1JCHA

Crystal structure of colicin e3 in complex with its immunity protein
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
468
structure length
468
Chain Sequence
VAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E3
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Ribosome inhibitor, hydrolase
total genus 107
structure length 468
sequence length 468
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.21.-:
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jchA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 1jchA03
1JCHA 1UJWB 2B5UA 1E44B 4UDMB 2YSUB
chains in the Genus database with same CATH superfamily
1KKCA 1WAZA 4J7ZA 1NVPB 4NXMO 5JH7A 2ZM6B 2WLJA 3UCSC 3UT5A 1VQLV 1PNLA 3K5LA 2LGWA 3ICXA 3A0BZ 1OHHG 1QQCA 3K9AA 4I4TA 2KB1A 1JPXA 4DR6O 3ABMB 3CJHB 3E8FA 1EN4A 1HP8A 1F7YA 2KKWA 3O65A 5HFMA 5L3CA 3ZRXA 5LP6A 3AG2B 4DW1A 1XBLA 5JJEB 4DV7O 1KYOF 3CWBH 2XAQA 2R9IA 4UCVA 1K8AW 2AHZA 2WLIB 3W7TA 3UM7A 4JPRA 4CBCA 4NTXA 4RUFA 4XBFA 1NBMG 3HKCB 1AILA 4DK1A 3JASB 1I94B 2Q7GA 3JSNA 2WWWA 3E22A 1XMOB 1LUWA 4LH6A 3P32A 4LFCO 4DR7O 3OR7C 5KX5A 2R9AA 1A32A 2OCCB 5JQGA 5L3EA 4YY3O 4N21A 4LF4B 2B9ZA 2F43G 1F4NA 5BY1A 2BCCH 4R7CA 1R6TA 3SPCA 1P49A 1VMGA 3ZHSA 5DM6V 3BA9A 3CE2A 3FAVB 2IH3C 3X2QB 1XHZA 1RSOB 4YJ2B 4JI8B 3SPHA 4JI1O 2PYJA 1GRJA 4IHJB 1M56B 4EB6A 3L73H 3WG7B 1IBKO 2Q8VA 4DK0A 2Y0IA 2AZ0A 3J81N 2IW5A 4LF6B 3AG1B 3GVMA 2WLMA 4ICGA 4TV8A 1RPOA 3QG5A 3JAWB 2E5LB 2X6AA 4WF9V 1NR7A 3AG3C 1NTZH 2RJZA 4DV3B 4L8JA 4H37A 2QWRB 1QHTA 1N4CA 1PPJH 4DV1B 1WB7A 4IT5A 4MT8A 3G71V 1P84F 1AI4A 2DQ3A 2QWNB 3RYHB 1OCCB 1SERA 2HP8A 3F5WC 5DN6G 3AEIA 3D8CA 3K5OA 5IYCO 3DTUB 4WBNA 5JCOC 4X1IB 4AHCA 4IYHA 2HJDA 3UQ8A 4AI8A 3H9VA 3HKBB 3D3QA 2F4VO 1P7BA 2X7RB 5GONB 4NYKA 4QGPA 3ETEA 5B5EZ 3T1YB 1M9NA 1YF2A 2EBOA 2BTQA 2QWPB 2HG5C 3JCUZ 3F7VC 2GV9A 3CRAA 2UUCB 4KUMA 2H94A 4DV4O 2B1IA 2ITCC 3IAYA 3J80N 1SQFA 4PA7A 4O4JA 5LGUA 2XAGA 1E79G 3ZHRA 3P3PA 4JZGA 4WFGA 1Y74B 5E79Z 1GM7A 2Y0PA 5LP6C 2WLLB 3WB2A 5FLXN 3JATB 3QVNA 5LMNB 3DSQA 1FXHA 1VQ4V 4LF8O 4ZI7B 1IBMB 4GKJB 3RT3C 1SRYA 2EILB 5IE9A 3E8HA 2HHHB 2YDEA 3OD4A 3U0ZA 1GMGA 4LFAB 2Q0AA 4RQEA 1R3JC 3G4SV 2UUBB 2GHYA 3K9SA 1M57B 3L70H 4CC5A 1SA0A 3BRCA 4NTWA 2ZE8A 1N0JA 2G38A 4ABMA 2UUAO 1ZUQA 1N36B 1US6A 4CC6A 4UUJC 5LXTB 5KMGA 1ORQC 1M90W 1HR0B 3FYEB 1K9MW 3CCSV 2CAZC 3ZCCA 3AK2A 2QGNA 4FMTA 5KA5A 1B04A 1GKFA 2PGGA 5IJ0A 5EZYB 3TETA 1XL4A 1JQ0A 1VEWA 4JYYA 1FXKA 2CTQA 3CCQV 1YZBA 4U7OA 3RFRA 2XUMA 2LO1A 5C8YB 3RYIB 1EZJA 4CZZA 5D5QA 4O2BA 1XL6A 2KG7B 2Y48A 4LP8A 1VQ9V 4EEQA 4TV9A 2UXCO 4U3FH 1N33O 3RW0A 1BHBA 5FPRA 3CCRV 1NVPD 4WFBV 3NR7A 1UFIA 1M1KW 5KHHA 4PA4A 5B1NA 1R3LC 4MW3A 1R6KA 1D2DA 1HNWO 3E89A 3HR0A 1WLEA 1OCRC 2IU0A 5J2UA 2N05A 1Y4MA 2OIGA 2ZR3A 2F95B 4PDVA 2B5UA 3ZMTA 4X65B 1BT8A 2AXTZ 5IYDO 4MTFA 1R3IC 4LF9B 4JI5O 1ZWIC 2MK3A 3Q4HB 5TISZ 2OTJV 4DR2B 1KP3A 1R73A 3K3WA 5IY5C 4FM2A 3SYPA 1Z5WA 1S5HC 2CTPA 1N32B 3JD0A 4MTXA 1VQ5V 3RYFB 3FB8C 5AG2A 5KUKA 5GTHZ 3K5MA 3ABLB 4LCUC 3NXSA 1PD3A 2YXLA 3K0GA 1N0NA 3VQVA 5CMUA 1AROP 4DW0A 1IXMA 1NS1A 3ASNC 3OGCC 3B40A 5CB4B 4HNAA 3SYCA 2CK3G 4QPJA 3VQXA 1WA8A 4F6RA 4O2AB 3LDDA 4I55B 2JEUA 1AVMA 5EIBC 4J80A 2EZOA 4PDMA 1MSDA 4JI4B 2RN9A 3L9DA 2WAMA 3M7MX 4UVAA 1H2NA 1EM1A 1SQVH 4XDLA 2GUZA 4X64O 3X2QC 5IYZA 1Z5VA 5IJ9B 4OXSA 2RCVA 3HKEA 4JI2B 1BHAA 2EJRA 4JYBA 4I5SA 3SJBC 2BTOA 2L35A 1N8RW 1W59A 2NLJC 3OR6C 3AG1C 4B3MO 1J95A 2ZE7A 5CBGA 5JJNB 1HNZB 1Y6XA 5B3SB 4PA6A 2CGNA 3T4DA 1Q82W 4B3TB 2PYLA 5JH7B 3ZHQA 3UT5B 2K9PA 3RVZA 4J7JA 4DYLA 5BXZA 2HEPA 2UXBB 4U7NA 3ZRSA 3OTFA 4U3JB 3N2KA 2PF4E 4NVPA 3FB6C 5A9GA 3R65A 2DWEC 3CRMA 4P9OA 4OX9O 4J9ZB 3L74H 3JCZA 1F4MA 2R72A 5LP6B 1YCIA 3QF7A 5CA1A 2Q7HA 2UU9O 1K92A 4LF7B 4QIWF 4JF3A 1PNKA 4Z1MG 5BMVB 1IBKB 2Q73A 2XTAA 4CH4A 4MVQA 4JAAA 1XDCA 4DV6O 4QJFB 1SESA 1QVFU 3E22B 1AJQA 1BCCH 1Q90D 4DR1B 4XDJA 2XOKG 4K3AA 5CA0A 5EYPA 3K03A 4GYCB 1AI6A 5JQGB 1MMMA 2DOSA 3MDSA 3KKYA 2YC0A 3AK1A 1OZ0A 3FKSG 5D5PA 1YVWA 3I56V 4ZBMA 2X6BA 2BSKA 1QBZA 4KP4A 4I9QA 3T2MA 3EVKA 1YI2V 2CH7A 4W4KA 2Z0AA 3W7UA 5LMUO 4HAMA 4YHHO 1VQ8V 3CCMV 1CEZA 1K34A 1XILA 1GAXA 5KAIZ 4UCUA 4EB6B 2GDSA 4DV2O 4X8AA 5IT9N 2HVJC 1COWG 2Y69C 3A8TA 4EFBA 5K1XA 2F4VB 4MVOA 4BIZA 1YTFB 2BOCC 3K04A 4TV8B 2JGUA 1DGSA 3SYOA 4UCTA 2OTLV 2DYSB 1SF9A 4XDKA 1AP5A 5CBHA 1AR4A 1M93A 2QSAA 1K7DA 3FB7C 4DV4B 4H33A 4K8ZA 1L8DA 1JOYA 3IGAC 2ATKC 3MHSC 4JV5B 3K59A 1QU7A 4CH5A 4DR4O 5IDJA 5BR8B 1JJ2U 3I5DA 1BQZA 2W0FC 1DF4A 1H2SB 1OCRB 3K06A 4IL6Z 2EZPA 2OIEA 4AQYO 3HKDA 4GKKO 5JJJB 2QA4V 1LUVA 2QR4A 1HWYA 4PJ0Z 2P67A 5LOVA 3RYCA 1EN5A 3B4SA 2ADQB 4LR3A 4NB5A 1N34B 1OJHA 3J7AU 2A3QA 3B8MA 3E35A 5DEDA 4F6EA 1NT2B 3H1KH 2ETNA 2E3CA 5IY5B 1SZTA 3BCCH 3JD1A 1Y76A 2HLDG 1JJOA 2BTQB 1IXBA 2ZXWC 1ROPA 3ZRWA 4UXNA 1H2KA 2IH1C 1HW7A 3LSUA 4LWSB 2JK5C 1U96A 5EBWC 4RAIA 1WP8A 2WA3A 2Z5UA 3ASNB 4X1KB 4O4JB 2ILMA 3JARA 4J7KA 1R3KC 2VQEB 4FK5C 3IC9A 4FJCC 3VBBA 3DXRB 1M4UA 1Z2GA 3CMAV 4GX2A 5J2TA 2W6IG 4EKWA 4G28B 4LH7A 1BGYH 1K73W 1ZX3A 1WP7A 3D36A 4O4HA 5FNVB 4JTDB 2HR3A 1MA1A 4FFBB 1R1BA 4X66O 4JI3O 3IC7A 3G6BA 3CHXA 4BIUA 1MNGA 3ABLC 3K08A 4P30A 3OTOB 1FD9A 1SETA 1VARA 1J5EB 3CC4V 4FLTA 2XASA 5LGNA 