1JCJA

Observation of covalent intermediates in an enzyme mechanism at atomic resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
252
structure length
252
Chain Sequence
b'HMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYRIBOSE-PHOSPHATE ALDOLASE
publication title Observation of covalent intermediates in an enzyme mechanism at atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 100
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcjA00
5G1YA 4UFIA 5F2IA 3M44A 2R14A 3TMLA 5K9DA 1DKWA 2X1TA 3LRKA 4UTTA 1F6PA 1K02A 3NM1A 3G1DA 1QDSA 4HN4A 5HULA 2VFDA 3W9ZA 3HGSA 3NQ6A 3PS7A 3GB6A 4YL2A 2QF7A 3QH2A 5D32A 4LV9A 3W7RA 4ZQRA 1W5NA 2NWSA 4JTKA 2OZ0A 5FEPA 4LTSA 1BEUA 1HO1A 4PFMA 1R47A 2QJGA 4KFNA 1G4PA 3VCRA 4XKYB 1GPWA 1GVOA 3FFSA 4UFJA 3TROA 1VLWA 3W07A 4EF9A 3RNDA 1ICPA 1P1XA 2E6FA 3IEBA 2NV1A 1WBJA 4N6EA 1ICSA 4CLMA 3DXIA 4BWLC 2CW6A 3TSMA 1UBSA 4LU0A 1TRIA 1X8FA 4K39A 4O10A 4MZYA 4CCDA 3M7WA 4Z1AA 5CZJA 2P0OA 1VS1A 2QCLA 2FQIA 4ORIA 4HNVA 4RR4A 2A7NA 4IMEA 1LRQA 1JCXA 1NF7A 2NXIA 1SZNA 3C8FA 3F1QA 4GC4A 1A5AA 3C4UA 3W75A 1OFAA 4ZL1A 3A22A 5CKSA 5KZDA 2V9DA 2YFNA 1VJIA 3MYOA 4O13A 4O19A 1KM3A 4FB7A 1W5OA 4AF0A 3H54A 2WNZA 4A21A 4LS1A 1WDWA 5CZ0A 3BW4A 3TDFA 4QSHA 4FHAA 3QQ0A 4PA8A 3HBLA 4HIBA 3G1VA 4N02A 1FY6A 3PR2A 2E68A 1P0KA 3UY7A 2TSYA 4Z0SA 4OGZA 2VFEA 3KXQA 4U28A 3A23A 2Q8ZA 2DZPA 2CLIA 3LCWA 5LGXA 1YXCA 1XUUA 1XI3A 2B0MA 2ZTJA 3LCGA 3G3DA 3TW6A 3INPA 5KZEA 3OVPA 1G69A 3G0SA 3A5FA 1VHCA 4Z1CA 1F7BA 4N4PA 2VXNA 5D2VA 3LHYA 1YTDA 3LOTA 5FF2A 4GUHA 3GKFA 4B5NA 5D37A 6ALDA 5AN7A 1DQXA 1LROA 4AVFA 2Q3OA 3UXAA 3IVUA 2H8ZA 2C3ZA 3N3MA 4AHQA 2Q3RA 3RMJA 4Y9AA 3DI1A 4MJZA 4TMBA 4YCPA 2ZZ6A 5HINA 5LNUA 4BR1A 4UUIA 1Z42A 4XQ6A 1GZGA 4L4MA 3NL5A 1KM4A 2QR6A 4RXFA 1GVRA 3P62A 3C61A 1VH7A 3B0PA 1ZAIA 2GVLA 4JTLA 1X1OA 3ANYA 3OHIA 4JN6A 4O8RA 1TTPA 3DU0A 5K4ZA 1EPXA 4I7WA 2FJKA 4O50A 3W1MA 1M7PA 3S1XA 1ADOA 1GVFA 4M6VA 4UR8A 3SECA 1OABA 4O0ZA 3PULA 4FX6M 1H5YA 4MYXA 2PRMA 4O52A 1JUKA 2FPYA 2WSYA 4ICNA 1FDZA 3P84A 4ZQOA 1AMKA 3HGRA 2J24A 2E5DA 5KZMA 1AL8A 1XBYA 2VEIA 3FLUA 3M47A 3PSVA 3TX9A 3P80A 3O15A 1UB3A 2QAFA 1KM1A 3C2EA 3UD6A 1OYAA 2NUXA 4RX0A 2HS8A 2QCHA 2ZA3A 3JR2A 5F4WA 1MXSA 4OV9A 4KKXA 4DBEA 3W7QA 1J5TA 2RDTA 1H51A 4FIRA 4MYAA 4AWSA 3HPZA 3UNDA 4YCOA 4MOZA 3QEZA 2YXGA 4AWUA 3OVRA 4H4IA 2CU0A 4WY0B 3B0UX 1DBTA 5D33A 1KBJA 2HMCA 3NL3A 4UTWC 4K8EA 2J9ZA 3M5XA 1OG0A 2I9EA 4JICA 3QQ1A 1L6SA 5AHMA 3MO7A 5LNVA 4TIMA 2HTMA 1OF8A 3DENA 1W56A 5AC7A 1FDYA 3KVJA 2VEKA 5HR7A 4UXDA 3NPWA 1DV7A 2QEZA 1TPDA 5A5WA 4UTHA 3DFQA 4O1CA 3W7DA 3IVSA 1GWJA 1TTJA 1FCVA 2R94A 1EIXA 2B7OA 3CEPA 1W8SA 3PBVA 2NX3A 4UNKA 1D3GA 2ZFAA 1P4CA 1YPFA 1GJPA 3TQ0A 1SO4A 4UNLA 4NJJA 1LZOA 1IIHA 3CHVA 2GVJA 2EPHA 4LVGA 2QCFA 1UJPA 3PVFA 3W1QA 2YYTA 3TFXA 5HWNA 1EWDA 4AMAA 3HIJA 2V2DA 3GXPA 5HMSA 4DQWA 2BLEA 1PVNA 3LXAA 3GNNA 1FCBA 3DFOA 3DFNA 1EEPA 3L21A 4UTIA 5D09A 3B06A 1KFCA 1SW0A 1SQ7A 4JDYA 4MUZA 4CCEA 5K9XA 4GJ1A 2YSWA 3P8IA 1LBFA 2NLIA 4OBTA 2Z6IA 3OA3A 2QCDB 4E2DA 4JTHA 3SSJA 1O60A 3K30A 3ABOA 4A2RA 1X7FA 4XUGA 3VKJA 3I7RA 2JGYA 4Y96A 5F2LA 2ATMA 1XBZA 3CQ0A 2CZDA 1JQVA 3QRHA 1KM6A 2YPIA 2A0NA 3BW2A 4FO4A 4UMBA 3F4NA 4DEFA 1ZNNA 4K7VA 3Q94A 5EBUA 4XTDA 1ZY9A 4X22A 3BGJA 3UWWA 5C54A 3MP4A 4X2RA 4NNCA 4QAIA 5L6UA 2TYSA 1M5WA 1R30A 1AW5A 1G6CA 1YDOA 5DY3A 2F7FA 3W84A 3M5ZA 1YDNA 3EX2A 4UFMA 5F2GA 1TJRA 2DJXA 1ZALA 2ZRZA 5J5DA 5DBUA 5J5RA 4PL1A 1JCMP 3MUXA 2EF9A 3M6YA 4IXHA 2P10A 2WJZA 4FNQA 4RK8A 2ZCGA 1SUXA 3T40A 3I65A 4R53A 4AHPA 4DBDA 4RV8A 1LORA 3M43A 1FWNA 1SW7A 3EKLA 2J9YA 5F4SA 3LCIA 1PCKA 4QITA 1I2OA 2PRLA 4LWWA 5G4EA 3W83A 3EB2A 1X1ZA 4I7UA 4UIOA 1JUBA 5LNSA 1BWLA 4FX8A 5LHFA 4CQAA 3PY2A 4EVZA 3GR7A 1H63A 3QSTA 5L9FA 2H8XA 3N73A 5K2ZA 1OFBA 4UFHA 5D38A 4NXKA 5LKYA 3R2GA 1LLZA 1EUNA 4C1LA 3PBUA 1RQBA 1RVGA 3LCHA 2XFWA 3OBKA 4FNUA 2GQ8A 3HGOA 2R8WA 3LHZA 4AB4A 3THAA 3PWAA 4HKPA 3CEUA 1C9DA 3S0CA 4IQLA 2OT1A 3KRUA 1C29A 3B0VC 3LI1A 3TUUA 4AXKA 3FEMA 2W6RA 2OX1A 3UXDA 1Q3NA 1K3UA 5D2YA 4C1KA 1FWRA 3L67A 2Y62A 4JTIA 2ZRYA 3CB8A 1AL7A 3KRZA 4UFLA 5CG7A 1JRBA 3G1XA 3BV4A 2Z2UA 5KITA 1EB3A 2H3DA 2A5HA 5FI8A 4M7TA 5D05A 1DHPA 2VEPA 4IGHA 2ZA2A 3NQAA 4M5PA 2JKEA 4LS2A 5F4XA 3S9YA 4DPPA 3BK0A 3PAJA 3BGGA 5CPNA 4O54A 1R46A 3O05A 5I3IA 4O1AA 3NPUA 2FPVA 3VFLA 4DO5A 3HMJG 3TQVA 2NXHA 2QCCA 2ZZ5A 1AW1A 3E96A 4MKNA 2I14A 3TV8A 3TJLA 4JYDA 4MPQA 1VHNA 3TXZA 4RXGA 3G1YA 3SI9A 4GUFA 4TX9A 3LTSA 1YPIA 1FWWA 2YR1A 3DH7A 2PC4A 1XM3A 3LGEA 3NZ1A 4LT9A 1K8XA 4OE7A 5TBOA 4ADTA 1AG1O 4E38A 5FEZA 4MFDA 3GKAA 3LB0A 3SIZA 5IM51 4PC8A 4RZ5A 4N9CA 3MI2A 3ELFA 2GVGA 4RZ6A 1FUYA 2NX9A 4OQVA 1IXNA 3W1LA 2C19A 1GG0A 4JGDA 4PEKA 2ISVA 3NEVA 3LHVA 1S5VA 4O18A 1ML1A 3W70A 3R89A 3DKLA 1SPQA 3TQKA 3UQNA 1WX0A 3A21A 3MI6A 3W85A 1JCLA 2CZFA 4NVTA 4DF2A 1QPRA 4QNWA 2FDSA 4IXXA 1RQEA 3MI3A 2CLEA 1V7YA 4JTTA 3TC6A 1V5XA 1KM0A 3EWZA 1WOAA 1ONRA 1G4EA 3N14A 3QPYA 1FX6A 1R2RA 2EAWA 3NG3A 4ALDA 3ATYA 3TU9A 3G1FA 4TMCA 1OFQA 3WK1A 3O06A 3IV3A 1SFJA 1LDCA 4BI5A 3U2OA 2C0AA 