1JCHA

Crystal structure of colicin e3 in complex with its immunity protein
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
468
structure length
468
Chain Sequence
b'VAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E3
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Ribosome inhibitor, hydrolase
total genus 107
structure length 468
sequence length 468
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.21.-:
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jchA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 1jchA03
1E44B 1UJWB 2YSUB 2B5UA 4UDMB 1JCHA
chains in the Genus database with same CATH superfamily
4DK1A 1VQ5V 4U3FH 3CB2A 1NI8A 5LBQA 5J9PC 2ARHA 3K58A 2JK5C 3K03A 3VOUA 4LF9B 2ZR2A 2YEVA 3LUTB 3L70H 2HVKC 1VQOV 4LFBO 1OCOB 3SYAA 4P9PA 5KHHA 3L72H 5LP6B 1AILA 1XBLA 4LCUC 1F51A 5L3DA 4TV9A 1QVGU 2HHHB 2X7RB 4WCEV 2XNDG 5E1AC 1EFRG 3G6BA 3AK3A 4EKWA 2G38A 2JEXA 2P06A 3E83A 4QPKA 2DQ0A 4X62B 3T1YO 3RYHA 3STLC 3H01A 4QIWF 4H0LB 3ZIAG 1YTFB 1HNXB 5LP6A 4JI4O 4DR3O 4K0KB 3FYIB 4IYHA 4RO2A 4ASUG 2JDIG 1Q6HA 3H1HH 3AK1A 3IC9A 2WSSG 2P4KA 1FXHA 3ZHSA 1OCZB 1OCOC 3G67A 4UDMB 1FD9A 4JI3O 5LP6C 2PYLA 4JYBA 1M4UA 2CAZC 2F1MA 1JMKC 1WJZA 1XNRB 1I08A 1BT8A 4QNHB 3GVMA 1NVPD 1JFFA 4PA7A 5KHIA 4YIPA 5EC1C 4WFFA 2UUBB 2C2AA 2IH1C 4B7EA 1SESA 1SQFA 1TUBB 5IWAO 4UVCA 4JI5B 4JYCA 3ZX6A 2VRZA 2PI4A 2LFSA 5E79Z 1H38A 2E75B 5JQGA 1SQBH 1R1BA 1N36O 2B5UA 1Z5WA 4NTXA 4PJ0Z 2VQEB 4U3JB 4AILC 3T4ZA 5IYBO 1OCZC 5LHIA 5L3BA 4B3MO 5D5PA 1HW7A 2CH7A 1NU1H 1RPRA 2QDOA 4GYCB 3ZMTA 2F66C 4D7TA 1TUBA 2ADQB 1JVMA 3E89A 4AQYO 4B3SO 1ZWIC 2QTSA 3RWRD 1TUEB 2ZR3A 4MW8A 5KA6A 2XUMA 1OCCB 2ITCC 2B9ZA 3WU2Z 2P90A 5B1AB 1VQNV 3SYOA 5JWPA 4U3JA 3CC7V 2ZKOA 5FNVB 2X0LA 2ILMA 3RGBA 1SS3A 3ASOB 3H9VA 3CX5F 3AEIA 1WA8B 4JI6O 4LFAO 1H2KA 4UUJC 2UXCB 4FZ0A 4MS2A 1SKVA 1B3QA 3NR7A 1IZ3A 3WB0A 4UXNA 4JPRA 2F4VB 1P84F 4OX9B 4J10A 4GX2A 4FPPA 3UCSC 2R9RB 3CPWU 4FLVA 1R73A 3QF7A 1BMFG 2V4DA 4X1KB 1WA8A 1OCCC 5B1AC 2UXBO 1KP3A 5IJ0B 1N32B 2JGUA 1G1XB 4DV7O 3ZN0A 1VQPV 3ASOC 4P9OA 3ZCCA 1XREA 3FB6C 2PY5A 4IIJB 3OUSA 2IM9A 2XOKG 4MTFA 3DSQA 4R50A 2IBZH 2Q6AA 1OHHG 3L73H 1NBMG 2ZE5A 4X1KA 3ASNB 4YHHO 3AG3B 4N23A 4MVSA 1S5JA 5BR8O 1N34B 2KKWA 5KUMA 4DV5O 4UCSA 3DGEA 1XEQA 1F23A 1PL4A 5FPRA 2XASA 1R6NA 4JYAO 4GX5A 2WAMA 4YY3B 2Z0AA 1KQSU 4A5UB 4DV4O 4IIJA 1H8HG 3F5TA 4DV1O 3E8FA 1V55B 2ZE8A 4FM1A 1Y6XA 1YHQV 5DN6G 3HKEB 4LH7A 4UCVA 1XOUA 3K04A 1AI7A 1IXBA 3KKYA 1WB7A 1NZ6A 2CGNA 4DRXB 1J5EB 2DOSA 4XDKA 3ASNC 3AG3C 3D3IA 3F5WC 4I50B 3B40A 2UUAO 1FAFA 1IBMO 1O9HA 4IL6Z 2BOCC 2P22C 4TOIA 5BMVB 5KAFZ 4DV2B 3HKEA 2DYRB 1LUVA 5KLVH 1BZKA 5DEDA 4DV6B 4RUEA 4GKJO 2QJ1A 2FYUH 2YXHA 1Y66A 3O65A 1MOFA 1VF5B 2AXTZ 4DRXA 4DUYB 1M9NA 1V55C 5D5QA 3OM3B 2MK3A 2IJJA 3JD1A 4I50A 1FXKB 1J95A 5BMVA 1HR0O 2EINB 4J9ZB 5CA1B 1M93A 3D36A 4X65O 1H2LA 2XHBA 2EZOA 3JATB 5BY1A 1GKFA 2PZSA 4LC1A 3K06A 3ETDA 4LFBB 4O4JB 4KHPO 5LHHA 2LW1A 1IURA 5B1BB 2DYRC 1FXKA 2QSAA 1AI4A 3CD6V 3AG2B 4L87A 3D36C 1K92A 3P3NA 3C3SA 4FLYA 1K97A 4FLXA 3SYPA 1YCIA 2BE3A 3HPLC 3SPHA 2YIBD 1NR1A 1S0VA 2Q0OC 5CA1A 1VIBA 2Q7EA 1XI1A 1FXKC 1XL4A 1AR1B 4O4JA 3T1YB 3JAWB 1RSOB 1G4YB 5EIBD 2EINC 3IAYA 2NLJC 1Y76B 3PN1A 4JI4B 4DR3B 3SYQA 5GTHZ 3KG2A 2IW5A 4NR1A 5LA6B 3UT5B 4JGSA 2EILB 2QR4A 2OTJV 5B1BC 4JI3B 1R3LC 4PA3A 2FL4A 3AG2C 4CS3A 1ZX3A 3JAWA 4WF9V 1RSOA 5J2UB 3CCEV 2QGNA 2RMKB 2R9IA 2PYJA 2A9HA 1L0LH 1Q7YW 4ZIBA 1Y76A 3E35A 2VS0A 3CXCU 5LMNO 1QLEB 2GDSA 4Z1MG 4LF6O 3C3TA 3VBBA 4I55B 1XNQO 2F43G 5LOVA 2D3OW 2WLMA 3UT5A 1H2MA 1IBLO 3JCUZ 5IWAB 1D5NA 1K5SA 2D2CB 4J7JA 5JVDA 4E4EA 2FTKA 5J2UA 1XQ8A 3W7SA 1Y67A 1N36B 3JAKB 2EILC 4R8CA 1PNMA 3B2EE 3LNNA 1M90W 4DUZO 4B3MB 1WP8A 4I55A 2ADPA 2IU3A 1LUWA 2YUAA 5C8YB 3QTCA 1YJWV 2CK3G 4UV8A 2Q68A 1QBZA 1BS3A 2LGWA 2IU0A 5H2FZ 4AQYB 5B5EZ 2PUSA 4B3SB 1QLEC 3CCQV 3JCZA 3FX7A 3K5MA 2AHYA 4B08A 1VQ6V 2PTMA 4FMTA 1TAEA 2NR5A 3BPZA 4MVMA 4R7CA 1KD1W 4C7UA 3K9SA 1PD3A 1VEWA 1EBOA 2P5OA 1K8AW 4JI6B 4LFAB 2JRIA 3L74H 2FB5A 4RAIA 3SPJA 3TCUA 4FFBA 3CCSV 2F23A 4RWUA 1XHXA 5JH7B 3OTOO 4RQFA 1OJHA 3F7YC 5GW7A 3CRAA 3TJTA 5LXTB 3CCJV 3UQ8A 1E79G 2XT9A 2IJIA 3OEEG 2KG7B 5A9GA 2WLLB 3KZIZ 3J80N 4XDJA 2UXBB 1YJNV 1FFXB 1YXBA 3ZRVA 4P2ZA 2E74B 1A32A 4DV7B 2DQ3A 1WAZA 1AP5A 4JI8O 1P49A 5LXTA 2CTWA 1K4CC 5AG2A 1PKXA 1XUQA 2JEUA 1S77D 4X8AA 3ABMB 3FKSG 4UCOA 3QO5A 4YHHB 2KG7A 3ABLB 5BZBA 2WLLA 2LFRA 1H2SB 4IHJA 5BR8B 3M8AA 3OUFA 2P4VA 2W0FC 3P30A 4DV5B 3N27A 1FFXA 1VQKV 2EIJB 4JYAB 2BCCH 4UVBA 4KUMA 2ZIMA 3OW2U 3BY6A 4DV4B 1YVWA 1N0JA 1BL8A 1WP7A 1NVPB 4J80A 2VQFO 3AG7A 3DXRB 3RYFB 3CJHB 4DV1B 1R6TA 4RUFA 2A3QA 4QJFB 5EK0A 1Q5OA 4DK0A 4NTQA 4CH3A 3MD0A 1PNKA 2RNBA 5LGNA 2DWEC 3U11A 3H1JH 4B7KA 4IT5A 3JD3A 1NQTA 3DC5A 3JARB 1Y4MA 3ABMC 4DR2O 3ABLC 4MVZA 5EBMC 1YDXA 1JOYA 3AG4B 3CSXA 2BSKB 4DR6O 2VWKA 3RYFA 3B8MA 1SQXH 3JAMN 4FJCC 5L3FA 2UUAB 3OFNG 1IBMB 2EIJC 2QKSA 3CC2V 2HJFC 3K59A 4BW9A 4JV5B 5H6QA 4GKJB 4DXWA 1O9GA 1WNSA 1IDSA 3JARA 3J7AU 4Z1VA 1FJGO 4CH5A 3H1KH 5JCOA 1I94O 2AZ2A 2Q73A 3CMAV 2BSKA 3FFQA 3LNMB 1GM8A 4PDRA 2YIAA 3L75H 3ZBHA 4G28B 1DLBA 1HR0B 4LF5O 3CRMA 3AG4C 3FAVB 2QM8A 5JCOC 2R9AA 4X65B 1FPOA 3T2MA 1NT2B 2Y0IA 