1JCNA

Binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
490
structure length
395
Chain Sequence
TGYVPEDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSPGIPITEVGIVTSRDIDPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVRTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE MONOPHOSPHATE DEHYDROGENASE I
publication title Crystal Structure of the Human Type I Inosine Monophosphate Dehydrogenase and Implications for Isoform Specificity
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 395
sequence length 490
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcnA00
1P0KA 1KTCA 3T44A 4Q32A 3UNDA 1FWTA 4WXZA 4FNUA 4GNJA 5G2HA 1WV2A 2HSAA 1N8FA 5J5RA 5T26A 5U4NA 3FJ6A 1H5YA 3C52A 3PBVA 1UB3A 3AO0A 1ZAJA 3RNDA 4K8HA 3W1XA 2DJLA 2Y62A 1FCQA 2B7QA 2Y70A 3ABRA 2EHHA 4MY9A 4E2DA 2PRMA 3P5YA 4FEZA 4TX9A 1A5BA 1EIXA 4O50A 3ATYA 2C14A 3LHWA 4O16A 3W7GA 2V2DA 3TQVA 2A7NA 3QZEA 3NOEA 3ABOA 1K02A 4LC6A 4AF0B 3DFTA 4UTUA 2V9DA 4ONVA 2CZ5A 5DXYA 1F5ZA 1LBMA 4RK8A 3VKJA 2VXNA 3MI6A 1SZFA 4CQAA 3HB9A 3M5ZA 2ATMA 3B05A 3NQEA 3OEXA 2OZ0A 1L6WA 5EBUA 2RDWA 3C2FA 4E0CA 4Y96A 4A2SA 4L4LA 3CPRA 3PWAA 5G4EA 5CKSA 1KFJA 3EXTA 1IGSA 3E02A 3A5FA 5EPDA 1DVJA 4JIPA 4N9CA 3B0VC 1BEUA 1TJPA 3F03K 3FKRA 3GB6A 1OG0A 4XBSA 2ISVA 4G1KA 4HPJA 1GG1A 5I3KA 3KOFA 1XL9A 1GTHA 2E09A 2E68A 2E5CA 1OF8A 4QNWA 3S5NA 3LCHA 3TK7A 5GVJA 2DZXA 4CCEA 2ABAA 3SJ3A 4ZMGA 3FLUA 4BR1A 3PY2A 5LHEA 1OJXA 2X2GA 3VNDA 1JVNA 1LYXA 3C4UA 2VFEA 4KFOA 1KM1A 2J27A 4U4MA 2G5WA 2GQ9A 1Q3NA 1OX5A 4GUJA 5F2MA 5LNVA 2NV2A 3DH7A 4RKAA 4LVDA 3OVRA 3B4UA 3LTSA 4OU1A 3NL6A 4QIUA 3G8RA 1QAPA 5G1YA 3E49A 1X1ZA 4JX6A 2DZUA 4NJGA 3MMTA 3N14A 4BFAA 1M7OA 2C6QA 1I4NA 4TO8A 1M7PA 3INPA 5A8GA 1VPXA 1VRDA 4XQ6A 4IMCA 3LCLA 3IIZA 2IQTA 2QCHA 4RX0A 3S8HA 4O4VA 4JTLA 5F4WA 3NQVA 4JX5A 1LOLA 3DFSA 1OFRA 5EA9A 1O4UA 2J6XA 3Q94A 1IIHA 4Y9AA 2ZA3A 3MUXA 4IXXA 1YXDA 4ADTA 1EWEA 3A5VA 3TNOA 4UTWC 2NUXA 4MY8A 3LHUA 3HIJA 2DJXA 3CWNA 3BG3A 1QPOA 3TIMA 3U2OA 4GUGA 4UTIA 1KM3A 4C1KA 3GNNA 4LNYA 4OV4A 1PS9A 1XDMA 3W86A 4DXVA 1YXCA 4UFHA 3LV5A 2ZRXA 5AFDA 1M5WA 5DY3A 3W83A 1JUBA 4N9BA 1ZCOA 1DBTA 1O95A 1YXYA 1TJRA 3NZRA 3B06A 4NZJA 4UFLA 5CG7A 3DU0A 1I2QA 3HQ1A 5TQLA 4XWUA 1XBXA 2ZZ5A 3OIXA 1A53A 2W6RA 4NX0A 3THQA 4AMAA 1P0NA 5U7SA 3PG9A 1B57A 1F74A 3I7RA 4A21A 2ZFAA 3B0PA 2ZRYA 3DZ1A 4EOUA 1WDWA 2ZZ6A 4MUZA 1GVRA 3TSDA 5L9FA 3LHTA 1MXSA 3W7LA 3W7QA 3W1TA 2V5LA 3N73A 5AB3A 4LV9A 1G7UA 3CT7A 3JS3A 1XUZA 3LOTA 4LS0A 3STGA 1L6SA 3S1XA 1ICQA 1KW1A 3ZWTA 2QCMA 1UUOA 1JQVA 3FYPA 2C1HA 1XDLA 2Z6JA 3LV6A 3HG5A 5D2WA 5HUPA 3S5YA 4NVTA 3EX1A 2QAPA 3CEUA 1GT8A 1KBJA 3GXNA 3A21A 5LHFA 2CU0A 4UTJA 3CM4A 3BK0A 4R34A 2QCCA 2CW6A 4O13A 5MHBA 2DZWA 3G0UA 3W7MA 1X1OA 4ORMA 4E2BA 4ZQOA 4PC8A 1G7VA 4UTKA 3GIYA 3DFPA 2J88A 4O17A 2E6FA 2QCDA 5CPLA 3TAKA 5F2IA 1H7WA 3UPBA 3CHVA 1JUEA 1PE1A 2TRSA 1C29A 1XM3A 2FPYA 1VLIA 3P7YA 1HUVA 4JYFA 2EKCA 5D33A 1OX4B 5E1QA 4CCCA 3UWQA 1TPC1 1MO0A 1XI3A 1FWWA 1G6CA 4JY8A 1JJKA 1WAUA 1WBJA 2ZA1A 5FF2A 4MIMA 3LGEA 1I2NA 3P61A 4X2RA 3I7SA 4RXGA 4GRSA 2FPTA 3TSMA 4WZHA 5LNRA 2YSWA 4Y8FA 4I7UA 2EF9A 1H63A 3S6DA 2CZFA 3H55A 3IVSA 3W9ZA 4O0ZA 1QFEA 1SW3A 4CNNA 2H8XA 3OVQA 3C2EA 1NF7A 1W5QA 2BSLA 1ME8A 4UNKA 4JTHA 4N9DA 1VR6A 3L9CA 3UZJA 3RK8A 4CNOA 1R2SA 1GG0A 2VENA 3NVTA 4JN6A 1VS1A 1F2JA 2Z6IA 3C56A 1R2TA 2O7SA 5DCBA 3G1XA 4AXKA 4WX2A 1YYAA 1JRCA 4CCDA 1W37A 2V82A 3G22A 4J9JA 3GAYA 1LTDA 1M6JA 3K30A 2PRLA 2WO5A 5TBOA 2TPSA 2E6DA 4YXGA 4UFKA 5CZTA 1GYNA 1KM0A 3W1LA 3KX6A 5DLCA 4FHAA 3SSJA 3NYZA 1X8FA 5HQEA 4ZQCA 3W7HA 3L65A 1V7YA 5CPNA 1A5AA 1W5MA 4LV4A 4YCPA 1RZMA 2GJLA 3OHIA 2DZSA 1LDCA 4GWEA 4WY0F 1LBFA 3W2JA 4AH7A 5KZMA 3NQGA 4NQ1A 4S1FA 1OFPA 2Y88A 3O05A 3WK3A 1YTEA 3IIXA 4RJEA 4GJ1A 3S5OA 2P0OA 1C9DA 3CB8A 4JTKA 3LXBA 1YLVA 1K7EA 1MSSA 2CFFA 4RZ6A 4PCFA 3DKLA 3GZ3A 3DFNA 1FXQA 1WOAA 3CEPA 5D09A 5K2ZA 3JR2A 5LKYA 2C15A 4XZ9A 4RXFA 3UWUA 2P1FA 1OF6A 3PG8A 2VEPA 1TQXA 3QQ1A 1OFDA 4FNTA 3TSBA 5SWUA 2CZEA 1CW2A 3TC6A 3DHFA 2QCLA 3N34A 4N2YA 2WSYA 1JCLA 3N3MA 1TTQA 1LORA 2WSQA 1EP2A 4JX4A 1KM2A 2RHGA 3SGZA 5HWJA 4MPQA 3M5VA 5G2IA 1OYBA 2PCQA 4O4WA 4I9AA 3HGSA 4Z1BA 5AC7A 5CZSA 4RR4A 5EMUA 3LLFA 3LB0A 5D2VA 1JCJA 1GJPA 1LOQA 3M6YA 3EWXA 1WQ5A 1T96A 4LUIA 5D05A 1YADA 4NNAA 2E6AA 4OGZA 4I7WA 1TTIA 2A7PA 4UFIA 4AWSA 3GR8A 2JKPA 1YTDA 2H8ZA 3SZ8A 3MO7A 4AWTA 2ZZ2A 4C1LA 4DPPA 3UY8A 2G96A 1R30A 5CPMA 2Z0IA 3RF9A 1DJQA 5K7JA 4N6EA 3ANYA 4ORIA 1ONRA 4O12A 3IIVA 3KRSA 2G97A 1LBLA 1TPVA 2QUVA 2F84A 4A2RA 1H50A 5E93A 3EX4A 4UMCA 5HUOA 4O57A 4Z0SA 3FFSA 1XBYA 3N2XA 2ZZ4A 2YCEA 1QNVA 1H7PA 1VHCA 1H51A 5C55A 4KFPA 4EF9A 4IUOA 4ICNA 3UY7A 4TR9A 1S5WA 1QR7A 4Y6GA 2UV8G 2NWSA 2GOUA 3CTLA 3O6CA 2QUUA 1JUKA 4IJBA 1IXQA 2QJIA 2ZRWA 3NQ8A 4TIMA 1JCXA 4IOTA 1VYRA 5FESA 4DF0A 1ADOA 3WK2A 3B04A 1KTBA 1TV7A 1L2UA 1TO3A 2C18A 3A23A 4RLIA 3EX3A 3C2RA 3W75A 5AC6A 3QW4B 3S0CA 4BI5A 4S2CA 4BI6A 1TCDA 2PRHA 1GEQA 1W31A 3GLCA 4FNPA 3PBYA 2DU2A 1KM6A 4GUHA 1I45A 3NO5A 1UBSA 4O1BA 2WNQA 4IQLA 1QOPA 3AJXA 3GXTA 4UTTC 4R7JA 3OVPA 2Q8ZA 