3RK8A 1VR6A 4H6KA 1JCNA 1UUMA 1FCUA 4M7SA 3LHUA 3N19B 4ZQPA 1TPB1 3S1WA 2YYUA 4HHPA 3S1VA 3GK0A 4WZHA 3THQA 1HO4A 2WSRA 1OYBA 2NV2A 2EKCA 2GQAA 1W5QA 2Y6ZA 2CLOA 4BFAA 1I2QA 4Z0JA 3KAOA 1RR2A 3WK3A 4O4VA 3C3NA 1QPNA 2QAPA 1YXDA 4O16A 1VYRA 3E12A 1B3OA 3MWAA 3QPZA 1IXQA 1QMLA 3LLDA 1H7RA 1TQXA 3LV6A 4DF1A 3G1SA 3VI2A 3ZR4A 1BKSA 3GVGA 5F1UA 3GX9A 3RF9A 4XBSA 1EUAA 3L0KA 4UFKA 1F74A 1UASA 3RLUA 1VYPX 1TQJA 1ZJIA 3EWUA 1MEWA 3EX6A 4IMGA 3U8GA 3PB2A 4LVDA 3BPWA 3QFEA 4WY0F 3W7GA 1O5KA 1U5JA 3W1UA 2G96A 3V1PA 4X9SA 2CZ5A 4MZ1A 2Y63A 3GNDA 1TPUA 3BG5A 1MSSA 4GWEA 3TSDA 3DHFA 4G1KA 4L4LA 3TXVA 2FPTA 3PG8A 1A5SA 1K03A 5C55A 2Y88A 3QW4B 1ME7A 5A8GA 2CZEA 3E49A 4O12A 4NJGA 2J6XA 1LOLA 3CM4A 4O1BA 3M5VA 1FDJA 4LC6A 5AYZA 5D04C 1TPWA 5C5YA 1Q6OA 4AAJA 1WQ5A 3C2FA 2V81A 3TSBA 5GVJA 2OT0A 1XXXA 1SO6A 3GDLA 1Z44A 4ORMA 3USBA 3G8EA 4IX0A 2ZRUA 5BMXA 2VFGA 1ZCOA 5FF4A 2O7QA 2NXGA 2WQPA 4MLRA 1TRDA 3P81A 3MHGA 1MO0A 3C2RA 3MP3A 1DVJA 1SFLA 2OMAA 5D30A 3HO8A 3NQMA 3C0JA 3Q58A 2H6RA 4LS0A 3G1HA 2A85A 3SGZA 1QWGA 3EWXA 3P67A 1KTCA 2X2GA 3T55A 1YADA 1EP3A 1GOXA 1LRTA 1WA3A 5G2IA 4XBKA 3TFCA 3LHTA 3UWYA 3NQ7A 1D9EA 4O15A 3O8AA 1D3HA 3N2XA 3IGUA 1YDVA 3TR2A 3BARA 1X6UA 2Z1BA 4ZQCA 3EX4A 4MY9A 1FXQA 4AWTA 4XKYA 2RDUA 2RHGA 4OT7A 2CLFA 1T0OA 4CCCA 3T44A 1JCYA 4MFEA 3UZ5A 2CLKA 3NGJA 4OV4A 3C52A 3PBWA 5G4WA 4ZZ9A 3NXFA 3WJYA 1OFEA 1SR9A 3S8HA 4UTTC 4O14A 3I7QA 1TJPA 1OX4B 1OHLA 5AHLA 5HR6A 1OK6A 2NWRA 3EWBX 1OYCA 3TAOA 3IIXA 3UPBA 4EF8A 1JQXA 4Y90A 1VZWA 2ABBA 2DZUA 3WJXA 4CNOA 4PODA 1XCFA 3BLIA 5G5IA 1TYGA 1ZAJA 1DJQA 1N8FA 2RKXA 2ZRVA 5I3GA 3S5ZA 4LUJA 4O11A 3ZWSA 5MHBA 2Y70A 4BI6A 1OFOA 5C6MA 1GTEA 1Y0EA 3N9RA 3FYPA 5CZSA 4S1FA 2BXVA 1G7UA 3WK0A 5AB3A 1L2UA 1JR1A 4ZMGA 1BTMA 2QJHA 2ZDRA 2JBMA 3ABSA 4CQ8A 1XDMA 5CPMA 5HNRA 1GVSA 3CIXA 3B8DA 4P61A 3YPIA 3NDOA 1A5CA 2B7PA 3P60A 1YTKA 3STEA 1RPXA 3W7KA 4KFPA 5AYYA 1DORA 1SSDA 3NL2A 3STGA 3G22A 4Q4KA 3TIMA 1W54A 2QCMA 5LNRA 2O7SA 5FF7A 4R34A 1QOQA 5HWJA 3BW3A 2A21A 3NPXA 1L9WA 1PS9A 4FNRA 4OHQA 2DZTA 3W72A 3RU6A 4BF9A 5KSWA 2VFFA 5HQEA 4POCA 4WJEA 3BLEA 1QFEA 5BOOA 1PHQA 3G3MA 2ZZ3A 4WD0A 5DN1A 3DFSA 2C15A 3OEXA 1EWEA 5LSMA 1N7KA 4WOQA 2CLLA 3W7JA 5CSSA 1W1ZA 2JKAA 2C1HA 4IPJA 2YW4A 3GYEA 3UYCA 3OVQA 1RZMA 1IGSA 3EWWA 3V75A 1RQHA 3O1NA 3L0GA 3STFA 5FESA 2E77A 3IVTA 3UY8A 3M0ZA 3EXTA 3CLMA 1C8VA 1TB3A 3W2UA 2ALDA 1F05A 3E02A 1Q45A 1JRCA 5DXXA 3EXRA 3FOKA 2EGZA 3TA6A 1K7XA 2HS6A 4I9AA 5HJLA 3GDTA 3UWQA 1RV8A 1OX5A 3GR8A 4JEQA 3DFPA 3G24A 1KFEA 3LLFA 4FNSA 5IBXA 1P5BA 5G2WA 2E5CA 1JCJA 4JS3A 5T26A 2BTMA 2VFIA 2FB2A 3O16A 2QUVA 2CLMA 1PIIA 2Q8LA 4K38A 5CSRA 3DGRA 1OFDA 5I3KA 1ME9A 3R8RA 1QPOA 1I8JA 1W3TA 3UWZA 3IGXA 3LRMA 2I1OA 3S5NA 1U83A 1FWSA 3H53A 4ADSA 4ZQMA 1TO3A 2D73A 4AH7A 3S42A 5D03A 1Q6RA 3FKRA 3EX3A 4O53A 4RLIA 3L0NA 3HF3A 4NT0A 3EKZA 1KFJA 3W87A 2Y85A 2F84A 5D2WA 3PC0A 5BMWA 8TIMA 1HTIA 2EHHA 2G5WA 2C13A 4JTEA 2Y7EA 1DJNA 3NR0A 4BI7A 4LW7A 5KINA 4JD4A 1UUOA 2X1SA 1JVNA 1DQWA 1GYLA 3E0IA 3KRSA 4RKAA 4XZ9A 1GTHA 3NNTA 2YGYA 5BRBA 3WFAA 2DZWA 1H7PA 1IIGA 2RDWA 3LCLA 3ABQA 4Z08A 1O95A 1OK4A 3M16A 3MYPA 5C2XA 3C2OA 1WAUA 3L9CA 3W22A 4WXYA 1ZHAA 3BLFA 2B7QA 2A7RA 4N9EA 2C6QA 3MBDA 3MW7A 1O5XA 1S5TA 4LVAA 1F5ZA 1LTDA 1H7WA 1F6KA 2BX7A 3G0UA 3FIGA 3O6DA 1K7EA 5DCEA 3P82A 4HNTA 1K8YA 1NF0A 2A4AA 3LV5A 1OF6A 1T99A 4OWGA 3R13A 3CT7A 1Q6LA 3QF0A 3BVJA 3FYOA 3MJYA 4Z1DA 5H2ZA 3S5YA 3DHDA 2V30A 1M7OA 2VENA 1QCWA 4HSOA 4UTLA 5AHEA 3FA5A 4JY8A 1FQ0A 4HSNA 3NQ8A 4JXCA 3LTPA 4BWLA 4CNNA 3N2MA 4DF0A 7TIMA 3OIXA 1B9BA 3KOFA 3LRLA 3LCFA 4DXVA 2QCDA 3GIYA 3FKKA 3NZRA 3Q37A 3P8JA 3SW6A 3U6WA 3I68A 4IUOA 5CZTA 1PE1A 1OX6A 1HL2A 1I45A 4WXZA 2G97A 3E9AA 3MBFA 5F2MA 4UCGA 1SZFA 4E2BA 4FIQA 2X1UA 2A2IA 2Y7DA 4KFOA 1JUEA 5FF0A 5LNWA 2W0UA 1Z41A 4OU1A 4IPIA 4LVBA 1IXOA 2WKJA 4YMZA 4FEZA 2TPSA 1WV2A 3H55A 3W2MA 2NX1A 3FJ6A 4Q32A 2Z0IA 4FXSA 2ZZ1A 1KV5A 4A2SA 1AK5A 1I4NA 5E1QA 4GUGA 5K4XA 3TW7A 1PHWA 2GUUA 1S3HA 1F2JA 3T78A 1FCQA 4RJEA 3TCEA 3M5YA 3W23A 4NU7A 4TU1A 2V5BA 3LM7A 2C16A 2WOQA 3W2NA 1H7NA 1XDLA 2UV8G 1G67A 4PTNA 3HOJA 1LYXA 5AOUA 3L5AA 1SU5A 4Z1BA 2NZLA 2FTPA 5AFDA 2YCEA 1P0NA 3S5OA 3G0XA 1KA9F 1PL9A 2A6LA 2AAMA 2H90A 4WUIA 6TIMA 3HB9A 4N4QA 2QDGA 1TTQA 4ML9A 1XKYA 4O0KA 5EPDA 3AO0A 4AF0B 5KTLA 1WYIA 4GUJA 4JX6A 3W2JA 1JJKA 1OJXA 1GT8A 1CI1A 4MIMA 3IGSA 3G18A 1SW3A 1PCWA 2J9XA 3DI0A 4AHOA 3CTLA 3CWOX 3T4CA 1EA0A 4LC8A 2PE4A 2B7NA 1O94A 4JTFA 4LRSA 3IIOA 4LV4A 3PB0A 1KM2A 2QCEA 3EXSA 4TR9A 4DO4A 1LM1A 3W1TA 4O17A 1W5MA 4IMCA 3HG2A 3I7SA 4JTUA 2CFFA 1B57A 4U4MA 4GRSA 1KTBA 1VYSX 5D2XA 3TKFA 1W31A 3NQDA 1SZEA 3PUOA 1YLVA 4UMCA 1OFRA 1F73A 3BO9A 3L65A 1WOBA 4PCFA 4D2JA 1O4UA 4R33A 2QUUA 1YTEA 1M6JA 3W3OA 1XL9A 3Q2DA 3TH6A 2BWGA 3FS2A 4HNUA 2ISSA 3LBCA 5AC6A 1HFBA 1VCVA 3NOEA 5DCDA 1XC4A 5U7SA 2GQ9A 3DKJA 1CX9A 3N9SA 1QPQA 3SJ3A 4JYFA 2V82A 3QYQA 3NQFA 2PCQA 2YFOA 4NNAA 1AW2A 1ALDA 1QOPA 4LOCA 1TPFA 3HPXA 3IIPA 4J9JA 3GXNA 1A50A 3DZ1A 2ZBTA 2LLEA 1H7XA 4PH6A 3LXBA 4NUWA 3S6DA 2FLIA 3FJLA 2V8ZA 2Z6JA 1T8XA 1W37A 