1JCJA

Observation of covalent intermediates in an enzyme mechanism at atomic resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
252
structure length
252
Chain Sequence
b'HMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYRIBOSE-PHOSPHATE ALDOLASE
molecule tags Lyase
source organism Escherichia coli
publication title Observation of covalent intermediates in an enzyme mechanism at atomic resolution.
pubmed doi rcsb
total genus 100
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcjA00
2B7QA 4TMBA 5AN7A 4GXMA 4M7TA 4NNBA 4U4MA 3DHDA 3FOKA 3HBLA 3CT7A 1W3TA 3NQAA 1L6SA 3L66A 2A6LA 4A29A 3NO5A 2QR6A 5CPOA 2V82A 4MZYA 2PC4A 1ICPA 2QCCA 2YFNA 1UASA 4UR8A 3LTYA 2GVGA 1S3HA 1RR2A 3W7EA 2DU2A 1AW1A 4O13A 3MYOA 1NAL1 3S1VA 4BF9A 2C15A 2B7NA 4L4LA 1YYAA 3SSJA 2A0NA 3P80A 1X8FA 1XKYA 4QJ1A 1KTNA 1NEYA 3BVJA 1IXQA 5D30A 4BI7A 4ONVA 4X9SA 4M7SA 4PL1A 4CQAA 2TSYA 2RHGA 3IEBA 4AMAA 2Y85A 2Y6ZA 4FX7A 4KFPA 4IOTA 3W7IA 3LTSA 3WK1A 3P82A 4JEQA 1YXCA 1WYIA 2V2HA 2H6RA 4CNPA 3GDLA 1UBSA 1X1ZA 1XC4A 2V30A 3KVLA 4PFMA 4UTWC 3CIXA 2NUWA 3NPXA 2CZEA 1OF8A 4UFJA 3L0NA 1E51A 4WY0B 1QOPA 4O28A 2Z6IA 4ADSA 3EX2A 3B03A 3W1MA 1XDLA 4IJBA 4O50A 4HNTA 3LHVA 1OFOA 1TPB1 2VFEA 4K8HA 4KFOA 3LM7A 1B57A 1VHCA 3TAKA 2ZZ2A 4ZQRA 1KM5A 4LU0A 5CZJA 1JUKA 2E5BA 3LRMA 1K7XA 1EB3A 3GNDA 2CZDA 4FHAA 1D3HA 1VR6A 2QEZA 2ZZ6A 2JGQA 4K7YA 2AAMA 5D09A 3NL2A 1BEUA 3MI6A 4IWWA 5D32A 1SW3A 2J9XA 4CLMA 4ICNA 4MIMA 5L9FA 3G8EA 1PS9A 4LVDA 3KX6A 4RX0A 1TPEA 1WOBA 3WK0A 4NZFA 4NJHA 4LVBA 5C5YA 3GZ3A 3IVUA 4JTTA 3M0ZA 1QDSA 2C1HA 2QCLA 3B0PA 4BI6A 1ALDA 2CLOA 4MYAA 1ZJIA 1TYGA 2J6XA 1KM0A 3T55A 3QC3A 3UY8A 3O05A 1TTJA 2ATMA 2QUVA 4MLJA 3GK0A 3P81A 1ME8A 3FIGA 1VYRA 4U28A 4X2RA 3BGJA 1GYLA 3FEMA 3LCGA 1XDMA 4IGHA 5LZLA 1S5VA 4JX5A 4S2CA 3GDKA 2ABAA 5K4XA 5K9CA 5LGZA 1FQ0A 3IIXA 2RDTA 3LXAA 1ZFJA 3U6WA 3LBMA 4Y9AA 1TB3A 3L65A 1LM1A 4RLIA 4D2JA 3NZRA 2J88A 1DQXA 1PE1A 5AHLA 5L6UA 1GVOA 3W1UA 1ZAHA 1W37A 3TU9A 1KFEA 3B8DA 3ABRA 3DFQA 1QO2A 2ISWA 4GUFA 3IIZA 3QYQA 4AHQA 2DZWA 4IMGA 5HULA 3BGGA 3GYEA 3S8HA 1YDVA 3NPWA 4TR9A 5KZEA 2QJHA 3S42A 1G4SA 3L67A 5U4NA 2ZCGA 1XUUA 4NX0A 5HQEA 3TIMA 4WZHA 3HGRA 3ZWTA 2DZVA 3G0SA 2TYSA 3M5ZA 3VCRA 3W7QA 4QSHA 1TSIA 4JX4A 4FX6M 4QISA 1YLVA 4DF2A 3IGSA 3LB0A 3SGUA 4HNNA 2GPTA 1TPDA 3STGA 3UZ5A 3OVQA 1L6WA 2DP3A 3LI1A 1O94A 4ZMGA 2Y88A 4DF1A 3EWWA 3CLMA 3RMJA 3A9IA 5C6MA 3O8AA 3NQVA 3INPA 1N55A 4GNJA 1KW1A 4P61A 2VXNA 2W6RA 4XWUA 1JCLA 3DFSA 4HHPA 3EX4A 1I2PA 3LCWA 5K4ZA 4NQ1A 5DY2A 3TSBA 1QPQA 3QM3A 2I14A 4FB7A 5D2YA 2HMCA 3TCEA 4IX0A 1FX6A 3U2OA 3DI1A 1K7EA 1FCQA 1AW2A 4LNYA 1DORA 4I7UA 4LVAA 2ALDA 5CSSA 2VFDA 4AAJA 5AB3A 4LUIA 3TXVA 1SFJA 1C29A 3MMTA 3NQ6A 2XFWA 4EVZA 4QITA 3TFCA 3NL5A 4UFLA 4Y8FA 3IIVA 1YDNA 2WO5A 3R8RA 5HR6A 3MI2A 1VGAA 1GOXA 1JQVA 3CEPA 3GAYA 2P10A 4MZ8A 2YW3A 4JTKA 5FEXA 4ZQCA 2A7NA 3DHFA 3W7MA 2Y70A 4FNTA 1WV2A 2JK2A 3GVGA 3W70A 2FLIA 3CEUA 3G1DA 3MI3A 2Z6JA 3LV5A 4NXSA 3WK3A 1RZMA 1M7PA 3LHUA 1SO4A 1DVJA 3CM4A 3M5XA 3UWWA 4WJEA 1XM3A 3VKJA 1KV5A 5CZSA 4Z1CA 4A3UA 1OG0A 4ZVJA 2V8ZA 5DCDA 4UTKA 2NX1A 3MW7A 3QW3A 2E09A 2QAPA 2YXGA 3OVPA 4UIOA 2E68A 1O60A 3PAJA 2DORA 2YX0A 1XBYA 1KFBA 3G24A 1PCWA 3TE9A 3F4WA 1QFEA 5K9DA 3LDVA 4PL2A 2CLLA 1K03A 3KVJA 1ME7A 4LC6A 1KBJA 1GJPA 3G3MA 1WA3A 3NYZA 1AK5A 3KVMA 3M44A 1UCWA 1VJIA 5EYWA 4Q4KA 3OVRA 2V5BA 4JYDA 1R30A 3N34A 4NJIA 4IMEA 4XQ6A 3GDMA 1F2JA 3KFTA 1HL2A 2AQWA 5AC8A 1M5WA 4UUIA 3TNOA 3DFTA 4MUZA 1FWNA 3VNDA 1R46A 1L6YA 2CU0A 1O5KA 4XBKA 2DZSA 4IUOA 1F6PA 1A50A 2RH9A 2Y63A 2FFCA 3BLFA 1F73A 3VE9A 1QO5A 3HB9A 3T4CA 3M16A 1WBHA 3R5EA 4OV4A 1DQWA 3GXPA 1OF6A 2VC6A 1ME9A 4JIPA 4YCPA 3P7YA 2RFGA 2CLEA 4Y6GA 4W9TA 1KFJA 4BWLA 5F2GA 4LRTA 4JTEA 4MY9A 3FJ6A 4LRSA 4O14A 3EXRA 2QCHA 2VEIA 3G1FA 4AB4A 5G2HA 2GOUA 1XFBA 3CTLA 1AW5A 1TJRA 2WKJA 1LDCA 4KKXA 5H91A 6TIMA 3V75A 3GNNA 4AXKA 1G69A 3HQ1A 2IQTA 3BLEA 4UTTA 1WAUA 4RXFA 1JUBA 3DFOA 4LS0A 5HJLA 5AHIA 2HTMA 1FWRA 5AHEA 3DI0A 2A7RA 2Q8LA 2E1DA 3B05A 4IPIA 1NSJA 5K3VA 4TMCA 3G18A 3PB2A 5HINA 4XKYB 3LCXA 4WD0A 3NL6A 3R13A 4P2VA 3E96A 5AC6A 3SI9A 5D33A 2RKXA 1LZOA 1AMKA 3TA6A 2ABBA 1PHWA 1QMLA 4FNPA 4RKAA 4MY8A 1OJXA 1WBJA 1JULA 4O8RA 1T8XA 3P8IA 4Q32A 4DPPA 3G3DA 5HWMA 1SSDA 1TJPA 3B06A 3HMJG 2YR1A 5AC7A 3E02A 1TV7A 3A5VA 1W54A 4K37A 5LHEA 2QAFA 2ZZ1A 2BX7A 2JBMA 2Q3RA 1P0NA 1QR7A 1H51A 1SZNA 1KTCA 3LERA 3T78A 1JCNA 1OX5A 1VYSX 1DHPA 3LXCA 2CLHA 3B4UA 2A2IA 1P5BA 3HPZA 1PHQA 2BZNA 1RV8A 5LNSA 4IXHA 5TBOA 2YZRA 3QPYA 1C9DA 3HJZA 3G8RA 3I7RA 3EX3A 2NV1A 2PRHA 3LCHA 3WJWA 1KM3A 4RXGA 1GYNA 2G5WA 1EA0A 2WNQA 4TX9A 4E38A 5KTLA 1LOLA 3SR7A 2CWNA 1YPFA 4XBSA 1VCVA 3LCLA 2QCGA 1R2RA 3TR2A 3PSWA 2Q8ZA 2OX1A 2NWSA 3DKJA 1XUZA 2TRSA 3BLIA 3W2JA 4ZQOA 3HGSA 5BNKA 3QQ1A 5K2ZA 2WQPA 1TV8A 2BTMA 1TV5A 1W5OA 3W1QA 1PCKA 3EWBX 1IIHA 1QOQA 3M47A 1ZAJA 4O4VA 3EWUA 3KRUA 1RPXA 3C2EA 5BRBA 1H61A 3S1UA 3I7SA 3BPWA 1GG0A 3TFXA 3C52A 5LNRA 1KFCA 1Y0EA 4L4MA 4AHPA 4XUGA 4ZQPA 5A8GA 1TTPA 3NM1A 3W1NA 4C1LA 1JRBA 2V9DA 4R34A 4N6FA 3UWYA 5AYYA 2F7FA 1ZHAA 