5FEPA 1SU5A 4H3DA 4LS2A 3FOKA 4M5PA 4O1AA 4JTIA 1JCNA 2YDAA 5FEWA 1K7FA 2QDGA 4XUGA 1OFBA 4UCGA 1FUYA 2H3BA 3P67A 3PUEA 3W2NA 3L0KA 4XBKA 4NNBA 3P62A 2ABBA 2QEZA 2DZVA 3W74A 3G0SA 3KRZA 3QEZA 1P5BA 3NQ7A 4IMFA 3H54A 1S5VA 1RV8A 3DI0A 1OFOA 5F1VA 3N9SA 3QW3A 1FX6A 3SW6A 5L6UA 4OWGA 5CGQA 2HMCA 1UUMA 4YL2A 5FEZA 1OYAA 4LRSA 3BARA 3DAQA 3QC3A 1LOSA 3MHUA 3HGJA 4AHQA 3DKJA 3L5MA 3CU2A 3EEGA 3QMTA 2EPHA 2NUWA 1SR9A 3PSWA 3TW6A 2YW4A 4XKYB 3DFOA 1Q45A 4A22A 2KZHA 5KZEA 2J9ZA 3HOJA 1ZFJA 2H6RA 3G1FA 4PH6A 3LCIA 1Y0EA 1ZNNA 3W71A 1F6KA 3G3DA 1FQ0A 2E77A 1VYPX 4E38A 4O15A 4HNNA 2CLLA 3C61A 5KZDA 4X9SA 1HFBA 3TXZA 1P1XA 5AHFA 3NQCA 1SZNA 3P81A 3TFXA 3NGJA 4ZQRA 3B03A 2A7RA 2WNNA 1GOXA 1H1YA 5AYXA 2JK2A 1BWKA 1ICPA 4EVZA 4QM1A 4UFJA 1KM5A 4MJZA 3IEBA 5K4ZA 3L68A 4MJMA 1TV5A 1I8JA 2OJPA 4X22A 3LCFA 3O07A 2XN2A 3HMJG 3QFEA 2RFGA 3S1WA 1G69A 1ZENA 1IXPA 2FLIA 5ABTA 2RKXA 3NL5A 1W54A 3W84A 1EUAA 4O1DA 3NL2A 5DXXA 2QJHA 1H62A 2WPBA 1VJIA 4JDBA 5BRBA 5KTLA 5J5DA 2OT1A 2QUTA 2D73A 2ZBTA 4JY9A 4BWLA 3M47A 1FWSA 5TIMA 1TPFA 1YPFA 4RZ5A 5KINA 1JQXA 1SZEA 4EF8A 3C8FA 3UWZA 3NQAA 1VZWA 4MZ8A 4TMCA 1FDJA 3O06A 5D2YA 3C6CA 3P74A 4PL2A 2ALDA 2BX7A 5BOOA 1W5PA 3W2MA 3KVMA 3U8GA 3IGXA 5CZJA 1XCFA 4O8RA 4HNTA 1JR1A 5HNRA 3HO8A 3IGUA 1R47A 3T55A 2R91A 4P2VA 4D2JA 5H2ZA 1IXNA 2Y7GA 1JULA 4DQWA 2TSYA 2I9EA 1ICSA 5H91A 6ALDA 1QCWA 1KBIA 4FF7A 2VFGA 1C8VA 3Q2DA 5F2LA 1YPIA 1H7XA 3W76A 4O14A 1N55A 4FX7A 5I3IA 4GFSA 3GNDA 2QDHA 3QPZA 2ISWA 3W7IA 3MI3A 4O28A 4H6KA 3TX9A 3I68A 2ZZ1A 1MEWA 1O60A 1O5XA 2JGYA 3MHGA 3MP5A 4K6AA 4GXMA 5D02A 2DP3A 2VEIA 4CLMA 5IM51 3NPUA 4K39A 1W0MA 4ML9A 3OA3A 4GUIA 1SW7A 2B7PA 5BMWA 2GJNA 3IRDA 5BW6A 3S5ZA 4ADUA 4YWIA 3D0CA 3LCGA 4HIBA 1ZAIA 3RMJA 2ZTJA 1LM1A 1XKYA 2AAMA 3W07A 4KWVA 1E51A 3W85A 4FIRA 3TAOA 4GC4A 2GVGA 3B0UX 3DHDA 5FEXA 2X30A 3HGOA 3W1NA 2VEMA 1I2RA 5C54A 1XXXA 4AHOA 4UTHA 2WV8A 4MKNA 1OHLA 3TQ0A 2V81A 5A5WA 1QO2A 5HR7A 3UPWA 3CIXA 5D30A 4QISA 1RR2A 3FEMA 3ATZA 1FWNA 1UASA 1PCKA 3NQ2A 3HG4A 3WJYA 1AL8A 4A29A 3LHZA 4O11A 1IXOA 2PURA 1SSDA 2DORA 2Y61A 1IF2A 5F4SA 3LERA 4MOZA 4WY0A 2C16A 3UWYA 1T0OA 1QPQA 1O5KA 3R2GA 1X7FA 3L0NA 4NXSA 4JS3A 3QPYA 3BG9A 2A5HA 4JTJA 4BF9A 2Z2UA 4M7SA 3LCXA 3TROA 1RQEA 4JEQA 1LLWA 3MWAA 1LRQA 3HGRA 3PVFA 3EWBX 3HG3A 3IIOA 4K8EA 1TREA 1ZAHA 3TV8A 1UCWA 1GVQA 4JICA 3W7KA 1DQWA 4POCA 1D3HA 3PAJA 3TQKA 4LW7A 3SI9A 1KFLA 3MBFA 2E1DA 3QRHA 1FDZA 1EWDA 5LGZA 2Q8LA 3W7NA 4UTMA 3W1AA 1SO3A 5HJLA 4Y90A 4XTDA 3KAOA 4O52A 1K8ZA 3PF3A 2CLEA 2V0TA 4UMAA 3TFCA 3LCWA 1Q6RA 1OX6A 4FNSA 1CI1A 4LY8A 3STEA 2WQPA 3M44A 2NLIA 2Z1BA 1LROA 4NJIA 1ME9A 4LUJA 3ELFA 1SSGA 1R2RA 4HT3A 1QDSA 2X1SA 3NM3A 2X1TA 3WJWA 3HF3A 4UIOA 1TPUA 5G4WA 4UFMA 3O1NA 1GVOA 1KA9F 4GUFA 2X1UA 3NPVA 4MYAA 3QH2A 4K36A 3BGGA 4R33A 3TCEA 2ZZ3A 2WOQA 1R46A 3HJZA 4LRTA 3W7PA 3LHVA 3BLFA 1NFBA 4WOZA 3UD6A 1TB3A 3TUUA 1VHNA 1YTKA 2O7QA 5FF7A 2HS6A 3BVJA 1AL7A 3BO9A 4JNMA 1W3TA 1NAL1 4PTNA 3H53A 3MW7A 1XC4A 4FXRA 3BV4A 1N7KA 3O6YX 3DXIA 4LT9A 2X16A 3DBPA 2QCDB 3MP4A 1EP1A 1G4EA 5K9CA 4MZYA 4OQVA 4LU0A 3QSRA 4O54A 1I2OA 2FFCA 3W1UA 2FB3A 4UR7A 2ZTKA 4ZVJA 5BMXA 5EY5A 4ADSA 3N2MA 5LSMA 3W88A 5I3FA 3SY5A 5CSRA 1RQHA 2VKZG 5DBTA 1TSIA 4PA8A 5DCEA 1EUNA 1LP6A 3W6YA 3P80A 1DORA 4RZ4A 3Q58A 1WYIA 4JTUA 1U83A 2EGZA 3ZFHA 1PL9A 2B0MA 1RPXA 3KVJA 5IBXA 4B5NA 2CLOA 3GXPA 4WUIA 5DBUA 2Y7FA 3WJZA 4NJJA 4ZL1A 1Z44A 4AB4A 5CSSA 4UUIA 5AC8A 3NDOA 4IPIA 3O15A 1XFBA 4JTGA 4IMGA 2VC6A 3NL3A 2GUUA 1IIGA 4HNUA 2FIQA 2DZPA 4PFMA 3KFTA 4NZFA 1EEPA 4WJEA 1QMLA 4NNCA 1K7XA 5FF3A 3QF0A 1GVFA 2VEKA 3LRMA 4IGHA 3EKLA 3LXCA 3P84A 3IVUA 4N4QA 3R89A 3TA6A 5LNUA 5HULA 1TV8A 2CLKA 1QOQA 4K7VA 3I6RA 3G1HA 3NNTA 5AHMA 1VH7A 5DN1A 3RLUA 1H1ZA 3F1QA 3NQDA 2YFNA 2NXHA 1ZALA 4NT0A 2ZDRA 4YLWA 4NXKA 3UQNA 5AHNA 5DY2A 3LDVA 2CLHA 3G3MA 2NX3A 2P10A 2CLIA 3L2IA 3SIZA 4UNLA 1Z42A 3BW2A 4MZ1A 2YYTA 4OBTA 1KFBA 1AG1O 2XN0A 4K37A 1F73A 3LRKA 3M7WA 1F6PA 2B7OA 3UWWA 1AK5A 4JYDA 3G1DA 4DO6A 4WOQA 3GDTA 5FI8A 1W1ZA 3W73A 1HTIA 3V75A 3GDLA 5D32A 1X6UA 4KWWA 2WKJA 5AYZA 1VC4A 4Z1DA 1BKSA 3PS7A 5C6MA 3A22A 4AF0A 2GVLA 2Q3OA 3NQ6A 3MI2A 2ZCGA 4N4PA 1LRNA 3W1PA 3EXSA 2BTMA 3OG3A 2OT0A 1KFEA 4CNPA 4O53A 1MEHA 1KFCA 4KKXA 2J9YA 3FYOA 4UR8A 3VI2A 4IX0A 3HG2A 1TRIA 3EWZA 1XBVA 2NXIA 5KITA 1B4KA 2WSRA 3GX9A 1SUXA 3STCA 4OHQA 1H7NA 3UXAA 2JGQA 1JCYA 5F1UA 1KV8A 1PVNA 4QJ1A 5D03A 4FO4A 2QJGA 2CWNA 3G1VA 3SGUA 5LGXA 5AN7A 3MHFA 3KXQA 1O94A 3TH6A 1BWLA 4A3UA 3NA8A 2W79A 1J4EA 1SFLA 3VE9A 4NX5A 3S1VA 2VFHA 4OT7A 3PBWA 2C13A 1HO1A 5AYYA 3WK1A 1LLZA 3W2UA 1G4PA 3W70A 3EWYA 3RLVA 1OFAA 3F4NA 3BG5A 2YW3A 3GDMA 1ML1A 2B7NA 4LS1A 4PL1A 1K03A 2NV1A 3W7JA 1SO6A 1XBZA 2JKEA 1DKWA 1FDYA 2XFWA 2AGKA 1RVGA 4MLRA 1A5CA 2YGYA 3PUOA 2Q3RA 3WFAA 2OX1A 1TTPA 3LI0A 3GYEA 2QR6A 1OK6A 2ZA2A 3PSVA 3BW3A 3IVTA 2G95A 3LRLA 4JR5A 3V1PA 5EKYA 2A1YA 3T78A 1WA3A 4DO5A 3A24A 6TIMA 3ABSA 2NXGA 5FF4A 3BLEA 3UWVA 3VFLA 2YX0A 5AOUA 3W2LA 1G4TA 4P61A 1RD5A 3FIGA 1ZHAA 5LNSA 1H7OA 1YDOA 3JRKA 5E0KA 4HPXA 1W3IA 5CPOA 1EPXA 3NEVA 3P8JA 3TDFA 4CQ8A 