4MVAA 1TPEA 4UTWA 3W1AA 1MEHA 3IIVA 3JRKA 4A3UA 3SFKA 5LHEA 2V2HA 2E6DA 3AJXA 5DCBA 4XTIA 4NZFA 1BWKA 3EWYA 1F76A 1TSIA 1NSJA 3W7EA 1TMHA 3PUEA 4A22A 3BG9A 2KZHA 2X16A 3CC1A 3P5ZA 3A5VA 4LVFA 3UWUA 3GDMA 3B03A 1N55A 4HPXA 4RCXA 3P61A 3LXCA 4JTJA 5FEXA 4R7JA 4UMAA 5LGZA 3LX9A 4N2YA 1PV8A 4NX0A 1R2SA 1TPH1 4UC5A 5DBTA 1J2WA 1TTIA 2OCZA 2YDAA 4JNMA 3F4WA 3O6CA 1KM5A 2VKZG 3QMSA 2CWNA 1H62A 1GYNA 2Y61A 3QMRA 1KFBA 4N9BA 1HUVA 5K9CA 3SY5A 5BW6A 3IRDA 2BSLA 3NO5A 3TC7A 1LOSA 3NL6A 5I3JA 3WJZA 1VGAA 2WNQA 1K8ZA 3LDVA 3WJWA 3W6YA 3P74A 4DPQA 1I2PA 3DAQA 3GXTA 2DZSA 4K37A 2P1FA 3R5EA 2C18A 3MHFA 4CQ9A 1ZENA 4WX2A 3M41A 3NQVA 2DU2A 3C6CA 3W7NA 3L2IA 5ABTA 3DBPA 3W1RA 5EMUA 3W7PA 2E5BA 3W76A 2ZQ0A 2QCNA 4IJBA 3W2LA 1UCWA 1H60A 5D02A 4M6QA 5E93A 3KHJA 4AEOA 4KWWA 2Y7GA 5DY2A 3B04A 2QDHA 3W7LA 5CGQA 3RFAA 4QJ1A 3P5YA 4Q33A 1TIMA 2ZRXA 1SZGA 5I3HA 3W86A 1WBHA 3HG3A 3KX6A 4NJHA 1H61A 2NUYA 3ZS4A 1KTNA 4FXRA 3TAKA 5HUPA 4EIVA 5EYWA 5AHFA 3SR7A 5DLCA 2VELA 3NQEA 5KMYA 3A9IA 2DP3A 3KFTA 1LRNA 4MY8A 2VOMA 1ICQA 4TO8A 2ZA1A 2GPTA 2RH9A 3TJXA 4IWWA 1H7OA 3W74A 3QSRA 5SWUA 3GAYA 1G7VA 2WO5A 5EA9A 1MZHA 4IMFA 2QCGA 5EL1A 5AYXA 1TV8A 1QNVA 2ISWA 2XN2A 4QISA 4GNJA 4ZQNA 2DJLA 1FWTA 2ZZ4A 4JDBA 4FX7A 4K7YA 1FXPA 4HPJA 3ATZA 3N34A 4ZVJA 3GDRA 4DO6A 4UTKA 4EOUA 1E51A 5DXYA 4JTGA 4NJKA 1KW1A 3HJZA 3W7OA 3D0CA 3O63A 2B4GA 3GLCA 5K7JA 1L6WA 3QC3A 1VCGA 4MY1A 5U4NA 1R2TA 3OG3A 3M9YA 2E1DA 3PF3A 3QZEA 1J4EA 3NAVA 4JR5A 4K8HA 1ZAHA 4MJMA 4Y6GA 1LCOA 4A29A 4UTUA 3MMTA 3HGJA 1S5WA 4O1DA 2ZRWA 4LY8A 2XN0A 1EP1A 3W7CA 4ONVA 2TMDA 1GVQA 2Y89A 3TNOA 3W73A 4UR7A 1XFBA 5G1TA 5HUOA 3W2KA 3W1NA 4HT3A 2ABAA 4ADUA 1KFKA 4FNPA 3LERA 1TCDA 4EWND 2QUTA 4O57A 3KVLA 1TPVA 5HWMA 3UZJA 2WV8A 4IOTA 3CIWA 4M6PA 2H3BA 2QJIA 4LUIA 5FF3A 5FEWA 3TMQA 4QQ3A 5EKYA 4HNNA 1H50A 1KV8A 1MEIA 4GFSA 2E6YA 4DELA 3W7MA 2ATSA 2CLHA 3L5MA 2E6AA 1W5PA 1FBAA 3GDKA 3NM3A 4GBUA 2DORA 3P7YA 3CU2A 1XBXA 1H1YA 1OX4A 1RD5A 3EX1A 4W9TA 1Z48A 4UTMA 5K3VA 3TK7A 3G1AA 5EY5A 1T96A 1NEYA 1TV7A 2YW3A 4JX5A 4UTJA 3HG5A 3HQ1A 5AHNA 4MZ8A 2W79A 1ZFJA 2WPBA 4Y8FA 5D2TA 2YZRA 1W3NA 4NX5A 4M19A 5BNKA 3ZFHA 2V2CA 2NUWA 3HG4A 4WOZA 2FB3A 4JIPA 3UWVA 1Q6QA 3B05A 2ZZ7A 3GZ3A 4K36A 4NNBA 2OJPA 2WSQA 3SZ8A 1OFPA 4WY0A 1LBMA 2C14A 3NPVA 1QR7A 4K6AA 1B4EA 4YLWA 1NAL1 3NYZA 4I7VA 4JY9A 2PRHA 3R12A 1GQNA 1W0MA 2ZTKA 1IXPA 2Y7FA 3W7IA 3NA8A 4GE8A 4S2CA 4RZ4A 4NQ1A 2PURA 4IX2A 3W1XA 3L68A 5AC8A 3L5LA 2TRSA 3I6RA 3L66A 1G4TA 3HPSA 1VC4A 3W88A 4FNTA 4NXSA 5G2HA 2FFCA 1QO5A 5H91A 2VC6A 2AQWA 5F1VA 4CNPA 1EP2A 2J27A 4E0CA 4NJIA 3LCXA 5DELA 1XBVA 2V0TA 1SO3A 2J88A 2JGQA 2JKPA 3PUDA 2A6NA 4N9DA 2G95A 4JTSA 2WNNA 4JYEA 1W3IA 3GAKA 2BZNA 4BK9A 1VLIA 2X1RA 1THFD 3CWNA 5LZLA 3O07A 4O4WA 3LHWA 1G4SA 3KVKA 2YX0A 2HSAA 1KBIA 3DFTA 1QO2A 2XN1A 1ME8A 3QW3A 4XWUA 1VCFA 1LOQA 1A53A 1IF2A 2DZVA 1L6YA 2GJNA 3F03K 3MHUA 3NVTA 4GXMA 4JX4A 4YXGA 1CW2A 3W7HA 2FIQA 3SGUA 5TQLA 3QMTA 4GUIA 4YWIA 5CPOA 1HG3A 3PG9A 1YXYA 5E0KA 3O6YX 4JIQA 1WXJA 3LTYA 4S2BA 3A24A 2V5LA 3B4UA 1DL3A 1GG1A 1OVDA 1YYAA 3C56A 3LBMA 3PSWA 1KLYA 3NQ2A 2JK2A 4NZJA 3S1UA 4LRTA 3VNDA 1TPC1 4P2VA 2GJLA 4KWVA 1SO5A 3NQCA 1LBLA 1NFBA 3BG3A 2R91A 1SSGA 1EX5A 3W71A 1XUZA 4LNYA 3MP5A 4QIUA 4X3ZA 5AHIA 3LI0A 1I2RA 5IBXC 4N6FA 3T7VA 4WQ6A 1TV5A 1LLWA 3M1ZA 1K7FA 3C2VA 3VE9A 1VQTA 3W1PA 2ZYFA 3KVMA 1JULA 1H1ZA 2VFHA 1GEQA 4H3DA 3PM6A 3IIZA 4O28A 2AGKA 2A7PA 1VRDA 5CPLA 3UPWA 3JS3A 2GOUA 3CPRA 2IQTA 4FF7A 1KFLA 3EEGA 1KLZA 1DOSA 4MLJA 1TREA 3QJAA 1A5BA 3ABRA 2DZXA 3STCA 2A1YA 1I2NA 3G8RA 3WK2A 1LP6A 3TE9A 4PL2A 4QM1A 1VPXA 3NQGA 1B4KA 5I3FA 2RFGA 1QAPA 4IMDA 5TIMA 2X30A 3ZWTA 2E09A 3QM3A 2ZZ2A 3PBYA 3WJSA 3VE7A 4QNEA 1NVMA 2QKFA 3RLVA 2VEMA
chains in the Genus database with same CATH superfamily
2OB3A 3ZVHB 4LH8A 5CC5A 3I6TA 2R14A 1XIEA 1D7FA 2AQVA 5BROA 4WHBA 4HN4A 1VFMA 2VC7A 4L1WA 3P93A 4YL2A 4KCUA 1DIEA 1KCXA 1MRQA 1PPIA 2GQ3A 5D9PA 1W5NA 2NWSA 1O66A 2OZ0A 4LTSA 1BEUA 3N1AA 3TN3A 3LYEA 4IQJA 4KFNA 3OLDA 4H8VA 4CVWA 1GPWA 1A0EA 4PCSA 5M5DA 5I02A 1JI2A 5BCAA 3RNDA 1CT5A 2OO6A 2CXGA 4TVUA 2GGHA 2KX9A 3VMOA 2DY3A 3ABXA 2C7FA 1QVBA 3CAVA 4JN8A 3B97A 2P3ZA 2JFEX 3P0WA 3APYA 4MZYA 1B5TA 1VS1A 3CQIA 4HNVA 4RDVA 2A7NA 4ZENA 3K8KA 3WL0A 1MNSA 1UZDA 4O19A 2XIIA 3H54A 1XDJA 4LS1A 1NDZA 3KBWA 4XV0A 4XZMX 5CZ0A 3NZQA 3H23A 3QQ0A 4PA8A 3G1VA 3UY7A 4MWAE 1ZBCA 2HBVA 2ZVRA 3C0QA 3SRHA 1GONA 5G1MA 3W26A 2VFEA 2BS9A 4FLRA 4BHYA 4Z42C 2Q8ZA 2DZPA 1JZ2A 2VR5A 3M7SA 5CGTA 1YXCA 2INFA 3HJEA 3BSHA 3SCOA 4PSRA 1O5QA 1R3SA 3WBEA 5CQ1A 1XIMA 4CEUC 1UJQA 2DGAA 3G0SA 4PSPA 4B5VA 1VHCA 4N4PA 3LHYA 3QXBA 2PSNA 5FF2A 3TYEA 5D37A 3UZYA 1LROA 4AVFA 1AJ2A 3FXYA 3HQNA 3MDUA 2OG9A 3AIWA 2G37A 1V3IA 2HV5A 4F66A 4MJZA 3B0YA 4GD0A 2EPKX 5LNUA 5BXPA 4PYSA 1VBJA 1Z42A 1BRLB 4L4MA 3CAWA 1W17A 2QR6A 2ZX6A 3LPPA 3DDMA 1H0IA 4JTLA 1X1OA 3ANYA 1WKEA 4JN6A 1F3EA 2QQ6A 2YA2A 3GIPA 2O4QA 5K4ZA 1EPXA 2I16A 1JDAA 4O50A 1E0TA 3ITXA 3SUSA 3W82A 3S1XA 1M65A 4UR8A 1UH3A 4BKNA 3SECA 4PEEA 1XLIA 3UR5A 1FP9A 4FX6M 4H6EA 4IGSA 4O52A 2WSYA 