4O1BA 4IX2A 5EKYA 5G1YA 4PTNA 2ZRXA 2Y61A 4UTIA 2A1YA 2DZTA 2E6AA 3W2UA 3UD6A 3NXFA 3M43A 1VLWA 3P84A 4PH6A 4UMAA 1QNVA 1F6KA 3N9RA 3EWZA 3NL3A 4BWLC 2CLMA 1TTIA 4DPQA 5FESA 3BK0A 4GBUA 4CCEA 1EWEA 1KLZA 4O0ZA 1H7OA 1K02A 2WSYA 1XI3A 2CZ5A 4UTWA 3TAOA 4IMFA 4MJMA 4MKNA 3PBYA 5KSWA 3I6RA 3Q94A 4UCGA 4BR1A 1TPWA 4LWWA 1QCWA 2NV2A 3SFKA 3W7GA 4JTGA 4PC8A 3TUUA 4KWVA 2YPIA 5ABTA 2XN0A 3FKRA 2Q3OA 3TDFA 8TIMA 1WXJA 2NUXA 1G7UA 4Z1BA 4AH7A 1LBMA 3W84A 5SWUA 5FEPA 4WQ6A 4IXXA 2H90A 5AFDA 3W23A 2Z0IA 3BW3A 4LS1A 1FUYA 2YDAA 1CW2A 1ONRA 3E49A 2FB3A 5IM51 3NPUA 2V81A 4TIMA 1A53A 3L9CA 1F7BA 4FO4A 4UTJA 1SW0A 2GVLA 5D37A 3IVTA 4BI5A 1NFBA 4HPJA 1SO3A 1UB3A 1YADA 5C55A 1GEQA 3Q58A 3EWYA 1JR1A 5FI8A 2VEPA 1D3GA 3W1AA 1SU5A 4WXYA 1HO4A 4O53A 3W1XA 1Z44A 3CHVA 1OHLA 3W7CA 3MBFA 3WJZA 3PY2A 4H6KA 1ZENA 5DXYA 3ZWSA 2E6YA 1WOAA 5F1VA 2H3DA 1Z48A 1XBXA 2QDHA 4JTIA 3GLCA 2YYTA 1VHNA 5FF3A 2OZ0A 2TMDA 1K7FA 2PE4A 3O06A 4RR4A 4CNNA 3H53A 3WK2A 1HTIA 4POCA 1L9WA 2X2GA 2FQIA 3ZS4A 3M41A 1KTBA 4UFMA 2QKFA 2CFFA 3NGJA 4YLWA 2E77A 3NQFA 3UYCA 3PR2A 3GB6A 4ALDA 2PURA 1PVNA 3NAVA 3W9ZA 1W3NA 5FF4A 4E2BA 1G4EA 3EXSA 2EF9A 1FDJA 3W73A 4GJ1A 5E93A 2P1FA 3BW4A 4NVTA 3FFSA 5AYZA 2ZRVA 3BV4A 3SJ3A 2FPVA 4MFEA 3C2RA 3GDTA 5K9XA 3TQVA 1TQJA 1K8YA 3KXQA 1DV7A 1TCDA 4GFSA 5LHFA 3P5YA 2ZTKA 2VFIA 2I1OA 2X1UA 1VPXA 4O52A 3FYOA 4DO4A 4HKPA 4FNUA 2ZQ0A 1PL9A 3W7NA 3L0KA 3W83A 4ADUA 1H1YA 3UZJA 3GR8A 4O16A 4OQVA 3HG2A 4EWND 5CSRA 3L0GA 1Q3NA 4O10A 2VEMA 1FDYA 1OFRA 4O19A 3ZFHA 4XKYA 1BKSA 1VH7A 3FJLA 2X30A 1MEWA 2ATSA 4H3DA 1NF7A 1HO1A 1VCFA 1EUAA 2GQ8A 3UPWA 3UWQA 2X1RA 1KM1A 3W07A 2JGYA 3TC7A 3PBVA 3GXNA 3GKAA 3O6DA 3PC0A 2C3ZA 3UQNA 1XL9A 3W88A 4UTUA 3FA5A 3ATYA 4NNAA 3H54A 3S5ZA 3EX6A 4JYEA 4ZQMA 4Z0JA 3W2LA 3A24A 5HWNA 3PSVA 1FWWA 3DAQA 1VC4A 5FF0A 4DO6A 3O6YX 3L5LA 3STCA 2WV8A 4K36A 2ZDRA 1BWKA 1W1ZA 4OGZA 4UMCA 2QJIA 4JN6A 5FEZA 2XN2A 1OFAA 3W7RA 3LCFA 3P61A 3PBWA 1EP3A 5I3KA 3A22A 4WY0A 3GR7A 2JKEA 1OX4A 1ZCOA 3BG5A 3P8JA 3TSMA 5MHBA 3QH2A 3W7LA 4O4WA 3BO9A 5EY5A 2ZZ7A 1G4PA 3FLUA 1GQNA 3I65A 3D0CA 4O57A 5F4SA 3RLVA 3PUOA 3STEA 4AWTA 1X6UA 3OG3A 1SZGA 1J5TA 2H3BA 3MHUA 4FXSA 2QJGA 1SZEA 2NX3A 4HNUA 2J27A 5CPNA 6ALDA 5D2TA 1KA9F 4TO8A 3L21A 3MHFA 4JTSA 4LVGA 1JCYA 3KAOA 4J9JA 3L5MA 5H2ZA 2YW4A 2VEKA 3M7WA 1H63A 3HG3A 1OYBA 2Z2UA 1WQ5A 3W1RA 1QWGA 4EOUA 1H7NA 3DH7A 4O11A 1GVFA 3R89A 2G97A 3F4NA 4N9CA 3MWAA 5F1UA 4M19A 3RNDA 3HPSA 2CLKA 1Z41A 4M5PA 1K8ZA 2VENA 2V5LA 1Q6RA 2DZXA 1IF2A 3EWXA 3LCIA 3NA8A 4FNQA 3HG5A 1VCGA 3B0VC 2R8WA 3SGZA 5I3IA 3W7DA 2E6FA 3LHZA 4X22A 1OVDA 5KZDA 1FXQA 5G2WA 3LTPA 3TMLA 2FB2A 1B9BA 3PWAA 5BW6A 2W0UA 4NXKA 4PA8A 2QF7A 3PULA 2C0AA 2HSAA 2QCNA 1SR9A 4QNWA 2HS6A 3P74A 3BARA 1LORA 4Z0SA 4O54A 2FJKA 4NNCA 1YTDA 1IXOA 1KM4A 1M7OA 4JR5A 3P67A 4K38A 4WY0F 4I7VA 3G1XA 3WJYA 1MZHA 4K7VA 3NQEA 4Z1DA 4NUWA 1OABA 1Q6OA 1TPVA 5KMYA 2VKZG 3LI0A 4C1KA 3P5ZA 5HNRA 1I45A 1I2OA 3O63A 5G4EA 1KV8A 4DBEA 2GJNA 3DXIA 3IRDA 4HIBA 3EEGA 3BG3A 4OV9A 2GQAA 4DELA 1MSSA 3S9YA 2H8XA 3B04A 2BXVA 4E0CA 3W1LA 2EHHA 1TPFA 1XCFA 4DO5A 3UXAA 3O1NA 3G1VA 4N6EA 3N3MA 2NXIA 2FDSA 2PRMA 4IMDA 2BLEA 1KFLA 3MBDA 4UXDA 1W31A 1OK6A 2GQ9A 4HT3A 4E2DA 2ZRYA 3KHJA 1RQEA 4EF8A 3V1PA 4M6QA 3W7OA 3DENA 3MO7A 1TMHA 3DZ1A 1SQ7A 3LXBA 2ZA2A 4UTTC 2Z1BA 5CPLA 2WNZA 5LNUA 4GUIA 1UUOA 2B7PA 1TREA 5EL1A 3M5VA 3NQCA 3OHIA 1BTMA 1GZGA 4O17A 4ORMA 4MVAA 1W56A 4X3ZA 3QZEA 3O6CA 5G2IA 5CGQA 4O0KA 4NJKA 1Z42A 4LV9A 4I7WA 4AHOA 2A6NA 1VS1A 3CB8A 5EMUA 1AL7A 2J9ZA 3LBCA 3N73A 3NQ7A 1TPUA 1FCVA 2NZLA 2RDUA 4UFKA 4XTIA 2KZHA 3OEXA 4NX5A 4WX2A 1F05A 5I3HA 3EB2A 3QW4B 4ORIA 5BMWA 3KVKA 4JTHA 3MP4A 5U7SA 1W0MA 3RFAA 5D02A 4IMCA 4LUJA 3HOJA 3W7JA 4PODA 3W74A 1K8XA 1JRCA 5F2IA 2EAWA 4MY1A 4QNEA 3DKLA 1EP1A 3LV6A 5CPMA 1MO0A 1A5AA 1PIIA 4OU1A 4O1CA 3P62A 3NQGA 2ISSA 1FDZA 1TRIA 4JX6A 3TH6A 1ZNNA 5EBUA 2C6QA 2Y7GA 4OHQA 4M6PA 3RK8A 1OX6A 3DFNA 3T44A 3HGJA 3K30A 1H7XA 1FCBA 3THAA 3BG9A 1LP6A 1ZY9A 1U5JA 3C8FA 5DCBA 2DZPA 5G4WA 4O1AA 3QQ0A 4NU7A 5FEWA 4GUHA 2V2CA 2NUYA 1GVRA 3GX9A 3JR2A 3G1YA 4MJZA 5BMXA 1B4EA 3O15A 4PCFA 3TW7A 1N7KA 2DJLA 3L68A 5TIMA 3S5NA 5GVJA 4A21A 4HNVA 2VFFA 4Y96A 5D38A 3TQ0A 3ANYA 2G95A 4MZ1A 4HN4A 1A5CA 3M9YA 3SIZA 2OMAA 4LS2A 4QQ3A 1MEHA 5I3FA 2CLIA 3IIOA 5D2VA 3GAKA 5F4XA 1WX0A 1TTQA 2HS8A 3ELFA 1I8JA 4JTUA 4FIQA 5FF2A 3TQKA 5J5RA 4DBDA 3S5OA 3SECA 4BFAA 2P0OA 3A23A 3AO0A 1ZAIA 2X1TA 1S5WA 3N14A 1HUVA 5LKYA 3WJSA 2DJXA 1RD5A 1SW7A 2C18A 3HG4A 1X1OA 3UWVA 3T40A 2C13A 4UTLA 1Q6QA 3UWZA 1Q45A 3IGUA 3NPVA 2ZA3A 3MJYA 2ZZ5A 4DXVA 3I7QA 2B4GA 2WPBA 3SW6A 1YXDA 3G1SA 3CPRA 5LNWA 4MLRA 2OJPA 4LC8A 1G6CA 5CZ0A 3U8GA 3PUEA 5FF7A 4ZZ9A 3LRKA 2W79A 1KM6A 2F84A 1EUNA 1FBAA 4N2YA 4HSNA 4JICA 1A5BA 2J9YA 1TQXA 3C2FA 4FF7A 3W2KA 3QRHA 1KFKA 5E0KA 3QFEA 5AHNA 3LGEA 4AF0A 3O16A 3WFAA 4WUIA 5AOUA 3TK7A 3TKFA 4RV8A 4HPXA 4Q33A 1TPC1 3G1HA 4GUGA 3NR0A 2Y62A 1BWLA 4TU1A 4AWUA 1IXPA 1B4KA 1OX4B 5KINA 1I2RA 3CWOX 4A2SA 3LHWA 4QAIA 3FKKA 3KRSA 1JVNA 2QDGA 5DXXA 2A85A 5AHFA 1RQHA 1LCOA 2Y7DA 1H62A 2OT0A 