1JCNA

Binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
490
structure length
395
Chain Sequence
TGYVPEDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSPGIPITEVGIVTSRDIDPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVRTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE MONOPHOSPHATE DEHYDROGENASE I
publication title Crystal Structure of the Human Type I Inosine Monophosphate Dehydrogenase and Implications for Isoform Specificity
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 395
sequence length 490
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcnA00
1H7OA 4HKPA 5G4EA 4DF2A 2QKFA 3G1YA 4XWUA 3NM3A 4LVDA 4PH6A 2VEIA 5FEXA 2V30A 2A21A 4IMDA 5IBXC 1U5JA 5D33A 3KRUA 2VEKA 4PODA 3TK7A 3GDMA 1FWSA 1LP6A 3PSVA 3OA3A 4NXKA 4BI6A 4N02A 1P4CA 4M6QA 4WJEA 3CM4A 1LBFA 2WNZA 5LNWA 4UFKA 1LLWA 2CLKA 3GK0A 4AVFA 4MVAA 3SIZA 3W23A 5EMUA 5HUPA 1WQ5A 5LHFA 4O57A 3S5YA 4O19A 1ALDA 5DY2A 3VE9A 2GPTA 4B5NA 1W5QA 4Y96A 4ORMA 4WZHA 5CPMA 5J5RA 3VFLA 1VLWA 4A2SA 3S9YA 4PC8A 4O18A 2X1SA 5DLCA 4MLRA 1KTNA 3UZJA 4QM1A 2RDUA 4Z0SA 4S1FA 3EX6A 5LNRA 3LBCA 4ZQOA 5HWJA 1W31A 1VH7A 4YL2A 2ZQ0A 4K38A 3LHWA 3PY2A 4O28A 3M6YA 2TSYA 3DH7A 4LUJA 1TO3A 2DJXA 2EKCA 3FYOA 3NQDA 4LU0A 1DVJA 3L9CA 2WNNA 2Z6JA 1GOXA 2F7FA 3TQVA 5F2IA 5TIMA 1BWKA 5DELA 4BWLC 1RVGA 4BWLA 5L9FA 1SPQA 2Y62A 4Y9AA 4EVZA 2O7QA 4PCFA 3P84A 3SGZA 2DZUA 4TR9A 4WOQA 4QITA 2V5BA 2GUUA 5BOOA 3QSRA 4A2RA 1KM0A 5EL1A 1RV8A 2KZHA 4NXSA 5CPLA 1GVOA 1XCFA 2W6RA 4FHAA 3TQ0A 2PRLA 3KX6A 4HNTA 1S5VA 1K7FA 3M1ZA 3LB0A 3LLDA 1I45A 3CQ0A 3W7CA 1OFEA 4PFMA 5I3JA 3A24A 1FWRA 2GVJA 2Y88A 2FPTA 3DFOA 4MOZA 1YADA 4AAJA 5T26A 3P8JA 4NT0A 4XTDA 1Z41A 2DZWA 1QOPA 4M6VA 2BLEA 4JDYA 4Y8FA 1X1OA 3IGSA 5TBOA 4A3UA 3B05A 4KFNA 3A22A 3BLEA 4OGZA 3W07A 1W8SA 1EP3A 3RF9A 4N4QA 4X9SA 2ZZ3A 4HPJA 2RFGA 2CLHA 1YTKA 3LCGA 4LY8A 4DPQA 4N9CA 1KTCA 4DO4A 1O5XA 1PCWA 3B8DA 2VC6A 2CLFA 1F5ZA 2QAFA 3W72A 1MSSA 1VCVA 1UUMA 2VFDA 1RZMA 5FF3A 2W0UA 3OVPA 3UY7A 3SR7A 3PSWA 5DCEA 2YPIA 3UXAA 4IX0A 1JCNA 1TREA 4O1BA 3D0CA 3W88A 4UTLA 2ZBTA 5HWMA 3G8EA 3U2OA 1SW7A 3E49A 4IMEA 3PBWA 1QPNA 1OABA 1PS9A 1OX4B 4L4LA 1DBTA 2CW6A 5K9DA 4O12A 1BEUA 1VR6A 3CIXA 1T8XA 3IRDA 3VI2A 4LS0A 4IXXA 2CU0A 5ABTA 4IUOA 2ZTKA 4O4WA 3CT7A 3BVJA 5D2XA 3UNDA 1OK6A 1YPIA 4N9BA 1ZENA 1EB3A 4H3DA 1AW5A 1D3GA 5MHBA 4HN4A 3GR7A 1DQWA 2DU2A 3QYQA 4YXGA 1TMHA 4Z1BA 4DF0A 1FXQA 1H50A 3OG3A 3FOKA 3IIZA 1ZAJA 2Z0IA 3OVRA 1KBJA 2E09A 4JY9A 