1JCHB

Crystal structure of colicin e3 in complex with its immunity protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E3
publication title Crystal structure of colicin E3: implications for cell entry and ribosome inactivation.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Ribosome inhibitor, hydrolase
total genus 19
structure length 84
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 1jchB00
3EIPA 2B5UB 4UDMA 1JCHB 1E44A
chains in the Genus database with same CATH superfamily
4URIA 2QF8A 1HJWA 5HBFA 2RQSA 4QT3A 2KGJA 3CH9A 2PPPA 4L3NA 3VAWA 1KT0A 3UQBA 2IF4A 2WLYA 1XHGA 4P8XA 2OLHA 3RM8A 3RM9A 1FD9A 3KAGA 3O5KA 4LGXA 2PV2A 3KZ7A 1R9HA 1W1PA 3NI6A 1ROUA 5HT1A 1FFRA 3I6CA 1NMWA 2B5UB 1D6OA 4HBEA 1NH6A 4Z2LA 4JFKA 4P8VA 4QIBA 2KI3A 4JFIA 1HKMA 3TDBA 5HW6A 1E15A 1WB0A 4MNJA 4ZS6A 1FKHA 3CGMA 1W1YA 2ZQVA 3ARVA 4MAVA 1M5YA 1OGGA 2XP5A 4R0XA 1ZB5A 1QZ2A 4U86A 4NZCA 1GPFA 5HWCA 1FKKA 1ROTA 2WK2A 1L1PA 3IHZA 4ODRA 4DRHA 4QT2A 2F2DA 3TC5A 1ZBKA 4DT4A 1NWRA 4MTVA 1FKGA 2LPVA 1LQ0A 3BMBA 1D7IA 2EULA 2PI6A 1FKJA 4UDMA 4LAYA 1J6YA 3ALFA 4DWSD 1E6NA 2YBUA 3AROA 3G6LA 1Q6HA 1W9PA 2B31A 1JCHB 2P4VA 2A3EA 1EIBA 5DEZA 1X6LA 3O5DA 2FDMA 3ARPA 1Q6UA 4Q22A 1NWTA 1TFVA 3B8SA 1J4IA 1J4RA 4S3KA 4WJXA 1FFQA 3WD4A 1OGBA 3LUOA 4P8UA 1E6RA 4ODOA 3UQIA 1SR0A 4HARA 3O5QA 1D2KA 3KAFA 4DRNA 4DRJA 3ODKA 2DSZA 2XP9A 2PBCA 3O5LA 1ZL1A 3H9RB 2UZ5A 3NTPA 1C9HA 3CHCA 4W5UA 2F23A 3KACA 3OA5A 3O5MA 2YBTA 4DROA 3AS0A 1FKDA 4ZPVR 3JYMA 2DSVA 2VCDA 1FJDA 2OFNA 1P5QA 3WQVA 4DH0A 2DG9A 1WNOA 4MSPA 4Z2GA 1FKSA 1W1VA 2WLZA 4WKFA 3ARTA 2FKEA 1UR9A 2XP8A 3ARQA 4DIPA 2RUDA 2G41A 3B9DA 4XAKA 3BXWA 1FKBA 4AY1A 3EIPA 1D7JA 3RMEA 3WD0A 2MLXA 4MNMA 3WD1A 4DRMA 2AOSA 1E9LA 2ESCA 3ARZA 5GQBA 2ETNA 3ARXA 3PR9A 4ML4A 1ZCNA 3FY1A 2KR7A 2KO7A 4JFMA 4MPKA 1HKKA 5B8IC 4ODNA 4Z2IA 3CHDA 4WIWA 1FKIA 3UI4A 3UF8A 4DWSA 4ODQA 1JNEA 2XPBA 3FXYA 2DSWA 3ARYA 3IKGA 3JXVA 2VN1A 1A7XA 4WK9A 3GTYX 2KE0A 1FAPA 4TW6A 1GOIA 4IT6A 1ZK6A 4NNRA 1FKRA 1Q1CA 2M08A 4W9QA 4WKHA 2ZR5A 1XRVA 2PPNA 3B9EA 2RSEA 3B9AA 3WIJA 1HXVA 3O5GA 1HJXA 1HKJA 3WL0A 2DT1A 2Q5AA 2LJ4A 1D7HA 3ARRA 2G8ZA 1KFWA 2K8IA 3OOBA 3WL1A 3PA7A 4MGVA 4TYOA 1HJVA 4DRQA 1K9TA 3IKDA 4BF8A 2A3AA 1GRJA 3RM4A 2A3BA 4TW7A 3O5FA 