1U5JA 5G5IA 3IGSA 3KHJA 3CIWA 4AAJA 2QCFA 3L0GA 3O16A 3NZ1A 2AQWA 3N9RA 3QM3A 4KFNA 3TE9A 3LM7A 5I3JA 1TRDA 2YPIA 3BW4A 3C2OA 2TYSA 4PODA 5BNKA 3W1QA 1KM4A 3MYPA 2PC4A 1L9WA 1VCGA 3O8AA 2C0AA 3QMRA 1WX0A 1WXJA 4UXDA 3LBMA 3W1RA 3R13A 2QCEA 3G8EA 3G1AA 1PHWA 1SO5A 3P60A 3R12A 1AW1A 3EB2A 2A0NA 2HTMA 3DFQA 4RCXA 1ALDA 1OYCA 2I1OA 3IV3A 4MY1A 1AW2A 1SO4A 2ISSA 3M16A 4M7TA 1I2PA 4XTIA 1W5OA 1KLYA 1PCWA 1ZJIA 3LTPA 3MYOA 4DF1A 5C5YA 4S2BA 3P8IA 1DJNA 3LXAA 5DCDA 1WOBA 3W7OA 3W23A 4O19A 1L6YA 2RDUA 3M9YA 4TU1A 5HINA 1GYLA 3LLDA 3FS2A 4ZQNA 2E6YA 2Y85A 3TJLA 3W72A 4FX8A 1OVDA 1GQNA 4UTWA 4NUWA 5DELA 1TPH1 1SPQA 4RV8A 3O6DA 5F4XA 3NXFA 3M43A 4ZQMA 4ZQPA 4JTSA 3ABQA 3ZS4A 3LHYA 3TJXA 1HL2A 1G4SA 3HBLA 3M5YA 2QF7A 3TMQA 2VFDA 2VFFA 2BXVA 3PULA 1TIMA 1OK4A 1TPB1 2QCGA 4BWLC 2WJZA 1W56A 4NJHA 3LI1A 4K7YA 3DI1A 2A6LA 1KLZA 1OABA 3L21A 3S1UA 4HN4A 3HPSA 3TR2A 3I65A 3CQ0A 1NSJA 2GQAA 1S3HA 4X3ZA 4O1CA 4W9TA 3KVKA 2CLFA 4NJKA 2GPTA 4N02A 2A21A 2QAFA 3W7EA 3TMLA 2PE4A 3LBCA 4ALDA 1NVMA 2EAWA 1JCMP 5G2WA 4DBDA 3SECA 3DGRA 4QSHA 2NX9A 2QKFA 3CC1A 1VYSX 2BWGA 2Y6ZA 2QCNA 3L5LA 3W7CA 4DBEA 3EKZA 2R8WA 4M6QA 1VQTA 1WBHA 3WJSA 4FNRA 3P5ZA 3GDKA 4GBUA 2R94A 3O63A 1OX4A 3GK0A 2X1RA 2Y7EA 1XUUA 1DQXA 3UZ5A 1PIIA 1P4CA 1DL3A 5EYWA 4NU7A 5D2XA 1OFQA 2A6NA 2ZZ7A 3EX6A 3GVGA 2J9XA 2ZRUA 3W7DA 2BLEA 3EWWA 3T7VA 3TKFA 1TMHA 1V5XA 3T40A 4WQ6A 3FA5A 3UYCA 1Q6OA 2A2IA 4LTSA 4O10A 1SZGA 3C3NA 3GKAA 2ATSA 2F7FA 4EWND 2JBMA 4LVFA 4PEKA 4YCOA 1RQBA 3NQFA 3CLMA 2V2HA 5C2XA 2XN1A 4LWWA 4LVGA 2VFIA 1MEIA 3E0IA 3OBKA 4HSNA 4MYXA 3PC0A 1J5TA 4Q4KA 5HWNA 1ZY9A 3GDRA 3G1YA 4AHPA 1GPWA 3VCRA 3GR7A 4QITA 5D37A 1QPRA 1K8XA 4N6FA 1HG3A 2FB2A 4MLJA 3BPWA 4LOCA 3NPWA 2YR1A 3YPIA 3G1SA 4CQ9A 5K3VA 2WNZA 2FJKA 3L5AA 2TMDA 3IIPA 3TXVA 4FIQA 1GZGA 1T8XA 2J24A 3STFA 3RFAA 3PUDA 5K9DA 1DOSA 1TPDA 4QAIA 1W3NA 4HHPA 4DELA 1F05A 5G1TA 3ZWSA 4JTEA 3W1MA 5D04C 4JTFA 1H7RA 4Z1AA 1AW5A 4H4IA 1J2WA 1Z41A 4O0KA 2B4GA 3WK0A 4M6PA 3L66A 1Q6LA 1B9BA 3L67A 4DO4A 5I3HA 4DF2A 4L4MA 1THFD 3W22A 1KFKA 3HPZA 2NUYA 5LNWA 1VCVA 4Z08A 1B4EA 2RH9A 3NAVA 1MZHA 1UJPA 2OMAA 2RDTA 4IMEA 7TIMA 1SQ7A 3GAKA 2DZTA 5HR6A 4R53A 4GE8A 4M19A 3WJXA 3THAA 3PB0A 4HNVA 1D3GA 5I3GA 2FDSA 4WY0B 4IWWA 4FX6M 2E5BA 1QO5A 3G0XA 4YMZA 8TIMA 1YDVA 3RU6A 3DENA 3EWUA 3W2KA 3M41A 1FCVA 1QWGA 3FKKA 3PB2A 4JDYA 2A85A 4IXHA 4MFDA 4JTTA 3MJYA 3LX9A 1BTMA 2Y7DA 3QJAA 4LVAA 3QQ0A 5D2TA 5K9XA 2H90A 3TC7A 4AVFA 1DV7A 4LVBA 2OCZA 3F4WA 3BGJA 3G24A 2NX1A 3HPXA 4JGDA 3C0JA 2GVJA 2V30A 3QYQA 1FCUA 4IMDA 3M5XA 1T99A 1TPEA 3CWOX 3QMSA 3KVLA 3G18A 1GTEA 4BK9A 1S5TA 3R8RA 5F2GA 1ME7A 5KMYA 4K38A 4JIQA 3ZR4A 5CZ0A 1LCOA 5AHEA 2VOMA 2C19A 4FXSA 1SFJA 4UMBA 1PV8A 4QQ3A 2A4AA 1GWJA 1FWRA 2NWRA 2V2CA 1TTJA 2H3DA 3E12A 2NZLA 3USBA 3NPXA 4QNEA 1KTNA 2YXGA 1H60A 3SR7A 3T4CA 4LC8A 1VCFA 3VE7A 4ZZ9A 3MBDA 1EB3A 3MP3A 3W7RA 1LRTA 4U28A 1DHPA 4UC5A 5HMSA 4AEOA 4HSOA 2FTPA 1Q6QA 3FJLA 2C3ZA 1CX9A 2HS8A 3U6WA 4OE7A 2ZQ0A 4MFEA 5D38A 3NR0A 5EL1A 3B8DA 1VGAA 2YFOA 5AHIA 4JD4A 4MVAA 3Q37A 3LTYA 1NEYA 3BLIA 4IPJA 1G67A 1TPWA 2V5BA 3GKFA 1W5NA 3A9IA 3UXDA 1FCBA 5KSWA 4IX2A 3KRUA 4Z0JA 1JRBA 5IBXC 1A50A 1EX5A 3EXRA 2FQIA 1AMKA 1EP3A 1FY6A 1K3UA 1KV5A 5HWMA 3P82A 3S9YA 1FXPA 4TMBA 2W0UA 4WD0A 2YZRA 1W8SA 5AHLA 4JXCA 2BZNA 4AWUA 3W3OA 2CZDA 2Y63A 1Z48A 1LZOA 4DEFA 1OFEA 2ZRZA 1NF0A 3NG3A 1HO4A 3R5EA 3M0ZA 3SFKA 3E9AA 1PHQA 4BI7A 4Q33A 2R14A 2ZYFA 3PBUA 3C2VA 1B3OA 4EIVA 2I14A 3NQMA 4I7VA 3N19B 3M1ZA 4M6VA 4Z1CA 4O18A 1D9EA 1YDNA 3PM6A 3I7QA 4FB7A 4UTTA 4DPQA 1F76A 3W87A 2LLEA 1H61A 1F7BA 1TQJA 2V8ZA 3S42A 3EX2A 4UTLA 1FBAA 2YYUA 3E96A 1QPNA 1EA0A 3TU9A 2GQ8A 5LZLA 4XKYA 5FF0A 1K8YA 3PR2A 2Y89A 5K4XA 1GVSA 1VLWA 2ZRVA 1A5SA 3TW7A 2FPVA 4HKPA 3QSTA 4FNQA 1SW0A 4N9EA 4WXYA 4OV9A 1TYGA 2CLMA 2JKAA 3NM1A 2VELA 2E5DA 4JYEA
chains in the Genus database with same CATH superfamily
3MMDA 2PFHA 2QUMA 4H01A 1KTCA 4I6KA 3WLLA 2WVSA 4Q32A 1FWTA 3UNDA 1P0BA 3SFWA 4Q8NA 3IACA 4GNJA 1FWJC 1IEVA 2XISA 4D8ZA 3LEPA 5A8NA 4IM4A 3HMCA 1H5YA 2E7FA 3VM7A 3FW6A 1DJXA 1BRLA 3RNDA 4K8HA 1CT5A 3H8AA 2WVVB 1IWBA 4W7VA 2Y62A 1UH4A 3ZO9A 1A5KC 3LN3A 5ECVA 1J10A 4LH8A 4C6EA 4JFSA 3AMDA 4MY9A 4X63A 4DAFA 4E2DA 1A5BA 3H2CA 2Y5EA 3TWAA 1ZB5A 3OLGA 3QKZA 4AD4A 1IZKA 1ZJHA 3BLLA 1QW7A 1UD5A 1JL8A 2A7NA 4H00A 3QZEA 3LY0A 4LC6A 4MWAA 1OEPA 4AF0B 4UTUA 3L23A 2V9DA 2CZ5A 3VKJA 1SZFA 4OZOA 3B05A 3NQEA 3OEXA 2B81A 1S2AA 1CECA 3URAA 4H6RA 4PUEA 2RDWA 4P7LA 4AISA 3ITXA 1XH1A 4L4LA 3CPRA 3WLKX 3M07A 4P8WA 5G4EA 3AIEA 1KFJA 4LPCA 3A5FA 4ZSUA 3VD9A 2WWDA 1DVJA 3B0VC 3UJSA 1XIBA 3FKRA 3FHQA 1PKMA 2Z29A 1OG0A 1J79A 3DC0A 1AJ2A 1JGIA 2E09A 4LYPA 2PMQA 2E5CA 1OF8A 3LCHA 1BG9A 1SMAA 2DSWA 1V3MA 3F2DA 3VNDA 1OGSA 5B7ZA 3VA8A 1LYXA 1PDYA 1XIIA 3V5FA 5LNVA 2NV2A 1OIMA 4LVDA 3OVRA 3KDOA 3SCVA 4OU1A 5DRCA 3CV7A 4GACA 1QAPA 9CGTA 3E49A 4XZHA 3XINA 5LIXX 1BG4A 1M7PA 9RUBA 4Q4SA 2QULA 1VRDA 1GPFA 4K2SA 4LYQA 1F8MA 1BXNA 2PDQA 4RX0A 3LSCA 4O4VA 5F4WA 3LZ3A 4JX5A 2J7BA 3DFSA 1O4UA 2NQJA 2HRWA 3HQOA 1HXJA 3MUXA 4IXXA 1YXDA 3WF0A 4UTWC 2NUXA 