3CWNA 4XTDA 4LTSA 2CZFA 4O18A 4DEFA 3VFLA 4NJGA 5EA9A 4S1FA 4MOZA 3QSRA 1G7VA 2BWGA 1DKWA 3DGRA 4JTLA 2WSRA 3FS2A 4GE8A 1XBVA 3W3OA 3N2XA 3C6CA 2NXHA 4QIUA 3NZ1A 3L5AA 3S0CA 1VQTA 2ZA1A 3VI2A 3G0XA 5A5WA 1JJKA 2ZFAA 3TW6A 2O7SA 3HO8A 3W2MA 4AEOA 3E12A 5F2LA 2A7PA 4JTFA 4OBTA 4B5NA 4YXGA 2NLIA 4OWGA 2C19A 4O1DA 1NF0A 3QPZA 3S5YA 1GT8A 3NQMA 2E6DA 1U83A 1QPRA 3W76A 4JYFA 4LVFA 2CW6A 4Y90A 5IBXA 1HG3A 4O12A 3QSTA 4JDYA 4ML9A 1GTHA 1GPWA 4YWIA 4AVFA 5J5DA 4K39A 5D2WA 5LGXA 3CC1A 1H1ZA 4MYXA 5E1QA 1AL8A 3UPBA 5HMSA 2EGZA 4UTHA 4JGDA 1JCJA 1NVMA 3S1WA 4UR7A 3QMRA 1LBFA 1C8VA 1OYCA 1I2QA 3IGXA 1DJNA 1VRDA 2A5HA 3C3NA 1LRTA 3ABOA 4FNSA 3G0UA 3HIJA 2NXGA 3W7KA 4BK9A 1YPIA 2X16A 4N9DA 1O95A 2R94A 4N02A 1R47A 4RZ4A 2NWRA 1YXYA 1LOSA 3DFPA 4N9EA 5F2MA 2QUUA 4RZ5A 3RF9A 3CU2A 1XBZA 5CKSA 1R2TA 1H60A 1T96A 1LLZA 3C2VA 4A2RA 1OFPA 2OCZA 4GRSA 4UMBA 2VOMA 3KRZA 3I68A 3PG9A 3EKZA 1FCUA 4LV4A 4JD4A 1FWTA 3HGOA 5KZMA 2XN1A 1P4CA 1SPQA 4UNLA 1V7YA 1H7RA 2EKCA 5DY3A 2WSQA 2R91A 1ICSA 1EWDA 1WDWA 2E5CA 3KOFA 3UY7A 3PG8A 1EIXA 3W87A 4FNRA 3E0IA 4R33A 2C14A 1ZALA 2JKPA 3QJAA 5BOOA 3RLUA 3W6YA 3W1PA 4JIQA 1LTDA 5F4WA 4K8EA 2O7QA 2CLFA 4CCDA 2EPHA 2WJZA 4FXRA 2WOQA 4N4QA 2PRLA 4UFIA 5D03A 3B0UX 3W71A 4YL2A 5C54A 1W5PA 3NQDA 3USBA 1LLWA 4CCCA 1ADOA 3UWUA 1I2NA 3LOTA 1SUXA 3GKFA 1JQXA 3JRKA 4IPJA 1W5NA 4RJEA 1IGSA 3W7HA 4MPQA 3IV3A 3F1QA 3G22A 5C2XA 1N8FA 3CQ0A 3Q2DA 3W1TA 3DU0A 3N2MA 5T26A 2ZRZA 3MUXA 3NEVA 1J2WA 1J4EA 2ZRUA 3ATZA 1SO5A 3ZR4A 1F5ZA 3ABQA 1H7PA 2VELA 5G1TA 3UXDA 4DF0A 1MEIA 3LLFA 4G1KA 3BW2A 4QM1A 1T99A 4MFDA 3TJXA 5I3GA 2YSWA 1OFBA 3NQ8A 5DBUA 1FY6A 3DBPA 4LW7A 3PS7A 1P1XA 3W72A 3N9SA 1GVSA 3MHGA 1KBIA 3SY5A 1FWSA 1ML1A 1B3OA 3LHYA 2LLEA 3R12A 5K7JA 4M6VA 2A4AA 2NX9A 2Y7FA 5DBTA 2B7OA 3NDOA 2OT1A 3TX9A 4LT9A 1M6JA 2X1SA 2R14A 4JY9A 3TV8A 3LRLA 3W22A 3C2OA 2D73A 4YCOA 3W85A 1HFBA 1W5QA 5DLCA 1LOQA 4OE7A 1EPXA 1R2SA 4UC5A 4JXCA 1PV8A 4Z08A 4GC4A 2YYUA 5HR7A 1H50A 3MP3A 3IVSA 3NOEA 4IQLA 3AJXA 2V2DA 4KFNA 3TXZA 3A21A 2VFGA 3OA3A 3TROA 5CZTA 3W7PA 1H5YA 2GUUA 1LRQA 3HF3A 1I4NA 2FPTA 4ADTA 3TC6A 3M6YA 1V5XA 1EEPA 3QEZA 1SO6A 1O4UA 1FXPA 4R7JA 4NZJA 4PEKA 4RCXA 3PM6A 1KLYA 1IIGA 1GVQA 3NG3A 4GWEA 3VE7A 4CNOA 3IIPA 1THFD 3LHTA 4WOQA 5CG7A 1G4TA 1OK4A 3STFA 3PVFA 5AYXA 2AGKA 3WJXA 5DELA 1EX5A 1ICQA 3SZ8A 1SSGA 3TJLA 1QAPA 4H4IA 3LX9A 4RZ6A 1JCXA 4HSOA 3QF0A 1F74A 2G96A 3EKLA 3PUDA 3E9AA 4O15A 3M5YA 3M1ZA 7TIMA 2JKAA 4NJJA 3CIWA 2ZZ3A 1W8SA 3R2GA 4XZ9A 2QUTA 4UFHA 2QCDA 3H55A 2ZBTA 4N9BA 3NQ2A 5AHMA 1YTKA 5D04C 4OT7A 4YMZA 1CI1A 1AG1O 3S1XA 3T7VA 1L2UA 4CQ8A 2Y89A 1YDOA 2QCDB 1GG1A 3THQA 1SFLA 3S6DA 4WOZA 1XXXA 2C16A 1SZFA 3HPXA 4UTMA 3MP5A 4GUJA 3TMQA 4FX8A 4EF9A 3N19B 2YGYA 5LSMA 3LLDA 4N4PA 3NVTA 1UUMA 2BSLA 4I9AA 1S5TA 3UNDA 2V0TA 1G67A 3RU6A 5HWJA 2FPYA 2WNNA 1F76A 3C0JA 3EXTA 2I9EA 4JNMA 2Y7EA 5G5IA 1A5SA 3PB0A 3L2IA 3W86A 2YCEA 3YPIA 1P0KA 3C4UA 1TIMA 2E5DA 2QCFA 2ZZ4A 4EIVA 1DL3A 4LOCA 3OBKA 1UJPA 5EPDA 1OYAA 1X7FA 1JUEA 3PBUA 4S2BA 1IXNA 1CX9A 1W5MA 3A5FA 4R53A 1H7WA 4AF0B 1VYPX 5HUOA 3W75A 3MYPA 1DBTA 2FTPA 2PCQA 2ZTJA 3W2NA 5LNVA 3O07A 5KITA 1W3IA 4ZL1A 2QCEA 2TPSA 1LYXA 5D05A 4DQWA 1Q6LA 1EP2A 4RK8A 1O5XA 3ABSA 3P60A 1KM2A 1OFEA 1TRDA 1LRNA 4KWWA 1YTEA 1QPNA 2UV8G 5HUPA 1LBLA 2YFOA 5IBXC 2H8ZA 4FIRA 2QCMA 2FIQA 4Z1AA 4JS3A 4JDBA 3GDRA 2DZUA 1GTEA 1RQBA 2GVJA 5I3JA 1TO3A 2B0MA 2J24A 3NNTA 3G1AA 1K3UA 4A22A 1VLIA 4UNKA 1OFQA 1JCMP 1DOSA 4LY8A 2ISVA 3QMTA 1QPOA 1LROA 3TSDA 5DN1A 4CQ9A 1TPH1 4NT0A 4AWSA 2ZRWA 2ZYFA 4FEZA 3GXTA 2RDWA 2A21A 1DJQA 3QMSA 5TQLA 3OIXA 3Q37A 5DCEA 2VFHA 4JY8A 4K6AA 1GWJA 1OFDA 4WXZA 1D9EA 3C56A 3FYPA 3JS3A 3GIYA 1VZWA 3NM3A 3PF3A 1T0OA 3C61A 5D2XA 1MXSA 4JTJA 3EX1A 1RVGA 3F03K 4ZQNA 2GJLA
chains in the Genus database with same CATH superfamily
2B7QA 3FDGA 4GXMA 4G7FA 3KM8A 1UR1A 4IMAA 1W3TA 5BOEA 3U2EA 2Y8UA 4Q7BA 4NF7A 1VFMA 3ARQA 3CZKA 3QV9A 4HU8A 1EO7A 1XSJA 3NCOA 4G7EA 3IUDA 4MNKA 4MZYA 2PC4A 1ICPA 2YFNA 4UR8A 1EEXA 3LTYA 3R0KA 1M41A 2AKMA 1AW1A 4O13A 1OC6A 2C15A 2A0NA 5DX7A 1X8FA 1DWHM 2BXZA 3KBWA 1BGAA 3BVJA 4GYPA 4ONVA 4PL1A 4ICCX 3WBWA 4A8LA 2TSYA 2GGIA 3SN1A 1X7IA 3H70A 3WNKA 2Y6ZA 4TV5A 5I5RA 4KFPA 1PZ1A 2DGAA 3P82A 1VB9A 1XC4A 2WBGA 3WDHA 4UTWC 2CZEA 2OVLA 1QK0A 2EJ1A 3BC9A 4IIFA 2WJDA 5XIMA 2C8NA 3EWCA 8RUCA 1FKXA 3B03A 2ZX5A 4WDWA 4IJBA 4AISA 3G1RA 4YNGA 1TPB1 3B9OA 3VA8A 2VT0A 2VQUA 3LM7A 1B57A 4L4PA 3RAOA 1IEIA 1KM5A 5CZJA 1JUKA 4PZVA 2QJJA 1EB3A 3GNDA 1XSIA 3ITVA 1XLHA 5CSYA 2ZZ6A 5D09A 3HTWA 4M56A 2DPEA 4F0LA 1OGGA 1SW3A 2J9XA 4ICNA 4MIMA 1PS9A 3KX6A 1TWDA 3WK0A 2PA6A 2VNCA 3RO6A 2G8ZA 5LIXX 4NJHA 4LVBA 4KS0A 3WQ6A 3M0ZA 3B0PA 4BI6A 2YA0A 2HQAA 1TYGA 2RJGA 3R0DA 3QC3A 4TVCA 3FK4A 4A3RA 1LL7A 3P81A 2I5IA 2V38A 3LU2A 4UBPC 2VC9A 3SO7A 1L2QA 3A47A 1EX1A 4ZOAA 3LCGA 3QZ6A 4IGHA 2D2GA 4JX5A 4S2CA 3KBVA 4JQ1A 3B9NA 5CJ5A 5LGZA 3PTKA 4ZB2A 2RDTA 4G6CA 3LXAA 1ZFJA 3R0UA 3ZSTA 1FFQA 4Y9AA 1LM1A 4RLIA 3SAZA 1UH2A 4D2JA 3P0XA 5AHLA 3GUGA 3U4AA 2FZMA 7REQB 3W26A 3WQ4A 5I09A 1V3MA 1ZAHA 2PI6A 1XQLA 