1JBTA

Crystal structure of ribotoxin restrictocin complexed with a 29-mer sarcin/ricin domain rna analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29-MER SARCIN/RICIN DOMAIN RNA ANALOG
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbtA00
1LOVA 4GHOA 1BANA 1BSBA 1BSDA 3HOHA 1RCKA 3D5IA 7GSPA 1X1WA 1FW7A 1DETA 1BRJA 1LRAA 1YGWA 1Q9EA 1BNJA 3AHSA 1RGGA 1HZ1A 1RN1A 2HOHA 1AY7A 1BRKA 1BIRA 1BRIA 1GOVA 1X1UA 1GOUA 2KF5A 1I2GA 9RNTA 1BRNL 5BIRA 2RNTA 1UCLA 3AGNA 1BNFA 5BU4A 1RLSA 2ZA4A 1I0XA 3D5GA 1BRHA 1BSAA 2KF6A 4BIRA 2BIRA 2KF4A 2KF3A 1R4YA 1B21A 1I3FA 4J5KA 4HOHA 3DGYA 1BNSA 1X1YA 1A2PA 1YVSA 1BNGA 1FYSA 1MGRA 1JBRA 5HOHA 1GMQA 1JBTA 1TTOA 2BU4A 1FUSA 8RNTA 3WHOA 1RDSA 1GMRA 1AQZA 1RGHA 3AGOA 1RNBA 1RGKA 1YNVX 1LOWA 1T2HA 2AAEA 5RNTA 1BNEA 1B3SA 1BSCA 3DH2A 1LNIA 1BSEA 1RGAA 3WR2A 1GMPA 1C54A 1PYLA 1FZUA 1JBSA 2F5WA 4J5GA 1RCLA 1BRGA 1RHLA 1RTUA 1TRQA 1BUJA 2GSPA 1B2XA 1RGCA 1TRPA 2SARA 3BIRA 4GSPA 1GOYA 1GSPA 1HYFA 1LOYA 1BRSA 1RGLA 1SARA 1RGFA 1RNTA 2C4BA 2F56A 1I2EA 1B27A 1BGSA 3KCHA 3BU4A 6RNTA 1UCKA 1G02A 2F5MA 4BU4A 1BVIA 1BNIA 1BU4A 1FUTA 4HAAA 1RGEA 1IYYA 2F4YA 2AADA 1I3IA 1I70A 1RSNA 1B2MA 1BAOA 1I2FA 1T2IA 2KAAA 1B2SA 4RNTA 1RMSA 1BOXA 6GSPA 1UCIA 1I8VA 1UCJA 3D4AA 1BNRA 3A5EA 7RNTA 1CH0A 1B2ZA 1I0VA 1RN4A 3GSPA 1ZGXA 1X1XA 1DE3A 2RBIA 1B20A 3URPA 5GSPA 3AHWA 1MGWA 3SYUA 1PY3A 3Q3FA 3RNTA 1B2UA
chains in the Genus database with same CATH superfamily
1V57A 1BANA 1KWIA 2W04A 1YIJ3 1EG9B 1IQXA 1ISKA 3HOHA 1IQ8A 1X1WA 4K90B 3S5CA 1FW7A 1QMAA 1WMNA 1YVBI 3NV0B 2W03A 3ALAA 3B4PA 3EN1B 3LMLA 2W6JH 1IU7A 1TFOA 3Q1CA 4BTXA 2LQVA 1BIRA 1GOVA 1X1UA 1ZS7A 1GOUA 2KF5A 3MHEA 1VQP3 3MG1A 5I97A 1O7GB 4AKZA 3J7Yd 1I2GA 2W2CA 1VQN3 2OQEC 1BRNL 1WNHA 3CU3A 1IVVA 2UUGC 3FG4A 2GBWB 1AVLA 3ER7A 3AGNA 4MMYB 1NU3A 1RLSA 1VQM3 2CFGA 2KF6A 3GZRA 1V58A 2KF4A 2KF3A 3EB8A 3NQYA 3X3YA 3CPW2 1OUNA 1U8CB 1I3FA 4BL3A 1DMQA 1RJOA 2BMQB 2CHCA 4J5KA 1IVXA 1G0TA 3ZG0A 1RKYA 3FZWA 1YVSA 1W6GA 3M8CA 3NV0A 4JRFA 1FYSA 3F8XA 3PS8A 3UL5A 3PZWA 2GEYA 3G16A 4FMBA 1EQKA 1JBTA 2BU4A 1LNHA 3EN8A 4O2HA 5G1LA 4EXRA 2C10A 2FGTA 1FA3A 3K5TA 3G8ZA 2CFWA 4U13A 3PYJA 3LZAA 1ASKA 1JN5A 5BXQA 1RRLA 1AQZA 4KFDA 3I563 1T3BA 1US1A 4FMCA 6STDA 3I0YA 2W56A 3S27A 5CXOA 5D81A 1RNBA 3CCM3 4XB5A 4LEHA 1T2HA 1BUQA 3GZBA 5RNTA 1NO3A 3DY5A 3GZYB 4STDA 4CJNA 1Q824 4XM4A 1DYUA 3T8UA 2O9UX 2QA43 1O7WB 1LNIA 2KCDA 3WR2A 1SPUA 1GMPA 1E97A 1DMMA 2KXGA 3MG2A 1Q40B 1FZUA 1VQQA 3CC43 1IV7A 1NNVA 1K8A4 4J5GA 1JBSA 4EV5A 4HM7B 4QWTA 1BUJA 4TX4A 1B2XA 4EBGA 2RCDA 3CD63 3L0RA 3SOAA 2W0QA 2UGIA 2HMMB 4NPBA 1HYFA 1W7CA 2R41A 4CCVA 2XGNA 2INXA 5AIHA 4J9AA 4O3VA 3SOYA 1VZZA 2F56A 2XFTA 3EC9A 1BGSA 2CW9A 3HIGA 3BU4A 3LTCA 4Q53A 1SQWA 5AEWB 1JJ22 4CPKA 3NM7A 3DXOA 