1OQFA 4MY8A 4H8HA 4K1WA 2VZVA 4Q6JA 2DJXA 3TTSA 2X40A 2YCIX 3TIMA 3U2OA 5C2CA 5HPCA 4BEUA 4FXFA 3MSGA 4XKMA 1UR0A 4OV4A 3W86A 3ZJ6A 1YXCA 5TAOA 2BHUA 1XD0A 4C6LA 1M5WA 3U0HA 2FTYA 3B40A 1O95A 1RVKA 4NZJA 5FCZA 4JEJA 1M04A 2O0TA 3CL7A 2F9RA 1A53A 1JIBA 4PMVA 3KCLA 1WZKA 5U7SA 1B57A 4A21A 1FFRA 1WDWA 3IJ6A 4MPKA 3WL0A 2ZZ6A 1AD4A 2PWGA 1EPVA 4FA3A 1MXSA 6PTDA 5FA5A 5AB3A 4FP1A 2Z24A 3BAXA 3XISA 2J8TA 2ZUWA 4DO7A 4LS0A 5KZ6A 3ME3A 4JKLA 4PCSA 3S1XA 1KW1A 2XM2A 1UUOA 1QI2A 1QTWA 2AQVA 3ARQA 4DUWA 2ZUMA 3HG5A 5HUPA 2IQ0A 3VDCA 1GT8A 3VMNA 3A21A 2XHYA 5AYIA 3WCZA 4GISA 1XSJA 2BDQA 2CW6A 3E2RA 4AY1A 4O13A 1ISVA 2DZWA 3G0UA 4ZQOA 2E25A 1MUCA 2BGSA 4LAOA 2QCDA 1DWHM 3LD5A 3JUGA 4GVFA 5CPLA 5A69A 5C7HA 3T2QA 5F2IA 4L56A 3APTA 3RN6A 1JUEA 2I7GA 1C29A 2O9OA 1XM3A 2ZICA 4CCCA 1AQ0A 4BCEA 1NQKA 3OYXA 1MO0A 9XIAA 1G6CA 5FF2A 2X09A 1Z32X 4NYUA 1I2NA 1FWDC 1MMFA 1N82A 3GTFA 1BSLA 3TSMA 4WZHA 1H2JA 3CUZA 4Y8FA 5LA0A 2BVDA 4O0ZA 1QFEA 1SW3A 2Z2AA 3KLLA 5GNZA 2OELA 3C2EA 1NF7A 2BSLA 3AHTA 3MVTA 1LUCA 2FZ8A 5CPSA 3T0CA 4M80A 1W1PA 1VR6A 3L9CA 3RK8A 1G1YA 1GG0A 3O2LA 2VENA 2ANUA 2HVOA 1VS1A 3N15A 2JIWA 1OCQA 2Z6IA 1LT7A 4NAFA 1R2TA 2WPGA 1JYVA 5XINA 4ZFCA 1YYAA 3VPLA 3G6MA 4R7OA 4XBJA 3K5XA 3K30A 2FH8A 2PRLA 3QY6A 1CYGA 2TPSA 3CYVA 4OUEA 4EE9A 3ZJ8A 5DLCA 4FHAA 3SSJA 4KWOA 1XLJA 3BH4A 4BY3A 1U5HA 1X8FA 3L65A 3CJPA 2VDHA 3LU2A 3VD4A 4LV4A 4YCPA 2YB1A 2GJLA 2PDFA 3PJWA 4KRZA 1TFVA 1ODZA 4X2PA 3NQGA 2CERA 1MDRA 4L65A 1YTEA 3MV11 1GORA 3L7RA 4GJ1A 3RO6A 3S5OA 2P0OA 1K6WA 4GX8A 1B3ZA 1VFOA 4JHZA 4JTKA 3BQ5A 3AALA 1XQKA 4I9JA 3U2ZA 4ZGYA 3DKLA 3GZ3A 3KS5A 1UH2A 1FXQA 5I79A 2GL5A 4E5TA 1KR0A 1X6NA 3VOIA 5K2ZA 4NRRA 1PXGA 1HW6A 4LANA 2G0WA 3W53A 2VEGA 1TQXA 1XRTA 4GZJA 2GK1B 2EG8A 3TSBA 5SWUA 1EDTA 2FVKA 3DHFA 1IR2A 1VFTA 4DWDA 1RY0A 4JX4A 2BGQA 5T8GA 2P5NA 3SGZA 5HWJA 2Z1KA 3CMGA 3KP1A 1OBAA 5G2IA 4DI8A 3ZR5A 3HGSA 1HP5A 1RALA 3VZZA 2A3AA 3BAJA 3TOPA 3LB0A 4QSFA 3M6YA 3EOUA 1YADA 1UD3A 2E6AA 3FDKA 4AW7A 4AWSA 5LXXA 3M0KA 4AWTA 3RRXA 3TONA 3SGGA 2ZZ2A 3IUHA 3UY8A 5CPMA 4F2UA 1R3RA 4N6EA 5DMLA 1ONRA 4O12A 4Y2WA 3QPEA 1TPVA 3QV6A 4ZO6A 3EX4A 2CBUA 4Z0SA 4BHYA 4EXQA 2ZZ4A 4RW3A 3VIMA 1VHCA 1OGGA 4IUOA 4MSSA 1ZP3A 5HMEA 3QHNA 2QW5A 1S5WA 3AIQA 1QR7A 4Y6GA 3WL1A 3PTMA 1ZZMA 1A3WA 2NWSA 3B9EA 3ORWA 1JUKA 1P6CA 3NQ8A 4NSBA 1VYRA 2PD9A 4DF0A 1ADOA 1KTBA 1C90A 2HE8A 1L2UA 2R24A 4RLIA 3EX3A 2HDJA 4L64A 3RX3A 5AC6A 3LGDA 3QW4B 2WWCA 5IRPA 3U7VA 1TCDA 1ZL1A 1EXBA 1Q7MA 2WM0A 4FNPA 2W92A 1XFCA 4GUHA 4LSBA 4C7FA 4O1BA 4IQLA 1KFWA 2QPXA 1KBBA 1TCMA 4IL0A 3TN6A 4O1AA 2YDAA 4B3LA 3AS2A 1PX3A 4XUGA 3SCNA 1FUYA 3UG4A 3B3DA 3PUEA 5CJ5A 5BXSA 2R6OA 3OU8A 4B2DD 4CN4A 4ZO8A 1PIGA 2QEZA 5EMMA 1PWLA 3NQ7A 4IMFA 1TUXA 3GW3A 1TA3B 3SSZA 2NSOA 1YNQA 1OFOA 5M1TA 1XQLA 1XYMA 2UY3A 1MXGA 1ZTVA 5FD0A 2FZ9A 1AFSA 2HMCA 3T07A 4KS0A 5H8PA 3VIHA 3SRKA 1XIHA 3QC3A 4L1GA 4O8AA 2PTDA 3L2MA 1V3IA 3CU2A 4HTYA 3AUJA 1SR9A 2VCAA 4KF1A 4CKQA 3PSWA 3TW6A 1BKHA 4XKYB 4W8AA 1VFUA 4A22A 4HZ8A 4AIOA 3A64A 1KGWA 3G1FA 3QV7A 4Z2KA 1PTGA 3SCUA 3W71A 4HHMA 4WJ8A 3KDNA 5E09A 1VYPX 2CLLA 3VDBA 1P1XA 3M0LA 5AHFA 3WMLA 3B03A 2A7RA 2WNNA 5H6HA 3AIRA 1BF2A 3IEBA 2O4MA 1K4HA 3L68A 1TELA 2ZE3A 3EDEA 4MWAC 3N6QA 1I8JA 3GU2A 3HPFA 3S1WA 1US2A 4YYCA 1ZENA 5ABTA 1S46A 3NL5A 4TXEA 3BMWA 1EUAA 3NL2A 2XFRA 4W8LA 2VGGA 2QJHA 2WPBA 4LCSA 3QLLA 5BRBA 5J5DA 5C8BB 2ZBTA 1SGJA 4DNMA 1HGYA 5AZ1A 3PPHA 1F3WA 3SJNA 2EJAA 3C8FA 4U3AA 2H9AB 2XIBA 3GTHA 5D2YA 4B3KA 5BOOA 3W2MA 2PGRA 1D8WA 4O8RA 2OEMA 4JFUA 3IGUA 3UBPC 3WUBA 2ZC1A 4R88A 4DQWA 1ICSA 5H91A 6ALDA 2WMGA 3RMEA 4RE2A 4Z42C 2VFGA 1C8VA 3GC4A 4HK5A 4RE4A 4PB4A 4D9PA 3JZUA 3G6LA 1RK6A 2QIWA 3K1DA 5I3IA 2QDDA 3QPZA 2ISWA 3W7IA 3TX9A 2ZZ1A 3U2CA 3K8LA 5CAHA 3MP5A 1G0CA 1K70A 1NDYA 3AWOA 4KETA 3P6LA 3CQKA 4QG8A 5D02A 2IPFA 2ZXDA 1OZMA 4HU4A 2B7PA 4PE8A 5BW6A 2PDNA 3S5ZA 3D0CA 4GIYA 1UR2A 4CNTA 1ZAIA 5E6ZA 1LM1A 1C92A 3GD6A 4GQRA 3W07A 3V35A 4E2VA 3W85A 5D9PA 3BLPX 4FAMA 3TAOA 4ERAA 1W9XA 2HVNA 5LIYX 2GVGA 3B0UX 3DHDA 5FEXA 3GU1A 2X30A 1WDDA 4B9ZA 5C54A 1NELA 1XXXA 2Q09A 1R5YA 3NXLA 4IIHA 2CKRA 5A5WA 1AZ2A 5HR7A 1U1HA 4B4HA 1WUFA 5D30A 2IQDA 3CS2A 3FEMA 3ATZA 1WXZA 1IT0A 4IIGA 1AL8A 3WJYA 3LHZA 5AVHA 3IK4A 1SSDA 1UG6A 2WHMA 3RCMA 2DORA 3NQBA 1IF2A 3HFTA 3T6CA 3BLOA 3B8TA 2C16A 3UWYA 1UUQA 1T0OA 1O5KA 1X7FA 5E70A 5A8OA 3DFHA 2POZA 2ZUTA 4BF9A 1AD1A 1RQEA 2G41A 4YN5A 4G1NA 3VINA 4AIBA 4K68A 1E43A 3UJFA 3EWBX 2XVPA 1MVYA 4DWSD 1TREA 2VRQA 4F0KA 1GVQA 4JICA 1DQWA 1YBQA 4G7FA 1M7XA 4C6KA 3I3BA 2QMKA 1W2PA 3MBFA 4RDWA 1GVIA 3PZUA 4XB3A 2PU0A 3VVGA 1X97A 3GXFA 4XTDA 3KAOA 4ATWA 2V0TA 3QV9A 4UMAA 3M0HA 2QGHA 3TFCA 1ZU8A 3LCWA 1K9EA 3FGCA 1CI1A 4PMQA 3GHRA 4I3GA 1A47A 3M44A 1YEYA 1Q85A 1SSGA 2X1SA 4CQDA 4MDOA 1Q2RA 4XG1A 1R9ZA 4IQJA 3HPAA 4HZ6A 1TPUA 1GVOA 1WO2A 2X1UA 2VWTA 4MYAA 2DT3A 3BGGA 2ZZ3A 4DZ5A 4HU8A 4HD5A 2CITA 2WOQA 4LRTA 4PTDA 3LHVA 5ABHA 4XZMX 3BLFA 1LWHA 2VGFA 3TUUA 1TE1A 1XGEA 4CD7A 2O7QA 5FF7A 1XH2A 4JNMA 4H9TA 3B9NA 4FXRA 1XC4A 3AIBA 1XG3A 4GIRA 1N7KA 3AHYA 4IF2A 1E9LA 1Z89A 