1JCHA

Crystal structure of colicin e3 in complex with its immunity protein
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
468
structure length
468
Chain Sequence
b'VAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E3
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Ribosome inhibitor, hydrolase
total genus 107
structure length 468
sequence length 468
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.21.-:
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jchA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 1jchA03
1JCHA 2B5UA 1E44B 1UJWB 4UDMB 2YSUB
chains in the Genus database with same CATH superfamily
1GH6A 1SQPH 1FS0G 1XUQA 5H6QA 3P3NA 2UUCB 4BWAA 4IIJB 1XNRB 4MVUA 1HR0B 2Q9LA 5IYZA 2B1IA 2EJ7A 4BIZA 2IW5A 1PNKA 1N33B 3TGUH 1SA0A 3L9DA 3QG5A 2G38A 1HNZB 1S5LZ 4JTAB 4X1IB 2HR3A 4PA4A 2WLLB 3G6BA 3Q4HA 1N0JA 3A0BZ 1Q6IA 2CGNA 1NQTA 3A0RA 4FZ0A 1NVPD 3ABMC 2YDEA 1VARA 4I0XB 4UFZA 2YXYA 5JJNB 5LP6C 4YIOA 3A0HZ 4W4LA 2QTSA 1QU7A 3T1CA 3CYOA 4K35A 3JYCA 1B06A 2ATKC 4DR5O 2F93B 4X62O 4LNUB 4O4LB 1NH2D 1K92A 1AI4A 5AG2A 1BS3A 3I56V 5EIBC 1I5XA 1BHBA 1DK1A 2H3OA 5JCOA 4GZRB 3F5WC 4FM0A 4WFFA 2UXBB 3M7MX 2DYSB 4MTFA 2MW2B 2WA3A 3VQXA 1YJNV 4WCEV 3G80A 2UUAB 3EFFK 4H33A 4N21A 1H2LA 2GUZA 4Q20A 1SQGA 3F5TA 1LUVA 5JQGA 1XQ8A 3P30A 4DR2B 2AHYA 1NT2B 4N23A 5J9PC 3UCSC 3JAKB 4A5UB 2JRIA 5J2UA 4YJ2B 1XNQB 1PP9H 3AK2A 4JI8B 4PA9A 2IH3C 5GTHZ 3C90A 3JD0A 4DYLA 3ZJZA 1AJQA 5C8YB 3HKBB 3UQ8A 2BSKA 4JI1B 4B3TO 4UV8A 3K08A 3FYEB 2ZT9B 4UV9A 1CXZB 3CX5F 3DXRA 4LWSB 3CC7V 1JCHA 2HJFC 2EULA 4JZ2A 3JALA 4Z1MG 1FXKA 2Q67A 3FB5C 2YI8A 4ZKIA 1YJWV 4MS2A 1N8RW 3OTOB 4O2AA 1ZX3A 3E8GA 2PGGA 3E8HA 1D5NA 3JSNA 2GDSA 2AZ2A 1HNWB 3CSXA 2MK3A 1N36O 1SESA 4DR3B 3OFNG 2RJZA 2UUBO 2D2CB 4UCSA 2UXDB 1EBOA 3APOA 2P6JA 4ZI7B 3RBZA 4UB6Z 1F7YA 4NTYA 5H9CA 4I7ZB 2E74B 2JJ1G 3WB0A 3ASOC 1R6TA 2YEVB 1WA8A 2HJDA 4B3SB 2X0LA 2FB5A 1HP8A 4NTXA 3CC2V 1IZ3A 3FAVB 1TUBA 4LBEC 3KKYA 1NI8A 1YEWA 3CS5A 2ZCEA 3K0DA 2CE4A 5JJJB 1T5EA 4LF5B 1EN4A 2GBOA 1K73W 2E3CA 3K79A 1VQPV 4DV5B 2OIGA 1RM1C 1NKDA 2EINC 2QM8A 1TAEA 1WAZA 3FYIB 2IJJA 4HZ3A 3IC7A 2JDIG 4X1IA 2JVDA 4ASUG 2CGOA 4DR1O 2D3OW 4KHPB 3DTUB 2WLLA 1YVWA 5B1AC 1GN6A 4WBNB 4K0KB 1N4CA 4NB5A 1Q43A 2DMXA 2CTWA 3K3WA 4GKKB 2LW7A 3JD2A 4RUFA 2W6JG 3OD4A 1THZA 5KUMA 4UCUA 1H2SB 3N27A 3DC5A 4LP8A 2QSAA 1GM7A 3CWBH 4L8JA 2R72A 3RYCA 5KHIA 4HNAB 4RUEA 4JI5O 4O4LA 2KB1A 1U96A 4TV8B 3K59A 1NR7A 3W7XA 1DLBA 5CMUA 1H8EG 3JASB 2YSUB 3ASNC 3SPJA 2LJ2A 2FTKA 3VQWA 1RSOB 3H1JH 2ZDIA 4B3RO 1NS1A 5B3SB 4EFBA 1RP3B 2OCCC 3ABKC 3E22B 2VQFO 1K8AW 5LMNB 4LFBB 3ZHVA 2W6IG 1OCRB 3K5OA 2Y0IA 2VS0A 1BCCH 1Y66A 3AG1C 3RYIB 5KLVH 3ETEA 3JAKA 4X64O 5LBQA 2Y4TA 3B40A 2E5LO 4YJ2A 1EZVH 4NTWA 4O4IA 2QR4A 4DO2A 3JD3A 2QM4A 3RYHB 3D36A 1IBLO 5C8YA 3HKBA 2ARHA 2N04A 5LOVA 3LNNA 1SZTA 1EM1A 4O4HA 4G2KA 4GX5A 5JWPA 1OCCB 4R6ZA 2CAZC 5IWAB 2F43G 4LFAO 3T1YO 1FJGO 2L6LA 3ZCCA 4BW9A 4YHHO 3H1IH 3OGCC 4GYCB 3CMEV 3ABUA 4J7KA 1VF7A 1DF5A 1FFXB 4JI3O 2QWPB 4X62B 1D5AA 3AK3A 3J81N 1WP8A 5BY1A 4Z2WA 4I50B 1NBMG 1UFIA 2A7WA 4ZI7A 5IJ0A 4NVPA 4X20A 1SS3A 1M9NA 2R9RB 4U7OA 1LUWA 1XMOB 1YZBA 4DV0O 5LGUA 4AQYB 2FL4A 5KA5A 1OV9A 1DF4A 3JAWA 2GV9A 2IJHA 4UDMB 3LDCA 4O4JA 4DV3O 2EILB 5EBMC 1IBMO 5LMUO 3ZMUA 2DE0X 2EIKC 4FLZA 2RMKB 3QF7A 4BW5A 2ZR2A 2CDYA 1SC5B 1R6KA 1S5HC 4DR7O 4JI4O 1SERA 4UVBA 3ZBHA 3Q4HB 3E89A 1Q81W 4WBNA 2B9ZA 2ODMA 1F4NA 4YJ3A 5IY5B 3HR0A 3K58A 4JI6B 5LXTA 2F4VO 4RQEA 3TJTA 1K97A 4MTGA 4AI8A 1YXBA 3ZHRA 4EEQA 4PHZA 3JAMN 4U3JA 3O9OA 4J10A 1OZ0A 4X65B 2P7TC 1K4DC 2IH1C 2WLKA 4JV5O 4HNAA 1XOUA 1MABG 3RW0A 3JD1A 4TV8A 1SRYA 2Q7EA 2E76B 4DV2O 3B2EE 2PF4E 2QWQB 4LF7O 2QKAA 4GLXA 4FLUA 2UUBB 1I7FA 4O2BB 1Q7YW 4QGPA 4MVQA 3T1HO 1FD9A 1MG1A 4NXMB 3ZRVA 2GUZB 4JPRA 4CH6A 4NR1A 2Z5UA 3E22A 1OJHA 3FKSG 4DUYO 1KKDA 3TETA 1G1XB 2HVKC 2UXNA 3SJAC 1E1RG 3RYIA 3K04A 3EVKA 3ICXA 3H01A 2EIMC 3QVNA 2QM7A 1VQ8V 4F6RA 3CP1A 4PV1B 3ZMSA 1KC8W 1CEZA 4PDMA 1UJWB 4XDKA 2BSKB 2X6BA 1VQ4V 2W0XA 2DQ3A 4PI2A 1QLEC 4WFGA 4DW0A 1U97A 4FLVA 1GN2A 1KMIZ 2JEUA 2OT5A 1GM9A 3DXRB 1M57B 4DR1B 3OR6C 5KHGA 2ZINA 2M7WA 2QEXV 4JAAA 1V55C 2XOKG 3JALB 3UKMA 1WNSA 1JA8A 2P06A 4O2AB 5BXZA 1TGOA 1SQXH 3SJCC 2F23A 2Y69C 5IJ9A 2OYQA 1ORQC 2CK3G 2YI9A 3VQYA 4NXNO 3BEHA 3WB2A 2ZKOA 3L71H 3UO3A 4U7NA 3CC4V 5L3DA 1WA8B 1Z5WA 3NXSA 3B8MA 1KP2A 3X2QC 5LYJB 1HNXO 2HFEC 3CE2A 3UO2A 1VF6A 1TUBB 5KHJA 1LR1A 4OXSA 3L73H 5L3FA 3JSLA 1QVGU 5DECA 2VWJA 2C2AA 5CA1B 3ZX6A 2Q73A 3L75H 1MA1A 3BA9A 1SETA 3QO5A 2WLJA 3CRQA 1E44B 2QWRB 4RO2A 2WSSG 4RAIA 1BT8A 4MVZA 4X64B 1K9MW 2ZXWC 1S0VA 5A2QN 3ZMVA 4QE9A 4IGGA 1MZFA 4BR6A 1CP9A 2DOSA 5LL6Y 2XASA 3H9VA 1VQLV 3KG2A 2ZNIA 1FXKC 1IBLB 1URFA 2A79B 4OPAA 4CH4A 2OWOA 3CRMA 3IGAC 5CB4A 1H2KA 1QVFU 2OIEA 3GWOA 2LGQA 2DWDC 3RYCB 2H94A 1PV0A 4DV6O 1FJGB 3RWRD 3WG7B 4FM1A 5DM6V 1FXHA 1YHQV 2WLMA 4DW1A 3U11A 3FB6C 1TA8A 3KZIZ 1QNMA 2GHYA 4I55B 1IBKO 4JI3B 1FAFA 4PDVA 3CCRV 3JATA 4O2BA 2RQ6A 2ZM6B 4UVCA 4CBCA 4JI2B 5IE9A 3CD6V 3SPIA 4X89A 1M1KW 1Y67A 1NZ6A 2W0FC 3WFVA 2P22C 3GWKC 4DV0B 5L3GA 1F23A 1XI1A 3IAYA 4DV1O 4L87A 4OX9O 1L1FA 2WWWA 4O4IB 5D5QA 4WF9V 1I94O 3SPHA 4DV3B 1US6A 4I5SA 4MW8A 5LMUB 