3RGCA 4Z2HA 1FKTA 1SYTA 1F40A 5D75A 4ZPTR 3UI6A 1W26A 1BKFA 4KR0B 2DG4A 1NSGA 2MNTA 4ZPWR 4GGQA 2RURA 2M1IA 2FAPA 3O5JA 1H0IA 1QPFA 4O2TA 2ZR6A 4JFJA 1KT1A 1EYMA 1EDQA 1ZBWA 1B6CA 4ODKA 3AS3A 3EY6A 3WKZA 5HUAA 3WD2A 1JNSA 4U84A 2XP7A 1O6IA 4J4NA 4NSBA 3TCZA 3O5RA 2MPHA 1LL6A 5DIUA 4DRKA 3RFWA 3QOKA 4S3JA 5BXJA 5GPRA 2XP6A 1IX5A 1CTNA 2XPAA 2M2AA 2WM0A 4ODLA 2DT0A 2ZQTA 3O5IA 5DITA 5HW7A 1OWQA 4G50A 1NWSA 4JYSA 1LJYA 2O9OA 2DT2A 2MF9A 2PPOA 1FKFA 4TX0A 4DRPA 1NMVA 1H0GA 3PRDA 1ZBVA 2IUZA 2O92A 4Z2JA 4TW8A 1LG2A 5HWBA 4P8WA 3ARWA 1VF8A 4DZ3A 5HTGA 1W9VA 2F21A 4HBOA 5HW8A 3WH0A 4WKAA 3ALGA 3UQAA 2DG3A 3ARSA 3CHEA 4Z2KA 2RUQA 3CHFA 5DIVA 1X6NA 4ODPA 1E6ZA 2ZQSA 3AS2A 2RUCA 1HKIA 4QZVB 4PTMA 2LGOA 3ARUA 4R5EA 5GPGA 2D9FA 3WQWA 2PV1A 3AQUA 4FAPA 1JNTA 3KAIA 1FKLA 4IT4A 3CZ8A 5DO2A 3GPKA 3AS1A 1F8AB 2L2SA 3IK8A 3CGNA 4LAVA 3B7XA 1LL4A 1W9UA 3O5PA 1ZBCA 4TNSA 1ZU8A 3GU0A 5J6EA 4MNKA 1EHNA 4KQZA 1EQ3A 1E6PA 1J4HA 4N19A 1PBKA 2ITKA 2F4EA 4LAXA 2AWGA 3KABA 2KFWA 2MLYA 2XP3A 5DF0A 4LAWA 2N87A 1YW5A 1BL4A 1GUVA 4DRIA 4IPXA 1NWUA 1RD6A 2DT3A 3G6MA 3UI5A 2DPEA 5JH8A 3KAHA 3KCEA 4DWSB 4C02B 1LL7A 3NRKA 4FN2A 1WAWA 4IQ2A 1T11A 1N1AA 1UR8A 2PV3A 3JYJA 4W9OA 4DWSC 4G2PA 1JNDA 2ZR4A 4ITZA 1JVWA 2DSUA 2Y78A 1PINA 3FAPA 4DZ2A 3O5EA 4IQCA 1ITXA 1Y0OA 1LG1A 4MNLA 3PRAA 3WD3A 1TCOC 4U85A 1YATA 2JZVA 3O5OA 3W4RA 4ODMA 1E44A 3KADA 4W9PA 2PN0A 1Q6IA 2A3CA 1QPLA 4L72B 4JFLA 2MLZA 2XP4A 4Q7NA 4GIVA 1U79A 2ZQUA 3PRBA 5HKGA 4J4OA 5I98A 1W1TA 3MDYB 2LKNA
chains in the Genus database with same CATH topology
3EIPA 2B5UB 4UDMA 1JCHB 1E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIP A;  2B5U B;  4UDM A;  1JCH B;  1E44 A; 
#chains in the Genus database with same CATH topology
 4URI A;  2QF8 A;  1HJW A;  5HBF A;  2RQS A;  4QT3 A;  2KGJ A;  3CH9 A;  2PPP A;  4L3N A;  3VAW A;  1KT0 A;  3UQB A;  2IF4 A;  2WLY A;  1XHG A;  4P8X A;  2OLH A;  3RM8 A;  3RM9 A;  1FD9 A;  3KAG A;  3O5K A;  4LGX A;  2PV2 A;  3KZ7 A;  1R9H A;  1W1P A;  3NI6 A;  1ROU A;  5HT1 A;  1FFR A;  3I6C A;  1NMW A;  2B5U B;  1D6O A;  4HBE A;  1NH6 A;  4Z2L A;  4JFK A;  4P8V A;  4QIB A;  2KI3 A;  4JFI A;  1HKM A;  3TDB A;  5HW6 A;  1E15 A;  1WB0 A;  4MNJ A;  4ZS6 A;  1FKH A;  3CGM A;  1W1Y A;  