4MZYA 2ZX6A 1I2OA 2FFCA 2CNCA 4UR7A 5BMXA 4ADSA 3N2MA 5LSMA 2R9RA 4AFYA 1QRQA 1RQHA 1GZJA 1DEDA 4PMXA 3AI0A 3P80A 5ABFB 3BV7A 1RP9A 3Q58A 3TTEA 1ZBKA 4JTUA 2NQ5A 1PL9A 4H9VA 2B0MA 1RPXA 5XIAA 2IPGA 5EFDA 1JDFA 4B5NA 3GXPA 2OOGA 4WUIA 4E4FA 4TVDA 2ZIDA 1ZJAA 1PAMA 3H6OA 1XFBA 3U4FA 1VPQA 4ATDA 3H21A 4HNUA 4J3XA 3M7SA 3KFTA 1OZQA 4PTXA 5HPOA 3VKBA 3GC2A 3URBA 1BXBA 4HK6A 4WSJA 2BASA 3MO4A 3ANVA 1E9YB 3TA6A 4QLLA 4K7VA 1F3TA 2INZA 2FHCA 3UR2A 1RJRA 2VZSA 2DZAA 5DN1A 1CLKA 1Q6FA 5H8UA 5DMMA 3MUIA 2NXHA 4NT0A 4NXKA 3LDVA 2CLHA 3G3MA 2NX3A 2CLIA 4GVGA 3BW2A 2YYTA 2WVVA 4K37A 5FJTA 5MKGB 2B7OA 1CWYA 3SCQA 3UWWA 4WOQA 4JTQA 5FI8A 1W1ZA 1UOKA 4H7VA 3N04A 1UWTA 1FWBC 1NU5A 4MNLA 1HTIA 1TWSA 3V75A 3BDKA 4AZCB 1ADDA 1S1RA 3LENA 3NEHA 1P1MA 1PTAA 1TWIA 3VNMA 1V8EA 3EDFA 4AF0A 3NQ6A 3MI2A 2ZCGA 2OOFA 3EXSA 2FDMA 2OT0A 1KFEA 4KRUA 4O53A 1MEHA 3WUFA 3SQLA 1KFCA 3WQCA 3VI2A 4IX0A 2IMRA 3EWZA 3ONCA 1XBVA 3CMFA 3H2MA 1SUXA 3STCA 4OHQA 3UXAA 2VR2A 3AYVA 1JCYA 1L8PA 4QJ1A 4Q8PA 2YL8A 2WBKA 5D03A 4Q8QA 1YPXA 2QJGA 3KZSA 3MDUA 4Y9PA 4AU0A 3LSBA 3G1VA 1A4MA 4JKKA 2NW0A 4OFCA 1FP9A 2PDLA 1SFLA 1KC7A 1KD0A 5A2AA 4RNHA 1LLZA 3TP4A 3W2UA 2QHAA 3FHAA 2BGNE 3GDMA 1ML1A 1DP0A 4LS1A 3VNIA 3N1AA 1K03A 1SO6A 3H24A 1DKWA 1EDGA 4DM2A 1RVGA 3FXYA 3PZTA 2Q3RA 1S39A 2OX1A 3WFAA 4UQAA 1TTPA 2ZA2A 1EIBA 3PSVA 3WENA 3BW3A 2XH4A 3LRLA 3HU7A 4NZCA 1KCKA 4IHCA 3HA1A 2A1YA 4XV0A 4BA0A 5FF4A 4ERGA 4Z1YA 3L4TA 2UWFA 3CB3A 3STPA 5AOUA 3W2LA 1G4TA 1E4MM 1FFQA 4V28A 1ZHAA 5HNNA 5LNSA 2VM8A 4ICMA 4IMAA 2PLCA 1BYCA 1YDOA 3S2LA 4DI9A 4GY1A 1V77A 1W3IA 4F8XA 3NEVA 3P8JA 3IGSA 3U5YA 1Q5MA 5BXRA 3CIWA 4XAGA 4FXJA 3NZ1A 3N9RA 5GJMA 4H83A 2Z1WA 5I3JA 2YPIA 4PODA 4ZTYA 5E5CA 1XPGA 4MWAE 3J7HA 2P8CA 5I03A 2C0AA 1PJ9A 3CH9A 1PHWA 1XYZA 1AW1A 1L8NA 2HTMA 3BJTA 3DFQA 3DN5A 4D71A 4RCXA 4Q4MA 3H26A 3WNNA 3SRHA 1W9BM 2JEPA 2ISSA 4GCXA 4M7TA 2J6VA 1PCWA 1P6BA 4L6OA 1ZJIA 4MTVA 3LTPA 1VJSA 3MYOA 1HGWA 3P8IA 3SCOA 3THCA 4GKLA 5DCDA 3W7OA 3B4YA 3W23A 1HT6A 4JFTA 4TU1A 1UA3A 3FS2A 2Y85A 3TJLA 3W72A 2BODX 4FX8A 1J96A 4ZA0A 3V7PA 4NUWA 1UKPA 5B80A 4MNMA 4RV8A 2QXWA 1TWDA 3LPGA 5I7GA 4ZQMA 4W85A 1CPUA 2NT1A 1JZ2A 1N8IA 3FX4A 4CD6A 2XIQA 3LHYA 3TJXA 1M7JA 2QF7A 1R3WA 2OWCA 2BXVA 1YQ2A 3AXMA 3QYSA 4GZIA 4KIEA 3WBEA 3B97A 3FSUA 2VNCA 2PWUA 1W56A 3SUVA 4PUJA 2G3MA 4K7YA 3DI1A 4QJ3B 1GOWA 2A6LA 1KLZA 1OABA 1K8CA 3EMZA 1RCQA 3TR2A 2YLLA 3I65A 3CQ0A 1NSJA 3KBSA 2D2HA 2GQAA 2OYMA 1S3HA 4L6DA 5I06A 1WZLA 3AIVA 3CHDA 3ARZA 2PE4A 2WJFA 1VIZA 4B5XA 1NOFA 4IGSA 3C86A 4QSHA 4H6QA 4X0VA 2Y6ZA 1FWIC 2R8WA 3SURA 1TIWA 1VQTA 1WDPA 5CPQA 3WQWA 3WJSA 4FNRA 2QZRA 3O63A 1MNSA 1W6TA 5A6LA 3KM8A 3L4YA 3UA3A 2VL4A 1OC7A 4Q4RA 4LB4A 4QS5A 3A4AA 1P4CA 3DYOA 3M46A 4JOMA 2J9XA 1JYWA 3TKFA 3T7VA 3WLMA 3TYCA 3MKKA 4D6FA 3EOLA 3WD3A 4HMEA 2ESCA 1SZGA 4V27A 3GKAA 2ATSA 4WKFA 1CXEA 1KWKA 1UWQA 2BOFX 4YCOA 1QASA 2PP3A 4RNIA 4WF7A 2VFIA 3PC0A 3WMBA 1GPWA 2XIJA 1OT1A 1TWWA 4FSAA 4V15A 4JQ3A 2FB2A 1CGXA 1V79A 3NPWA 4M3PA 3QQWA 4FOKA 1Q65A 3KLKA 3WD4A 2WNZA 1D2KA 3MQTA 2FJKA 1BTCA 3AIWA 4KT2A 3WQEA 5K9DA 2XVKA 2PU1A 3L4XA 1TPDA 3QBUA 4ZOEA 4QAIA 4J3TA 4LAMA 1H3GA 1V4YA 3MCNA 1XCWA 4WHBA 3ZWSA 1V0NA 5D04C 4D1IA 3VC6A 4MJ2A 3WZ0E 1UZDA 2HJPA 2B4GA 1UP0A 3L66A 3B9OA 4G9PA 4M29A 1B9BA 4DO4A 4DF2A 2XDFA 2NSXA 5C9WA 2NUYA 2SFPA 1OGBA 1B3YA 5LNWA 5CPTA 1BQGA 2RH9A 4F4RA 4V1XA 2OMAA 4HVXA 2RDTA 7TIMA 5FJJA 2GK1A 4M19A 3NOYA 3PB0A 4TVCA 1C7SA 1HP4A 2VVNA 4LF1A 1QO5A 1HNYA 3QR3A 3GXMA 4KERA 3W2KA 4EAYA 4IXHA 3BAYA 4JIRA 3MJYA 3TYBA 4Q4PA 2Y7DA 3QXBA 2MNRA 3QQ0A 1ONEA 4TX6A 3RHGA 2H90A 1KQYA 1J6OA 2NX1A 1VEOA 3NYDA 3QYQA 2BFGA 4F0HA 2OEKA 2VGBA 3CWOX 3QMSA 3URQA 3G18A 3VCNA 2O55A 2J13A 5CG0A 5G1MA 3OZOA 4D6CA 3TA9A 4M6UA 1LCOA 5AHEA 4Z2IA 7XIMA 2GSJA 2Q01A 4QQ3A 4FI4A 1TTJA 3E12A 2PSNA 4MGGA 2BMBA 4PUUA 1TVLA 4QNEA 1KNWA 2YXGA 4LUSB 4MB3A 2Z26A 4U28A 4I5UA 1DHPA 3KW3A 1EGZA 4HSOA 2PODA 1BLIA 4N42A 3JU2A 4XVDA 1CENA 3NR0A 3WBWA 3DHPA 3FNDA 4MVAA 5JIPA 3LTYA 1NEYA 3BLIA 4IPJA 1IR1A 3QKEA 3ARVA 4UWMA 2V5BA 3GKFA 1W5NA 4F0SA 5KSWA 5CBIA 4L1WA 1A50A 2AKZA 3GG0A 3EXRA 3N2TA 1EP3A 1PTDA 2DW7A 4ZXLA 2HE5A 4C6QA 5DANA 3FAWA 2VZUA 3CAVA 5BOFA 1WNOA 3S9YA 1FXPA 1WKEA 1Z48A 4DEFA 3M0JA 3NGFA 1NF0A 1W1TA 1TA3A 3M0ZA 3SFKA 2OKTA 1NQ6A 1BAGA 4Q33A 1KWGA 2ZYFA 3AYRA 4I7VA 2XWDA 1R7AA 3M1ZA 5CH9A 4Z1CA 4UTTA 2GGHA 4LBSA 2LLEA 1H61A 1W8GA 3RX4A 3MU7A 3I10A 4ZENA 1FBAA 2W66A 5LZLA 4XKYA 1O5QA 1K8YA 3VGGA 5K4XA 3LMYA 2VO5A 3ID7A 2FHBA 3MUAA 1A5SA 2I9UA 3TW7A 3VD3A 3QSTA 4FNQA 1OCBA 3VNJA 4N9EA 5I2UA 4P7OA 5DX7A 4OVXA 2CLMA 3NM1A 2VELA 2XPKA 5KMYA 2L5HA 3PN8A 3AWNA 1P0KA 3MA8A 3PTKA 2ZUSA 1GOKA 3PFMA 4WXZA 2HQAA 3BCFA 5G2HA 1WV2A 2ZDSA 1N8FA 3KOYA 2WC4A 5A8QA 3GO2A 2BVTA 4DBSA 3VILA 5FOOA 1UB3A 3AO0A 3W1XA 5C9ZA 2JEQA 4IQDA 2DJLA 3WDIA 4D6EA 3TOYA 1B3WA 1V6TA 3IUIA 3ABRA 3P5YA 4FEZA 4LNCA 5C9XA 1ECEA 2H9AA 2J25A 2C14A 2PTZA 4O16A 1F3XA 2ZOXA 1Y5XA 3W7GA 3RM9A 4DZIA 1HJSA 2VMFA 3TQVA 3FSTA 1EQPA 1K02A 1XYBA 4QQUA 3HV8A 3DFTA 3JVAA 1SJAA 1KRAC 3W02A 1RSCA 4RK8A 2WVUA 2YL6A 3WDJA 