1JCJA

Observation of covalent intermediates in an enzyme mechanism at atomic resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
252
structure length
252
Chain Sequence
HMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYRIBOSE-PHOSPHATE ALDOLASE
publication title Observation of covalent intermediates in an enzyme mechanism at atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 100
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2001-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcjA00
2ZZ2A 4MY8A 5DCDA 2ISVA 1H62A 1EUNA 3TU9A 1JUKA 4MZYA 1EA0A 3QQ0A 5F4XA 2DJXA 1RV8A 3UWYA 3I7QA 2Z0IA 3W1QA 4NXSA 4UTUA 3SJ3A 1KTCA 1G67A 3CTLA 3PBYA 3QF0A 1RQBA 3CLMA 3GAKA 4NZJA 5AHMA 3BW3A 3V1PA 1FWWA 2NUWA 3GK0A 1YYAA 1GVFA 1VRDA 2QUVA 5K9CA 3INPA 1WA3A 4RCXA 3M43A 3GKFA 1KM1A 4E38A 1TPEA 2A6NA 3CPRA 3W1AA 1MEWA 1AL7A 1W5MA 3NQFA 3OVPA 1FCQA 4EF8A 3P84A 3W2UA 3LDVA 3C2VA 1S5WA 2PRLA 2AQWA 3NPWA 1RQHA 3M5XA 1SZGA 2RFGA 3STGA 1I2PA 1LBMA 5LNRA 1O5XA 3G0UA 3M6YA 1W5OA 4K38A 1A53A 2FPYA 3DI0A 2ZFAA 3R2GA 3NO5A 4OGZA 1M7PA 5DELA 1F05A 3E49A 1JRCA 4Z0JA 2VC6A 4PC8A 2ZRXA 4Y8FA 3DENA 2HSAA 1NFBA 3EWWA 4MPQA 5G2IA 2C14A 1EEPA 4YMZA 2OMAA 5FF2A 2FB3A 2OCZA 3TW7A 1TV8A 1OK6A 4AF0A 2A2IA 4UUIA 1DQWA 4FX7A 2A21A 3O07A 1TPH1 3UZ5A 4YWIA 1H63A 3TX9A 1JVNA 2OZ0A 3I68A 4PA8A 1QCWA 4UCGA 3E02A 3QPYA 3BK0A 1JCLA 2EHHA 2NLIA 4K7YA 3GNNA 4HIBA 3VKJA 1PHWA 1TV7A 3S42A 3O8AA 5AHFA 2QCNA 3GZ3A 3S5ZA 2Q3RA 3LCWA 5LNWA 4A3UA 4O18A 3DH7A 1OYAA 3OEXA 1G4PA 4XZ9A 4IMGA 3TMLA 4FNPA 1A50A 1KM3A 3NPUA 1W3TA 3G0XA 3NZ1A 3GDTA 4PEKA 3L67A 3BGJA 3O15A 1CX9A 4U4MA 2X1TA 3BLFA 4FNTA 1VCFA 3EX6A 1F73A 2TRSA 1HL2A 2ZZ3A 4JTEA 1LROA 1UBSA 3MP5A 1C9DA 1JCJA 2ALDA 3TAKA 1DVJA 1NF7A 3O16A 5HUPA 4CNPA 1G4EA 1TPDA 3RMJA 4EWND 3NOEA 5K9DA 4OV4A 3C2OA 5DXYA 3Q94A 1Q6QA 5DLCA 3UWUA 4NVTA 1NF0A 3E12A 3W72A 2ZRVA 2WNNA 4BI5A 1SPQA 3LV5A 4UC5A 5AC7A 3NM1A 2CWNA 3CEUA 4PL1A 3DZ1A 5KZEA 5CGQA 1WAUA 2BX7A 4GUGA 2NXHA 5FF0A 4QSHA 3SIZA 5G4WA 3THAA 3AJXA 1TPWA 1WOBA 3PUDA 1DHPA 3LM7A 3W75A 2E09A 4N9CA 4IWWA 2Q8LA 4BI6A 4O11A 1U83A 2A7RA 1LBFA 3N2MA 3EKLA 3QFEA 3RK8A 3G0SA 3LTYA 3TXZA 2C13A 2C18A 2ATMA 3KRZA 4JTLA 1S5VA 1VHNA 4RXFA 1QO5A 2GJNA 4GBUA 2RH9A 4LV4A 5G5IA 1I4NA 3LCGA 3BV4A 4UR8A 1MEHA 1LLZA 1VR6A 1FWTA 1F76A 1LOLA 5AYZA 3L65A 5FEWA 3BLEA 3W87A 4TR9A 2WOQA 1UUMA 4RZ4A 3S1VA 2X1RA 3W7KA 4JS3A 2NWRA 1TTPA 1RR2A 4HNNA 4O16A 1W0MA 1P5BA 5AOUA 3NR0A 4RZ5A 1SZFA 2PRHA 5I3HA 1R2RA 3F4NA 2PCQA 1R47A 3ELFA 4WOQA 3EWXA 1H7RA 1SUXA 1ME9A 3LTSA 1F74A 3HGRA 4HT3A 5K4XA 3I6RA 3GVGA 5F4WA 3W7HA 3B4UA 4O53A 3ABRA 3JS3A 3ZFHA 3EWUA 2GQAA 4CCCA 1H61A 4WD0A 4C1KA 1M6JA 4I7WA 4NJIA 5AC8A 5DY2A 3VCRA 3DXIA 4L4MA 1H7OA 3O6YX 3R13A 4MZ8A 4AWUA 1XXXA 2ZA1A 1W1ZA 5CZ0A 1T0OA 3DFQA 4O12A 3M7WA 3NAVA 5HNRA 3B03A 3QW4B 1LCOA 2CLHA 4Y6GA 3ATYA 3W1NA 1A5CA 3LHWA 3NPXA 1YPIA 1FCUA 2J27A 2Q3OA 1MZHA 3IGUA 1ALDA 3TDFA 3LI1A 1NSJA 3HIJA 4O17A 1G69A 3F1QA 4AVFA 3DKLA 3TE9A 3KHJA 1CW2A 3IIXA 5AFDA 2O7SA 4PCFA 2QCHA 1GWJA 1WBHA 1OFAA 1XL9A 4NJJA 5C2XA 1FCVA 3G1DA 3W7EA 4M6QA 2GVGA 1ML1A 2VFGA 2ZBTA 1K8ZA 1N7KA 5K3VA 1TPB1 1O60A 1OX4A 3LCHA 5HQEA 3UY7A 5BNKA 4UMBA 4O1BA 4EIVA 3CT7A 5F1UA 3R5EA 3UWQA 3FYPA 4DPQA 5DBTA 3LB0A 1QPRA 3GR8A 4UFMA 2YX0A 2A4AA 1F6KA 1QOPA 3MP4A 4XTIA 5I3FA 4HPJA 3G22A 3N73A 2ISWA 3PF3A 2E1DA 3LRMA 3TSBA 5D32A 3QEZA 4JIPA 3VNDA 1I45A 3FA5A 1KFEA 3S0CA 2WPBA 4Z1AA 1DV7A 4O14A 2W79A 3NGJA 2G96A 3FEMA 1O94A 2DZXA 5TBOA 5EKYA 1FCBA 2C0AA 1F2JA 1DBTA 2WNZA 1MEIA 5HUOA 1SO4A 2GOUA 3MHUA 3KVMA 3QYQA 4M7TA 1KM2A 3OVQA 1HTIA 3PG8A 1ZNNA 2GVLA 3W1RA 3ZWTA 4M6VA 3GDRA 1TTIA 3UD6A 4U28A 3QH2A 1V5XA 1G4TA 4ZQRA 4E0CA 4GXMA 3IIVA 1FDZA 4L4LA 1TIMA 2DORA 4YLWA 3P80A 4AWTA 5G2HA 4FNQA 2Y7FA 3WK2A 2RDWA 3Q2DA 1Q45A 2A6LA 1XFBA 3C56A 5LHFA 5U4NA 1QWGA 4R7JA 4FF7A 1TJRA 4I7UA 3M44A 4ZQNA 5I3KA 2P0OA 5AN7A 1QAPA 4FIRA 4IJBA 4JD4A 5HMSA 4UNKA 3W1PA 1V7YA 2JKEA 1LM1A 3KVLA 1I2OA 4GNJA 2CW6A 4HKPA 5LNVA 4P61A 4LVBA 2GPTA 4MVAA 2FTPA 3S1UA 4WX2A 3IIPA 4PL2A 1GYLA 5G1TA 1X1ZA 3EB2A 1N8FA 5HR6A 2WO5A 4A2SA 3W2LA 1OHLA 3P7YA 4TX9A 2E5BA 3BO9A 1H50A 2W6RA 4LUJA 2QCFA 3W71A 2YPIA 3P60A 3WK0A 5KMYA 1J5TA 1W3IA 1H60A 1WBJA 2D73A 4LT9A 1ICSA 3HGJA 3L0NA 4AXKA 5D30A 3W84A 4DO5A 4LTSA 2VELA 4DQWA 1KLZA 1TMHA 1KBJA 1W5NA 3E9AA 4KWVA 1H7NA 3IVSA 1NVMA 3C4UA 4ZQCA 4NX5A 3W2KA 1A5AA 1AW1A 1VZWA 4ADSA 3IRDA 4LS0A 2QUUA 3BLIA 3HF3A 1TQXA 3GYEA 2P1FA 5C55A 2QR6A 4AB4A 1UASA 2QCGA 1BEUA 3T55A 3LXBA 1PHQA 2ZYFA 3G18A 3HG5A 1FY6A 5L6UA 2J6XA 2A0NA 3S5NA 5MHBA 2RDUA 3SI9A 4JTSA 3P82A 4IMDA 4JYDA 4PTNA 4GJ1A 1H51A 4MFDA 3FOKA 4NNBA 3O6CA 1VJIA 3W7LA 5HINA 1EWDA 5K7JA 3KVKA 3S1XA 1JJKA 2H90A 3M5YA 3PBWA 3MHFA 5FI8A 1LBLA 1W56A 4A29A 4Y9AA 4UTKA 4LC8A 3EXRA 1OYCA 2E6FA 2YXGA 4K36A 3CQ0A 3WFAA 4BWLA 2CLIA 3IIZA 1B3OA 3LCIA 4O10A 5G2WA 4RR4A 1EUAA 4B5NA 2LLEA 1IGSA 3V75A 1KFJA 1ZJIA 5I3JA 3G3DA 2ZRYA 1TPUA 4UFJA 3GXTA 3D0CA 4ADTA 4LV9A 4KFNA 3Q37A 3DFPA 4Z0SA 1K3UA 2FPTA 2Y88A 4IMFA 4A2RA 3GB6A 4MZ1A 3DI1A 1NAL1 1AW2A 