5KMGB 1P4RA 1JFFA 3KCYA 4TUYB 4IIJB 4WFFA 5IWAO 1O9HA 4GCZA 2FYUH 1HNWB 4YJ3A 3CEIA 2IJJA 5IJ0B 3ZMZA 1TUBA 5B1BB 4J41A 1VQPV 1NKDA 1GM8A 2PTMA 4LNUB 2VQFB 1YJNV 5H6RA 4MTOA 3ZX6A 2DMXA 4KHPO 2FKXA 4JI0B 3E2EA 2OYQA 1BQ0A 4DV5O 2E76B 1XNQB 3LSQA 4ZOLA 3AG7A 5LL6Y 3CCEV 2XT9A 1VIBA 2QKAA 1SQXH 2P4VA 3U10A 4O2BB 1B3QA 1GN2A 2WLNA 2GBOA 4X88A 4TV9B 1GO3F 1VF7A 1DTOA 2YSUB 2ADPA 4HZ3A 1SQQH 1F23A 2M6YA 4RUEA 3ZHUA 1W2BU 2LW1A 2Q69A 3SYQA 4JYAB 5B3SC 1NH2B 4PELA 3ML0A 3W7XA 2DYRC 4FIPC 4CH6A 1FJGB 2NN4A 4DUYO 4I0XB 3N2GB 3CMEV 1PP9H 2HJFC 2Y4UA 2YXHA 2EINC 2JGDB 5H2FZ 2W6JG 1YJ9V 4MS2A 2PY5A 2IBZH 1IBLO 2WLIA 2JS3A 5JWPA 1TVKB 3B77A 1BSMA 4O4LB 4TSFG 3ZJZA 4B7EA 4JASA 1NI8A 3UKMA 4J42A 1FXVA 1S5JA 1NJIW 2YIBD 4X9QA 1H2LA 2MW2B 3VOUA 1XQ8A 4DUZO 4JI6B 2Q6AA 2JJ2G 1GN6A 3CRRA 3JALA 1I5XA 2ZM6O 2Y69B 3LDEA 1ZL8B 2Z3YA 4DR5O 1AB3A 1SQBH 3VQYA 2LGQA 2P06A 3K79A 4LFBB 1FFTB 1YIJV 4B08A 4NTQA 1KQSU 1Q43A 4NTYA 4GX0A 1RSOA 4KXRA 5CBFA 1NTMH 5L3GA 3D36C 4TOIA 4IHJA 4JAUA 2AW9A 3EXAA 4GT1A 2YIDA 4OPHA 1V55B 1EBOA 2GUZB 1YTFD 5IYZB 4JI7O 4OX9B 1I94O 3HKEB 1S3JA 1XMOO 4LF5B 3S3XA 1JCHA 1AR5A 4X62B 1GTOA 1YHQV 2UXDO 4OGQB 2JS5A 4I50A 3OUFA 2EIJC 1NQTA 2OCHA 4Q20A 1URFA 2P7TC 2F93B 3ZEDA 4GLXA 4ASUG 4LF4O 1XNRB 2DYSC 2ZXWB 1QR8A 3CPWU 2OWOA 3B2EE 4DRXB 1H38A 4KL1A 1V54C 4FM0A 1MZFA 2Q9LA 2JEXA 2A06H 4G27B 3RYHA 1OCOC 4JI8O 3ETDA 1RM1C 3N2KB 3JAKB 2DE0X 3CX5F 3THOA 1S76D 1MZEA 3TGUH 1S5LZ 4LF6O 5LBQA 2HFEC 3CSXA 5ITZB 1LNQA 1Y67A 2DQ0A 4CH3A 4FLZA 4AILC 5KHGA 3OEHG 2E5LO 4WCEV 5F2VO 3HB3B 3MD0A 3QO7A 4DV2B 1B6QA 1VF6A 2ZQMA 2GTAA 3T1HB 4DV3O 1NR1A 5EC2C 3ZIAG 2P5OA 1XMQB 1AJPA 4I9WA 2F23A 2ZIMA 1SS3A 2YEVB 3EHBB 1V9PA 5EYPB 1TUEB 3FX7A 2YICA 2A9HA 4DXWA 2YI8A 1UJWB 1Y74A 5EIBD 4X89A 2QJ1A 3DGEA 4ZI7A 2H3OA 2Q67A 3K58A 5FPOA 4IGGA 3F5TA 2BSKB 5EK0A 5LYJB 3A0HZ 1SKVA 4NXMB 4K0KO 1PNMA 4R6ZA 2FL4A 4AQYB 1MSWD 4X20A 5DECA 3BA8A 5EBMC 3T1YO 2CH7B 1K5QA 3OMIB 2Q4PA 2EULA 2Q0OC 4RWUA 2QDOA 3ABKC 4DR6B 3LSSA 3BEHA 3MAQA 2UUCO 3SPJA 2HKOA 3ABTA 1DLBA 1HDJA 4QE9A 2OT5A 1FFXB 4DV7B 4R50A 1JR9A 4P9PA 1KC8W 3JD3A 2Y4TA 2NR5A 2ZT9B 4K35A 3CC7V 5KHKA 5CA3A 2ZIOA 2EIKC 3OMAB 4UCRA 1Q3EA 1AI7A 4ZHQA 1GH6A 3OFNG 4YIPA 2N04A 1IBMO 1SQPH 4K8XA 4GKJO 3K57A 2DYRB 4LFCB 4MTGA 5B1AB 2PI4A 5B1BC 4DR7B 1EFRG 1FS0G 4LFAO 3HKDB 1GM9A 2EINB 3K0DA 1Q8IA 4H44B 2UUBO 4JYCA 4YY3B 3RYCB 1FXKC 2KG7A 5L3FA 4I4TB 1H2MA 5H6QA 2QE7G 1N36O 4R8CA 3BABA 3JYCA 2XAFA 2ARHA 1QVGU 2D3OW 1Y76B 2QWQB 5IYBO 1Q6IA 4JI3B 1X59A 4MSWC 4JI1B 2A0LA 4NXNO 4G2KA 1MABG 2VRZA 4RQFA 4B3RO 2ZD9A 1GN4A 1WJZA 4MVMA 5IWAB 3ZHVA 3OW2U 4UB8Z 3JARB 1D5NA 5LA6A 2EIMC 3M8AA 3Q4HA 1E44B 5KX5B 4GZRB 4P2ZA 4QNHB 2P4KA 1S72V 3L75H 2A7WA 2R9RB 3BFRA 4UVBA 1S77D 2D2CB 1HNXO 2CUGA 4O4HB 3ZRVA 4C7UA 5A2QN 1CXZB 1VQMV 3IJ4A 3E8BA 2UXNA 2VWKA 2KQXA 2VWJA 2EX3A 5CB4A 4BW5A 3APOA 1SC5B 1WPBA 2JIZG 3O9OA 3M99B 1SQGA 4JTCB 4PDRA 4O2AA 1LR1A 2EIJB 4X65O 1XOUA 1JFFB 1CPYA 4LF9O 1RPRA 2ZE5A 2WLHA 3ETGA 2N74A 1FPOA 1L0NH 2YUAA 1K33A 1N32O 1V54B 3ZMVA 3JAMN 3AG4C 1Q6UA 5IJ9A 1OCOB 1UPGA 1Q7YW 3CCLV 2WSSG 4BR6A 4X1YA 1RM1B 3ABUA 3PJSK 1IDSA 1IBLB 2V1DA 1V55C 4LBEC 3APQA 3IFXA 1K3EA 1OV9A 2XHBA 3DC6A 2FB5A 3OAAG 4UB6Z 4LF8B 4WBNB 5KHIA 4FVMA 1PM9A 2DWDC 3TXQA 4W4LA 3OMNB 5FL7G 1PV0A 4JI4O 3W7WA 4U3JA 1K97A 4DR5B 2HVKC 2UUAB 1WNSA 3FYIB 3N27A 1AI5A 3CB2A 3C90A 1B06A 4JI2O 4JAVA 1KUQA 4O4IA 1E1QG 1YEWA 1JX9A 2ZCEA 3CP1A 2ZDIA 2Q68A 2QM8A 3RN4A 3WFVA 1KU9A 4F4LA 5BMVA 2JVDA 3TXSA 4JI7B 3CC2V 1Q6HA 2YIBA 1HNZO 1AR1B 2K1EA 2JJ1G 3ABKB 2UXDB 4B3TO 4TQDA 4Q6GA 4CS3A 3SDLA 3JALB 4DR3O 3STLC 2ZINA 2IJKA 5EC1C 2P90A 3KCXA 4QE7A 2UXBO 1SA0B 5LHIA 2UXCB 1N33B 1IVSA 3P3NA 4YXWG 4FLYA 3I55V 2IJHA 2X6CA 1IX9A 2EIKB 3JD4A 1GK9A 1XUQA 1WPXA 3GWKC 4HYOA 1XEQA 1L1FA 5H5NA 3KZIZ 2QKSA 1OCZC 1XREA 2E75B 1G8MA 4QPKA 5L3BA 4E2LA 4E4EA 2ITDC 4LF7O 3RBZA 5HFLA 4PI0A 2O57A 3LUTB 4H13B 4MVSA 5JVDA 1P7GA 3BY6A 3HPLC 3H1JH 1FXKB 1BS3A 1BL8A 4JI5B 4DR1O 2ZNJA 1PKXA 3GB7C 4I7ZB 4I50B 4TQFA 3BVOA 2YXYA 3QO8A 1Y66A 2YIAA 1TAEA 2LFRA 3BAAA 4KFMA 2CE4A 2W0XA 1D5AA 3ETQA 4DO2A 2KSDA 1DF5A 2QKCA 1O9GA 4PV1B 3R66A 5BZBA 3SYAA 3ASOC 5CN0A 3TJTA 3SJCC 2LJ2A 1X4TA 5L3DA 1PL0A 1SZXA 4HBNA 5B1AC 2EIMB 4GX1A 5J2UB 3CJHA 2LQTA 3G80A 2XNDG 3SPGA 3ZN1A 4K0KB 3P30A 1H8EG 2ZKOA 3JD2A 4DV0O 5E1AC 1YXBA 1VP7A 1VQNV 4B3SO 2GSMB 4PD4F 4UVCA 4LWSA 2QM7A 2QTOA 3HKCA 4X64B 1VQKV 3JASA 2Q5ZA 2H8PC 3STZC 3WU2Z 1W0KG 4X1KA 1YDXA 4MW8A 4JV5O 5BR8O 4JGSA 3OUSA 1EZVH 3CS5A 2IU3A 3DXRA 3QNEA 3TK1A 4B3MB 2FMLA 1KP2A 2QM4A 3CCJV 2V4DA 4N23A 4HNAB 3K5NA 1N34O 2ZNIA 4UDMB 4FLVA 2DJVA 1M5IA 2CTRA 2ZDIC 3AK3A 1WA8B 4F6RB 2LP7A 5FNVA 1GN3A 2E74B 3QO5A 4FFBA 2IM9A 4FLUA 3FAVA 3AG4B 4X20B 3H1IH 4WFEA 4YJ2A 2AGAA 3BHPA 3L71H 3CCVV 2V7QG 2PUSA 1ZLZA 2JRIA 1MOFA 4J9YB 1RP3B 3CRQA 4PA9A 4BAYA 2GTSA 4TUYA 4IIJA 4ZIBA 2UU9B 3JAWA 2P22C 2VQEO 3DC5A 3SJQC 4FM1A 4UFZA 1K4CC 3UO2A 3WB0A 4NXNB 3CXCU 3OT7A 1I5YA 5B66Z 1KB9F 4WFHA 4ZHQB 1K5SA 4L87A 4LNUA 4B3RB 4GX5A 4DV6B 1R6NA 4FLWA 4BWAA 4BIOA 1KBHA 1XHXA 1G6UA 2EJ7A 3C3TA 1KD1W 2PI5A 1F51A 4MVZA 4WFAV 1H2GA 3BPZA 1BE3H 1Q86W 4X1IA 2WA4A 1KKDA 1HNXB 3OTOO 4J10A 3HKBA 2ZR2A 1J5EO 5GW7A 2IJIA 1QLEC 1KMIZ 5CA1B 