4CQAA 3ZSTA 3HB9A 3E0LA 2OZ0A 2VTFA 2GOKA 1L6WA 1L2QA 3C2FA 4E0CA 1B2YA 4Y9MA 3T9PA 1ISYA 5CKSA 1EZ2A 2J7EA 3EDDA 2CBVA 2RDXA 5EPDA 1UPPA 3UYIA 4DNHA 4JIPA 3SBFA 3CHEA 3PZOA 3GB6A 2PF0A 4XAFA 4ROPA 1X8CA 4HBKA 1GG1A 1NWUA 4MNKA 2HBVA 4HQVA 1W3HA 1JYNA 2DZXA 4CCEA 4ZMGA 1O5RA 3PY2A 5LHEA 5C7VA 3RIKA 3ZYZA 1J0ZA 1NP0A 4V2XA 4GUJA 4OOUA 4XD6A 1ZS2A 3B4UA 3LTSA 2J79A 2JQXA 3NL6A 4QIUA 5D9MA 1X1ZA 2DZUA 4S3CA 2FJUB 4NJGA 4A3QA 3MMTA 2BXZA 4QDMA 4BQ4A 1CDGA 5J04A 3TW9A 3INPA 4UB9A 3B8IA 3PTQA 1QU4A 1UWIA 2XG9A 4YTUA 3V0TA 3LCLA 1UMYA 1MW0A 2QCHA 3AS1A 4LJ3A 3S8HA 4CN6A 3WMSA 4FZIA 4B9YA 3NQVA 1OFRA 3R0KA 5A6AA 1IIHA 1ENUA 4Y9AA 2G4FA 4UNIA 3A5VA 3S9ZA 3GHTA 3MSDA 4D1JA 3IPWA 2YL9A 2YJQA 3IK2A 4GUGA 3IRSA 3WH7A 1KM3A 4JQ4A 5DF0A 4QG9A 4AEFA 1Q4WA 3ZJ7A 3ABZA 2Z7KA 3LV5A 4B5VA 2ZRXA 1UD6A 2V38A 3GZAA 1AODA 3EDJA 5HATA 1CXKA 1JUBA 4N9BA 1ZCOA 5BXTA 4EAMA 2JFEX 5CG7A 1EL3A 3DU0A 3EGJA 3WUGA 4QX4A 1XC6A 1F6YA 2DUAA 1W9UA 5TQLA 4F3HA 1XBXA 2ZZ5A 4H9UA 4KGJA 3BANA 4GO8A 4YVVA 3PG9A 4FMVA 3DZ1A 2R1KA 3WQFA 1NDZA 4MUZA 3W7QA 1XINA 4HYWA 4RPPA 1DWFM 2CXEA 3BUVA 1J6PA 1DJIA 1XIFA 3CT7A 3CXOA 1XUZA 1L6SA 7PTDA 1DWJM 2QCMA 3HJEA 1NP2A 1JQVA 4UQEA 1XDLA 1GVYA 1L0PA 3LV6A 4QEEA 3AZTA 3S5YA 2XFYA 1BQCA 4NVTA 1UIPA 1KBJA 3S2JA 4XX6A 1ITCA 3CM4A 2O9RA 2QCCA 5EGRA 3QGVA 3R58A 2X42A 3W7MA 4PC8A 4A3YA 1G7VA 4RL3A 1S2CA 2HPMA 4AZBA 1XLEA 1PO9A 4EKJA 4E3VA 2WZHA 2DPEA 2TRSA 4D8AA 5EBAA 2FPYA 3REQB 3MSRA 5ECUA 2FHFA 3P7YA 3SN0A 3W29A 1IYXA 2EKCA 5D33A 3CWHA 5E1QA 3UWQA 1QT1A 4YHGA 1TPC1 1JJKA 1WAUA 2ZA1A 4MIMA 4G2DA 2EJ1A 5ABFA 4PMOA 1VKFA 4GRSA 4RXGA 2FPTA 3HFYA 2YSWA 3KBWA 4GMEA 4I7UA 4LF2A 2EF9A 1H63A 4DJDA 4QLJA 1I1XA 3S6DA 1X1NA 2H8XA 1UWUA 1V51A 3SRFA 5TNVA 4N9DA 4CNOA 4IIFA 4ZFMA 3NVTA 1BFNA 3OZYA 1F2JA 3C56A 4Z2HA 3CL8A 3UR5A 2QJNA 3WQGA 5I78A 2EPLX 1B31A 4LFYA 4J9JA 5HJYA 1LTDA 1M6JA 2CEQA 4CN1A 4JIEA 3M0VA 3BZGA 2W62A 3TTQA 2A3HA 1EDQA 3NYZA 2DIJA 1E6XM 1Z7AA 4ZQCA 1V7YA 1LL6A 2J78A 2Z1VA 3NWRA 1XLGA 1A5AA 4X9YA 5HAOA 2AMXA 1W5MA 4LY4A 2PI6A 3VGFA 2DZSA 4GWEA 4S1FA 2Y88A 4WEVX 3CAWA 3F5JA 3L4VA 4RJEA 5MKGA 2X7VA 4UR9A 3SUWA 1HKJA 4IGNA 1TJ2A 3CB8A 4AZGA 1R3SA 3LXBA 1PYMA 1YE4A 1MSSA 3G2GA 1TUFA 4FR1A 5D09A 5LKYA 4AZCA 4XZ9A 3UWUA 4ZOAA 4GQQA 3PG8A 3EOOA 2W9MA 1OFDA 4HYVA 5I0DA 4LCQA 4M1BA 2BBFA 3TC6A 1XIJA 1W1VA 2QCLA 1OSEA 3N34A 1JCLA 5DT5A 3UW6A 2E3ZA 1R6WA 2WSQA 2QS8A 1KCLA 4GGBA 3E2VA 1XD1A 4C7GA 4MPQA 2QIIA 2EG6A 3SCRA 1EXPA 5AC7A 5CZSA 1J0HA 3KP0A 4P7NA 1ZQ5A 2PB1A 1EZWA 1LOQA 1GJPA 4EPDC 3LPOA 1T96A 2WKLA 5D05A 4D6DA 2VX6A 4NNAA 4OGZA 1XKJA 4M1RA 5IDZA 4IPPA 4ML4A 1IE7C 1YTDA 2H8ZA 3SZ8A 1UR8A 5FJRA 5HJXA 3F2CA 2V5CA 3C0LA 4NF7A 1JZ5A 1R30A 1Q13A 1IQ8A 1DHKA 3GH7A 3PPFA 3EPNA 3UA4A 1DJQA 5K7JA 1U5VA 2Y0FA 3ANYA 2AMGA 4GY0A 1LL7A 3VMPA 2IKGA 3IIVA 1K1DA 2QUVA 2F84A 2DZBA 4A3HA 5HUOA 1E15A 3N2XA 2PDKA 1MFVA 3GVRA 4CVWA 1H51A 5C55A 3R8HA 4KFPA 4ICNA 4DVOA 1BVZA 3UY7A 2BOGX 2WZMA 2QUUA 3M6DA 4IJBA 2ADAA 2ZRWA 1XIEA 4TIMA 4F66A 5FESA 1GHSA 1TV7A 4GC3A 3E0VA 2BY1A 3A23A 3C2RA 3W75A 1GOOA 2IKJA 3BE7A 4BI5A 4S2CA 3T4WA 1IZCA 3VCCA 1FHLA 1IGWA 4U2YA 4YS1A 3NUKA 4W4QA 1I45A 4UOQA 1UBSA 3TLQA 2WNQA 1QOPA 4XAYA 4GQBA 4C5ZA 4RZBA 3GXTA 4UTTC 3OA5A 4WDTA 2Q8ZA 1LQ2A 4H3DA 4LS2A 1NWRA 3FOKA 1VFLA 4M5PA 4JTIA 4ZB2A 1LWIA 1K7FA 1OFBA 3AYSA 1UKSA 3KOXA 1R3VA 4UCGA 3E5BA 3W2NA 1B5TA 3L0KA 4XBKA 3VUPA 4NNBA 3P62A 2DZVA 2PD5A 1XP3A 3KRZA 3W74A 5T9BG 1S5VA 1RV8A 1QNPA 3QR1A 5F1VA 3KEHA 1FX6A 3USZA 1TVPA 4OWGA 1Q7ZA 1DWAM 3KUMA 1XRFA 4YL2A 2DQWA 3S5SA 2GGJA 3BARA 1LOSA 3HGJA 5HXMA 3L5MA 4J28A 3UXIA 1X7IA 2NUWA 2HCVA 2GJXB 5A6SA 1ZGDA 4Q6XA 3DFOA 1V0KA 1Q45A 4C60A 4WDXA 3N11A 5BWFA 5I02A 1GUVA 1F6KA 3D3AA 3BGAA 3WELA 3AXIA 1XIMA 3C61A 4X9SA 1SZNA 2FYMA 3NGJA 1W3KA 1H1YA 5AYXA 2JK2A 1ICPA 3WD2A 2J47A 2OFJA 3CYJA 4GIAA 1CLXA 4QM1A 4MJZA 5DMYA 2F61A 3VFCA 3BQ6A 1SJDA 3G1RA 4DUVA 3HMJG 3Q65A 4IQEA 4PCPA 2RKXA 3ZLGA 4BF5A 2DW6A 2PDXA 1V6VA 1A49A 4HNCA 2QMJA 1CEOA 5KTLA 4OKDA 2PDBA 2QUTA 1E4NA 1TV2A 1ESWA 1UR1A 1D7KA 3VNKA 3R1ZA 2WLZA 1JQXA 4ROQA 4ZEPA 3WBXA 3SEPA 3UWZA 1EO5A 4EANA 3O06A 1SFSA 3C6CA 3AUOA 3P74A 2ALDA 4YJ5A 2BX7A 1E0TA 3WLPA 3ABXA 3U8GA 5CZJA 1XCFA 4HNTA 4J27A 5HNRA 3EPMA 1F8IA 5I09A 1EC7A 1XGZA 2R91A 3S47A 5BXPA 4XK2A 5H2ZA 4KWSA 1KGUA 4QG6A 2I9EA 4WLCA 3UXLA 5E6YA 1VEPA 3UVIA 4O14A 2XWEA 1V3LA 4FX7A 3RPTA 3RCNA 3B8SA 2ZVRA 1EFZA 3MI3A 2VZTA 1S2WA 3I68A 3II1A 2J66A 1D3CA 1O60A 1J8VA 3RITA 4Z2JA 4GXMA 4CEXC 4KRTA 2WVTA 3AS3A 3TEVA 4CLMA 2WMJA 5B7YA 3NPUA 4K39A 4ML9A 1SW7A 1UWRA 2GJNA 4U31A 3LMZA 4QE1A 3WEOA 4CU7A 2ZTJA 1XKYA 4HA4A 2PTYA 2V3EA 1R38A 2CHOA 4JCLA 1TV3A 4WSKA 1I2RA 4MJ4A 4LGXA 4AHOA 4UTHA 4MKNA 4HA3A 1MRAA 3TQ0A 2BS9A 3T8LA 3VYLA 1RCOB 4PSRA 1QO2A 4XO7A 3R0DA 2ZADA 3VD5A 2OXNA 5AC5A 4J4KA 4A29A 2CKSA 3AMGA 3AJ7A 3T05A 2F2HA 4GY7A 4EPEC 3UCDA 4GZ7A 1QPQA 3L0NA 3OGRA 1HKIA 4NAEB 3BG9A 2A5HA 4JTJA 5GJNA 3TROA 2J75A 3W27A 4CGTA 3T0AA 4LYKA 4D72A 1WKDA 2GDVA 3FDGA 4J40A 3WF2A 3HGRA 5BOEA 4PZVA 2I56A 3KZPA 4N7QA 1UCWA 2XM1A 4U10A 3W7KA 1NJJA 4NIRA 1OD8A 