1JQ0A 4K8ZA 1M5IA 1BQZA 2KQXA 1M56B 2AXTZ 2ZE6A 5LOVB 4X66O 4UCVA 3LSUA 4O4HB 5JH7A 2ETNA 1AP5A 4DR7B 4JI4B 4FZ1A 2HG5C 2UXCO 1WN7A 4IL6Z 4H44B 3BY6A 4TSFG 1YJ9V 2XT9A 3OMNB 4UVAA 4KUMA 3SDLA 4JASA 3SR2C 3ZHTA 3OEHG 4FMTA 4DR6B 1Y76B 1KECA 4LR3A 5FL7G 2X6AA 2DYSC 3LUTB 4JV5B 2ZDIC 5FLXN 2JS5A 5LHGA 5KX5A 2K1EA 1BSMA 1X59A 5IJ0B 2Q7HA 1K5QA 3AG3B 3WB1A 1XEQA 4X20B 4GUNA 1IX9A 1L0NH 3SJBC 4BIOA 1W0KG 4LF7B 2QA4V 1JVMA 1Q90D 5LYJA 2YIDA 1NJIW 2H8PC 3T1HB 1ZAUA 1NTKH 1I0HA 2LGWA 1EZJA 5CA1A 3JAWB 5GTIZ 2JIZG 3D36C 3OUSA 4IYIA 4O4JB 4PA3A 4JGSA 1JR9A 4DK1A 3M8AA 3AG4B 2BCCH 3SJQC 1XL4A 3LSSA 1VEWA 1TVKB 5LHIA 4TWKA 1P49A 1S77D 1PNMA 1E79G 4C7UA 4WFHA 2AW9A 4ZIBA 1AILA 1K7DA 3E8FA 4FK5C 1XBLA 4YJ3B 2AGAA 1PD3A 5LXTB 2Q0OC 2QTOA 4P9PA 1P84F 3CCLV 4FJCC 4DUZO 4LF6O 4MVMA 4JTCB 4U3JB 5LGNA 4DRXB 1O9GA 2BTQA 4FLYA 4HYOA 4XDJA 5J2TA 1XMQB 1A32A 3U10A 2IM9A 1NTMH 4HAMA 2ITCC 1WB7A 1BGYH 2XAQA 2RNBA 3SYQA 2EX3A 4PA6A 1OCZB 2Q8VA 5CBFA 4JI0B 4I55A 3TCUA 4NXNB 4R8CA 2BOCC 2GTSA 4JYAO 1AI6A 3RT3C 2WLIA 2OTJV 3JCUZ 1COWG 3SYAA 2PI4A 4DV7B 3K9SA 3J7AU 4J7ZA 1R6NA 1M90W 5EK0A 2NLJC 1HNXB 2UU9O 1VQ6V 5BR8O 3SPGA 2RN9A 1R3IC 3KCYA 4CH3A 2CH7A 2YUAA 2HP8A 5B1OA 2E75B 4F6RB 3GVMA 4YY3O 1FKAO 4MTOA 2PTMA 1AR5A 2DW4A 1H2NA 2IU3A 4QNHB 5LHHA 1HNZO 5LGTA 3FB7C 4JF3A 2N05A 1AR1B 4E4EA 2XAHA 5FPOA 3RYFA 1N32O 3RN4A 1O9HA 2Y48A 1PL0A 1N0NA 5B1BB 1FYJA 2Y4UA 1WJZA 5IJ9B 1QLNA 1Y76A 3MD0A 4PDRA 5EZYA 2LQTA 4DR5B 4QIWF 3B4SA 1N34O 2P90A 5B3SC 1Q6HA 3CRRA 1AI5A 1IVSA 2Q69A 2B1GA 4PA7A 3G71V 1XL6A 1IBKB 4BIUA 3ZHUA 1OCRC 2VQEO 4DR4O 2WPDG 3AG2B 1G4YB 2UXBO 3PN1A 3ZEDA 2GTAA 1GN3A 2YXHA 3BABA 1M93A 1QQCA 2UUAO 2Z0AA 1F51A 1S76D 1SQVH 3U0ZA 3AEIA 3QO7A 4JYBA 4DR2O 3G67A 1NR1A 1VQMV 2X7RB 4DV1B 1XHZA 2BOBC 1Z2GA 2LP7A 4NTQA 1TVKA 3K06A 1OCCC 1I94B 3ZN1A 2QWNB 4F6EA 5L3BA 3L70H 3BRCA 4JI8O 2OCHA 5H6RA 4XDLA 3C3SA 3E2EA 4G27B 3L72H 1B04A 5KA6A 2YIBA 4B3TB 1V54B 5EYPB 3KCXA 4X66B 1Y74A 5CB4B 1TUEB 3JARA 5IDJA 2WAMA 3CCJV 1K34A 3UT5B 2LFRA 4DRXA 2DYRB 2WLHA 2PYLA 3RVYA 1WP7A 1KBHA 2KG7A 1WLEA 3EXAA 2F1MA 4P9OA 1M4UA 5KAFZ 1KB9F 4AILC 5CA0A 3N2KA 3HKEB 1N36B 3P32A 3WU2Z 3W7UA 1SQBH 3JATB 1OCOB 4FFBB 3SYPA 2CTRA 3A8TA 3ABLB 1Q86W 4MVOA 1EN6A 5B1NA 2XNDG 3BPZA 2YS8A 2K9PA 2GSMB 2EILC 5ITZA 1GRJA 1E1QG 5EBLC 3ZRXA 4B3SO 3K5MA 3K9AA 5E1AC 2PZSA 3SYOA 5H2FZ 5LA6A 3J80N 1H8HG 3N2GA 1Y6XA 2ITDC 3F7YC 1ROPA 2EIJB 5IY5C 5KHKA 1YSCA 1AJNA 3PJSK 5JH7B 2ADPA 1DTOA 1QR9A 2LO1A 2ZE7A 3H1KH 5GW7A 1ZLZA 4KHPO 4ZBMA 5JVDA 3L74H 4QPJA 1R3LC 3MHHC 1XDCA 3MAQA 4PJ0Z 1EFRG 3HPLC 4JYCA 4EFEA 2YICA 3CMAV 2EZOA 1K5SA 3CB2A 1VMGA 5JCOC 1DGSA 4YIPA 2Q5ZA 3GB7C 2VWKA 3IFXA 4IYHA 1GKFA 2XUMA 1R3KC 3DGEA 4FLXA 4JI5B 3S3XA 3DC6A 1P7GA 5KX5B 3JD4A 3LNMB 3ZRSA 2DJVA 3CPWU 1KD1W 2JK5C 3ABMB 5KHHA 2HKOA 5H5NA 1QCEA 1Q6UA 2Z3YA 4TOIA 2JJ2G 5LP6B 5CBHA 3I55V 2EBOA 2KSDA 3K5NA 4EKWA 4B3RB 2F95B 3IJ4A 2WLNA 4HBNA 4JYAB 3CEIA 2B5UA 4X88A 3ZRWA 2VQFB 5HFLA 5EC2C 3HKCB 1KP3A 2UU9B 4J80A 5LMNO 4WFEA 1VQ5V 5IYDO 2N74A 4NYKA 2E5LB 4BAYA 1AP6A 1M57C 1R1BA 4W4KA 3VBBA 2PI5A 3LSQA 4YY3B 4LF9O 5KUKA 3JCZA 3D8CA 5DN6G 4LFCO 4LF8O 4K3AA 4EB6B 3CRAA 5EYPA 4J42A 4R7CA 4TUYA 3STZC 2JGUA 1R73A 5F2VO 2BTQB 3OM3B 3OMIB 2A0LA 3UT5A 1KUQA 4LFAB 1N32B 4P30A 3T1YB 5J2TB 1J5EO 5IWAO 3CRCA 1F4MA 1FXVA 2ZR3A 4YHHB 2HHHO 2QWOB 5L3CA 1G6UA 3FFQA 3CCEV 1JMKC 3CCVV 1NVPB 1SKVA 2ZIMA 3HKDB 1EN5A 3BCCH 4PI0A 1W0JG 3HKEA 3AK1A 5D5PA 4ABMA 1GAXA 4UCRA 1N34B 2QKSA 1K33A 2XTAA 4QPKA 4FFBA 1QBZA 3CJHB 2WLIB 3FD9A 1YTFD 2YXLA 2FMLA 3G4SV 3LDDA 5TISZ 1NH2B 1YTFB 2L35A 1WPXA 4FLTA 1KYOF 1KU9A 2VQEB 4DR4B 4Z1VA 3R65A 4JAUA 1VP7A 1S72V 1G8MA 2QDOA 4X1KA 4X1YA 2CH7B 1XMOO 3CXCU 2XAJA 4AQYO 3K57A 3HB3B 4WFAV 3VQVA 2LFSA 2A3QA 1ZL8B 1AJPA 4I4TB 4LF4O 4D7TA 1LNQA 3H1LH 3T2MA 3ASOB 4IT5A 3W7SA 1IBMB 4UXNA 3K5LA 1MSWD 1W59A 3QO8A 1VQKV 1NU1H 3OE7G 1BQ0A 2FYUH 2ZIOA 2A9HA 3RYFB 1SQQH 1H2GA 5KAIZ 2ZE8A 4E2LA 2F4VB 3WG7C 4MW3A 1RM1B 1I5YA 3M99B 2YC0A 2Y0PA 4JI6O 2EINB 2IJKA 5IYCO 2PUSA 3E83A 4WFBV 2DQ0A 3K0GA 4JYYA 4ZOLA 1YITV 5EZYB 2R9AA 3CHXA 5DEDA 4TQFA 5FNVB 1VQ7V 5B1AB 4X65O 1VQNV 4OPHA 3BVOA 3AG7A 3BFRA 3MDSA 3E8BA 1XREA 1B6QA 4J11A 3BHPA 2R9IA 1IURA 4DV2B 3A2FA 2Q6AA 1HW7A 5LP6A 4FIPC 4MTXA 3TK1A 4JI7O 2JGDA 3QTCA 1JOYA 4MT8A 1ZTEA 4NXMO 4FPPA 5KMGB 3C3TA 4FM2A 2NN4A 4P2ZA 5EC1C 4GKJO 3HKCA 4DUYB 2RDCA 2QE7G 4MVSA 3W7WA 4GX0A 1M56C 2VRZA 3ASNB 4UCTA 4B3MO 4RQFA 2WA4A 3CCQV 5IYBO 2P67A 1AROP 3CCUV 2M6YA 1Q5OA 4JZGA 2OCCB 3ABKB 4IIJA 5CN0A 2PY5A 2LW1A 2YIBD 2CTQA 2XAGA 1AI7A 2QGNA 1I08A 1Y74B 4EB6A 1BHAA 3JARB 2V4DA 3AG1B 5B66Z 1MMMA 1PM9A 3R66A 1JJOA 3QNEA 3B8NA 4LC1A 2KG7B 5E79Z 3AG3C 4GT1A 2IU0A 2ILMA 3W7TA 3ZHQA 5CA0B 4I0XA 3N2KB 4GX2A 2Q68A 3HKDA 1QR8A 1AR4A 4GCZA 1X4TA 1IXMA 1JFFB 1FPOA 4DV4O 4U3FH 3RFRA 4KFMA 4PDLA 3CJHA 1YDXA 4LNUA 1V9PA 4TQDA 4J7JA 4H13B 3OAAG 5ITZB 3NR7A 2HEPA 3D3QA 3AG4C 3OUFA 2V1DA 1GM8A 2ZD9A 2IBZH 4LH6A 4ZHQB 3OMAB 1IDSA 2YIAA 3K03A 4JTDB 2RCVA 5K1XA 3ZMZA 2P4KA 4F4LA 3OTFA 3ABTA 1SQFA 5LA6B 4Q6GA 2UUCO 1XNRO 1Q8IA 1D2DA 1ZL8A 3N2GB 1OHHG 4I4TA 1HR0O 3BAAA 1YI2V 2EZPA 1N33O 3F7VC 4I9QA 4KXRA 2A06H 3DSQA 4LF9B 4J41A 3H1HH 4LFCB 2CUGA 5JVDB 4TV9B 3T4ZA 1IXBA 4B7KA 