4NJHA 4E2DA 2WJZA 2YYTA 3EX1A 2NX1A 4GE8A 3WK3A 3G1FA 1XC4A 2FIQA 2Y89A 3G3MA 3QM3A 3CC1A 5J5DA 1GTHA 3DBPA 2XFWA 4HSOA 4OT7A 4YXGA 1SO6A 3QC3A 3P74A 4N9BA 4NJKA 4FIQA 3PBUA 3LRLA 4ZL1A 3W7IA 2C16A 3A21A 1XM3A 3PUOA 2O7QA 4J9JA 2X16A 3L5MA 4LUIA 2V2DA 1GVQA 2VFFA 2WSYA 4HHPA 3P67A 5AC6A 1EB3A 4NQ1A 3W83A 3M5ZA 4IMEA 3HGOA 3WJYA 3L2IA 2V2HA 4QM1A 3T44A 3FJLA 4LU0A 4GUIA 3UPWA 5J5RA 1KFKA 4LOCA 4HNTA 1LYXA 3BPWA 4Z1DA 1LLWA 3STCA 4QIUA 1FUYA 3C0JA 4WY0F 1GQNA 2ZA3A 2QCDA 3A24A 2J24A 1QDSA 4CQ9A 1GPWA 4IGHA 2EKCA 3RNDA 4DBEA 1W8SA 2BTMA 1KTNA 4JTUA 3LLDA 4FNRA 1ZAJA 1OJXA 4HN4A 3G1YA 3TR2A 1W37A 2ZDRA 2NUXA 1D3GA 3HG3A 2CLKA 3HPZA 2GQ8A 3SFKA 4O50A 5H91A 2YCEA 2VKZG 3MUXA 3LX9A 1P0NA 4H3DA 4ALDA 4XBKA 1QPOA 3M41A 3C8FA 3G1AA 4ORIA 3NQ8A 3NA8A 4WOZA 3CWNA 2E6AA 6TIMA 4IX0A 3I7SA 1LRQA 1YXDA 5CZJA 2WQPA 3SZ8A 3HO8A 2VFHA 5A8GA 3LLFA 1VS1A 4IMCA 4WQ6A 3GXNA 1GVRA 1XBXA 3W1LA 3W1UA 3EEGA 2VENA 2QJHA 1GZGA 4NJGA 1Z42A 4JDBA 5CKSA 3G8EA 1VQTA 4Q33A 4K8HA 3NL5A 4ONVA 3UYCA 1JUEA 2H8XA 2CLMA 3W7QA 3HMJG 1Q6OA 4JTGA 3IVUA 2E77A 3NQ7A 2B7QA 5D04C 2I9EA 1AL8A 4WXZA 1TREA 3EWBX 1JCNA 1OFRA 1N55A 4JTFA 1YPFA 2ZTJA 3C3NA 1GG1A 2CZEA 3KAOA 3TROA 4N6FA 1CI1A 1ZCOA 4IPIA 1KTBA 2OT1A 2JKPA 5EMUA 4FO4A 1TPC1 1E51A 3TFCA 5EA9A 2NWSA 1K7FA 1SFLA 1PIIA 3A5FA 3SGZA 2IQTA 1AG1O 1LRNA 1LRTA 4TMBA 3W7PA 1JCXA 3RF9A 3L5LA 3PBVA 2BWGA 5F4SA 2QJGA 3UQNA 4DO6A 1EPXA 3PM6A 1WQ5A 4JY8A 2QJIA 4AF0B 3W7NA 3PC0A 1A5SA 2V5LA 3VI2A 4GUFA 3DHFA 3W1MA 3GDMA 3TJXA 2YFOA 3RLVA 3TJLA 1RVGA 1KFBA 4XQ6A 4O15A 5FEZA 4OBTA 1XUZA 2FDSA 3NQ2A 5D37A 3W86A 2Z6JA 2OJPA 4W9TA 4JTKA 2GUUA 2VOMA 1RQEA 1FDYA 4JY9A 2Y62A 4NZFA 1J4EA 2A5HA 1F6PA 1GEQA 5CSSA 3C52A 4JTTA 4IXXA 4UFHA 1THFD 3KVJA 4MYAA 5CSRA 4XUGA 5C5YA 3UPBA 2UV8G 1GVSA 3W74A 3C61A 5F1VA 3Q58A 4RLIA 2QAFA 1VCGA 3CIWA 3NQDA 1GG0A 3EXTA 2YGYA 1ZALA 4UTTA 1XI3A 1VLWA 2E68A 1PS9A 2A85A 2Z6IA 3O6DA 4G1KA 3NEVA 2QDGA 1GJPA 4Q32A 2AAMA 1JCMP 5LKYA 3CM4A 3HJZA 1Z44A 5DCBA 3RU6A 3LCLA 2WKJA 5H2ZA 3FLUA 5D03A 1OVDA 2WSQA 3A9IA 1W5QA 1ICPA 3GDLA 2FQIA 2TPSA 3GDKA 5TQLA 6ALDA 3UWWA 1C29A 4JTHA 3QMSA 1D9EA 1O5KA 4KWWA 4CQAA 1DOSA 2C3ZA 4H4IA 1XDLA 1PCKA 5GVJA 4MOZA 3DGRA 3UY8A 3FJ6A 4PFMA 1HO1A 2BLEA 3AO0A 4C1LA 3ZWSA 4LVAA 3STEA 3M1ZA 1Y0EA 3WJXA 4CNOA 1TRIA 2FJKA 2RDTA 1J2WA 3W2NA 3ZS4A 1ME7A 1H7PA 3W07A 4JTJA 1KW1A 1P4CA 3L66A 1AK5A 4MUZA 4XWUA 2V82A 3ABOA 3TKFA 1K03A 2ZZ6A 3EKZA 4JX5A 3HG2A 4CQ8A 3IGXA 1Q3NA 3NQVA 2Z2UA 4R53A 1SU5A 3R89A 2X2GA 2DZPA 4N2YA 2FPVA 1M7OA 3PS7A 1TO3A 4MKNA 4UFKA 1VYRA 2QKFA 2NZLA 3NQCA 5LHEA 2TSYA 3NQEA 5AHEA 4HSNA 2Y85A 2DZSA 3THQA 3LXCA 5ABTA 3R12A 3QSTA 3CB8A 4KFPA 4ICNA 5F2GA 1RD5A 2ISSA 3UWVA 2ZZ7A 5K9XA 4AAJA 4WY0A 1R30A 2JBMA 2B4GA 1UB3A 5CPNA 3FFSA 4M7SA 3ABQA 3K30A 3CU2A 3W73A 1XBYA 1TSIA 1WX0A 2ZRUA 1FX6A 1B4KA 1A5BA 3NL6A 2A7NA 4EVZA 1B4EA 1D3HA 4BWLC 7TIMA 1L6SA 2EAWA 4ML9A 1SW3A 1XUUA 1EIXA 5C54A 3BG5A 1MXSA 2PRMA 4TU1A 1SW0A 1X6UA 2YDAA 4M19A 1XDMA 4FXSA 4JEQA 4DPPA 3SY5A 3HQ1A 3HGSA 2ZRWA 2F7FA 4FXRA 1YDVA 2BSLA 1ZHAA 3N34A 3NL2A 4LW7A 1GVOA 5G4EA 4WUIA 1VH7A 1MSSA 3TQ0A 1BTMA 1UCWA 1U5JA 4LS2A 4M5PA 5CPLA 5HWMA 3GAYA 1Z48A 2HS6A 1FWNA 1AW5A 4MJMA 5D02A 3OHIA 5AHLA 1QPNA 5U7SA 3TIMA 2E5DA 3PWAA 1JQVA 5CG7A 3HB9A 5LZLA 4NNAA 2V0TA 1XBVA 2E6YA 3W9ZA 3RLUA 1HO4A 4LC6A 4K8EA 1LOQA 1YTDA 3W7RA 3STFA 4BF9A 3EX2A 4DF0A 3I7RA 3IGSA 4K6AA 5FF7A 4UMCA 3HPSA 2I1OA 5DY3A 1QPQA 4S2CA 3S6DA 3NPVA 1OX4B 1X8FA 3LHVA 1F7BA 5LGZA 3PY2A 3HOJA 1TRDA 1JR1A 1I2RA 1OYBA 4DXVA 1DQXA 3EXSA 1ZY9A 1LZOA 3SW6A 5EPDA 2ATSA 4OWGA 2BZNA 1EWEA 4NNCA 4CNNA 1QO2A 1H7XA 3N19B 4FB7A 5BW6A 2VEMA 1KA9F 4UMAA 3R8RA 3M9YA 2NX3A 2NV2A 3M5VA 1FXPA 3H54A 3TMQA 4JR5A 4S1FA 4RJEA 4K37A 3QPZA 1QR7A 2QF7A 1G4SA 2DU2A 3PSWA 1ZENA 2X30A 1IXQA 3OG3A 2X1UA 1HFBA 5FEXA 1VCVA 3WJSA 3L21A 1Z41A 3W22A 1YLVA 2DZTA 3EWYA 3VE7A 5D2VA 5FF3A 5KINA 1TV5A 1SW7A 4KKXA 1O95A 2V30A 4DEFA 3CEPA 1XCFA 2V5BA 2B7PA 1FDJA 4AHPA 2YZRA 2VFEA 1W54A 3B06A 1SZNA 2DZVA 2ZZ5A 3LXAA 4IX2A 4QITA 2VXNA 1PCWA 3YPIA 4AH7A 2J9ZA 3TXVA 3H53A 1R46A 3DFNA 1ME8A 3P5ZA 5I3IA 5D05A 1YTKA 4MLJA 4AMAA 3H55A 3LTPA 1ZFJA 4X9SA 5HWNA 5KZDA 5BMWA 4R34A 3RFAA 2ABAA 3PR2A 2B0MA 3LCXA 5A5WA 4NX0A 4A22A 1XKYA 5BMXA 4JX4A 2YSWA 2ZRZA 2ABBA 3NQMA 5BRBA 3TV8A 1OFEA 1ONRA 2V8ZA 1K02A 1SO5A 1VYPX 4D2JA 2GQ9A 1DJNA 5D33A 3N9SA 3FKRA 4ZQPA 2ZCGA 5IBXA 1L9WA 2QCEA 2Y7DA 1JQXA 1P1XA 1DJQA 3MO7A 3L68A 3IIOA 5AYXA 2G97A 5FEPA 3LGEA 3FS2A 2WSRA 3NQ6A 2VEIA 1LORA 3M16A 3NQGA 1QFEA 1OABA 4LNYA 5D2WA 1KV5A 3LRKA 2YW4A 2ZZ1A 2Y61A 2YYUA 1GYNA 4MIMA 3T4CA 2QCMA 5EL1A 3W7CA 4JXCA 3S9YA 1H5YA 1WDWA 1W5PA 2VFIA 4IPJA 2H6RA 4LRSA 3NYZA 3N14A 1OFBA 4UTWA 1X7FA 5HJLA 5T26A 1JULA 4O1CA 4UXDA 3UZJA 1LOSA 3G1XA 3B0UX 5HR7A 3LERA 1DORA 4I7VA 4POCA 4UNLA 2CZFA 1K8YA 5E93A 4DF1A 3U2OA 3NNTA 1BKSA 3KOFA 2B7NA 1VHCA 4GFSA 1OX5A 3OBKA 4FX8A 1FBAA 1HG3A 1PL9A 4X2RA 4EF9A 2RKXA 3O06A 4BFAA 1G6CA 4FEZA 2FLIA 4RZ6A 4CCEA 4KFOA 2YFNA 3VE9A 1GTEA 2H3DA 3KX6A 3N3MA 3GLCA 4HNUA 1R2TA 1WV2A 3NDOA 1SSGA 3GR7A 3G1VA 3B8DA 