1JCHB

Crystal structure of colicin e3 in complex with its immunity protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Ribosome inhibitor, hydrolase
molecule keywords COLICIN E3
total genus 19
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 1jchB00
4UDMA 3EIPA 2B5UB 1JCHB 1E44A
chains in the Genus database with same CATH superfamily
1LL4A 2MNTA 1ZL1A 1XRVA 1SYTA 1FKGA 4DRJA 4JFLA 3RM9A 2PN0A 4ML4A 2XP7A 3GTYX 1OWQA 1Q6IA 1VF8A 1UR8A 1E9LA 4WKFA 3IKDA 3NTPA 3B7XA 5HWBA 2VN1A 1ZBCA 3RM8A 1FKTA 3WKZA 4G2PA 2M1IA 3NRKA 4DT4A 2K8IA 1N1AA 4U85A 3WIJA 4DZ2A 2PV3A 1D2KA 3CHDA 3TC5A 3O5EA 4AY1A 3NI6A 4UDMA 1KFWA 2XP3A 3WL0A 4GGQA 1IX5A 5I98A 2O92A 1PBKA 4WKAA 2DSUA 4J4OA 2YBUA 4MNKA 2WLZA 4QT2A 3KABA 4LAYA 4MTVA 2KI3A 3G6LA 2AOSA 2DT0A 3AS2A 2XP8A 3AS0A 5HWCA 3EIPA 2PPNA 3AS1A 3IK8A 1R9HA 1XHGA 1E6RA 4Z2GA 2A3EA 3MDYB 4W9PA 4Z2LA 2PI6A 2LJ4A 1FKFA 4JFKA 4QT3A 4GIVA 2OFNA 1NWRA 4HARA 4KQZA 1W1VA 4QZVB 2RQSA 3ALFA 3AROA 4ZPTR 2LGOA 2FDMA 5HW8A 2P4VA 2F21A 2XPBA 3BMBA 1W9VA 3TDBA 1NWTA 1SR0A 3ARYA 1JVWA 2UZ5A 4DWSD 1BL4A 1JNTA 1KT1A 2F23A 1NSGA 3ODKA 4WKHA 3O5FA 4L72B 5HT1A 4IT6A 3WD1A 4TW8A 1J6YA 1JNSA 3ARWA 1Y0OA 3PRDA 2EULA 1E6NA 5DO2A 4Z2HA 4Z2KA 3RGCA 1NMVA 4FN2A 3WD2A 1HJXA 3KAFA 5GPRA 4ODLA 3G6MA 1TCOC 4J4NA 4W5UA 1ZCNA 4ZPVR 5DF0A 4ODNA 1GOIA 4ODKA 4FAPA 2ZQUA 4P8VA 4Q22A 2XPAA 3WD4A 2N87A 5HBFA 1PINA 4QIBA 4JFIA 3WD0A 4U84A 2WM0A 1LQ0A 4S3KA 2PV1A 3WL1A 5DIUA 1D7JA 2M08A 4BF8A 1ZBWA 1FKBA 2QF8A 1E6ZA 4P8WA 2XP4A 1FJDA 4JFMA 5HUAA 2M2AA 4LAXA 5GPGA 4JFJA 3TCZA 3CGNA 4W9QA 2ZR4A 3RM4A 4WIWA 1H0GA 1K9TA 3B8SA 2OLHA 4URIA 5HKGA 2ZQTA 3UQIA 1FKDA 4LGXA 1GPFA 3LUOA 2F4EA 1EDQA 1NWSA 2JZVA 1HKIA 2WLYA 4DRPA 1L1PA 1FAPA 1RD6A 2DG3A 1P5QA 2PBCA 4TYOA 2ITKA 4R0XA 1LL6A 2DPEA 1EIBA 4ODPA 5J6EA 2DT2A 3O5DA 4IQCA 1Q6HA 2PV2A 4LAVA 3B9EA 4HBEA 2RUCA 1FKHA 2DT3A 3AS3A 4O2TA 4PTMA 1BKFA 2ESCA 1W1PA 1HJWA 4MPKA 2WK2A 3O5LA 2MPHA 3JYJA 4DROA 1C9HA 1EQ3A 4MNMA 2ZQVA 2FKEA 2VCDA 3PR9A 4TW7A 2MLXA 3KAGA 3UQAA 5HW7A 2ZR5A 4WK9A 4ODRA 2A3CA 1J4IA 4DRQA 1T11A 4MSPA 2IUZA 2DSZA 3VAWA 1QPFA 2D9FA 3O5OA 2A3AA 3O5IA 4KR0B 1ZBVA 3UQBA 4S3JA 1B6CA 2DG9A 1Q6UA 4WJXA 2KFWA 1ZB5A 3ARZA 4JYSA 1NWUA 4G50A 4MNLA 