3UF9A 3P84A 4ZQOA 3BQ5A 4JQ3A 1AL8A 1XBYA 3TX9A 1A49A 3P80A 4WR3A 5A6LA 2YJQA 3C2EA 4V15A 3S1GA 1IT0A 2WW5A 4GXWA 4GFIA 5HPCA 3WNPA 1CXEA 5F4WA 4OV9A 4GGHA 4URIA 3W7QA 1HJWA 4KGJA 3LGDA 4HBKA 4MYAA 3GS6A 2XVPA 3XINA 4H4IA 2CIPA 5A6BA 1XYZA 3E0FA 3MSGA 1KBJA 4H9MA 3M5XA 4XSLA 1FKWA 3QQ1A 3LZ3A 1BQCA 1TFVA 4TIMA 3EDKA 1L2QA 3T2PA 1W56A 1HN1A 4DNHA 3KVJA 3A4JA 3CTTA 4XIMA 4AC1X 1TPDA 3BWWA 2OEMA 3W7DA 1EIXA 4YWSA 2OEJA 1W8SA 1HQTA 3WD2A 4MB3A 1LWIA 3SDOA 1IIHA 4OUEA 1XH2A 2JIEA 4RUBA 1R0MA 1UJPA 3W1QA 2YYTA 1EWDA 4AMAA 1BG9A 1UC5A 1J6PA 3OLGA 1A5OC 3KOZA 2ZICA 2G4JA 5JH1A 3TYUA 1QWKA 5D09A 3SCPA 4B92A 3W02A 4JDYA 4XAYA 1GK8A 1JXJA 1LBFA 2NLIA 1HJVA 4B4FA 4EPEC 3OA3A 1PTDA 4RNJA 4GQQA 4E2DA 4JTHA 3L4ZA 3SSJA 3KOWA 2ADAA 1K6AA 2E8YA 3IS4A 1M01A 4K1GA 3DEQA 3WBYA 3CQ0A 1KM6A 2YDQA 4TV5A 3BW2A 3HU7A 4LCSA 4UMBA 3LQGA 5EBUA 3CB3A 4Q4RA 2VYOA 4LPCA 4X22A 1DTNA 1P0EA 3BGJA 1UIPA 4GKTA 5C54A 3KZPA 5L6UA 1J0IA 2GJRA 4UOJA 1AW5A 1YDOA 1BVZA 3KM8A 2Z26A 1J79A 3IAPA 4HPNA 2BXZA 1Q6GA 2XVNA 5J5DA 5DBUA 4W5ZA 2CBIA 3TQPA 1OINA 1DJGA 3MUXA 4AMCA 3Q65A 2YCKX 3RX4A 1S5MA 1WKDA 3SN0A 2ZUVA 2J62A 1H09A 4IXHA 2WJZA 4FNQA 4V1XA 1EJWC 3I65A 1ENUA 4DBDA 4CD4A 1LORA 4IP7A 2POTA 4W87A 3RJYA 1BXNA 3GSMA 3BLKA 3VNIA 3JUGA 1NP0A 3AXHA 4GH3A 4I7UA 1JUBA 4KETA 2EXOA 5LHFA 4HNOA 1CCWB 1V02E 3EOUA 3GR7A 1R9XA 2EBNA 5L9FA 4Q4PA 3VM7A 1F8MA 2PDKA 5K2ZA 2VGGA 2ACRA 3LEPA 5H8UA 5LKYA 2Y4SA 3QFWA 1LLZA 1XGDA 4MB1A 2ISFA 1EUNA 1RHCA 1RQBA 3T4WA 3LCHA 3OBKA 3MSYA 4GMEA 3LHZA 3RO6A 3B8VA 2FVKA 9XIAA 2OT1A 4KWOA 3TUUA 2HROA 4GYFA 4L1XA 1Q3NA 5D2YA 5EMLA 2GUYA 2IKGA 3QLLA 1HL9A 3SCQA 1I0DA 2CESA 2HVNA 3VC6A 4UFLA 1W1VA 3G1XA 5KITA 2PWVA 3HMCA 1EB3A 2H3DA 4UQAA 2DSVA 2WZEA 2VEPA 3NVDA 4DX3A 3WUBA 4XK2A 4DPPA 4HJFA 4O54A 4D6GA 1PZ2A 5FJUA 3H12A 3NPUA 4GCXA 1VFUA 2ESCA 1PKNA 4S38A 2QCCA 4PGLA 2I14A 1QBBA 3TV8A 4I6VA 4MPQA 1VHNA 3SI9A 4TX9A 1DHKA 2PWGA 3LU2A 2YR1A 2PC4A 4ADTA 2FMOA 4E38A 1K9EA 3L4XA 5FEZA 3SIZA 1OC6A 3L12A 4K68A 1V3JA 4N9CA 4RZ6A 1XIIA 5EMJA 4PEKA 4OOZA 4IZGA 4BY3A 1ML1A 3R89A 4DYJA 3DKLA 3BLOA 1X96A 1ZCCA 5HXMA 2CZFA 4NVTA 2OQLA 3KWSA 2VD8A 4QNWA 4IIGA 1ISWA 3N6JA 1KM0A 1EJUC 2QMKA 2Y24A 2XPKA 2EAWA 5AECA 5MKGB 4NI8A 4WDUA 1XSIA 4ALDA 3ATYA 2PCEA 1CPUA 2QXWA 1SFJA 2V3GA 2UY4A 4F0MA 3VAVA 2DIJA 2O4MA 3K13A 3N6HA 1VR6A 1JPKA 3SQMA 2J8TA 7ODCA 3LHUA 4IGMA 3N19B 4ZQPA 3S1WA 3RO8A 4OBSA 3VNLA 3THQA 4PTDA 1W1TA 2JALA 2WSRA 2IPWA 2Y6ZA 2CLOA 5DMMA 2VC5A 1XS2A 4Z0JA 2NQZA 1RR2A 3WK3A 1YXDA 2QPXA 1B3OA 1IXQA 2V67A 3GZAA 1HKVA 5F1UA 2XTKA 2DPEA 1EUAA 1S2AA 2G3NA 1A3HA 3NXLA 1JPIA 5I00A 1RCQA 1F74A 2E4TA 2WWDA 3N18A 3EWUA 3KE0A 4IMGA 3U8GA 3M0JA 4LVDA 3VD4A 3BPWA 3CL8A 2WSKA 3MJMA 3W7GA 1O5KA 1U5JA 5EB8A 1VFTA 3WCZA 3IJIA 5C7HA 4ZSTA 1R7OA 3ITLA 3WMBA 4S23A 3DHFA 3TXVA 1SM9A 2FPTA 2DT2A 2OR2A 1LF1A 3C86A 4V28A 3OG2A 3IJQA 3WQPA 2BY0A 1XLCA 4IIBA 3QW4B 5A8GA 3NIYA 4NI3A 2CZEA 5BOEA 3E49A 4XZNX 2J6XA 1LOLA 1ISZA 2HE5A 1HVXA 4LC6A 5AYZA 4JHZA 2QULA 4S3GA 4GO9A 5GVJA 4MNMA 1XXXA 1YBQB 2PDCA 3GXIA 3C5QA 1JPDX 2OEKA 3SO7A 1F3TA 2ZRUA 5BMXA 1ZCOA 2O7QA 4WSJA 1EGVA 2PFHA 3MHGA 1M3UA 1MO0A 2XWDA 3GTXA 4A8NA 3TC3A 3HO8A 4EP8C 4XD4A 3G1HA 3BANA 5D4YA 1YADA 5J8LA 5FACA 1QNRA 1VRXA 3LHTA 4IMAA 1D9EA 1XYMA 3O8AA 3N2XA 3IGUA 1X6UA 4ZQCA 3G2GA 1OZQA 3EX4A 1GW9A 1QI4A 1Q6FA 1T0OA 4CCCA 5A69A 3T44A 5B7YA 3NGJA 3SQLA 3WQOA 4PUNA 5LIUX 2I57A 3CLWA 1XG4A 3WJYA 4Z2IA 3CIVA 3I7QA 1SJAA 3OW1A 5AHLA 2XVGA 1SVDA 1CXKA 3GTFA 4TV6A 3EB4A 4GBDA 3VNZA 2ABBA 1CTNA 3ES7A 1DJQA 2ZRVA 3V4BA 3S5ZA 1ZTVA 4LUJA 4QE4A 4EE9A 4ML4A 4KPLA 3VYLA 4B2DA 3N9RA 3VGHA 5CZSA 3GVVA 1YQ2A 4S1FA 3WK0A 5AB3A 3ABSA 2CHOA 4CQ8A 4DWSD 1EOMA 4P61A 4AD1A 1NFPA 5E09A 1TR1A 1XRFA 3ANUA 3AIEA 2Y5JA 2OQYA 4NZ5A 3A4WA 1SSDA 3N2BA 4BZYA 3NZPA 4US5D 3TIMA 3URBA 5LNRA 1QOQA 2PBOA 1KQZA 4Y9PA 3NPXA 1L9WA 2DZTA 1ZRQA 2VFFA 4POCA 1WZKA 5DN1A 4D72A 5CGMA 3R0UA 1N7KA 5LSMA 1W1ZA 3K4AA 4NAFA 1AUSL 4XKMA 4IH3A 2YW4A 1W1IE 4AY7A 3EWWA 3MCOA 1AZ2A 1RQHA 3SUVA 4AW7A 3M0ZA 1XRTA 1LT7A 1LLOA 3D46A 3CLMA 4PMYA 3FX4A 2DUXA 2JEQA 3OQEA 2GGGA 1BRLA 1JRCA 2XVLA 4HZMA 2PLJA 4RDWA 1Q7ZA 3N25A 1JDCA 3W38A 1NELA 1R3WA 1M53A 4JEQA 4JIHA 3LUTA 5HMFA 5DT5A 5G2WA 1QW9A 4IG2B 2WHLA 3O16A 2FB2A 2QUVA 3SY1A 2CLMA 3LQLA 2XSBA 4K38A 3DGRA 5I3KA 3R8RA 2Q01A 1QPOA 1W3TA 3PZIA 3LRMA 4KRTA 1YEYA 2I1OA 3S5NA 3S2JA 1UD3A 1HKKA 1BAGA 2YXOA 3FKRA 3BUVA 3EX3A 3IJ8A 5GQBA 3L0NA 9XIMA 1LL7A 3HF3A 3EOSA 4NT0A 2FGLA 3W53A 3PPFA 2O56A 2F84A 1VBRA 5D2WA 3B3DA 1HTIA 2EHHA 1YNPA 2G5WA 3AIVA 4JD4A 3RGTA 2X1SA 1JIBA 3E5PA 3KRSA 4XZ9A 4PTMA 3R58A 3S2MA 2PWDA 2YGYA 4C6OA 3VGGA 1O95A 1Z8AA 4EKJA 3W22A 1ZHAA 3F5LA 2B7QA 3LENA 3MBDA 1S5TA 1E5NA 1W6TA 1F6KA 1ZBKA 3T8QA 3WKZA 4ACZB 3RMEA 5ABFB 4M3PA 3A4XA 1UHVA 4Z2JA 3VO0A 5CAHA 1K8YA 2XYLA 3AYSA 1OF6A 3WO8A 2OZ3A 2VENA 3PZMA 3CV2A 5JBDA 5AHEA 1FQ0A 3KOYA 4BWLA 3N2MA 3OIXA 3KOFA 4HHMA 1TA3B 3LRLA 4GY1A 2YBVA 2ZX5A 3UG4A 3ME3A 3NZRA 1Q85A 3P8JA 4IFKB 3U6WA 4DJED 5CZTA 4AG0A 4CNTA 3MQTA 1NP2A 4PTXA 1OX6A 5D9OA 3SGGA 1PX8A 1HL2A 