3N9RA 4UTTC 3GX9A 2FFCA 1TYGA 1KM6A 1IF2A 1P0KA 4ZVJA 3PG9A 4MJZA 3KRUA 3P81A 4Y96A 3NQAA 1W31A 1EP2A 4O4WA 4UTHA 5DN1A 1QNVA 1FWRA 3UXDA 4M6PA 2CLFA 3ANYA 2W0UA 3A5VA 3S8HA 3TA6A 3JR2A 2AGKA 4OU1A 1ADOA 4ZMGA 1YXYA 3TQVA 2V2CA 2DP3A 5HWJA 1KLYA 3U6WA 4TMCA 3QSRA 3KRSA 4HNVA 5CPOA 3ATZA 3WJZA 1TPFA 4WXYA 2NUYA 5LSMA 1OFOA 1TCDA 1YTEA 3NG3A 2QDHA 3WJWA 1KFCA 3QRHA 4Y90A 3LBMA 1L2UA 1OF6A 1LDCA 1QMLA 4GRSA 2Y63A 4HPXA 2Z1BA 2C15A 2YR1A 4RK8A 1B9BA 2Y70A 4IXHA 2TYSA 4MYXA 1FWSA 2GJLA 2E5CA 1IIGA 2C1HA 3O63A 1VC4A 4DELA 4JICA 3B0VC 4BI7A 4LS1A 3LHYA 1WOAA 5IM51 1O4UA 2EGZA 4YCPA 1GOXA 2WNQA 1QOQA 4LVFA 1K7XA 2QCDB 3EWZA 3C2RA 3L0GA 3T7VA 1H1ZA 4O28A 4Z1CA 2C19A 1TTJA 4JTIA 3SGUA 2VEKA 3FKKA 5KZMA 2QEZA 3TSDA 1SZEA 3NL3A 5D38A 4NXKA 3G1SA 3W7MA 3MMTA 3BVJA 3M0ZA 5DCEA 1FQ0A 2DZWA 4QISA 3DFOA 5LGXA 3L0KA 3DFTA 3BG9A 4OV9A 2I14A 1KM4A 1TB3A 3MBDA 4ZQMA 3QJAA 1H7WA 3M47A 3PB2A 1KFLA 1EP1A 2JGQA 3TH6A 2OX1A 2CLOA 3P5YA 1OF8A 3GIYA 2A1YA 4S2BA 3W2MA 3EX3A 5D2YA 2R94A 1T99A 3F4WA 4O0KA 5CZTA 1YADA 2DZUA 1F5ZA 4ZQOA 3L9CA 2QCLA 1M5WA 1XBZA 3NZRA 5DBUA 3ZR4A 3G24A 4N4PA 3CWOX 3C2FA 2QCCA 2NXIA 3FIGA 1YDNA 3W7OA 1VPXA 3IV3A 4AWSA 2G5WA 2FB2A 1I2QA 5I3GA 2Y7EA 4N9EA 2R91A 3DAQA 1KM5A 5BOOA 3BW4A 3W7GA 3SECA 2ZZ4A 1PV8A 4N02A 4AHQA 3MI2A 2XN2A 4UTJA 3GKAA 4QAIA 5G1YA 4JIQA 4TIMA 5KSWA 3A23A 1HUVA 4O0ZA 4OHQA 1TJPA 4QNWA 4O8RA 4IUOA 4FNUA 1Q6RA 1SQ7A 2ZQ0A 1YXCA 4Z08A 2G95A 5L9FA 1OX6A 3MW7A 3HBLA 5CPMA 3B04A 4YCOA 2H3BA 1G7VA 3MHGA 2EF9A 3USBA 4A21A 5FESA 4FNSA 4O13A 3LV6A 2V81A 2QUTA 2B7OA 2HTMA 4RV8A 3MYPA 2DJLA 3NXFA 3EX4A 1B57A 2A7PA 1RPXA 1OFDA 3TQKA 3W70A 3DHDA 4IQLA 3P61A 3T40A 4X22A 3W88A 2PE4A 4Z1BA 2PC4A 5EYWA 2ZA2A 2CU0A 1IIHA 4NUWA 1OG0A 4GUJA 3C2EA 4BK9A 1K8XA 5D09A 1LTDA 4QNEA 2CZDA 1JCYA 1T96A 5K4ZA 3MYOA 1KM0A 3LBCA 1KBIA 5LNUA 3QMRA 3P8JA 3PVFA 3MWAA 3ABSA 3NM3A 3LHZA 4NT0A 4MFEA 2C6QA 2R14A 4CCDA 3S1WA 2J9YA 3O05A 3W3OA 4O52A 4EOUA 4K7VA 1UUOA 3BG3A 4LVGA 3FYOA 3TFXA 3TK7A 3WK1A 2R8WA 1S3HA 2YW3A 4UFLA 1ZAHA 4GC4A 5D2TA 1C8VA 4X3ZA 1I2NA 2P10A 2JKAA 3BW2A 3LOTA 4DBDA 5AHNA 4UR7A 3TAOA 4I9AA 4ZZ9A 1IXOA 4UFIA 4N9DA 1FXQA 1VGAA 2PURA 4LRTA 4QQ3A 2KZHA 5C6MA 1TTQA 3QZEA 3T78A 3U8GA 4YL2A 3GXPA 4FHAA 2JK2A 4OE7A 2E6DA 4O1DA 3PUEA 2NXGA 2CFFA 3QMTA 4LVDA 4UTMA 4JX6A 2XN0A 4PH6A 4MLRA 4MY1A 4JNMA 1SFJA 4ADUA 2CZ5A 2NV1A 3QQ1A 3E0IA 1T8XA 1S5TA 3MI3A 4AHOA 3UWZA 4MY9A 2EPHA 3PAJA 5F2LA 4ORMA 3LHTA 2GVJA 3BARA 4RX0A 2J88A 4E2BA 3KXQA 1KV8A 1NEYA 4QJ1A 3JRKA 2Y7GA 1VLIA 1EX5A 4WJEA 4XKYA 4OQVA 5E1QA 4JYFA 5IBXC 3TSMA 1X1OA 3PSVA 3E96A 2CLEA 4AEOA 1YDOA 1WXJA 3S5YA 1OK4A 4GWEA 3O1NA 4K39A 4LWWA 3W1XA 5HULA 1BWKA 1SR9A 3P8IA 4PODA 3C6CA 5EBUA 3N2XA 5KITA 4Q4KA 2CLLA 3W7JA 3UXAA 3IVTA 1LP6A 3OVRA 5AHIA 2V9DA 3TC7A 4O54A 4UTLA 5F2MA 3A22A 5DXXA 3DFSA 5EY5A 1I8JA 3MBFA 1G7UA 3W6YA 4UTWC 5SWUA 3OIXA 3B0PA 3S5OA 5LNSA 3MI6A 5TIMA 1VYSX 3LI0A 1DKWA 4P2VA 2Y6ZA 1L6YA 1DL3A 1GT8A 1OFPA 2JGYA 3F03K 3TUUA 1AMKA 3TCEA 1W3NA 2X1SA 3MP3A 4XBSA 3W2JA 2J9XA 4WZHA 1EP3A 4JN6A 1WYIA 4RKAA 3CIXA 4N4QA 1UJPA 4O4VA 4RXGA 4WY0B 4GUHA 4NU7A 4CLMA 5K2ZA 4DF2A 1Q6LA 3NVTA 3G1HA 2HMCA 3OA3A 3PULA 1L6WA 2F84A 3TC6A 1IXNA 4LY8A 5E0KA 3W23A 4BR1A 4JGDA 4O57A 1H1YA 3W7DA 1JRBA 3I65A 3HG4A 3HPXA 2WV8A 5KTLA 3TW6A 4TO8A 4FX6M 2QAPA 3LCFA 3PB0A 3DU0A 1RZMA 5CZSA 3SSJA 3GNDA 8TIMA 4R33A 3B05A 2H8ZA 2VEPA 1TPVA 3LHUA 4DO4A 3UNDA 3SR7A 1BWLA 3CHVA 3BGGA 3IEBA 3QW3A 2OT0A 2VFDA 2TMDA 1IXPA 5AB3A 3KFTA 3DKJA 1MO0A 3P62A 4UIOA 1SSDA 3MJYA 2BXVA 4XKYB 3TNOA 1OFQA 3W76A 3G8RA 4JDYA 1SO3A 4O19A 2Q8ZA 1ZAIA 1TQJA 4JYEA 2ZTKA 4N6EA 4IOTA 5AYYA 4H6KA 5D2XA 4O1AA 2NX9A 2XN1A 3W1TA 2RHGA 1R2SA 5FF4A 3W85A 1K7EA 1PE1A 1JUBA 1ICQA 3VFLA 1PVNA 3L5AA 2HS8A 5F2IA 4UTIA 4XTDA
chains in the Genus database with same CATH superfamily
2ISVA 2WNWA 4PTWA 2DT1A 5DANA 1SFTA 3A6OA 2O4MA 3TU9A 1JUKA 3LQLA 4GISA 4L80A 3W1QA 3HQOA 1FVPA 5CPTA 4NXSA 4ACZB 2E40A 4D71A 3POHA 2DEPA 1VP5A 4MB4A 2YBVA 3BGAA 5CPSA 3GAKA 3B3DA 2D24A 4NZJA 2PWUA 4HTBA 3WUFA 2QUVA 4PUWA 1Q7MA 1FWEC 2BS9A 2O9PA 1PZ1A 1KM1A 3PUGA 1T40A 3R6IA 1TPEA 3AIUA 3QHOA 3W1AA 1V02A 1MEWA 1AL7A 2P76A 5FJUA 4KWOA 5IDZA 2V68A 4GBDA 2HVNA 2FZ9A 3P84A 3LDVA 3V3WA 2PRLA 1EBHA 4AX7A 3L4XA 2D0HA 3M5XA 1SZGA 1I2PA 1LBMA 5LNRA 2JE8A 2OFJA 2YCJA 4K38A 1DJIA 2E1WA 3WF1A 3EGJA 4IM4A 3SRHA 1BF2A 4DUVA 4MB1A 1TR9A 1F05A 5LA0A 4L6OA 5E6YA 4AZGA 3DENA 1RCOB 2HSAA 4WHBA 2EG8A 3GH7A 2C14A 3ZJ8A 3AU6A 2OMAA 2FB3A 2OCZA 3TW7A 3PWGA 3H21A 1DQWA 2XIMA 2WQDA 4DJDC 3AZRA 1WXZA 4Y9PA 2W66A 2PUZA 3O07A 2E7FA 1N2VA 4YWIA 2OZ0A 1A49A 1RALA 2CESA 3BLOA 1V79A 4UCGA 1RAKA 4OIFA 3BK0A 3R0KA 2WMKA 1E9LA 4A8RA 1TV7A 2EBNA 3VAVA 2VRQA 1XQKA 1G1YA 1GOQA 2PEVA 3OEXA 1OM0A 1G4PA 4WVXA 4IMGA 4FNPA 3G5EA 1ZJAA 1VEPA 1E3ZA 4ERAA 1KM3A 3G0XA 3NZ1A 2F2HA 4IP4A 3GDTA 3L67A 3MS8A 1JDCA 1C91A 3MMDA 4W8BA 3N11A 3LBOA 3V1HA 3DG6A 4H8NA 4AXNA 1M53A 1W32A 1UBSA 1R85A 3TAKA 2ACUA 3O16A 3BOLA 1MDLA 3RMJA 4EWND 4OV4A 2QVNA 1UR4A 1S38A 1NF0A 5HK4A 3QTGA 3W72A 2ZRVA 1SPQA 4K1GA 1JCTA 4PL1A 