4LF8B 5IT9N 4D6TH 1GMGA 2HVJC 1GN4A 2JEXA 2EIKB 3S3WA 1H38A 3ZS8C 3ETGA 1K3EA 1OCZC 2Q0AA 3TXQA 3VOUA 5CA3A 3P3PA 1YF2A 4LWSA 1BE3H 4DV6B 1J5EB 2ZE5A 2BTOA 5FNVA 2P5OA 1PPJH 1WPBA 3ZIAG 1VIBA 1KKCA 2X6CA 1RFYA 2HHHB 1FFTB 1JPXA 5GONB 4RWUA 2JS3A 3FB8C 5HFMA 4CS2A 4UUJC 1VQ9V 2ADQB 1L8DA 4B08A 4QE7A 1Q82W 3MHSC 1VQOV 3APQA 2KKWA 1HWYA 1MZEA 2Q7GA 1PKXA 1ENVA 3UM7A 2ZM6O 1L0LH 1RPRA 3ZRWB 4JI2O 4D7SA 2AZ0A 1VF5B 3E35A 4IHJB 5KMGA 2XHBA 1SF9A 3CXHF 3D3IA 2YEVA 5BMVB 1RPOA 4NKGB 4OX9B 4H37A 3FAVA 1Q3EA 4J9YB 1KQSU 1XNQO 4X9QA 2PYJA 3E86A 4LF4B 4H0LB 1PNLA 2V7QG 3STLC 5IYZB 1P7BA 3O65A 1SA0B 3G6EV 5B1BC 4TUYB 4JI1O 1CPYA 2P4VA 3LDEA 1BL8A 4MSWC 2BE3A 2EIMB 2UXCB 4AHCA 4CZZA 3ETQA 4I9WA 1W2BU 2Q4PA 4K8XA 4DK0A 4PD4F 2ZQMA 1UPGA 3TXSA 1QLEB 1ZWIC 3ZN0A 3OTOO 3RVZA 1NTZH 4XBFA 1R3JC 1ZUQA 4DR6O 4MVRA 1Z5VA 4TT3G 1HNWO 1GO3F 1K4CC 3AG2C 4CS4A 1VF6C 3B77A 1V55B 4FVMA 3THOA 4DR3O 1JFFA 4LCUC 2UXDO 3OT7A 5L3EA 1JX9A 1HDJA 5A9GA 3RGBA 3OEEG 1YCIA 4KL1A 2Y69B 1MOFA 2UXXA 3JASA 4X1KB 4JI7B 4X1YB 4KP4A 3CCSV 4B7EA 1QHTA 2XAFA 1RSOA 4CH5A 2CTPA 4ZHQA 3CCMV 4JAVA 1S3JA 3I5DA 5JQGB 4GKJB 2IJIA 4CC5A 4LF5O 5B5EZ 3SGIA 5EBWC 4B3MB 4CC6A 1B3QA 1V54C 1MSDA 3SPCA 2DWEC 3ZMTA 3X2QB 4DV5O 2F66C 5J2UB 3B09A 2EJRA 4OGQB 5FPRA 1YIJV 1Y4MA 1H2MA 4YXWG 3EHBB 2DYRC 1GK9A 2DN9A 4TV9A 1J95A 3RYHA 5BZBA 4DXWA 4K0KO 4FFKA 4QJFB 4DUZB 1P4RA 4GX1A 1ZSPA 4LF6B 4GKKO 1AB3A 4UCOA 1S5JA 1MNGA 2ZNJA 2ZXWB 4ZOLB 5C93A 1OCOC 4LH7A 1WB8A 3OGIB 1FXKB 3ML0A 1JJ2U 4ICGA 1XMQO 2QJ1A 4FLWA 3ABLC 1XILA 3ZHSA 4G28B 5GONA 3OR7C 1AVMA 2OTLV 1XHXA 1BZKA 1GTOA 5K1PA 4J9ZB 2FKXA 4X8AA 2AHZA 5JJEB 4R50A 1FFXA 3BA8A 4JI0O 3IC9A 2JGDB 4DV4B 1PL4A 3OW2U 1SZXA 4CS3A 2QKCA 1BMFG 5CBGA 5EIBD 3ETDA 4I50A 3FX7A 2NR5A 2R70A 2NNUA 4IHJA 2O57A 3SYCA 2HLDG 4UB8Z 4DV7O 2EIJC 4PELA 5BR8B 4LFBO 3T4DA 5BMVA
chains in the Genus database with same CATH topology
3E83A 1R3IC 4WFBV 2DQ0A 3K0GA 1YITV 1FS0G 5H6QA 1OZ0A 1VQ7V 2P7TC 1K4DC 2IH1C 2WLKA 5B1AB 5B1OA 1VQNV 1MABG 4MVUA 3RW0A 3E8BA 3JD1A 1B6QA 1SRYA 2R9IA 2B1IA 4MTOA 4BIZA 2IW5A 2Q6AA 1PNKA 2DW4A 2IU3A 4QNHB 5LHHA 4FIPC 4JTAB 4MTXA 3TK1A 2HR3A 4PA4A 5LGTA 3FB7C 4JF3A 1Q7YW 1JOYA 4MVQA 2WLLB 1MG1A 1AR1B 2XAHA 4MT8A 3ZRVA 4JPRA 4FPPA 1NQTA 3A0RA 1NVPD 3ABMC 2Z5UA 2Y48A 4P2ZA 1PL0A 5EC1C 3FKSG 5B1BB 2QE7G 4MVSA 3W7WA 4GX0A 1KKDA 3TETA 1M56C 3ASNB 2HVKC 4RQFA 2UXNA 1QLNA 1E1RG 3CCQV 5IYBO 3MD0A 4PDRA 3T1CA 3K04A 2P67A 1AROP 2EIMC 3CYOA 3H01A 2QM7A 1VQ8V 3CCUV 4QIWF 3JYCA 2P90A 5B3SC 2ATKC 2OCCB 3ABKB 3CP1A 5CN0A 3ZMSA 1KC8W 1NH2D 1CEZA 1K92A 1AI7A 1AI4A 2XAGA 4PDMA 3I56V 1UJWB 1AI5A 1I5XA 1VQ6V 4XDKA 1BHBA 2Q69A 2B1GA 4PA7A 2X6BA 1BHAA 3G71V 1XL6A 4BIUA 1VQ4V 2DQ3A 1OCRC 3AG1B 1QLEC 4WFGA 3F5WC 4WFFA 2WPDG 2OT5A 2JEUA 3AG2B 2DYSB 1G4YB 1GM9A 4MTFA 1M57B 1YJNV 3OR6C 4WCEV 5IYCO 2M7WA 2QEXV 1V55C 2XOKG 3EFFK 4H33A 4N21A 3UKMA 1F51A 1S76D 3QNEA 4Q20A 3B8NA 4LC1A 3AG3C 4GT1A 2IU0A 3W7TA 3P30A 3AEIA 2AHYA 3QO7A 4GX2A 2Q68A 4JYBA 4N23A 1QR8A 5J9PC 1NR1A 1VQMV 2X7RB 2Y69C 2BOBC 2LP7A 1ORQC 4GCZA 3K06A 1IXMA 1OCCC 2CK3G 3ZN1A 4PA9A 5L3BA 2IH3C 3BEHA 4KFMA 4PDLA 5H6RA 4XDLA 3E2EA 4G27B 3JD0A 3ZJZA 5KA6A 1AJQA 4U7NA 3CC4V 1V54B 5L3DA 3OAAG 3NXSA 1TUEB 3B8MA 5IDJA 4UV8A 1KP2A 3AG4C 3K08A 3X2QC 2WAMA 3CCJV 3FYEB 4UV9A 2HFEC 3OUFA 2V1DA 1GM8A 1K34A 5L3FA 4OXSA 2LFRA 3CC7V 2ZD9A 1QVGU 1JCHA 2HJFC 3OMAB 3K03A 4JTDB 2C2AA 2DYRB 2WLHA 3ZMZA 4Z1MG 4F4LA 1FXKA 2Q67A 3ABTA 3FB5C 3RVYA 1WLEA 1OHHG 1E44B 1SETA 3QO5A 2WLJA 4P9OA 4ZKIA 1YJWV 4MS2A 4RO2A 1N8RW 2WSSG 1YI2V 4RAIA 3E8GA 2EZPA 3E8HA 4MVZA 1K9MW 3F7VC 2MK3A 3P32A 1SESA 3W7UA 2ZXWC 1S0VA 3ZMVA 4QE9A 1OCOB 3OFNG 3SYPA 1CP9A 2XASA 1VQLV 3KG2A 1EBOA 3T4ZA 2P6JA 1FXKC 3ABLB 3RBZA 1Q86W 4MVOA 5B1NA 2XNDG 5H9CA 2A79B 2JJ1G 1GMGA 2HVJC 3ASOC 2GSMB 2JEXA 2YEVB 2EILC 2EIKB 3IGAC 1QVFU 1E1QG 5EBLC 3ZRXA 2X0LA 1H38A 3GWOA 3ETGA 1K3EA 1OCZC 3CC2V 2DWDC 3VOUA 5CA3A 4LBEC 3K9AA 5E1AC 2H94A 3ZIAG 3K0DA 2X6CA 3SYOA 3WG7B 1FFTB 1K73W 5DM6V 3K79A 1JPXA 1H8HG 2ITDC 3F7YC 1VQPV 3FB8C 1FXHA 5HFMA 1ROPA 2EIJB 4UUJC 2WLMA 5IY5C 1RM1C 1YHQV 1VQ9V 3FB6C 1NKDA 1YSCA 4QE7A 2EINC 1AJNA 2GHYA 1Q82W 3PJSK 2QM8A 3MHSC 1VQOV 3FYIB 1HWYA 2IJJA 4HZ3A 1PKXA 3IC7A 2JDIG 4PDVA 1ENVA 3CCRV 1DTOA 4ASUG 1QR9A 3UM7A 2D3OW 4UVCA 5GW7A 3DTUB 4CBCA 2WLLA 4ZBMA 5B1AC 3CD6V 1RPRA 3SPIA 4QPJA 3ZRWB 1R3LC 3MHHC 3E35A 4X89A 1M1KW 1EFRG 3K3WA 2W0FC 3HPLC 3D3IA 3JD2A 4JYCA 4RUFA 3WFVA 2YEVA 2EZOA 1K5SA 2W6JG 1THZA 5KUMA 3CMAV 1RPOA 5L3GA 4LP8A 1F23A 1GM7A 3GB7C 3IFXA 1GKFA 4H37A 4L87A 1R3KC 1L1FA 2WWWA 3DGEA 4J9YB 1KQSU 4RUEA 3JD4A 3LNMB 3ZRSA 3CPWU 1KD1W 3E86A 4WF9V 1PNLA 2V7QG 3STLC 2JK5C 3ABMB 3SPHA 2KB1A 4I5SA 2HKOA 4MW8A 1NR7A 1P7BA 1QCEA 1JQ0A 2Z3YA 1M56B 3W7XA 3G6EV 2JJ2G 5B1BC 1DLBA 5CBHA 5CMUA 3I55V 1H8EG 1CPYA 2EBOA 2YSUB 3ASNC 3SPJA 3LDEA 4EKWA 1BL8A 4MSWC 2EIMB 2FTKA 2WLNA 2ZDIA 2HG5C 5B3SB 4CZZA 4I9WA 3BY6A 1W2BU 4TSFG 2B5UA 4X88A 2OCCC 3ABKC 3ZRWA 1YJ9V 5HFLA 3OMNB 5EC2C 1KP3A 4UVAA 1K8AW 2ZQMA 4KUMA 4JASA 1VQ5V 2W6IG 4WFEA 1OCRB 1QLEB 1ZWIC 3ZN0A 3OEHG 5IYDO 1Y66A 4FMTA 3RVZA 1KECA 3AG1C 3ETEA 4XBFA 1R3JC 5FL7G 4MVRA 5LBQA 4TT3G 2X6AA 1GO3F 1K4CC 3AG2C 2DYSC 3LUTB 4BAYA 2ZDIC 1M57C 1V55B 3B77A 3VBBA 