3RYCB 3ZRWB 4KHPB 1KB9F 2E5LO 4NXNO 4FLWA 2GV9A 1SQGA 2A7WA 4GUNA 2DYSB 3SDLA 1SZTA 2UUCO 4JASA 2LJ2A 5KUKA 1SQQH 3FAVA 2QWRB 3P32A 3H1IH 1VQ7V 1QHTA 3HR0A 3M7MX 2XAGA 4LWSB 4GCZA 3RYCA 3ZRWA 1IBKO 5JJNB 5CBFA 4DR4O 2E3CA 2LGQA 2QA4V 5F2VO 1YITV 2RCVA 4UVAA 3L9DA 1VF6A 3CRQA 4DR7O 1L8DA 3OGIB 1N4CA 4MVRA 2DW4A 1H2NA 1GRJA 3W7TA 3I5DA 3ZJZA 3A0RA 5B3SB 3QO7A 4EFBA 3RT3C 1JQ0A 2DYSC 4YJ3B 2A79B 1VF6C 1HDJA 5KX5B 1Q6IA 4XBFA 2H8PC 4DO2A 1MSWD 3S3XA 5LMNB 5B1OA 5L3CA 3J81N 4LF6B 5FNVA 2R70A 1B04A 2Y4UA 1XNQB 2EBOA 1ZL8B 1B6QA 1W2BU 3A0HZ 4LF4O 1IBLB 4JAUA 4D6TH 3CWBH 1RP3B 4WFBV 2UXDO 1AP6A 3K57A 1QQCA 2YS8A 4X20B 3OTFA 1VMGA 2HFEC 3U10A 2ETNA 4O2AB 4YJ3A 4DW0A 5KX5A 5LGTA 1P7BA 4F6RB 3QNEA 1AI5A 3UKMA 4DUZB 2WLNA 1W0JG 1FXVA 4K3AA 4LFCO 3SJBC 1W59A 5B3SC 1ZL8A 2ODMA 4GZRB 2HLDG 3W7XA 3K0GA 3G6EV 5J2TB 2OT5A 3CYOA 2P7TC 2CTRA 4X20A 2ZNJA 5HFLA 5IJ0A 5L3GA 2ZE7A 2ZM6O 4O2AA 1EN4A 5KHJA 4Q6GA 5EYPB 4F6RA 5EZYB 2X6AA 5LHGA 3OMAB 1Y74B 4MVOA 2L35A 3NXSA 1T5EA 1R6KA 4JTDB 4JZ2A 1WLEA 2QWOB 1F4NA 1BCCH 4PI0A 5J2TA 5DECA 1BQZA 1VQ9V 5IYZB 2Q9LA 3OTOB 4JI2O 1TVKB 1U96A 5C93A 2E76B 5EYPA 1AR5A 2VWJA 3LSQA 5EZYA 2X6CA 5KHKA 4Q20A 2RN9A 1NTKH 4O2BB 4FLTA 2GHYA 4BWAA 4X64O 1Y74A 2P67A 3N2GB 1KC8W 3OD4A 2JVDA 3VQVA 3TXSA 4JZGA 2O57A 1YF2A 2DN9A 1H8EG 1N0NA 1KECA 1GM9A 2QTOA 5L3EA 1P7GA 3TXQA 5IYZA 2A0LA 4PD4F 2OYQA 4ZOLB 4B3TO 1Q6UA 4KXRA 1TVKA 4DV0O 2YI9A 4WFGA 3S3WA 4Z2WA 4TQDA 3OMIB 2CTPA 4HZ3A 1NH2B 4JI8B 2LO1A 5GTIZ 4H44B 5EBLC 2QM4A 4FFKA 2H94A 3APOA 5CBHA 2EJRA 1L1FA 3IJ4A 5LL6Y 1S76D 3N2GA 1F4MA 2LW7A 4JAVA 4JI7O 4YJ2B 1XILA 2AW9A 4HNAB 3RVZA 4LBEC 1K73W 2HR3A 1V54B 1M56B 4PA6A 4UCTA 2CE4A 3ETGA 3OAAG 1E1QG 1NTZH 2ZIOA 4PA4A 3ZRSA 2H3OA 3T1CA 3K3WA 2VQFB 1EZJA 3CRRA 2ZNIA 3EXAA 4NTYA 1KU9A 1BHAA 1HNWO 1M1KW 3A8TA 4YJ2A 1XMOO 4DR1O 2EIMB 2RJZA 4KFMA 1UJWB 3JATA 4QPJA 4YXWG 4DR2B 3BABA 3WB1A 4N21A 2JJ1G 1SETA 2AGAA 3ZMVA 1GN3A 2HEPA 4DR6B 1US6A 3K0DA 4EEQA 2WWWA 1V54C 1SF9A 1M56C 5B1NA 3KCYA 4WFAV 3CS5A 4ZKIA 1KP2A 1N33O 4NYKA 3ZRXA 3I55V 3CCMV 2KB1A 2JS5A 3G71V 4JI0O 4MTOA 1EZVH 3WB2A 1FJGB 1I94B 3CE2A 4BR6A 3N2KB 3E8HA 4HAMA 4LF8O 1AB3A 4PI2A 1FKAO 2EIMC 2EZPA 1KYOF 4B3RO 1FYJA 3FD9A 4LF5B 5LA6A 2JS3A 4I4TB 3ETQA 3VQXA 4MVQA 2KSDA 2DJVA 4MSWC 3RFRA 2GSMB 4X88A 2XAHA 4W4LA 5LMUO 2E5LB 3GWOA 3LSUA 4X89A 3OR6C 4NXNB 4KL1A 3N2KA 3JALB 2PGGA 4EFEA 3A2FA 3ZHRA 4O4HB 4DW1A 2UUCB 5CA3A 4I4TA 2BTOA 1S72V 1PP9H 1R3KC 1ZUQA 2Y4TA 2YICA 1Q43A 1TA8A 3B8NA 3SJQC 4IGGA 3BA9A 1PM9A 5JJJB 2M7WA 2XAQA 2Q8VA 3TETA 1D5AA 3EVKA 1IBKB 4KP4A 2YC0A 3ZMZA 4DR4B 3JD2A 2K9PA 2OIGA 3JAKA 2QKCA 3JALA 1EM1A 4XDLA 1XL6A 2V7QG 3JASB 4O4HA 4CH6A 4YIOA 1R3IC 1VQ8V 4DR7B 1L0NH 1Q82W 3BFRA 2JGDB 3PJSK 5C8YA 4CS4A 4K8ZA 3UO2A 3OMNB 4FM2A 2ZD9A 1HWYA 3ZHVA 4BIUA 1G8MA 4P30A 4G27B 1MG1A 4CS2A 3O9OA 3JASA 2QKAA 1JPXA 2YXLA 2YIDA 1CP9A 1ENVA 4I9QA 4LF4B 4QE9A 2JGDA 2IJHA 4TV8B 2W6JG 2UXDB 4MW3A 2P6JA 1AVMA 4PA9A 1GN2A 2F93B 4PDVA 1THZA 2AZ0A 4JF3A 2OCCB 5JH7A 4G2KA 3HKCB 3E86A 1H2GA 5CB4B 1QNMA 4FM0A 4U7OA 3SPCA 3MHHC 1SA0B 1VP7A 4PV1B 1P4RA 2Z5UA 1DF5A 3K08A 4LFCB 1SRYA 1XDCA 1YSCA 1JA8A 3KCXA 3IFXA 1NS1A 4TV8A 4X66O 1PNLA 4H13B 1BGYH 1WPBA 5CN0A 3ICXA 2ZM6B 1QR8A 3HKCA 4JAAA 1DF4A 1KKCA 4J9YB 5CB4A 3T1HO 3APQA 1SA0A 4GKKO 4TV9B 2FMLA 1CEZA 1KMIZ 2OCCC 3JYCA 3CC4V 1ZTEA 1MZEA 1COWG 1I0HA 3IGAC 3ZMUA 2PI5A 2N04A 3CCUV 4JI2B 4I0XB 3RYHB 3FB8C 5A2QN 4TWKA 5FL7G 5KHGA 1Z5VA 4PHZA 3ZMSA 3THOA 4JV5O 2CUGA 5CBGA 4X64B 5GONB 3HKBB 3DXRA 3OR7C 4JYYA 3CJHA 1U97A 4CH4A 1RPOA 5IE9A 4NB5A 1CXZB 1Q90D 4ABMA 3MDSA 5IT9N 4B3TB 2Y0PA 3C90A 4DV0B 1ROPA 4I0XA 4D7SA 4CZZA 1QU7A 1RFYA 4GT1A 2QM7A 1JFFB 4HYOA 4LNUB 1QVFU 1KKDA 3Q4HB 3CP1A 5GONA 4DR5O 1SQPH 3HKBA 2KQXA 3K5LA 4JI7B 4O4LB 3LDDA 1SZXA 3G4SV 4PELA 1AI6A 2JIZG 4OPHA 2EX3A 1ZLZA 3ZHTA 5JQGB 3RW0A 2L6LA 2Y69B 4DV3O 3OEHG 1WB8A 5HFMA 1XHZA 2RQ6A 1N8RW 4LNUA 4TSFG 2IJKA 1YIJV 4X1YB 3Q4HA 4WBNB 2CH7B 1HNWB 4K35A 4MTGA 4UFZA 4BAYA 4O4LA 4R6ZA 2R72A 3ABUA 3ZS8C 1XMOB 1RM1B 4JI1O 4DR1B 1NKDA 4ZHQB 1DGSA 3K79A 3SJAC 2WA3A 3CXHF 2OWOA 2WA4A 3JSLA 1YZBA 4CBCA 2NNUA 5IJ9B 1OV9A 1WPXA 4X1YA 2WLJA 1VF7A 1YTFD 4WBNA 1I5YA 2QEXV 4MT8A 2Y69C 1N33B 2QE7G 3CEIA 1OZ0A 2YSUB 4ZHQA 2LP7A 2N05A 2ZDIA 2V1DA 5CMUA 1K7DA 4JI0B 5CA0B 1BSMA 4IYIA 5K1PA 2B1IA 4LWSA 3JSNA 5IJ9A 4F4LA 1RM1C 2N74A 4LF8B 5IDJA 1HNZO 3R66A 1PPJH 2ZDIC 3BA8A 1NTMH 1F7YA 1GN6A 4CC5A 2YDEA 4B3RB 3MHSC 3AG1B 3OGCC 4LR3A 1VQLV 1K33A 3ABTA 4FLZA 1M5IA 3JD0A 5CA0A 3SR2C 2Z3YA 2UU9O 5LMUB 3DTUB 4E2LA 1MA1A 4FK5C 2Y48A 3B4SA 2ZQMA 2AHZA 3EHBB 5KAIZ 5TISZ 1XMQO 2Q69A 1MMMA 1BE3H 5LGUA 2HKOA 4I9WA 1NR7A 2EJ7A 3E22B 4ZI7B 1WN7A 3ABKB 3CCRV 5FPOA 5LYJB 3CHXA 3B77A 2DWDC 3TK1A 3CCVV 3I56V 3AG1C 4LF7O 3E2EA 3W7UA 4NXMO 1FS0G 4UCRA 4JTCB 1GM7A 4BW5A 4PDLA 3WFVA 1D2DA 2B1GA 5IYCO 2Q0AA 3OT7A 3OE7G 2WPDG 2YI8A 4GX1A 3E22A 4ZI7A 4LF9O 3RBZA 1K34A 3K5NA 2DE0X 2QWQB 3SPGA 3ZEDA 5LYJA 3SPIA 3ZHUA 3QVNA 1CPYA 1G6UA 4MVUA 1MZFA 3U0ZA 2CDYA 2XAJA 2Q7GA 2HHHO 4W4KA 3A0BZ 3ABKC 1VQMV 2GTAA 1BHBA 3LSSA 3HB3B 4L8JA 5FLXN 3R65A 1KBHA 1X59A 2F95B 1R3JC 5EC2C 3VQYA 4X62O 3FB7C 1HNXO 4J7ZA 4K0KO 4O2BA 1QR9A 2OIEA 5DM6V 1ZSPA 1S5HC 4FIPC 4X66B 2Q5ZA 2BTQB 3H1LH 