5FACA 5HMDA 5KZEA 4DAFA 1E70M 4UOZA 2BX7A 2ZUSA 7ODCA 2HZGA 4C1NB 4QSHA 5A2AA 3SIMA 2R24A 4JFSA 3THAA 3AJXA 2FKPA 1EO7A 2V69A 2FVMA 3TW9A 1P0EA 4Z2JA 1ZCCA 3AYSA 2E09A 4IWWA 3GD6A 1US2A 3MKKA 3WFLA 4W7WA 1A0EA 3N2MA 3QFEA 3BQ5A 3RK8A 3LTYA 1IWPA 4JTLA 3KRBA 2GVYA 3CO4A 1NOUA 4RXFA 4Z2HA 2ZE0A 2GJNA 3A4AA 2PWDA 3LUTA 3RPMA 1DWGM 3AMKA 4IPLA 2PLCA 1LOLA 3NUKA 5AYZA 3AYVA 3WQFA 3BLEA 2WOQA 1UUMA 4JS3A 4KIEA 1DE5A 1KFWA 4DRSA 4F48A 2VRJA 1IQ8A 2GJRA 4LCQA 3V0UA 4YTQA 3F5LA 1UR3M 4MNLA 2PRHA 3F4NA 2PCQA 4N42A 4WOQA 3EBVA 2W4XA 1H7RA 3ZO9A 1ME9A 4DN1A 4XK2A 1UOKA 3GFZA 5K4XA 1OCJA 1W3KA 3WDHA 1OG6A 1BVZA 4M1RA 5LA1A 3B4UA 5H6HA 5A94A 4GYJA 3H22A 4CCCA 1XS2A 3D6NA 4L5ZA 2VTFA 4WD0A 1JZ2A 3VCRA 1VBGA 3AMCA 3ARRA 1JZ7A 4AWUA 3K1GA 4PTXA 2VX6A 1LQ0A 4H7ZA 3Q65A 3DFQA 3E0FA 3U7BA 3LPPA 3NAVA 3L4VA 2JF7A 3WLLA 1NQ6A 1Q4WA 4Y6GA 4HVXA 3NPXA 3GG7A 1YPIA 4E4FA 4IMAA 4QDPA 3GH4A 3LI1A 2F6KA 1QBBA 3HIJA 4AFYA 3DKLA 4P5UA 3VIMA 3TYAA 3WKZA 3WLKX 5C2XA 4G56A 4XD5A 2QYGA 1LL6A 3VDAA 1FCVA 3TR9A 5I03A 3QY8A 3UNTA 2VFGA 5K3VA 5BXTA 5HQEA 5BNKA 3UY7A 4OOZA 2G3FA 1GGOA 1W2PA 1BYBA 3R5EA 1R7OA 5DBTA 3NDYA 2X1IA 2POZA 5I79A 3VOHA 3T6CA 2R1PA 4L7ZA 2DUZA 1C7TA 3PZIA 3PF3A 3SCRA 4IIHA 3LRMA 3QEZA 1BD0A 4JIPA 2EPNA 1QWKA 3S0CA 1QUMA 1V3MA 1DV7A 4O14A 2V3EA 2L5HA 2QS8A 1OB0A 1F2JA 1DBTA 1XSKA 3NXLA 3AIEA 2X05A 1J18A 2D1ZA 1SO4A 4M7TA 3PG8A 2Y0FA 1YBQB 3ZWTA 1A4LA 1TTIA 4HPGA 1V5XA 4GXMA 3C5QA 4XVEA 1CENA 3KTSA 4JIRA 1UWSA 2RDWA 5LHFA 2XFYA 3SN0A 1OD0A 3LG3A 4I7UA 1F61A 2VGFA 4I8YA 3OB8A 4JD4A 3ANUA 3SB0A 4UNKA 1V7YA 1LM1A 1WE5A 4LB3A 1DWFM 3MMUA 3FAXA 4LVBA 4HCHA 3HURA 2GPTA 5CEWA 2ANUA 5BXPA 3MWCA 4IT1A 1KBKA 3IIPA 4PL2A 1X1ZA 1JGMA 5JH2A 3TEVA 2XH0A 3W2LA 4XV0A 1H50A 2RJHA 4YWSA 2W6RA 3W71A 3P60A 3BJSA 3GXFA 3PPHA 5KMYA 1RA5A 3A4XA 2P3EA 1ECQA 4GQBA 1AQFA 3URNA 4DQWA 1TMHA 4LUSB 2QGYA 1NVMA 1FOBA 2X8RA 4ADSA 1FWBC 3BLIA 2P1FA 2O56A 4EANA 5DMLA 3H2AA 4H9UA 3T55A 1QJWA 1FY6A 3KCJA 2CXGA 2J6XA 1BPLB 1V3IA 5MHBA 2RDUA 5BCAA 3SI9A 4DX3A 1H51A 4AVNA 3MUIA 3FOKA 4H9TA 3O6CA 4IP5A 4CNTA 3CYVA 1VJIA 1EJWC 1EWDA 1JJKA 1XPGA 2H90A 1ZBCA 3M5YA 1LBLA 1EQPA 2ZXQA 1OYCA 1DPMA 2YXGA 3A47A 4K36A 3LCIA 3VD7A 2RGLA 3IJ9A 2ZRYA 2GSEA 1R0MA 2CXEA 4F2UA 3URAA 4FS9A 3D0CA 4UQBA 3ZIZA 1DTUA 2RJGA 2WJEA 3KWSA 4LV9A 1LWJA 2WZIA 2FPTA 1JI1A 4A2RA 2J6VA 3KS5A 4W8LA 1XGDA 4QDMA 2ZX6A 4Q4MA 3UT0A 3EOSA 3CMFA 4HYWA 2VCBA 2WJZA 1P6WA 4GE8A 3W28A 4V2XA 2ZX7A 3G1FA 1XC4A 4NAFA 3FK4A 2FIQA 1LQAA 3G3MA 5J5DA 3RDKA 1VIZA 3DBPA 4YXGA 1SO6A 2GGGA 3PBUA 3KLKA 4ZL1A 2V5JA 3W7IA 4FMVA 5BXRA 4IQJA 5EMMA 4K3ZA 4GIAA 3GU9A 4YNGA 2E4TA 1SJCA 1V93A 1TZ7A 2V2DA 1GVQA 1KGUA 1QNOA 4KCWA 3WUEA 3T42A 2VFFA 3LSBA 5EGRA 5AC6A 2YDRA 4CD8A 3NSNA 3M5ZA 4IMEA 2AAAA 3WJYA 4LYRA 2V2HA 3RILA 3FJLA 4LU0A 5C9WA 4MDOA 4HNTA 2Z4GA 3BPWA 4Z1DA 3MUZ1 3GM8A 2I57A 2J8TA 2E0PA 4QIUA 3VNLA 4D6HA 2VQUA 2GL5A 2QCDA 3A24A 4RDVA 1Q85A 4WGHA 2ZC1A 4LAMA 1IZCA 3FXYA 2EKCA 1NQKA 1W8SA 2UY3A 4JTUA 4GINA 4E2OA 3LLDA 1R9YA 4HN4A 1W37A 2Y8UA 2ZDRA 5CBBA 2VVNA 2CLKA 2IXVA 4KPLA 3KBMA 4EX4A 5A6JA 4HK5A 2YCEA 3SCQA 1QW7A 1WZKA 2ZUVA 3UCQA 4H3DA 3RPDA 1FH8A 3GHRA 4W87A 2X2YA 7XIMA 2HV5A 4DXKA 4WOZA 6TIMA 4IX0A 4HZ6A 3VMPA 4MNMA 5CZJA 1A5UA 2WQPA 5A8QA 4G9PA 2YB4A 2C79A 4IMCA 2PFHA 4OTKA 1WCGA 1FA2A 2RUSA 3EEGA 4F8XA 2WJDA 4MHBA 2PTYA 1J11A 1V0MA 4K8HA 2Y4SA 3UYCA 2XSAA 2H8XA 1Q6OA 4JTGA 1BG4A 3PTMA 3IVUA 3NQ7A 5D04C 1IGWA 2XZ7A 1AL8A 4WXZA 5FCZA 1TREA 3EWBX 4K8GA 3QC0A 1LUCA 2AL2B 3PN8A 5D4YA 5CLWA 3LZ3A 3UZZA 2DSWA 1TPC1 2ZUWA 5GJMA 4GO8A 1WPCA 1SFLA 1PIIA 1HJQA 3SGZA 1AG1O 1SVDA 1FHLA 4TMBA 3WFZA 3AMLA 1E1EA 1JCXA 1TVNA 4DHGA 3PBVA 4ZCWA 2VD8A 3QZAA 2DQXA 5A8MA 3I6EA 5BYWA 3MANA 4AF0B 3T05A 3W7NA 2V5LA 2VYOA 1WDRA 2QGHA 4J3SA 3RLVA 4PMUA 2P53A 4O15A 2HRWA 2VDHA 3FDGA 1H5VA 4OBTA 3W86A 4PMZA 1KRCC 4JPGA 1RQEA 3EYPA 1IE7C 1FDYA 2PDBA 2Y62A 4AZCA 3CT2A 5CSSA 3KCLA 1CXEA 4CNSA 1THFD 1E71M 2W91A 3K2GA 4J3VA 4AD3A 3UFYA 3QLLA 1XH2A 4HYVA 4ICMA 1W9UA 4QS5A 4XO7A 1ZALA 1Q7QA 1VEOA 4FLOA 1ECEA 4L64A 3FYYA 1F4AA 4MAVA 5FJPA 4M81A 1HL8A 3FAWA 1ZLPA 2BY0A 3O6DA 4G1KA 2VDIA 1G5AA 2YCLA 3QV8A 5LKYA 1VFUA 3HJZA 1ITUA 3LCLA 3S3GA 7REQA 4AQLA 3FLUA 4V28A 4GJJA 1UKPA 1F07A 1E1CA 2VO5A 4V27A 3EB4A 1X7IA 1M7JA 4RW5A 4C6IA 4IQDA 4D8AA 4JTHA 2GK1A 4EAMA 1O5KA 3CV6A 2J62A 4Q8OA 5GVJA 1J0ZA 4MOZA 6ENLA 3ZWSA 4LVAA 1VB9A 3M1ZA 4E4UA 1Y0EA 3GFXA 3SUUA 1BQCA 4AY7A 3FXGA 1T7LA 4P8UA 1XQLA 2EKGA 4JTJA 3PTKA 3VO0A 1AK5A 3IUDA 4XWUA 2V82A 4Q8PA 4UB9A 3W02A 1O1HA 4IPNB 1E9IA 3WYZA 3VD4A 1HT6A 1DJYA 2OQYA 2XYLA 1M7OA 1TO3A 3NQCA 2E9LA 3VNKA 5AHEA 4AD2A 2Y85A 2DZSA 1ZPTA 1E6NA 3R12A 4JN7A 2J7EA 1NDVA 1U2YA 3I6TA 1UBPC 5F2GA 4AISA 3ZR5A 1RD5A 4XAGA 3B97A 2ZZ7A 2B4GA 5CPNA 1UIOA 3FFSA 4DJDD 3K30A 1UWAA 2ZRUA 1DIKA 1AVAA 3BDKA 1A5BA 4GYKA 1YIXA 1L6SA 1PO9A 2EAWA 4ML9A 3CPUA 2J7FA 1MXSA 2PRMA 1J93A 1SW0A 2YDAA 1XDMA 1Z6KA 4FXSA 4GQRA 3SY5A 1ZB5A 4PMOA 1XSJA 4DVOA 1S2UA 4V33A 1NM9A 4FXRA 3B9NA 2UWFA 1ISXA 1AJZA 2BSLA 2OLSA 3NL2A 4XD4A 1L8NA 1UH4A 4LW7A 1GVOA 2EPMX 5G4EA 