;  2GU1 A;  2CFK A;  4L7K A;  1UI8 A;  4XBY A;  4EV5 A;  2GSP A;  3CC2 3;  3NV0 B;  1LOY A;  2YFJ B;  4GSP A;  2D42 A;  1BSC A;  1TIJ A;  5KP3 A;  2HMN B;  1RNB A;  5AYR B;  4EXR A;  5AIF A;  1BU4 A;  1BRK A;  3D79 A;  2JQ5 A;  5IW9 A;  3FSD A;  4HJL B;  4J5G A;  4BTW A;  1JNQ A;  3F7X A;  1QMA A;  3BNE A;  3STD A;  5BU4 A;  3BNC A;  2Y74 A;  5I97 A;  1O7G B;  3Q2P A;  2F99 A;  5KP1 A;  1A2V A;  4FMD A;  3DGM A;  4R9K A;  1YHQ 3;  3WA2 X;  4MEI A;  1N8Q A;  1OHS A;  1UGH I;  1B27 A;  4WWU C;  4GHO A;  5DRE A;  3ECF A;  5JPU A;  1ISK A;  2CWT A;  1SIH A;  3CCJ 3;  1VQM 3;  4J9A A;  5IG3 A;  1Q42 A;  2XH9 A;  1LXE A;  3T8U A;  3FGY A;  2R41 A;  1B2U A;  4RBN A;  2HMK B;  3URP A;  3X3Y A;  1FW7 A;  5CF1 A;  5LC6 A;  1DMQ A;  1NB5 I;  4K1U A;  1IDP A;  1O7W B;  3F40 A;  3S27 A;  5ELJ A;  1BNI A;  1RSN A;  2KF6 A;  3ALA A;  2CW9 A;  1W02 A;  4HBR A;  4KFF A;  1ZS7 A;  3FZW A;  3CCM 3;  1GY5 A;  3N9H A;  3UJM A;  4FR9 A;  3U1W A;  2QEX 3;  1B20 A;  3E99 A;  1TU5 A;  1VQ8 3;  5M19 A;  2CC3 A;  1NB3 I;  3A76 A;  3RGA A;  1W6C A;  2XSO B;  3CPO A;  1K41 A;  3PS8 A;  1S72 3;  1TTO A;  4R4K A;  5HGR A;  3EN8 A;  1BNR A;  3GSP A;  4R1K A;  1I3I A;  1RLS A;  1ZX2 A;  1RN7 A;  5D83 A;  1O7M B;  1Q7Y 4;  1JBS A;  1FA3 A;  4FMA A;  1RRL A;  3FG1 A;  3PGB A;  3J7Y d;  5IG4 A;  1VQN 3;  2JDI H;  3PCS A;  2Y73 A;  3GZB A;  1GY6 A;  4N6T A;  1M9G A;  1YIT 3;  3CD6 3;  1IYY A;  2XFS A;  2GEY A;  1AVK A;  1AQZ A;  1TJD A;  2GEX A;  2ZA4 A;  1I0V A;  4N6U A;  4HZB B;  4BTY A;  3NM7 A;  4O8S A;  1RN1 A;  1U5O A;  1UGI A;  1UCJ A;  4HM4 B;  1EEJ A;  1UUG B;  2IMJ A;  3BND A;  3V92 A;  1VQO 3;  2KF5 A;  5BXQ A;  2BU4 A;  2KF4 A;  5FGO A;  1DE3 A;  2CK3 H;  1Z1S A;  3DGO A;  2YX9 A;  2IUJ A;  3OWU A;  3F8X A;  2H0H A;  1A2K A;  1OPY A;  3I55 3;  2K3D A;  2IY2 A;  3SYU A;  5AI1 A;  5M18 A;  2HMO B;  2GU3 A;  3MKI A;  2GBX B;  1FGR A;  1I2G A;  3SVA A;  5CLK A;  1M1K 4;  3GZY B;  2STD A;  1LOV A;  4L8P A;  1GOV A;  1N5H A;  2D1W A;  3AGN A;  4I4K A;  4RNZ A;  1LQG C;  3CCV 3;  3JUN A;  3M8C A;  1BNS A;  3SOY A;  3UNL A;  1IT7 A;  3FKA A;  2BNG A;  3WOE B;  8CHO A;  3EF8 A;  1E97 A;  1RGL A;  1OUN A;  3WA3 A;  1FGQ A;  1QVG 2;  1I8V A;  1FGM A;  2FXT A;  3B4P A;  3JUP A;  1K9M 4;  1W6Y A;  3BNB A;  2CFG A;  1RNT A;  1W5Z A;  2CWU A;  1YJ9 3;  1BUJ A;  1A67 A;  1MGR A;  1KWI A;  1NNV A;  1IU7 A;  2WGQ A;  1B21 A;  1O7P B;  2W9P A;  3HI7 A;  2BT3 A;  3JUQ A;  4O02 B;  3GRD A;  3SLU A;  4BL3 A;  2INX A;  1KQS 2;  2K0M A;  1RGH A;  1UCI A;  3MG2 A;  3F9S A;  1F8N A;  1RGF A;  3FH1 A;  3X3X A;  5IER A;  2BMR B;  1FUT A;  4J8T A;  3X3Z A;  1BAO A;  4BTX A;  3CCE 3;  4RNT A;  1OAC A;  3JVC A;  1L5G B;  1QJG A;  2SAR A;  1GMR A;  5EQL A;  1QVF 2;  1EA2 A;  1JZO A;  1RGG A;  3EN1 B;  3LML A;  1YVS A;  2IUK A;  4O2H A;  3LTC A;  3QRD A;  1X1W A;  4AKY A;  3VF1 A;  3ER7 A;  4LGQ A;  1W01 A;  4OUQ A;  1IVW A;  