1LR1A 4U7NA 2YIBA 1FFTB 3D3QA 1YEWA 2HP8A 3K5OA 4ZOLA 4OPAA 4AHCA 1LNQA 1XNRO 3TGUH 4TQFA 4H37A 3T1HB 1YI2V 3LDEA 3LDCA 1IX9A 1UPGA 2OTLV 4GKKB 4WFHA 1BQ0A 2LQTA 3QO8A 3AK2A 2DMXA 1YJ9V 1E44B 2UUBO 4FVMA 3GWKC 1AR4A 3DC6A 2BTQA 1Q3EA 3L71H 4JI5O 5EIBC 4HNAA 5ITZB 1VQ4V 1JJOA 1I5XA 3T4DA 1GN4A 1GMGA 4LH6A 1URFA 1PL0A 3B09A 1I7FA 3BHPA 3G80A 4NTWA 2VQEO 2BOBC 4ZBMA 3BAAA 3ML0A 2GTSA 2X6BA 3F7VC 2Q7HA 3BCCH 1TGOA 3RVYA 2MW2B 3FB5C 3WG7B 4F6EA 3ETEA 1B06A 1GK9A 4DYLA 1AJNA 1MABG 1ORQC 4AI8A 2UXNA 3VQWA 4X9QA 5ITZA 4UV9A 2QWPB 4GX0A 1Q86W 1SERA 2A06H 4UB6Z 2ZCEA 1NH2D 5K1XA 2UXXA 1OCRB 3UO3A 4PDMA 2HVJC 1DTOA 4FZ1A 1K3EA 3E8GA 1ZAUA 4TT3G 1SC5B 2ATKC 3FYEB 1IXMA 2ZT9B 4DR5B 3JD4A 5LOVB 4K8XA 5JJEB 3X2QB 4JTAB 4QGPA 3CMEV 3K9AA 5IYDO 2W0XA 2QWNB 3MAQA 2ZINA 4EB6B 5B66Z 1SQVH 3BEHA 2UXCO 2M6YA 5JVDB 2NN4A 4I7ZB 2XTAA 4DV3B 1S3JA 5IY5B 1K4DC 5KA5A 4ICGA 5EBWC 2GUZB 4J7KA 2EIKB 4UCUA 3IC7A 1X4TA 3WG7C 5KMGB 1MSDA 2F4VO 4OX9O 2RDCA 3EFFK 5H9CA 4J11A 1VARA 4O4IB 1Z2GA 1JR9A 4J41A 4NKGB 1PV0A 1OCRC 1EN5A 4JI1B 1V9PA 4MTXA 4EB6A 2ZE6A 3UM7A 1AJQA 2K1EA 2ZXWB 4LP8A 1N32O 3ZHQA 4OXSA 2XAFA 2GUZA 4BIOA 2JJ2G 2FKXA 3STZC 2OCHA 3X2QC 5KMGA 3P3PA 4TUYB 4RQEA 2WLHA 2HJDA 1W0KG 2PF4E 4O4IA 1MNGA 1JJ2U 4GLXA 3SYCA 4CC6A 5IY5C 1QLNA 4NVPA 4QE7A 2EIKC 3CRCA 3SJCC 5H5NA 1GAXA 1N34O 4FFBB 3BVOA 2WLIB 3SGIA 4X1IB 4H33A 2YXYA 3HKDB 4YY3O 3QG5A 1HP8A 4WFEA 3ZN1A 1Q8IA 4TUYA 3RYIB 1HNZB 2CTQA 1M57B 2EULA 1GTOA 2IH3C 2W6IG 2ZXWC 2WLKA 2Q67A 1GO3F 1JX9A 5H6RA 1KUQA 2WLIA 3D8CA 4X1IA 4UB8Z 2UU9B 1QCEA 3HKDA 1J5EO 4BIZA 4FLUA 1JCHA 4OGQB 1IVSA 1EN6A 3RYIA 2ITDC 3BRCA 1K9MW 1XMQB 4J42A 1AJPA 3M99B 3W7WA 2Q4PA 4IHJB 1Q81W 1AROP 1GH6A 4DV2O 1E1RG 4DV6O 1UFIA 2CGOA 1NJIW 2YEVB 3CCLV 2GBOA 4HBNA 1M57C 3GB7C 4DUYO 3E8BA 3RN4A 1K5QA 1S5LZ 4LF7B 4I5SA 5BXZA 1DK1A 4NXMB 2HG5C
chains in the Genus database with same CATH topology
3VBBA 2QEXV 2F43G 4MT8A 1KC8W 1VQ5V 2Y69C 2D3OW 2WLMA 2QE7G 5LBQA 1H8EG 1OZ0A 5J9PC 2YSUB 1KECA 1GM9A 2JK5C 2LP7A 2QTOA 3K03A 1K5SA 2ZDIA 3VOUA 2V1DA 5L3EA 2A0LA 2ZR2A 5CMUA 2YEVA 1K7DA 3LUTB 4WFGA 2B1IA 3OMIB 2FTKA 2HVKC 4HZ3A 3W7SA 1NH2B 1VQOV 4F4LA 1OCOB 3SYAA 5EBLC 4P9PA 1RM1C 2H94A 2EILC 5CBHA 4R8CA 5IDJA 1PNMA 4LCUC 2EJRA 1F51A 2ZDIC 1L1FA 1M90W 5L3DA 1QVGU 1S76D 2X7RB 2IU3A 4WCEV 2XNDG 1F4MA 5E1AC 3MHSC 1EFRG 3AG1B 3OGCC 4JAVA 1YJWV 2CK3G 4UV8A 2Q68A 4EKWA 3RVZA 1QBZA 2JEXA 4LBEC 2IU0A 1K33A 1VQLV 2HR3A 1K73W 3ABTA 1V54B 1M56B 4PA6A 1QLEC 3JD0A 3CCQV 3E83A 3ETGA 3OAAG 2Z3YA 1E1QG 4QPKA 3JCZA 4PA4A 2DQ0A 3DTUB 3ZRSA 4E2LA 2AHYA 4FK5C 3T1CA 1VQ6V 3STLC 3H01A 4QIWF 2Y48A 4FMTA 3K3WA 3ZIAG 2ZQMA 2AHZA 1YTFB 3EHBB 1EZJA 4MVMA 4R7CA 1KD1W 3FYIB 1PD3A 1BHAA 4RO2A 4ASUG 2JDIG 1M1KW 1EBOA 2WSSG 1K8AW 1FXHA 2Q69A 1OCZB 1OCOC 2EIMB 4UDMB 5LGUA 2HKOA 4I9WA 4RAIA 3SPJA 1NR7A 4KFMA 3TCUA 3CCSV 1UJWB 4JYBA 3ABKB 3CCRV 4RQFA 3F7YC 5GW7A 4QPJA 4YXWG 3B77A 2DWDC 3TK1A 3CCVV 3I56V 4N21A 3AG1C 2JJ1G 1SETA 4QNHB 3CCJV 3ZMVA 1NVPD 3E2EA 4PA7A 3W7UA 1E79G 3K0DA 1FS0G 2IJIA 4JTCB 1GM7A 2WWWA 4BW5A 1V54C 4PDLA 1M56C 5EC1C 4WFFA 3WFVA 3OEEG 2B1GA 5B1NA 2C2AA 2IH1C 5IYCO 2WLLB 4WFAV 3OE7G 4ZKIA 1KP2A 1SESA 4XDJA 3ZRXA 2WPDG 4GX1A 4UVCA 3I55V 3CCMV 4JYCA 2KB1A 3RBZA 1K34A 1YJNV 2PI4A 3ZRVA 2LFSA 4P2ZA 3G71V 2DQ3A 3SPGA 1H38A 4MTOA 3SPIA 2B5UA 1K4CC 3T4ZA 1CPYA 5IYBO 3E8HA 1OCZC 1PKXA 4HAMA 4MVUA 2EIMC 5LHIA 2EZPA 2XAJA 2JEUA 5L3BA 1S77D 4X8AA 3ABMB 3FKSG 3QO5A 3ABKC 1VQMV 1RPRA 3ABLB 5BZBA 2WLLA 2LFRA 3ZMTA 1BHBA 3OUFA 2W0FC 3P30A 3LSSA 3HB3B 4MVQA 1JVMA 3E89A 2EIJB 3R65A 1VQKV 4MSWC 4UVBA 1ZWIC 2GSMB 4KUMA 1TUEB 4X88A 2ZR3A 2XAHA 4MW8A 3OW2U 5KA6A 1OCCB 1R3JC 2ITCC 5EC2C 3BY6A 2P90A 5B1AB 3GWOA 1VQNV 4X89A 1BL8A 3SYOA 3OR6C 3FB7C 1NVPB 3CC7V 2X0LA 4RUFA 1QR9A 5DM6V 4QJFB 3ASOB 5EK0A 1S5HC 5CA3A 3MD0A 3AEIA 4FIPC 1PNKA 5LGNA 2DWEC 1S72V 4U7NA 4UUJC 1R3KC 3JD3A 3SJQC 3B8NA 1NQTA 1FFTB 4MS2A 2M7WA 2XAQA 3TETA 1Y4MA 3ABMC 4KP4A 1LNQA 3ABLC 4MVZA 5EBMC 3ZMZA 4UXNA 4H37A 1YI2V 3JD2A 1JOYA 3LDEA 3AG4B 3LDCA 4JPRA 4GX2A 2OTLV 4XDLA 4FPPA 4WFHA 2R9RB 3QO8A 3CPWU 1XL6A 1R73A 2V7QG 3B8MA 4FJCC 5L3FA 1YJ9V 3OFNG 2EIJC 1BMFG 1R3IC 1VQ8V 2QKSA 1E44B 3CC2V 2HJFC 1OCCC 1Q82W 5H6QA 5B1AC 3PJSK 1KP3A 4DXWA 1VQ4V 1I5XA 3OMNB 3T4DA 2ZD9A 3ZN0A 1HWYA 1VQPV 3ASOC 1GMGA 4P9OA 3ZCCA 4BIUA 3FB6C 1G8MA 3OUSA 1PL0A 4P30A 2BOBC 4ZBMA 3CMAV 3ML0A 2XOKG 4MTFA 4R50A 4G27B 1MG1A 2Q6AA 1OHHG 3LNMB 2X6BA 1JPXA 1NBMG 3F7VC 1GM8A 4PDRA 3ASNB 1CP9A 3RVYA 3AG3B 1ENVA 3FB5C 3WG7B 3ETEA 4G28B 1DLBA 1GK9A 4N23A 4QE9A 1AJNA 4MVSA 2IJHA 1MABG 1ORQC 2W6JG 2UXNA 4MW3A 5KUMA 2P6JA 3AG4C 4PA9A 2QM8A 4UV9A 3DGEA 1F23A 4GX0A 4PDVA 1Q86W 1SERA 1THZA 2XASA 1R6NA 4JF3A 3T2MA 4GX5A 2OCCB 4G2KA 2WAMA 1NH2D 2UXXA 1OCRB 3ZRWB 1KQSU 4PDMA 2HVJC 3E86A 1H2GA 1DTOA 1K3EA 1H8HG 3E8GA 4TT3G 4U7OA 3SPCA 2ATKC 3FYEB 1IXMA 3MHHC 1P4RA 2Z5UA 1DF5A 3K08A 3JD4A 1SRYA 3E8FA 1YSCA 1V55B 2DYSB 1SZTA 3X2QB 3IFXA 4JTAB 4JASA 3CMEV 5KUKA 3K9AA 1YHQV 5DN6G 5IYDO 1PNLA 3P32A 3K04A 1AI7A 3BEHA 1VQ7V 5CN0A 1S3JA 5IY5B 1K4DC 2XAGA 5KA5A 5EBWC 4GCZA 1QR8A 3ZRWA 2EIKB 4XDKA 3ASNC 1DF4A 3IC7A 3AG3C 4J9YB 3WG7C 5CBFA 3D3IA 2QA4V 3F5WC 1YITV 3EFFK 5H9CA 4UVAA 1CEZA 2OCCC 3JYCA 3CC4V 2BOCC 1OCRC 