3K0ZA 1QJGA 3KKGA 1BNIA 1FUTA 1O7PB 3CMA3 4HAAA 2XR8B 1IYYA 4N6MA 5ELJA 3B8LA 2AADA 2L4VA 5D83A 1I70A 4HKVB 2BMOB 1RSNA 1BAOA 3HZPA 3NBBA 2CFKA 1RMSA 5IERA 2IY2A 4WWUC 4J8TA 3AMOB 3QK9A 5M19A 1EUIC 1UGHI 3FG1A 1W6CA 1WQLB 1JNQA 1R4CA 1TIJA 3QRDA 1KQS2 1GY6A 2QEX3 3FG3A 3E99A 1LOVA 1OGZA 2HMJB 4GHOA 5FGOA 1S723 3B7CA 1VQK3 3OXAA 2E2UA 3RDEA 5ELUA 2XSHB 3UB1A 4N6UA 2CFDA 4XBTA 5JBSA 1LRAA 1YGWA 1JKGA 5EEOA 3KZTA 3OWYA 4LGQA 1SIHA 2K54A 1N8QA 4DKIA 1AY7A 1BRIA 1N5HA 4FCJA 5DREA 4KVHA 1T5YA 1LOXA 2CG0A 3BNDA 5IG3A 2H0GA 9RNTA 1CQSA 1W5ZA 2CWTA 4N6NB 3SX1A 1YIT3 3SVAA 1UCLA 4BL2A 1Q7Y4 4HBRA 4IIAA 4WYKB 3AMOA 3KFQC 1OHPA 2ZA4A 2F99A 3S28A 3WMDA 1KC84 1OH0A 3LXUX 1F8NA 1MWTA 3EX9A 1ROAA 3UL6A 2BIRA 2RSXA 3FH1A 4EV2A 4LYLB 1TU5A 3NBRA 3N9HA 4WFOA 3X3ZA 1KSIA 2A15A 1STFI 1DVDA 1BNSA 2HMKB 2H0HA 5G1KA 1A2PA 1ROVA 5AIFA 2P05A 4WP5A 1GD3A 3MYTA 3ZG5A 1AR0A 1DMNA 3JUQA 4NREA 5KP3A 3KIIA 3DGLA 5HOHA 1GMQA 3TDGA 3CCJ3 1QALA 1TTOA 3F7SA 3WHOA 5G2GA 2CH9A 3ECFA 1NB5I 4MJDA 1JV2B 4HJLB 2CWVA 1HU9A 1GMRA 4EC6A 3OWSA 3FF2A 3VSYA 4FCMA 4WYKA 3SLUA 1A67A 1RGHA 3KE7A 2KRTA 3D3LA 1S5AA 1RGKA 2CX0A 3H3HA 4L7KA 1M9GA 3X42A 1M904 1KD14 3N8BA 4I4KA 3H51A 1O7MB 3X40A 2QGUA 1UUWB 1C54A 3PCSA 1NB3I 2JDIH 3WA2X 2BO9B 5TGNA 3F7XA 1TRQA 3NHXA 1N5PA 3PCRA 3MWZA 2GSPA 2CC3A 3OX9A 4MEIA 2ZL8A 4N6OB 4RZMA 4EW5A 5IG4A 5IW9A 3BIRA 2HMOB 1GSPA 3EQQB 1SARA 1W4NA 2GU3A 5IEPA 1NDOB 2B1XB 2YFLB 2C4BA 2GBXB 1I2EA 1B27A 2ML6A 1W2B2 2WGOA 3CCL3 5AYRB 6RNTA 1UGIA 3K7CA 3EE1A 3CXC2 5AYSC 2PZVA 4FMDA 1BVIA 2ZDJA 5AIGA 2IA7A 1VQL3 1WTHA 2XSOB 1K734 2V1LA 1MWRA 2F4YA 3Q2PA 3IJEB 3FF0A 2CIUA 3LH4A 5EQLA 3RGAA 3D9RA 4XDWA 1T2IA 1I2FA 3CC23 4RNTA 2B24B 1N9EA 5FW5A 1YHQ3 2OTJ3 1UCIA 1UCJA 2P38A 2Y73A 2STDA 3EF8A 3V99A 7RNTA 1GY5A 2E2TA 1B2ZA 1I0VA 1C7HA 1X1XA 4ILFA 3LTDA 2RBIA 1B20A 3JUOA 2IUKA 2HMNB 2O3OA 5GSPA 4H61A 3SYUA 1PY3A 1D6YA 3Q3FA 5CF2A 2UX0A 1UI8A 4LZIA 3MKIA 5M18A 1BSDA 3D5IA 1W00A 7GSPA 3N54B 1DETA 3BNEA 1BRJA 2HMLB 1WMOA 4R80A 4AEQA 1BNJA 1IVUA 3GWRA 4HM6B 1NWWA 1FGTA 1RGGA 4R9KA 1E3VA 1HZ1A 2D42A 2MF7A 1RRHA 5M1AA 2H0IA 2GXFA 1BRKA 1OHSA 3FKAA 1LVNA 4JF8A 4R4KA 2WOHA 2Z6BA 3FCSB 1Q40A 5IG0A 3U97A 3LTBA 3G4S3 2P09A 8CHOA 3WOFB 2RNTA 5AEUB 1WMPA 1IV9A 2XRXB 1Q42A 5EVHA 1Q864 1YJW3 4LMIA 1W01A 1I0XA 1EA2A 1BRHA 2CG1A 2I9WA 4RBNA 2P0XA 3JVCA 1NJI4 1ZX2A 1OF5B 3K9MC 5IF6A 4CDLA 1YJN3 1MWSA 3KSPA 1E3RA 5AIIA 3OV4A 1ULJB 1JB5A 3LT8A 3DGYA 4HOHA 3CME3 1X1YA 4N6V0 1LQGC 1VQ73 2CKFB 1BNGA 2OOVA 1MGRA 3DZLA 1A90A 2L1SA 3MG3A 5IENA 2BNGA 1LXEA 2K0MA 4MMXB 2RFRA 2C11A 8RNTA 1FUSA 2CWUA 3NUVA 3EBYA 1ZO2A 2JQ5A 1OHOA 1SJWA 4G1MB 3JUPA 1OCVA 2GU1A 4N6LA 1FGOA 1JB4A 1EKMA 4L8OA 2BMRB 2Q07A 3BNCA 3AGOA 2CX1A 1K9M4 3GAXA 2XH9A 1YNVX 2AAEA 3FLJA 4KT3B 2R4IA 4XDVA 