5FAJA 1U5JA 4M5PA 3WMSA 4ZFMA 2CHNA 5CSYA 2WHMA 4NAEA 1E0XA 5FL1A 2YOCA 1YPXA 1AW5A 4GQGA 1KB3A 3RLHA 2JIWA 3F4DA 1W1IE 3SY1A 2E5DA 2G3IA 3HB9A 2OYLA 4YVVA 2VZVA 4RE2A 1XBVA 2E6YA 3BV7A 3SCSA 3VMOA 4LQ1A 3CUGA 3Q4DA 3W7RA 4BF9A 3GUWA 4NASA 1S5NA 2QV5A 3WNOA 3HPSA 1QPQA 2HPMA 2VWSA 1X8FA 3LHVA 2Q6ZA 5LGZA 4D6GA 4FLQA 1F3EA 4DBUA 1LG1A 1OYBA 4LAZA 1LZOA 2OVLA 3CGTA 2BZNA 3T2PA 4CNNA 1N8WA 1A0DA 1DWJM 3UVIA 5BW6A 4Q4OA 3M9YA 2NX3A 3M5VA 1VBUA 5XIMA 1FXPA 4JR5A 4K37A 3QPZA 1QR7A 1R9XA 2BHZA 2QF7A 1G4SA 1JYVA 2X30A 3OO2A 4D6FA 1HFBA 5FEXA 4B5TA 3WJSA 4PMRA 4Q8TA 1Z41A 3W22A 3B8SA 1XIBA 1YLVA 3NZPA 2QJJA 2DZTA 1XGEA 4QJ4B 1UYQA 2BG5A 3ARQA 3MUY1 4GMEA 3N9KA 4GO9A 1PKNA 1SW7A 1O95A 2V30A 3CEPA 3VK5A 2KX9A 5HNUA 1FDJA 2VFEA 4CN4A 3DN5A 3GBEA 3EA3A 5AYBA 1QHOA 2OZTA 3H53A 4W89A 1RY8A 1X97A 3DG3A 2DY3A 2HCVA 3DFNA 3P5ZA 1YTKA 4MLJA 3H55A 3LTPA 3WNLA 4A05A 2HBXA 3DHPA 2OO6A 3W26A 5HWNA 2E9BA 3LD5A 4W8AA 2ABAA 3LCXA 2EG6A 4JX4A 3ZT6A 3ITXA 2ABBA 1UKQA 2PDMA 2AGTA 4ZOCA 3ZR6A 4FAMA 3FW6A 4PRTA 3TV8A 4ZB5A 4Y9NA 1OFEA 3CZ8A 1EKOA 2V8ZA 1PX3A 4C6OA 3TOPA 4ZQPA 1A5LC 1XGZA 1NFPA 2ZCGA 1L9WA 4WJXA 1DJQA 4EXBA 3H2NA 4NRRA 3NQ6A 4XVDA 1LORA 2CNCA 3M16A 5REQA 3LRKA 2ZZ1A 5A6KA 4C6PA 3FHQA 3IJ6A 5LXXA 5E9AA 2V6AA 3PNZA 4IPJA 4LRSA 3SRDA 4DWDA 2XINA 4GY1A 1J0IA 1ZP3A 4UTWA 5T26A 1WKDA 4IISA 1JULA 3N4FA 2NQJA 4UXDA 3DFHA 2HE8A 3B0UX 3IJDA 5HJXA 3E3HA 3WD1A 4MWAC 3OZPA 3ZSSA 5E93A 4DF1A 5H8PA 3NNTA 3SQLA 3KOFA 2B7NA 5A6MA 1QI4A 5FSEC 2VM8A 1T41A 3CS2A 1H09A 1KBBA 2QUNA 1WNOA 4FEZA 4D72A 1LWHA 3VE9A 2H3DA 4TV5A 1XD1A 4AG0A 3N3MA 1IR1A 3RM4A 4AWEA 3G1VA 1PZ3A 3N9RA 4UTTC 3OZOA 4AZ6A 1P6CA 3ZQ9A 3GHTA 4Q8WA 1GOIA 4MJZA 3OQEA 3KRUA 3BL3A 1EP2A 4UTHA 4O1EA 1QNVA 4QCFA 1FWRA 4IIBA 2JQXA 3W81A 2REQA 5HNNA 4IPPA 2J75A 3G2GA 3TA6A 4AIEA 4OU1A 3BMWA 2FMNA 3IS4A 1O68A 3KOZA 2HVMA 1UD5A 3TQVA 5I23A 2VC5A 3BSGA 3HA1A 2GGEA 1CLXA 5CCZA 3HN3A 1ODUA 4TMCA 1B9ZA 3QSRA 3KRSA 8A3HA 5CPOA 4GPNA 3SCPA 3V0TA 3DIPA 3ZT7A 4AX6A 1OFOA 4GYPC 3AHYA 3WJWA 1KFCA 4F66A 1QMLA 1LDCA 2Z1BA 1P48A 4OKDA 4UCFA 4HJWA 1B9BA 2Y70A 2TYSA 1FWSA 2VR4A 2R1NA 3O63A 3WH5A 2CBUA 2WLZA 2VWTA 2X0HA 3MB9A 4DELA 2J7DA 4JIIX 4ILSA 3ITVA 4OECA 3O0FA 3R43A 1GOXA 4KW2A 3C2RA 3T7VA 4BS0A 3RUBL 4GLEA 3AUOA 2XIIA 2C19A 1PKYA 4FZIA 2DW7A 2GZXA 2ZWYA 3I3DA 1SZEA 4IICA 1WB0A 3II1A 1FQ0A 4GYFA 2DZWA 3SBFA 2G4JA 3DFOA 3KWXA 4HPHA 4DZ5A 4EWJA 2I14A 2WAGA 3QJAA 1JZ4A 1KFLA 1TX2A 2VUYA 3GTIA 3H70A 3REQA 2CLOA 5DMMA 1R5YA 3TYZA 2OPJA 1ZBVA 4GNVA 3W2MA 3SCTA 4O0KA 2YL6A 1YADA 1F5ZA 3KOXA 4BEQA 1TELA 3WF2A 4XBJA 4ZTYA 5CSUA 1ZQ5A 3SM0A 4QR6A 2BGSA 1E6XM 3EDFA 1EC9A 4GOAA 1YDNA 2XSXA 4B16A 1VPXA 3IV3A 2FB2A 1I2QA 2Y7EA 3DAQA 5BOOA 3GW0A 2ZZ4A 3DESA 1T8QA 2OYMA 4L65A 1JL8A 4DY1A 4GX8A 3SCVA 3GKAA 4JIQA 1XHGA 2Y5JA 2PTWA 3WENA 1CGXA 1TJPA 3N6QA 1FKWA 2ZQ0A 4Z08A 3MW7A 1BXCA 4NILA 4GJIA 1NWUA 1G7VA 2Q8XA 3WLJA 2WMHA 4FNSA 2OZ3A 2V81A 2HTMA 1WZLA 1B57A 4F3HA 4RE4A 4FLSA 2FZDA 4PBFA 3TQKA 3DHDA 2DSKA 5IHRA 2D20A 2EXOA 4Z1BA 5EMJA 1TJ2A 3B8TA 2CU0A 1RXOB 4NUWA 2VD9A 3O9NA 1OZMA 3CL8A 4S3CA 5D09A 4FLRA 1LTDA 1LF1A 2WPGA 1T96A 3AI0A 1BYDA 4KEZA 4FOJA 2VZUA 5DX7A 2VZOA 3LHZA 4LF2A 4NT0A 3AU2A 3SUTA 2C6QA 3EPOA 3W3OA 1AZ2A 2FMOA 4O52A 3FHAA 4E5TA 1HKJA 4H2HA 1C8XA 1HZYA 2HJPA 4UFLA 5D2TA 4X3ZA 6XIAA 3U5UA 3LOTA 3NSXA 3QLDA 2XISA 2O55A 1ADDA 1IXOA 3PANA 1UIPA 2Z00A 2KZHA 1RBAA 2PP3A 3U4FA 3IRSA 3QZEA 2JK2A 2W67A 2E6DA 2OQHA 3PUEA 3T8LA 2NXGA 3VA8A 4JX6A 4NZCA 4MY1A 4ICCX 4XIAA 2NV1A 3UWZA 3PAJA 1REQA 5F2LA 5JVLA 2GVJA 2WZEA 1F3TA 5A6BD 5MKGA 1QK0A 1VLIA 1GQKA 4WJEA 4V1XA 5IBXC 3QY7A 2CLEA 4QG9A 1E0WA 1YDOA 4FR6A 1OK4A 4YVPA 3H2EA 2QVHA 1SR9A 3C6CA 1V0NA 3S47A 1CTNA 2CLLA 2Z1WA 1R6WA 1C3FA 1KWKA 2HDJA 1Q13A 5AHIA 2Z26A 2P50A 5DXXA 3FN9A 5EY5A 5SWUA 5DRIA 5TIMA 1XV8A 5BU9A 4NF7A 1DKWA 4X63A 1GZJA 1GT8A 3TUUA 1W3NA 2GWGA 2PD5A 3V18A 4XBSA 4JQ3A 2PF8A 1C8QA 3CIXA 4LSBA 2IKIA 2DUAA 1XC6A 4NU7A 3WDIA 5FJRA 4CLMA 4J4KA 1Q6LA 3LN3A 2GUBA 4QJ3B 3ENLA 3PULA 4AD1A 4MM1A 3TC6A 1IXNA 5E0KA 3W23A 4BKNA 3HFTA 4O57A 3RM8A 2BVDA 1H1YA 2DZBA 2CCRA 3HG4A 4PFHA 3MCOA 3TW6A 3SAZA 4C6MA 2ZUNA 5ABGA 1NIUA 4P7OA 2XIOA 3SSJA 3GNDA 3TWAA 4R33A 1OGBA 3OOQA 4DO4A 3VKAA 1VJSA 3SR7A 4W5ZA 5LIYX 1BWLA 3CHVA 4MF4A 4EXAA 1MO0A 4UIOA 1JGIA 5LIWX 1W9VA 2BXVA 3TNOA 1OFQA 4DXXA 4ZB0A 1FKXA 4G6CA 4H7CA 2CEQA 2P0IA 1MXGA 2Y5SA 2Q8ZA 1BSIA 4WIWA 1BKHA 1PWLA 2OSWA 5AYYA 1QT1A 1RBLA 2OG9A 3QV6A 3UF9A 5DQPA 1PIFA 3THUA 1DP0A 4XIMA 3MSRA 3B0XA 5FF4A 4Q7NA 5AZ0A 3W85A 3IJIA 3OG2A 5DF0A 2HS8A 3P3BA 4UTIA 4L61A 4J28A 1K70A 2Y8KA 4JQ2A 1H62A 1V6XA 4HCLA 1EUNA 4MZYA 1RJQA 1EA0A 2DJXA 4OBSA 1RV8A 4Q4PA 3W01A 5KEZA 3UP8A 2ZVIA 5CGMA 3GG1A 4XZHA 3L2MA 1BRLA 4LUYA 3SJ3A 1KTCA 3PBYA 1TIWA 4XO6A 1XJBA 1R3WA 3I3BA 2VJXA 1DXFA 2BBFA 3CLMA 2CKRA 5AHMA 2J7CA 5C7HA 2OZ8A 3WQWA 3WDQA 2NUWA 1L6GA 1YYAA 4KQNA 3INPA 4LYKA 2G3NA 3ZJ7A 4D6CA 3CPRA 4AZBA 5CBJA 4D1JA 5IFTA 1JF5A 3GXMA 1UC4A 2IW0A 3BICA 1E9ZB 4F2BA 1W5MA 3NQFA 3IAQA 3URBA 3C2VA 1S5WA 4QCEA 1SGJA 5BXSA 4Y8EA 4FR1A 1U1UA 4MB5A 