1IEVA 2HPMA 3B8DA 4IP5A 4WGXA 2JIWA 4E5TA 5H8MA 2XDFA 3QYQA 1N82A 2E67A 4V28A 1KBKA 3GYEA 1L8NA 5A8PA 2BP1A 2QJHA 3WD3A 4H9VA 4JTRA 3H4GA 4NX0A 3L4YA 2G41A 2WC4A 3GXFA 2QPSA 3G0SA 3M5ZA 3VCRA 3CL6A 1TCMA 1J0HA 4JX4A 4QISA 4I90A 1GKPA 4US6A 1G5AA 3TYAA 3BLLA 3UZ5A 2BVDA 3RITA 4HK6A 1L6WA 2DP3A 1A47A 4DF1A 2GJXB 1QI0A 3A9IA 5DEZA 2QGYA 4P61A 1VKFA 2VXNA 2QHAA 2W6RA 2R1MA 1PKYA 2A3LA 1WUFA 4YTRA 2Z25A 4RNJA 4D1JA 3WD4A 3EX4A 3QM3A 4FB7A 4ES4A 1HKWA 2HMCA 4IX0A 1FX6A 3U2OA 3CL7A 1VIWA 1FH9A 1AW2A 1OZMA 4LNYA 3STPA 4I7UA 4JIIX 3WD1A 1RK5A 2ALDA 3BGAA 1JF5A 4E8DA 5AB3A 4O8AA 3TXVA 3NQ6A 3HJEA 4GD0A 3TFCA 5A94A 4PBGA 3U5UA 1MQPA 1E0TA 1F6YA 2BFGA 4GFIA 1BHGA 4KWUA 5AY7A 1HKMA 3IRSA 7XIMA 1GOXA 3CEPA 3GAYA 1PEZA 2YW3A 4JTKA 4ZQCA 2A7NA 1CNVA 1IE7C 2Y70A 3GVGA 1EJXC 4NXSA 5HBFA 3BJFA 3BCDA 3LHUA 4I3GA 1DVJA 1CGXA 1H11A 1XM3A 1KV5A 5CZSA 1EJVC 7TAAA 1B2YA 3EGJA 3CZLA 1L8PA 5DCDA 1OIFA 2NX1A 3MW7A 1MRQA 4HA0A 2IS7A 2QAPA 3ARRA 4MUPA 2YXGA 4W7WA 4Z1YA 3FHQA 3BMVA 1DXFA 1EDGA 2NQZA 3GXMA 3MCNA 4IPLA 6XIMA 1XLEA 2PDHA 2DORA 2Z2BA 3B3DA 4JHZA 1RPKA 3F4WA 4KGLA 2EEXA 4PL2A 2WZEA 2V6AA 3ZVIA 2VZSA 3GHSA 1XYBA 1WA3A 3NYZA 4HZMA 3KVMA 3M44A 4MDOA 5EYWA 3OVRA 3N34A 2IKJA 4US5D 4IMEA 1R85A 1VFTA 2BG5A 1HL2A 2DV0A 1MI3A 2NLYA 4PMDA 4HU3A 4G8TA 4MUZA 1E1CB 3FA3A 4PTWA 6PTDA 5DF0A 2D0GA 2RH9A 2AGTA 2FFCA 3OPSA 3BLFA 2Z1SA 1QO5A 4AC7C 1UR2A 2WQDA 2NT0A 1UMLA 1V77A 3EZ4A 4OV4A 1UC5A 3GXPA 3LY0A 4S39A 4ACYA 2RFGA 4W9TA 3ECQA 3KDNA 2YCIX 3EXRA 3FDKA 4IGNA 4W85A 2QCHA 2P0IA 2O9PA 1AW5A 3SRDA 2DT2A 2WKJA 1FFRA 1LDCA 2DIKA 3Q67A 1J0JA 3AIQA 1HN1A 1B3WA 4WKAA 3QY6A 2IQTA 3IK4A 3BLEA 1TX2A 4G9PA 1E6SM 1R87A 5CAKA 1Z7AA 5D8WA 1JUBA 3A4WA 5ABGA 4LS0A 5HJLA 1PX3A 3DI0A 2Q8LA 2E1DA 3B05A 5K3VA 3WF2A 1QRQA 4C6MA 2OSWA 4M29A 3R58A 2PDCA 5AC6A 1LZOA 1T8QA 2D69A 1GW1A 4FNPA 4RKAA 3NDYA 1QNPA 4GVHA 2WLZA 3KUMA 1SSDA 4NP7A 1TV7A 3RLGA 2QAFA 2ZZ1A 3URBA 2JBMA 2Q3RA 2WM1A 5BXRA 1N8IA 1AUSL 1QR7A 1H51A 3LERA 3TZNA 1JCNA 2DSZA 1CXIA 1DHPA 3HPZA 2BY1A 1V93A 1H3GA 2YZRA 3QPYA 1SFTA 3GYCA 2CBVA 3EX3A 1VBGA 2NV1A 2PU1A 2GWNA 3ICJA 3WJWA 2BB0A 2G5WA 5I24A 1RBOB 2XYLA 1PKMA 3BZJA 3CMFA 2CWNA 3FAWA 3N2TA 4XKMA 1EQCA 4Z2LA 3LCLA 3R7MA 3IJ7A 2WSPA 3PSWA 2ZUTA 2V63A 3W2JA 1U5VA 4S3DA 3RRAA 1HNYA 4H8VA 3ARPA 2BVTA 3QQ1A 5K2ZA 1V6TA 1TV8A 1UZHA 2BTMA 4C6IA 3GC5A 1ECEA 1QOQA 1RY8A 7PTDA 3KRUA 3C2EA 3W0KA 3S1UA 5CZKA 4CNTA 1C91A 3BPWA 3CZEA 1X1NA 4AHPA 4L4MA 1KRBC 5A8GA 3NM1A 1JRBA 1WXYA 2FTYA 1I0BA 2OOGA 4E2VA 1J79A 1QVBA 2E9MA 2JFEX 3N4FA 1F3XA 3EBVA 5EKYA 5G1YA 2ZRXA 2Y61A 4UTIA 5RUBA 2V5CA 2E6AA 3VX1A 3VD9A 2VGBA 3K4WA 3UJ2A 4DJEC 1C7SA 1DHKA 3BL3A 4DLMA 4IICA 4UMAA 3E5BA 3EAUA 1F6KA 1TTIA 4A3YA 2C0HA 4CCEA 4FR6A 3IAQA 2PLCA 3TAOA 6XIAA 4HK5A 4ROQA 5KSWA 1ITUA 3Q94A 4BR1A 5FJOA 3W27A 3W7GA 3SFKA 4AZBA 4HYWA 1R9ZA 4AIBA 2F6XA 1C9WA 4S3CA 4GY7A 3UNTA 3L4ZA 6ENLA 1TV2A 4FLQA 3B8VA 3C2YA 3MUIA 3BSHA 3M64A 4S23A 3BW3A 4LS1A 1UIOA 1FUYA 2G0WA 1RD6A 4GINA 2FB3A 3JZUA 4B4FA 5HMDA 3L23A 3CXOA 3WLLA 1BRLA 1V02E 4P7OA 1NFBA 1SO3A 1K4HA 3W1AA 5H8UA 2ZUWA 2HNEA 3CH9A 1AZ2A 2W63A 2F38A 4C6KA 3B9EA 3ZWSA 2I56A 3GHRA 3AYTA 1F3WA 1Z48A 2QDHA 2Z29A 2OZ0A 2TMDA 3O06A 4RR4A 3H53A 1XLCA 3WK2A 1I9CB 4PCTA 5CC7A 1L9WA 1QASA 3N9KA 2YL6A 3O0FA 4UFMA 4MPKA 1EJWC 2XH2A 3NGJA 4H9TA 3UYCA 4J3SA 4B3ZA 1PVNA 4YPJA 3W9ZA 4E2BA 1G4EA 1IEWA 5F7UA 1YNYA 1IWBA 4R85A 3H2MA 5BU9A 2REQB 3M7SA 1JD9A 1GYMA 4L56A 3TQVA 4GO9A 2JIEA 3GS6A 3WELA 1JPIA 1TCDA 5LHFA 4M24A 4R9XA 5I06A 4FNUA 1UD6A 1PX4A 4MWAA 3W83A 3UZJA 3BCFA 4O16A 1A0DA 4REQA 1OFRA 3ZFHA 4JFWA 5XINA 1PIGA 4EPEC 1UJQA 2ATSA 4TXEA 1SJAA 1EUAA 1W1TA 1UC4A 1XP3A 1KM1A 1X6LA 2JGYA 4AQLA 4DZIA 3GXNA 3E5PA 1SZRA 4IFKA 3O6DA 3APTA 3AHZA 2C3ZA 3GW3A 3GIQA 3ARVA 2XHYA 3JUGA 4UOJA 4XAPA 4Z0JA 3W2LA 2NQLA 4OVXA 4ZFCA 1FWWA 1VC4A 3KCOA 3O6YX 2WV8A 2CYGA 4K36A 5FIPA 1LL4A 5FA5A 2XGIA 4FI4A 1UOZA 5DMMA 3KOZA 5FEZA 1OFAA 3LCFA 3P61A 1EP3A 5I3KA 3A22A 5A8NA 1ZCOA 2CC0A 3P8JA 4UQEA 4O4WA 4C5YA 2ZZ7A 3H2NA 1G4PA 3GTIA 1UR9A 1GQNA 3FLUA 5ABFA 4O57A 3OGSA 1L6GA 2H3BA 1SZEA 3UZZA 3DDMA 3GY1A 1QNSA 2J27A 1NFPA 1KXQA 2CHRA 3GD6A 3HQPA 1PUDA 4TO8A 3OA5A 1PWLA 3L21A 3GVQA 4REQB 3CAQA 1QPKA 4GVGA 4J9JA 2VX5A 4QE1A 2GDVA 2Z24A 3QOMA 3T0DA 4IH3A 3JZEA 3ZJ8A 4R9OA 3MJMA 4AZGA 4O11A 2CKRA 5TNVA 2WZIA 3QOKA 4N9CA 2G97A 3ARSA 3IWPA 2GLKA 3QKEA 4L6DA 4M19A 5AVHA 2PDQA 2CBJA 3NEHA 2D2OA 4M5PA 3QXBA 2YOCA 1Q6RA 4GI4A 1IF2A 3ARZA 4HHHA 3WF3A 4LX4A 1E6RA 3NA8A 1VP5A 3UZWA 2PDNA 2NQ5A 3SGZA 5I3IA 2P3EA 5KZDA 3DHUA 3MANA 3A13A 1TR9A 4NXKA 1QNRA 3PULA 1GKQA 2HS6A 4GNKB 3P74A 3TONA 4H83A 4P5UA 4LUTA 1IXOA 1J96A 1M7OA 2PD9A 4WY0F 4L4OA 4I7VA 1IZCA 5CLWA 3G1XA 3SADA 1DWAM 4HU0A 3QY8A 4GMEA 3S2LA 2FZNA 3APGA 3O63A 1EYWA 1HJUA 1FKWA 1E5NA 2VD9A 3AYVA 4DBEA 1O66A 1Z32X 2ISDA 2HBXA 1K9EA 3EOSA 2XVGA 4HIBA 3EEGA 1MSSA 1QNOA 4DVOA 2BXVA 3QR3A 3URNA 3CQKA 4R88A 4DO5A 1MZRA 2NXIA 3GR4A 3TYDA 3ZR5A 2SFPA 1VEPA 4DWSD 1KFLA 3IJ6A 4DJDD 2DQWA 5HNTA 5C9XA 2GQ9A 4HT3A 1JFXA 3R8HA 3V1PA 1GZJA 4M6QA 3DENA 1TMHA 1V0MA 