4MVRA 1COWG 2DYRB 2DW4A 3IGAC 4MTXA 3ZMUA 2PI5A 3UM7A 4RUEA 3W7TA 3ZJZA 1Y66A 3A0RA 1AJQA 2K1EA 2ZXWB 4LP8A 1MOFA 3CCUV 5B3SB 4OXSA 2XAFA 3QO7A 3FB8C 1JQ0A 1M9NA 1V55C 2DYSC 2JJ2G 2A79B 4TWKA 5FL7G 3STZC 3X2QC 3OM3B 4XBFA 2H8PC 4DO2A 2MK3A 1MSWD 2IJJA 3ZMSA 3JD1A 4RQEA 1FXKB 2WLHA 5B1OA 5CBGA 1W0KG 5L3CA 1JJ2U 3OR7C 1J95A 3SYCA 2EBOA 5IY5C 1QLNA 1RPOA 1B6QA 1W2BU 4QE7A 2EIKC 2EINB 4J9ZB 4JAUA 4WFBV 2WLIB 3D36A 4H33A 2EZOA 2HFEC 1ROPA 1GKFA 4LC1A 3K06A 4CZZA 3ETDA 5LHHA 4GT1A 5LGTA 4WFEA 2QM7A 1P7BA 3ZN1A 4HYOA 1KKDA 1QVFU 5B1BB 2DYRC 1FXKA 3QNEA 1AI5A 3UKMA 1AI4A 3CD6V 3CP1A 2WLNA 1W0JG 1FXVA 1M57B 3AG2B 1GTOA 2IH3C 2W6IG 2ZXWC 4L87A 1K92A 2WLKA 5B3SC 2Q67A 1GO3F 2HLDG 1K97A 3W7XA 3LDDA 3SYPA 3K0GA 3G4SV 3HPLC 4PELA 3G6EV 1JX9A 3SPHA 1NR1A 2OT5A 1S0VA 1AI6A 2JIZG 3CYOA 5H6RA 2WLIA 2P7TC 5HFLA 1FXKC 5L3GA 3RW0A 2Y69B 1QCEA 1XL4A 3OEHG 5HFMA 1AR1B 4BIZA 1G4YB 1JCHA 1N8RW 4TSFG 2EINC 2NLJC 2IJKA 1YIJV 2X6AA 5LHGA 2ITDC 3OMAB 3SYQA 1K9MW 4MVOA 3NXSA 3KG2A 2IW5A 4MTGA 1AJPA 1R6KA 4JTDB 3M99B 3W7WA 4BAYA 4R6ZA 1WLEA 1Q81W 3ABUA 1AROP 4JGSA 1F4NA 1RM1B 1NKDA 2EILB 2OTJV 1E1RG 1VQ9V 5B1BC 3K79A 1R3LC 1NJIW 4PA3A 2YEVB 3CCLV 3AG2C 1M57C 5C93A 3GB7C 3E8BA 4CBCA 4WF9V 3CCEV 2NNUA 2R9IA 1K5QA 2A9HA 3LSQA 1Q7YW 1WPXA 2X6CA 4I5SA 2WLJA 4Q20A 3E35A 1YTFD 3CXCU 1QLEB 2HG5C 1I5YA 4Z1MG 2GHYA 2P67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E44 B;  1UJW B;  2YSU B;  2B5U A;  4UDM B;  1JCH A; 
#chains in the Genus database with same CATH topology
 4DK1 A;  1VQ5 V;  4U3F H;  3CB2 A;  1NI8 A;  5LBQ A;  5J9P C;  2ARH A;  3K58 A;  2JK5 C;  3K03 A;  3VOU A;  4LF9 B;  2ZR2 A;  2YEV A;  3LUT B;  3L70 H;  2HVK C;  1VQO V;  4LFB O;  1OCO B;  3SYA A;  4P9P A;  5KHH A;  3L72 H;  5LP6 B;  1AIL A;  1XBL A;  4LCU C;  1F51 A;  5L3D A;  4TV9 A;  1QVG U;  2HHH B;  2X7R B;  4WCE V;  2XND G;  5E1A C;  1EFR G;  3G6B A;  3AK3 A;  4EKW A;  2G38 A;  2JEX A;  2P06 A;  3E83 A;  4QPK A;  2DQ0 A;  4X62 B;  3T1Y O;  3RYH A;  3STL C;  3H01 A;  4QIW F;  4H0L B;  3ZIA G;  1YTF B;  1HNX B;  5LP6 A;  4JI4 O;  4DR3 O;  4K0K B;  3FYI B;  4IYH A;  4RO2 A;  4ASU G;  2JDI G;  1Q6H A;  3H1H H;  3AK1 A;  3IC9 A;  2WSS G;  2P4K A;  1FXH A;  3ZHS A;  1OCZ B;  1OCO C;  3G67 A;  4UDM B;  1FD9 A;  4JI3 O;  5LP6 C;  2PYL A;  4JYB A;  1M4U A;  2CAZ C;  2F1M A;  1JMK C;  1WJZ A;  1XNR B;  1I08 A;  1BT8 A;  4QNH B;  3GVM A;  1NVP D;  1JFF A;  4PA7 A;  5KHI A;  4YIP A;  5EC1 C;  4WFF A;  2UUB B;  2C2A A;  2IH1 C;  4B7E A;  1SES A;  1SQF A;  1TUB B;  5IWA O;  4UVC A;  4JI5 B;  4JYC A;  3ZX6 A;  2VRZ A;  2PI4 A;  2LFS A;  5E79 Z;  1H38 A;  2E75 B;  5JQG A;  1SQB H;  1R1B A;  1N36 O;  2B5U A;  1Z5W A;  4NTX A;  4PJ0 Z;  2VQE B;  4U3J B;  4AIL C;  3T4Z A;  5IYB O;  1OCZ C;  5LHI A;  5L3B A;  4B3M O;  5D5P A;  1HW7 A;  2CH7 A;  1NU1 H;  1RPR A;  2QDO A;  4GYC B;  3ZMT A;  2F66 C;  4D7T A;  1TUB A;  2ADQ B;  1JVM A;  3E89 A;  4AQY O;  4B3S O;  1ZWI C;  2QTS A;  3RWR D;  1TUE B;  2ZR3 A;  4MW8 A;  5KA6 A;  2XUM A;  1OCC B;  2ITC C;  2B9Z A;  3WU2 Z;  2P90 A;  5B1A B;  1VQN V;  3SYO A;  5JWP A;  4U3J A;  3CC7 V;  2ZKO A;  5FNV B;  2X0L A;  2ILM A;  3RGB A;  1SS3 A;  3ASO B;  3H9V A;  3CX5 F;  3AEI A;  1WA8 B;  4JI6 O;  4LFA O;  1H2K A;  4UUJ C;  2UXC B;  4FZ0 A;  4MS2 A;  1SKV A;  1B3Q A;  3NR7 A;  1IZ3 A;  3WB0 A;  4UXN A;  4JPR A;  2F4V B;  1P84 F;  4OX9 B;  4J10 A;  4GX2 A;  4FPP A;  3UCS C;  2R9R B;  3CPW U;  4FLV A;  1R73 A;  3QF7 A;  1BMF G;  2V4D A;  4X1K B;  1WA8 A;  1OCC C;  5B1A C;  2UXB O;  1KP3 A;  5IJ0 B;  1N32 B;  2JGU A;  1G1X B;  4DV7 O;  3ZN0 A;  1VQP V;  3ASO C;  4P9O A;  3ZCC A;  1XRE A;  3FB6 C;  2PY5 A;  4IIJ B;  3OUS A;  2IM9 A;  2XOK G;  4MTF A;  3DSQ A;  4R50 A;  2IBZ H;  2Q6A A;  1OHH G;  3L73 H;  1NBM G;  2ZE5 A;  4X1K A;  3ASN B;  4YHH O;  3AG3 B;  4N23 A;  4MVS A;  1S5J A;  5BR8 O;  1N34 B;  2KKW A;  5KUM A;  4DV5 O;  4UCS A;  3DGE A;  1XEQ A;  1F23 A;  1PL4 A;  5FPR A;  2XAS A;  1R6N A;  4JYA O;  4GX5 A;  2WAM A;  4YY3 B;  2Z0A A;  1KQS U;  4A5U B;  4DV4 O;  4IIJ A;  1H8H G;  3F5T A;  4DV1 O;  3E8F A;  1V55 B;  2ZE8 A;  4FM1 A;  1Y6X A;  1YHQ V;  5DN6 G;  3HKE B;  4LH7 A;  4UCV A;  1XOU A;  3K04 A;  1AI7 A;  1IXB A;  3KKY A;  1WB7 A;  1NZ6 A;  2CGN A;  4DRX B;  1J5E B;  2DOS A;  4XDK A;  3ASN C;  3AG3 C;  3D3I A;  3F5W C;  4I50 B;  3B40 A;  2UUA O;  1FAF A;  1IBM O;  1O9H A;  4IL6 Z;  2BOC C;  2P22 C;  4TOI A;  5BMV B;  5KAF Z;  4DV2 B;  3HKE A;  2DYR B;  1LUV A;  5KLV H;  1BZK A;  5DED A;  4DV6 B;  4RUE A;  4GKJ O;  2QJ1 A;  2FYU H;  2YXH A;  1Y66 A;  3O65 A;  1MOF A;  1VF5 B;  2AXT Z;  4DRX A;  4DUY B;  1M9N A;  1V55 C;  5D5Q A;  3OM3 B;  2MK3 A;  2IJJ A;  3JD1 A;  4I50 A;  1FXK B;  1J95 A;  5BMV A;  1HR0 O;  2EIN B;  4J9Z B;  5CA1 B;  1M93 A;  3D36 A;  4X65 O;  1H2L A;  2XHB A;  2EZO A;  3JAT B;  5BY1 A;  1GKF A;  2PZS A;  4LC1 A;  3K06 A;  3ETD A;  4LFB B;  4O4J B;  4KHP O;  5LHH A;  2LW1 A;  1IUR A;  5B1B B;  2DYR C;  1FXK A;  2QSA A;  1AI4 A;  3CD6 V;  3AG2 B;  4L87 A;  3D36 C;  1K92 A;  3P3N A;  3C3S A;  4FLY A;  1K97 A;  4FLX A;  3SYP A;  1YCI A;  2BE3 A;  3HPL C;  3SPH A;  2YIB D;  1NR1 A;  1S0V A;  