3ZFZA 4FCZA 2IMJA 4IT7A 1B3SA 1OF5A 1BSCA 1PFPA 3UNLA 4KFEA 1BSEA 2M7OA 4XBXA 5JPPA 2QIYA 3HK4A 1FUWA 1G96A 2F86B 3X41A 1UUVB 4X2OA 4X2HA 3SEDA 1W6YA 2F5WA 3VGNA 3NQZA 1K41A 1BRGA 3FGYA 4HYZA 1QAKA 1JRQA 3DM8A 4OUQA 4N6TA 2MC8A 5STDA 3U1WA 1RGCA 2IYJA 2SARA 2Y74A 3V92A 2FXTA 1BRSA 1RGLA 1O7HB 1RGFA 1STDA 1FGRA 4GL6A 4K1VA 5A0OB 1OACA 4HM3B 3CCR3 3PXMA 1VQ93 1IK3A 3B4OA 4N3VA 1W02A 3DGNA 1GS3A 1UCKA 1MOLA 1YI23 2CFLA 3IMAB 3S67A 4GB5A 3V98A 4BU4A 3DGMA 2SBLA 1LQMB 1TJDA 1BU4A 2E2VA 1QAFA 4LSOA 5CF1A 1AVKA 2XGLA 1UI7A 1CEWI 2P0MA 1L5GB 5HGRA 1I3IA 3FSDA 4ORLA 1IVWA 1B2SA 2LYXA 4MMZB 1BOXA 1JN5B 6GSPA 1I8VA 3D4AA 2FNQA 4FMAA 3NX0A 5D82A 1CYUA 3WDGB 5IG5A 3CCV3 2W56B 3F8HA 1N9JA 1TFKA 3BLZA 4HM0B 3URPA 1MGWA 1GY7A 2OQEA 1K28A 3RNTA 1B2UA 1M1K4 1UUGB 4XBYA 3CCE3 1BSBA 1JB2A 2Z76A 3ROBA 3CPOA 1RCKA 3X3XA 3CCU3 3WODG 2YX9A 3CCQ3 3DMCA 2XFSA 4HZBB 1Q9EA 3AHSA 3VF1A 1A2KA 4RNZA 1RN1A 2HOHA 4FR9A 5LC7A 1MWUA 4IPBA 3EJVA 2XF3A 1J2BA 3PGBA 1FGMA 4OVMA 1UDII 1D6UA 5BIRA 1VQ83 3KSED 1GYBA 3D79A 1BNFA 1IT8A 2WGQA 5BU4A 3D5GA 4K1UA 1BSAA 1GD4A 1QVF2 1YGEA 2Z77A 5DRVA 4BIRA 1UW1A 1M1XB 2D1WA 1R4YA 1W2ZA 3A76A 2ZHXB 4HM1B 1B21A 4EYCA 4WHAA 5CK6A 2GEXA 1TP6A 3RGRA 5LC6A 4BTWA 3LT9A 1QVG2 4NHFA 1A2VA 3EHCA 3G713 1O7NB 4ZM8A 2PNCA 3S29A 1ULIB 3CCS3 1JBRA 3CNXA 1V74A 2OWPA 1VQ43 2WOFA 1RDSA 2YFJB 4HM5B 3JUNA 4R9LA 1Y4KA 2Z7AA 3WA3A 1AV4A 4H3UA 1YJ93 2W9PA 2W9QA 4HVNA 3SXXA 1U5OA 1TUHA 1MNLA 3F9SA 3G6E3 3O8YA 2XEPA 1SIIA 2RGQA 1LOWA 2OOVC 4O02B 1JKGB 3Q90A 3CNMA 1BNEA 3DH2A 4HM4B 1D6ZA 1HKXA 4KZ1A 3T0UA 1RGAA 3G0KA 4HM8B 3LTAA 2J8XB 1PYLA 2YFIB 4R1KA 5KP1A 3HIIA 1RCLA 1RHLA 1VQ53 3WOEB 1RTUA 5AI1A 3CC73 1CYVA 2BHMA 3DGOA 1OGXA 3MSOA 1Q814 2OTL3 5CLKA 4HM2B 2OCTA 4HZ9B 2F98A 3DUKA 3STDA 1TRPA 3T8NA 1PU4A 1N8R4 2K3DA 3IPTA 4GSPA 4AKYA 1GOYA 3NM2A 1LOYA 3JUMA 7STDA 1JZDA 1RNTA 5BVBA 2ML5A 4KFFA 4PEJA 4I5QA 1IDPA 3KCHA 4RNYA 3NXJA 3K63A 5JPUA 3EBTA 1G02A 1Q7HA 2F5MA 3LOYA 3LYGA 3NBJA 1FGQA 3HX8A 1RGEA 3GRDA 4L8PA 3F14A 2CK3H 3BB9A 1OPYA 4OK0A 1Z1SA 3KN4A 3UJMA 1B2MA 1VQO3 2KAAA 3F40A 3GZXB 5KP4A 2IUJA 3I553 1VQ63 1BNRA 2BT3A 5IEOA 3A5EA 1IT7A 1CH0A 1DVCA 1RN4A 1RN7A 3GSPA 1ZGXA 3OW22 1JZOA 3MPHA 1DE3A 2WO0A 3OWUA 3AHWA 1IQYA 3BNBA 3HI7A 4K61A 4BTYA 1EEJA 4O8SA
chains in the Genus database with same CATH topology
1LOVA 4GHOA 1BANA 1BSBA 1BSDA 3HOHA 1RCKA 3D5IA 7GSPA 1X1WA 1FW7A 1DETA 1BRJA 1LRAA 1YGWA 1Q9EA 1BNJA 3AHSA 1RGGA 1HZ1A 1RN1A 2HOHA 1AY7A 1BRKA 1BIRA 1BRIA 1GOVA 1X1UA 1GOUA 2KF5A 1I2GA 9RNTA 1BRNL 5BIRA 2RNTA 1UCLA 3AGNA 1BNFA 5BU4A 1RLSA 2ZA4A 1I0XA 3D5GA 1BRHA 1BSAA 2KF6A 4BIRA 2BIRA 2KF4A 2KF3A 1R4YA 1B21A 1I3FA 4J5KA 4HOHA 3DGYA 1BNSA 1X1YA 1A2PA 1YVSA 1BNGA 1FYSA 1MGRA 1JBRA 5HOHA 1GMQA 1JBTA 1TTOA 2BU4A 1FUSA 