5GONA 4JTAB 2XAJA 3C3SA 3D3IA 4TWKA 5LMUB 3VQWA 3WB1A 3F7YC 4YHHB 1H8HG 1THZA 2B1GA 3ZMUA 4I0XA 2PZSA 3N2GA 1EN6A 2CDYA 5KHJA 2VQFO 4TT3G 2JGDA 2ZE6A 4UV8A 4D7SA 2DW4A 1I0HA 5LA6B 4IYIA 4JI0O 4YIOA 4NKGB 3ABMC 4DV1O 1BMFG 5CA0B 2WLKA 1TVKA 4O4LA 1XNQO 3S3WA 3LNNA 2WLLA 3AG2C 2XAHA 3JATA 4NR1A 1K4DC 5H9CA 3T4ZA 1JVMA 3GWOA 4CS2A 1OCZB 4H0LB 3OGIB 4B7KA 1T5EA 4DR4B 3SR2C 1QR9A 4J11A 4PA3A 3RVYA 1XI1A 2CTWA 4GKKB 2DN9A 1VQ7V 4D7TA 1ZL8A 4JYAO 1G1XB 1E1RG 1FJGO 3G67A 1FKAO 5K1PA 1Q81W 2OCCC 3H1HH 5LXTA 2BE3A 3FFQA 3AG3B 1QCEA 5LGTA 1NTKH 4Z1VA 3G6EV 3PN1A 2WPDG 3MHHC 4PDLA 4ZKIA 2CGOA 5LHHA 5EZYA 1WB8A 5LMNO 2A79B 5KA6A 1ENVA 3ASOB 1YSCA 2F1MA 1PL4A 3B8NA 5LHGA 4JI6O 4X1YB 1I7FA 2HHHO 2QTSA 1M56C 3QTCA 3WG7C 3W7SA 4FZ1A 5C8YA 1BZKA 3RYIA 3TCUA 4FFKA 1JA8A 3UO3A 4Z2WA 5LOVB 5B1OA 3ZHTA 3CCUV 3L72H 3H01A 1KECA 4LFBO 4DRXA 2F66C 4FPPA 1AJNA 4UV9A 1RFYA 1FYJA 4DR3B 1HR0O 1MG1A 4X66B 5GTIZ 1U97A 1NH2D 1I08A 1JMKC 1QNMA 3ZRWB 3SPIA 3JAKA 1TGOA 2QWOB 3A2FA 3JSLA 5KLVH 1OCCC 2X0LA 1CP9A 1G4YB 1VF5B 3SJAC 5ITZA 4FLXA 3A0RA 4O4IB 4RO2A 4LF5O 3FD9A 4X62O 1AP6A 1WN7A 2YI9A 1ZSPA 2L6LA 1L0LH 2RMKB 5J2TB 2R70A 3E83A 1W0JG 3RYFA 3E86A 1S0VA 1TA8A 2LFSA 3OEEG 1IZ3A 1XNRO 3RGBA 1VQ6V 4LC1A 3E8GA 4KHPB 4CS4A 2YEVA 4DV5B 1FAFA 1VF6C 5J9PC 2BOBC 2RQ6A 4OPAA 5C93A 3FB5C 3ZN0A 2YS8A 2Q7EA 2M7WA 3KG2A 4GUNA 4JZ2A 3H1LH 1ZAUA 4UCSA 2UXXA 1IURA 2QEXV 1NU1H 4MVUA 3EFFK 4EFEA 4MVRA 5LYJA 1QLNA 3OM3B 4PHZA 4I55A 2FTKA 2NNUA 2P6JA 3CYOA 3LNMB 1Q5OA 3U11A 2EILC 4DR2O 4YJ3B 1ZTEA 2RNBA 3CRCA 3SGIA 1YITV 2ODMA 1NZ6A 3OE7G 4DUYB 1TUBB 4FZ0A 3LDCA 3T1HO 4PI2A 5JVDB 1FFXA 1M57C 3ZS8C 5KAFZ 1XMQO 4DV0B 2AHYA 3ZBHA 2RDCA 5JCOA 4D6TH 4UCOA 4B3SB 2JDIG 4ZOLB 1YJWV 2LW7A 2AZ2A 3ZMSA 3T1CA 5KUMA 1DK1A 1QLEB 2VS0A 5EBLC 1VQOV 3RWRD 4DUZB 2C2AA 3CXHF 3CD6V 4BW9A 3B09A 4A5UB
chains in the Genus database with same CATH topology
1V54C 1NVPB 2JEXA 2WLJA 4G27B 3RVZA 5BZBA 1VQLV 3SYAA 1PNLA 1OCOC 3ASOC 5CN0A 4U7NA 3ZRSA 1OHHG 3ETDA 3K9AA 5L3DA 1RM1C 1PL0A 3FB6C 2KB1A 1S76D 1JPXA 5B1AC 2EIMB 4GX1A 3ABMB 3E8FA 3R65A 2XNDG 2DWEC 3SPGA 4P9OA 3ZN1A 4J9ZB 5HFMA 3P30A 5LBQA 1H8EG 3JCZA 5L3CA 1F4MA 2HFEC 3ZRXA 3AG2B 3JD2A 1LNQA 5E1AC 2DQ0A 2XAQA 2R9IA 1VQNV 1K8AW 2AHZA 2WLIB 3OEHG 3W7TA 3UM7A 1K92A 4WCEV 4QIWF 2GSMB 4JPRA 4CBCA 3HB3B 1PNKA 3MD0A 4JF3A 4RUFA 4Z1MG 4UVCA 4XBFA 3QO7A 1B6QA 2ZQMA 1NBMG 2QM7A 2QTOA 1VQKV 2H8PC 3STZC 1NR1A 4MVQA 1W0KG 4QJFB 1SESA 2WWWA 5EC2C 3ZIAG 1QVFU 1AJPA 4MW8A 1AJQA 4I9WA 4JGSA 2YEVB 3OUSA 3P32A 3EHBB 4XDJA 2XOKG 1TUEB 2IU3A 3K03A 3OR7C 2A9HA 4DXWA 3QNEA 2OCCB 1UJWB 1AI6A 3TK1A 5L3EA 1KP2A 3CCJV 4N23A 4X89A 4N21A 3DGEA 4UDMB 1OZ0A 2Q67A 3FKSG 2F43G 2ZDIC 1F4NA 4R7CA 3I56V 4ZBMA 2X6BA 3SPCA 2LP7A 5EK0A 1QBZA 1PNMA 3QO5A 4R6ZA 5DM6V 4KP4A 1MSWD 2IH3C 3AG4B 3X2QB 3T2MA 1YI2V 5EBMC 1K5QA 3OMIB 4WFEA 3SPHA 3W7UA 4HAMA 3CCVV 1VQ8V 3CCMV 1CEZA 1K34A 2V7QG 3ABKC 1M56B 3LSSA 3WG7B 4X8AA 3BEHA 1MOFA 2HVJC 4J9YB 1COWG 2Y69C 3SPJA 2HKOA 2IW5A 3ABTA 1DLBA 4MVOA 3AG1B 4PA9A 2OT5A 4QE9A 2BOCC 4BIZA 1YTFB 2WLMA 4BAYA 4R50A 3K04A 1RPOA 3SYOA 4P9PA 1KC8W 3JD3A 2OTLV 3SJQC 3CC7V 2DYSB 2X6AA 4WF9V 5CA3A 2EIKC 3OMAB 4XDKA 1K4CC 3CXCU 1NR7A 5CBHA 3AG3C 1AI7A 1I5YA 1K7DA 3FB7C 4WFHA 1K5SA 4L87A 4H33A 3OFNG 1JOYA 4GX5A 3IGAC 1R6NA 4H37A 2ATKC 3MHSC 5IDJA 2DYRB 1JJ2U 4MTGA 5B1AB 2W0FC 2PI4A 1DF4A 1OCRB 4MT8A 5B1BC 1EFRG 1FS0G 3K06A 3G71V 1KD1W 1AI4A 2PI5A 2EZPA 1F51A 2DQ3A 4MVZA 1OCCB 1GM9A 2EINB 3K0DA 1SERA 3F5WC 5DN6G 2QA4V 3AEIA 4WFAV 1HWYA 4JYCA 5IYCO 2P67A 1FXKC 1H2GA 3DTUB 5L3FA 3B8MA 3E35A 1Q86W 5H6QA 1KKDA 2QE7G 4R8CA 5IY5B 2ZR2A 1SZTA 3JYCA 5GW7A 1P7BA 2IJIA 2X7RB 2XAFA 3JD1A 1QLEC 1QVGU 2D3OW 2HLDG 4JTAB 3ETEA 5IYBO 2XAJA 3D3IA 1M9NA 4MSWC 2EBOA 4TWKA 2HG5C 2ZXWC 3F7YC 1H8HG 1ROPA 3F7VC 3ZRWA 1THZA 4UXNA 2A0LA 2B1GA 2IH1C 3ZMUA 2JK5C 4KUMA 5EBWC 2H94A 4G2KA 1MABG 2B1IA 4RAIA 2ITCC 4RQFA 2ZD9A 4TT3G 2Z5UA 3ASNB 4UV8A 4MVMA 4PA7A 2DW4A 5LGUA 3OW2U 1R3KC 2XAGA 1E79G 2EIMC 4FK5C 3ABMC 1E44B 1BMFG 2WLKA 4FJCC 3VBBA 4WFGA 3CMAV 4P2ZA 4QNHB 1S72V 1GM7A 4GX2A 2WLLB 3AG2C 2WLLA 2XAHA 2W6IG 4EKWA 2R9RB 1FXHA 4G28B 1VQ4V 1K4DC 5H9CA 3T4ZA 1JVMA 3GWOA 1K73W 4UVBA 1S77D 1OCZB 1SRYA 2EILB 3E8HA 3D36A 4JTDB 1QR9A 4PA3A 2HR3A 3ZRVA 1VQMV 3E8BA 1GMGA 2UXNA 3RVYA 4RQEA 1R3JC 3IC7A 1VQ7V 3G4SV 2GHYA 1M57B 4BW5A 4BIUA 3ABLC 2JIZG 3M99B 1E1RG 3K08A 4P30A 4JTCB 4PDRA 1SETA 1Q81W 2OCCC 3CC4V 2EIJB 4UUJC 2XASA 5LGNA 1ORQC 1M90W 3AG3B 1P4RA 1QCEA 3FYEB 1K9MW 3CCSV 1CPYA 4WFFA 3ZCCA 5LGTA 1RPRA 4GCZA 4FMTA 5KA5A 2WLHA 3G6EV 1GKFA 3ETGA 2WPDG 2IJJA 3MHHC 3ZMZA 1K33A 4PDLA 4ZKIA 5LHHA 5B1BB 1V54B 1VQPV 1NKDA 1GM8A 3ZMVA 3AG4C 3TETA 1XL4A 2A79B 5KA6A 1ENVA 1YJNV 1OCOB 3ASOB 1YSCA 1Q7YW 1JQ0A 5H6RA 3CCLV 3B8NA 5LHGA 2WSSG 4MTOA 1FXKA 3ABUA 1RM1B 3CCQV 3E2EA 3PJSK 2V1DA 1M56C 3WG7C 4U7OA 3W7SA 1V55C 3LSQA 4LBEC 3TCUA 3IFXA 3CCEV 1EZJA 4CZZA 1K3EA 5B1OA 3OAAG 1XL6A 2Y48A 2WLNA 4X88A 4LP8A 1VQ9V 3CCUV 1GO3F 3RW0A 1BHBA 3H01A 1KECA 3CCRV 1DTOA 1NVPD 4WFBV 2YSUB 4HZ3A 2DWDC 4FPPA 1AJNA 4UV9A 1F23A 1M1KW 4RUEA 1MG1A 1W2BU 4PA4A 2Q69A 5B1NA 3SYQA 3OMNB 1NH2D 1R3LC 4MW3A 5FL7G 1R6KA 5B3SC 1NH2B 3E89A 4PELA 1K97A 3ML0A 3W7WA 1WLEA 3ZRWB 2DYRC 4FIPC 