2PPPA 3RFWA 1HKMA 1D6OA 4L3NA 2RURA 2XP9A 3PA7A 3UI4A 1X6NA 4ODQA 1O6IA 3WQVA 3KAIA 4U86A 4IT4A 1WAWA 3O5GA 4R5EA 2DT1A 1YATA 3ALGA 3CHCA 4MNJA 4NSBA 3UI5A 1FKRA 3CGMA 3KAHA 1KT0A 3KACA 3IHZA 1OGGA 1D7IA 1ROUA 1QPLA 4P8XA 3ARVA 2B5UB 2G8ZA 2XP6A 5JH8A 1M5YA 1Q1CA 1W26A 2G41A 1A7XA 2RUQA 2Q5AA 3H9RB 4DRNA 1F40A 3OA5A 3AQUA 2KE0A 2DSVA 2Y78A 3WH0A 4Q7NA 1JCHB 1TFVA 4C02B 2LPVA 1ITXA 3WD3A 2MLZA 3GU0A 3IKGA 1GUVA 1ZBKA 5B8IC 4XAKA 3CHEA 1E15A 1W9PA 2B31A 4TW6A 1FKSA 1GRJA 1LG2A 2O9OA 1FKLA 1D7HA 4ZPWR 1FD9A 1J4HA 1YW5A 1X6LA 5DEZA 3ARUA 3OOBA 5BXJA 2ZR6A 3O5JA 3ARRA 2LKNA 4NNRA 1JNDA 3KZ7A 4MAVA 4TX0A 3ARSA 3JXVA 5HTGA 5DIVA 3B9AA 4P8UA 3FAPA 3O5KA 1FKIA 1FKJA 1LJYA 2DSWA 4IQ2A 3RMEA 1UR9A 4DZ3A 1W1YA 1W9UA 4DWSA 3O5MA 1NH6A 1ROTA 3PRBA 1CTNA 3GPKA 3QOKA 3CH9A 4Z2JA 1E6PA 1E44A 4DWSB 2XP5A 1WNOA 4ZS6A 1ZU8A 1EHNA 3PRAA 1NMWA 1LL7A 5HW6A 3UF8A 2KR7A 2RSEA 2DG4A 3ARXA 1ZK6A 2PPOA 4DRMA 2A3BA 3O5QA 4DIPA 1HJVA 3O5RA 2YBTA 2IF4A 1HKJA 4MGVA 1LG1A 1J4RA 1EYMA 1F8AB 1W1TA 4LAWA 4TNSA 1HKKA 1FKKA 4N19A 4NZCA 1OGBA 3BXWA 4DRHA 3CZ8A 3WQWA 4DH0A 5GQBA 3ARPA 1QZ2A 2ETNA 4DWSC 1HXVA 3KADA 1FFQA 4DRIA 3ARTA 3B9DA 2MF9A 4ITZA 5DITA 3FY1A 3EY6A 3JYMA 1H0IA 1U79A 3I6CA 2MLYA 3KCEA 2FAPA 4IPXA 4ODOA 2AWGA 4Z2IA 5D75A 2F2DA 2ZQSA 3ARQA 3O5PA 4DRKA 2L2SA 1WB0A 4ODMA 1FFRA 4HBOA 2RUDA 1JNEA 3UI6A 3W4RA 4W9OA 3CHFA 2KGJA 2KO7A 3FXYA
chains in the Genus database with same CATH topology
4UDMA 3EIPA 2B5UB 1JCHB 1E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDM A;  3EIP A;  2B5U B;  1JCH B;  1E44 A; 
#chains in the Genus database with same CATH topology
 1LL4 A;  2MNT A;  1ZL1 A;  1XRV A;  1SYT A;  1FKG A;  4DRJ A;  4JFL A;  3RM9 A;  2PN0 A;  4ML4 A;  2XP7 A;  3GTY X;  1OWQ A;  1Q6I A;  1VF8 A;  1UR8 A;  1E9L A;  4WKF A;  3IKD A;  3NTP A;  3B7X A;  5HWB A;  2VN1 A;  1ZBC A;  3RM8 A;  1FKT A;  3WKZ A;  4G2P A;  2M1I A;  3NRK A;  4DT4 A;  2K8I A;  1N1A A;  4U85 A;  3WIJ A;  4DZ2 A;  2PV3 A;  1D2K A;  3CHD A;  3TC5 A;  3O5E A;  4AY1 A;  3NI6 A;  4UDM A;  1KFW A;  2XP3 A;  3WL0 A;  4GGQ A;  1IX5 A;  5I98 A;  2O92 A;  1PBK A;  4WKA A;  2DSU A;  4J4O A;  2YBU A;  4MNK A;  2WLZ A;  4QT2 A;  3KAB A;  4LAY A;  4MTV