8RNTA 3WHOA 1RDSA 1GMRA 1AQZA 1RGHA 3AGOA 1RNBA 1RGKA 1YNVX 1LOWA 1T2HA 2AAEA 5RNTA 1BNEA 1B3SA 1BSCA 3DH2A 1LNIA 1BSEA 1RGAA 3WR2A 1GMPA 1C54A 1PYLA 1FZUA 1JBSA 2F5WA 4J5GA 1RCLA 1BRGA 1RHLA 1RTUA 1TRQA 1BUJA 2GSPA 1B2XA 1RGCA 1TRPA 2SARA 3BIRA 4GSPA 1GOYA 1GSPA 1HYFA 1LOYA 1BRSA 1RGLA 1SARA 1RGFA 1RNTA 2C4BA 2F56A 1I2EA 1B27A 1BGSA 3KCHA 3BU4A 6RNTA 1UCKA 1G02A 2F5MA 4BU4A 1BVIA 1BNIA 1BU4A 1FUTA 4HAAA 1RGEA 1IYYA 2F4YA 2AADA 1I3IA 1I70A 1RSNA 1B2MA 1BAOA 1I2FA 1T2IA 2KAAA 1B2SA 4RNTA 1RMSA 1BOXA 6GSPA 1UCIA 1I8VA 1UCJA 3D4AA 1BNRA 3A5EA 7RNTA 1CH0A 1B2ZA 1I0VA 1RN4A 3GSPA 1ZGXA 1X1XA 1DE3A 2RBIA 1B20A 3URPA 5GSPA 3AHWA 1MGWA 3SYUA 1PY3A 3Q3FA 3RNTA 1B2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOV A;  4GHO A;  1BAN A;  1BSB A;  1BSD A;  3HOH A;  1RCK A;  3D5I A;  7GSP A;  1X1W A;  1FW7 A;  1DET A;  1BRJ A;  1LRA A;  1YGW A;  1Q9E A;  1BNJ A;  3AHS A;  1RGG A;  1HZ1 A;  1RN1 A;  2HOH A;  1AY7 A;  1BRK A;  1BIR A;  1BRI A;  1GOV A;  1X1U A;  1GOU A;  2KF5 A;  1I2G A;  9RNT A;  1BRN L;  5BIR A;  2RNT A;  1UCL A;  3AGN A;  1BNF A;  5BU4 A;  1RLS A;  2ZA4 A;  1I0X A;  3D5G A;  1BRH A;  1BSA A;  2KF6 A;  4BIR A;  2BIR A;  2KF4 A;  2KF3 A;  1R4Y A;  1B21 A;  1I3F A;  4J5K A;  4HOH A;  3DGY A;  1BNS A;  1X1Y A;  1A2P A;  1YVS A;  1BNG A;  1FYS A;  1MGR A;  1JBR A;  5HOH A;  1GMQ A;  1JBT A;  1TTO A;  2BU4 A;  1FUS A;  8RNT A;  3WHO A;  1RDS A;  1GMR A;  1AQZ A;  1RGH A;  3AGO A;  1RNB A;  1RGK A;  1YNV X;  1LOW A;  1T2H A;  2AAE A;  5RNT A;  1BNE A;  1B3S A;  1BSC A;  3DH2 A;  1LNI A;  1BSE A;  1RGA A;  3WR2 A;  1GMP A;  1C54 A;  1PYL A;  1FZU A;  1JBS A;  2F5W A;  4J5G A;  1RCL A;  1BRG A;  1RHL A;  1RTU A;  1TRQ A;  1BUJ A;  2GSP A;  1B2X A;  1RGC A;  1TRP A;  2SAR A;  3BIR A;  4GSP A;  1GOY A;  1GSP A;  1HYF A;  1LOY A;  1BRS A;  1RGL A;  1SAR A;  1RGF A;  1RNT A;  2C4B A;  2F56 A;  1I2E A;  1B27 A;  1BGS A;  3KCH A;  3BU4 A;  6RNT A;  1UCK A;  1G02 A;  2F5M A;  4BU4 A;  1BVI A;  1BNI A;  1BU4 A;  1FUT A;  4HAA A;  1RGE A;  1IYY A;  2F4Y A;  2AAD A;  1I3I A;  1I70 A;  1RSN A;  1B2M A;  1BAO A;  1I2F A;  1T2I A;  2KAA A;  1B2S A;  4RNT A;  1RMS A;  1BOX A;  6GSP A;  1UCI A;  1I8V A;  1UCJ A;  3D4A A;  1BNR A;  3A5E A;  7RNT A;  1CH0 A;  1B2Z A;  1I0V A;  1RN4 A;  3GSP A;  1ZGX A;  1X1X A;  1DE3 A;  2RBI A;  1B20 A;  3URP A;  5GSP A;  3AHW A;  1MGW A;  3SYU A;  1PY3 A;  3Q3F A;  3RNT A;  1B2U A; 
#chains in the Genus database with same CATH topology