2Q0O C;  5CA1 A;  1VIB A;  2Q7E A;  1XI1 A;  1FXK C;  1XL4 A;  1AR1 B;  4O4J A;  3T1Y B;  3JAW B;  1RSO B;  1G4Y B;  5EIB D;  2EIN C;  3IAY A;  2NLJ C;  1Y76 B;  3PN1 A;  4JI4 B;  4DR3 B;  3SYQ A;  5GTH Z;  3KG2 A;  2IW5 A;  4NR1 A;  5LA6 B;  3UT5 B;  4JGS A;  2EIL B;  2QR4 A;  2OTJ V;  5B1B C;  4JI3 B;  1R3L C;  4PA3 A;  2FL4 A;  3AG2 C;  4CS3 A;  1ZX3 A;  3JAW A;  4WF9 V;  1RSO A;  5J2U B;  3CCE V;  2QGN A;  2RMK B;  2R9I A;  2PYJ A;  2A9H A;  1L0L H;  1Q7Y W;  4ZIB A;  1Y76 A;  3E35 A;  2VS0 A;  3CXC U;  5LMN O;  1QLE B;  2GDS A;  4Z1M G;  4LF6 O;  3C3T A;  3VBB A;  4I55 B;  1XNQ O;  2F43 G;  5LOV A;  2D3O W;  2WLM A;  3UT5 A;  1H2M A;  1IBL O;  3JCU Z;  5IWA B;  1D5N A;  1K5S A;  2D2C B;  4J7J A;  5JVD A;  4E4E A;  2FTK A;  5J2U A;  1XQ8 A;  3W7S A;  1Y67 A;  1N36 B;  3JAK B;  2EIL C;  4R8C A;  1PNM A;  3B2E E;  3LNN A;  1M90 W;  4DUZ O;  4B3M B;  1WP8 A;  4I55 A;  2ADP A;  2IU3 A;  1LUW A;  2YUA A;  5C8Y B;  3QTC A;  1YJW V;  2CK3 G;  4UV8 A;  2Q68 A;  1QBZ A;  1BS3 A;  2LGW A;  2IU0 A;  5H2F Z;  4AQY B;  5B5E Z;  2PUS A;  4B3S B;  1QLE C;  3CCQ V;  3JCZ A;  3FX7 A;  3K5M A;  2AHY A;  4B08 A;  1VQ6 V;  2PTM A;  4FMT A;  1TAE A;  2NR5 A;  3BPZ A;  4MVM A;  4R7C A;  1KD1 W;  4C7U A;  3K9S A;  1PD3 A;  1VEW A;  1EBO A;  2P5O A;  1K8A W;  4JI6 B;  4LFA B;  2JRI A;  3L74 H;  2FB5 A;  4RAI A;  3SPJ A;  3TCU A;  4FFB A;  3CCS V;  2F23 A;  4RWU A;  1XHX A;  5JH7 B;  3OTO O;  4RQF A;  1OJH A;  3F7Y C;  5GW7 A;  3CRA A;  3TJT A;  5LXT B;  3CCJ V;  3UQ8 A;  1E79 G;  2XT9 A;  2IJI A;  3OEE G;  2KG7 B;  5A9G A;  2WLL B;  3KZI Z;  3J80 N;  4XDJ A;  2UXB B;  1YJN V;  1FFX B;  1YXB A;  3ZRV A;  4P2Z A;  2E74 B;  1A32 A;  4DV7 B;  2DQ3 A;  1WAZ A;  1AP5 A;  4JI8 O;  1P49 A;  5LXT A;  2CTW A;  1K4C C;  5AG2 A;  1PKX A;  1XUQ A;  2JEU A;  1S77 D;  4X8A A;  3ABM B;  3FKS G;  4UCO A;  3QO5 A;  4YHH B;  2KG7 A;  3ABL B;  5BZB A;  2WLL A;  2LFR A;  1H2S B;  4IHJ A;  5BR8 B;  3M8A A;  3OUF A;  2P4V A;  2W0F C;  3P30 A;  4DV5 B;  3N27 A;  1FFX A;  1VQK V;  2EIJ B;  4JYA B;  2BCC H;  4UVB A;  4KUM A;  2ZIM A;  3OW2 U;  3BY6 A;  4DV4 B;  1YVW A;  1N0J A;  1BL8 A;  1WP7 A;  1NVP B;  4J80 A;  2VQF O;  3AG7 A;  3DXR B;  3RYF B;  3CJH B;  4DV1 B;  1R6T A;  4RUF A;  2A3Q A;  4QJF B;  5EK0 A;  1Q5O A;  4DK0 A;  4NTQ A;  4CH3 A;  3MD0 A;  1PNK A;  2RNB A;  5LGN A;  2DWE C;  3U11 A;  3H1J H;  4B7K A;  4IT5 A;  3JD3 A;  1NQT A;  3DC5 A;  3JAR B;  1Y4M A;  3ABM C;  4DR2 O;  3ABL C;  4MVZ A;  5EBM C;  1YDX A;  1JOY A;  3AG4 B;  3CSX A;  2BSK B;  4DR6 O;  2VWK A;  3RYF A;  3B8M A;  1SQX H;  3JAM N;  4FJC C;  5L3F A;  2UUA B;  3OFN G;  1IBM B;  2EIJ C;  2QKS A;  3CC2 V;  2HJF C;  3K59 A;  4BW9 A;  4JV5 B;  5H6Q A;  4GKJ B;  4DXW A;  1O9G A;  1WNS A;  1IDS A;  3JAR A;  3J7A U;  4Z1V A;  1FJG O;  4CH5 A;  3H1K H;  5JCO A;  1I94 O;  2AZ2 A;  2Q73 A;  3CMA V;  2BSK A;  3FFQ A;  3LNM B;  1GM8 A;  4PDR A;  2YIA A;  3L75 H;  3ZBH A;  4G28 B;  1DLB A;  1HR0 B;  4LF5 O;  3CRM A;  3AG4 C;  3FAV B;  2QM8 A;  5JCO C;  2R9A A;  4X65 B;  1FPO A;  3T2M A;  1NT2 B;  2Y0I A;  3RYC B;  3ZRW B;  4KHP B;  1KB9 F;  2E5L O;  4NXN O;  4FLW A;  2GV9 A;  1SQG A;  2A7W A;  4GUN A;  2DYS B;  3SDL A;  1SZT A;  2UUC O;  4JAS A;  2LJ2 A;  5KUK A;  1SQQ H;  3FAV A;  2QWR B;  3P32 A;  3H1I H;  1VQ7 V;  1QHT A;  3HR0 A;  3M7M X;  2XAG A;  4LWS B;  4GCZ A;  3RYC A;  3ZRW A;  1IBK O;  5JJN B;  5CBF A;  4DR4 O;  2E3C A;  2LGQ A;  2QA4 V;  5F2V O;  1YIT V;  2RCV A;  4UVA A;  3L9D A;  1VF6 A;  3CRQ A;  4DR7 O;  1L8D A;  3OGI B;  1N4C A;  4MVR A;  2DW4 A;  1H2N A;  1GRJ A;  3W7T A;  3I5D A;  3ZJZ A;  3A0R A;  5B3S B;  3QO7 A;  4EFB A;  3RT3 C;  1JQ0 A;  2DYS C;  4YJ3 B;  2A79 B;  1VF6 C;  1HDJ A;  5KX5 B;  1Q6I A;  4XBF A;  2H8P C;  4DO2 A;  1MSW D;  3S3X A;  5LMN B;  5B1O A;  5L3C A;  3J81 N;  4LF6 B;  5FNV A;  2R70 A;  1B04 A;  2Y4U A;  1XNQ B;  2EBO A;  1ZL8 B;  1B6Q A;  1W2B U;  3A0H Z;  4LF4 O;  1IBL B;  4JAU A;  4D6T H;  3CWB H;  1RP3 B;  4WFB V;  2UXD O;  1AP6 A;  3K57 A;  1QQC A;  2YS8 A;  4X20 B;  3OTF A;  1VMG A;  2HFE C;  3U10 A;  2ETN A;  4O2A B;  4YJ3 A;  4DW0 A;  5KX5 A;  5LGT A;  1P7B A;  4F6R B;  3QNE A;  1AI5 A;  3UKM A;  4DUZ B;  2WLN A;  1W0J G;  1FXV A;  4K3A A;  4LFC O;  3SJB C;  1W59 A;  5B3S C;  1ZL8 A;  2ODM A;  4GZR B;  2HLD G;  3W7X A;  3K0G A;  3G6E V;  5J2T B;  2OT5 A;  3CYO A;  2P7T C;  2CTR A;  4X20 A;  2ZNJ A;  5HFL A;  5IJ0 A;  5L3G A;  2ZE7 A;  2ZM6 O;  4O2A A;  1EN4 A;  5KHJ A;  4Q6G A;  5EYP B;  4F6R A;  5EZY B;  2X6A A;  5LHG A;  3OMA B;  1Y74 B;  4MVO A;  2L35 A;  3NXS A;  1T5E A;  1R6K A;  4JTD B;  4JZ2 A;  1WLE A;  2QWO B;  1F4N A;  1BCC H;  4PI0 A;  5J2T A;  5DEC A;  1BQZ A;  1VQ9 V;  5IYZ B;  2Q9L A;  3OTO B;  4JI2 O;  1TVK B;  1U96 A;  5C93 A;  2E76 B;  5EYP A;  1AR5 A;  2VWJ A;  3LSQ A;  5EZY A;  2X6C A;  5KHK A;  4Q20 A;  2RN9 A;  1NTK H;  4O2B B;  4FLT A;  2GHY A;  4BWA A;  4X64 O;  1Y74 A;  2P67 A;  3N2G B;  1KC8 W;  3OD4 A;  2JVD A;  3VQV A;  3TXS A;  4JZG A;  2O57 A;  1YF2 A;  2DN9 A;  1H8E G;  1N0N A;  1KEC A;  1GM9 A;  2QTO A;  5L3E A;  1P7G A;  3TXQ A;  5IYZ A;  2A0L A;  4PD4 F;  2OYQ A;  4ZOL