3TQPA 1D3HA 5C71A 2VC7A 4WKAA 4LW7A 3SI9A 1V08A 3S46A 1KFLA 3WUEA 4Z2LA 1JF5A 1YNPA 1FDZA 5LGZA 2Q8LA 3AAMA 5A3HA 4DBUA 4QDPA 1E1CB 1XLFA 2PDPA 1K8ZA 4LUSA 3PF3A 4AVNA 2YBUA 2IKHA 3A4XA 4LY8A 3STEA 2CIPA 2Z1BA 3IAQA 2GSHA 1R2RA 4HT3A 4IICA 1R85A 1QDSA 5BROA 3NM3A 1W9DM 2X1TA 3WJWA 2Z27A 1T40A 3S2MA 5G4WA 1KA9F 1M68A 1UP3A 3THDA 2ACUA 3TCEA 3VOJA 4OOZA 3HJZA 4H9YA 7CGTA 3ZVHB 1NFBA 2FGLA 1TB3A 4NL1A 3BVJA 1AL7A 4DJDC 1NAL1 1L6GA 3IJQA 1E3XA 2X16A 4PMZA 3DBPA 3RGTA 1O1ZA 3MP4A 1W1IE 2Y8UA 3MY9A 3VOHA 3ES7A 3OQ8A 3W1UA 3DDMA 1JPDX 1UC4A 4ZODA 5I3FA 4CD4A 3SY5A 1GKPA 3CASA 5DCEA 4IIBA 1LP6A 4RZ4A 3VC5A 2F8QA 4GVIA 1F61A 3IV8A 4UTFA 3KVJA 3B8UA 4MKSA 2YLAA 1YDYA 5DBUA 3RLHA 1XR2A 4ZL1A 3CV1A 3N18A 3EA1A 5AC8A 4KCWA 2Y8KA 4I9MA 5GQBA 4JTGA 4IMGA 2VC6A 3UZYA 3NL3A 5DRIA 4NZ1A 4MWAD 1UH3A 3AICA 3GNRA 4IIEA 4F79A 3WQVA 1EEPA 4QHRA 1QMLA 4DX3A 1LT8A 4NHVA 3QF0A 1GVFA 2VEKA 1UHVA 3K8MA 5BCAA 1DQUA 4IGHA 4K8GA 5HMFA 3IVUA 5LNUA 5HULA 4Y9NA 1TV8A 2CLKA 1QOQA 2XH0A 2QYGA 3GHSA 3VKKA 3NNTA 3QOMA 5AHMA 1E40A 3B0YA 3RLUA 3KBVA 1H1ZA 1OM0A 1JFHA 5FIPA 4CNUA 4W84A 2YFNA 3BTNA 1F9CA 2FVMA 3UQNA 5DY2A 1HJUA 2V3GA 3GTNA 3UFYA 4UNLA 1Z42A 1KFBA 3F7JA 3CHCA 3TYZA 1F73A 3LRKA 3M7WA 1F6PA 2OLHA 1AK5A 3G1DA 2XZ7A 2ZWYA 3W73A 1EHNA 4JN8A 1SYTA 3IJ9A 4PMNA 6CGTA 1OWQA 4BQ3A 3WH5A 1VC4A 4DXKA 4Z1DA 3PS7A 2WW5A 2X0YA 2J8GA 3VOFA 1Q8JA 1LRNA 1B30A 1P0DA 1Z69A 3UR8A 1KKRA 2Y5SA 3HURA 4KKXA 4QFUA 2RGLA 3HG2A 3PAOA 2NXIA 3QC0A 1SR0A 4JFWA 2GVEA 3NSNA 1H7NA 1RLDA 1UWAA 4TTUA 1B1YA 3CQIA 5F1UA 1KV8A 4FO4A 1UKTA 3GYCA 4L4PA 4HCDA 3R10A 3MANA 2G3FA 3VIPA 3NA8A 2W79A 4TVUA 2X41A 4OT7A 3PBWA 1VENA 2C13A 5HMDA 3WK1A 4GINA 3W70A 3EWYA 3RLVA 1OFAA 2G3IA 4ZBCA 2YW3A 3XIMA 4JPGA 2E4TA 5C2GA 2XFWA 4MLRA 2GDUA 5A8PA 3R6IA 3GYEA 4L7ZA 4KIRA 3UG5A 3IVTA 2G95A 2ZX5A 6XIMA 4GXWA 3T78A 1WA3A 5C9UA 3ARTA 1U1JA 5GPRA 2UY5A 4P61A 3FIGA 1OY0A 2J7GA 1BYAA 4GYFA 3V16A 1SVDA 5CPOA 3PZVA 1OADA 1M3UA 3H2EA 3ARUA 4E8DA 4QXIA 2AQWA 1B3VA 3LM7A 4A4AA 2TODA 3C2OA 3BW4A 4PMUA 2FZBA 5BNKA 1PX4A 5CC7A 2PC4A 1L9WA 1VCGA 2D3LA 3NIYA 1XISA 1JYXA 1WXJA 4UXDA 5CLTA 3G8EA 1MW1A 1SO5A 1V0LA 1ALDA 2IPWA 2OQLA 3WQ8A 2I1OA 4BS0A 4MY1A 1AW2A 1SO4A 4H04A 2PDYA 2RUSA 5C5YA 3RDKA 1DJNA 1RPKA 2E8YA 3CHFA 1PIFA 2E1WA 1GYLA 4B5TA 3V4BA 2E6YA 1QI3A 1R9XA 4JTRA 1V02A 2G3NA 1OVDA 1BVWA 4W87A 3TR9A 1P48A 4W8BA 3VDHA 4LB3A 1TPH1 1HKMA 3D5HA 3O6DA 4PULA 4L6HA 1EH9A 3KL5A 5F4XA 3NXFA 5FJPA 3M43A 3DGBA 4ZQPA 1AJ0A 5FL0A 1DWIM 3AISA 4JTSA 3ABQA 3ZS4A 5I23A 3ARSA 4E3TA 1FWHC 3M5YA 5ABGA 4Z2GA 3RM8A 1TIMA 1DWGM 2C1GA 4WKHA 3O0KA 1R7OA 3BCJA 1TZZA 2Z00A 3L21A 4HN4A 2VR5A 5A2CA 1UROA 3UEQA 3N3TA 1JPKA 3UZWA 4X3ZA 4O1CA 2V5JA 2A21A 3EOSA 3W7EA 4YNGA 2WXDM 3ITLA 1NVMA 2EAWA 5D9NA 2WCGA 1HF6A 5G2WA 2HWGA 3VIGA 3DGRA 4DJEA 3W7CA 4UQCA 4DBEA 4QLKA 1ADSA 5CC5A 1VBGA 1OCNA 3REQA 2X7WA 3A13A 3GDKA 4PRWA 2W4XA 3IJIA 1AQHA 3UG3A 3CUXA 4J2MA 1W9VA 4CEUC 1C9WA 1JI1A 2PWVA 3UZ5A 1J12A 4AY7A 1PIIA 1MWOA 4NU7A 1TR1A 5D2XA 4A6GA 3W01A 1OFQA 1E3ZA 5CJNA 5G4HC 3EWWA 3B0XA 8A3HA 4V33A 3FA5A 3UYCA 1Q6OA 2ZWZA 2DV0A 3M4HA 1UA7A 4W7UA 3C3NA 3I4KA 3AYTA 1RXOB 2F7FA 3BMVA 4AD5A 3N2CA 3WLOA 3WFZA 1KRMA 5AC4A 4LVFA 4PEKA 1EX1A 5E0FA 2AL2B 5PTDA 2PDIA 2V2HA 5C2XA 3EWDA 3L4WA 2QLYA 3H4XA 1EF3A 3E0IA 3OBKA 4RDZA 1A5LC 1J5TA 1EJTC 3GDRA 3G1YA 5CLWA 2REQB 3H2NA 4MB4A 4QITA 5D37A 4N6FA 4PTMA 2XTKA 1V0MA 3P2VA 2I5QA 4PUNA 1EJUC 1B90A 2YDQA 4GNVA 1MDLA 2YR1A 4TV6A 1XSKA 5K3VA 4O0QA 3TXVA 3LNPA 1PEZA 4H19A 2Y24A 1OD0A 4WVXA 3H7VA 5G1TA 1UIOA 3W1MA 1H7RA 1FWEC 4E8GA 1AW5A 4C6BA 4H4IA 1NH6A 1Z41A 3QGAC 3WBYA 2XIMA 3UU0A 5IDIA 5D9OA 3GHUA 3WK0A 2QUNA 2YXOA 3L67A 4FK9A 1LG1A 4ZOCA 5I3HA 1R3YA 1E9ZB 1VCVA 2HXTA 1PZ1A 3TZNA 3E2SA 2Y8VA 3GWQA 4G8TA 4AUBA 1UJPA 2F6KA 1S2VA 1Q4NX 2PBOA 1SQ7A 3GAKA 1GJWA 3VKAA 1CGVA 4UCFA 5BRPA 3OGSA 3P0WA 5ABEA 5I3GA 3W37A 2PCEA 2ODOA 1FWFC 5EB8A 4WY0B 4IWWA 1QK0A 2E5BA 1T6MA 5JH2A 1O66A 4NRSA 2D23A 3DENA 4JFVA 1FCVA 1QWGA 2A85A 4GIEA 5IFTA 4H9MA 3QGKC 3LX9A 1BTMA 4NKCA 3QJAA 3OQEA 3CUJA 1RBAA 2P3EA 4AVFA 3MJMA 5FAJA 4H6EA 3BGJA 3AS0A 2GVJA 2V30A 1FCUA 3M5XA 3GY1A 3MMWA 2GSEA 1OG6A 4W5ZA 1ZUAX 3WD1A 2FMOA 4K38A 3ZR4A 5CZ0A 3MDWA 3H70A 2VOMA 2NWRA 1VBUA 4RPQA 2MUCA 3VIKA 4DY1A 5HA7A 1IHIA 1UBPC 1KTNA 4IPLA 4PUDA 3SR7A 4HOZA 1FWGC 1GZ1A 1QVBA 1HZYA 3BMXA 3S2CA 1GYMA 3DIPA 3GRIA 4UC5A 2Y2WA 5LA2A 1MFUA 2C3ZA 1CX9A 1M53A 2YDSA 1OCJA 4FOUA 3U6WA 4OE7A 1H5VA 1XCXA 4MFEA 3TNBA 3MUY1 5D38A 3ICJA 5EL1A 1Q6CA 4UOZA 3ANUA 3T2OA 4JD4A 3DYMA 1G67A 2E67A 1TPWA 3BOXA 4W88A 3A9IA 4N0RA 4MAZA 4RDVA 3KRUA 1JCTA 2OKOA 3GIPA 1K3UA 3TTYA 4WD0A 1W8SA 1S5MA 4JXCA 2XFFA 4NI8A 4AWUA 3W3OA 2CZDA 2R1NA 2Y63A 3KL3A 3KE0A 2ZRZA 3OPSA 1VFHA 4XVEA 2G3JA 2WCSA 3E9AA 4R3UA 1PHQA 4HPNA 1EA9C 4BI7A 3EDKA 3PBUA 7A3HA 3NQMA 4M6VA 3PM6A 3I7QA 4DPQA 2F6UA 2YXXA 1TQJA 2V8ZA 3EX2A 4UTLA 1UD2A 3WLHA 4P8UA 3SB0A 4D6JA 3PWGA 5M03A 4S3JA 4PB5A 1EA0A 2ZXQA 2WM1A 3DBNA 2GJXA 4I6VA 1ZLPA 3KWSA 1V93A 3GTXA 4Q8TA 3PR2A 1PZ2A 3V5OA 2Y89A 4WK9A 4M0XA 3KHDA 3V18A 1POJA 4HNLA 4PRRA 2FPVA 