 1V57 A;  1BAN A;  1KWI A;  2W04 A;  1YIJ 3;  1EG9 B;  1IQX A;  1ISK A;  3HOH A;  1IQ8 A;  1X1W A;  4K90 B;  3S5C A;  1FW7 A;  1QMA A;  1WMN A;  1YVB I;  3NV0 B;  2W03 A;  3ALA A;  3B4P A;  3EN1 B;  3LML A;  2W6J H;  1IU7 A;  1TFO A;  3Q1C A;  4BTX A;  2LQV A;  1BIR A;  1GOV A;  1X1U A;  1ZS7 A;  1GOU A;  2KF5 A;  3MHE A;  1VQP 3;  3MG1 A;  5I97 A;  1O7G B;  4AKZ A;  3J7Y d;  1I2G A;  2W2C A;  1VQN 3;  2OQE C;  1BRN L;  1WNH A;  3CU3 A;  1IVV A;  2UUG C;  3FG4 A;  2GBW B;  1AVL A;  3ER7 A;  3AGN A;  4MMY B;  1NU3 A;  1RLS A;  1VQM 3;  2CFG A;  2KF6 A;  3GZR A;  1V58 A;  2KF4 A;  2KF3 A;  3EB8 A;  3NQY A;  3X3Y A;  3CPW 2;  1OUN A;  1U8C B;  1I3F A;  4BL3 A;  1DMQ A;  1RJO A;  2BMQ B;  2CHC A;  4J5K A;  1IVX A;  1G0T A;  3ZG0 A;  1RKY A;  3FZW A;  1YVS A;  1W6G A;  3M8C A;  3NV0 A;  4JRF A;  1FYS A;  3F8X A;  3PS8 A;  3UL5 A;  3PZW A;  2GEY A;  3G16 A;  4FMB A;  1EQK A;  1JBT A;  2BU4 A;  1LNH A;  3EN8 A;  4O2H A;  5G1L A;  4EXR A;  2C10 A;  2FGT A;  1FA3 A;  3K5T A;  3G8Z A;  2CFW A;  4U13 A;  3PYJ A;  3LZA A;  1ASK A;  1JN5 A;  5BXQ A;  1RRL A;  1AQZ A;  4KFD A;  3I56 3;  1T3B A;  1US1 A;  4FMC A;  6STD A;  3I0Y A;  2W56 A;  3S27 A;  5CXO A;  5D81 A;  1RNB A;  3CCM 3;  4XB5 A;  4LEH A;  1T2H A;  1BUQ A;  3GZB A;  5RNT A;  1NO3 A;  3DY5 A;  3GZY B;  4STD A;  4CJN A;  1Q82 4;  4XM4 A;  1DYU A;  3T8U A;  2O9U X;  2QA4 3;  1O7W B;  1LNI A;  2KCD A;  3WR2 A;  1SPU A;  1GMP A;  1E97 A;  1DMM A;  2KXG A;  3MG2 A;  1Q40 B;  1FZU A;  1VQQ A;  3CC4 3;  1IV7 A;  1NNV A;  1K8A 4;  4J5G A;  1JBS A;  4EV5 A;  4HM7 B;  4QWT A;  1BUJ A;  4TX4 A;  1B2X A;  4EBG A;  2RCD A;  3CD6 3;  3L0R A;  3SOA A;  2W0Q A;  2UGI A;  2HMM B;  4NPB A;  1HYF A;  1W7C A;  2R41 A;  4CCV A;  2XGN A;  2INX A;  5AIH A;  4J9A A;  4O3V A;  3SOY A;  1VZZ A;  2F56 A;  2XFT A;  3EC9 A;  1BGS A;  2CW9 A;  3HIG A;  3BU4 A;  3LTC A;  4Q53 A;  1SQW A;  5AEW B;  1JJ2 2;  4CPK A;  3NM7 A;  3DXO A;  3K0Z A;  1QJG A;  3KKG A;  1BNI A;  1FUT A;  1O7P B;  3CMA 3;  4HAA A;  2XR8 B;  1IYY A;  4N6M A;  5ELJ A;  3B8L A;  2AAD A;  2L4V A;  5D83 A;  1I70 A;  4HKV B;  2BMO B;  1RSN A;  1BAO A;  3HZP A;  3NBB A;  2CFK A;  1RMS A;  5IER A;  2IY2 A;  4WWU C;  4J8T A;  3AMO B;  3QK9 A;  5M19 A;  1EUI C;  1UGH I;  3FG1 A;  1W6C A;  1WQL B;  1JNQ A;  1R4C A;  1TIJ A;  3QRD A;  1KQS 2;  1GY6 A;  2QEX 3;  3FG3 A;  3E99 A;  1LOV A;  1OGZ A;  2HMJ B;  4GHO A;  5FGO A;  1S72 3;  3B7C A;  1VQK 3;  3OXA A;  2E2U A;  3RDE A;  5ELU A;  2XSH B;  3UB1 A;  4N6U A;  2CFD A;  4XBT A;  5JBS A;  1LRA A;  1YGW A;  1JKG A;  5EEO A;  3KZT A;  3OWY A;  4LGQ A;  1SIH A;  2K54 A;  1N8Q A;  4DKI A;  1AY7 A;  1BRI A;  1N5H A;  4FCJ A;  5DRE A;  4KVH A;  1T5Y A;  1LOX A;  2CG0 A;  3BND A;  5IG3 A;  2H0G A;  9RNT A;  1CQS A;  1W5Z A;  2CWT A;  4N6N B;  3SX1 A;  1YIT 3;  3SVA A;  1UCL A;  4BL2 A;  1Q7Y 4;  4HBR A;  4IIA A;  4WYK B;  3AMO A;  3KFQ C;  1OHP A;  2ZA4 A;  2F99 A;  3S28 A;  3WMD A;  1KC8 4;  1OH0 A;  3LXU X;  1F8N A;  1MWT A;  3EX9 