B;  4B3T O;  1Q6U A;  4KXR A;  1TVK A;  4DV0 O;  2YI9 A;  4WFG A;  3S3W A;  4Z2W A;  4TQD A;  3OMI B;  2CTP A;  4HZ3 A;  1NH2 B;  4JI8 B;  2LO1 A;  5GTI Z;  4H44 B;  5EBL C;  2QM4 A;  4FFK A;  2H94 A;  3APO A;  5CBH A;  2EJR A;  1L1F A;  3IJ4 A;  5LL6 Y;  1S76 D;  3N2G A;  1F4M A;  2LW7 A;  4JAV A;  4JI7 O;  4YJ2 B;  1XIL A;  2AW9 A;  4HNA B;  3RVZ A;  4LBE C;  1K73 W;  2HR3 A;  1V54 B;  1M56 B;  4PA6 A;  4UCT A;  2CE4 A;  3ETG A;  3OAA G;  1E1Q G;  1NTZ H;  2ZIO A;  4PA4 A;  3ZRS A;  2H3O A;  3T1C A;  3K3W A;  2VQF B;  1EZJ A;  3CRR A;  2ZNI A;  3EXA A;  4NTY A;  1KU9 A;  1BHA A;  1HNW O;  1M1K W;  3A8T A;  4YJ2 A;  1XMO O;  4DR1 O;  2EIM B;  2RJZ A;  4KFM A;  1UJW B;  3JAT A;  4QPJ A;  4YXW G;  4DR2 B;  3BAB A;  3WB1 A;  4N21 A;  2JJ1 G;  1SET A;  2AGA A;  3ZMV A;  1GN3 A;  2HEP A;  4DR6 B;  1US6 A;  3K0D A;  4EEQ A;  2WWW A;  1V54 C;  1SF9 A;  1M56 C;  5B1N A;  3KCY A;  4WFA V;  3CS5 A;  4ZKI A;  1KP2 A;  1N33 O;  4NYK A;  3ZRX A;  3I55 V;  3CCM V;  2KB1 A;  2JS5 A;  3G71 V;  4JI0 O;  4MTO A;  1EZV H;  3WB2 A;  1FJG B;  1I94 B;  3CE2 A;  4BR6 A;  3N2K B;  3E8H A;  4HAM A;  4LF8 O;  1AB3 A;  4PI2 A;  1FKA O;  2EIM C;  2EZP A;  1KYO F;  4B3R O;  1FYJ A;  3FD9 A;  4LF5 B;  5LA6 A;  2JS3 A;  4I4T B;  3ETQ A;  3VQX A;  4MVQ A;  2KSD A;  2DJV A;  4MSW C;  3RFR A;  2GSM B;  4X88 A;  2XAH A;  4W4L A;  5LMU O;  2E5L B;  3GWO A;  3LSU A;  4X89 A;  3OR6 C;  4NXN B;  4KL1 A;  3N2K A;  3JAL B;  2PGG A;  4EFE A;  3A2F A;  3ZHR A;  4O4H B;  4DW1 A;  2UUC B;  5CA3 A;  4I4T A;  2BTO A;  1S72 V;  1PP9 H;  1R3K C;  1ZUQ A;  2Y4T A;  2YIC A;  1Q43 A;  1TA8 A;  3B8N A;  3SJQ C;  4IGG A;  3BA9 A;  1PM9 A;  5JJJ B;  2M7W A;  2XAQ A;  2Q8V A;  3TET A;  1D5A A;  3EVK A;  1IBK B;  4KP4 A;  2YC0 A;  3ZMZ A;  4DR4 B;  3JD2 A;  2K9P A;  2OIG A;  3JAK A;  2QKC A;  3JAL A;  1EM1 A;  4XDL A;  1XL6 A;  2V7Q G;  3JAS B;  4O4H A;  4CH6 A;  4YIO A;  1R3I C;  1VQ8 V;  4DR7 B;  1L0N H;  1Q82 W;  3BFR A;  2JGD B;  3PJS K;  5C8Y A;  4CS4 A;  4K8Z A;  3UO2 A;  3OMN B;  4FM2 A;  2ZD9 A;  1HWY A;  3ZHV A;  4BIU A;  1G8M A;  4P30 A;  4G27 B;  1MG1 A;  4CS2 A;  3O9O A;  3JAS A;  2QKA A;  1JPX A;  2YXL A;  2YID A;  1CP9 A;  1ENV A;  4I9Q A;  4LF4 B;  4QE9 A;  2JGD A;  2IJH A;  4TV8 B;  2W6J G;  2UXD B;  4MW3 A;  2P6J A;  1AVM A;  4PA9 A;  1GN2 A;  2F93 B;  4PDV A;  1THZ A;  2AZ0 A;  4JF3 A;  2OCC B;  5JH7 A;  4G2K A;  3HKC B;  3E86 A;  1H2G A;  5CB4 B;  1QNM A;  4FM0 A;  4U7O A;  3SPC A;  3MHH C;  1SA0 B;  1VP7 A;  4PV1 B;  1P4R A;  2Z5U A;  1DF5 A;  3K08 A;  4LFC B;  1SRY A;  1XDC A;  1YSC A;  1JA8 A;  3KCX A;  3IFX A;  1NS1 A;  4TV8 A;  4X66 O;  1PNL A;  4H13 B;  1BGY H;  1WPB A;  5CN0 A;  3ICX A;  2ZM6 B;  1QR8 A;  3HKC A;  4JAA A;  1DF4 A;  1KKC A;  4J9Y B;  5CB4 A;  3T1H O;  3APQ A;  1SA0 A;  4GKK O;  4TV9 B;  2FML A;  1CEZ A;  1KMI Z;  2OCC C;  3JYC A;  3CC4 V;  1ZTE A;  1MZE A;  1COW G;  1I0H A;  3IGA C;  3ZMU A;  2PI5 A;  2N04 A;  3CCU V;  4JI2 B;  4I0X B;  3RYH B;  3FB8 C;  5A2Q N;  4TWK A;  5FL7 G;  5KHG A;  1Z5V A;  4PHZ A;  3ZMS A;  3THO A;  4JV5 O;  2CUG A;  5CBG A;  4X64 B;  5GON B;  3HKB B;  3DXR A;  3OR7 C;  4JYY A;  3CJH A;  1U97 A;  4CH4 A;  1RPO A;  5IE9 A;  4NB5 A;  1CXZ B;  1Q90 D;  4ABM A;  3MDS A;  5IT9 N;  4B3T B;  2Y0P A;  3C90 A;  4DV0 B;  1ROP A;  4I0X A;  4D7S A;  4CZZ A;  1QU7 A;  1RFY A;  4GT1 A;  2QM7 A;  1JFF B;  4HYO A;  4LNU B;  1QVF U;  1KKD A;  3Q4H B;  3CP1 A;  5GON A;  4DR5 O;  1SQP H;  3HKB A;  2KQX A;  3K5L A;  4JI7 B;  4O4L B;  3LDD A;  1SZX A;  3G4S V;  4PEL A;  1AI6 A;  2JIZ G;  4OPH A;  2EX3 A;  1ZLZ A;  3ZHT A;  5JQG B;  3RW0 A;  2L6L A;  2Y69 B;  4DV3 O;  3OEH G;  1WB8 A;  5HFM A;  1XHZ A;  2RQ6 A;  1N8R W;  4LNU A;  4TSF G;  2IJK A;  1YIJ V;  4X1Y B;  3Q4H A;  4WBN B;  2CH7 B;  1HNW B;  4K35 A;  4MTG A;  4UFZ A;  4BAY A;  4O4L A;  4R6Z A;  2R72 A;  3ABU A;  3ZS8 C;  1XMO B;  1RM1 B;  4JI1 O;  4DR1 B;  1NKD A;  4ZHQ B;  1DGS A;  3K79 A;  3SJA C;  2WA3 A;  3CXH F;  2OWO A;  2WA4 A;  3JSL A;  1YZB A;  4CBC A;  2NNU A;  5IJ9 B;  1OV9 A;  1WPX A;  4X1Y A;  2WLJ A;  1VF7 A;  1YTF D;  4WBN A;  1I5Y A;  2QEX V;  4MT8 A;  2Y69 C;  1N33 B;  2QE7 G;  3CEI A;  1OZ0 A;  2YSU B;  4ZHQ A;  2LP7 A;  2N05 A;  2ZDI A;  2V1D A;  5CMU A;  1K7D A;  4JI0 B;  5CA0 B;  1BSM A;  4IYI A;  5K1P A;  2B1I A;  4LWS A;  3JSN A;  5IJ9 A;  4F4L A;  1RM1 C;  2N74 A;  4LF8 B;  5IDJ A;  1HNZ O;  3R66 A;  1PPJ H;  2ZDI C;  3BA8 A;  1NTM H;  1F7Y A;  1GN6 A;  4CC5 A;  2YDE A;  4B3R B;  3MHS C;  3AG1 B;  3OGC C;  4LR3 A;  1VQL V;  1K33 A;  3ABT A;  4FLZ A;  1M5I A;  3JD0 A;  5CA0 A;  3SR2 C;  2Z3Y A;  2UU9 O;  5LMU B;  3DTU B;  4E2L A;  1MA1 A;  4FK5 C;  2Y48 A;  3B4S A;  2ZQM A;  2AHZ A;  3EHB B;  5KAI Z;  5TIS Z;  1XMQ O;  2Q69 A;  1MMM A;  1BE3 H;  5LGU A;  2HKO A;  4I9W A;  1NR7 A;  2EJ7 A;  3E22 B;  4ZI7 B;  1WN7 A;  3ABK B;  3CCR V;  5FPO A;  5LYJ B;  3CHX A;  3B77 A;  2DWD C;  3TK1 A;  3CCV V;  3I56 V;  3AG1 C;  4LF7 O;  3E2E A;  3W7U A;  4NXM O;  1FS0 G;  4UCR A;  4JTC B;  1GM7 A;  4BW5 A;  4PDL A;  3WFV A;  1D2D A;  2B1G A;  5IYC O;  2Q0A A;  3OT7 A;  3OE7 G;  2WPD G;  2YI8 A;  4GX1 A;  3E22 A;  