3S6TA 4WXYA 4GGHA 1TYGA 4G7EB 4HMDA 2DQXA 5GNYA 1PZ0A 4PCNA 3G77A 4NASA 4CNSA 2J7HA 2AOSA 1PBGA 2HZGA 4JQ1A 3WN6A 1Y8BA 2Z7GA 1CLVA 3F2BA 2HSAA 1C3FA 1VFMA 5J5RA 4LUTB 5T26A 4G6CA 5U4NA 3FJ6A 1GNXA 3AROA 3N6JA 1O6IA 3KCOA 1GONA 5HANA 3B8WA 3SRDA 4GQGA 2B7QA 2Y70A 1E4IA 2PRMA 5A94A 4J5NA 4O50A 3S4TA 3CTTA 4NYYA 2Q71A 1DXEA 1X98A 1BD0A 2V2DA 3O6AA 1XLKA 1W1YA 2CYGA 1RJPA 2TAAA 1KRCC 3PZMA 2AQOA 4ONVA 5DXYA 1F5ZA 1LBMA 3RJYA 4HNOA 4A2SA 2PEVA 3PWAA 4IP4A 3RJXA 1I0DA 4HMCA 3EXTA 3BSGA 1XX1A 3GH4A 1R0MA 3SCWA 4DHGA 4S39A 3OLDA 1TJPA 3F03K 4IFKB 3WNMA 1J18A 2W61A 1XRVA 4C6PA 2W27A 2ISVA 4G1KA 4HPJA 1VPYA 5I3KA 1XL9A 1M65A 2E68A 4QNWA 3AOFA 4GH3A 1E71M 3S5NA 3TK7A 1S5NA 3AXKA 2ABAA 3SJ3A 4BR1A 1E6RA 1E0WA 3N13A 3GBEA 1OJXA 4DN1A 2X2GA 1JVNA 2PGEA 1HJQA 1K77A 3C4UA 2VFEA 2J27A 2XYLA 4U4MA 2GQ9A 1OX5A 2NVDA 2OWXA 3VZXA 2X2YA 4C6MA 4IISA 3G8RA 5G1YA 4JX6A 4GX9A 1FKWA 4S23A 2GGIA 3N14A 1M7OA 2YZ5A 1S1PA 1W91A 4TO8A 3SUSA 3KTSA 3W82A 4XQ6A 1W1B1 4IMCA 5REQB 2IQTA 1FTXA 4JTLA 5EA9A 2J6XA 4AD3A 3CZ8A 3OLIA 1QNRA 1ZP4A 1Z6KA 2ZA3A 3PANA 2V68A 4HZMA 1C8XA 4ADTA 4LALA 3ARPA 3HIJA 2ACQA 4NAEA 3FYYA 5LA1A 1QPOA 4ZO7A 4UTIA 5A6KA 4EK7A 3ITGA 5IHSA 3WQDA 2PAJA 1XDMA 4DXVA 4UFHA 1NFPA 2PDJA 4HHLA 4ZSTA 2XSBA 5AFDA 5DY3A 1J9YA 1ONWA 3AZSA 3W83A 2WYSA 1DBTA 3I6EA 1YXYA 1TJRA 1T41A 4IIDA 2IW0A 1I2QA 2OGYA 4RV3A 3HQ1A 2GUBA 3RM4A 3TN5A 3OO2A 4XWUA 3THQA 3TZFA 3O0FA 3H22A 1F74A 2ZFAA 3B0PA 2ZRYA 4EOUA 1E1CA 5GNXA 3U7BA 1K4GA 3DHUA 3TSDA 6ENLA 3W7LA 3W1TA 2V5LA 3N73A 1TX2A 1P7TB 4LV9A 1TMLA 4JCMA 4ZB5A 5CZKA 4DJEC 4C1NB 3OP2A 3STGA 5JBFA 3ONBA 4XD5A 2ZX7A 3PK7A 3C0QA 3FYPA 3B9DA 3KCJA 1I0BA 2Z6JA 5AY7A 1NOUA 4RE3A 1DJZA 5D2WA 2VD9A 3GU9A 3GXNA 3N2BA 3WDHA 1LG2A 5LHFA 1H09A 2CU0A 1QJWA 3ZVHA 2QNEA 3BAWA 4YVXA 3BK0A 3CMJA 4R34A 1TV4A 4LYRA 2YB4A 4IP5A 3L12A 2D20A 3EBVA 5MHBA 1X1OA 4KEZA 4V1YA 2FFIA 2R1PA 2O92A 3UETA 4E2BA 4GFIA 1AJZA 2P88A 3DFPA 2J88A 2E6FA 2EXOA 5C70A 2IPJA 3TAKA 5LYRA 1H7WA 3UPBA 2DIEA 1JGMA 1PE1A 1ISWA 3WBAA 9XIMA 1FWWA 3KBNA 1KRBC 3LGEA 3FAXA 4YIWA 4KCUA 3RR4A 3P61A 4ZCWA 4X2RA 3I7SA 1F4AA 5LNRA 3PZIA 2YKKA 2I5GA 3KTXA 3H55A 4INFA 3F4DA 3CZKA 4JN7A 3W9ZA 4CNNA 1J5SA 4ZB0A 5LIKX 1J2BA 1W5QA 1ME8A 4UNKA 1MW3A 5A6TC 4KCTA 1E55A 3HV9A 2WKGA 1PKYA 4JQAA 2QV5A 2DT0A 2W5FA 3NZPA 3A6OA 3CT2A 4IT1A 3G1XA 1EF2A 3W6MA 2X8RA 4CCDA 4UZUA 4UQ9A 1W37A 3G22A 3V0SA 5TBOA 4F9JA 4UFKA 3D3FA 5CZTA 1GYNA 2DFAA 2OG9A 3W1LA 4HK7A 3H7UA 2HNHA 4XAZA 3W7HA 3FA4A 3GR4A 5CPNA 3T0BA 1EQCA 4M56A 1RLCL 1RZMA 1US0A 3AMCA 1ELSA 2OO6A 1LDCA 2HEJA 3W2JA 1LBFA 4AH7A 4R27A 1RY8A 3C3UA 3VX1A 4NQ1A 1OFPA 3PJTA 3WK3A 3WLJA 1FKXA 3P3BA 2CLPA 3W00A 4US6A 2WJEA 1YLVA 1K7EA 4RZ6A 4PCFA 4HJFA 1UR9A 1WOAA 3WQ4A 1M01A 3JR2A 2C15A 1W9PA 1QPKA 5I07A 2P1FA 3NTYA 4JIHA 5CGMA 2AAAA 4FNTA 1XLAA 1DIEA 2A3CA 2CZEA 1CW2A 1ZCCA 1PB0A 5AZ0A 1JPMA 1LORA 4GG9A 4S38A 1KM2A 3AHXA 4Q7BA 1X39A 4BF7A 3U4AA 1OYBA 2PCQA 1BHGA 1GK8A 4O4WA 4AVOA 3JZEA 1AH4A 4I9AA 1NM9A 1DXFA 2PLJA 5H8MA 4QBXA 1GGOA 1MUWA 3CUHA 5D2VA 1JCJA 3EWXA 4LUIA 3WG6A 3TYUA 4S3BA 2A7PA 4UFIA 3GR8A 2JKPA 4PEEA 4ASTA 2QPSA 4DPPA 1FWAC 3UP8A 2G96A 2W67A 2XINA 3RF9A 2OX4A 3CUFA 3WO8A 2VCBA 4E4PA 1ZRQA 1WKYA 1GQKA 3KRSA 2G97A 1WCGA 4A2RA 5E93A 4UMCA 2B31A 4O57A 5FSDC 3FFSA 2YCEA 3T1GA 1QNVA 1H7PA 1EYEA 4EF9A 1PKNA 5DO8A 2WZIA 3UCQA 2UV8G 1I1WA 4BZYA 4Q22A 3BAKA 3U3HA 2CBIA 1JDAA 3OHMB 4W86A 1GEHA 1JCXA 2FH6A 4U3CA 5JXQA 4A35A 3T0DA 3MUCA 3GVWA 2YBVA 3OOQA 3S0CA 1E9IA 4BI6A 3MT1A 3ZJKA 2PRHA 1W31A 3GLCA 1I75A 2DU2A 2RGMA 2CHRA 1KM6A 2D1ZA 2OLAA 1FH9A 2YCJA 5M3WA 5D8ZA 1VRXA 3OVPA 4AX7A 5DMNA 1SU5A 4DWSB 1EJWC 4GABA 1JCNA 5FEWA 2VR4A 3UXKA 2QDGA 4QR6A 4UOJA 3P67A 3TC3A 4DUXA 3HN3A 4Y8EA 5XIMA 2ABBA 5AKQA 3G0SA 3QEZA 4JQ2A 2JALA 1H41A 4KEUA 1E4LA 2OGJA 3VXGA 3QW3A 3SW6A 2QGYA 1TVNA 3T8QA 4BKNA 2XJ7A 3K4AA 4GJIA 4DM1A 4DZAA 1UUMA 2V5KA 5FEZA 2J77A 3DAQA 2GDQA 3H2FA 3MHUA 4AHQA 3NVDA 2ZE0A 6REQB 2EPHA 1Q2SA 2YW4A 2KZHA 2YIHA 2YCKX 2H6RA 4PH6A 5I00A 1Y0EA 4CVUA 1RH9A 2E77A 4OIFA 5HDRA 4FLOA 5A6JA 4E38A 4HNNA 3ZIZA 3NQCA 3P81A 2CPUA 4I5XA 1GOIA 2XIOA 3NO1A 5CJMA 4HU3A 4GI6A 4EVZA 4LUYA 2YA1A 1KM5A 4AC7C 5T91A 5FAGA 2I17A 1YNYA 3O07A 1U1UA 1UR4A 2RFGA 4HPHA 1G69A 1W1A1 3GNPA 1B9ZA 3PUGA 1W54A 2NVCA 1QATA 2WCAA 4O1DA 4HMNA 3KBJA 1H62A 3N12A 1M03A 1VJIA 4JY9A 2D73A 3OVGA 4BWLA 1ZJBA 5TIMA 3L4ZA 1SZEA 4GI9A 1EGMA 3A4JA 3OGVA 3O9NA 5DQPA 4S3KA 4MZ8A 4HHHA 1FDJA 4I8DA 3WQ6A 3KVMA 2V69A 2X1IA 3OLEA 1JR1A 3TWBA 4HSHA 4I8YA 3HO8A 1LWJA 2WHLA 3T55A 4P2VA 2FKPA 1OC6A 3WLIA 2PWEA 1IXNA 2Y7GA 1JULA 3OB8A 2TSYA 3ZMRA 5DEZA 4LEFA 4OTKA 3Q2DA 5F2LA 1YPIA 1H7XA 2AL2A 3W76A 3ITTA 3L2LA 2BNJA 1V02E 1N55A 4YU1A 2XVLA 4GYKA 4GFSA 3GNDA 2BXYA 1VP5A 1EC8A 3MC5A 4O28A 2OZ8A 3EA3A 2REQA 1R3TA 1Y5WA 4L9XA 4K3ZA 4J3ZA 1EJRC 2ZC8A 2DUXA 2VEIA 1W0MA 1OB0A 3OA3A 1JDDA 5BMWA 2OQYA 4WSHA 4KQNA 4YWIA 3LCGA 4HIBA 2OZTA 3DG6A 7REQA 3BL3A 2QPUA 2AAMA 1JPHA 3U5UA 1A0CA 4KWVA 3IJDA 4CUCA 3MZ2A 2D2OA 1EJSC 1KXQA 1FHVA 3HGOA 3W1NA 1SM9A 1UC5A 3ZLHA 3AQUA 2VEMA 2D22A 3TYEA 2WV8A 3UGRA 4B5WA