A;  1ROA A;  3UL6 A;  2BIR A;  2RSX A;  3FH1 A;  4EV2 A;  4LYL B;  1TU5 A;  3NBR A;  3N9H A;  4WFO A;  3X3Z A;  1KSI A;  2A15 A;  1STF I;  1DVD A;  1BNS A;  2HMK B;  2H0H A;  5G1K A;  1A2P A;  1ROV A;  5AIF A;  2P05 A;  4WP5 A;  1GD3 A;  3MYT A;  3ZG5 A;  1AR0 A;  1DMN A;  3JUQ A;  4NRE A;  5KP3 A;  3KII A;  3DGL A;  5HOH A;  1GMQ A;  3TDG A;  3CCJ 3;  1QAL A;  1TTO A;  3F7S A;  3WHO A;  5G2G A;  2CH9 A;  3ECF A;  1NB5 I;  4MJD A;  1JV2 B;  4HJL B;  2CWV A;  1HU9 A;  1GMR A;  4EC6 A;  3OWS A;  3FF2 A;  3VSY A;  4FCM A;  4WYK A;  3SLU A;  1A67 A;  1RGH A;  3KE7 A;  2KRT A;  3D3L A;  1S5A A;  1RGK A;  2CX0 A;  3H3H A;  4L7K A;  1M9G A;  3X42 A;  1M90 4;  1KD1 4;  3N8B A;  4I4K A;  3H51 A;  1O7M B;  3X40 A;  2QGU A;  1UUW B;  1C54 A;  3PCS A;  1NB3 I;  2JDI H;  3WA2 X;  2BO9 B;  5TGN A;  3F7X A;  1TRQ A;  3NHX A;  1N5P A;  3PCR A;  3MWZ A;  2GSP A;  2CC3 A;  3OX9 A;  4MEI A;  2ZL8 A;  4N6O B;  4RZM A;  4EW5 A;  5IG4 A;  5IW9 A;  3BIR A;  2HMO B;  1GSP A;  3EQQ B;  1SAR A;  1W4N A;  2GU3 A;  5IEP A;  1NDO B;  2B1X B;  2YFL B;  2C4B A;  2GBX B;  1I2E A;  1B27 A;  2ML6 A;  1W2B 2;  2WGO A;  3CCL 3;  5AYR B;  6RNT A;  1UGI A;  3K7C A;  3EE1 A;  3CXC 2;  5AYS C;  2PZV A;  4FMD A;  1BVI A;  2ZDJ A;  5AIG A;  2IA7 A;  1VQL 3;  1WTH A;  2XSO B;  1K73 4;  2V1L A;  1MWR A;  2F4Y A;  3Q2P A;  3IJE B;  3FF0 A;  2CIU A;  3LH4 A;  5EQL A;  3RGA A;  3D9R A;  4XDW A;  1T2I A;  1I2F A;  3CC2 3;  4RNT A;  2B24 B;  1N9E A;  5FW5 A;  1YHQ 3;  2OTJ 3;  1UCI A;  1UCJ A;  2P38 A;  2Y73 A;  2STD A;  3EF8 A;  3V99 A;  7RNT A;  1GY5 A;  2E2T A;  1B2Z A;  1I0V A;  1C7H A;  1X1X A;  4ILF A;  3LTD A;  2RBI A;  1B20 A;  3JUO A;  2IUK A;  2HMN B;  2O3O A;  5GSP A;  4H61 A;  3SYU A;  1PY3 A;  1D6Y A;  3Q3F A;  5CF2 A;  2UX0 A;  1UI8 A;  4LZI A;  3MKI A;  5M18 A;  1BSD A;  3D5I A;  1W00 A;  7GSP A;  3N54 B;  1DET A;  3BNE A;  1BRJ A;  2HML B;  1WMO A;  4R80 A;  4AEQ A;  1BNJ A;  1IVU A;  3GWR A;  4HM6 B;  1NWW A;  1FGT A;  1RGG A;  4R9K A;  1E3V A;  1HZ1 A;  2D42 A;  2MF7 A;  1RRH A;  5M1A A;  2H0I A;  2GXF A;  1BRK A;  1OHS A;  3FKA A;  1LVN A;  4JF8 A;  4R4K A;  2WOH A;  2Z6B A;  3FCS B;  1Q40 A;  5IG0 A;  3U97 A;  3LTB A;  3G4S 3;  2P09 A;  8CHO A;  3WOF B;  2RNT A;  5AEU B;  1WMP A;  1IV9 A;  2XRX B;  1Q42 A;  5EVH A;  1Q86 4;  1YJW 3;  4LMI A;  1W01 A;  1I0X A;  1EA2 A;  1BRH A;  2CG1 A;  2I9W A;  4RBN A;  2P0X A;  3JVC A;  1NJI 4;  1ZX2 A;  1OF5 B;  3K9M C;  5IF6 A;  4CDL A;  1YJN 3;  1MWS A;  3KSP A;  1E3R A;  5AII A;  3OV4 A;  1ULJ B;  1JB5 A;  3LT8 A;  3DGY A;  4HOH A;  3CME 3;  1X1Y A;  4N6V 0;  1LQG C;  1VQ7 3;  2CKF B;  1BNG A;  2OOV A;  1MGR A;  3DZL A;  1A90 A;  2L1S A;  3MG3 A;  5IEN A;  2BNG A;  1LXE A;  2K0M A;  4MMX B;  