1I0X A;  1IQ8 A;  5AIG A;  4HM2 B;  3HZP A;  1Q40 B;  1NO3 A;  3NBB A;  2P38 A;  2GXF A;  4LMI A;  1W6G A;  1W2Z A;  5KP4 A;  4ILF A;  3WOF B;  3N8B A;  2KCD A;  2IYJ A;  1ZGX A;  1AVL A;  5EVH A;  1UUV B;  5STD A;  3RGR A;  4QWT A;  1UUW B;  3X42 A;  1W7C A;  4N6V 0;  2Z7A A;  5IEN A;  3CPW 2;  4WYK A;  1BRJ A;  1V57 A;  4FMC A;  1GOY A;  3EQQ B;  1AY7 A;  3WR2 A;  1A90 A;  3S29 A;  2OCT A;  2BIR A;  1MGW A;  1EUI C;  4Q53 A;  3L0R A;  2RNT A;  3WMD A;  1BRS A;  2UGI A;  4KZ1 A;  3NM2 A;  1JB4 A;  1SQW A;  1CQS A;  1I3F A;  2CHC A;  2CH9 A;  5BVB A;  5JBS A;  5CK6 A;  2H0G A;  3O8Y A;  3BIR A;  4N6L A;  2HMM B;  3SX1 A;  3HK4 A;  1AV4 A;  2E2U A;  1TP6 A;  1LQM B;  2BO9 B;  4OVM A;  3IJE B;  2CWV A;  2OQE C;  1LOW A;  2O3O A;  3MG1 A;  4MJD A;  1BSB A;  1N9E A;  1JJ2 2;  4HM6 B;  1G96 A;  1FYS A;  5TGN A;  1UCL A;  3KZT A;  5IG5 A;  2O9U X;  3MHE A;  1JN5 A;  1E3R A;  2OQE A;  1AR0 A;  7RNT A;  8RNT A;  3UL5 A;  1VQ5 3;  1NDO B;  2C4B A;  3LT9 A;  3Q1C A;  1DMN A;  3NX0 A;  2OOV A;  3S5C A;  6GSP A;  3JUO A;  2CFL A;  1VQ4 3;  4HAA A;  3MYT A;  3DZL A;  3DUK A;  3Q90 A; 
#chains in the Genus database with same CATH homology
 1GSP A;  3AHW A;  5RNT A;  1RTU A;  3SYU A;  1B2X A;  2F4Y A;  3DH2 A;  1RMS A;  1RCK A;  1B2M A;  1I2G A;  3Q3F A;  1LOV A;  5GSP A;  1GOV A;  1BOX A;  3AGN A;  4BU4 A;  2KAA A;  1BNS A;  1FUS A;  1YGW A;  4J5K A;  4HOH A;  7GSP A;  1FZU A;  4BIR A;  1B2Z A;  2RBI A;  1RGL A;  1I8V A;  3A5E A;  1BIR A;  1PY3 A;  1BNG A;  3AHS A;  1BRG A;  1RGA A;  1RNT A;  1TRP A;  1X1U A;  1I70 A;  1BUJ A;  1A2P A;  1MGR A;  1B21 A;  9RNT A;  3D5G A;  1RDS A;  1LRA A;  1RGH A;  1UCI A;  2AAE A;  1UCK A;  1RGF A;  1FUT A;  2GSP A;  1GMQ A;  1BAO A;  1RCL A;  1T2H A;  1BRN L;  4RNT A;  1HYF A;  1LOY A;  1BSE A;  2SAR A;  4GSP A;  1BSC A;  1RNB A;  1GMR A;  1DET A;  1BU4 A;  1BRK A;  1X1Y A;  1RGG A;  1X1X A;  4J5G A;  1YVS A;  2AAD A;  1X1W A;  1GMP A;  5BU4 A;  2KF3 A;  1BSD A;  1I0X A;  3WHO A;  1B2S A;  1B27 A;  1YNV X;  3RNT A;  4GHO A;  1C54 A;  3KCH A;  1I2F A;  1B2U A;  3D5I A;  3URP A;  1FW7 A;  1BRI A;  1ZGX A;  1T2I A;  3DGY A;  1TRQ A;  1RGC A;  1BRJ A;  1BGS A;  1GOY A;  1BNI A;  1AY7 A;  1RSN A;  1RHL A;  1SAR A;  2KF6 A;  1RGK A;  3WR2 A;  1CH0 A;  2BIR A;  6RNT A;  1MGW A;  2RNT A;  1GOU A;  1BRS A;  1JBT A;  1B20 A;  1HZ1 A;  1I3F A;  2F56 A;  3BIR A;  1B3S A;  1PYL A;  1BVI A;  1TTO A;  1BNR A;  3GSP A;  1I3I A;  1RLS A;  1R4Y A;  5HOH A;  3D4A A;  1BNF A;  1RN4 A;  3BU4 A;  5BIR A;  1LOW A;  1JBS A;  1BSB A;  1LNI A;  2HOH A;  3HOH A;  1FYS A;  1IYY A;  1G02 A;  1UCL A;  1Q9E A;  1AQZ A;  1I2E A;  2ZA4 A;  1I0V A;  7RNT A;  1BAN A;  1RGE A;  8RNT A;  1BRH A;  1JBR A;  2C4B A;  1RN1 A;  6GSP A;  1BSA A;  1UCJ A;  3AGO A;  2F5W A;  2KF5 A;  2BU4 A;  2KF4 A;  1DE3 A;  1BNE A;  4HAA A;  2F5M A;  1BNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...