2PI5A 3LSQA 5LHGA 4DO2A 5KUKA 2K1EA 3JCZA 4LCUC 5DN6G 5L3EA 1JX9A 3JD3A 3AG3B 1K5QA 3D36A 3OEEG 1W0KG 4R7CA 2Y69B 3STZC 1SZTA 1MOFA 2UXXA 1R73A 2QA4V 1JVMA 4G2KA 4KP4A 4GX5A 3CCSV 2XAFA 3OM3B 2H8PC 1NJIW 1OCCB 3OMIB 2A0LA 4R6ZA 4P30A 3CCMV 4JAVA 2F43G 1EZJA 1S3JA 1F4MA 1FXVA 2ZR3A 2IJIA 2JIZG 3OUSA 5L3CA 4PA3A 3ZCCA 4JGSA 3CCVV 3CCEV 1NVPB 5EBWC 3OGCC 1V54C 3CMEV 3SPCA 3AG4B 2DWEC 3ABUA 3ZMTA 3X2QB 3SJQC 1W0JG 1XL4A 3LSSA 1DF5A 5LHIA 2EJRA 4TWKA 2QKSA 1S77D 1K33A 1PNMA 4QPKA 1YIJV 1E79G 1Y4MA 1QBZA 4WFHA 4YXWG 2WLIB 2DYRC 3EHBB 1GK9A 1YTFD 1K7DA 3E8FA 1NBMG 4FK5C 3G4SV 1J95A 3LDDA 5BZBA 1NH2B 1YTFB 4DXWA 1WPXA 1PD3A 4QJFB 2QTOA 1P4RA 4P9PA 1M9NA 2R9RB 4GX1A 3CCLV 4FJCC 4U7OA 4MVMA 3R65A 4JAUA 4JTCB 1S72V 1G8MA 2ZXWB 5C93A 5LGNA 5LGUA 3CXCU 2XAJA 5KA5A 1OCOC 3HB3B 4WFAV 4HYOA 4XDJA 1FXKB 2LFSA 3ML0A 1JJ2U 1DF4A 4HAMA 1AJPA 2ITCC 2IJHA 1LNQA 3ABLC 3T2MA 4G28B 3ASOB 4UDMB 3LDCA 3OR7C 3W7SA 2EILB 5EBMC 4UXNA 2XAQA 3ZMUA 3SYQA 2OTLV 2EIKC 4PA6A 1OCZB 1GTOA 4J9ZB 5CBFA 1MSWD 4X8AA 2AHZA 4BW5A 2ZR2A 3TCUA 4R50A 3QO8A 1VQKV 1R6KA 3OE7G 3OW2U 1S5HC 4R8CA 1SERA 2BOCC 4UVBA 1BMFG 2A9HA 5CBGA 1AI6A 3E89A 1Q81W 3ETDA 2WLIA 2OTJV 1H2GA 1COWG 4E2LA 3SYAA 3WG7C 1F4NA 2PI4A 5IY5B 4MW3A 1RM1B 1I5YA 3M99B 2NNUA 3SYCA 4RQEA 2HLDG 2EIJC 1K97A 1R6NA 2EINB 4PELA 2NLJC 4MTGA 5EK0A 1M90W 2IJKA 3T4DA 3SPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH A;  2B5U A;  1E44 B;  1UJW B;  4UDM B;  2YSU B; 
#chains in the Genus database with same CATH topology
 1GH6 A;  1SQP H;  1FS0 G;  1XUQ A;  5H6Q A;  3P3N A;  2UUC B;  4BWA A;  4IIJ B;  1XNR B;  4MVU A;  1HR0 B;  2Q9L A;  5IYZ A;  2B1I A;  2EJ7 A;  4BIZ A;  2IW5 A;  1PNK A;  1N33 B;  3TGU H;  1SA0 A;  3L9D A;  3QG5 A;  2G38 A;  1HNZ B;  1S5L Z;  4JTA B;  4X1I B;  2HR3 A;  4PA4 A;  2WLL B;  3G6B A;  3Q4H A;  1N0J A;  3A0B Z;  1Q6I A;  2CGN A;  1NQT A;  3A0R A;  4FZ0 A;  1NVP D;  3ABM C;  2YDE A;  1VAR A;  4I0X B;  4UFZ A;  2YXY A;  5JJN B;  5LP6 C;  4YIO A;  3A0H Z;  4W4L A;  2QTS A;  1QU7 A;  3T1C A;  3CYO A;  4K35 A;  3JYC A;  1B06 A;  2ATK C;  4DR5 O;  2F93 B;  4X62 O;  4LNU B;  4O4L B;  1NH2 D;  1K92 A;  1AI4 A;  5AG2 A;  1BS3 A;  3I56 V;  5EIB C;  1I5X A;  1BHB A;  1DK1 A;  2H3O A;  5JCO A;  4GZR B;  3F5W C;  4FM0 A;  4WFF A;  2UXB B;  3M7M X;  2DYS B;  4MTF A;  2MW2 B;  2WA3 A;  3VQX A;  1YJN V;  4WCE V;  3G80 A;  2UUA B;  3EFF K;  4H33 A;  4N21 A;  1H2L A;  2GUZ A;  4Q20 A;  1SQG A;  3F5T A;  1LUV A;  5JQG A;  1XQ8 A;  3P30 A;  4DR2 B;  2AHY A;  1NT2 B;  4N23 A;  5J9P C;  3UCS C;  3JAK B;  4A5U B;  2JRI A;  5J2U A;  4YJ2 B;  1XNQ B;  1PP9 H;  3AK2 A;  4JI8 B;  4PA9 A;  2IH3 C;  5GTH Z;  3C90 A;  3JD0 A;  4DYL A;  3ZJZ A;  1AJQ A;  5C8Y B;  3HKB B;  3UQ8 A;  2BSK A;  4JI1 B;  4B3T O;  4UV8 A;  3K08 A;  3FYE B;  2ZT9 B;  4UV9 A;  1CXZ B;  3CX5 F;  3DXR A;  4LWS B;  3CC7 V;  1JCH A;  2HJF C;  2EUL A;  4JZ2 A;  3JAL A;  4Z1M G;  1FXK A;  2Q67 A;  3FB5 C;  2YI8 A;  4ZKI A;  1YJW V;  4MS2 A;  1N8R W;  3OTO B;  4O2A A;  1ZX3 A;  3E8G A;  2PGG A;  3E8H A;  1D5N A;  3JSN A;  2GDS A;  2AZ2 A;  1HNW B;  3CSX A;  2MK3 A;  1N36 O;  1SES A;  4DR3 B;  3OFN G;  2RJZ A;  2UUB O;  2D2C B;  4UCS A;  2UXD B;  1EBO A;  3APO A;  2P6J A;  4ZI7 B;  3RBZ A;  4UB6 Z;  1F7Y A;  4NTY A;  5H9C A;  4I7Z B;  2E74 B;  2JJ1 G;  3WB0 A;  3ASO C;  1R6T A;  2YEV B;  1WA8 A;  2HJD A;  4B3S B;  2X0L A;  2FB5 A;  1HP8 A;  4NTX A;  3CC2 V;  1IZ3 A;  3FAV B;  1TUB A;  4LBE C;  3KKY A;  1NI8 A;  1YEW A;  3CS5 A;  2ZCE A;  3K0D A;  2CE4 A;  5JJJ B;  1T5E A;  4LF5 B;  1EN4 A;  2GBO A;  1K73 W;  2E3C A;  3K79 A;  1VQP V;  4DV5 B;  2OIG A;  1RM1 C;  1NKD A;  2EIN C;  2QM8 A;  1TAE A;  1WAZ A;  3FYI B;  2IJJ A;  4HZ3 A;  3IC7 A;  2JDI G;  4X1I A;  2JVD A;  4ASU G;  2CGO A;  4DR1 O;  2D3O W;  4KHP B;  3DTU B;  2WLL A;  1YVW A;  5B1A C;  1GN6 A;  4WBN B;  4K0K B;  1N4C A;  4NB5 A;  1Q43 A;  2DMX A;  2CTW A;  3K3W A;  4GKK B;  2LW7 A;  3JD2 A;  4RUF A;  2W6J G;  3OD4 A;  1THZ A;  5KUM A;  4UCU A;  1H2S B;  3N27 A;  3DC5 A;  4LP8 A;  2QSA A;  1GM7 A;  3CWB H;  4L8J A;  2R72 A;  3RYC A;  5KHI A;  4HNA B;  4RUE A;  4JI5 O;  4O4L A;  2KB1 A;  1U96 A;  4TV8 B;  3K59 A;  1NR7 A;  3W7X A;  1DLB A;  5CMU A;  1H8E G;  3JAS B;  2YSU B;  3ASN C;  3SPJ A;  2LJ2 A;  2FTK A;  3VQW A;  1RSO B;  3H1J H;  2ZDI A;  4B3R O;  1NS1 A;  5B3S B;  4EFB A;  1RP3 B;  2OCC C;  3ABK C;  3E22 B;  2VQF O;  1K8A W;  5LMN B;  4LFB B;  3ZHV A;  2W6I G;  1OCR B;  3K5O A;  2Y0I A;  2VS0 A;  1BCC H;  1Y66 A;  3AG1 C;  3RYI B;  5KLV H;  3ETE A;  3JAK A;  4X64 O;  5LBQ A;  2Y4T A;  3B40 A;  2E5L O;  4YJ2 A;  1EZV H;  4NTW A;  4O4I A;  2QR4 A;  4DO2 A;  3JD3 A;  2QM4 A;  3RYH B;  3D36 A;  1IBL O;  5C8Y A;  3HKB A;  2ARH A;  2N04 A;  5LOV A;  3LNN A;  1SZT A;  1EM1 A;  4O4H A;  4G2K A;  4GX5 A;  5JWP A;  1OCC B;  4R6Z A;  2CAZ C;  5IWA B;  2F43 G;  4LFA O;  3T1Y O;  1FJG O;  2L6L A;  3ZCC A;  4BW9 A;  4YHH O;  3H1I H;  3OGC C;  4GYC B;  3CME V;  3ABU A;  4J7K A;  1VF7 A;  1DF5 A;  1FFX B;  4JI3 O;  2QWP B;  4X62 B;  1D5A A;  3AK3 A;  3J81 N;  1WP8 A;  5BY1 A;  4Z2W A;  4I50 B;  1NBM G;  1UFI A;  2A7W A;  4ZI7 A;  5IJ0 A;  