2RFR A;  2C11 A;  8RNT A;  1FUS A;  2CWU A;  3NUV A;  3EBY A;  1ZO2 A;  2JQ5 A;  1OHO A;  1SJW A;  4G1M B;  3JUP A;  1OCV A;  2GU1 A;  4N6L A;  1FGO A;  1JB4 A;  1EKM A;  4L8O A;  2BMR B;  2Q07 A;  3BNC A;  3AGO A;  2CX1 A;  1K9M 4;  3GAX A;  2XH9 A;  1YNV X;  2AAE A;  3FLJ A;  4KT3 B;  2R4I A;  4XDV A;  3ZFZ A;  4FCZ A;  2IMJ A;  4IT7 A;  1B3S A;  1OF5 A;  1BSC A;  1PFP A;  3UNL A;  4KFE A;  1BSE A;  2M7O A;  4XBX A;  5JPP A;  2QIY A;  3HK4 A;  1FUW A;  1G96 A;  2F86 B;  3X41 A;  1UUV B;  4X2O A;  4X2H A;  3SED A;  1W6Y A;  2F5W A;  3VGN A;  3NQZ A;  1K41 A;  1BRG A;  3FGY A;  4HYZ A;  1QAK A;  1JRQ A;  3DM8 A;  4OUQ A;  4N6T A;  2MC8 A;  5STD A;  3U1W A;  1RGC A;  2IYJ A;  2SAR A;  2Y74 A;  3V92 A;  2FXT A;  1BRS A;  1RGL A;  1O7H B;  1RGF A;  1STD A;  1FGR A;  4GL6 A;  4K1V A;  5A0O B;  1OAC A;  4HM3 B;  3CCR 3;  3PXM A;  1VQ9 3;  1IK3 A;  3B4O A;  4N3V A;  1W02 A;  3DGN A;  1GS3 A;  1UCK A;  1MOL A;  1YI2 3;  2CFL A;  3IMA B;  3S67 A;  4GB5 A;  3V98 A;  4BU4 A;  3DGM A;  2SBL A;  1LQM B;  1TJD A;  1BU4 A;  2E2V A;  1QAF A;  4LSO A;  5CF1 A;  1AVK A;  2XGL A;  1UI7 A;  1CEW I;  2P0M A;  1L5G B;  5HGR A;  1I3I A;  3FSD A;  4ORL A;  1IVW A;  1B2S A;  2LYX A;  4MMZ B;  1BOX A;  1JN5 B;  6GSP A;  1I8V A;  3D4A A;  2FNQ A;  4FMA A;  3NX0 A;  5D82 A;  1CYU A;  3WDG B;  5IG5 A;  3CCV 3;  2W56 B;  3F8H A;  1N9J A;  1TFK A;  3BLZ A;  4HM0 B;  3URP A;  1MGW A;  1GY7 A;  2OQE A;  1K28 A;  3RNT A;  1B2U A;  1M1K 4;  1UUG B;  4XBY A;  3CCE 3;  1BSB A;  1JB2 A;  2Z76 A;  3ROB A;  3CPO A;  1RCK A;  3X3X A;  3CCU 3;  3WOD G;  2YX9 A;  3CCQ 3;  3DMC A;  2XFS A;  4HZB B;  1Q9E A;  3AHS A;  3VF1 A;  1A2K A;  4RNZ A;  1RN1 A;  2HOH A;  4FR9 A;  5LC7 A;  1MWU A;  4IPB A;  3EJV A;  2XF3 A;  1J2B A;  3PGB A;  1FGM A;  4OVM A;  1UDI I;  1D6U A;  5BIR A;  1VQ8 3;  3KSE D;  1GYB A;  3D79 A;  1BNF A;  1IT8 A;  2WGQ A;  5BU4 A;  3D5G A;  4K1U A;  1BSA A;  1GD4 A;  1QVF 2;  1YGE A;  2Z77 A;  5DRV A;  4BIR A;  1UW1 A;  1M1X B;  2D1W A;  1R4Y A;  1W2Z A;  3A76 A;  2ZHX B;  4HM1 B;  1B21 A;  4EYC A;  4WHA A;  5CK6 A;  2GEX A;  1TP6 A;  3RGR A;  5LC6 A;  4BTW A;  3LT9 A;  1QVG 2;  4NHF A;  1A2V A;  3EHC A;  3G71 3;  1O7N B;  4ZM8 A;  2PNC A;  3S29 A;  1ULI B;  3CCS 3;  1JBR A;  3CNX A;  1V74 A;  2OWP A;  1VQ4 3;  2WOF A;  1RDS A;  2YFJ B;  4HM5 B;  3JUN A;  4R9L A;  1Y4K A;  2Z7A A;  3WA3 A;  1AV4 A;  4H3U A;  1YJ9 3;  2W9P A;  2W9Q A;  4HVN A;  3SXX A;  1U5O A;  1TUH A;  1MNL A;  3F9S A;  3G6E 3;  3O8Y A;  2XEP A;  1SII A;  2RGQ A;  1LOW A;  2OOV C;  4O02 B;  1JKG B;  3Q90 A;  3CNM A;  1BNE A;  3DH2 A;  4HM4 B;  1D6Z A;  1HKX A;  4KZ1 A;  3T0U A;  1RGA A;  3G0K A;  4HM8 B;  3LTA A;  2J8X B;  1PYL A;  2YFI B;  4R1K A;  5KP1 A;  3HII