1XDJA 1BG4A 3BMXA 4UTTC 5CPLA 4J35A 1J11A 1UUOA 2X0YA 1EGZA 3AXXA 4HNOA 1BTMA 3DX5A 1DXIA 3LS9A 2NSOA 4EKJA 2PB1A 3SUSA 4AU0A 4YVPA 3M07A 4NJKA 2DSUA 4I7WA 1V4YA 4GQRA 2A6NA 3V3WA 1VS1A 3H6OA 1GUVA 2BASA 1AL7A 1KNWA 2WB5A 3THDA 4UFKA 4YN5A 4D6FA 4MF4A 1N8WA 5HATA 2KZHA 4NX5A 4DX3A 5I3HA 1HIZA 3UA4A 5BMWA 3MP4A 3V5OA 1W0MA 2NW0A 3PHAA 4C1NB 5F2IA 2EAWA 4XSLA 5JMUA 5D9MA 4FF5A 1PIIA 4OU1A 3I3DA 1TX0A 3TH6A 5EBUA 4BS0A 1Q6FA 3RJYA 2C6QA 2Y7GA 4M6PA 1GORA 3DFNA 1H7XA 1GHRA 3BG9A 4G1NA 1ZY9A 3EB4A 2HBVA 1U5JA 3AHTA 3C8FA 2DZPA 3OVGA 5FEWA 3KOYA 1GVRA 3GX9A 1E71M 2YL5A 3WMLA 4PCFA 1CDGA 1YNQA 3TTSA 3PTQA 4A21A 1LLOA 4HGXA 3VVGA 5LIUX 3GG1A 4Y96A 1I0DA 2OMAA 1AJZA 1MW1A 1MEHA 4QP0A 5D2VA 1DQUA 3NFUA 1HVQA 3VUSA 1WX0A 3OYZA 3VDCA 3S6TA 4OFCA 2HS8A 1YW1A 2PWDA 3IV8A 1YHTA 3T2QA 1GOMA 3TQKA 1NIUA 5J5RA 3GH5A 2Z1WA 3W25A 1OT1A 4DBDA 3S5OA 2PWVA 3SN4A 3VIOA 4EK7A 3SECA 4BFAA 3A23A 3AO0A 4OOZA 2X1TA 2XH0A 3WJSA 4ZO8A 1X1OA 1CB7B 3T40A 1UH3A 4L80A 4HPGA 1KCKA 1RLCL 1K6WA 3IGUA 4LBSA 3BLKA 2F8QA 4DXVA 1H2JA 4W5UA 2B4GA 1CGWA 1XLKA 3CPRA 4J1OA 1GJWA 4L1GA 2WCAA 1KO0A 4HYRA 1G6CA 3A6OA 2V3EA 1ODUA 5CZ0A 3HFYA 2J25A 5IXEA 1J5SA 2PZNA 1KBLA 5M5DA 2J9YA 3AALA 5LIWX 4O0QA 1A5OC 4FF7A 3QRHA 1KFKA 4FLOA 2BY0A 4V27A 3MQTA 2WHLA 4WUIA 5AOUA 3TTYA 2UY5A 4B5UA 4C6QA 4HPXA 1TPC1 1V6VA 4GUGA 5FAGA 2QIIA 4AWUA 3AMKA 1UPMB 5KINA 3M0VA 2XZ9A 4XAYA 3LHWA 4QAIA 3R11A 5BRPA 1DJHA 1L6FA 3KRSA 4C6FA 5REQA 2J78A 3TWBA 1LCOA 4XO6A 3CWNA 2EG8A 2CZFA 3BZGA 5HPCA 4QG8A 3M0HA 2ZE0A 2BWGA 5AECA 4C6CA 3SCWA 4A4AA 1Y5XA 3N2XA 2H9AB 4QIUA 2PLKA 1V0NA 3L5AA 3VGGA 2FZ9A 4QGCA 2J7GA 3G0XA 4J2PA 3PZTA 3DECA 5F2LA 2A7PA 4JTFA 1EC8A 4OWGA 3AIUA 4O1DA 3S5YA 2V5KA 4YU1A 1U83A 4RNHA 1TVNA 1Z89A 3WD0A 4Y90A 4E4UA 4Q7NA 2DT1A 1BXNA 3AAMA 1GTHA 8XIMA 4XZLX 4YWIA 3UVAA 4AVFA 4CD8A 2OSYA 1AJ0A 3HURA 5LGXA 1H1ZA 4MYXA 5E1QA 1AL8A 3UPBA 2EGZA 4Q4SA 1JCJA 1NVMA 3S1WA 4UR7A 3QMRA 1C8VA 1GJUA 3VMOA 3WH9A 1O5QA 2WCGA 3C3NA 4FNSA 2FFIA 5FKYA 3MC5A 1E4MM 1RVKA 1UZ1A 3G0UA 4DM2A 4Q8WA 2WJFA 1GK8A 4WKHA 2IPFA 3EA1A 2ZOXA 1C8XA 1R47A 5CLTA 4QLJA 4GJIA 1NFGA 2NWRA 1ZTVA 3B8TA 3CU2A 1XBZA 1H60A 3DFYA 3K5XA 2NQ9A 4XZWA 2OCZA 2W66A 2VRQA 2VOMA 1D8CA 1VIZA 1VFHA 1E6XM 1Q2SA 3H4XA 1V7YA 1H7RA 1S38A 4FLRA 3UP8A 3EOUA 3H24A 1U1JA 3PG8A 1HJSA 4C6NA 3NYDA 4MG4A 3KW3A 3E0IA 2VL4A 3REQB 2O55A 3E6EA 4PB3A 1WAWA 3W1PA 3SDOA 4KETA 1JZ5A 1LTDA 7ENLA 2WJZA 5D03A 3B0UX 4DJFC 3BAKA 4YL2A 5C54A 1W5PA 2FYMA 3WBXA 3A4JA 1Z3NA 1W1IE 3USBA 2QLYA 3AU2A 1A80A 4ZOCA 1I2NA 1U33A 1JQXA 1HT6A 2DVXA 4RJEA 5CBBA 2FVMA 5HQLA 3THCA 3DU0A 5A3HA 2ZRZA 4D8AA 1UR3M 2ZRUA 1J4EA 3ZR4A 1HKJA 2X8RA 4JOMA 1E4NA 1T99A 4MFDA 3TJXA 5KEZA 3DOPA 2VEFA 3QN3A 1XYMA 4U31A 4D71A 3IAPA 5DBUA 1FY6A 3DBPA 4LW7A 1VFLA 4I9TA 5A6SA 4QG9A 4BKNA 2POTA 3PPGA 3LM3A 2G3FA 3T42A 1B3OA 1U22A 3B8SA 4O1EA 4QJ5B 2B7OA 3GG7A 3O3RA 3WUEA 1BFNA 4LT9A 5PTDA 2ACUA 4XD3A 3NWRA 4JY9A 4HK7A 3W22A 4O1FA 1E4IA 4YCOA 2HRWA 5DLCA 1XH2A 4OE7A 5H1WA 2PDUA 4JXCA 1PV8A 1M7JA 5HR7A 4PUJA 4GKLA 3IVSA 2W67A 2ZX8A 4KFNA 1EZWA 2VFGA 4P8XA 3OA3A 1H5YA 4PRRA 1BXBA 3WH7A 2FHBA 2REQA 4UQAA 4ADTA 1V5XA 3QEZA 2D20A 4S38A 4V1YA 3AHVA 4RCXA 3PM6A 1KLYA 3PZOA 4UZSA 3HV8A 3VE7A 4PCPA 3W38A 1E1EA 1DWIM 3RGTA 4BCEA 1THFD 1R3SA 4WOQA 4NRRA 1H49A 2OU4A 4HBKA 1EX5A 1VBJA 1NDVA 3N6QA 1PWMA 3UZXA 1KCLA 4PTDA 3LX9A 2PDBA 5CH9A 2VRJA 4PUEA 1JCXA 2CERA 1F74A 2G96A 3KLKA 3PUDA 4O15A 2JKAA 3CIWA 1FWBC 4F0KA 1A49A 4N9BA 1NWRA 5AHMA 1KB3A 2Z27A 5M1TA 2YB1A 1CXLA 3AROA 1WXZA 1MDRA 1YPXA 4OT7A 1BSIA 2WHMA 4PMVA 1FHVA 3SUUA 4OBSA 4C90A 5I78A 1VEOA 1W9XA 4P7LA 3GTNA 3BUVA 1UOKA 1SJDA 4UTMA 1SZFA 3WBEA 2FZ8A 4EF9A 1TJ1A 1TELA 3N19B 5LSMA 4N4PA 1MQRA 1ZSXA 2OZ3A 3WNLA 1MFUA 3UNDA 3CV1A 2PP1A 4QEEA 3VOHA 4JNMA 2J79A 1A5SA 1R38A 4CQDA 1AQMA 3L2IA 4R3UA 2YCEA 4CGTA 2QCFA 1BKHA 1DL3A 4LOCA 1UJPA 1MNZA 4AD0A 3N2CA 3UJRA 1WZMA 3A5FA 3GM8A 1K9TA 3Q4DA 4UQBA 1H7WA 1VYPX 5HUOA 1DBTA 2QDEA 2ZTJA 5LNVA 1A4MA 1GVIA 2GVEA 4M51A 1Q6LA 3CWHA 4PFHA 5A6BD 1KM2A 3WQWA 4KWWA 4ZE5A 1GW9A 1FHLA 1QPNA 2W3ZA 1N2VA 3MV11 4Q8UA 2YFOA 2CKSA 4FIRA 3GDBA 4Z1AA 2FIQA 4JS3A 3DBNA 2DZUA 1AMYA 3G1AA 3R10A 1K3UA 1GVYA 3F4VA 4R27A 3ONCA 4UNKA 1JCMP 1XGZA 3GG8A 3QMTA 4XD4A 1UG6A 4RPPA 4JL2A 4Q8OA 3B9AA 3LUTA 3MO4A 2A21A 2HWGA 3A12A 3UG8A 4MB5A 5TQLA 3OIXA 4JY8A 1EKOA 4K6AA 1GWJA 5AYBA 4UOZA 8XIAA 1YBQB 1JXKA 3NM3A 1T0OA 3EX1A 4EPBC 1GOWA 5E70A 5A8MA 3H12A 2ZWYA 1KQZA 4XV0A 4NNBA 4F0SA 1XYLA 4PSPA 3FOKA 4E8CA 2EJAA 3V7PA 3FXYA 1R0MA 3U9IA 4FAMA 4W86A 1ADSA 1ZPTA 3NO5A 1XLIA 3KHDA 1D7FA 4KWOA 4QE5A 4A8IA 1T40A 2GL5A 1UASA 4C7GA 3MUY1 3T1GA 2ADAA 2GVGA 1RR2A 3W7EA 1ISZA 4S3AA 5E6YA 3MYOA 3PFMA 2VCBA 4L4LA 4R7OA 1TE6A 4QJ1A 1KTNA 4GQGA 4QSFA 2PWHA 1UWQA 2W4XA 1WUEA 5D30A 1HKIA 4ZBCA 2UY4A 2RHGA 3EDDA 4FX7A 3UVIA 1UKOA 3WK1A 1IT7A 2ASHA 1YXCA 2V2HA 1Z69A 2H6RA 1X1ZA 1ZZMA 2V30A 4PFMA 3EDJA 1NTHA 4IIHA 3CIXA 2ISFA 1E51A 5C8BB 4O28A 4L64A 1AD1A 4QG6A 4I8YA 3DCPA 3WQEA 4FZIA 2G50A 4HNTA 2MUCA 1MW2A 4RV3A 4B3KA 2IXVA 3V1HA 4B5WA 1XGEA 1VHCA 4FXJA 5T9BG 