3SPIA 3W7XA 2HVKC 1OCRC 2IU0A 1Y4MA 3FYIB 3CMEV 2ZR3A 1AI5A 2HJFC 1OCCC 2EINC 4PDVA 2B5UA 2X0LA 3ZMTA 1CP9A 1G4YB 5IYDO 4JAVA 4MTFA 2W6JG 1YJ9V 1R3IC 3A0RA 4MS2A 4RO2A 1ZWIC 2MK3A 2OTJV 1E1QG 2WLIA 1JX9A 3CP1A 3B77A 4TSFG 2ZDIA 3ZJZA 4JASA 1KP3A 1R73A 2Q68A 2QM8A 3K3WA 3UKMA 5IY5C 3SYPA 1S5HC 1FXVA 3JD0A 4MTXA 3WFVA 4F4LA 1VQ5V 1NJIW 3E83A 1W0JG 3FB8C 3E86A 3CC2V 1S0VA 3VOUA 2LFSA 3OEEG 1AR1B 5KUKA 1VQ6V 2K1EA 3E8GA 4LC1A 2JJ1G 3ABLB 4LCUC 3NXSA 2YEVA 3ABKB 1PD3A 2Q6AA 2JJ2G 3K0GA 5J9PC 2BOBC 5CMUA 5C93A 1I5XA 3FB5C 1AROP 2Y69B 3STLC 3ZN0A 2IJKA 1IXMA 5EC1C 2M7WA 3ASNC 3OGCC 3LDEA 2P90A 3KG2A 4QE7A 3SYCA 2Z3YA 2CK3G 5LHIA 4QPJA 2UXXA 4YXWG 3I55V 2QEXV 3K79A 4MVUA 3EFFK 2IJHA 2X6CA 2EIKB 3JD4A 4MVRA 1GK9A 1FFTB 3LDDA 1WPXA 1QLNA 1YIJV 3OM3B 4HYOA 1L1FA 2JEUA 2FTKA 2NNUA 2P6JA 1KQSU 2QKSA 3CYOA 4GX0A 3LNMB 1OCZC 2EZOA 4PDMA 1G8MA 2EILC 4QPKA 5L3BA 5CBFA 2WAMA 4E2LA 2ITDC 5L3GA 4UVAA 1YITV 3RBZA 3OE7G 4JAUA 4GT1A 1V55B 3LDCA 5HFLA 1EBOA 4XDLA 1YTFD 3X2QC 3LUTB 4OXSA 4MVSA 1M57C 3BY6A 3HPLC 1BHAA 1FXKB 2AHYA 1S3JA 2EJRA 1BL8A 4JYBA 4I5SA 1JCHA 1GTOA 1YHQV 1N8RW 1PKXA 2JDIG 1YJWV 3GB7C 3OUFA 2NLJC 2EIJC 1NQTA 3ZMSA 3OR6C 4Q20A 3T1CA 3AG1C 5KUMA 3QO8A 2P7TC 1Y66A 1QLEB 2LFRA 4KFMA 5EBLC 1VQOV 2C2AA 1J95A 5CBGA 4ASUG 3CD6V 4DO2A 5B3SB 2DYSC 2ZXWB 1QR8A 1DF5A 4PA6A 3T4DA 3CPWU 1Q82W 1H38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH A;  1UJW B;  2B5U A;  1E44 B;  4UDM B;  2YSU B; 
#chains in the Genus database with same CATH topology
 1KKC A;  1WAZ A;  4J7Z A;  1NVP B;  4NXM O;  5JH7 A;  2ZM6 B;  2WLJ A;  3UCS C;  3UT5 A;  1VQL V;  1PNL A;  3K5L A;  2LGW A;  3ICX A;  3A0B Z;  1OHH G;  1QQC A;  3K9A A;  4I4T A;  2KB1 A;  1JPX A;  4DR6 O;  3ABM B;  3CJH B;  3E8F A;  1EN4 A;  1HP8 A;  1F7Y A;  2KKW A;  3O65 A;  5HFM A;  5L3C A;  3ZRX A;  5LP6 A;  3AG2 B;  4DW1 A;  1XBL A;  5JJE B;  4DV7 O;  1KYO F;  3CWB H;  2XAQ A;  2R9I A;  4UCV A;  1K8A W;  2AHZ A;  2WLI B;  3W7T A;  3UM7 A;  4JPR A;  4CBC A;  4NTX A;  4RUF A;  4XBF A;  1NBM G;  3HKC B;  1AIL A;  4DK1 A;  3JAS B;  1I94 B;  2Q7G A;  3JSN A;  2WWW A;  3E22 A;  1XMO B;  1LUW A;  4LH6 A;  3P32 A;  4LFC O;  4DR7 O;  3OR7 C;  5KX5 A;  2R9A A;  1A32 A;  2OCC B;  5JQG A;  5L3E A;  4YY3 O;  4N21 A;  4LF4 B;  2B9Z A;  2F43 G;  1F4N A;  5BY1 A;  2BCC H;  4R7C A;  1R6T A;  3SPC A;  1P49 A;  1VMG A;  3ZHS A;  5DM6 V;  3BA9 A;  3CE2 A;  3FAV B;  2IH3 C;  3X2Q B;  1XHZ A;  1RSO B;  4YJ2 B;  4JI8 B;  3SPH A;  4JI1 O;  2PYJ A;  1GRJ A;  4IHJ B;  1M56 B;  4EB6 A;  3L73 H;  3WG7 B;  1IBK O;  2Q8V A;  4DK0 A;  2Y0I A;  2AZ0 A;  3J81 N;  2IW5 A;  4LF6 B;  3AG1 B;  3GVM A;  2WLM A;  4ICG A;  4TV8 A;  1RPO A;  3QG5 A;  3JAW B;  2E5L B;  2X6A A;  4WF9 V;  1NR7 A;  3AG3 C;  1NTZ H;  2RJZ A;  4DV3 B;  4L8J A;  4H37 A;  2QWR B;  1QHT A;  1N4C A;  1PPJ H;  4DV1 B;  1WB7 A;  4IT5 A;  4MT8 A;  3G71 V;  1P84 F;  1AI4 A;  2DQ3 A;  2QWN B;  3RYH B;  1OCC B;  1SER A;  2HP8 A;  3F5W C;  5DN6 G;  3AEI A;  3D8C A;  3K5O A;  5IYC O;  3DTU B;  4WBN A;  5JCO C;  4X1I B;  4AHC A;  4IYH A;  2HJD A;  3UQ8 A;  4AI8 A;  3H9V A;  3HKB B;  3D3Q A;  2F4V O;  1P7B A;  2X7R B;  5GON B;  4NYK A;  4QGP A;  3ETE A;  5B5E Z;  3T1Y B;  1M9N A;  1YF2 A;  2EBO A;  2BTQ A;  2QWP B;  2HG5 C;  3JCU Z;  3F7V C;  2GV9 A;  3CRA A;  2UUC B;  4KUM A;  2H94 A;  4DV4 O;  2B1I A;  2ITC C;  3IAY A;  3J80 N;  1SQF A;  4PA7 A;  4O4J A;  5LGU A;  2XAG A;  1E79 G;  3ZHR A;  3P3P A;  4JZG A;  4WFG A;  1Y74 B;  5E79 Z;  1GM7 A;  2Y0P A;  5LP6 C;  2WLL B;  3WB2 A;  5FLX N;  3JAT B;  3QVN A;  5LMN B;  3DSQ A;  1FXH A;  1VQ4 V;  4LF8 O;  4ZI7 B;  1IBM B;  4GKJ B;  3RT3 C;  1SRY A;  2EIL B;  5IE9 A;  3E8H A;  2HHH B;  2YDE A;  3OD4 A;  3U0Z A;  1GMG A;  4LFA B;  2Q0A A;  4RQE A;  1R3J C;  3G4S V;  2UUB B;  2GHY A;  3K9S A;  1M57 B;  3L70 H;  4CC5 A;  1SA0 A;  3BRC A;  4NTW A;  2ZE8 A;  1N0J A;  2G38 A;  4ABM A;  2UUA O;  1ZUQ A;  1N36 B;  1US6 A;  4CC6 A;  4UUJ C;  5LXT B;  5KMG A;  1ORQ C;  1M90 W;  1HR0 B;  3FYE B;  1K9M W;  3CCS V;  2CAZ C;  3ZCC A;  3AK2 A;  2QGN A;  4FMT A;  5KA5 A;  1B04 A;  1GKF A;  2PGG A;  5IJ0 A;  5EZY B;  3TET A;  1XL4 A;  1JQ0 A;  1VEW A;  4JYY A;  1FXK A;  2CTQ A;  3CCQ V;  1YZB A;  4U7O A;  3RFR A;  2XUM A;  2LO1 A;  5C8Y B;  3RYI B;  1EZJ A;  4CZZ A;  5D5Q A;  4O2B A;  1XL6 A;  2KG7 B;  2Y48 A;  4LP8 A;  1VQ9 V;  4EEQ A;  4TV9 A;  2UXC O;  4U3F H;  1N33 O;  3RW0 A;  1BHB A;  5FPR A;  3CCR V;  1NVP D;  4WFB V;  3NR7 A;  1UFI A;  1M1K W;  5KHH A;  4PA4 A;  5B1N A;  1R3L C;  4MW3 A;  1R6K A;  1D2D A;  1HNW O;  3E89 A;  3HR0 A;  1WLE A;  1OCR C;  2IU0 A;  5J2U A;  2N05 A;  1Y4M A;  2OIG A;  2ZR3 A;  2F95 B;  4PDV A;  2B5U A;  3ZMT A;  4X65 B;  1BT8 A;  2AXT Z;  5IYD O;  4MTF A;  1R3I C;  4LF9 B;  4JI5 O;  1ZWI C;  2MK3 A;  3Q4H B;  5TIS Z;  2OTJ V;  4DR2 B;  1KP3 A;  1R73 A;  3K3W A;  5IY5 C;  4FM2 A;  3SYP A;  1Z5W A;  1S5H C;  2CTP A;  1N32 B;  3JD0 A;  4MTX A;  1VQ5 V;  3RYF B;  3FB8 C;  5AG2 A;  5KUK A;  5GTH Z;  3K5M A;  3ABL B;  4LCU C;  3NXS A;  1PD3 A;  2YXL A;  3K0G A;  1N0N A;  3VQV A;  5CMU A;  1ARO P;  4DW0 A;  1IXM A;  1NS1 A;  3ASN C;  3OGC C;  3B40 A;  