3M6YA 1JPIA 1A53A 3PJXA 2FPYA 4UOJA 4DYJA 3NO5A 4OGZA 2GDVA 3ITLA 1OQFA 3OZYA 4Z0JA 3UXIA 4PC8A 4Y8FA 2G3MA 1NFBA 4C6QA 5G2IA 1OK6A 4JHZA 1OT2A 3AYRA 3UGVA 3VGBA 3ZLFA 5M3WA 3TC3A 1CECA 3E5PA 1WKYA 1C90A 1OGGA 1Q8AA 4I3GA 3FJNA 3UG3A 4NZ1A 4PA8A 5DT7A 1QCWA 3QPYA 3RM9A 4LY4A 4DJEC 4W88A 2EHHA 5I00A 1PHWA 4JIEA 3O8AA 3S5ZA 3FGCA 1D7FA 1EDTA 1GZ1A 3CUHA 3LCWA 5LNWA 3DH7A 4XZ9A 1QHZA 2ZC8A 3V5CA 4N0RA 3CJPA 1EPVA 1XIJA 3JUGA 5I3DA 5B7ZA 3NPUA 1W3TA 2FGZA 1B30A 1X98A 3QFWA 3BGJA 1CX9A 1T6MA 4IP7A 4U4MA 1QASA 1VCFA 2PBOA 2ZZ3A 2XTKA 5A2CA 1X6LA 2ALDA 1DVJA 3APYA 5HUPA 4CNPA 2OXNA 5C9UA 4WKAA 4HK7A 5K9DA 3WQEA 4B91A 1E15A 4XX6A 5BROA 2XVPA 4BI5A 2OELA 1M65A 3NM1A 2CWNA 2PPGA 3CEUA 4W85A 3DZ1A 4FOKA 4A4AA 5CGQA 4GUGA 5C2GA 2NXHA 5HATA 1LG2A 4MNJA 1AD1A 5G4WA 4HOXA 3UA3A 1GW9A 1XP3A 3GE7A 1YX1A 3CQIA 3KDNA 2Q8LA 3WQ5A 4G7FA 4MWAA 1UZDA 1LBFA 3EKLA 1KXQA 3G0SA 1YMYA 1CLVA 4LV4A 1J8VA 4GBUA 5G5IA 1RH9A 1LLZA 3TOYA 1E1FA 1IHIA 3TTQA 4F0SA 3KEHA 5FEWA 3NO3A 9RUBA 3W87A 1V3HA 3T0BA 4RZ4A 3S1VA 1BG9A 3F5KA 3H4GA 3W7KA 1O66A 1TTPA 2E9MA 3RPTA 1W0MA 3CZEA 1B5TA 5AOUA 3NR0A 2INZA 1RCQA 4WDTA 3ELFA 3EWXA 2G37A 1N82A 1X38A 4F79A 1H2JA 1VBJA 3ES8A 4HT3A 5D9OA 1U1JA 1FHUA 3GVGA 3W29A 4GY7A 3JS3A 3EWUA 4P7RA 1UR1A 4B5SA 2OEJA 3SRKA 1VKFA 3N2CA 1H61A 4MB3A 4C1KA 5AC8A 4IF2A 1GEHA 4L4MA 1H7OA 3O6YX 3VKCA 1V08A 4BQ5A 4GIYA 4AD0A 3PPGA 1DIOA 1VFSA 2J7HA 2VGIA 2V5KA 3STPA 3VIFA 4H00A 3FVDA 3ATYA 3OIHA 2PGRA 3A12A 3PNUA 3ARXA 4ZO9A 4C6KA 2VRKA 2H9AA 2Q3OA 3MU7A 4JAWA 1ALDA 2VX7A 3TE9A 4LALA 3IIXA 5AFDA 3UJRA 4TUFA 1XL9A 1U30A 1CWYA 2YA0A 3TJ4A 2PWFA 2GVGA 2C0HA 1Z9AA 1TPB1 4W4QA 4UMBA 4O1BA 1H1NA 3V35A 5F1UA 3UWQA 3FYPA 4P7QA 2PDUA 1QPRA 4ZOBA 3H6OA 2YX0A 3FX4A 3MP4A 4XTIA 3CUIA 4HPJA 3G22A 3N73A 3VD3A 2E1DA 1TV4A 5D32A 2XH4A 1F4HA 3VNDA 5ABFA 4QRNA 3PZMA 1TZZA 2CBIA 4U33A 3T09A 3ZXWA 3A3WA 1V6YA 1UWIA 5FA5A 4ASTA 1E55A 1FCBA 4B2DD 3BMVA 1MEIA 3LU2A 2GOUA 4Q3MA 3OVQA 2WVVB 4MKVA 3WG6A 1BGAA 4B4FA 3GDRA 4XAZA 3GHUA 4U28A 3RX2A 2BP1A 3UJ2A 4HU4A 3QH2A 4E0CA 2BY2A 1BTCA 1AQ0A 3ZOAA 3WZ0E 1TIMA 1XKJA 2GSJA 2OSYA 3MSGA 4YLWA 4FNQA 3DGBA 2XU2A 2GJXB 3AUJA 3C56A 4IFKA 1XYAA 1UA3A 3LNPA 3BE7A 1SJBA 3F4CA 5I3KA 1AA1B 2P0OA 2X7WA 3WUGA 1UR2A 2FHFA 4PBGA 4EACA 1TJ0A 5HMSA 3W1PA 1JZ8A 3SQSA 5CBIA 3WN6A 4NYUA 1I2OA 5JUVA 3VX1A 4HKPA 4TX6A 3C0LA 4P61A 4WF7A 3ICJA 3RHGA 4MVAA 2VUNA 1GYLA 5G1TA 3EB2A 3ZJ6A 5HR6A 3UZXA 3CL7A 5A6LA 3P7YA 2E5BA 3ZZ1A 1J5TA 4XZMX 1ICSA 3KZSA 4LTSA 5H8MA 2VELA 3KCOA 1KLZA 3E9AA 2QMJA 1H7NA 2HPIA 5EBAA 2TODA 3C4UA 4ZQCA 4NX5A 3W2KA 2D22A 2QUUA 4X60A 3MKVA 1SFSA 1XLLA 1BEUA 1WDDA 1FWJC 2ZYFA 3G18A 4JN8A 1XLGA 2A0NA 3S5NA 3VUSA 1E6PA 2ZOXA 4Z42C 1V02E 3WD3A 2NSXA 4AIBA 4G7EB 3BMXA 3U4AA 1K8CA 4NNBA 4F0MA 1S3TC 4IG2A 5HINA 3WMCA 3KVKA 5CJ5A 1IWAA 3KZPA 3PBWA 5FI8A 3LMYA 4A29A 2E6FA 4C6FA 1QU4A 3BSMA 1EUAA 4J3XA 3V75A 1UZ1A 1ZJIA 5I3JA 1MWOA 1PSCA 3BCFA 3GXTA 2R6OA 2PLKA 1ADSA 5AC5A 3KW3A 3EOOA 3Q37A 2BGQA 1CGTA 2R1MA 1WZMA 1C9WA 4MZ1A 4DWSB 3EPMA 3QQWA 1AW2A 3VGFA 4LAUA 1UKSA 3V4BA 1MW2A 3AS3A 4I5RA 5LXEA 3QM3A 2WANA 3CC1A 1EGVA 5I6SA 2VMFA 1IT7A 1NTHA 4XD3A 3WELA 1UKTA 3P74A 5HNTA 4NJKA 3LRLA 2C16A 1IT8A 1JZ3A 4Q7IA 2A3AA 3WCZA 3IV8A 1XPYA 2WSYA 1B31A 4C6NA 3P67A 4NQ1A 2VX4A 1Y7VA 3T44A 1G9HA 1NARA 4LOCA 3ERPA 1OZQA 1LYXA 4UQEA 3N04A 1LLWA 2BY3A 5EMKA 3QKZA 3C0JA 1GQNA 4D6IA 3OA5A 4Y7EA 4XAYA 1KQZA 1QDSA 5J8LA 1GPWA 1UW9A 3TYUA 2Y8VA 4V1YA 3AHZA 1UMLA 3PWIA 3KP0A 1KTNA 1R3RA 2WMIA 3GVRA 2IQ0A 3BTNA 1OJXA 3MA8A 2NUXA 3T9PA 2J8GA 3NFUA 2J7BA 1H11A 2GQ8A 3SFKA 5I0DA 1B1YA 2VKZG 3MUXA 3R8GA 4ALDA 1P0NA 3ZLHA 4P8XA 4S3AA 1UQZA 3C8FA 1JI2A 2UY2A 4ORIA 2ZUUA 1RLCL 1Q2RA 2E6AA 3I7SA 1LRQA 1X6NA 3SZ8A 4KMQA 1VFLA 3V5FA 1VS1A 3BZJA 3GXNA 1MNZA 3W1LA 4JKKA 1GZGA 4NJGA 4Q33A 4CD5A 3W7QA 2CLMA 4QG8A 2PDJA 1B3VA 2VZTA 3MSYA 4RNIA 1DWIM 3KAOA 4U2YA 5CGTA 3TROA 2VEFA 1D3CA 4IPIA 3SGGA 1JZ5A 2JKPA 1RLDA 5EMLA 3OW1A 4BF7A 3VC6A 1U33A 4P8WA 2RGMA 3UVAA 3A5FA 2IQTA 2C1GA 1LRNA 5CC6A 3NCOA 3RF9A 5TF0A 4DJFA 5F4SA 3W6LA 1EXPA 3F7JA 3A4WA 2VX5A 1Y5VA 3PC0A 1A5SA 3QN3A 4AD5A 4AZIA 1DJGA 2CIPA 3HTWA 5FIPA 2FDSA 4QBXA 5E5CA 2OJPA 4W9TA 4JTKA 2GUUA 2VOMA 2XJ7A 2BNJA 3NO1A 1DJXA 4PN2A 4JY9A 4QQUA 4NZFA 2A5HA 1GEQA 7CGTA 1VEMA 4IXXA 1S46A 1V3LA 2CLPA 3AZTA 4ZR8A 1E4MM 2BVTA 4UZSA 5C5YA 3UPBA 3G1RA 2UV8G 4GH3A 3W74A 5JH1A 4FSAA 3C61A 3CMGA 5IFPA 5E9XA 4QX4A 3UW6A 4B9YA 3TN4A 2A85A 3NEVA 3DERA 4Q32A 3FDKA 3CM4A 5FJOA 4MAZA 1CXIA 3WQ4A 1MQQA 2WKJA 1DYSA 1BQGA 4C90A 2AKMA 3ID7A 2WSQA 3A9IA 3UXLA 1ICPA 1GQJA 5A6BA 4XZIA 4L9XA 2FHBA 2BGNE 2DGAA 3N6HA 2TPSA 3GDKA 3RX4A 5TQLA 6ALDA 3EAUA 2ODOA 3UWWA 3WLRA 2XGZA 3T08A 1DOSA 1XDLA 3OHMB 1J10A 1E6SM 1S1RA 1J0KA 2X7VA 3TN3A 2CERA 4ZXOA 4CNOA 1TRIA 4LBRA 4S3EA 2EPOA 3MVIA 1ME7A 1H7PA 3WNKA 1KW1A 3L66A 4RE3A 2QDEA 3ABOA 3TKFA 2ZZ6A 2YJQA 1I0DA 3HG2A 4CQ8A 5J04A 5MF5A 1Q3NA 3ITYA 2Z2UA 1XINA 2FPVA 4S39A 1G0CA 3PS7A 4ENLA 4H8VA 3THQA 4Z17A 1K9EA 3SN4A 1TE1A 3QSTA 5CZKA 3RITA 3LZ5A 2ZXDA 1M41A 5IDIA 5HMFA 5HJYA 5B7YA 3AS1A 1UD2A 3V7PA 1EDGA 