4NVP A;  4X20 A;  1SS3 A;  1M9N A;  2R9R B;  4U7O A;  1LUW A;  1XMO B;  1YZB A;  4DV0 O;  5LGU A;  4AQY B;  2FL4 A;  5KA5 A;  1OV9 A;  1DF4 A;  3JAW A;  2GV9 A;  2IJH A;  4UDM B;  3LDC A;  4O4J A;  4DV3 O;  2EIL B;  5EBM C;  1IBM O;  5LMU O;  3ZMU A;  2DE0 X;  2EIK C;  4FLZ A;  2RMK B;  3QF7 A;  4BW5 A;  2ZR2 A;  2CDY A;  1SC5 B;  1R6K A;  1S5H C;  4DR7 O;  4JI4 O;  1SER A;  4UVB A;  3ZBH A;  3Q4H B;  3E89 A;  1Q81 W;  4WBN A;  2B9Z A;  2ODM A;  1F4N A;  4YJ3 A;  5IY5 B;  3HR0 A;  3K58 A;  4JI6 B;  5LXT A;  2F4V O;  4RQE A;  3TJT A;  1K97 A;  4MTG A;  4AI8 A;  1YXB A;  3ZHR A;  4EEQ A;  4PHZ A;  3JAM N;  4U3J A;  3O9O A;  4J10 A;  1OZ0 A;  4X65 B;  2P7T C;  1K4D C;  2IH1 C;  2WLK A;  4JV5 O;  4HNA A;  1XOU A;  1MAB G;  3RW0 A;  3JD1 A;  4TV8 A;  1SRY A;  2Q7E A;  2E76 B;  4DV2 O;  3B2E E;  2PF4 E;  2QWQ B;  4LF7 O;  2QKA A;  4GLX A;  4FLU A;  2UUB B;  1I7F A;  4O2B B;  1Q7Y W;  4QGP A;  4MVQ A;  3T1H O;  1FD9 A;  1MG1 A;  4NXM B;  3ZRV A;  2GUZ B;  4JPR A;  4CH6 A;  4NR1 A;  2Z5U A;  3E22 A;  1OJH A;  3FKS G;  4DUY O;  1KKD A;  3TET A;  1G1X B;  2HVK C;  2UXN A;  3SJA C;  1E1R G;  3RYI A;  3K04 A;  3EVK A;  3ICX A;  3H01 A;  2EIM C;  3QVN A;  2QM7 A;  1VQ8 V;  4F6R A;  3CP1 A;  4PV1 B;  3ZMS A;  1KC8 W;  1CEZ A;  4PDM A;  1UJW B;  4XDK A;  2BSK B;  2X6B A;  1VQ4 V;  2W0X A;  2DQ3 A;  4PI2 A;  1QLE C;  4WFG A;  4DW0 A;  1U97 A;  4FLV A;  1GN2 A;  1KMI Z;  2JEU A;  2OT5 A;  1GM9 A;  3DXR B;  1M57 B;  4DR1 B;  3OR6 C;  5KHG A;  2ZIN A;  2M7W A;  2QEX V;  4JAA A;  1V55 C;  2XOK G;  3JAL B;  3UKM A;  1WNS A;  1JA8 A;  2P06 A;  4O2A B;  5BXZ A;  1TGO A;  1SQX H;  3SJC C;  2F23 A;  2Y69 C;  5IJ9 A;  2OYQ A;  1ORQ C;  2CK3 G;  2YI9 A;  3VQY A;  4NXN O;  3BEH A;  3WB2 A;  2ZKO A;  3L71 H;  3UO3 A;  4U7N A;  3CC4 V;  5L3D A;  1WA8 B;  1Z5W A;  3NXS A;  3B8M A;  1KP2 A;  3X2Q C;  5LYJ B;  1HNX O;  2HFE C;  3CE2 A;  3UO2 A;  1VF6 A;  1TUB B;  5KHJ A;  1LR1 A;  4OXS A;  3L73 H;  5L3F A;  3JSL A;  1QVG U;  5DEC A;  2VWJ A;  2C2A A;  5CA1 B;  3ZX6 A;  2Q73 A;  3L75 H;  1MA1 A;  3BA9 A;  1SET A;  3QO5 A;  2WLJ A;  3CRQ A;  1E44 B;  2QWR B;  4RO2 A;  2WSS G;  4RAI A;  1BT8 A;  4MVZ A;  4X64 B;  1K9M W;  2ZXW C;  1S0V A;  5A2Q N;  3ZMV A;  4QE9 A;  4IGG A;  1MZF A;  4BR6 A;  1CP9 A;  2DOS A;  5LL6 Y;  2XAS A;  3H9V A;  1VQL V;  3KG2 A;  2ZNI A;  1FXK C;  1IBL B;  1URF A;  2A79 B;  4OPA A;  4CH4 A;  2OWO A;  3CRM A;  3IGA C;  5CB4 A;  1H2K A;  1QVF U;  2OIE A;  3GWO A;  2LGQ A;  2DWD C;  3RYC B;  2H94 A;  1PV0 A;  4DV6 O;  1FJG B;  3RWR D;  3WG7 B;  4FM1 A;  5DM6 V;  1FXH A;  1YHQ V;  2WLM A;  4DW1 A;  3U11 A;  3FB6 C;  1TA8 A;  3KZI Z;  1QNM A;  2GHY A;  4I55 B;  1IBK O;  4JI3 B;  1FAF A;  4PDV A;  3CCR V;  3JAT A;  4O2B A;  2RQ6 A;  2ZM6 B;  4UVC A;  4CBC A;  4JI2 B;  5IE9 A;  3CD6 V;  3SPI A;  4X89 A;  1M1K W;  1Y67 A;  1NZ6 A;  2W0F C;  3WFV A;  2P22 C;  3GWK C;  4DV0 B;  5L3G A;  1F23 A;  1XI1 A;  3IAY A;  4DV1 O;  4L87 A;  4OX9 O;  1L1F A;  2WWW A;  4O4I B;  5D5Q A;  4WF9 V;  1I94 O;  3SPH A;  4DV3 B;  1US6 A;  4I5S A;  4MW8 A;  5LMU B;  1JQ0 A;  4K8Z A;  1M5I A;  1BQZ A;  2KQX A;  1M56 B;  2AXT Z;  2ZE6 A;  5LOV B;  4X66 O;  4UCV A;  3LSU A;  4O4H B;  5JH7 A;  2ETN A;  1AP5 A;  4DR7 B;  4JI4 B;  4FZ1 A;  2HG5 C;  2UXC O;  1WN7 A;  4IL6 Z;  4H44 B;  3BY6 A;  4TSF G;  1YJ9 V;  2XT9 A;  3OMN B;  4UVA A;  4KUM A;  3SDL A;  4JAS A;  3SR2 C;  3ZHT A;  3OEH G;  4FMT A;  4DR6 B;  1Y76 B;  1KEC A;  4LR3 A;  5FL7 G;  2X6A A;  2DYS C;  3LUT B;  4JV5 B;  2ZDI C;  5FLX N;  2JS5 A;  5LHG A;  5KX5 A;  2K1E A;  1BSM A;  1X59 A;  5IJ0 B;  2Q7H A;  1K5Q A;  3AG3 B;  3WB1 A;  1XEQ A;  4X20 B;  4GUN A;  1IX9 A;  1L0N H;  3SJB C;  4BIO A;  1W0K G;  4LF7 B;  2QA4 V;  1JVM A;  1Q90 D;  5LYJ A;  2YID A;  1NJI W;  2H8P C;  3T1H B;  1ZAU A;  1NTK H;  1I0H A;  2LGW A;  1EZJ A;  5CA1 A;  3JAW B;  5GTI Z;  2JIZ G;  3D36 C;  3OUS A;  4IYI A;  4O4J B;  4PA3 A;  4JGS A;  1JR9 A;  4DK1 A;  3M8A A;  3AG4 B;  2BCC H;  3SJQ C;  1XL4 A;  3LSS A;  1VEW A;  1TVK B;  5LHI A;  4TWK A;  1P49 A;  1S77 D;  1PNM A;  1E79 G;  4C7U A;  4WFH A;  2AW9 A;  4ZIB A;  1AIL A;  1K7D A;  3E8F A;  4FK5 C;  1XBL A;  4YJ3 B;  2AGA A;  1PD3 A;  5LXT B;  2Q0O C;  2QTO A;  4P9P A;  1P84 F;  3CCL V;  4FJC C;  4DUZ O;  4LF6 O;  4MVM A;  4JTC B;  4U3J B;  5LGN A;  4DRX B;  1O9G A;  2BTQ A;  4FLY A;  4HYO A;  4XDJ A;  5J2T A;  1XMQ B;  1A32 A;  3U10 A;  2IM9 A;  1NTM H;  4HAM A;  2ITC C;  1WB7 A;  1BGY H;  2XAQ A;  2RNB A;  3SYQ A;  2EX3 A;  4PA6 A;  1OCZ B;  2Q8V A;  5CBF A;  4JI0 B;  4I55 A;  3TCU A;  4NXN B;  4R8C A;  2BOC C;  2GTS A;  4JYA O;  1AI6 A;  3RT3 C;  2WLI A;  2OTJ V;  3JCU Z;  1COW G;  3SYA A;  2PI4 A;  4DV7 B;  3K9S A;  3J7A U;  4J7Z A;  1R6N A;  1M90 W;  5EK0 A;  2NLJ C;  1HNX B;  2UU9 O;  1VQ6 V;  5BR8 O;  3SPG A;  2RN9 A;  1R3I C;  3KCY A;  4CH3 A;  2CH7 A;  2YUA A;  2HP8 A;  5B1O A;  2E75 B;  4F6R B;  3GVM A;  4YY3 O;  1FKA O;  4MTO A;  2PTM A;  1AR5 A;  2DW4 A;  1H2N A;  2IU3 A;  4QNH B;  5LHH A;  1HNZ O;  5LGT A;  3FB7 C;  4JF3 A;  2N05 A;  1AR1 B;  4E4E A;  2XAH A;  5FPO A;  3RYF A;  1N32 O;  3RN4 A;  1O9H A;  2Y48 A;  1PL0 