5CB4 B;  4HNA A;  3SYC A;  2CK3 G;  4QPJ A;  3VQX A;  1WA8 A;  4F6R A;  4O2A B;  3LDD A;  4I55 B;  2JEU A;  1AVM A;  5EIB C;  4J80 A;  2EZO A;  4PDM A;  1MSD A;  4JI4 B;  2RN9 A;  3L9D A;  2WAM A;  3M7M X;  4UVA A;  1H2N A;  1EM1 A;  1SQV H;  4XDL A;  2GUZ A;  4X64 O;  3X2Q C;  5IYZ A;  1Z5V A;  5IJ9 B;  4OXS A;  2RCV A;  3HKE A;  4JI2 B;  1BHA A;  2EJR A;  4JYB A;  4I5S A;  3SJB C;  2BTO A;  2L35 A;  1N8R W;  1W59 A;  2NLJ C;  3OR6 C;  3AG1 C;  4B3M O;  1J95 A;  2ZE7 A;  5CBG A;  5JJN B;  1HNZ B;  1Y6X A;  5B3S B;  4PA6 A;  2CGN A;  3T4D A;  1Q82 W;  4B3T B;  2PYL A;  5JH7 B;  3ZHQ A;  3UT5 B;  2K9P A;  3RVZ A;  4J7J A;  4DYL A;  5BXZ A;  2HEP A;  2UXB B;  4U7N A;  3ZRS A;  3OTF A;  4U3J B;  3N2K A;  2PF4 E;  4NVP A;  3FB6 C;  5A9G A;  3R65 A;  2DWE C;  3CRM A;  4P9O A;  4OX9 O;  4J9Z B;  3L74 H;  3JCZ A;  1F4M A;  2R72 A;  5LP6 B;  1YCI A;  3QF7 A;  5CA1 A;  2Q7H A;  2UU9 O;  1K92 A;  4LF7 B;  4QIW F;  4JF3 A;  1PNK A;  4Z1M G;  5BMV B;  1IBK B;  2Q73 A;  2XTA A;  4CH4 A;  4MVQ A;  4JAA A;  1XDC A;  4DV6 O;  4QJF B;  1SES A;  1QVF U;  3E22 B;  1AJQ A;  1BCC H;  1Q90 D;  4DR1 B;  4XDJ A;  2XOK G;  4K3A A;  5CA0 A;  5EYP A;  3K03 A;  4GYC B;  1AI6 A;  5JQG B;  1MMM A;  2DOS A;  3MDS A;  3KKY A;  2YC0 A;  3AK1 A;  1OZ0 A;  3FKS G;  5D5P A;  1YVW A;  3I56 V;  4ZBM A;  2X6B A;  2BSK A;  1QBZ A;  4KP4 A;  4I9Q A;  3T2M A;  3EVK A;  1YI2 V;  2CH7 A;  4W4K A;  2Z0A A;  3W7U A;  5LMU O;  4HAM A;  4YHH O;  1VQ8 V;  3CCM V;  1CEZ A;  1K34 A;  1XIL A;  1GAX A;  5KAI Z;  4UCU A;  4EB6 B;  2GDS A;  4DV2 O;  4X8A A;  5IT9 N;  2HVJ C;  1COW G;  2Y69 C;  3A8T A;  4EFB A;  5K1X A;  2F4V B;  4MVO A;  4BIZ A;  1YTF B;  2BOC C;  3K04 A;  4TV8 B;  2JGU A;  1DGS A;  3SYO A;  4UCT A;  2OTL V;  2DYS B;  1SF9 A;  4XDK A;  1AP5 A;  5CBH A;  1AR4 A;  1M93 A;  2QSA A;  1K7D A;  3FB7 C;  4DV4 B;  4H33 A;  4K8Z A;  1L8D A;  1JOY A;  3IGA C;  2ATK C;  3MHS C;  4JV5 B;  3K59 A;  1QU7 A;  4CH5 A;  4DR4 O;  5IDJ A;  5BR8 B;  1JJ2 U;  3I5D A;  1BQZ A;  2W0F C;  1DF4 A;  1H2S B;  1OCR B;  3K06 A;  4IL6 Z;  2EZP A;  2OIE A;  4AQY O;  3HKD A;  4GKK O;  5JJJ B;  2QA4 V;  1LUV A;  2QR4 A;  1HWY A;  4PJ0 Z;  2P67 A;  5LOV A;  3RYC A;  1EN5 A;  3B4S A;  2ADQ B;  4LR3 A;  4NB5 A;  1N34 B;  1OJH A;  3J7A U;  2A3Q A;  3B8M A;  3E35 A;  5DED A;  4F6E A;  1NT2 B;  3H1K H;  2ETN A;  2E3C A;  5IY5 B;  1SZT A;  3BCC H;  3JD1 A;  1Y76 A;  2HLD G;  1JJO A;  2BTQ B;  1IXB A;  2ZXW C;  1ROP A;  3ZRW A;  4UXN A;  1H2K A;  2IH1 C;  1HW7 A;  3LSU A;  4LWS B;  2JK5 C;  1U96 A;  5EBW C;  4RAI A;  1WP8 A;  2WA3 A;  2Z5U A;  3ASN B;  4X1K B;  4O4J B;  2ILM A;  3JAR A;  4J7K A;  1R3K C;  2VQE B;  4FK5 C;  3IC9 A;  4FJC C;  3VBB A;  3DXR B;  1M4U A;  1Z2G A;  3CMA V;  4GX2 A;  5J2T A;  2W6I G;  4EKW A;  4G28 B;  4LH7 A;  1BGY H;  1K73 W;  1ZX3 A;  1WP7 A;  3D36 A;  4O4H A;  5FNV B;  4JTD B;  2HR3 A;  1MA1 A;  4FFB B;  1R1B A;  4X66 O;  4JI3 O;  3IC7 A;  3G6B A;  3CHX A;  4BIU A;  1MNG A;  3ABL C;  3K08 A;  4P30 A;  3OTO B;  1FD9 A;  1SET A;  1VAR A;  1J5E B;  3CC4 V;  4FLT A;  2XAS A;  5LGN A;  5KMG B;  1P4R A;  1JFF A;  3KCY A;  4TUY B;  4IIJ B;  4WFF A;  5IWA O;  1O9H A;  4GCZ A;  2FYU H;  1HNW B;  4YJ3 A;  3CEI A;  2IJJ A;  5IJ0 B;  3ZMZ A;  1TUB A;  5B1B B;  4J41 A;  1VQP V;  1NKD A;  1GM8 A;  2PTM A;  4LNU B;  2VQF B;  1YJN V;  5H6R A;  4MTO A;  3ZX6 A;  2DMX A;  4KHP O;  2FKX A;  4JI0 B;  3E2E A;  2OYQ A;  1BQ0 A;  4DV5 O;  2E76 B;  1XNQ B;  3LSQ A;  4ZOL A;  3AG7 A;  5LL6 Y;  3CCE V;  2XT9 A;  1VIB A;  2QKA A;  1SQX H;  2P4V A;  3U10 A;  4O2B B;  1B3Q A;  1GN2 A;  2WLN A;  2GBO A;  4X88 A;  4TV9 B;  1GO3 F;  1VF7 A;  1DTO A;  2YSU B;  2ADP A;  4HZ3 A;  1SQQ H;  1F23 A;  2M6Y A;  4RUE A;  3ZHU A;  1W2B U;  2LW1 A;  2Q69 A;  3SYQ A;  4JYA B;  5B3S C;  1NH2 B;  4PEL A;  3ML0 A;  3W7X A;  2DYR C;  4FIP C;  4CH6 A;  1FJG B;  2NN4 A;  4DUY O;  4I0X B;  3N2G B;  3CME V;  1PP9 H;  2HJF C;  2Y4U A;  2YXH A;  2EIN C;  2JGD B;  5H2F Z;  2W6J G;  1YJ9 V;  4MS2 A;  2PY5 A;  2IBZ H;  1IBL O;  2WLI A;  2JS3 A;  5JWP A;  1TVK B;  3B77 A;  1BSM A;  4O4L B;  4TSF G;  3ZJZ A;  4B7E A;  4JAS A;  1NI8 A;  3UKM A;  4J42 A;  1FXV A;  1S5J A;  1NJI W;  2YIB D;  4X9Q A;  1H2L A;  2MW2 B;  3VOU A;  1XQ8 A;  4DUZ O;  4JI6 B;  2Q6A A;  2JJ2 G;  1GN6 A;  3CRR A;  3JAL A;  1I5X A;  2ZM6 O;  2Y69 B;  3LDE A;  1ZL8 B;  2Z3Y A;  4DR5 O;  1AB3 A;  1SQB H;  3VQY A;  2LGQ A;  2P06 A;  3K79 A;  4LFB B;  1FFT B;  1YIJ V;  4B08 A;  4NTQ A;  1KQS U;  1Q43 A;  4NTY A;  4GX0 A;  1RSO A;  4KXR A;  5CBF A;  1NTM H;  5L3G A;  3D36 C;  4TOI A;  4IHJ A;  4JAU A;  2AW9 A;  3EXA A;  4GT1 A;  2YID A;  4OPH A;  1V55 B;  1EBO A;  2GUZ B;  1YTF D;  5IYZ B;  4JI7 O;  4OX9 B;  1I94 O;  3HKE B;  1S3J A;  1XMO O;  4LF5 B;  3S3X A;  1JCH A;  1AR5 A;  4X62 B;  1GTO A;  1YHQ V;  2UXD O;  4OGQ B;  2JS5 A;  4I50 A;  3OUF A;  2EIJ C;  1NQT A;  2OCH A;  4Q20 A;  1URF A;  2P7T C;  2F93 B;  3ZED A;  4GLX A;  4ASU G;  4LF4 O;  1XNR B;  2DYS C;  2ZXW B;  1QR8 A;  3CPW U;  2OWO A;  3B2E E;  4DRX B;  1H38 A;  4KL1 A;  1V54 C;  4FM0 A;  1MZF A;  2Q9L A;  2JEX A;  2A06 H;  4G27 B;  3RYH A;  1OCO