4WXZA 1ZJAA 1F4HA 2WMFA 4W89A 1SZFA 4FIQA 2A2IA 2Y7DA 4J3WA 1JUEA 2Z00A 4IPIA 1CB2A 1DWJM 2WKJA 3BOLA 3SJNA 1KGXA 4JQ4A 2NX1A 2QF8A 3RM9A 3QGKC 2QZRA 2J7HA 3DFYA 4C6FA 4A2SA 3CPUA 3M5YA 4MWAD 3ARTA 4TU1A 1UPPA 1HKMA 3N04A 3QHOA 4GVHA 2PF0A 2QT3A 4NILA 2V5KA 1ONXA 1V3LA 2QIIA 4MNKA 4US5A 1LYXA 4Z1BA 2NZLA 5AFDA 3BLDA 2D2JA 1KA9F 1Q13A 2VRQA 1HKJA 2F8QA 1OCJA 4MM1A 3THDA 1XKYA 3MPGA 1OY0A 5ECUA 5KTLA 3WF3A 3W2JA 3DN5A 1JJKA 3QGVA 4LAZA 3BAWA 2V63A 4HCDA 4GIYA 1GT8A 1CI1A 1IZKA 2DVTA 1V93A 3OZOA 1PCWA 3DI0A 2E40A 5JH2A 2C0HA 4UTFA 1W91A 3PB0A 3BCFA 3GH5A 4JTUA 1B57A 4PMQA 3G77A 2P8BA 4U4MA 1CLVA 2HNHA 3CJPA 3W29A 2O9PA 1E3ZA 4DY1A 1OFRA 3TCSA 1R9YA 1LWJA 4PCFA 4D2JA 1O4UA 3W3OA 3TH6A 3N6QA 3LBCA 5DCDA 3PFRA 4E3VA 2WMIB 4QX4A 1UYQA 2GQ9A 1MW1A 2INZA 3OHMB 2V82A 1AW2A 1QOPA 4LOCA 2RJGA 3WLQA 4J9JA 3BV7A 3GRIA 3DZ1A 1FWHC 1G0CA 4PUWA 3GW3A 1DQUA 4NRRA 4IT1A 4Q8MA 1MDLA 3S6DA 1SR0A 4GX8A 3ZR6A 1LL6A 5AC5A 1TPEA 3W1AA 5A2CA 3QLDA 1PX3A 3OQ8A 4A3UA 3SFKA 3AJXA 2W61A 3EMZA 4XTIA 4R7WA 4ECLA 1F76A 3OZYA 2FHCA 3U7VA 1QHOA 2ZX8A 3W7EA 3BG9A 3R0KA 2X16A 3CC1A 3UWUA 3GDMA 3B03A 1FWBC 1N55A 2PTYA 2XU2A 4RCXA 4DZIA 1JYVA 3LXCA 3QV6A 4JTJA 4RE3A 3SRFA 3T0AA 4CKQA 1RAKA 1NU5A 3REQB 1EA9C 5DBTA 3QKZA 2X42A 1DJYA 4DUVA 2BHZA 3F4WA 2VKZG 2VWSA 2Z7KA 2PDGA 5I6SA 1A80A 3SCUA 4F0KA 2GDVA 1QUMA 3QMRA 1KFBA 4S39A 4MNLA 5K9CA 3SY5A 1OSEA 4OIFA 1BGAA 5LA0A 2HK0A 1EPVA 1LOSA 2Z1SA 1JFXA 1GOWA 1XP3A 1K9DA 1J0JA 3NSXA 3WJWA 4K8GA 1CGTA 4HHHA 3EWCA 3GXTA 1XQKA 2DZSA 7REQB 3BAYA 3MHFA 4GLEA 1ZENA 1XLJA 3PK7A 2O55A 3OA5A 3W7NA 4J4KA 3ZT5A 1WUFA 1E6RA 3CH9A 3MUZ1 2OZTA 2XG9A 3FCPA 1E56A 3W2LA 1UCWA 2GLKA 3ARYA 4GABA 1B54A 2XM1A 4M6QA 1NIUA 5C0QA 4AEOA 2GGIA 5LIXX 3B04A 3DECA 1E0UA 3E5BA 1F07A 4S3AA 4Q8TA 5LA1A 2OWXA 3RFAA 1T6MA 2I56A 3P5YA 3FVDA 1TIMA 2ZRXA 1CBGA 3W86A 1H61A 3QY6A 3AISA 3CV6A 1ZJBA 4EIVA 5AHFA 3SR7A 4HA0A 1ZPTA 1W9BM 3KFTA 3DX5A 4MY8A 2G4FA 4TO8A 2PEVA 2ZA1A 2GPTA 2AMXA 4IWWA 1H7OA 4W7UA 3GAYA 1G7VA 2WO5A 4JZ5A 3KTXA 1MZHA 3DERA 1FVPA 1TMLA 3DYOA 4IMFA 2P0IA 4HPHA 4ZTYA 3NURA 2XN2A 3AXKA 2G41A 2YA1A 3QYSA 3WENA 3W24A 4HN8A 4QISA 3TONA 4GVFA 2YL6A 3NGFA 2ZZ4A 4LAUA 4FX7A 2J79A 4IJRA 2XFRA 4JCMA 2F6UA 3D0CA 2OYMA 5ECVA 5DO8A 2VGIA 5EGRA 2B81A 2VCCA 2YCIX 4MY1A 2PGEA 1YBQA 3T8LA 4LYKA 3M9YA 4PMVA 4G7EB 1BXCA 1QNPA 3QV9A 2WMHA 4BF5A 2DEPA 4MJMA 3AUOA 1LCOA 3CHEA 3MU7A 5D8ZA 4GO8A 3MMTA 2V5CA 5JXQA 1YRRA 4EACA 4M82A 3W25A 3QHMA 2QPUA 2EPOA 2Y89A 1CZ1A 1IQ8A 1FHUA 1R3VA 4UR7A 2R9RA 4C7DA 2C1GA 3W1NA 3SRDA 4HT3A 2ABAA 1TCDA 3IJ9A 2QUTA 2ZC1A 3AWOA 1K77A 4C6BA 1JYWA 4R5EA 2XWEA 2WV8A 2HVOA 5FF3A 4LUIA 1WDRA 2PLKA 1R6WA 5EKYA 4UWMA 2BV9A 4E6MA 2E6YA 1A4MA 3W7MA 2CLHA 3S6OA 1K4HA 3R79A 1W5PA 5HDRA 4GBUA 1ONEA 1XBXA 1H1YA 4QJ3B 1CLXA 4UTMA 1S46A 3A13A 1XPGA 1PZ0A 4UTJA 4D6DA 1V4YA 3HQ1A 2W79A 1O5RA 1ZFJA 2WPBA 2MANA 3ZJKA 3EA2A 2FHBA 2YZRA 1W3NA 3BOXA 3QV8A 2GK1B 2V2CA 1LG2A 3RU8X 4JIPA 2OELA 4Q4QA 3UWVA 1FHVA 3WSUA 3UT0A 1LBMA 2PDQA 4OBRA 2E0PA 4WVXA 5C2CA 1XHGA 4K6AA 2W67A 3COTA 1DE5A 1B4EA 1NAL1 3NYZA 4GOAA 2D23A 1GQIA 1LUCB 1V0LA 5I78A 1EZWA 1E6NA 3VIIA 3NA8A 4GE8A 2OXNA 2OKTA 4PMJA 4E2VA 3QHNA 2YCLB 5DX7A 4GIEA 2ODOA 1UROA 3LZ5A 1G4TA 2VZUA 1VC4A 4FNTA 5G2HA 4RDZA 5CEWA 2VC6A 1Q66A 2ASHA 2NQ5A 1OGSA 3OTRA 4CU7A 5DELA 1LQ0A 2VX5A 3VZZA 3PUDA 1R9ZA 1W3IA 1K70A 2ZX9A 1V03A 4GYKA 5JIWA 1WZAA 3F2BA 5LZLA 3HTWA 4O4WA 3LMYA 1G4SA 3KVKA 4MUPA 1W9VA 3T0BA 3GH4A 2DZVA 1A53A 1IF2A 1M7JA 4AFYA 2GJNA 1H0GA 5HNNA 3NVTA 4LEQA 4GXMA 3ITOA 1CW2A 4IG2A 1CXFA 4GUIA 1TWWA 4YWIA 3UGRA 1A3WA 1YXYA 2Z4GA 1BKHA 3N29A 4Q8VA 2V5LA 3R1ZA 1DL3A 4Q8OA 1GG1A 5JQ9A 2XIJA 3GTHA 1YYAA 5H6HA 1KLYA 3ITTA 2JK2A 4NZJA 3VNDA 3WLPA 1W8GA 1SO5A 3NQCA 1SYTA 3SY8A 4I90A 1PDYA 1EX5A 1XUZA 4LNYA 4Q7BA 4D8ZA 4H7VA 4AZBA 4FOKA 5AHIA 1EKOA 5JUVA 1E9YB 1YIXA 4N6FA 4AEFA 3SIMA 3TYDA 4GYJA 2GGEA 3NFUA 4WQ6A 1TV5A 1K7FA 1WPCA 4FAMA 1H1ZA 1VEMA 3SEPA 3WBWA 1GEQA 2AKMA 4H3DA 2HRWA 1DIDA 2CETA 4FA3A 3KBSA 2A7PA 1UOKA 5I09A 1F9CA 1LG1A 4HNLA 4MLJA 3RR4A 1OT2A 3PP7A 4L64A 5AY7A 3CMFA 1I2NA 1Q5MA 3FXGA 5ABFA 4MDOA 2RAGA 2RFGA 2BVDA 5H1WA 3KDOA 3AMLA 2NVAA 1D2KA 4CN4A 4JBRA 1BYAA 1EC7A 1EX1A 2QKFA 2UWFA 5G1YA 4U5IA 4H01A 3AS1A 4YJ5A 2J7CA 1TA3A 1QDSA 1NOUA 1WO2A 2VFDA 3W9ZA 2XHYA 6ENLA 4IFKA 3TJ4A 3OIHA 2DT0A 2QF7A 1ZU8A 3QH2A 5D32A 3SUWA 4P7LA 4YHGA 4HB7A 5CJMA 5FEPA 2GL5A 1BLIA 2MNRA 4J35A 2EG8A 3M0VA 1IR1A 1EJTC 2QJGA 3UZXA 3H8AA 3SRKA 2Z27A 3VCRA 3FFSA 1EH9A 7A3HA 1SGJA 4HU0A 3W07A 3CUXA 4J7RA 3QC0A 2QS8A 2E6FA 4FZIA 1SJCA 3SN1A 1RVKA 2PDNA 4N6EA 4AY8A 1ICSA 1EFZA 3VUSA 4KQNA 4BWLC 2CW6A 3HFYA 2JEPA 1TRIA 1X8FA 3C0LA 2PTDA 1M7XA 3M7WA 3EDEA 2UY2A 1GVYA 2FQIA 4DO7A 4J27A 3WF0A 3EPNA 4MADA 2V5DA 3C8FA 3QR3A 1QI0A 1X6LA 3C4UA 2OPJA 3A22A 4PUUA 2V9DA 2Z28A 5HK4A 3KWXA 3SCRA 1B9ZA 3MYOA 2OVLA 1KM3A 3FYYA 4XG1A 1KCZA 1WDWA 3BW4A 2A3LA 3MUAA 2YLAA 3MMWA 2VX4A 2E68A 1P0KA 2E3ZA 4R3UA 1EBHA 3O2LA 3KXQA 4DB7A 3A23A 3G1RA 3ARQA 1G1YA 2CLIA 4C60A 2AL2A 2B0MA 3T08A 5KZEA 1HT6A 2PU0A 1JD7A 4UQEA 3GQYA 3A5FA 