A;  1N0N A;  5B1B B;  1FYJ A;  2Y4U A;  1WJZ A;  5IJ9 B;  1QLN A;  1Y76 A;  3MD0 A;  4PDR A;  5EZY A;  2LQT A;  4DR5 B;  4QIW F;  3B4S A;  1N34 O;  2P90 A;  5B3S C;  1Q6H A;  3CRR A;  1AI5 A;  1IVS A;  2Q69 A;  2B1G A;  4PA7 A;  3G71 V;  1XL6 A;  1IBK B;  4BIU A;  3ZHU A;  1OCR C;  2VQE O;  4DR4 O;  2WPD G;  3AG2 B;  1G4Y B;  2UXB O;  3PN1 A;  3ZED A;  2GTA A;  1GN3 A;  2YXH A;  3BAB A;  1M93 A;  1QQC A;  2UUA O;  2Z0A A;  1F51 A;  1S76 D;  1SQV H;  3U0Z A;  3AEI A;  3QO7 A;  4JYB A;  4DR2 O;  3G67 A;  1NR1 A;  1VQM V;  2X7R B;  4DV1 B;  1XHZ A;  2BOB C;  1Z2G A;  2LP7 A;  4NTQ A;  1TVK A;  3K06 A;  1OCC C;  1I94 B;  3ZN1 A;  2QWN B;  4F6E A;  5L3B A;  3L70 H;  3BRC A;  4JI8 O;  2OCH A;  5H6R A;  4XDL A;  3C3S A;  3E2E A;  4G27 B;  3L72 H;  1B04 A;  5KA6 A;  2YIB A;  4B3T B;  1V54 B;  5EYP B;  3KCX A;  4X66 B;  1Y74 A;  5CB4 B;  1TUE B;  3JAR A;  5IDJ A;  2WAM A;  3CCJ V;  1K34 A;  3UT5 B;  2LFR A;  4DRX A;  2DYR B;  2WLH A;  2PYL A;  3RVY A;  1WP7 A;  1KBH A;  2KG7 A;  1WLE A;  3EXA A;  2F1M A;  4P9O A;  1M4U A;  5KAF Z;  1KB9 F;  4AIL C;  5CA0 A;  3N2K A;  3HKE B;  1N36 B;  3P32 A;  3WU2 Z;  3W7U A;  1SQB H;  3JAT B;  1OCO B;  4FFB B;  3SYP A;  2CTR A;  3A8T A;  3ABL B;  1Q86 W;  4MVO A;  1EN6 A;  5B1N A;  2XND G;  3BPZ A;  2YS8 A;  2K9P A;  2GSM B;  2EIL C;  5ITZ A;  1GRJ A;  1E1Q G;  5EBL C;  3ZRX A;  4B3S O;  3K5M A;  3K9A A;  5E1A C;  2PZS A;  3SYO A;  5H2F Z;  5LA6 A;  3J80 N;  1H8H G;  3N2G A;  1Y6X A;  2ITD C;  3F7Y C;  1ROP A;  2EIJ B;  5IY5 C;  5KHK A;  1YSC A;  1AJN A;  3PJS K;  5JH7 B;  2ADP A;  1DTO A;  1QR9 A;  2LO1 A;  2ZE7 A;  3H1K H;  5GW7 A;  1ZLZ A;  4KHP O;  4ZBM A;  5JVD A;  3L74 H;  4QPJ A;  1R3L C;  3MHH C;  1XDC A;  3MAQ A;  4PJ0 Z;  1EFR G;  3HPL C;  4JYC A;  4EFE A;  2YIC A;  3CMA V;  2EZO A;  1K5S A;  3CB2 A;  1VMG A;  5JCO C;  1DGS A;  4YIP A;  2Q5Z A;  3GB7 C;  2VWK A;  3IFX A;  4IYH A;  1GKF A;  2XUM A;  1R3K C;  3DGE A;  4FLX A;  4JI5 B;  3S3X A;  3DC6 A;  1P7G A;  5KX5 B;  3JD4 A;  3LNM B;  3ZRS A;  2DJV A;  3CPW U;  1KD1 W;  2JK5 C;  3ABM B;  5KHH A;  2HKO A;  5H5N A;  1QCE A;  1Q6U A;  2Z3Y A;  4TOI A;  2JJ2 G;  5LP6 B;  5CBH A;  3I55 V;  2EBO A;  2KSD A;  3K5N A;  4EKW A;  4B3R B;  2F95 B;  3IJ4 A;  2WLN A;  4HBN A;  4JYA B;  3CEI A;  2B5U A;  4X88 A;  3ZRW A;  2VQF B;  5HFL A;  5EC2 C;  3HKC B;  1KP3 A;  2UU9 B;  4J80 A;  5LMN O;  4WFE A;  1VQ5 V;  5IYD O;  2N74 A;  4NYK A;  2E5L B;  4BAY A;  1AP6 A;  1M57 C;  1R1B A;  4W4K A;  3VBB A;  2PI5 A;  3LSQ A;  4YY3 B;  4LF9 O;  5KUK A;  3JCZ A;  3D8C A;  5DN6 G;  4LFC O;  4LF8 O;  4K3A A;  4EB6 B;  3CRA A;  5EYP A;  4J42 A;  4R7C A;  4TUY A;  3STZ C;  2JGU A;  1R73 A;  5F2V O;  2BTQ B;  3OM3 B;  3OMI B;  2A0L A;  3UT5 A;  1KUQ A;  4LFA B;  1N32 B;  4P30 A;  3T1Y B;  5J2T B;  1J5E O;  5IWA O;  3CRC A;  1F4M A;  1FXV A;  2ZR3 A;  4YHH B;  2HHH O;  2QWO B;  5L3C A;  1G6U A;  3FFQ A;  3CCE V;  1JMK C;  3CCV V;  1NVP B;  1SKV A;  2ZIM A;  3HKD B;  1EN5 A;  3BCC H;  4PI0 A;  1W0J G;  3HKE A;  3AK1 A;  5D5P A;  4ABM A;  1GAX A;  4UCR A;  1N34 B;  2QKS A;  1K33 A;  2XTA A;  4QPK A;  4FFB A;  1QBZ A;  3CJH B;  2WLI B;  3FD9 A;  1YTF D;  2YXL A;  2FML A;  3G4S V;  3LDD A;  5TIS Z;  1NH2 B;  1YTF B;  2L35 A;  1WPX A;  4FLT A;  1KYO F;  1KU9 A;  2VQE B;  4DR4 B;  4Z1V A;  3R65 A;  4JAU A;  1VP7 A;  1S72 V;  1G8M A;  2QDO A;  4X1K A;  4X1Y A;  2CH7 B;  1XMO O;  3CXC U;  2XAJ A;  4AQY O;  3K57 A;  3HB3 B;  4WFA V;  3VQV A;  2LFS A;  2A3Q A;  1ZL8 B;  1AJP A;  4I4T B;  4LF4 O;  4D7T A;  1LNQ A;  3H1L H;  3T2M A;  3ASO B;  4IT5 A;  3W7S A;  1IBM B;  4UXN A;  3K5L A;  1MSW D;  1W59 A;  3QO8 A;  1VQK V;  1NU1 H;  3OE7 G;  1BQ0 A;  2FYU H;  2ZIO A;  2A9H A;  3RYF B;  1SQQ H;  1H2G A;  5KAI Z;  2ZE8 A;  4E2L A;  2F4V B;  3WG7 C;  4MW3 A;  1RM1 B;  1I5Y A;  3M99 B;  2YC0 A;  2Y0P A;  4JI6 O;  2EIN B;  2IJK A;  5IYC O;  2PUS A;  3E83 A;  4WFB V;  2DQ0 A;  3K0G A;  4JYY A;  4ZOL A;  1YIT V;  5EZY B;  2R9A A;  3CHX A;  5DED A;  4TQF A;  5FNV B;  1VQ7 V;  5B1A B;  4X65 O;  1VQN V;  4OPH A;  3BVO A;  3AG7 A;  3BFR A;  3MDS A;  3E8B A;  1XRE A;  1B6Q A;  4J11 A;  3BHP A;  2R9I A;  1IUR A;  4DV2 B;  3A2F A;  2Q6A A;  1HW7 A;  5LP6 A;  4FIP C;  4MTX A;  3TK1 A;  4JI7 O;  2JGD A;  3QTC A;  1JOY A;  4MT8 A;  1ZTE A;  4NXM O;  4FPP A;  5KMG B;  3C3T A;  4FM2 A;  2NN4 A;  4P2Z A;  5EC1 C;  4GKJ O;  3HKC A;  4DUY B;  2RDC A;  2QE7 G;  4MVS A;  3W7W A;  4GX0 A;  1M56 C;  2VRZ A;  3ASN B;  4UCT A;  4B3M O;  4RQF A;  2WA4 A;  3CCQ V;  5IYB O;  2P67 A;  1ARO P;  3CCU V;  2M6Y A;  1Q5O A;  4JZG A;  2OCC B;  3ABK B;  4IIJ A;  5CN0 A;  2PY5 A;  2LW1 A;  2YIB D;  2CTQ A;  2XAG A;  1AI7 A;  2QGN A;  1I08 A;  1Y74 B;  4EB6 A;  1BHA A;  3JAR B;  2V4D A;  3AG1 B;  5B66 Z;  1MMM A;  1PM9 A;  3R66 A;  1JJO A;  3QNE A;  3B8N A;  4LC1 A;  2KG7 B;  5E79 Z;  3AG3 C;  4GT1 A;  2IU0 A;  2ILM A;  3W7T A;  3ZHQ A;  5CA0 B;  4I0X A;  3N2K B;  4GX2 A;  2Q68 A;  3HKD A;  1QR8 A;  1AR4 A;  4GCZ A;  1X4T A;  1IXM A;  1JFF B;  1FPO A;  4DV4 O;  4U3F H;  3RFR A;  4KFM A;  4PDL A;  3CJH A;  1YDX A;  4LNU A;  1V9P A;  4TQD A;  4J7J A;  4H13 B;  3OAA G;  