C;  4JI8 O;  3ETD A;  1RM1 C;  3N2K B;  3JAK B;  2DE0 X;  3CX5 F;  3THO A;  1S76 D;  1MZE A;  3TGU H;  1S5L Z;  4LF6 O;  5LBQ A;  2HFE C;  3CSX A;  5ITZ B;  1LNQ A;  1Y67 A;  2DQ0 A;  4CH3 A;  4FLZ A;  4AIL C;  5KHG A;  3OEH G;  2E5L O;  4WCE V;  5F2V O;  3HB3 B;  3MD0 A;  3QO7 A;  4DV2 B;  1B6Q A;  1VF6 A;  2ZQM A;  2GTA A;  3T1H B;  4DV3 O;  1NR1 A;  5EC2 C;  3ZIA G;  2P5O A;  1XMQ B;  1AJP A;  4I9W A;  2F23 A;  2ZIM A;  1SS3 A;  2YEV B;  3EHB B;  1V9P A;  5EYP B;  1TUE B;  3FX7 A;  2YIC A;  2A9H A;  4DXW A;  2YI8 A;  1UJW B;  1Y74 A;  5EIB D;  4X89 A;  2QJ1 A;  3DGE A;  4ZI7 A;  2H3O A;  2Q67 A;  3K58 A;  5FPO A;  4IGG A;  3F5T A;  2BSK B;  5EK0 A;  5LYJ B;  3A0H Z;  1SKV A;  4NXM B;  4K0K O;  1PNM A;  4R6Z A;  2FL4 A;  4AQY B;  1MSW D;  4X20 A;  5DEC A;  3BA8 A;  5EBM C;  3T1Y O;  2CH7 B;  1K5Q A;  3OMI B;  2Q4P A;  2EUL A;  2Q0O C;  4RWU A;  2QDO A;  3ABK C;  4DR6 B;  3LSS A;  3BEH A;  3MAQ A;  2UUC O;  3SPJ A;  2HKO A;  3ABT A;  1DLB A;  1HDJ A;  4QE9 A;  2OT5 A;  1FFX B;  4DV7 B;  4R50 A;  1JR9 A;  4P9P A;  1KC8 W;  3JD3 A;  2Y4T A;  2NR5 A;  2ZT9 B;  4K35 A;  3CC7 V;  5KHK A;  5CA3 A;  2ZIO A;  2EIK C;  3OMA B;  4UCR A;  1Q3E A;  1AI7 A;  4ZHQ A;  1GH6 A;  3OFN G;  4YIP A;  2N04 A;  1IBM O;  1SQP H;  4K8X A;  4GKJ O;  3K57 A;  2DYR B;  4LFC B;  4MTG A;  5B1A B;  2PI4 A;  5B1B C;  4DR7 B;  1EFR G;  1FS0 G;  4LFA O;  3HKD B;  1GM9 A;  2EIN B;  3K0D A;  1Q8I A;  4H44 B;  2UUB O;  4JYC A;  4YY3 B;  3RYC B;  1FXK C;  2KG7 A;  5L3F A;  4I4T B;  1H2M A;  5H6Q A;  2QE7 G;  1N36 O;  4R8C A;  3BAB A;  3JYC A;  2XAF A;  2ARH A;  1QVG U;  2D3O W;  1Y76 B;  2QWQ B;  5IYB O;  1Q6I A;  4JI3 B;  1X59 A;  4MSW C;  4JI1 B;  2A0L A;  4NXN O;  4G2K A;  1MAB G;  2VRZ A;  4RQF A;  4B3R O;  2ZD9 A;  1GN4 A;  1WJZ A;  4MVM A;  5IWA B;  3ZHV A;  3OW2 U;  4UB8 Z;  3JAR B;  1D5N A;  5LA6 A;  2EIM C;  3M8A A;  3Q4H A;  1E44 B;  5KX5 B;  4GZR B;  4P2Z A;  4QNH B;  2P4K A;  1S72 V;  3L75 H;  2A7W A;  2R9R B;  3BFR A;  4UVB A;  1S77 D;  2D2C B;  1HNX O;  2CUG A;  4O4H B;  3ZRV A;  4C7U A;  5A2Q N;  1CXZ B;  1VQM V;  3IJ4 A;  3E8B A;  2UXN A;  2VWK A;  2KQX A;  2VWJ A;  2EX3 A;  5CB4 A;  4BW5 A;  3APO A;  1SC5 B;  1WPB A;  2JIZ G;  3O9O A;  3M99 B;  1SQG A;  4JTC B;  4PDR A;  4O2A A;  1LR1 A;  2EIJ B;  4X65 O;  1XOU A;  1JFF B;  1CPY A;  4LF9 O;  1RPR A;  2ZE5 A;  2WLH A;  3ETG A;  2N74 A;  1FPO A;  1L0N H;  2YUA A;  1K33 A;  1N32 O;  1V54 B;  3ZMV A;  3JAM N;  3AG4 C;  1Q6U A;  5IJ9 A;  1OCO B;  1UPG A;  1Q7Y W;  3CCL V;  2WSS G;  4BR6 A;  4X1Y A;  1RM1 B;  3ABU A;  3PJS K;  1IDS A;  1IBL B;  2V1D A;  1V55 C;  4LBE C;  3APQ A;  3IFX A;  1K3E A;  1OV9 A;  2XHB A;  3DC6 A;  2FB5 A;  3OAA G;  4UB6 Z;  4LF8 B;  4WBN B;  5KHI A;  4FVM A;  1PM9 A;  2DWD C;  3TXQ A;  4W4L A;  3OMN B;  5FL7 G;  1PV0 A;  4JI4 O;  3W7W A;  4U3J A;  1K97 A;  4DR5 B;  2HVK C;  2UUA B;  1WNS A;  3FYI B;  3N27 A;  1AI5 A;  3CB2 A;  3C90 A;  1B06 A;  4JI2 O;  4JAV A;  1KUQ A;  4O4I A;  1E1Q G;  1YEW A;  1JX9 A;  2ZCE A;  3CP1 A;  2ZDI A;  2Q68 A;  2QM8 A;  3RN4 A;  3WFV A;  1KU9 A;  4F4L A;  5BMV A;  2JVD A;  3TXS A;  4JI7 B;  3CC2 V;  1Q6H A;  2YIB A;  1HNZ O;  1AR1 B;  2K1E A;  2JJ1 G;  3ABK B;  2UXD B;  4B3T O;  4TQD A;  4Q6G A;  4CS3 A;  3SDL A;  3JAL B;  4DR3 O;  3STL C;  2ZIN A;  2IJK A;  5EC1 C;  2P90 A;  3KCX A;  4QE7 A;  2UXB O;  1SA0 B;  5LHI A;  2UXC B;  1N33 B;  1IVS A;  3P3N A;  4YXW G;  4FLY A;  3I55 V;  2IJH A;  2X6C A;  1IX9 A;  2EIK B;  3JD4 A;  1GK9 A;  1XUQ A;  1WPX A;  3GWK C;  4HYO A;  1XEQ A;  1L1F A;  5H5N A;  3KZI Z;  2QKS A;  1OCZ C;  1XRE A;  2E75 B;  1G8M A;  4QPK A;  5L3B A;  4E2L A;  4E4E A;  2ITD C;  4LF7 O;  3RBZ A;  5HFL A;  4PI0 A;  2O57 A;  3LUT B;  4H13 B;  4MVS A;  5JVD A;  1P7G A;  3BY6 A;  3HPL C;  3H1J H;  1FXK B;  1BS3 A;  1BL8 A;  4JI5 B;  4DR1 O;  2ZNJ A;  1PKX A;  3GB7 C;  4I7Z B;  4I50 B;  4TQF A;  3BVO A;  2YXY A;  3QO8 A;  1Y66 A;  2YIA A;  1TAE A;  2LFR A;  3BAA A;  4KFM A;  2CE4 A;  2W0X A;  1D5A A;  3ETQ A;  4DO2 A;  2KSD A;  1DF5 A;  2QKC A;  1O9G A;  4PV1 B;  3R66 A;  5BZB A;  3SYA A;  3ASO C;  5CN0 A;  3TJT A;  3SJC C;  2LJ2 A;  1X4T A;  5L3D A;  1PL0 A;  1SZX A;  4HBN A;  5B1A C;  2EIM B;  4GX1 A;  5J2U B;  3CJH A;  2LQT A;  3G80 A;  2XND G;  3SPG A;  3ZN1 A;  4K0K B;  3P30 A;  1H8E G;  2ZKO A;  3JD2 A;  4DV0 O;  5E1A C;  1YXB A;  1VP7 A;  1VQN V;  4B3S O;  2GSM B;  4PD4 F;  4UVC A;  4LWS A;  2QM7 A;  2QTO A;  3HKC A;  4X64 B;  1VQK V;  3JAS A;  2Q5Z A;  2H8P C;  3STZ C;  3WU2 Z;  1W0K G;  4X1K A;  1YDX A;  4MW8 A;  4JV5 O;  5BR8 O;  4JGS A;  3OUS A;  1EZV H;  3CS5 A;  2IU3 A;  3DXR A;  3QNE A;  3TK1 A;  4B3M B;  2FML A;  1KP2 A;  2QM4 A;  3CCJ V;  2V4D A;  4N23 A;  4HNA B;  3K5N A;  1N34 O;  2ZNI A;  4UDM B;  4FLV A;  2DJV A;  1M5I A;  2CTR A;  2ZDI C;  3AK3 A;  1WA8 B;  4F6R B;  2LP7 A;  5FNV A;  1GN3 A;  2E74 B;  3QO5 A;  4FFB A;  2IM9 A;  4FLU A;  3FAV A;  3AG4 B;  4X20 B;  3H1I H;  4WFE A;  4YJ2 A;  2AGA A;  3BHP A;  3L71 H;  3CCV V;  2V7Q G;  2PUS A;  1ZLZ A;  2JRI A;  1MOF A;  4J9Y B;  1RP3 B;  3CRQ A;  4PA9 A;  4BAY A;  2GTS A;  4TUY A;  4IIJ A;  4ZIB A;  2UU9 B;  