4ZQRA 4LU0A 3PNZA 2E5BA 1K7XA 2CZDA 2RAGA 2QEZA 3NL2A 1JPHA 2EBNA 3PNUA 1HP4A 4IWWA 1KKRA 1S2UA 2OB3A 1MQQA 3WLJA 3G8EA 4LVDA 1WOBA 1GVEA 1UWSA 1POJA 5C5YA 3IVUA 4LAMA 2QCLA 3G6LA 1NP2A 2X1IA 2OYLA 1J8VA 2J6XA 2VC5A 1KM0A 3E74A 2PDMA 3UY8A 1I1WA 1GHSA 3E0VA 3EMCA 3O05A 1HQTA 1TTJA 3GK0A 4BHYA 2VZUA 3HA1A 1PAMA 1VYRA 4U28A 4BF5A 3BGJA 3KWXA 1GYLA 3N15A 3ZVHB 5LZLA 3WLTA 3GDKA 3GTHA 1FQ0A 3IIXA 3C3UA 3ITYA 2C71A 1ZB5A 3H2EA 3LBMA 4OJYA 3WQGA 3VC6A 4MGGA 3NZRA 1BYAA 2A3HA 3FSTA 3VNKA 2W62A 2KX9A 3WMSA 1UBPC 3VOIA 1M3UA 4H19A 1E0VA 1EDQA 1VJSA 3T07A 4X0VA 2V5DA 2XFYA 4GUFA 1G1YA 2P8CA 3ARYA 3DEQA 1XIJA 3LNPA 4AHQA 2DZWA 4IMGA 3BGGA 1WKYA 3I4EA 3TQPA 5GPRA 5A2BA 3S42A 1G4SA 2OO0A 5U4NA 2FHCA 4WZHA 2PTXA 1XX1A 3WQOA 2XISA 3CV7A 4LYQA 1V79A 3E0WA 4QSHA 1TSIA 4FX6M 2V5JA 3IGSA 2VMFA 2GPTA 3STGA 1E40A 4NAFB 4W7UA 2Y88A 3HFTA 3R8GA 3CLMA 1K77A 1EH9A 4PMUA 2F2HA 4CCZA 1C8QA 3INPA 2X41A 1EC7A 1W17A 3ALGA 1P1MA 4MM1A 4IP7A 4IJCA 1JCLA 3CQIA 3DFSA 5I77A 4HHPA 1I2PA 4DB7A 2ZVRA 1QPQA 1W1PA 3TCEA 5EB8A 2WKGA 2PDLA 3DI1A 5MKGB 1DORA 3QYSA 4AD5A 3LENA 2HISA 3W24A 4AAJA 2D22A 3S2JA 3D5HA 5C9RA 3MMTA 2XFWA 4EVZA 4QITA 7ODCA 2HVNA 3M0XA 1X38A 2L5HA 3IIVA 1T7LA 2WO5A 5C9ZA 4A35A 1QHOA 1CGTA 5EFFA 4EAYA 4PYSA 4NKCA 5FEXA 5T91A 2QZRA 1JPDX 3W7MA 3H23A 1EIBA 4FNTA 3WIJA 3OIHA 5D9OA 1UWAA 2FLIA 3VIGA 4GPNA 2Z6JA 3LV5A 1RZMA 4C60A 2JEQA 2TAAA 3TEVA 2ZVIA 1LJYA 3II1A 1E3XA 3H21A 4DUVA 2YDQA 4A3UA 2UY3A 3FEQA 3GNRA 2V8ZA 2E09A 1ZP3A 1PYFA 1XG3A 1ODZA 1XIGA 4MJ2A 4AZ5A 5FSDC 4DUWA 3TLLA 4BA0A 3E3HA 3BE7A 4UWMA 4GGHA 4AIUA 4RW3A 5E0FA 1CLKA 1K03A 3LN3A 1M01A 1ME7A 3QTPA 4LC6A 1GJPA 1CXKA 3F2BA 4MKSA 4UZUA 1AK5A 2JEPA 1QBBA 4OIFA 3L4TA 2BVWA 2V5BA 1R30A 1FWGC 3GDMA 3R1ZA 2AQWA 1M5WA 3N4EA 4HNLA 3TNOA 3VCNA 3MTWA 3SCTA 3QHMA 1P6WA 1A50A 4AIEA 5FACA 3HPAA 2Y63A 2OELA 4C6BA 1AH0A 1F73A 3HB9A 3T4CA 3HQOA 1WBHA 3LPGA 1JZ6A 2RGLA 3BAYA 2XIMA 5AVNA 4DWSA 4DBWA 2XUCA 1U30A 3R6IA 4YCPA 2Z7GA 3P7YA 3PWIA 1KFJA 3QVQA 4BWLA 5F2GA 4JTEA 4MY9A 3G1FA 4AB4A 2GOUA 1XFBA 3ZT5A 1TJRA 3I3BA 3TTOA 2OKOA 3CZ8A 1UZDA 2G3JA 1H0IA 1XLBA 3DUGA 4AXKA 1TE1A 3HQ1A 4GZIA 2Q6ZA 5C71A 3LMZA 4GX8A 2GVYA 3LQLA 1WAUA 1CBGA 4RXFA 3DFOA 5A95A 4MNMA 3QLLA 4XX6A 5AHIA 4IPIA 4LCQA 1FHUA 2Q8XA 5HINA 4AD1A 3LCXA 3TLQA 4IT1A 3NL6A 3FVDA 2BV9A 2VGIA 1K9DA 1QNQA 3QV7A 3TN4A 2RKXA 1QW8A 2ABBA 2E8ZA 4PBEA 1OJXA 2XIOA 4J28A 1WBJA 1Z8AA 3W28A 2GDUA 1R3QA 4WIWA 3G3DA 1FWHC 1TJPA 5I6SA 3HMJG 2YR1A 5AC7A 4XZHA 4PUMA 5TF0A 4AY1A 4W89A 2BX7A 4AZCB 4CUCA 1P0NA 5HMEA 3AIRA 1OCNA 1A4LA 2IKGA 3WMCA 2DUZA 3T78A 1VYSX 2ZICA 2DY3A 4IIGA 1RK6A 3B4UA 9XIAA 1PHQA 4PGLA 1RV8A 3URAA 4J3ZA 3MVIA 5TBOA 1C9DA 1V3JA 3G8RA 4Q4PA 4C5ZA 3CAWA 4IUGA 2PRHA 1W32A 3I10A 3WSUA 3PUGA 1KM3A 3E0LA 1EBHA 5KTLA 2PDPA 1NQKA 4J27A 2E40A 1TA3B 2V69A 4J7RA 4AVNA 3LK6A 4Y9MA 3EMZA 2QCGA 1R2RA 1MDLA 1J2BA 3TR2A 5J04A 2OX1A 2NWSA 1XUZA 4UQ9A 2TRSA 4NZ5A 3T4WA 1VRXA 4NSBA 1W3LA 2HDJA 2Z28A 5LYRA 4ACZA 3GH4A 5JU6A 3EWBX 1IIHA 3KTXA 3CS2A 3M47A 3EWUA 1H61A 3I7SA 2OO6A 1Q65A 1KFCA 2XINA 2E0PA 1KGXA 3CL8A 4XUGA 4ZQPA 1TTPA 4C1LA 4CEUC 2V9DA 4GI8A 1PIFA 1VFOA 2MANA 3UWYA 5BRQA 4XBJA 3SN0A 3QY7A 1TFVA 4GQBA 4M1RA 5LXEA 4J40A 2A1YA 3BOXA 4GH3A 4KPLA 3M43A 3GNOA 3P84A 5HA7A 4PH6A 1NM9A 3JU2A 4UOQA 3EWZA 1RA0A 4KCVA 3GFYA 4BWLC 4QS5A 2CLMA 4RW5A 2OWWA 2QPXA 3DN5A 4RE2A 5FESA 4KIEA 3VU2A 2XZ7A 3BK0A 3VINA 1KLZA 1ISXA 1H7OA 4L65A 1K02A 3UPMA 4GYKA 1ZU8A 1UD5A 2PLJA 4PB5A 2Q02A 3UR2A 4L61A 3T08A 4ATWA 1BQGA 1TPWA 1A5LC 3MMDA 5CEWA 3WO8A 1NH6A 1UD2A 2NV2A 1UQZA 5AC5A 4JIRA 5GNZA 1HVXA 8TIMA 4QEHA 1G7UA 2XSXA 1CPUA 1EQPA 2G3NA 2VD8A 3WH8A 2H90A 4PCNA 2Z0IA 5IM51 2V81A 4TIMA 1P7TA 4GXPA 4UQDA 1J0KA 4FO4A 3IK2A 5D37A 1XRVA 1Q7ZA 1P43A 3ARWA 5C55A 3AZRA 4QQUA 4GX9A 4X63A 1OGBA 1JR1A 5FI8A 4GACA 1V03A 1D3GA 3EPMA 4WXYA 2WNWA 3P2VA 4B2DA 2UBPC 3MT1A 3W1XA 3D3FA 3W7CA 1DE5A 2HVMA 3WJZA 3ZSSA 4H6KA 5DXYA 4B5VA 2AQVA 3WUBA 2P50A 1OADA 4LF1A 2E8YA 4JTIA 4WSHA 4E4PA 1R7OA 2E9LA 1HTIA 4HMCA 4JCLA 2FQIA 3ZS4A 1KXVA 1KTBA 2QKFA 4ICMA 6CGTA 2CFFA 1FOBA 4PMOA 3OGVA 2E77A 3NQFA 4AIOA 3PR2A 1YMYA 3GB6A 2PURA 1W3NA 3GFZA 2DIJA 3EXSA 1FDJA 5E93A 4AY7A 2P1FA 4NVTA 4D8LA 3IUIA 2ZRVA 1OC5A 2FPVA 1E6QM 2V68A 4PUUA 1MW3A 1TQJA 1YE6A 1US0A 4OTKA 2QQ6A 3P5YA 2Z4GA 2VFIA 2OGJA 3CV2A 2X1UA 2OXNA 4O52A 5E5CA 4KCUA 4HKPA 1W2VA 2ZQ0A 3L0KA 1H1YA 2WMJA 2ZWZA 4CVUA 4WKFA 3CYVA 5CSRA 3L0GA 4O10A 5B7ZA 4RDYA 4XKYA 1VH7A 1BVNP 1E6PA 2X30A 4HTYA 1MEWA 4ZR8A 1QWKA 2GQ8A 2X1RA 3W07A 4DWSC 1JFHA 3ANVA 1TWWA 3GKAA 2O9RA 3PC0A 3UQNA 3W88A 2W27A 1XS2A 1JF6A 1DJIA 1UMYA 4NNAA 3OZMA 1O68A 3S5ZA 3SUTA 3SY1A 3AS2A 4E6MA 4QE4A 1BAGA 3A24A 3DAQA 4EPDC 5FF0A 3FJ4A 1RP9A 3L5LA 4DYJA 3GBDA 1TZ7A 4DAFA 4UMCA 4JN6A 2XN2A 3PBWA 4WY0A 4IIEA 1VBHA 1ISVA 3N6HA 4HZ8A 3QZAA 2F9RA 5A6KA 5BZAA 1FP8A 5F4SA 3RLVA 1UR0A 2OG9A 1OB0A 2JF7A 1EOMA 1SZGA 4FXSA 4WK9A 4QJ4B 4V2XA 5D2TA 4JTSA 3APYA 3S9ZA 2GWGA 1PTDA 4DAIA 1FRBA 4LVGA 5I00A 5H8PA 4H7ZA 5CPTA 1YIXA 3T0TA 2VEKA 4LAUA 1JZ4A 1H63A 3HG3A 2VQTA 3W1RA 1MWOA 5C7HA 4EOUA 