5ITZ B;  3NR7 A;  2HEP A;  3D3Q A;  3AG4 C;  3OUF A;  2V1D A;  1GM8 A;  2ZD9 A;  2IBZ H;  4LH6 A;  4ZHQ B;  3OMA B;  1IDS A;  2YIA A;  3K03 A;  4JTD B;  2RCV A;  5K1X A;  3ZMZ A;  2P4K A;  4F4L A;  3OTF A;  3ABT A;  1SQF A;  5LA6 B;  4Q6G A;  2UUC O;  1XNR O;  1Q8I A;  1D2D A;  1ZL8 A;  3N2G B;  1OHH G;  4I4T A;  1HR0 O;  3BAA A;  1YI2 V;  2EZP A;  1N33 O;  3F7V C;  4I9Q A;  4KXR A;  2A06 H;  3DSQ A;  4LF9 B;  4J41 A;  3H1H H;  4LFC B;  2CUG A;  5JVD B;  4TV9 B;  3T4Z A;  1IXB A;  4B7K A;  4LF8 B;  5IT9 N;  4D6T H;  1GMG A;  2HVJ C;  1GN4 A;  2JEX A;  2EIK B;  3S3W A;  1H38 A;  3ZS8 C;  3ETG A;  1K3E A;  1OCZ C;  2Q0A A;  3TXQ A;  3VOU A;  5CA3 A;  3P3P A;  1YF2 A;  4LWS A;  1BE3 H;  4DV6 B;  1J5E B;  2ZE5 A;  2BTO A;  5FNV A;  2P5O A;  1PPJ H;  1WPB A;  3ZIA G;  1VIB A;  1KKC A;  2X6C A;  1RFY A;  2HHH B;  1FFT B;  1JPX A;  5GON B;  4RWU A;  2JS3 A;  3FB8 C;  5HFM A;  4CS2 A;  4UUJ C;  1VQ9 V;  2ADQ B;  1L8D A;  4B08 A;  4QE7 A;  1Q82 W;  3MHS C;  1VQO V;  3APQ A;  2KKW A;  1HWY A;  1MZE A;  2Q7G A;  1PKX A;  1ENV A;  3UM7 A;  2ZM6 O;  1L0L H;  1RPR A;  3ZRW B;  4JI2 O;  4D7S A;  2AZ0 A;  1VF5 B;  3E35 A;  4IHJ B;  5KMG A;  2XHB A;  1SF9 A;  3CXH F;  3D3I A;  2YEV A;  5BMV B;  1RPO A;  4NKG B;  4OX9 B;  4H37 A;  3FAV A;  1Q3E A;  4J9Y B;  1KQS U;  1XNQ O;  4X9Q A;  2PYJ A;  3E86 A;  4LF4 B;  4H0L B;  1PNL A;  2V7Q G;  3STL C;  5IYZ B;  1P7B A;  3O65 A;  1SA0 B;  3G6E V;  5B1B C;  4TUY B;  4JI1 O;  1CPY A;  2P4V A;  3LDE A;  1BL8 A;  4MSW C;  2BE3 A;  2EIM B;  2UXC B;  4AHC A;  4CZZ A;  3ETQ A;  4I9W A;  1W2B U;  2Q4P A;  4K8X A;  4DK0 A;  4PD4 F;  2ZQM A;  1UPG A;  3TXS A;  1QLE B;  1ZWI C;  3ZN0 A;  3OTO O;  3RVZ A;  1NTZ H;  4XBF A;  1R3J C;  1ZUQ A;  4DR6 O;  4MVR A;  1Z5V A;  4TT3 G;  1HNW O;  1GO3 F;  1K4C C;  3AG2 C;  4CS4 A;  1VF6 C;  3B77 A;  1V55 B;  4FVM A;  3THO A;  4DR3 O;  1JFF A;  4LCU C;  2UXD O;  3OT7 A;  5L3E A;  1JX9 A;  1HDJ A;  5A9G A;  3RGB A;  3OEE G;  1YCI A;  4KL1 A;  2Y69 B;  1MOF A;  2UXX A;  3JAS A;  4X1K B;  4JI7 B;  4X1Y B;  4KP4 A;  3CCS V;  4B7E A;  1QHT A;  2XAF A;  1RSO A;  4CH5 A;  2CTP A;  4ZHQ A;  3CCM V;  4JAV A;  1S3J A;  3I5D A;  5JQG B;  4GKJ B;  2IJI A;  4CC5 A;  4LF5 O;  5B5E Z;  3SGI A;  5EBW C;  4B3M B;  4CC6 A;  1B3Q A;  1V54 C;  1MSD A;  3SPC A;  2DWE C;  3ZMT A;  3X2Q B;  4DV5 O;  2F66 C;  5J2U B;  3B09 A;  2EJR A;  4OGQ B;  5FPR A;  1YIJ V;  1Y4M A;  1H2M A;  4YXW G;  3EHB B;  2DYR C;  1GK9 A;  2DN9 A;  4TV9 A;  1J95 A;  3RYH A;  5BZB A;  4DXW A;  4K0K O;  4FFK A;  4QJF B;  4DUZ B;  1P4R A;  4GX1 A;  1ZSP A;  4LF6 B;  4GKK O;  1AB3 A;  4UCO A;  1S5J A;  1MNG A;  2ZNJ A;  2ZXW B;  4ZOL B;  5C93 A;  1OCO C;  4LH7 A;  1WB8 A;  3OGI B;  1FXK B;  3ML0 A;  1JJ2 U;  4ICG A;  1XMQ O;  2QJ1 A;  4FLW A;  3ABL C;  1XIL A;  3ZHS A;  4G28 B;  5GON A;  3OR7 C;  1AVM A;  2OTL V;  1XHX A;  1BZK A;  1GTO A;  5K1P A;  4J9Z B;  2FKX A;  4X8A A;  2AHZ A;  5JJE B;  4R50 A;  1FFX A;  3BA8 A;  4JI0 O;  3IC9 A;  2JGD B;  4DV4 B;  1PL4 A;  3OW2 U;  1SZX A;  4CS3 A;  2QKC A;  1BMF G;  5CBG A;  5EIB D;  3ETD A;  4I50 A;  3FX7 A;  2NR5 A;  2R70 A;  2NNU A;  4IHJ A;  2O57 A;  3SYC A;  2HLD G;  4UB8 Z;  4DV7 O;  2EIJ C;  4PEL A;  5BR8 B;  4LFB O;  3T4D A;  5BMV A; 
#chains in the Genus database with same CATH homology
 3E83 A;  1R3I C;  4WFB V;  2DQ0 A;  3K0G A;  1YIT V;  1FS0 G;  5H6Q A;  1OZ0 A;  1VQ7 V;  2P7T C;  1K4D C;  2IH1 C;  2WLK A;  5B1A B;  5B1O A;  1VQN V;  1MAB G;  4MVU A;  3RW0 A;  3E8B A;  3JD1 A;  1B6Q A;  1SRY A;  2R9I A;  2B1I A;  4MTO A;  4BIZ A;  2IW5 A;  2Q6A A;  1PNK A;  2DW4 A;  2IU3 A;  4QNH B;  5LHH A;  4FIP C;  4JTA B;  4MTX A;  3TK1 A;  2HR3 A;  4PA4 A;  5LGT A;  3FB7 C;  4JF3 A;  1Q7Y W;  1JOY A;  4MVQ A;  2WLL B;  1MG1 A;  1AR1 B;  2XAH A;  4MT8 A;  3ZRV A;  4JPR A;  4FPP A;  1NQT A;  3A0R A;  1NVP D;  3ABM C;  2Z5U A;  2Y48 A;  4P2Z A;  1PL0 A;  5EC1 C;  3FKS G;  5B1B B;  2QE7 G;  4MVS A;  3W7W A;  4GX0 A;  1KKD A;  3TET A;  1M56 C;  3ASN B;  2HVK C;  4RQF A;  2UXN A;  1QLN A;  1E1R G;  3CCQ V;  5IYB O;  3MD0 A;  4PDR A;  3T1C A;  3K04 A;  2P67 A;  1ARO P;  2EIM C;  3CYO A;  3H01 A;  2QM7 A;  1VQ8 V;  3CCU V;  4QIW F;  3JYC A;  2P90 A;  5B3S C;  2ATK C;  2OCC B;  3ABK B;  3CP1 A;  5CN0 A;  3ZMS A;  1KC8 W;  1NH2 D;  1CEZ A;  1K92 A;  1AI7 A;  1AI4 A;  2XAG A;  4PDM A;  3I56 V;  1UJW B;  1AI5 A;  1I5X A;  1VQ6 V;  4XDK A;  1BHB A;  2Q69 A;  2B1G A;  4PA7 A;  2X6B A;  1BHA A;  3G71 V;  1XL6 A;  4BIU A;  1VQ4 V;  2DQ3 A;  1OCR C;  3AG1 B;  1QLE C;  4WFG A;  3F5W C;  4WFF A;  2WPD G;  2OT5 A;  2JEU A;  3AG2 B;  2DYS B;  1G4Y B;  1GM9 A;  4MTF A;  1M57 B;  1YJN V;  3OR6 C;  4WCE V;  5IYC O;  2M7W A;  2QEX V;  1V55 C;  2XOK G;  3EFF K;  4H33 A;  4N21 A;  3UKM A;  1F51 A;  1S76 D;  3QNE A;  4Q20 A;  3B8N A;  4LC1 A;  3AG3 C;  4GT1 A;  2IU0 A;  3W7T A;  3P30 A;  3AEI A;  2AHY A;  3QO7 A;  4GX2 A;  2Q68 A;  4JYB A;  4N23 A;  1QR8 A;  5J9P C;  1NR1 A;  1VQM V;  2X7R B;  2Y69 C;  2BOB C;  2LP7 A;  1ORQ C;  4GCZ A;  3K06 A;  1IXM A;  1OCC C;  2CK3 G;  3ZN1 A;  4PA9 A;  5L3B A;  2IH3 C;  3BEH A;  4KFM A;  4PDL A;  5H6R A;  4XDL A;  