4ZI7 A;  4LF9 O;  3RBZ A;  1K34 A;  3K5N A;  2DE0 X;  2QWQ B;  3SPG A;  3ZED A;  5LYJ A;  3SPI A;  3ZHU A;  3QVN A;  1CPY A;  1G6U A;  4MVU A;  1MZF A;  3U0Z A;  2CDY A;  2XAJ A;  2Q7G A;  2HHH O;  4W4K A;  3A0B Z;  3ABK C;  1VQM V;  2GTA A;  1BHB A;  3LSS A;  3HB3 B;  4L8J A;  5FLX N;  3R65 A;  1KBH A;  1X59 A;  2F95 B;  1R3J C;  5EC2 C;  3VQY A;  4X62 O;  3FB7 C;  1HNX O;  4J7Z A;  4K0K O;  4O2B A;  1QR9 A;  2OIE A;  5DM6 V;  1ZSP A;  1S5H C;  4FIP C;  4X66 B;  2Q5Z A;  2BTQ B;  3H1L H;  1LR1 A;  4U7N A;  2YIB A;  1FFT B;  3D3Q A;  1YEW A;  2HP8 A;  3K5O A;  4ZOL A;  4OPA A;  4AHC A;  1LNQ A;  1XNR O;  3TGU H;  4TQF A;  4H37 A;  3T1H B;  1YI2 V;  3LDE A;  3LDC A;  1IX9 A;  1UPG A;  2OTL V;  4GKK B;  4WFH A;  1BQ0 A;  2LQT A;  3QO8 A;  3AK2 A;  2DMX A;  1YJ9 V;  1E44 B;  2UUB O;  4FVM A;  3GWK C;  1AR4 A;  3DC6 A;  2BTQ A;  1Q3E A;  3L71 H;  4JI5 O;  5EIB C;  4HNA A;  5ITZ B;  1VQ4 V;  1JJO A;  1I5X A;  3T4D A;  1GN4 A;  1GMG A;  4LH6 A;  1URF A;  1PL0 A;  3B09 A;  1I7F A;  3BHP A;  3G80 A;  4NTW A;  2VQE O;  2BOB C;  4ZBM A;  3BAA A;  3ML0 A;  2GTS A;  2X6B A;  3F7V C;  2Q7H A;  3BCC H;  1TGO A;  3RVY A;  2MW2 B;  3FB5 C;  3WG7 B;  4F6E A;  3ETE A;  1B06 A;  1GK9 A;  4DYL A;  1AJN A;  1MAB G;  1ORQ C;  4AI8 A;  2UXN A;  3VQW A;  4X9Q A;  5ITZ A;  4UV9 A;  2QWP B;  4GX0 A;  1Q86 W;  1SER A;  2A06 H;  4UB6 Z;  2ZCE A;  1NH2 D;  5K1X A;  2UXX A;  1OCR B;  3UO3 A;  4PDM A;  2HVJ C;  1DTO A;  4FZ1 A;  1K3E A;  3E8G A;  1ZAU A;  4TT3 G;  1SC5 B;  2ATK C;  3FYE B;  1IXM A;  2ZT9 B;  4DR5 B;  3JD4 A;  5LOV B;  4K8X A;  5JJE B;  3X2Q B;  4JTA B;  4QGP A;  3CME V;  3K9A A;  5IYD O;  2W0X A;  2QWN B;  3MAQ A;  2ZIN A;  4EB6 B;  5B66 Z;  1SQV H;  3BEH A;  2UXC O;  2M6Y A;  5JVD B;  2NN4 A;  4I7Z B;  2XTA A;  4DV3 B;  1S3J A;  5IY5 B;  1K4D C;  5KA5 A;  4ICG A;  5EBW C;  2GUZ B;  4J7K A;  2EIK B;  4UCU A;  3IC7 A;  1X4T A;  3WG7 C;  5KMG B;  1MSD A;  2F4V O;  4OX9 O;  2RDC A;  3EFF K;  5H9C A;  4J11 A;  1VAR A;  4O4I B;  1Z2G A;  1JR9 A;  4J41 A;  4NKG B;  1PV0 A;  1OCR C;  1EN5 A;  4JI1 B;  1V9P A;  4MTX A;  4EB6 A;  2ZE6 A;  3UM7 A;  1AJQ A;  2K1E A;  2ZXW B;  4LP8 A;  1N32 O;  3ZHQ A;  4OXS A;  2XAF A;  2GUZ A;  4BIO A;  2JJ2 G;  2FKX A;  3STZ C;  2OCH A;  3X2Q C;  5KMG A;  3P3P A;  4TUY B;  4RQE A;  2WLH A;  2HJD A;  1W0K G;  2PF4 E;  4O4I A;  1MNG A;  1JJ2 U;  4GLX A;  3SYC A;  4CC6 A;  5IY5 C;  1QLN A;  4NVP A;  4QE7 A;  2EIK C;  3CRC A;  3SJC C;  5H5N A;  1GAX A;  1N34 O;  4FFB B;  3BVO A;  2WLI B;  3SGI A;  4X1I B;  4H33 A;  2YXY A;  3HKD B;  4YY3 O;  3QG5 A;  1HP8 A;  4WFE A;  3ZN1 A;  1Q8I A;  4TUY A;  3RYI B;  1HNZ B;  2CTQ A;  1M57 B;  2EUL A;  1GTO A;  2IH3 C;  2W6I G;  2ZXW C;  2WLK A;  2Q67 A;  1GO3 F;  1JX9 A;  5H6R A;  1KUQ A;  2WLI A;  3D8C A;  4X1I A;  4UB8 Z;  2UU9 B;  1QCE A;  3HKD A;  1J5E O;  4BIZ A;  4FLU A;  1JCH A;  4OGQ B;  1IVS A;  1EN6 A;  3RYI A;  2ITD C;  3BRC A;  1K9M W;  1XMQ B;  4J42 A;  1AJP A;  3M99 B;  3W7W A;  2Q4P A;  4IHJ B;  1Q81 W;  1ARO P;  1GH6 A;  4DV2 O;  1E1R G;  4DV6 O;  1UFI A;  2CGO A;  1NJI W;  2YEV B;  3CCL V;  2GBO A;  4HBN A;  1M57 C;  3GB7 C;  4DUY O;  3E8B A;  3RN4 A;  1K5Q A;  1S5L Z;  4LF7 B;  4I5S A;  5BXZ A;  1DK1 A;  4NXM B;  2HG5 C; 
#chains in the Genus database with same CATH homology
 3VBB A;  2QEX V;  2F43 G;  4MT8 A;  1KC8 W;  1VQ5 V;  2Y69 C;  2D3O W;  2WLM A;  2QE7 G;  5LBQ A;  1H8E G;  1OZ0 A;  5J9P C;  2YSU B;  1KEC A;  1GM9 A;  2JK5 C;  2LP7 A;  2QTO A;  3K03 A;  1K5S A;  2ZDI A;  3VOU A;  2V1D A;  5L3E A;  2A0L A;  2ZR2 A;  5CMU A;  2YEV A;  1K7D A;  3LUT B;  4WFG A;  2B1I A;  3OMI B;  2FTK A;  2HVK C;  4HZ3 A;  3W7S A;  1NH2 B;  1VQO V;  4F4L A;  1OCO B;  3SYA A;  5EBL C;  4P9P A;  1RM1 C;  2H94 A;  2EIL C;  5CBH A;  4R8C A;  5IDJ A;  1PNM A;  4LCU C;  2EJR A;  1F51 A;  2ZDI C;  1L1F A;  1M90 W;  5L3D A;  1QVG U;  1S76 D;  2X7R B;  2IU3 A;  4WCE V;  2XND G;  1F4M A;  5E1A C;  3MHS C;  1EFR G;  3AG1 B;  3OGC C;  4JAV A;  1YJW V;  2CK3 G;  4UV8 A;  2Q68 A;  4EKW A;  3RVZ A;  1QBZ A;  2JEX A;  4LBE C;  2IU0 A;  1K33 A;  1VQL V;  2HR3 A;  1K73 W;  3ABT A;  1V54 B;  1M56 B;  4PA6 A;  1QLE C;  3JD0 A;  3CCQ V;  3E83 A;  3ETG A;  3OAA G;  2Z3Y A;  1E1Q G;  4QPK A;  3JCZ A;  4PA4 A;  2DQ0 A;  3DTU B;  3ZRS A;  4E2L A;  2AHY A;  4FK5 C;  3T1C A;  1VQ6 V;  3STL C;  3H01 A;  4QIW F;  2Y48 A;  4FMT A;  3K3W A;  3ZIA G;  2ZQM A;  2AHZ A;  1YTF B;  3EHB B;  1EZJ A;  4MVM A;  4R7C A;  1KD1 W;  3FYI B;  1PD3 A;  1BHA A;  4RO2 A;  4ASU G;  2JDI G;  1M1K W;  1EBO A;  2WSS G;  1K8A W;  1FXH A;  2Q69 A;  1OCZ B;  1OCO C;  2EIM B;  4UDM B;  5LGU A;  2HKO A;  4I9W A;  4RAI A;  3SPJ A;  1NR7 A;  4KFM A;  3TCU A;  3CCS V;  1UJW B;  4JYB A;  3ABK B;  3CCR V;  4RQF A;  3F7Y C;  5GW7 A;  4QPJ A;  4YXW G;  3B77 A;  2DWD C;  3TK1 A;  3CCV V;  3I56 V;  4N21 A;  3AG1 C;  2JJ1 G;  1SET A;  4QNH B;  3CCJ V;  3ZMV A;  1NVP D;  3E2E A;  4PA7 A;  3W7U A;  1E79 G;  3K0D A;  1FS0 G;  2IJI A;  4JTC B;  1GM7 A;  2WWW A;  4BW5 A;  1V54 C;  4PDL A;  1M56 C;  5EC1 C;  4WFF A;  3WFV A;  3OEE G;  2B1G A;  5B1N A;  2C2A A;  2IH1 C;  5IYC O;  2WLL B;  