3OLDA 4H2CA 4DJFA 1JDAA 3BV7A 3DH7A 3VD3A 3GVRA 3R89A 3F4NA 5F1UA 3MWAA 2QIWA 2PWGA 4ERAA 3HPSA 2PTWA 4HP5A 3WLRA 1K8ZA 1S2WA 2V5LA 2RGMA 4L7ZA 3CZJA 3U2CA 1VCGA 2QMJA 2PS2A 1HKKA 2XH7A 4NAEA 2DDXA 3AUOA 1FXQA 3M6DA 1V3LA 4L9XA 3WUGA 4W88A 4PA8A 2QCNA 2PWUA 3PBMA 4OUIA 4EAMA 4HMEA 7A3HA 1LORA 1E0XA 4IF2A 3P67A 2ZIDA 4QLLA 5JH1A 1XC6A 1EHNA 3NQEA 3ZLFA 4I8DA 3AXHA 1TPVA 3ITOA 1JNEA 4C1KA 3P5ZA 2XM2A 1J9YA 5HNRA 3A64A 1I2OA 2X09A 2XG9A 3VGFA 4UR9A 5G4EA 3VGHA 4FS9A 3M46A 2BMBA 3ID7A 4OZOA 3BG3A 4OV9A 1HGYA 2IMRA 4QHRA 4E0CA 1X98A 3W1LA 2EHHA 3U0HA 3G1VA 4F79A 1JXJA 1BWVA 2FDSA 1RH9A 3F2DA 4IMDA 4GQQA 3MSGA 4WSJA 1OK6A 1PXGA 4HA4A 1RQEA 1XYFA 5EMMA 4S3BA 3CO4A 2BHUA 3LXBA 2XJ7A 1DJWA 2Z1BA 3WN6A 4GUIA 3NQCA 2PTZA 3OHIA 4PE8A 2BODX 1RCXB 5H6HA 1ITXA 4LV9A 2X0HA 4MAZA 4HZ6A 3BH4A 5A2CA 1RY0A 2JALA 3CB8A 5EMUA 1TZZA 2G3IA 2J9ZA 2X7WA 3AMLA 1CLXA 1TPUA 1A0CA 4XAFA 2NZLA 2XPKA 1HKVA 3EB2A 3QW4B 4H1ZA 1P0DA 2GOKA 4IMCA 3HOJA 4PODA 1UR8A 1JRCA 1S2AA 4XSMA 1OM0A 2P76A 3DKLA 1M04A 3WQPA 5CPMA 1MO0A 4O1CA 5EMYA 1MUCA 2BGQA 3P3BA 3FN9A 4QFUA 3QKZA 4JX6A 3CQHA 3RK8A 3VX0A 4LEFA 5FJTA 3K30A 1FCBA 4PR4A 3THAA 1AH3A 1JI1A 2PWEA 3QQ0A 3AUJA 3ZT7A 4JTCA 2OSXA 3JR2A 3G1YA 2YA2A 3L4VA 2D0HA 1CENA 1Q63A 2VFFA 3TQ0A 1A5CA 4QQ3A 1UWIA 2WHJA 1CGYA 4ZGYA 1TTQA 2QJNA 4ZODA 3VKDA 3NGFA 3MDWA 3DESA 3AIWA 1E6NA 3RHGA 3F7JA 3KLLA 3MUCA 4FMVA 1SMDA 3L2MA 2P0OA 4Z2HA 3L4WA 3N14A 1HUVA 1RD5A 1SW7A 2V3FA 3HG4A 3RJXA 3UWVA 4ZCWA 2HCVA 3VOFA 1Q6QA 1Q45A 2PAJA 3NPVA 1QK2A 2ACSA 2ZZ5A 4MMWA 1J6OA 4E3VA 3PZNA 3SW6A 3UZYA 3ME3A 1YXDA 3G1SA 4LC8A 1H0GA 3MMUA 4GI9A 3GXIA 1JAEA 4F9JA 3PUEA 2VYOA 2W79A 1KM6A 2F84A 2EG6A 4TVDA 3TYZA 1FBAA 1T6MA 4N2YA 1TQXA 2YL8A 2HNHA 5HNNA 3QFEA 5AHNA 2X40A 1KC7A 3DG3A 4MHBA 4Q33A 3FXGA 4Q8TA 3G1HA 3NUKA 2XWEA 4TU1A 1OX4B 2QULA 1I2RA 3CWOX 2X0SA 3ZR6A 4A2SA 5CC3A 2P53A 3FKKA 3UCDA 3RYSA 1XQKA 1E0UA 2QDGA 5DXXA 2VURA 5JUVA 4J4KA 1RQHA 2W91A 3ES7A 2OT0A 4C7FA 1XICA 4O18A 4JN8A 4DEFA 1XRSA 4NJGA 5EA9A 4S1FA 4AX6A 3RCMA 4S3KA 3P14A 1Z6KA 5DMNA 2BHYA 1DKWA 3B40A 4JTLA 2WSRA 4C91A 1EGMA 3WNMA 3WQVA 3NZ1A 3VI2A 5A5WA 1JJKA 3HO8A 2ODOA 3W2MA 4HB7A 1JDEA 4TOQA 4B5NA 4YXGA 3AFBA 1S2VA 5IHSA 2NLIA 2VGFA 5MKGA 4HCHA 1W3JA 4PUDA 1MUWA 4Q3MA 2INZA 1HG3A 2AL2A 4K39A 4C7DA 3CUGA 4L6OA 2XGBA 4UTHA 4JGDA 1V3KA 1XLGA 3BJSA 1JD7A 1HGWA 2NXGA 3HIJA 3W7KA 4BK9A 2X16A 2JE8A 1IR2A 4N02A 1E1FA 1WDSA 1R3TA 1I1XA 1XINA 3PZIA 3QHOA 3BLOA 3DFPA 4BY3A 5CKSA 1R2TA 4PMNA 1T96A 4WSKA 4GRSA 1JYXA 3OO2A 3K1GA 1OY0A 4KEUA 4LV4A 1FWTA 2XN1A 3BOLA 5DY3A 2CBIA 2EKCA 2XFRA 2HJPA 2WSQA 3G6MA 1ICSA 1E4LA 1EWDA 1WDWA 4EANA 3KOFA 3W87A 4A3QA 4IP4A 3BXWA 2F2KA 3NSNA 1ZALA 2JKPA 4Y9OA 4E8GA 1XYCA 4K8EA 2WJEA 3GU9A 4H8NA 2EPHA 3GQYA 3NTYA 3PZUA 4N4QA 3LA4A 4UFIA 4DN1A 1NWTA 3ARUA 3B0XA 4M80A 3SCOA 1KRMA 1EFZA 3NQDA 4JQ4A 2DIEA 3EOEA 1CTNA 1ADOA 2WWCA 3GWQA 4ZOEA 3BURA 3LOTA 4FA3A 1GQLA 1SUXA 4F0MA 3U3HA 5C2XA 5BXPA 3W1TA 2PCEA 3N2MA 5T26A 3K2GA 1J2WA 4H9ZA 3ATZA 1OBAA 1MRAA 3ABQA 1IEQA 4PTXA 5G1TA 1MEIA 3LLFA 4G1KA 4IGSA 1VPYA 4QM1A 2WVVB 3UXLA 2YSWA 5T9CE 2WANA 4J3UA 1OFBA 3NQ8A 2PC8A 1W1B1 2WK2A 3PS7A 1F9CA 5A8QA 4LAZA 3N9SA 3HN3A 4Q8QA 5ABEA 1B3YA 2P88A 1VBUA 1HJVA 1EO5A 1Q66A 2ZXDA 2LLEA 4M6VA 4OECA 3A3XA 1OCBA 3DYMA 2NX9A 1MNSA 3K4DA 2WW5A 3TX9A 4GY1A 2Y0FA 3R94A 2R82A 2D73A 2FZBA 3GRIA 3HQNA 1U2YA 9CGTA 4ZTYA 1LOQA 3HMCA 2CITA 1TMLA 1EPXA 4UNIA 3WLMA 1DJGA 1H50A 3PK7A 1WKDA 2V2DA 2HROA 4DNMA 3GE7A 5BXTA 1DE6A 4XAGA 3AOFA 1KWKA 2ACRA 1LRQA 1XFCA 1Q4NX 2FPTA 4JHMA 3TC6A 1B31A 6TAAA 2P8BA 2E9BA 4OUEA 1SO6A 1FXPA 4R7JA 2IPGA 4AZCA 3MZ2A 4PEKA 3MU7A 7REQA 3NG3A 2VUNA 4GWEA 2DT3A 5M3WA 4CNOA 4CQCA 1VAHA 1ZGDA 1ZBCA 3IIPA 3LSBA 4CN4A 3CHFA 2C1IA 5A6TC 5CG7A 2IKHA 3QQWA 4U3CA 1SR0A 3STFA 1S5NA 4N0RA 1FA2A 3OZPA 3WJXA 3UYIA 2J6VA 1W1VA 4H4IA 4RZ6A 4EXAA 3DYPA 1DJZA 3IJ8A 3QF0A 3E9AA 3AIBA 3GZAA 7TIMA 4KRTA 3WKZA 4HMNA 3D46A 1W8SA 4Q4MA 3R2GA 5CGTA 3IJIA 3H55A 1SVDA 2R1LA 3GHTA 4J2MA 4U5IA 1CI1A 4LAKA 3UGVA 3IJQA 4YIWA 3UF9A 1YDOA 3U57A 1Q8JA 3THQA 4GK8A 2O56A 2Q71A 3AXMA 2C16A 4GUJA 3TMQA 4J3XA 3Q45A 4HHLA 3TYBA 4GVFA 4DI9A 5CJNA 1UUMA 1R7AA 1K70A 1ZS2A 3RU6A 1MW0A 4GO8A 2Y7EA 1CLVA 3USZA 2BOGX 3UJEA 5B80A 3W86A 4NAEB 4G56A 1P0KA 4IFRA 4K68A 1ISWA 2ZC8A 2E5DA 4EIVA 3E0FA 1TV4A 1XLDA 3LZ3A 1V3IA 1TMQA 3PBUA 5ABHA 1CX9A 4RNFA 1IV8A 2P5NA 5IFPA 3AXKA 4AF0B 1W1A1 3WD2A 2OEMA 4WDUA 3KBNA 1LYXA 2INEA 1EP2A 4Y9NA 4KIRA 2IW0A 3VZZA 2YCKX 2GQ3A 1S2CA 1JDCA 1XIMA 5HUPA 3SURA 1LBLA 2VDIA 2J62A 2H8ZA 2QCMA 2WLYA 1C8YA 4AXNA 4GBDA 1GTEA 3VNIA 5D8ZA 1TO3A 2B0MA 2I7GA 1QOXA 2Y24A 4P8VA 1B3ZA 2GZXA 3QFWA 2OTDA 4IL0A 1OFQA 3AQUA 2PDWA 1SMAA 1Q4WA 4LY8A 3TYEA 4EX4A 1QPOA 3TSDA 4CQ9A 1R6WA 3B0YA 1FWFC 1NOWA 4HTBA 1R3VA 5E09A 2ZRWA 3EA3A 2RDWA 1DJQA 2V3GA 1RSCA 5DCEA 2GUYA 3C56A 3FYPA 3JS3A 2IXUA 1VZWA 3E38A 3UXKA 2HZGA 3C61A 5GNXA 1CXFA 1MXSA 2AAAA 3OLEA 1F3TA 3F03K 4NRSA 4WDXA 4P8UA 3PBGA 1E1CA 5CQ1A 3DHDA 3HBLA 4I6KA 4S3GA 2VVSA 1A5UA 3L66A 3W37A 4B9YA 4V33A 2A6LA 1W3HA 2QDDA 2WVTA 4A29A 1J0YA 3WNPA 