2ZQV A;  3ARV A;  4MAV A;  1M5Y A;  1OGG A;  2XP5 A;  4R0X A;  1ZB5 A;  1QZ2 A;  4U86 A;  4NZC A;  1GPF A;  5HWC A;  1FKK A;  1ROT A;  2WK2 A;  1L1P A;  3IHZ A;  4ODR A;  4DRH A;  4QT2 A;  2F2D A;  3TC5 A;  1ZBK A;  4DT4 A;  1NWR A;  4MTV A;  1FKG A;  2LPV A;  1LQ0 A;  3BMB A;  1D7I A;  2EUL A;  2PI6 A;  1FKJ A;  4UDM A;  4LAY A;  1J6Y A;  3ALF A;  4DWS D;  1E6N A;  2YBU A;  3ARO A;  3G6L A;  1Q6H A;  1W9P A;  2B31 A;  1JCH B;  2P4V A;  2A3E A;  1EIB A;  5DEZ A;  1X6L A;  3O5D A;  2FDM A;  3ARP A;  1Q6U A;  4Q22 A;  1NWT A;  1TFV A;  3B8S A;  1J4I A;  1J4R A;  4S3K A;  4WJX A;  1FFQ A;  3WD4 A;  1OGB A;  3LUO A;  4P8U A;  1E6R A;  4ODO A;  3UQI A;  1SR0 A;  4HAR A;  3O5Q A;  1D2K A;  3KAF A;  4DRN A;  4DRJ A;  3ODK A;  2DSZ A;  2XP9 A;  2PBC A;  3O5L A;  1ZL1 A;  3H9R B;  2UZ5 A;  3NTP A;  1C9H A;  3CHC A;  4W5U A;  2F23 A;  3KAC A;  3OA5 A;  3O5M A;  2YBT A;  4DRO A;  3AS0 A;  1FKD A;  4ZPV R;  3JYM A;  2DSV A;  2VCD A;  1FJD A;  2OFN A;  1P5Q A;  3WQV A;  4DH0 A;  2DG9 A;  1WNO A;  4MSP A;  4Z2G A;  1FKS A;  1W1V A;  2WLZ A;  4WKF A;  3ART A;  2FKE A;  1UR9 A;  2XP8 A;  3ARQ A;  4DIP A;  2RUD A;  2G41 A;  3B9D A;  4XAK A;  3BXW A;  1FKB A;  4AY1 A;  3EIP A;  1D7J A;  3RME A;  3WD0 A;  2MLX A;  4MNM A;  3WD1 A;  4DRM A;  2AOS A;  1E9L A;  2ESC A;  3ARZ A;  5GQB A;  2ETN A;  3ARX A;  3PR9 A;  4ML4 A;  1ZCN A;  3FY1 A;  2KR7 A;  2KO7 A;  4JFM A;  4MPK A;  1HKK A;  5B8I C;  4ODN A;  4Z2I A;  3CHD A;  4WIW A;  1FKI A;  3UI4 A;  3UF8 A;  4DWS A;  4ODQ A;  1JNE A;  2XPB A;  3FXY A;  2DSW A;  3ARY A;  3IKG A;  3JXV A;  2VN1 A;  1A7X A;  4WK9 A;  3GTY X;  2KE0 A;  1FAP A;  4TW6 A;  1GOI A;  4IT6 A;  1ZK6 A;  4NNR A;  1FKR A;  1Q1C A;  2M08 A;  4W9Q A;  4WKH A;  2ZR5 A;  1XRV A;  2PPN A;  3B9E A;  2RSE A;  3B9A A;  3WIJ A;  1HXV A;  3O5G A;  1HJX A;  1HKJ A;  3WL0 A;  2DT1 A;  2Q5A A;  2LJ4 A;  1D7H A;  3ARR A;  2G8Z A;  1KFW A;  2K8I A;  3OOB A;  3WL1 A;  3PA7 A;  4MGV A;  4TYO A;  1HJV A;  4DRQ A;  1K9T A;  3IKD A;  4BF8 A;  2A3A A;  1GRJ A;  3RM4 A;  2A3B A;  4TW7 A;  3O5F A;  3RGC A;  4Z2H A;  1FKT A;  1SYT A;  1F40 A;  5D75 A;  4ZPT R;  3UI6 A;  1W26 A;  1BKF A;  4KR0 B;  2DG4 A;  1NSG A;  2MNT A;  4ZPW R;  4GGQ A;  2RUR A;  2M1I