1JFHA 4I5UA 3W73A 1WX0A 1B4KA 2XH2A 1A80A 3NL6A 2A7NA 4EVZA 1B4EA 3PPCA 3IK2A 7TIMA 1SW3A 1EIXA 3BG5A 4G1NA 3EEZA 4LUTA 4DJED 2D0GA 4DPPA 2ZRWA 2F7FA 1YDVA 1EL3A 3RCMA 3C8NA 4LJ3A 3VD5A 3TQ0A 1UCWA 2QDDA 4C7FA 1PAMA 3IWPA 1XLJA 2DZAA 4TTUA 5HWMA 1QI5A 4FA3A 2AMXA 3EDKA 3PFRA 1FWNA 4X61A 3OHIA 3SFWA 1QPNA 3TIMA 1Q6DA 3BXWA 1M01A 2WZTA 2YCKX 3ME3A 3UR2A 3NYDA 3SRFA 5CAKA 4GHRA 3RLUA 4GY0A 1KKOA 2WWCA 3STFA 3CUZA 2D3NA 2WBKA 4A8LA 4C6JA 4UMCA 1ELSA 3UWEA 5DY3A 4GGHA 1SR0A 3W82A 1F7BA 4KS0A 4E8GA 3EB3A 3HOJA 1TRDA 2X40A 1I2RA 2E28A 4TQTA 4DM2A 1DQXA 2UY4A 1V6WA 1QO2A 2NT1A 1H7XA 3N19B 4ZODA 2VEMA 3P93A 4R27A 3KBSA 4QROA 5A6TC 4PUNA 1XH0A 4I9MA 2PMQA 1TCMA 1LLOA 2PS2A 1P1MA 1B3WA 1WKEA 3PSWA 1XSIA 3VIIA 2X1UA 1E6RA 1SYTA 1E40A 4C6BA 4CU6A 3IPWA 1S2VA 5FF3A 4H6QA 2O92A 4UQCA 5KINA 4XG1A 4KKXA 4WDUA 3PPFA 4BCEA 1XCFA 3BCJA 4PB4A 1GUVA 1S5MA 4CU8A 4AHPA 2YZRA 1MRAA 4B9ZA 3RG6A 1SZNA 3SUSA 2BMBA 2ZZ5A 1JEZA 2V5DA 4IX2A 2Z7GA 3M46A 2CBJA 3TXVA 1QW9A 3WQ8A 4A3YA 4AMAA 1OADA 3H7UA 3W25A 1IZJA 1ZFJA 4PB5A 5KZDA 1MUCA 1V3KA 2Q09A 4R34A 3RFAA 4D8ZA 4NX0A 1NOWA 2FGBA 4YIWA 2ZX9A 4M1BA 1PBGA 3BH4A 1Q6GA 1ONRA 1YRRA 4XSLA 1SO5A 1M1BA 2GQ9A 1HIZA 4DWSD 4YTRA 4LEQA 4LNCA 2Y7DA 1JQXA 3TLLA 1EJVC 3MO7A 3L68A 1AZ1A 2G97A 5FEPA 3LGEA 3FS2A 2FZ8A 3NQGA 3O0KA 5LIUX 4LNYA 5D2WA 4DBWA 1J0YA 2YYUA 1P6BA 1GYNA 4FI4A 3W7CA 4JXCA 3S9YA 1WDWA 3QV7A 4O1FA 3C0SA 3N4EA 3MDWA 1X7FA 4J3UA 2QQ6A 2WHLA 3WBXA 3SURA 3A64A 3LERA 4I7VA 5FKYA 3BJTA 4UNLA 1K8YA 3R4IA 4GXPA 3URQA 3LA4A 3U2OA 1RK6A 1UZHA 4GFSA 2DW6A 1HG3A 1PL9A 4X2RA 3TYDA 4ZO6A 4BFAA 2XGBA 3L4YA 4RZ6A 4CCEA 4KFOA 2YFNA 4B5XA 1GTEA 3BAXA 4HNUA 2QUMA 1R2TA 1VIWA 1WV2A 2DT0A 3BC9A 2A3HA 3GR7A 3B8DA 1QNPA 2FFCA 3TTYA 1TYGA 1KM6A 2OR2A 4MPKA 4LCRA 3GFYA 3MCMA 4C6LA 1J12A 4M0XA 4HJFA 3CPGA 4M6PA 3BLKA 3UBPC 3S8HA 1F8IA 1CT5A 1NELA 2AGKA 4ZFCA 3QR0A 2QT3A 3RMEA 3W38A 3GDBA 1ZSXA 4NAFB 5HWJA 1F3WA 3U6WA 4CQBA 4YTUA 3WJZA 3O7UA 1VAHA 1PYFA 1B3XA 3WQ6A 2NUYA 3N1AA 1TCDA 3H4XA 1TV2A 2QXWA 3NG3A 3AS0A 4H9YA 1UA7A 1ZRQA 3PP7A 5H8UA 3LBMA 1HF6A 1JD7A 2BXYA 2YR1A 3PZOA 4RK8A 4JTQA 1BGGA 2DIJA 3DX5A 5LA2A 4CD7A 4MYXA 2PB1A 1IIGA 4J3ZA 3QOMA 4DZHA 2YL9A 1LT7A 4BI7A 3EDJA 1EJRC 4IH3A 1EO5A 1O4UA 1CNVA 1FWGC 3GNOA 1QOQA 3ITGA 4LVFA 2DH3A 2QCDB 3EWZA 3MT1A 3L0GA 3MUCA 1H1ZA 5GNYA 4KRUA 3SGUA 2VEKA 3FKKA 5HPOA 1YQ2A 3IGHX 4KT2A 3EPNA 4QISA 3AISA 4IIGA 3LSCA 3DFTA 1O7AA 1TKKA 3AMDA 3M47A 3PB2A 4KGJA 1EEXA 4V15A 3E1F1 1WAWA 4HNCA 1M3UA 2OX1A 4U5KA 1BF6A 4NHVA 3R7MA 4MJ4A 3XIMA 2CITA 4LB4A 3GIYA 2A1YA 2DIEA 3VKBA 3H4WA 3KUMA 3F4WA 5JQ9A 4ZQOA 2QCLA 4M80A 1WZAA 2AMGA 4Q4SA 4N4PA 3UJEA 3GQYA 3R94A 2QCCA 2IKGA 5BRPA 3TN6A 3LENA 5I3GA 1B2YA 3OYXA 4QP0A 2DV0A 2E25A 3BW4A 1JDFA 3SECA 1W3HA 1PV8A 3MI2A 4HOZA 3ZMRA 4B3LA 3EA2A 4REQA 5LIXX 1ZJBA 1HUVA 2PA6A 2QIIA 1J5SA 3VDGA 4OHQA 1LUCB 3BCDA 3LK6A 4B2DA 2ADAA 4O8RA 4IUOA 1Q6RA 1YXCA 3H2CA 2XSBA 5L9FA 1HJUA 3LYEA 4IIEA 5CPMA 2H3BA 4D6EA 3MHGA 2EF9A 3Q67A 4GVFA 3KL0A 3MYPA 4PTDA 2A7PA 2QPSA 2J47A 3W70A 1UR8A 3KBNA 1RVKA 4E2VA 3P61A 4HHHA 4DZAA 1W17A 4X22A 4AD4A 5EYWA 2ISFA 3JZUA 2VZSA 3RYSA 1O12A 4GZIA 1AH3A 4W5UA 1XLMA 1DIEA 2OX4A 1KCXA 1PB0A 1JDAA 3EMQA 4AZCB 3MYOA 4LXFA 3KE0A 3QMRA 2FHCA 4JTCA 4ROPA 2CETA 4ZE4A 2PDNA 2R14A 2D2GA 3S1WA 1LL4A 2J9YA 2O9TA 3KTCA 4EOUA 2FZBA 4K7VA 3TK7A 5D9MA 4HMDA 3WK1A 2YW3A 4GC4A 5C7VA 4R7WA 1I2NA 2QJNA 4DBDA 5AHNA 4IJRA 1HGYA 1PX8A 4ZZ9A 3S5SA 3CV7A 1VGAA 2PURA 3M0MA 1AODA 2PDIA 4B4HA 1JPDX 4H9XA 3T78A 3GXPA 3ZVIA 1A4MA 3RN6A 2CFFA 4LVDA 3NIYA 7REQB 4GVGA 2BHYA 4PH6A 1NDZA 1HP4A 4ADUA 1E1CB 3GXDA 3OPSA 3WL1A 3IJQA 4HMNA 3VC5A 1T8XA 4IFRA 1CZ1A 1WP6A 1XX1A 4AHOA 4PRWA 4H8UA 1B90A 1YNYA 2D69A 9CGTA 1XD0A 3LHTA 3BUVA 2GK1B 1JG9A 3KXQA 4HA4A 4R5EA 2Y7GA 3KL3A 1NP2A 1X1OA 4CQCA 3WF4A 1KQYA 2J77A 2ZUTA 3FSUA 4GI8A 3UCDA 3P8IA 4C6EA 2VGBA 3P0WA 5EBUA 3N2XA 3W7JA 1A47A 5BWAA 1LP6A 1O5RA 3TN5A 1UC5A 2DSVA 3V16A 3A22A 3SDOA 1KXHA 1G7UA 1ZBKA 3B8WA 4UTWC 3OIXA 1ONEA 3V0SA 2OKTA 3MI6A 4L6DA 1AUSL 4KESA 2BXZA 3R58A 1L6YA 3M0HA 3F03K 1AMKA 4QG6A 3TCEA 3WLOA 1Z8AA 2X1SA 3MP3A 2J9XA 4I9TA 4N4QA 1UJPA 4RXGA 4A3QA 1UWQA 2WBGA 4E6MA 1CGUA 4R9XA 3NVTA 4QTGA 3OA3A 1R87A 3CAVA 1YNPA 4JGDA 5HQMA 1IYXA 4S3KA 5T9BG 3W7DA 1XLFA 1GQIA 3I65A 3ITTA 2INEA 4MKSA 2JFEX 2WV8A 4NZ3A 5KTLA 1EOMA 2Z1KA 4DM1A 1RZMA 1JYNA 1WDSA 5CZSA 1CXHA 2H8ZA 1TPVA 3LHUA 2CKSA 3GHSA 1S2AA 3C2YA 3QBUA 4JCMA 3IEBA 3QW3A 2VFDA 2DSUA 3P62A 3TTEA 3WQPA 1A5KC 3GXIA 4NAEB 3TZNA 3W76A 3G8RA 2WSPA 2CHRA 3SCOA 4F0LA 4JDYA 1W8GA 4C7DA 3GC4A 3GNPA 4DB7A 3EWDA 1PKMA 2WCSA 1ZAIA 3TONA 4JFVA 4JYEA 2ZTKA 1DJHA 3WNMA 4O1AA 1U5HA 4PUJA 1CCWB 2NLYA 3WH7A 2NX9A 2RHGA 1XLBA 1Q65A 4U10A 1JUBA 3PZVA 1AFSA 1OBAA 3L5AA 3AQUA 1PZ0A 5F2IA 5AC4A 4XTDA 1OCQA 4GZJA 2J66A 5DCDA 2OQLA 3CK5A 5HBFA 4XISA 4AYSA 1UMYA 1E4NA 3QQ0A 5F4XA 5AZ1A 1K9DA 4UQAA 4U3AA 5JXQA 3PK7A 3PTDA 1GHRA 4JNZA 3LEPA 3I7QA 2Z0IA 3GR4A 4UTUA 3CTLA 2J25A 3VNYA 3QF0A 4JFUA 2FYMA 2VP8A 4RV3A 1XYZA 3VFCA 3FA3A 2QZRA 1VRDA 5K9CA 1X39A 2ZADA 3O2LA 1WA3A 2P5NA 3M43A 