2QCCA 4KCTA 3MB9A 3WLOA 2QS8A 4GZ7A 3VD4A 3T05A 1NAL1 3S1VA 4BF9A 1TKKA 2B7NA 5JBFA 3NXLA 3P80A 4HPHA 1WE5A 1XKYA 1Y65A 5FJJA 2YBVA 1NEYA 1V6UA 2J66A 4BI7A 3PPFA 3MSRA 3RCYA 4LXFA 2CHOA 2IPWA 2IUZA 4NZ1A 4YJ5A 1WZLA 2IKIA 3W7IA 3LTSA 4JEQA 1WYIA 4FOKA 5HJXA 3VD7A 1REQB 3H7RA 4D6CA 1A3XA 4J3WA 1FH8A 4WY0B 1QOPA 1DTNA 2Z6IA 4H9XA 2HXUA 3SB0A 2BXYA 1XDLA 2EPMX 4O50A 2ZX6A 3MKCA 1IWAA 4HHMA 2OOFA 1OFOA 3LD5A 1XSKA 3WDJA 4W4QA 4Z2JA 4K8HA 3JVAA 2QUMA 2ZZ2A 4JAWA 4FHAA 1P0BA 3NJ3A 1D3HA 1Q6CA 1VR6A 4CNUA 2AAMA 1BEUA 4TX8A 3MI6A 2J4GA 5L9FA 4DWDA 3M0JA 4Z2KA 4RX0A 3MCOA 1WNOA 1J93A 2Y8KA 4RPQA 3AC0A 3WF4A 3VGBA 1CXHA 1QDSA 3A3WA 1SFSA 3CUHA 2C1HA 1JIBA 1ALDA 2CLOA 1XGDA 3KBMA 4JZ5A 4NASA 4TQTA 5AZ0A 1OT2A 3WH5A 3GIPA 2ATMA 2QUVA 4MLJA 1ME8A 3AS1A 3J7HA 1TVPA 3FEMA 3GNPA 2PTDA 4CD5A 3N1AA 2ABAA 1CCWB 5EMLA 3U6WA 3N29A 1UP3A 1F07A 1TB3A 3L65A 1Y5WA 2J88A 1PE1A 3MPGA 1QATA 1GVOA 3VNZA 3W6LA 3W1UA 3A9BA 4XB3A 3TU9A 2HE8A 1KFEA 4C6JA 3VDHA 3GVWA 3K46A 4H2HA 2ISWA 3CIVA 4G7EB 3IIZA 5LIYX 5HULA 3NPWA 4H9YA 4U3AA 3L67A 3GC2A 1XUUA 5HQEA 1BLIA 1E15A 3N18A 2PLMA 3V0UA 2DZVA 3W7QA 4V15A 3C0SA 1ESWA 1YLVA 1VFFA 1G01A 1AQHA 4X61A 1YBQA 1E56A 5JQ9A 4HCLA 1TPDA 1JDDA 4ACZB 3OVQA 1S1RA 4CU7A 3LI1A 4ZMGA 3WLNA 5DO8A 2PP0A 5C6MA 5HNUA 4HYVA 3B8WA 1XH0A 1N55A 4GNJA 3OHMB 5JIWA 1JI2A 3OJGA 3TN6A 4XWUA 5CBIA 3F2CA 4H9UA 3VNMA 2YDSA 3LCWA 2PEVA 4NQ1A 3TSBA 1R86A 4XD5A 5D2YA 3QGVA 3SEPA 1FCQA 3VDBA 2OR2A 1QHPA 5FAJA 1FH7A 4LVAA 1POKA 1H09A 2XGZA 2YCLB 3PFRA 1C29A 3QHNA 1GOKA 2WC3A 3CMGA 5E9AA 4Y8FA 1ITCA 2PGEA 3M4HA 1VENA 1YDNA 3K4AA 1NWSA 1O7AA 3R8RA 1TA3A 5HR6A 4FP1A 1VGAA 4B15A 1JQVA 3PJUA 1E3ZA 3KCJA 2P10A 2R1PA 3AWNA 4MB3A 1DWGM 2VCCA 3LBOA 4Q7IA 1WV2A 2JK2A 2W61A 3AYSA 3W70A 3CEUA 3FHAA 3MI3A 5TD4A 3SIMA 4W8LA 3WK3A 1B3VA 3VKKA 1M7PA 4LYRA 5E6ZA 1SO4A 3CM4A 2X05A 3M5XA 1RCQA 3UWWA 2VOTA 4WJEA 4XZNX 3VKJA 3LQGA 1BQCA 2VM8A 1OG0A 5G1MA 4ZVJA 4UTKA 3QW3A 4DJFD 4U33A 2ZE3A 3OVPA 1LQ2A 2E68A 1O60A 3PAJA 5CPQA 3H2CA 3KTCA 2AOSA 3RX2A 1GOQA 3TE9A 4IGMA 1QFEA 4BQ5A 4FK9A 3LDVA 5K9DA 1IYXA 1CWYA 3KVJA 4JQAA 3W00A 4JEJA 3EEZA 3OOQA 2E1WA 4H6RA 3G3MA 1MXGA 1VJIA 2VJXA 3QBUA 1R8LA 4GCAA 4JYDA 2XH4A 1EJUC 1O1ZA 3WMBA 4XQ6A 1XIFA 3KFTA 4I5RA 1XIEA 4ROPA 5AC8A 3MCMA 1V6YA 4UUIA 3RX4A 1KXHA 1XRFA 2A3CA 5BWFA 3DFTA 4DHGA 2ZX9A 1R46A 1XH1A 4GHRA 1L6YA 1WO2A 4XBKA 4IUOA 1AFSA 4GG9A 2F6UA 4Q8MA 5FJPA 1J0ZA 3E2SA 3UGRA 1REQA 1DIEA 5T8GA 3CMJA 3FNDA 2ESCA 4IZGA 2IQ0A 4NHVA 3CK5A 2CLEA 4Y6GA 2D0FA 3WQFA 1XIHA 3FJ6A 4LRSA 1OGSA 4DWSB 5G2HA 4IG2B 1E73M 3CTLA 3RPDA 5I23A 4KKXA 1ZUAX 3N13A 2I5GA 1TJ2A 2YB4A 3WBAA 4H8HA 3KOWA 3SQMA 2VR2A 1EF3A 1VF8A 3ABXA 2HTMA 1FWRA 1WB0A 3LPFA 2A7RA 3M0LA 5AHEA 1NSJA 4TMCA 3PB2A 4XKYB 3ZT6A 4WD0A 3UWEA 4X2PA 1QBAA 5A1AA 3R13A 4M8UA 4P2VA 5JBEA 3OLGA 5D33A 1F4AA 3XINA 2UWFA 2C1GA 2D1ZA 2ALRA 1R3RA 1T8XA 1UROA 3P8IA 2BVYA 4DPPA 2WZMA 3RRXA 2OEKA 3VNLA 3E02A 3B8UA 3KZPA 1BRLB 3A5VA 1W54A 4K37A 5LHEA 5CCZA 4GIRA 1QI4A 1JZ2A 2V3DA 4KW2A 1SZNA 1KTCA 3PTDA 3N25A 4ZSUA 3ITCA 3LXCA 1F4HA 2CLHA 1P5BA 1EJTC 3WUFA 1V0LA 3BCJA 3BDKA 3SM0A 2NVDA 1EGVA 4GXWA 4RNIA 3GH7A 3I7RA 3KP0A 2J7BA 4RXGA 1EA0A 2WNQA 2QT3A 4TX9A 4DZAA 3SR7A 4WJ8A 4PBFA 4XG1A 2AMGA 2CLPA 1YPFA 1X97A 2VTFA 4XBSA 1B3XA 1VCVA 2F61A 2Y5EA 4YYCA 1CEOA 2Q8ZA 3MUAA 1OWQA 3DKJA 3NZQA 2J7DA 4IISA 3BLIA 4UTFA 1TVLA 1D3CA 4BZYA 5C2CA 4ZQOA 4IIDA 1TV5A 4I5XA 1W5OA 4JNZA 3F4DA 1PCKA 4XIAA 4HSHA 2YJQA 3MUZ1 4O4VA 3FV9A 4U2YA 3OB8A 1GG0A 1Q6EA 3C52A 2XFFA 3EDKA 4GCXA 1DYSA 2XTKA 3W1NA 2E25A 1W8GA 4R34A 3VO0A 5AYYA 2F7FA 1ZHAA 4O1BA 2QNEA 4GQ0A 1XD0A 4DJEA 1X6NA 3W2UA 3UD6A 3OZYA 1VLWA 1XWYA 2WMIB 4U10A 1QNVA 2Z1XA 1ONEA 2VVNA 3NL3A 4MAVA 2PP3A 4IG2A 1OD8A 1Q13A 5C70A 1B5TA 4ENLA 4DPQA 1EWEA 3GUWA 4O0ZA 2Z26A 3RLHA 4J5NA 1XI3A 2CZ5A 2J7EA 4UTWA 4IMFA 3CPUA 4MJMA 4MKNA 3VM7A 3I6RA 2A3BA 4PN2A 1JYNA 4GA8A 3UCCA 1QCWA 5AYIA 5BOFA 4JTGA 2WVVA 3TUUA 4KWVA 2YPIA 4GGBA 4AEEA 2XN0A 3FKRA 5LIKX 3TDFA 1WDQA 4Q8VA 3DG6A 4Z1BA 1L0PA 4AH7A 3W84A 5SWUA 1B90A 4ZSTA 3WL0A 3CAVA 1EOKA 3PZVA 3W23A 4MWAB 2YDAA 4BQ2A 1ONRA 3E49A 2FTWA 5CPSA 3UG3A 1JGIA 1KKOA 1A53A 3L9CA 5CSUA 4UTJA 1SW0A 2GVLA 2Z2AA 3IVTA 4HPJA 1XG4A 1T41A 3FVMA 3OGRA 1QHZA 2Y1HA 2QW5A 3H22A 5A6BA 1RA5A 3EWYA 3Q58A 4K3ZA 4JPGA 1SU5A 3KRBA 4IPPA 4QDMA 2BY3A 4O53A 1ZBKA 1Z44A 3CHVA 4V1XA 2A3AA 3WX7A 2O4QA 3NVDA 3B97A 4LAOA 4ATDA 3MBFA 3U48A 4AUBA 3PY2A 1MMFA 1SGJA 4KEZA 4LEQA 1WOAA 2H3DA 3GLCA 1H5VA 2GGEA 2AL2B 5FF3A 1E72M 1K7FA 4HA1A 4OOUA 4OKDA 2PDIA 2X2GA 1LF1A 1Q2RA 4CNSA 1QI5A 2DSWA 3NO3A 2E3ZA 1PO9A 2ZXQA 3DC0A 1P6BA 2JQXA 4EPKA 2PDKA 3RX3A 4Q8PA 2BS9A 1ISYA 2EF9A 3W73A 3W81A 3BW4A 2H9AA 2WCSA 3O0KA 4UB9A 4XZIA 3SJ3A 4MFEA 3GDTA 5K9XA 3BAIA 4PUKA 3KXQA 1R9XA 1DTUA 4GFSA 2I1OA 5TAOA 2D3NA 3FYOA 4NYYA 1PX8A 3SSZA 4LYPA 3C86A 1NDWA 2VEMA 1FDYA 1LQ0A 1BKSA 1KGUA 3RPMA 1OG6A 5HDRA 1NF7A 3S2NA 1VCFA 4ZB5A 5BXSA 3FGCB 3UPWA 3UWQA 3VIJA 3T6CA 1RJQA 3N2OA 3PWGA 3UXIA 2OLSA 2VRKA 1XL9A 3RMEA 4DJDA 4QS6A 4UTUA 3ATYA 4EXQA 1VFSA 3UBPC 3EX6A 4JYEA 1WP6A 4RE0A