2EG7A 5XIMA 5D2VA 4RL3A 1XYAA 1YTDA 3OZPA 3FDKA 1ZP3A 2DQWA 3UXAA 1VPQA 1E4LA 2WVTA 1XICA 2VUYA 1EQPA 3BAIA 2DUAA 4AHQA 4Y9AA 3DI1A 2C1IA 4GQ0A 4YCPA 3ZQ9A 4Y9NA 4XQ6A 1GZGA 3QVQA 3PZNA 2WNWA 4MJ4A 4RXFA 3P62A 3C61A 2W27A 1ZAIA 2GVLA 1GZ1A 2BY1A 3WX7A 2BOEX 1EC8A 3TNBA 3UG3A 4O8RA 4C6DA 2IPJA 4I7WA 4GI6A 3PUGA 1ADOA 1GVFA 4WKHA 3H2NA 4L61A 4M1BA 1H5YA 4MYXA 2ZXAA 2FPYA 2OKOA 3U5YA 1AJZA 3VMPA 1AMKA 2I5IA 1Z6KA 1FWAC 1PO9A 1W9UA 3CUJA 4EK7A 3O15A 3UP8A 4HHLA 4J3SA 1KM1A 4E8CA 3GHRA 4XZWA 5CBBA 2HS8A 3WFLA 3ZLGA 4C6EA 4I3GA 1BF6A 1MXSA 1GYMA 4KKXA 3U48A 2DFAA 2PWFA 3MMDA 3PTKA 3P14A 1FH8A 4AWSA 4NZ4A 4AWUA 3GM8A 4D1IA 5LXEA 4ICMA 4WY0B 3KL5A 1OC5A 4TUFA 3EMQA 5AHMA 1O1HA 2QEZA 1EXBA 2D3NA 3DFQA 3GUGA 4HYWA 2J6VA 1TTJA 4AC7C 2B7OA 7REQA 3CEPA 4DBUA 3VIJA 2D0FA 4HYRA 4QP0A 2ZFAA 1YPFA 1MFVA 1YX1A 1SO4A 4UNLA 4CVUA 4NJJA 3WQVA 3CHVA 3ZLFA 1UR3M 4E3TA 2NQ9A 2ZKMX 3TFXA 1FA2A 3PANA 3UXLA 4X63A 4ES4A 4ZE4A 2V2DA 3GXPA 2Y8UA 4DQWA 1M03A 2QJNA 4IM4A 4XD5A 3NWRA 3ZSSA 3GNNA 3DFOA 3ARZA 5M3WA 1P6CA 3VXGA 4QDWA 4HTYA 1SW0A 2CLPA 1JNDA 4A05A 3CNYA 4CCEA 3OJGA 4AZGA 2YDSA 3P8IA 2CBUA 1E4IA 1NARA 2GOKA 2Z6IA 4BS0A 3W6MA 3K30A 1JAKA 1EDGA 4A2RA 4PUDA 4XUGA 2ATMA 4FO4A 2ZUWA 3F4NA 1E1CB 4L80A 3CUIA 4K7VA 3Q94A 3MWCA 4MKSA 4XTDA 1X8CA 4WRHA 4A6GA 4X2RA 4QAIA 1Y5WA 1E1EA 1OD8A 1M5WA 3L4WA 5AYBA 4G56A 3ITCA 1FWJC 2F7FA 3T6CA 3M5ZA 1YDNA 4H8NA 1QTWA 3RUBL 3AIRA 4UFMA 3APGA 5F2GA 5JIPA 2DJXA 3ONCA 2FGBA 1JCMP 3IJLA 4ZODA 2NQJA 3WQFA 1HJUA 4QEEA 2G3MA 3S3GA 4G7EA 3CL7A 1U33A 4ZOBA 3E2QA 4JQ2A 1J01A 5C9ZA 3FN9A 3WLSA 1FWNA 1SW7A 4ILSA 4YU1A 3GU2A 4P7NA 4QROA 4DYEA 2W4XA 2PRLA 3E0LA 3QKEA 3WQWA 4DLFA 3SADA 3D6NA 1X1ZA 4AX7A 4UIOA 1NQ6A 2YB4A 3VD9A 1XLKA 2IQ0A 4CQAA 4ZO8A 5TD4A 1Y5XA 4C91A 1Q4WA 1H63A 1VFLA 2PTZA 2H8XA 4KIEA 5D38A 4F9DA 4NXKA 3EOEA 1HL8A 3S46A 4C1LA 1UR8A 3MSDA 1NTHA 3R94A 3VDHA 5CAKA 3WMCA 3VGEA 3HGOA 3MUY1 4HMNA 1PZ3A 3S0CA 3KRUA 4CU6A 4AXKA 4HU4A 4O1FA 2W6RA 5EMYA 3TEVA 1GOQA 4ATWA 4DJFA 4PCNA 3V5FA 2Y62A 4JTIA 2OODA 3F4DA 1AL7A 2DT1A 2WHKA 5CG7A 2HPMA 3QGAC 2PGFA 2GK1A 3BV4A 2EJ1A 1MMFA 4FR6A 4YS1A 4M7TA 3WY1A 2ZA2A 2QGYA 3S9YA 1PKMA 3BK0A 3PAJA 3BGGA 5CPNA 1HKIA 3O05A 1JGIA 5I3IA 4O1AA 2BVYA 3BE7A 4MKNA 3IJ6A 1QT1A 4JYDA 3VNJA 5FOOA 1PJ9A 2WLZA 4GUFA 7TAAA 2YCLA 1YPIA 3NO3A 4RE4A 1OT1A 3H22A 3DH7A 3H2EA 1EO5A 5LYRA 3GNRA 4MFDA 3GKAA 4Q6XA 3VGBA 2ZVIA 3IPWA 3IRSA 5IM51 4PC8A 3MI2A 3ELFA 2GVGA 1FUYA 4OQVA 1OIFA 3NEVA 3TVAA 3LHVA 4QS5A 4O18A 1VJZA 3W70A 1ZBWA 2VT0A 1SPQA 2PDPA 4ATLA 2G50A 4HA1A 3UQNA 1WX0A 3A21A 3MI6A 1JCLA 4TTUA 3KCJA 2YBTA 1RQEA 1E71M 2CLEA 4OUIA 3CASA 3EWZA 5BU9A 3QPYA 4MKVA 2ZUUA 1XLEA 3UXIA 3TTYA 3G1FA 4TMCA 4P8UA 3CV7A 3O06A 1AH3A 3IV3A 1E6PA 1GORA 8XIAA 2BVTA 4F0HA 3U9IA 1V79A 4BI5A 4YTRA 4JKMA 4Q3MA 3I4KA 4B91A 1JGMA 4H6KA 5HBFA 1FCUA 4ZCWA 2ICSA 4LAKA 4WZHA 4X60A 1J2BA 1L8PA 6REQB 2OO0A 1HO4A 1OYBA 2NV2A 3WUGA 2EKCA 4MPKA 1A0CA 2OZ8A 1IZJA 4BFAA 1VFOA 1CGYA 3KAOA 5DMNA 4TX6A 3C3NA 3BMXA 4O16A 1VYRA 2P88A 4CD5A 2PLCA 1EJVC 4C6KA 2QDEA 2DUZA 3TP4A 1H7RA 3LV6A 3G1SA 3ZR4A 2DW7A 3VK5A 2CBJA 2VEGA 1AFSA 4GPNA 5FJIA 1UZ1A 5IRPA 5C9WA 3P3BA 1NDWA 2NLYA 2GSEA 4U2ZA 1G9HA 3BLPX 4PBFA 4BCEA 3W1UA 5GPRA 4MZ1A 3GNDA 3L2LA 1TPUA 3BG5A 1MSSA 5A6JA 4G1KA 4L4LA 2C91A 1MQPA 2FGZA 3PG8A 2XGZA 4FXFA 1K03A 1UW9A 1ME7A 1YDYA 4O12A 1XIGA 4NJGA 2ONEA 4WIWA 4AAJA 2PWUA 3AIBA 4DUOA 1NJJA 3GDLA 4P8XA 4IX0A 1RCXB 2E25A 1L6FA 2HWGA 2VFGA 2CERA 3URQA 3IAQA 4MLRA 4D6CA 3PBMA 2DDXA 1W32A 5D30A 3NQMA 1POJA 2GWNA 4GXPA 3WNNA 1QWGA 1KTCA 3T55A 3LBOA 1P7TB 1IEIA 3B9DA 1LRTA 1KNWA 4JKKA 4QHRA 5LIYX 1FFRA 4S3FA 3F4CA 3II1A 4D6JA 3MT1A 3T2QA 5IXEA 2CWXA 1B0IA 1FXQA 2XM2A 4OFCA 6CGTA 2RDUA 4OT7A 2CLFA 1H1NA 1JCYA 2EG6A 4MFEA 3UZ5A 1J18A 1V3MA 1E40A 4ZO6A 3PBWA 5G4WA 4ZZ9A 3PWGA 3NXFA 3B9NA 2JF6A 1ESWA 3WH6A 1X1NA 1IGWA 3QBUA 4WSKA 3SCVA 5HR6A 3PTDA 2VVNA 1VZWA 4OKDA 1KR1A 4CNOA 5IDZA 1E70M 3BLIA 1UH4A 1ZAJA 5JBEA 3VGFA 3ITYA 5PTDA 3WEOA 1G01A 4I9JA 3PHAA 5C6MA 3JVAA 2F9RA 3RITA 2FKPA 1JR1A 4ZMGA 4GY7A 1BTMA 1NOFA 2ZDRA 2JBMA 3U2ZA 1KB3A 5HNRA 2DW6A 1GZJA 1Q7MA 1A5CA 3N4AA 1YTKA 2WQDA 3RDKA 4C7GA 1Y8BA 3GW0A 4LAMA 1RPXA 2J74A 4ZXLA 2X0SA 1DORA 1N8IA 3STGA 1PAMA 1UC4A 2QCMA 2O7SA 4KW2A 4R34A 3TW9A 2PD5A 5HWJA 4FOUA 3M46A 5T9BG 4FNRA 1VP5A 2QPSA 4XD6A 2D2GA 3GBEA 1R85A 1C8XA 1TV2A 1AMYA 1WB0A 5BOOA 1PHQA 3PPGA 4WD0A 3UJEA 3DFSA 4JQ1A 4WOQA 2W9MA 2CLLA 3BZJA 3W7JA 5CSSA 4PCTA 3UYCA 3OVQA 1JI1A 1IGSA 1RZMA 3GG8A 4QBXA 3L0GA 4B3KA 3UY8A 3EYPA 2ALDA 3E02A 4H2CA 3FOKA 4KWSA 3TA6A 2X09A 5HJLA 4HQVA 4PMNA 3GDTA 3UWQA 3GR8A 3KZSA 3DFPA 2WKLA 2O9TA 1S2VA 1JCJA 3V18A 1JYNA 3WNOA 1NH6A 5T26A 4MJ2A 2BTMA 2VFIA 4JTQA 3TTQA 4XO6A 3MMUA 4G8TA 3H7VA 4ZO9A 2XH4A 4YVVA 4GKLA 1RJQA 2WM1A 3H7RA 1PDZA 4ZA0A 3O7UA 4ERIA 4DUXA 1U83A 1FWSA 3D5HA 4ADSA 5LIKX 3CUZA 4ZQMA 3P6LA 3GG7A 3UVAA 2FVLA 2PWEA 5D03A 1K9TA 3MO4A 4RLIA 1LQAA 3EKZA 1KFJA 4XVEA 3W87A 4EXQA 3AOFA 1OD0A 3UNTA 1WE5A 2Y5SA 3S4TA 2C13A 4JTEA 1DJNA 1Q65A 4LW7A 3AUJA 1GHRA 3M0YA 1UUOA 2HISA 4TOQA 3E0IA 