3GKFA 1ITCA 4E38A 2G0WA 1A3WA 3EKGA 5CC7A 3JU2A 1GKPA 4MJ2A 1GOKA 3RGTA 4BF5A 3OVPA 4QJ5B 2VNCA 2VEGA 1FCQA 3S9IA 3Q45A 6REQA 3PJTA 1JIBA 4HMCA 3W2UA 1A3XA 2AQWA 3NPWA 1RQHA 3PBGA 3STGA 5DT5A 1Y5XA 4BY3A 3B9OA 4E3TA 2WVUA 1JPMA 2WVSA 1M7PA 1CIUA 3QHMA 4S3BA 4UZUA 3E49A 1SM9A 1RUSA 2VC6A 3VILA 2ZRXA 1GJWA 3BAIA 3ITCA 4JQ1A 4H83A 1B3YA 3EWWA 4M6UA 1YHTA 4MPQA 5T8GA 2ACRA 1RY0A 4YMZA 4B5WA 1TV8A 3MZ2A 1TVLA 4GZEA 3UJSA 1I60A 2A2IA 4IHCA 4UUIA 1K6AA 4JL2A 3CAQA 4FX7A 4OJYA 4TXEA 4RNFA 2A21A 4PBEA 1TPH1 1H63A 4GD0A 1JVNA 3I3EA 1EJTC 3QV9A 1Q4NX 3OZMA 1SJAA 4IGNA 5TAOA 1JCLA 2J79A 2NLIA 1XIHA 1WDQA 5REQB 5A1AA 1U5VA 4JNYA 2PDHA 5JIWA 3U9IA 2OO0A 4A3UA 4O18A 2PU0A 4XD6A 2D2JA 3NOYA 3ZYZA 3NVDA 1A50A 4W7UA 2HXUA 1B54A 4DNHA 3KP1A 4PEKA 3T0DA 3MPGA 4HA3A 4FXJA 3O15A 3VOGA 2X1TA 3VM7A 2PZ0A 3BLFA 4FPSA 2TRSA 1HL2A 4JTEA 1LROA 3MP5A 1C9DA 1GONA 1NF7A 4HTYA 1G4EA 1TPDA 3NOEA 3WDJA 1EHNA 3Q94A 1Q6QA 1E6QM 2XH7A 3E12A 4AC1X 2JEPA 3A4JA 2WNNA 4PCPA 4AMCA 3ZLGA 4UC5A 3UESA 3B8UA 1WAUA 2G3JA 5D9NA 1FHDA 5FF0A 1T5AA 3SIZA 1TG7A 3WLNA 3K13A 3ARPA 2REQB 1WOBA 3PUDA 1DHPA 4HB7A 3GBDA 3UG5A 4BI6A 4O11A 1U83A 3IUHA 1U1HA 1XCWA 2D2OA 1RP9A 3N2TA 3TXZA 1QATA 3TYCA 3KRZA 2UBPC 1S5VA 1VHNA 1HJVA 4MMWA 2RH9A 3LCGA 3BV4A 4UR8A 1RBOB 1MEHA 1MW0A 1OT1A 1VR6A 4H2CA 3R10A 1FWTA 3WBEA 1F76A 1JXKA 5HAOA 2XWDA 4PTMA 3L65A 3A9BA 3WH6A 4E3VA 5I09A 1ZL1A 3WLIA 1CXFA 2A3CA 1WUFA 5AYIA 1RR2A 3ITOA 1S1PA 4O16A 1O1ZA 3WLTA 3U7VA 1P5BA 4RZ5A 3M0VA 1TWDA 1KR0A 1NOFA 6TAAA 3PZNA 1R47A 1CLKA 1WUEA 3N18A 3VOCA 2A3LA 1E9YB 1SUXA 3LTSA 1YDYA 4TVDA 3I6RA 2J74A 3N2OA 4PUKA 2OGYA 5F4WA 4O53A 1HJWA 1PTDA 3ZFHA 4KH2A 4ZENA 3BOXA 3CQHA 4PEEA 4DUXA 1POJA 1M6JA 4XAFA 1H0GA 3VU2A 3POCA 1GOMA 4MZ8A 3RJXA 1VENA 2CZVA 3UR5A 4PMQA 3B8VA 3M7WA 5HNRA 3B03A 3W27A 4S23A 2YBUA 3QW4B 1LCOA 2CLHA 1BXNA 4HA1A 3W1NA 4ZOEA 4CQDA 3C0QA 4M56A 4LFYA 3REQB 1FCUA 1GYMA 1MZHA 5HQLA 5I7GA 1NSJA 4EPKA 1POKA 3KHJA 1CW2A 2O7SA 4PCFA 3FV9A 2QCHA 4EAYA 1QI2A 4GABA 3DUGA 1OFAA 4NJJA 3PFMA 1FH9A 3BWWA 2EO7A 2J78A 1ML1A 2ZBTA 1K8ZA 1N7KA 4H9ZA 1O60A 1OX4A 4EIVA 1ITXA 3CT7A 5CC5A 5LIKX 4H01A 4GK8A 1P43A 2A4AA 3TLQA 4J27A 4KEUA 1F6KA 1QOPA 4N7QA 2ISWA 2WC4A 1X96A 4HNLA 3FA5A 4RNHA 1EF3A 2WPBA 4Z1AA 5DFAA 2W79A 5ABHA 4QE1A 4ZSTA 3H2FA 4S3DA 2PGFA 3W6MA 2G96A 3FEMA 1O94A 5TBOA 2J13A 3QHNA 1FWHC 4HOWA 1MNSA 5HUOA 2WYSA 4PCNA 3MHUA 2I5GA 3KVMA 3QYQA 3WBYA 1HTIA 3OYZA 3EDEA 4HZ8A 2GVLA 3W1RA 2I5QA 1CGVA 3QR3A 3GH5A 5JBDA 4JL1A 3CASA 1G4TA 4S3JA 4ZQRA 2XIBA 1FDZA 4L4LA 3W24A 4PUEA 1QOXA 4AWTA 5G2HA 4ERIA 2Y7FA 1IEXA 1Q45A 2A6LA 4GCAA 4FF7A 3CHFA 3VIPA 4H8HA 3FJ4A 4ZQNA 6XIMA 5AN7A 5BRQA 4GACA 1IZKA 4FIRA 3ARUA 1FFRA 2Z29A 2JKEA 1PTAA 3APTA 3M07A 1CXKA 3ISIX 3N25A 1XLAA 4X0VA 2YDQA 5LNVA 4KEMA 4I8DA 1XIGA 4QLJA 3SSZA 5C70A 4M8UA 2FTPA 3R25A 3S1UA 4WX2A 2GOKA 4AZ5A 3AFBA 4B3ZA 1AH0A 3AJ7A 2WO5A 4A2SA 1OHLA 3BO9A 3HPFA 2QCFA 2GSHA 3WK0A 2I5IA 4TX8A 1GVIA 1H60A 1WBJA 2D73A 4LT9A 5D30A 3T1GA 3L0NA 3W84A 4A35A 4JHMA 4DO5A 4TTGA 2DT2A 1I1WA 1XLHA 4KWVA 3BJFA 4HBKA 3IVSA 3ZM8A 4ZEPA 2ZKMX 1JPKA 3HF3A 1AJ0A 2YDSA 3HV9A 4J1OA 3F2DA 4EK7A 1REQB 3UU0A 4WSHA 1KNWA 3LXBA 4WEVX 2NQ5A 1PHQA 4S38A 2Y2WA 3HG5A 1HXJA 7ENLA 1BLIA 5MKGB 4J2MA 2W62A 3UG4A 4JTSA 3F5JA 3P82A 4JYDA 4PTNA 4GJ1A 4MFDA 4TV6A 2RDXA 3W7LA 5K7JA 2XDFA 3WNPA 3MV11 3ZSTA 3MHFA 2IPGA 4GFIA 1ENUA 1EF2A 2OEKA 4Y9AA 3EXRA 1IEQA 3VGHA 3CQ0A 3WFAA 3FA4A 4BWLA 2CLIA 4O10A 4FF5A 1Z89A 4RR4A 7A3HA 1UP0A 4DYKA 1KFJA 4L6HA 4Q4RA 3NDZA 4GI4A 4MADA 4LEFA 1IT0A 3UGRA 3U3HA 3NZGA 3DFPA 2IPFA 4Z0SA 2V67A 1K3UA 1FWCC 3P14A 3HMCA 4IMFA 3AXIA 3GG0A 5BU6A 4IIDA 1W9XA 1EJ7L 1NAL1 4HN8A 3NZQA 4P7LA 4HGXA 2GFTA 3EX1A 4J3WA 2NX1A 3VD9A 5IRPA 3PJWA 5A69A 1XF0A 4E8DA 3PTQA 1OCBA 2Y89A 3PZ9A 1XYMA 1GTHA 1PWMA 4OT7A 4NG3A 1VD6A 1NH6A 3QC3A 4N9BA 4FIQA 1XM3A 3PUOA 3RRAA 1PTGA 2X16A 4C6CA 1W3JA 4JKMA 9XIAA 3GY1A 1EB3A 5ABEA 3HGOA 1MYRA 3L2IA 4QM1A 2OGJA 1KCZA 4GUIA 2EJAA 4WSKA 3VPLA 1PJ9A 3K5XA 4C91A 3CBWA 3E5BA 1OIMA 5DEZA 3UR7A 5BZAA 2VCAA 3EOLA 2ZA3A 3KS6A 4DYEA 4IGHA 2DSZA 3KTXA 4LAOA 2CWXA 2BTMA 3QGVA 4U5IA 1W1YA 4PYSA 1Q6FA 4FNRA 1ZAJA 3G1YA 3TR2A 3D3AA 1D3GA 3HG3A 4L9ZA 4GZ7A 1MFVA 2XG9A 4BQ3A 3LX9A 4XBKA 3OU8A 1JD9A 1QPOA 1BRLB 3TA9A 3NQ8A 3CWHA 1XICA 4MWAE 3NA8A 3M0YA 3CWNA 1YXDA 1ITQA 1NP0A 1UG6A 3LLFA 3M0IA 2NVCA 3F2CA 3W1UA 1V6VA 2QJHA 4WJ8A 4H1ZA 3CQJA 4B3KA 1Z42A 1ESWA 4JDBA 5CKSA 4PMVA 1VQTA 2GLKA 4Z2IA 2PGEA 3AALA 2P3ZA 1XG3A 2YA2A 3HMJG 4BHYA 2GUYA 3NQBA 2BODX 3IJLA 3AYTA 2E77A 3SCWA 3UR8A 3W37A 2I9EA 3EWCA 2XPKA 5TD4A 2DDXA 3H24A 1JCNA 1OFRA 4W7VA 1EJSC 4YJ5A 2ZTJA 3AIVA 1GG1A 3PBMA 5GNZA 2CZEA 4C7GA 3VIHA 4N6FA 1CI1A 1DHKA 1KTBA 5EMUA 1XRTA 3QR1A 4FO4A 4DI8A 3SCUA 1R38A 3AWNA 2NWSA 1K7FA 3E2VA 3EOEA 4KCVA 2YXXA 1LRTA 3TYBA 1CB7B 2OLAA 2F38A 3W7PA 2UY5A 3L5LA 3UQNA 4XZLX 2QJGA 3PM6A 1R3VA 2PD9A 1YW1A 2QJIA 2HNEA 4LX4A 1A0CA 4GUFA 3W1MA 1BVNP 3TJXA 4OBRA 3TJLA 4LH8A 5FEZA 1I75A 4PRRA 3HPAA 5D37A 3I4KA 1KKRA 3UJFA 2V63A 1E3XA 2QPXA 2EG7A 4BEUA 3H7RA 1J4EA 4ZOAA 1HJSA 3UZYA 1F6PA