3E2E A;  4G27 B;  3JD0 A;  3ZJZ A;  5KA6 A;  1AJQ A;  4U7N A;  3CC4 V;  1V54 B;  5L3D A;  3OAA G;  3NXS A;  1TUE B;  3B8M A;  5IDJ A;  4UV8 A;  1KP2 A;  3AG4 C;  3K08 A;  3X2Q C;  2WAM A;  3CCJ V;  3FYE B;  4UV9 A;  2HFE C;  3OUF A;  2V1D A;  1GM8 A;  1K34 A;  5L3F A;  4OXS A;  2LFR A;  3CC7 V;  2ZD9 A;  1QVG U;  1JCH A;  2HJF C;  3OMA B;  3K03 A;  4JTD B;  2C2A A;  2DYR B;  2WLH A;  3ZMZ A;  4Z1M G;  4F4L A;  1FXK A;  2Q67 A;  3ABT A;  3FB5 C;  3RVY A;  1WLE A;  1OHH G;  1E44 B;  1SET A;  3QO5 A;  2WLJ A;  4P9O A;  4ZKI A;  1YJW V;  4MS2 A;  4RO2 A;  1N8R W;  2WSS G;  1YI2 V;  4RAI A;  3E8G A;  2EZP A;  3E8H A;  4MVZ A;  1K9M W;  3F7V C;  2MK3 A;  3P32 A;  1SES A;  3W7U A;  2ZXW C;  1S0V A;  3ZMV A;  4QE9 A;  1OCO B;  3OFN G;  3SYP A;  1CP9 A;  2XAS A;  1VQL V;  3KG2 A;  1EBO A;  3T4Z A;  2P6J A;  1FXK C;  3ABL B;  3RBZ A;  1Q86 W;  4MVO A;  5B1N A;  2XND G;  5H9C A;  2A79 B;  2JJ1 G;  1GMG A;  2HVJ C;  3ASO C;  2GSM B;  2JEX A;  2YEV B;  2EIL C;  2EIK B;  3IGA C;  1QVF U;  1E1Q G;  5EBL C;  3ZRX A;  2X0L A;  1H38 A;  3GWO A;  3ETG A;  1K3E A;  1OCZ C;  3CC2 V;  2DWD C;  3VOU A;  5CA3 A;  4LBE C;  3K9A A;  5E1A C;  2H94 A;  3ZIA G;  3K0D A;  2X6C A;  3SYO A;  3WG7 B;  1FFT B;  1K73 W;  5DM6 V;  3K79 A;  1JPX A;  1H8H G;  2ITD C;  3F7Y C;  1VQP V;  3FB8 C;  1FXH A;  5HFM A;  1ROP A;  2EIJ B;  4UUJ C;  2WLM A;  5IY5 C;  1RM1 C;  1YHQ V;  1VQ9 V;  3FB6 C;  1NKD A;  1YSC A;  4QE7 A;  2EIN C;  1AJN A;  2GHY A;  1Q82 W;  3PJS K;  2QM8 A;  3MHS C;  1VQO V;  3FYI B;  1HWY A;  2IJJ A;  4HZ3 A;  1PKX A;  3IC7 A;  2JDI G;  4PDV A;  1ENV A;  3CCR V;  1DTO A;  4ASU G;  1QR9 A;  3UM7 A;  2D3O W;  4UVC A;  5GW7 A;  3DTU B;  4CBC A;  2WLL A;  4ZBM A;  5B1A C;  3CD6 V;  1RPR A;  3SPI A;  4QPJ A;  3ZRW B;  1R3L C;  3MHH C;  3E35 A;  4X89 A;  1M1K W;  1EFR G;  3K3W A;  2W0F C;  3HPL C;  3D3I A;  3JD2 A;  4JYC A;  4RUF A;  3WFV A;  2YEV A;  2EZO A;  1K5S A;  2W6J G;  1THZ A;  5KUM A;  3CMA V;  1RPO A;  5L3G A;  4LP8 A;  1F23 A;  1GM7 A;  3GB7 C;  3IFX A;  1GKF A;  4H37 A;  4L87 A;  1R3K C;  1L1F A;  2WWW A;  3DGE A;  4J9Y B;  1KQS U;  4RUE A;  3JD4 A;  3LNM B;  3ZRS A;  3CPW U;  1KD1 W;  3E86 A;  4WF9 V;  1PNL A;  2V7Q G;  3STL C;  2JK5 C;  3ABM B;  3SPH A;  2KB1 A;  4I5S A;  2HKO A;  4MW8 A;  1NR7 A;  1P7B A;  1QCE A;  1JQ0 A;  2Z3Y A;  1M56 B;  3W7X A;  3G6E V;  2JJ2 G;  5B1B C;  1DLB A;  5CBH A;  5CMU A;  3I55 V;  1H8E G;  1CPY A;  2EBO A;  2YSU B;  3ASN C;  3SPJ A;  3LDE A;  4EKW A;  1BL8 A;  4MSW C;  2EIM B;  2FTK A;  2WLN A;  2ZDI A;  2HG5 C;  5B3S B;  4CZZ A;  4I9W A;  3BY6 A;  1W2B U;  4TSF G;  2B5U A;  4X88 A;  2OCC C;  3ABK C;  3ZRW A;  1YJ9 V;  5HFL A;  3OMN B;  5EC2 C;  1KP3 A;  4UVA A;  1K8A W;  2ZQM A;  4KUM A;  4JAS A;  1VQ5 V;  2W6I G;  4WFE A;  1OCR B;  1QLE B;  1ZWI C;  3ZN0 A;  3OEH G;  5IYD O;  1Y66 A;  4FMT A;  3RVZ A;  1KEC A;  3AG1 C;  3ETE A;  4XBF A;  1R3J C;  5FL7 G;  4MVR A;  5LBQ A;  4TT3 G;  2X6A A;  1GO3 F;  1K4C C;  3AG2 C;  2DYS C;  3LUT B;  4BAY A;  2ZDI C;  1M57 C;  1V55 B;  3B77 A;  3VBB A;  2PI5 A;  3LSQ A;  5LHG A;  4DO2 A;  5KUK A;  2K1E A;  3JCZ A;  4LCU C;  5DN6 G;  5L3E A;  1JX9 A;  3JD3 A;  3AG3 B;  1K5Q A;  3D36 A;  3OEE G;  1W0K G;  4R7C A;  2Y69 B;  3STZ C;  1SZT A;  1MOF A;  2UXX A;  1R73 A;  2QA4 V;  1JVM A;  4G2K A;  4KP4 A;  4GX5 A;  3CCS V;  2XAF A;  3OM3 B;  2H8P C;  1NJI W;  1OCC B;  3OMI B;  2A0L A;  4R6Z A;  4P30 A;  3CCM V;  4JAV A;  2F43 G;  1EZJ A;  1S3J A;  1F4M A;  1FXV A;  2ZR3 A;  2IJI A;  2JIZ G;  3OUS A;  5L3C A;  4PA3 A;  3ZCC A;  4JGS A;  3CCV V;  3CCE V;  1NVP B;  5EBW C;  3OGC C;  1V54 C;  3CME V;  3SPC A;  3AG4 B;  2DWE C;  3ABU A;  3ZMT A;  3X2Q B;  3SJQ C;  1W0J G;  1XL4 A;  3LSS A;  1DF5 A;  5LHI A;  2EJR A;  4TWK A;  2QKS A;  1S77 D;  1K33 A;  1PNM A;  4QPK A;  1YIJ V;  1E79 G;  1Y4M A;  1QBZ A;  4WFH A;  4YXW G;  2WLI B;  2DYR C;  3EHB B;  1GK9 A;  1YTF D;  1K7D A;  3E8F A;  1NBM G;  4FK5 C;  3G4S V;  1J95 A;  3LDD A;  5BZB A;  1NH2 B;  1YTF B;  4DXW A;  1WPX A;  1PD3 A;  4QJF B;  2QTO A;  1P4R A;  4P9P A;  1M9N A;  2R9R B;  4GX1 A;  3CCL V;  4FJC C;  4U7O A;  4MVM A;  3R65 A;  4JAU A;  4JTC B;  1S72 V;  1G8M A;  2ZXW B;  5C93 A;  5LGN A;  5LGU A;  3CXC U;  2XAJ A;  5KA5 A;  1OCO C;  3HB3 B;  4WFA V;  4HYO A;  4XDJ A;  1FXK B;  2LFS A;  3ML0 A;  1JJ2 U;  1DF4 A;  4HAM A;  1AJP A;  2ITC C;  2IJH A;  1LNQ A;  3ABL C;  3T2M A;  4G28 B;  3ASO B;  4UDM B;  3LDC A;  3OR7 C;  3W7S A;  2EIL B;  5EBM C;  4UXN A;  2XAQ A;  3ZMU A;  3SYQ A;  2OTL V;  2EIK C;  4PA6 A;  1OCZ B;  1GTO A;  4J9Z B;  5CBF A;  1MSW D;  4X8A A;  2AHZ A;  4BW5 A;  2ZR2 A;  3TCU A;  4R50 A;  3QO8 A;  1VQK V;  1R6K A;  3OE7 G;  3OW2 U;  1S5H C;  4R8C A;  1SER A;  2BOC C;  4UVB A;  1BMF G;  2A9H A;  5CBG A;  1AI6 A;  3E89 A;  1Q81 W;  3ETD A;  2WLI A;  2OTJ V;  1H2G A;  1COW G;  4E2L A;  3SYA A;  3WG7 C;  1F4N A;  2PI4 A;  5IY5 B;  4MW3 A;  1RM1 B;  1I5Y A;  3M99 B;  2NNU A;  3SYC A;  4RQE A;  2HLD G;  2EIJ C;  1K97 A;  1R6N A;  2EIN B;  4PEL A;  2NLJ C;  4MTG A;  5EK0 A;  1M90 W;  2IJK A;  3T4D A;  3SPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...