4FK9A 2Y2WA 1IR2A 3FW6A 2GZXA 4KRUA 3VILA 3WFAA 1IIGA 4Y9OA 1UD8A 3LCLA 1O1ZA 1U1HA 4I9TA 4Z08A 3M16A 3VGDA 9RUBA 3W00A 3TWAA 1A47A 1WAUA 3KBMA 4NYUA 2A7RA 4KIRA 1J0KA 3R8HA 2C6QA 1O5XA 2HBXA 5HA7A 1F5ZA 5BOFA 1XGZA 3G0UA 3FIGA 2QJJA 1E6ZA 1CDGA 1NF0A 3LV5A 4HPGA 1T99A 3AI0A 1Q6LA 3QF0A 3BVJA 3FYOA 3MJYA 3WEMA 5H2ZA 3S5YA 3DHDA 1ZUAX 1QCWA 4NL1A 4QDMA 3UCQA 4E8GA 4UTLA 1KWKA 3FA5A 1JG9A 1BXBA 3BGAA 1B3VA 4DF0A 1RA5A 1CGXA 3UBPC 1DYSA 3V36A 3DC8A 4MG4A 3TTSA 2V3EA 3GIYA 4PTVA 3SW6A 3W01A 4GIRA 1CWYA 3I68A 4HJWA 5FSEC 1I45A 5LA2A 3RILA 1E1CA 1UKOA 3MBFA 1MRAA 4E2BA 4EPKA 5LNWA 3AXIA 3PJTA 4LVBA 1A4LA 3CZJA 2BXYA 4AZCA 4J5NA 1UPMB 1TVPA 1JEZA 1ZSXA 4PB5A 1FKXA 3FJ6A 3S2LA 2Z0IA 4FXSA 2NT1A 3T09A 4AD3A 4RNHA 1I4NA 5E1QA 3USZA 4GUGA 5CC3A 3TW7A 2GUUA 2OFJA 1FCQA 3TCEA 3W27A 4HMEA 3LM7A 4V1YA 3C2YA 4J3VA 2WOQA 3B9EA 3KS6A 4QLLA 1H7NA 1XDLA 4EX4A 2O9OA 1QASA 1G67A 3MKKA 1MNZA 2SFPA 1SU5A 2YCEA 1P0NA 3S5OA 1PL9A 2W62A 2AAMA 2H90A 4N4QA 3RX2A 4MAVA 1D8CA 1KRMA 4ML9A 4O0KA 3EB3A 2D0HA 4AF0B 1WYIA 5I7GA 4D71A 3OLIA 2WPGA 4XX6A 4PBGA 1OJXA 4MIMA 2J9XA 4FPSA 1KWGA 2X40A 2PE4A 3IACA 5A6BD 1E4MM 4LRSA 4LQ1A 1PBGA 3OODA 1KM2A 4QR6A 3KBJA 4NASA 1E9ZB 3HG2A 5I03A 3I7SA 4RZBA 3WQ8A 4QG8A 5D2XA 3TKFA 1LT8A 2PGRA 3EDJA 4AU0A 4J2PA 5A94A 1SZEA 5HQLA 1F73A 3BO9A 1WOBA 2O0TA 3HM7A 1J93A 4R33A 2PPGA 4RE2A 1KR0A 2WMKA 1RLDA 2BWGA 3FSUA 3OOQA 1VCVA 3A3XA 3QZ6A 3TJIA 1SZRA 1IYXA 3DKJA 3MZ2A 1CX9A 3N9SA 1FHDA 3RPMA 1OCQA 3NQFA 4NNAA 3BMWA 1ALDA 4KGLA 3IIPA 1AH4A 1NWUA 1H7XA 5HANA 3LXBA 2HXUA 2I17A 1A0DA 3EA1A 4XO7A 2V8ZA 3UEQA 4YIWA 2WVVB 3AXMA 3H2OA 5TF0A 4Z1YA 2WCSA 1XYLA 3K5XA 2BY3A 2F2KA 3JRKA 5LHEA 2V2HA 3AZTA 5DCBA 5E6YA 4CQDA 4NG3A 1BWKA 1JNEA 2GDQA 4L1GA 1DXIA 2OWWA 3H4WA 3PUEA 4A22A 2CITA 4DJFC 1H3GA 4HPXA 3T9PA 1QK2A 4G7FA 2Z1XA 3MKCA 1IT8A 5FA5A 1W2PA 2FMNA 2D2OA 3EPMA 4UC5A 2OCZA 3SAZA 1PEZA 2CWNA 4IIFA 3POCA 1K8CA 2GJXA 1P1MA 2Y61A 1ITCA 2F6XA 3VDGA 1V6UA 2BSLA 2Y5EA 2ON3A 5I3JA 1OCBA 3AIUA 4X2PA 1Q6CA 1W3HA 3TYAA 1MQRA 5AVNA 3LDVA 5H8PA 3W6YA 3P74A 1MUMA 5D8WA 1QATA 4DPQA 3UJ2A 4K37A 1MWOA 3R5EA 3U2CA 2C18A 2HQAA 4WX2A 3MV01 3C6CA 1KO0A 3GO2A 3J7HA 2XIQA 5ABTA 3W1RA 2D2HA 3W7PA 2WC7A 3WLHA 2E5BA 2XIMA 2X41A 4WGHA 2QCNA 3M6DA 2CHRA 1US3A 6REQA 1XKJA 1CXLA 3MTWA 4NAFB 4W86A 1TUXA 1HW6A 4ZR8A 3WQ6A 4Q33A 4F0RA 3G6LA 3KX6A 4NJHA 5GNZA 3N4FA 4IF2A 1HP5A 3ZS4A 1KTNA 1R7AA 1ZZMA 5EYWA 3T42A 2VELA 3NQEA 3FSTA 1Q8AA 5KMYA 3A9IA 2DP3A 4JIIX 2PP3A 3V1HA 2VOMA 3WDHA 3XISA 2FVMA 2RH9A 4ZSUA 3AALA 2J4GA 3W74A 3GU1A 2VX6A 4JTDA 3V16A 1GW1A 3BDKA 2QCGA 1MDRA 5EL1A 4Q22A 2C79A 1J9YA 2F38A 1QRQA 3MCNA 1FWTA 4JDBA 5C7VA 4K7YA 1ZJHA 2XZ9A 3GDRA 2A3EA 2BOFX 4UTKA 4EOUA 1OCNA 5CSUA 4GIAA 4JIEA 3NSNA 5DXYA 3V0TA 3HJZA 1V6XA 1W1PA 4E4UA 5K7JA 3N15A 1RBAA 2PP0A 4KBXA 2PGWA 5E9XA 3OG3A 2DZAA 3HPFA 2E1DA 3BJSA 3PF3A 3NAVA 4K8HA 4M6UA 1LJYA 4JFTA 4JNYA 4PRRA 4A29A 2D0GA 3EAUA 3HGJA 1S5WA 2ZRWA 2XN0A 6XIAA 3W7CA 3VOCA 1TCMA 1P7TA 2TMDA 3VABA 1GVQA 3W73A 1XFBA 3TOYA 3ZM8A 4W8AA 4AZ5A 7CGTA 3LERA 4EWND 2DVUA 4O57A 4AYSA 3U0HA 1RH9A 4X9YA 3KP0A 4LF1A 4KESA 1BPLB 3GG0A 4HVXA 2EJAA 9CGTA 1ISXA 3CIWA 1Q4NX 3SFWA 4L7ZA 2H3BA 1TJ2A 2XH2A 4L4PA 4NIRA 3TYCA 1WZLA 1H50A 1QK0A 4GFSA 3E2RA 1FBAA 3NM3A 1FWIC 2WJFA 1RD5A 2UBPC 3EX1A 4W9TA 1Z48A 3RAOA 2PU1A 5CPTA 2F2HA 4RW5A 3G1AA 4L9XA 1TV7A 2YW3A 3QQWA 1IEWA 3CMGA 3ZFHA 4FI4A 1JF5A 1EJSC 2FB3A 3GWQA 1HJSA 2J8FA 3B05A 3GZ3A 4MHBA 3SZ8A 3RIKA 1E43A 2YA0A 3WDQA 4DJDD 2OYKA 4S3EA 4JQAA 1V0NA 1WDDA 3VOIA 1ITXA 4Q4MA 4HK5A 1TV4A 1W0MA 1EYEA 3GXDA 1PZ1A 2L5HA 1VBHA 2QVNA 1K6WA 1TMQA 4S2CA 1H2JA 3NSMA 1W1A1 4J3ZA 2ZUMA 3OYZA 3A47A 3VPLA 2VURA 1KD0A 5IFPA 4HNCA 3L5LA 2OWCA 2QJMA 1JDFA 2X0HA 1PWMA 3ZVIA 3CMJA 2FFCA 1FH7A 1JFHA 3A3HA 2FZBA 1B31A 4CNPA 4UQDA 1RD6A 4E0CA 1Z89A 3GNXA 4NJIA 5M1TA 4JEJA 1XBVA 1SO3A 2JGQA 2JKPA 1EL3A 5BWAA 4N9DA 5A3HA 4A3HA 4JTSA 1X7IA 1V51A 1ZL1A 2Y8KA 2ACSA 1V0KA 1THFD 5FL0A 2YX0A 2HXTA 2HSAA 3BMVA 3DFTA 1QO2A 2NQHA 3URNA 2XN1A 1I75A 3UJFA 4XWUA 1MYRA 4ZOAA 1TWSA 1FH9A 1GEHA 5A6SA 1XLHA 3D3FA 2PODA 2PZ0A 2FIQA 2BHUA 3QMTA 5HAOA 4H04A 5CPOA 1EQCA 4QE1A 3QTPA 4UB9A 3O6YX 3LTYA 4HCHA 2P5NA 5BXTA 3ZOAA 1QI3A 1EXPA 5GNXA 3KLLA 1J10A 5C70A 1V6WA 1OVDA 3PSWA 3M0XA 3NQ2A 3QR0A 2WJDA 3S1UA 1VFFA 3L4UA 2ZIDA 4P2VA 4LYRA 1IWBA 1SSGA 2WZHA 4HA4A 4QIUA 4Y8EA 5CSYA 4NRSA 1F3XA 1JD9A 2W5FA 4GJJA 1I2RA 2PI6A 1LLWA 3M1ZA 2PLMA 3C2VA 3GFXA 2ZYFA 1JULA 3WH9A 5FL1A 3OGSA 2DH2A 3WQGA 4AVNA 2XGBA 3IIZA 3U57A 1UD2A 1BF2A 5CPLA 1J0YA 4QDPA 2IQTA 4FF7A 3S2NA 1DOSA 4X61A 4JKLA 3QJAA 5CJ5A 4Q4SA 3A3WA 3L4YA 4HMCA 5HNUA 4B2DD 3G8RA 3WK2A 3ARVA 3CUFA 1Z3NA 5DANA 1E3XA 4XISA 3GFYA 4TVCA 4QM1A 1VPXA 3BZGA 5I3FA 2TAAA 1UR2A 2E1WA 1BGGA 5EU9A 2PDWA 3ZWTA 2E09A 3QM3A 4BQ4A 3PBYA 5EMKA 4YN5A 3U5UA 3BSMA 2FZMA 3WEZA 7ENLA 3AJ7A 5DQPA 4I5RA 3RM4A 4UFIA 1UR9A 5F2IA 1T41A 5CZKA 1YW1A 3ZJ7A 3W28A 3CO4A 4K3ZA 4NSBA 5K9DA 1DKWA 3RCNA 5HULA 4YYCA 5CCZA 1QJWA 3DGBA 1ONWA 3NQ6A 1UR4A 4G2DA 3R7MA 4ZQRA 2VHLA 2A3HA 1HNYA 4DBSA 3BCDA 1HO1A 4QQUA 4WSHA 