A;  2KI3 A;  3G6L A;  2AOS A;  2DT0 A;  3AS2 A;  2XP8 A;  3AS0 A;  5HWC A;  3EIP A;  2PPN A;  3AS1 A;  3IK8 A;  1R9H A;  1XHG A;  1E6R A;  4Z2G A;  2A3E A;  3MDY B;  4W9P A;  4Z2L A;  2PI6 A;  2LJ4 A;  1FKF A;  4JFK A;  4QT3 A;  4GIV A;  2OFN A;  1NWR A;  4HAR A;  4KQZ A;  1W1V A;  4QZV B;  2RQS A;  3ALF A;  3ARO A;  4ZPT R;  2LGO A;  2FDM A;  5HW8 A;  2P4V A;  2F21 A;  2XPB A;  3BMB A;  1W9V A;  3TDB A;  1NWT A;  1SR0 A;  3ARY A;  1JVW A;  2UZ5 A;  4DWS D;  1BL4 A;  1JNT A;  1KT1 A;  2F23 A;  1NSG A;  3ODK A;  4WKH A;  3O5F A;  4L72 B;  5HT1 A;  4IT6 A;  3WD1 A;  4TW8 A;  1J6Y A;  1JNS A;  3ARW A;  1Y0O A;  3PRD A;  2EUL A;  1E6N A;  5DO2 A;  4Z2H A;  4Z2K A;  3RGC A;  1NMV A;  4FN2 A;  3WD2 A;  1HJX A;  3KAF A;  5GPR A;  4ODL A;  3G6M A;  1TCO C;  4J4N A;  4W5U A;  1ZCN A;  4ZPV R;  5DF0 A;  4ODN A;  1GOI A;  4ODK A;  4FAP A;  2ZQU A;  4P8V A;  4Q22 A;  2XPA A;  3WD4 A;  2N87 A;  5HBF A;  1PIN A;  4QIB A;  4JFI A;  3WD0 A;  4U84 A;  2WM0 A;  1LQ0 A;  4S3K A;  2PV1 A;  3WL1 A;  5DIU A;  1D7J A;  2M08 A;  4BF8 A;  1ZBW A;  1FKB A;  2QF8 A;  1E6Z A;  4P8W A;  2XP4 A;  1FJD A;  4JFM A;  5HUA A;  2M2A A;  4LAX A;  5GPG A;  4JFJ A;  3TCZ A;  3CGN A;  4W9Q A;  2ZR4 A;  3RM4 A;  4WIW A;  1H0G A;  1K9T A;  3B8S A;  2OLH A;  4URI A;  5HKG A;  2ZQT A;  3UQI A;  1FKD A;  4LGX A;  1GPF A;  3LUO A;  2F4E A;  1EDQ A;  1NWS A;  2JZV A;  1HKI A;  2WLY A;  4DRP A;  1L1P A;  1FAP A;  1RD6 A;  2DG3 A;  1P5Q A;  2PBC A;  4TYO A;  2ITK A;  4R0X A;  1LL6 A;  2DPE A;  1EIB A;  4ODP A;  5J6E A;  2DT2 A;  3O5D A;  4IQC A;  1Q6H A;  2PV2 A;  4LAV A;  3B9E A;  4HBE A;  2RUC A;  1FKH A;  2DT3 A;  3AS3 A;  4O2T A;  4PTM A;  1BKF A;  2ESC A;  1W1P A;  1HJW A;  4MPK A;  2WK2 A;  3O5L A;  2MPH A;  3JYJ A;  4DRO A;  1C9H A;  1EQ3 A;  4MNM A;  2ZQV A;  2FKE A;  2VCD A;  3PR9 A;  4TW7 A;  2MLX A;  3KAG A;  3UQA A;  5HW7 A;  2ZR5 A;  4WK9 A;  4ODR A;  2A3C A;  1J4I A;  4DRQ A;  1T11 A;  4MSP A;  2IUZ A;  2DSZ A;  3VAW A;  1QPF A;  2D9F A;  3O5O A;  2A3A A;  3O5I A;  4KR0 B;  1ZBV A;  3UQB A;  4S3J A;  1B6C A;  2DG9 A;  1Q6U A;  4WJX A;  2KFW A;  1ZB5 A;  3ARZ A;  4JYS A;  1NWU A;  4G50 A;  4MNL A;  2PPP A;  3RFW A;  1HKM