3JAW A;  2P22 C;  2VQE O;  3DC5 A;  3SJQ C;  4FM1 A;  4UFZ A;  1K4C C;  3UO2 A;  3WB0 A;  4NXN B;  3CXC U;  3OT7 A;  1I5Y A;  5B66 Z;  1KB9 F;  4WFH A;  4ZHQ B;  1K5S A;  4L87 A;  4LNU A;  4B3R B;  4GX5 A;  4DV6 B;  1R6N A;  4FLW A;  4BWA A;  4BIO A;  1KBH A;  1XHX A;  1G6U A;  2EJ7 A;  3C3T A;  1KD1 W;  2PI5 A;  1F51 A;  4MVZ A;  4WFA V;  1H2G A;  3BPZ A;  1BE3 H;  1Q86 W;  4X1I A;  2WA4 A;  1KKD A;  1HNX B;  3OTO O;  4J10 A;  3HKB A;  2ZR2 A;  1J5E O;  5GW7 A;  2IJI A;  1QLE C;  1KMI Z;  5CA1 B;  5GON A;  4JTA B;  2XAJ A;  3C3S A;  3D3I A;  4TWK A;  5LMU B;  3VQW A;  3WB1 A;  3F7Y C;  4YHH B;  1H8H G;  1THZ A;  2B1G A;  3ZMU A;  4I0X A;  2PZS A;  3N2G A;  1EN6 A;  2CDY A;  5KHJ A;  2VQF O;  4TT3 G;  2JGD A;  2ZE6 A;  4UV8 A;  4D7S A;  2DW4 A;  1I0H A;  5LA6 B;  4IYI A;  4JI0 O;  4YIO A;  4NKG B;  3ABM C;  4DV1 O;  1BMF G;  5CA0 B;  2WLK A;  1TVK A;  4O4L A;  1XNQ O;  3S3W A;  3LNN A;  2WLL A;  3AG2 C;  2XAH A;  3JAT A;  4NR1 A;  1K4D C;  5H9C A;  3T4Z A;  1JVM A;  3GWO A;  4CS2 A;  1OCZ B;  4H0L B;  3OGI B;  4B7K A;  1T5E A;  4DR4 B;  3SR2 C;  1QR9 A;  4J11 A;  4PA3 A;  3RVY A;  1XI1 A;  2CTW A;  4GKK B;  2DN9 A;  1VQ7 V;  4D7T A;  1ZL8 A;  4JYA O;  1G1X B;  1E1R G;  1FJG O;  3G67 A;  1FKA O;  5K1P A;  1Q81 W;  2OCC C;  3H1H H;  5LXT A;  2BE3 A;  3FFQ A;  3AG3 B;  1QCE A;  5LGT A;  1NTK H;  4Z1V A;  3G6E V;  3PN1 A;  2WPD G;  3MHH C;  4PDL A;  4ZKI A;  2CGO A;  5LHH A;  5EZY A;  1WB8 A;  5LMN O;  2A79 B;  5KA6 A;  1ENV A;  3ASO B;  1YSC A;  2F1M A;  1PL4 A;  3B8N A;  5LHG A;  4JI6 O;  4X1Y B;  1I7F A;  2HHH O;  2QTS A;  1M56 C;  3QTC A;  3WG7 C;  3W7S A;  4FZ1 A;  5C8Y A;  1BZK A;  3RYI A;  3TCU A;  4FFK A;  1JA8 A;  3UO3 A;  4Z2W A;  5LOV B;  5B1O A;  3ZHT A;  3CCU V;  3L72 H;  3H01 A;  1KEC A;  4LFB O;  4DRX A;  2F66 C;  4FPP A;  1AJN A;  4UV9 A;  1RFY A;  1FYJ A;  4DR3 B;  1HR0 O;  1MG1 A;  4X66 B;  5GTI Z;  1U97 A;  1NH2 D;  1I08 A;  1JMK C;  1QNM A;  3ZRW B;  3SPI A;  3JAK A;  1TGO A;  2QWO B;  3A2F A;  3JSL A;  5KLV H;  1OCC C;  2X0L A;  1CP9 A;  1G4Y B;  1VF5 B;  3SJA C;  5ITZ A;  4FLX A;  3A0R A;  4O4I B;  4RO2 A;  4LF5 O;  3FD9 A;  4X62 O;  1AP6 A;  1WN7 A;  2YI9 A;  1ZSP A;  2L6L A;  1L0L H;  2RMK B;  5J2T B;  2R70 A;  3E83 A;  1W0J G;  3RYF A;  3E86 A;  1S0V A;  1TA8 A;  2LFS A;  3OEE G;  1IZ3 A;  1XNR O;  3RGB A;  1VQ6 V;  4LC1 A;  3E8G A;  4KHP B;  4CS4 A;  2YEV A;  4DV5 B;  1FAF A;  1VF6 C;  5J9P C;  2BOB C;  2RQ6 A;  4OPA A;  5C93 A;  3FB5 C;  3ZN0 A;  2YS8 A;  2Q7E A;  2M7W A;  3KG2 A;  4GUN A;  4JZ2 A;  3H1L H;  1ZAU A;  4UCS A;  2UXX A;  1IUR A;  2QEX V;  1NU1 H;  4MVU A;  3EFF K;  4EFE A;  4MVR A;  5LYJ A;  1QLN A;  3OM3 B;  4PHZ A;  4I55 A;  2FTK A;  2NNU A;  2P6J A;  3CYO A;  3LNM B;  1Q5O A;  3U11 A;  2EIL C;  4DR2 O;  4YJ3 B;  1ZTE A;  2RNB A;  3CRC A;  3SGI A;  1YIT V;  2ODM A;  1NZ6 A;  3OE7 G;  4DUY B;  1TUB B;  4FZ0 A;  3LDC A;  3T1H O;  4PI2 A;  5JVD B;  1FFX A;  1M57 C;  3ZS8 C;  5KAF Z;  1XMQ O;  4DV0 B;  2AHY A;  3ZBH A;  2RDC A;  5JCO A;  4D6T H;  4UCO A;  4B3S B;  2JDI G;  4ZOL B;  1YJW V;  2LW7 A;  2AZ2 A;  3ZMS A;  3T1C A;  5KUM A;  1DK1 A;  1QLE B;  2VS0 A;  5EBL C;  1VQO V;  3RWR D;  4DUZ B;  2C2A A;  3CXH F;  3CD6 V;  4BW9 A;  3B09 A;  4A5U B; 
#chains in the Genus database with same CATH homology
 1V54 C;  1NVP B;  2JEX A;  2WLJ A;  4G27 B;  3RVZ A;  5BZB A;  1VQL V;  3SYA A;  1PNL A;  1OCO C;  3ASO C;  5CN0 A;  4U7N A;  3ZRS A;  1OHH G;  3ETD A;  3K9A A;  5L3D A;  1RM1 C;  1PL0 A;  3FB6 C;  2KB1 A;  1S76 D;  1JPX A;  5B1A C;  2EIM B;  4GX1 A;  3ABM B;  3E8F A;  3R65 A;  2XND G;  2DWE C;  3SPG A;  4P9O A;  3ZN1 A;  4J9Z B;  5HFM A;  3P30 A;  5LBQ A;  1H8E G;  3JCZ A;  5L3C A;  1F4M A;  2HFE C;  3ZRX A;  3AG2 B;  3JD2 A;  1LNQ A;  5E1A C;  2DQ0 A;  2XAQ A;  2R9I A;  1VQN V;  1K8A W;  2AHZ A;  2WLI B;  3OEH G;  3W7T A;  3UM7 A;  1K92 A;  4WCE V;  4QIW F;  2GSM B;  4JPR A;  4CBC A;  3HB3 B;  1PNK A;  3MD0 A;  4JF3 A;  4RUF A;  4Z1M G;  4UVC A;  4XBF A;  3QO7 A;  1B6Q A;  2ZQM A;  1NBM G;  2QM7 A;  2QTO A;  1VQK V;  2H8P C;  3STZ C;  1NR1 A;  4MVQ A;  1W0K G;  4QJF B;  1SES A;  2WWW A;  5EC2 C;  3ZIA G;  1QVF U;  1AJP A;  4MW8 A;  1AJQ A;  4I9W A;  4JGS A;  2YEV B;  3OUS A;  3P32 A;  3EHB B;  4XDJ A;  2XOK G;  1TUE B;  2IU3 A;  3K03 A;  3OR7 C;  2A9H A;  4DXW A;  3QNE A;  2OCC B;  1UJW B;  1AI6 A;  3TK1 A;  5L3E A;  1KP2 A;  3CCJ V;  4N23 A;  4X89 A;  4N21 A;  3DGE A;  4UDM B;  1OZ0 A;  2Q67 A;  3FKS G;  2F43 G;  2ZDI C;  1F4N A;  4R7C A;  3I56 V;  4ZBM A;  2X6B A;  3SPC A;  2LP7 A;  5EK0 A;  1QBZ A;  1PNM A;  3QO5 A;  4R6Z A;  5DM6 V;  4KP4 A;  1MSW D;  2IH3 C;  3AG4 B;  3X2Q B;  3T2M A;  1YI2 V;  5EBM C;  1K5Q A;  3OMI B;  4WFE A;  3SPH A;  3W7U A;  4HAM A;  3CCV V;  1VQ8 V;  3CCM V;  1CEZ A;  1K34 A;  2V7Q G;  3ABK C;  1M56 B;  3LSS A;  3WG7 B;  4X8A A;  3BEH A;  1MOF A;  2HVJ C;  4J9Y B;  1COW G;  2Y69 C;  3SPJ A;  2HKO A;  2IW5 A;  3ABT A;  1DLB A;  4MVO A;  3AG1 B;  4PA9 A;  2OT5 A;  4QE9 A;  2BOC C;  4BIZ A;  1YTF B;  2WLM A;  4BAY A;  4R50 A;  3K04 A;  1RPO A;  3SYO A;  4P9P A;  1KC8 W;  3JD3 A;  2OTL V;  3SJQ C;  3CC7 V;  