5EFFA 1R47A 4DN1A 3MUCA 1G4PA 2VOTA 2Q02A 1DJHA 1GVOA 1YKWA 2DV0A 3UPMA 1VLWA 1L8NA 1RBOB 5C9RA 1ICPA 1P1XA 3IEBA 3MANA 1VD6A 3N2TA 1U1UA 1VBUA 2NV1A 1XYFA 1WBJA 4Z2HA 4DJDA 3TLLA 3R11A 4CLMA 2WBKA 3DXIA 3OO2A 2XIBA 2Y8VA 1UBSA 4NYYA 3VNYA 2CCRA 5CZJA 3VIGA 1AD1A 2P0OA 2QCLA 4EPBC 4RR4A 4IMEA 4R85A 1JCXA 1NF7A 2NXIA 4EANA 3F1QA 4GC4A 3AAMA 1PTAA 2YDRA 3EBVA 4ZL1A 1K4GA 2VI0A 5KZDA 1XGEA 1VJIA 5TAOA 4O13A 3WIJA 2Z25A 1W5OA 4AF0A 2QW5A 2QIWA 1TX2A 1UOZA 2WNZA 4A21A 4KCWA 1FFQA 3BOFA 3TDFA 4QSHA 3PNUA 3LD5A 4N02A 3OPSA 2IPFA 3IANA 3RM8A 2TSYA 4XZLX 3HV8A 4Z0SA 2VL4A 3NDZA 4OGZA 3WNMA 1A3XA 4MAZA 4DZ5A 2QV4A 3VOFA 4ERGA 5LGXA 3VOJA 2ZXBA 1XI3A 4WKAA 2ZTJA 3G5EA 3TW6A 4B5UA 4QCEA 2EPMX 3INPA 3NZGA 3OVPA 3AQUA 5REQB 1A5UA 5I3DA 5KEZA 1G69A 1ISVA 1T5AA 2VXNA 3H2CA 5KETA 3OBEA 3AHVA 1JYXA 4B5NA 6ALDA 5AN7A 1DQXA 2Q3OA 3IVUA 2H8ZA 2ZUTA 3N3MA 3B40A 2Q3RA 3L4TA 2BG5A 3E0VA 4I9MA 1TIWA 4TMBA 4LCRA 4N0RA 5HINA 2EKGA 1US2A 3S47A 4BR1A 4PRWA 2P76A 3NL5A 1QI2A 1PTGA 4OOUA 1GVRA 3LA4A 3KTSA 4LUSB 1VH7A 3OHIA 1CECA 3K2GA 4RPPA 2VMFA 3WLLA 4A8LA 2WVVA 4H41A 3RR1A 4B90A 3KS5A 2W3ZA 1OABA 3GVRA 5ENLA 1OBAA 1FDZA 2OLSA 4WLCA 2CBVA 3HGRA 2J24A 3DCPA 1ELSA 2E5DA 5FJTA 5KZMA 1EYWA 2VEIA 4S3BA 2OGJA 2QAFA 3S9IA 1OYAA 4RX0A 2QCHA 1WDQA 1REQA 2ZA3A 3UGVA 3WH7A 2NSXA 3ECQA 3PTMA 4EXBA 1FOBA 1SJDA 5JU6A 3SSZA 4LEFA 1ZB5A 3OVRA 3NEHA 1Z69A 2E28A 2CU0A 4YVXA 1F61A 1C92A 3B0UX 1EDTA 2VNCA 2ZUSA 3VZYA 4K8EA 1UUQA 1OG0A 1J5SA 2I9EA 2IXVA 4JICA 1CGUA 2HTMA 3GXMA 3RHGA 1FDYA 2FH8A 2VEKA 3WQCA 4UXDA 4UTHA 1DV7A 2R82A 5DFAA 4OTKA 3AC0A 1GWJA 3IVSA 1FCVA 4XB3A 3V5OA 3PBVA 2NX3A 1C8QA 4UNKA 3U2EA 1D3GA 1EHNA 1MFUA 1P4CA 1GJPA 4NY2A 3VKBA 4LVGA 2QCFA 2DT3A 4LY4A 1E4NA 3PVFA 4M80A 2JIWA 4GYPA 3QTGA 4I6KA 3HIJA 3H6OA 2X7VA 1M1BA 1OZMA 2WANA 4W93A 3K8MA 4RDYA 1FCBA 5DRCA 3CO8A 1EEPA 3L21A 4UTIA 3ORWA 1KFCA 1SQ7A 3URAA 2VGBA 4ZEPA 3T0DA 1E73M 5K9XA 4GJ1A 2YSWA 3NCOA 2ALRA 4QFUA 4OBTA 4UZSA 4G6CA 4JL2A 2VJXA 4H7ZA 4TTGA 1EHAA 3ABOA 3UW6A 3WUFA 4Y96A 4HA3A 1DP0A 2FTWA 1JQVA 3QRHA 2YPIA 1XW8A 1ZNNA 3WYZA 1TVLA 2PDMA 1C7SA 4IP5A 1ZY9A 3VIHA 3MP4A 4NNCA 4Q6JA 2ZXQA 2Q6ZA 1K9FA 4INFA 3IUHA 3E0WA 3WNKA 1G6CA 5DY3A 2CXEA 1J96A 1TZZA 4AVOA 1RA0A 1XRVA 1U5HA 1ZALA 2ZRZA 5J5RA 1E5JA 5BYWA 2EF9A 1HVQA 1UP3A 2OGYA 1FP8A 3BH4A 3GU9A 4QSFA 3F5KA 4DNMA 3LSCA 4Z2KA 1B2YA 2Z24A 4RK8A 2ZCGA 3NO1A 4QXIA 4AHPA 4AX6A 2X2YA 3EKLA 1CXHA 2J9YA 5F4SA 1GQKA 4QITA 1I2OA 4LWWA 3HPAA 4GJIA 3TA9A 4JTCA 2WZMA 1S1PA 3FGCB 3M64A 1RALA 1BWLA 4GNVA 2VX7A 1N8WA 2GVEA 3PY2A 4E5TA 3MSRA 1V3KA 1OGGA 3PJXA 3MZNA 1TVNA 3UETA 3N73A 2GGJA 1ITQA 4UFHA 1VEOA 2YIHA 2D24A 3FDGA 1QNOA 1IEXA 4FNUA 4GISA 1UQYA 1RUSA 2CEQA 2FZ9A 3LPFA 2R8WA 3R8GA 3KBNA 4AB4A 4HKPA 1C9DA 2EPLX 4IQLA 4FP1A 1C29A 1S1RA 3LI1A 4UOZA 1FTXA 4JAWA 5F7UA 1LQ2A 3FEMA 3WBAA 4YPJA 3UXDA 3FK4A 5DMLA 1KRBC 1K3UA 1XLAA 4Q8PA 4C1KA 1UG6A 3RRAA 1FWRA 5ABHA 2ZRYA 2ACUA 3KRZA 2W66A 3ARSA 1JRBA 3AWNA 3GUWA 2A5HA 5FI8A 4TX8A 1DHPA 4M5PA 2VZTA 4Q7IA 1CENA 1R46A 3WF1A 1WDSA 2R1KA 3VFLA 2ZZ5A 5LIWX 4C5ZA 3HV9A 4U5KA 1FRBA 5BZAA 3TJLA 1VJSA 1AQMA 3SCNA 1UA7A 4RXGA 3G1YA 4UBPC 1XCXA 1OB0A 2VGFA 4OE7A 3NZ1A 4LT9A 1EOKA 1XM3A 3LGEA 5TBOA 2WZIA 1RBLA 4H6QA 4AIUA 3AS0A 4GI9A 1WKYA 3LSBA 4RZ5A 2NX9A 3Q45A 2C19A 4CNUA 3PZTA 1AJ0A 4PTWA 3WQEA 2FHFA 3SUTA 2CKSA 1DXFA 2VQUA 3TQKA 1A5NC 4NZCA 1TUFA 1QPRA 4NF7A 4C6QA 4IXXA 1V7YA 4JTTA 3TC6A 4FXJA 2WCGA 1ONRA 2YL9A 3N14A 3WQ5A 1HKWA 2AL2B 1R2RA 3LNPA 4C6CA 3NG3A 4PUJA 3TU9A 4AD0A 1OFQA 1WXYA 1LDCA 4H83A 3F2DA 3U2OA 2C0AA 2YZ5A 3RK8A 1JCNA 2TODA 2NV9A 2GFTA 3TOPA 4HHPA 3UVIA 3S1VA 1EEXA 1O68A 1M04A 1RK5A 2R1LA 5MF5A 3STPA 1RP9A 3THCA 2F61A 5IHRA 4A35A 1I2QA 2YBUA 1QPNA 2QAPA 3PAOA 3KCLA 3E12A 1PYMA 3N13A 1ODZA 3MWAA 1QMLA 3KHDA 3LLDA 1TQXA 3DYPA 4DF1A 3GVGA 3RF9A 3WG6A 3TTEA 1QNQA 3L0KA 1UASA 3RLUA 1VYPX 1TQJA 1MEWA 3N2OA 3S83A 5A6KA 3BSGA 2W63A 4L65A 2WC4A 3V1PA 4D6IA 3FJ4A 3CZ8A 4IHCA 3TSDA 2EPNA 1F8IA 3HQPA 1I1XA 1DWFM 4PE8A 1A5SA 2YB1A 5C55A 4ENLA 5J04A 1CLKA 1LL4A 4O1BA 1FDJA 4QAWA 1TPWA 4M81A 4J28A 3C2FA 3AHYA 5M17A 1SO6A 4DZAA 5EMMA 3V0SA 3BXWA 4ORMA 3USBA 1DIKA 3UZWA 2I9UA 3SCWA 2OOFA 3DESA 2QLYA 2X0YA 4AD4A 3WD1A 2D20A 3IUIA 3PZUA 2WQPA 4CCZA 3WN6A 1KRCC 1MXGA 1XSJA 1DVJA 3RCMA 1SFLA 1XISA 3C0JA 2H6RA 3E38A 5GJMA 4LS0A 3QR1A 2A85A 3SGZA 3EWXA 2X2GA 4Q8WA 2PS2A 8RUCA 4GC3A 4H9UA 3F5JA 1WA3A 1HGWA 2AKZA 3QY7A 3NQ7A 2J7BA 1RY0A 2BVWA 4HTBA 1D3HA 2P3EA 3UR7A 2VM8A 1NDVA 1YDVA 2Z1BA 2W91A 4MY9A 3I3BA 1OC7A 1TE6A 1YPXA 5E5CA 2XVKA 1TWZA 2QDDA 4OV4A 2PF8A 3C52A 4DUWA 2XJ7A 4F3HA 3VIPA 1EJXC 1J0ZA 1OFEA 2OX4A 1TJPA 1OX4B 2NWRA 1NY1A 3A9BA 3CL6A 3WD3A 4Y90A 3CZEA 2DZUA 3WJXA 3VIKA 4HMDA 1TYGA 4I5XA 1N8FA 2J75A 1F4AA 4O11A 1DXEA 3V35A 3ZWSA 3B8TA 2PDLA 1OFOA 3D47A 1GTEA 3FYPA 5C71A 3R6IA 1M41A 1AQ0A 1GVSA 3CIXA 3YPIA 3NDOA 2J7FA 3MCMA 2B7PA 3P60A 4DJDC 3STEA 1KXQA 3P2VA 3W7KA 4KFPA 3NL2A 3G22A 4Q4KA 5FF7A 1AQHA 3BW3A 2A21A 3E2SA 1PXGA 3QZAA 3UCCA 1MW2A 2XDFA 4PCPA 4BF9A 3GXFA 5A8MA 5REQA 4C6IA 1R3YA 1RP8A 1EBGA 2C15A