A;  2FAP A;  3O5J A;  1H0I A;  1QPF A;  4O2T A;  2ZR6 A;  4JFJ A;  1KT1 A;  1EYM A;  1EDQ A;  1ZBW A;  1B6C A;  4ODK A;  3AS3 A;  3EY6 A;  3WKZ A;  5HUA A;  3WD2 A;  1JNS A;  4U84 A;  2XP7 A;  1O6I A;  4J4N A;  4NSB A;  3TCZ A;  3O5R A;  2MPH A;  1LL6 A;  5DIU A;  4DRK A;  3RFW A;  3QOK A;  4S3J A;  5BXJ A;  5GPR A;  2XP6 A;  1IX5 A;  1CTN A;  2XPA A;  2M2A A;  2WM0 A;  4ODL A;  2DT0 A;  2ZQT A;  3O5I A;  5DIT A;  5HW7 A;  1OWQ A;  4G50 A;  1NWS A;  4JYS A;  1LJY A;  2O9O A;  2DT2 A;  2MF9 A;  2PPO A;  1FKF A;  4TX0 A;  4DRP A;  1NMV A;  1H0G A;  3PRD A;  1ZBV A;  2IUZ A;  2O92 A;  4Z2J A;  4TW8 A;  1LG2 A;  5HWB A;  4P8W A;  3ARW A;  1VF8 A;  4DZ3 A;  5HTG A;  1W9V A;  2F21 A;  4HBO A;  5HW8 A;  3WH0 A;  4WKA A;  3ALG A;  3UQA A;  2DG3 A;  3ARS A;  3CHE A;  4Z2K A;  2RUQ A;  3CHF A;  5DIV A;  1X6N A;  4ODP A;  1E6Z A;  2ZQS A;  3AS2 A;  2RUC A;  1HKI A;  4QZV B;  4PTM A;  2LGO A;  3ARU A;  4R5E A;  5GPG A;  2D9F A;  3WQW A;  2PV1 A;  3AQU A;  4FAP A;  1JNT A;  3KAI A;  1FKL A;  4IT4 A;  3CZ8 A;  5DO2 A;  3GPK A;  3AS1 A;  1F8A B;  2L2S A;  3IK8 A;  3CGN A;  4LAV A;  3B7X A;  1LL4 A;  1W9U A;  3O5P A;  1ZBC A;  4TNS A;  1ZU8 A;  3GU0 A;  5J6E A;  4MNK A;  1EHN A;  4KQZ A;  1EQ3 A;  1E6P A;  1J4H A;  4N19 A;  1PBK A;  2ITK A;  2F4E A;  4LAX A;  2AWG A;  3KAB A;  2KFW A;  2MLY A;  2XP3 A;  5DF0 A;  4LAW A;  2N87 A;  1YW5 A;  1BL4 A;  1GUV A;  4DRI A;  4IPX A;  1NWU A;  1RD6 A;  2DT3 A;  3G6M A;  3UI5 A;  2DPE A;  5JH8 A;  3KAH A;  3KCE A;  4DWS B;  4C02 B;  1LL7 A;  3NRK A;  4FN2 A;  1WAW A;  4IQ2 A;  1T11 A;  1N1A A;  1UR8 A;  2PV3 A;  3JYJ A;  4W9O A;  4DWS C;  4G2P A;  1JND A;  2ZR4 A;  4ITZ A;  1JVW A;  2DSU A;  2Y78 A;  1PIN A;  3FAP A;  4DZ2 A;  3O5E A;  4IQC A;  1ITX A;  1Y0O A;  1LG1 A;  4MNL A;  3PRA A;  3WD3 A;  1TCO C;  4U85 A;  1YAT A;  2JZV A;  3O5O A;  3W4R A;  4ODM A;  1E44 A;  3KAD A;  4W9P A;  2PN0 A;  1Q6I A;  2A3C A;  1QPL A;  4L72 B;  4JFL A;  2MLZ A;  2XP4 A;  4Q7N A;  4GIV A;  1U79 A;  2ZQU A;  3PRB A;  5HKG A;  4J4O A;  5I98 A;  1W1T A;  3MDY B;  2LKN A; 
#chains in the Genus database with same CATH homology
 3EIP A;  2B5U B;  4UDM A;  1JCH B;  1E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...