A;  1D6O A;  4L3N A;  2RUR A;  2XP9 A;  3PA7 A;  3UI4 A;  1X6N A;  4ODQ A;  1O6I A;  3WQV A;  3KAI A;  4U86 A;  4IT4 A;  1WAW A;  3O5G A;  4R5E A;  2DT1 A;  1YAT A;  3ALG A;  3CHC A;  4MNJ A;  4NSB A;  3UI5 A;  1FKR A;  3CGM A;  3KAH A;  1KT0 A;  3KAC A;  3IHZ A;  1OGG A;  1D7I A;  1ROU A;  1QPL A;  4P8X A;  3ARV A;  2B5U B;  2G8Z A;  2XP6 A;  5JH8 A;  1M5Y A;  1Q1C A;  1W26 A;  2G41 A;  1A7X A;  2RUQ A;  2Q5A A;  3H9R B;  4DRN A;  1F40 A;  3OA5 A;  3AQU A;  2KE0 A;  2DSV A;  2Y78 A;  3WH0 A;  4Q7N A;  1JCH B;  1TFV A;  4C02 B;  2LPV A;  1ITX A;  3WD3 A;  2MLZ A;  3GU0 A;  3IKG A;  1GUV A;  1ZBK A;  5B8I C;  4XAK A;  3CHE A;  1E15 A;  1W9P A;  2B31 A;  4TW6 A;  1FKS A;  1GRJ A;  1LG2 A;  2O9O A;  1FKL A;  1D7H A;  4ZPW R;  1FD9 A;  1J4H A;  1YW5 A;  1X6L A;  5DEZ A;  3ARU A;  3OOB A;  5BXJ A;  2ZR6 A;  3O5J A;  3ARR A;  2LKN A;  4NNR A;  1JND A;  3KZ7 A;  4MAV A;  4TX0 A;  3ARS A;  3JXV A;  5HTG A;  5DIV A;  3B9A A;  4P8U A;  3FAP A;  3O5K A;  1FKI A;  1FKJ A;  1LJY A;  2DSW A;  4IQ2 A;  3RME A;  1UR9 A;  4DZ3 A;  1W1Y A;  1W9U A;  4DWS A;  3O5M A;  1NH6 A;  1ROT A;  3PRB A;  1CTN A;  3GPK A;  3QOK A;  3CH9 A;  4Z2J A;  1E6P A;  1E44 A;  4DWS B;  2XP5 A;  1WNO A;  4ZS6 A;  1ZU8 A;  1EHN A;  3PRA A;  1NMW A;  1LL7 A;  5HW6 A;  3UF8 A;  2KR7 A;  2RSE A;  2DG4 A;  3ARX A;  1ZK6 A;  2PPO A;  4DRM A;  2A3B A;  3O5Q A;  4DIP A;  1HJV A;  3O5R A;  2YBT A;  2IF4 A;  1HKJ A;  4MGV A;  1LG1 A;  1J4R A;  1EYM A;  1F8A B;  1W1T A;  4LAW A;  4TNS A;  1HKK A;  1FKK A;  4N19 A;  4NZC A;  1OGB A;  3BXW A;  4DRH A;  3CZ8 A;  3WQW A;  4DH0 A;  5GQB A;  3ARP A;  1QZ2 A;  2ETN A;  4DWS C;  1HXV A;  3KAD A;  1FFQ A;  4DRI A;  3ART A;  3B9D A;  2MF9 A;  4ITZ A;  5DIT A;  3FY1 A;  3EY6 A;  3JYM A;  1H0I A;  1U79 A;  3I6C A;  2MLY A;  3KCE A;  2FAP A;  4IPX A;  4ODO A;  2AWG A;  4Z2I A;  5D75 A;  2F2D A;  2ZQS A;  3ARQ A;  3O5P A;  4DRK A;  2L2S A;  1WB0 A;  4ODM A;  1FFR A;  4HBO A;  2RUD A;  1JNE A;  3UI6 A;  3W4R A;  4W9O A;  3CHF A;  2KGJ A;  2KO7 A;  3FXY A; 
#chains in the Genus database with same CATH homology
 4UDM A;  3EIP A;  2B5U B;  1JCH B;  1E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...