2DYS B;  2X6A A;  4WF9 V;  5CA3 A;  2EIK C;  3OMA B;  4XDK A;  1K4C C;  3CXC U;  1NR7 A;  5CBH A;  3AG3 C;  1AI7 A;  1I5Y A;  1K7D A;  3FB7 C;  4WFH A;  1K5S A;  4L87 A;  4H33 A;  3OFN G;  1JOY A;  4GX5 A;  3IGA C;  1R6N A;  4H37 A;  2ATK C;  3MHS C;  5IDJ A;  2DYR B;  1JJ2 U;  4MTG A;  5B1A B;  2W0F C;  2PI4 A;  1DF4 A;  1OCR B;  4MT8 A;  5B1B C;  1EFR G;  1FS0 G;  3K06 A;  3G71 V;  1KD1 W;  1AI4 A;  2PI5 A;  2EZP A;  1F51 A;  2DQ3 A;  4MVZ A;  1OCC B;  1GM9 A;  2EIN B;  3K0D A;  1SER A;  3F5W C;  5DN6 G;  2QA4 V;  3AEI A;  4WFA V;  1HWY A;  4JYC A;  5IYC O;  2P67 A;  1FXK C;  1H2G A;  3DTU B;  5L3F A;  3B8M A;  3E35 A;  1Q86 W;  5H6Q A;  1KKD A;  2QE7 G;  4R8C A;  5IY5 B;  2ZR2 A;  1SZT A;  3JYC A;  5GW7 A;  1P7B A;  2IJI A;  2X7R B;  2XAF A;  3JD1 A;  1QLE C;  1QVG U;  2D3O W;  2HLD G;  4JTA B;  3ETE A;  5IYB O;  2XAJ A;  3D3I A;  1M9N A;  4MSW C;  2EBO A;  4TWK A;  2HG5 C;  2ZXW C;  3F7Y C;  1H8H G;  1ROP A;  3F7V C;  3ZRW A;  1THZ A;  4UXN A;  2A0L A;  2B1G A;  2IH1 C;  3ZMU A;  2JK5 C;  4KUM A;  5EBW C;  2H94 A;  4G2K A;  1MAB G;  2B1I A;  4RAI A;  2ITC C;  4RQF A;  2ZD9 A;  4TT3 G;  2Z5U A;  3ASN B;  4UV8 A;  4MVM A;  4PA7 A;  2DW4 A;  5LGU A;  3OW2 U;  1R3K C;  2XAG A;  1E79 G;  2EIM C;  4FK5 C;  3ABM C;  1E44 B;  1BMF G;  2WLK A;  4FJC C;  3VBB A;  4WFG A;  3CMA V;  4P2Z A;  4QNH B;  1S72 V;  1GM7 A;  4GX2 A;  2WLL B;  3AG2 C;  2WLL A;  2XAH A;  2W6I G;  4EKW A;  2R9R B;  1FXH A;  4G28 B;  1VQ4 V;  1K4D C;  5H9C A;  3T4Z A;  1JVM A;  3GWO A;  1K73 W;  4UVB A;  1S77 D;  1OCZ B;  1SRY A;  2EIL B;  3E8H A;  3D36 A;  4JTD B;  1QR9 A;  4PA3 A;  2HR3 A;  3ZRV A;  1VQM V;  3E8B A;  1GMG A;  2UXN A;  3RVY A;  4RQE A;  1R3J C;  3IC7 A;  1VQ7 V;  3G4S V;  2GHY A;  1M57 B;  4BW5 A;  4BIU A;  3ABL C;  2JIZ G;  3M99 B;  1E1R G;  3K08 A;  4P30 A;  4JTC B;  4PDR A;  1SET A;  1Q81 W;  2OCC C;  3CC4 V;  2EIJ B;  4UUJ C;  2XAS A;  5LGN A;  1ORQ C;  1M90 W;  3AG3 B;  1P4R A;  1QCE A;  3FYE B;  1K9M W;  3CCS V;  1CPY A;  4WFF A;  3ZCC A;  5LGT A;  1RPR A;  4GCZ A;  4FMT A;  5KA5 A;  2WLH A;  3G6E V;  1GKF A;  3ETG A;  2WPD G;  2IJJ A;  3MHH C;  3ZMZ A;  1K33 A;  4PDL A;  4ZKI A;  5LHH A;  5B1B B;  1V54 B;  1VQP V;  1NKD A;  1GM8 A;  3ZMV A;  3AG4 C;  3TET A;  1XL4 A;  2A79 B;  5KA6 A;  1ENV A;  1YJN V;  1OCO B;  3ASO B;  1YSC A;  1Q7Y W;  1JQ0 A;  5H6R A;  3CCL V;  3B8N A;  5LHG A;  2WSS G;  4MTO A;  1FXK A;  3ABU A;  1RM1 B;  3CCQ V;  3E2E A;  3PJS K;  2V1D A;  1M56 C;  3WG7 C;  4U7O A;  3W7S A;  1V55 C;  3LSQ A;  4LBE C;  3TCU A;  3IFX A;  3CCE V;  1EZJ A;  4CZZ A;  1K3E A;  5B1O A;  3OAA G;  1XL6 A;  2Y48 A;  2WLN A;  4X88 A;  4LP8 A;  1VQ9 V;  3CCU V;  1GO3 F;  3RW0 A;  1BHB A;  3H01 A;  1KEC A;  3CCR V;  1DTO A;  1NVP D;  4WFB V;  2YSU B;  4HZ3 A;  2DWD C;  4FPP A;  1AJN A;  4UV9 A;  1F23 A;  1M1K W;  4RUE A;  1MG1 A;  1W2B U;  4PA4 A;  2Q69 A;  5B1N A;  3SYQ A;  3OMN B;  1NH2 D;  1R3L C;  4MW3 A;  5FL7 G;  1R6K A;  5B3S C;  1NH2 B;  3E89 A;  4PEL A;  1K97 A;  3ML0 A;  3W7W A;  1WLE A;  3ZRW B;  2DYR C;  4FIP C;  3SPI A;  3W7X A;  2HVK C;  1OCR C;  2IU0 A;  1Y4M A;  3FYI B;  3CME V;  2ZR3 A;  1AI5 A;  2HJF C;  1OCC C;  2EIN C;  4PDV A;  2B5U A;  2X0L A;  3ZMT A;  1CP9 A;  1G4Y B;  5IYD O;  4JAV A;  4MTF A;  2W6J G;  1YJ9 V;  1R3I C;  3A0R A;  4MS2 A;  4RO2 A;  1ZWI C;  2MK3 A;  2OTJ V;  1E1Q G;  2WLI A;  1JX9 A;  3CP1 A;  3B77 A;  4TSF G;  2ZDI A;  3ZJZ A;  4JAS A;  1KP3 A;  1R73 A;  2Q68 A;  2QM8 A;  3K3W A;  3UKM A;  5IY5 C;  3SYP A;  1S5H C;  1FXV A;  3JD0 A;  4MTX A;  3WFV A;  4F4L A;  1VQ5 V;  1NJI W;  3E83 A;  1W0J G;  3FB8 C;  3E86 A;  3CC2 V;  1S0V A;  3VOU A;  2LFS A;  3OEE G;  1AR1 B;  5KUK A;  1VQ6 V;  2K1E A;  3E8G A;  4LC1 A;  2JJ1 G;  3ABL B;  4LCU C;  3NXS A;  2YEV A;  3ABK B;  1PD3 A;  2Q6A A;  2JJ2 G;  3K0G A;  5J9P C;  2BOB C;  5CMU A;  5C93 A;  1I5X A;  3FB5 C;  1ARO P;  2Y69 B;  3STL C;  3ZN0 A;  2IJK A;  1IXM A;  5EC1 C;  2M7W A;  3ASN C;  3OGC C;  3LDE A;  2P90 A;  3KG2 A;  4QE7 A;  3SYC A;  2Z3Y A;  2CK3 G;  5LHI A;  4QPJ A;  2UXX A;  4YXW G;  3I55 V;  2QEX V;  3K79 A;  4MVU A;  3EFF K;  2IJH A;  2X6C A;  2EIK B;  3JD4 A;  4MVR A;  1GK9 A;  1FFT B;  3LDD A;  1WPX A;  1QLN A;  1YIJ V;  3OM3 B;  4HYO A;  1L1F A;  2JEU A;  2FTK A;  2NNU A;  2P6J A;  1KQS U;  2QKS A;  3CYO A;  4GX0 A;  3LNM B;  1OCZ C;  2EZO A;  4PDM A;  1G8M A;  2EIL C;  4QPK A;  5L3B A;  5CBF A;  2WAM A;  4E2L A;  2ITD C;  5L3G A;  4UVA A;  1YIT V;  3RBZ A;  3OE7 G;  4JAU A;  4GT1 A;  1V55 B;  3LDC A;  5HFL A;  1EBO A;  4XDL A;  1YTF D;  3X2Q C;  3LUT B;  4OXS A;  4MVS A;  1M57 C;  3BY6 A;  3HPL C;  1BHA A;  1FXK B;  2AHY A;  1S3J A;  2EJR A;  1BL8 A;  4JYB A;  4I5S A;  1JCH A;  1GTO A;  1YHQ V;  1N8R W;  1PKX A;  2JDI G;  1YJW V;  3GB7 C;  3OUF A;  2NLJ C;  2EIJ C;  1NQT A;  3ZMS A;  3OR6 C;  4Q20 A;  3T1C A;  3AG1 C;  5KUM A;  3QO8 A;  2P7T C;  1Y66 A;  1QLE B;  2LFR A;  4KFM A;  5EBL C;  1VQO V;  2C2A A;  1J95 A;  5CBG A;  4ASU G;  3CD6 V;  4DO2 A;  5B3S B;  2DYS C;  2ZXW B;  1QR8 A;  1DF5 A;  4PA6 A;  3T4D A;  3CPW U;  1Q82 W;  1H38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...