A;  1RCL A;  1RHL A;  1VQ5 3;  3WOE B;  1RTU A;  5AI1 A;  3CC7 3;  1CYV A;  2BHM A;  3DGO A;  1OGX A;  3MSO A;  1Q81 4;  2OTL 3;  5CLK A;  4HM2 B;  2OCT A;  4HZ9 B;  2F98 A;  3DUK A;  3STD A;  1TRP A;  3T8N A;  1PU4 A;  1N8R 4;  2K3D A;  3IPT A;  4GSP A;  4AKY A;  1GOY A;  3NM2 A;  1LOY A;  3JUM A;  7STD A;  1JZD A;  1RNT A;  5BVB A;  2ML5 A;  4KFF A;  4PEJ A;  4I5Q A;  1IDP A;  3KCH A;  4RNY A;  3NXJ A;  3K63 A;  5JPU A;  3EBT A;  1G02 A;  1Q7H A;  2F5M A;  3LOY A;  3LYG A;  3NBJ A;  1FGQ A;  3HX8 A;  1RGE A;  3GRD A;  4L8P A;  3F14 A;  2CK3 H;  3BB9 A;  1OPY A;  4OK0 A;  1Z1S A;  3KN4 A;  3UJM A;  1B2M A;  1VQO 3;  2KAA A;  3F40 A;  3GZX B;  5KP4 A;  2IUJ A;  3I55 3;  1VQ6 3;  1BNR A;  2BT3 A;  5IEO A;  3A5E A;  1IT7 A;  1CH0 A;  1DVC A;  1RN4 A;  1RN7 A;  3GSP A;  1ZGX A;  3OW2 2;  1JZO A;  3MPH A;  1DE3 A;  2WO0 A;  3OWU A;  3AHW A;  1IQY A;  3BNB A;  3HI7 A;  4K61 A;  4BTY A;  1EEJ A;  4O8S A; 
#chains in the Genus database with same CATH homology
 1LOV A;  4GHO A;  1BAN A;  1BSB A;  1BSD A;  3HOH A;  1RCK A;  3D5I A;  7GSP A;  1X1W A;  1FW7 A;  1DET A;  1BRJ A;  1LRA A;  1YGW A;  1Q9E A;  1BNJ A;  3AHS A;  1RGG A;  1HZ1 A;  1RN1 A;  2HOH A;  1AY7 A;  1BRK A;  1BIR A;  1BRI A;  1GOV A;  1X1U A;  1GOU A;  2KF5 A;  1I2G A;  9RNT A;  1BRN L;  5BIR A;  2RNT A;  1UCL A;  3AGN A;  1BNF A;  5BU4 A;  1RLS A;  2ZA4 A;  1I0X A;  3D5G A;  1BRH A;  1BSA A;  2KF6 A;  4BIR A;  2BIR A;  2KF4 A;  2KF3 A;  1R4Y A;  1B21 A;  1I3F A;  4J5K A;  4HOH A;  3DGY A;  1BNS A;  1X1Y A;  1A2P A;  1YVS A;  1BNG A;  1FYS A;  1MGR A;  1JBR A;  5HOH A;  1GMQ A;  1JBT A;  1TTO A;  2BU4 A;  1FUS A;  8RNT A;  3WHO A;  1RDS A;  1GMR A;  1AQZ A;  1RGH A;  3AGO A;  1RNB A;  1RGK A;  1YNV X;  1LOW A;  1T2H A;  2AAE A;  5RNT A;  1BNE A;  1B3S A;  1BSC A;  3DH2 A;  1LNI A;  1BSE A;  1RGA A;  3WR2 A;  1GMP A;  1C54 A;  1PYL A;  1FZU A;  1JBS A;  2F5W A;  4J5G A;  1RCL A;  1BRG A;  1RHL A;  1RTU A;  1TRQ A;  1BUJ A;  2GSP A;  1B2X A;  1RGC A;  1TRP A;  2SAR A;  3BIR A;  4GSP A;  1GOY A;  1GSP A;  1HYF A;  1LOY A;  1BRS A;  1RGL A;  1SAR A;  1RGF A;  1RNT A;  2C4B A;  2F56 A;  1I2E A;  1B27 A;  1BGS A;  3KCH A;  3BU4 A;  6RNT A;  1UCK A;  1G02 A;  2F5M A;  4BU4 A;  1BVI A;  1BNI A;  1BU4 A;  1FUT A;  4HAA A;  1RGE A;  1IYY A;  2F4Y A;  2AAD A;  1I3I A;  1I70 A;  1RSN A;  1B2M A;  1BAO A;  1I2F A;  1T2I A;  2KAA A;  1B2S A;  4RNT A;  1RMS A;  1BOX A;  6GSP A;  1UCI A;  1I8V A;  1UCJ A;  3D4A A;  1BNR A;  3A5E A;  7RNT A;  1CH0 A;  1B2Z A;  1I0V A;  1RN4 A;  3GSP A;  1ZGX A;  1X1X A;  1DE3 A;  2RBI A;  1B20 A;  3URP A;  5GSP A;  3AHW A;  1MGW A;  3SYU A;  1PY3 A;  3Q3F A;  3RNT A;  1B2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...