4WFA V;  3OE7 G;  4ZKI A;  1KP2 A;  1SES A;  4XDJ A;  3ZRX A;  2WPD G;  4GX1 A;  4UVC A;  3I55 V;  3CCM V;  4JYC A;  2KB1 A;  3RBZ A;  1K34 A;  1YJN V;  2PI4 A;  3ZRV A;  2LFS A;  4P2Z A;  3G71 V;  2DQ3 A;  3SPG A;  1H38 A;  4MTO A;  3SPI A;  2B5U A;  1K4C C;  3T4Z A;  1CPY A;  5IYB O;  3E8H A;  1OCZ C;  1PKX A;  4HAM A;  4MVU A;  2EIM C;  5LHI A;  2EZP A;  2XAJ A;  2JEU A;  5L3B A;  1S77 D;  4X8A A;  3ABM B;  3FKS G;  3QO5 A;  3ABK C;  1VQM V;  1RPR A;  3ABL B;  5BZB A;  2WLL A;  2LFR A;  3ZMT A;  1BHB A;  3OUF A;  2W0F C;  3P30 A;  3LSS A;  3HB3 B;  4MVQ A;  1JVM A;  3E89 A;  2EIJ B;  3R65 A;  1VQK V;  4MSW C;  4UVB A;  1ZWI C;  2GSM B;  4KUM A;  1TUE B;  4X88 A;  2ZR3 A;  2XAH A;  4MW8 A;  3OW2 U;  5KA6 A;  1OCC B;  1R3J C;  2ITC C;  5EC2 C;  3BY6 A;  2P90 A;  5B1A B;  3GWO A;  1VQN V;  4X89 A;  1BL8 A;  3SYO A;  3OR6 C;  3FB7 C;  1NVP B;  3CC7 V;  2X0L A;  4RUF A;  1QR9 A;  5DM6 V;  4QJF B;  3ASO B;  5EK0 A;  1S5H C;  5CA3 A;  3MD0 A;  3AEI A;  4FIP C;  1PNK A;  5LGN A;  2DWE C;  1S72 V;  4U7N A;  4UUJ C;  1R3K C;  3JD3 A;  3SJQ C;  3B8N A;  1NQT A;  1FFT B;  4MS2 A;  2M7W A;  2XAQ A;  3TET A;  1Y4M A;  3ABM C;  4KP4 A;  1LNQ A;  3ABL C;  4MVZ A;  5EBM C;  3ZMZ A;  4UXN A;  4H37 A;  1YI2 V;  3JD2 A;  1JOY A;  3LDE A;  3AG4 B;  3LDC A;  4JPR A;  4GX2 A;  2OTL V;  4XDL A;  4FPP A;  4WFH A;  2R9R B;  3QO8 A;  3CPW U;  1XL6 A;  1R73 A;  2V7Q G;  3B8M A;  4FJC C;  5L3F A;  1YJ9 V;  3OFN G;  2EIJ C;  1BMF G;  1R3I C;  1VQ8 V;  2QKS A;  1E44 B;  3CC2 V;  2HJF C;  1OCC C;  1Q82 W;  5H6Q A;  5B1A C;  3PJS K;  1KP3 A;  4DXW A;  1VQ4 V;  1I5X A;  3OMN B;  3T4D A;  2ZD9 A;  3ZN0 A;  1HWY A;  1VQP V;  3ASO C;  1GMG A;  4P9O A;  3ZCC A;  4BIU A;  3FB6 C;  1G8M A;  3OUS A;  1PL0 A;  4P30 A;  2BOB C;  4ZBM A;  3CMA V;  3ML0 A;  2XOK G;  4MTF A;  4R50 A;  4G27 B;  1MG1 A;  2Q6A A;  1OHH G;  3LNM B;  2X6B A;  1JPX A;  1NBM G;  3F7V C;  1GM8 A;  4PDR A;  3ASN B;  1CP9 A;  3RVY A;  3AG3 B;  1ENV A;  3FB5 C;  3WG7 B;  3ETE A;  4G28 B;  1DLB A;  1GK9 A;  4N23 A;  4QE9 A;  1AJN A;  4MVS A;  2IJH A;  1MAB G;  1ORQ C;  2W6J G;  2UXN A;  4MW3 A;  5KUM A;  2P6J A;  3AG4 C;  4PA9 A;  2QM8 A;  4UV9 A;  3DGE A;  1F23 A;  4GX0 A;  4PDV A;  1Q86 W;  1SER A;  1THZ A;  2XAS A;  1R6N A;  4JF3 A;  3T2M A;  4GX5 A;  2OCC B;  4G2K A;  2WAM A;  1NH2 D;  2UXX A;  1OCR B;  3ZRW B;  1KQS U;  4PDM A;  2HVJ C;  3E86 A;  1H2G A;  1DTO A;  1K3E A;  1H8H G;  3E8G A;  4TT3 G;  4U7O A;  3SPC A;  2ATK C;  3FYE B;  1IXM A;  3MHH C;  1P4R A;  2Z5U A;  1DF5 A;  3K08 A;  3JD4 A;  1SRY A;  3E8F A;  1YSC A;  1V55 B;  2DYS B;  1SZT A;  3X2Q B;  3IFX A;  4JTA B;  4JAS A;  3CME V;  5KUK A;  3K9A A;  1YHQ V;  5DN6 G;  5IYD O;  1PNL A;  3P32 A;  3K04 A;  1AI7 A;  3BEH A;  1VQ7 V;  5CN0 A;  1S3J A;  5IY5 B;  1K4D C;  2XAG A;  5KA5 A;  5EBW C;  4GCZ A;  1QR8 A;  3ZRW A;  2EIK B;  4XDK A;  3ASN C;  1DF4 A;  3IC7 A;  3AG3 C;  4J9Y B;  3WG7 C;  5CBF A;  3D3I A;  2QA4 V;  3F5W C;  1YIT V;  3EFF K;  5H9C A;  4UVA A;  1CEZ A;  2OCC C;  3JYC A;  3CC4 V;  2BOC C;  1OCR C;  4MVR A;  1COW G;  2DYR B;  2DW4 A;  3IGA C;  4MTX A;  3ZMU A;  2PI5 A;  3UM7 A;  4RUE A;  3W7T A;  3ZJZ A;  1Y66 A;  3A0R A;  1AJQ A;  2K1E A;  2ZXW B;  4LP8 A;  1MOF A;  3CCU V;  5B3S B;  4OXS A;  2XAF A;  3QO7 A;  3FB8 C;  1JQ0 A;  1M9N A;  1V55 C;  2DYS C;  2JJ2 G;  2A79 B;  4TWK A;  5FL7 G;  3STZ C;  3X2Q C;  3OM3 B;  4XBF A;  2H8P C;  4DO2 A;  2MK3 A;  1MSW D;  2IJJ A;  3ZMS A;  3JD1 A;  4RQE A;  1FXK B;  2WLH A;  5B1O A;  5CBG A;  1W0K G;  5L3C A;  1JJ2 U;  3OR7 C;  1J95 A;  3SYC A;  2EBO A;  5IY5 C;  1QLN A;  1RPO A;  1B6Q A;  1W2B U;  4QE7 A;  2EIK C;  2EIN B;  4J9Z B;  4JAU A;  4WFB V;  2WLI B;  3D36 A;  4H33 A;  2EZO A;  2HFE C;  1ROP A;  1GKF A;  4LC1 A;  3K06 A;  4CZZ A;  3ETD A;  5LHH A;  4GT1 A;  5LGT A;  4WFE A;  2QM7 A;  1P7B A;  3ZN1 A;  4HYO A;  1KKD A;  1QVF U;  5B1B B;  2DYR C;  1FXK A;  3QNE A;  1AI5 A;  3UKM A;  1AI4 A;  3CD6 V;  3CP1 A;  2WLN A;  1W0J G;  1FXV A;  1M57 B;  3AG2 B;  1GTO A;  2IH3 C;  2W6I G;  2ZXW C;  4L87 A;  1K92 A;  2WLK A;  5B3S C;  2Q67 A;  1GO3 F;  2HLD G;  1K97 A;  3W7X A;  3LDD A;  3SYP A;  3K0G A;  3G4S V;  3HPL C;  4PEL A;  3G6E V;  1JX9 A;  3SPH A;  1NR1 A;  2OT5 A;  1S0V A;  1AI6 A;  2JIZ G;  3CYO A;  5H6R A;  2WLI A;  2P7T C;  5HFL A;  1FXK C;  5L3G A;  3RW0 A;  2Y69 B;  1QCE A;  1XL4 A;  3OEH G;  5HFM A;  1AR1 B;  4BIZ A;  1G4Y B;  1JCH A;  1N8R W;  4TSF G;  2EIN C;  2NLJ C;  2IJK A;  1YIJ V;  2X6A A;  5LHG A;  2ITD C;  3OMA B;  3SYQ A;  1K9M W;  4MVO A;  3NXS A;  3KG2 A;  2IW5 A;  4MTG A;  1AJP A;  1R6K A;  4JTD B;  3M99 B;  3W7W A;  4BAY A;  4R6Z A;  1WLE A;  1Q81 W;  3ABU A;  1ARO P;  4JGS A;  1F4N A;  1RM1 B;  1NKD A;  2EIL B;  2OTJ V;  1E1R G;  1VQ9 V;  5B1B C;  3K79 A;  1R3L C;  1NJI W;  4PA3 A;  2YEV B;  3CCL V;  3AG2 C;  1M57 C;  5C93 A;  3GB7 C;  3E8B A;  4CBC A;  4WF9 V;  3CCE V;  2NNU A;  2R9I A;  1K5Q A;  2A9H A;  3LSQ A;  1Q7Y W;  1WPX A;  2X6C A;  4I5S A;  2WLJ A;  4Q20 A;  3E35 A;  1YTF D;  3CXC U;  1QLE B;  2HG5 C;  1I5Y A;  4Z1M G;  2GHY A;  2P67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...