4WUIA 1TTQA 3BG9A 3PBYA 3C2FA 2ZCGA 1QPQA 3TW6A 2ZZ7A 1TPVA 2J6XA 3B4UA 4Q32A 3ELFA 4QIUA 5I3IA 3W1NA 4MZ8A 3GYEA 2RH9A 1K7XA 5LNSA 4FNQA 5AYZA 1KM3A 1SU5A 3C3NA 3HG5A 3LX9A 3NQEA 3HPZA 3A21A 1GJPA 3MHFA 4UFJA 2H90A 2WSRA 3GDTA 3RNDA 1OX4A 5FF4A 3NDOA 4IPJA 2ALDA 2OMAA 3P7YA 1A53A 3LM7A 3EWZA 3TIMA 1EP1A 2Z2UA 3C2OA 1K7EA 1N55A 4W9TA 5LNUA 1TJRA 2ATSA 2WJZA 1IXNA 1WBJA 3LCXA 1C8VA 5EYWA 3BLFA 3UPWA 4YLWA 1H7XA 4BK9A 3BPWA 3SGUA 2WKJA 3LCIA 3S1UA 3THAA 1OK4A 3W7JA 1VLIA 3H54A 2I1OA 3NQGA 1BKSA 2CLEA 1LDCA 1K03A 4OWGA 3L0GA 3RMJA 1ZAHA 4FO4A 2A6LA 1YDNA 5CGQA 4O1DA 1HO1A 4S2BA 3HG3A 3W22A 3AO0A 3DFTA 3EX2A 3MI6A 4C1LA 3W1AA 5KZMA 1OYBA 2XN2A 3MYOA 4EF9A 1EPXA 2J88A 2QF7A 3HOJA 1ML1A 4E2BA 3QMTA 4LVBA 3DBPA 5AYYA 3HJZA 1TPEA 2HS6A 1TRIA 1S3HA 1U83A 1H51A 1SFJA 1UASA 1FCQA 4MIMA 2CWNA 2CLMA 1YXDA 3W7MA 3OEXA 4O52A 5D09A 1Q6RA 3W7EA 3W87A 3B0UX 1F73A 4NNAA 3QW3A 3LI1A 4CNOA 5KTLA 1VQTA 3JRKA 4LTSA 3EWWA 4C1KA 1IXPA 3W74A 2JKEA 1PHQA 1GTEA 4UTIA 3R89A 5K7JA 5K2ZA 5C5YA 1IGSA 4FNUA 5U4NA 4JX4A 2FIQA 2NUWA 5F4XA 3SY5A 3SECA 5KZDA 1W37A 1SR9A 2PCQA 2ZZ1A 3TH6A 3WJZA 2HS8A 1ICQA 4YWIA 1NVMA 3TAOA 3QH2A 5CKSA 3W7KA 5AC8A 3LI0A 1BTMA 2PRMA 3FJ6A 2PURA 4N6FA 1GG0A 3FIGA 2Z1BA 1NFBA 4UMBA 1F6KA 3NGJA 4ONVA 3TDFA 4IOTA 1KFEA 1JCYA 1GQNA 2GVGA 4N9DA 3JR2A 4QNEA 4N4PA 4JTGA 1Q6OA 1I4NA 3DGRA 1LTDA 2ZZ6A 3I68A 4MLJA 2V82A 3MHUA 4NZFA 1W5NA 3W2NA 2GJLA 2ZRUA 5HUOA 4IQLA 4R34A 2QCFA 3P67A 4Y6GA 3QF0A 4IMCA 2FPVA 4O15A 3TMLA 4Y90A 1LYXA 3HPXA 4NX5A 1XBVA 3NO5A 2H6RA 3G1SA 3KVJA 1SSDA 3TMQA 1VYPX 1RR2A 3TR2A 1KFBA 1SO4A 5K9XA 4DQWA 1T96A 2I14A 3TU9A 1XUUA 5G1YA 1P1XA 5F2GA 1V5XA 3HQ1A 1ZFJA 2V5LA 1ADOA 4FF7A 1KV8A 1PCKA 3S8HA 1QNVA 2E6FA 2J9YA 1R2TA 1SO6A 1DKWA 5AHMA 3C2VA 4YCPA 4S2CA 4X3ZA 3CLMA 1OJXA 3I6RA 3NM1A 2ZRYA 4DF1A 2JK2A 3SSJA 5I3GA 1TV5A 5DN1A 1IF2A 3I7RA 3PG8A 3W1LA 2QCGA 4R53A 1G4SA 1KA9F 4RZ5A 1PHWA 3USBA 3TCEA 2J9ZA 3QPZA 2X30A 3P5ZA 2AGKA 2CLOA 2J27A 5HQEA 2DZTA 1YYAA 3CIWA 4JTJA 3MMTA 3INPA 2GQ8A 4UFMA 2QCCA 3MYPA 4GUJA 4FEZA 3LBMA 3QM3A 1E51A 3QMSA 3QEZA 3GZ3A 1XBXA 2E68A 1KFCA 4DELA 1VPXA 3FKKA 4KFOA 4RR4A 1QO2A 3VE7A 5LZLA 5BMWA 4FNPA 5E0KA 2P1FA 4E0CA 3O15A 4JEQA 1JCJA 2AAMA 4JR5A 5CSRA 1LBMA 3O6CA 1H5YA 3UWWA 3GKAA 4Z08A 2NWSA 3U8GA 4AHPA 1CX9A 4LT9A 2TRSA 3V1PA 1GEQA 5D05A 4AF0B 1W1ZA 3F4NA 3W85A 4UTUA 4TIMA 4I7UA 4E2DA 3DZ1A 1VYSX 2OX1A 1KM4A 4HPXA 5D37A 3NPXA 6ALDA 2JBMA 5FI8A 4FNTA 1L6SA 2QCDB 1A5BA 4JTIA 3W1XA 4XKYB 4ZZ9A 2E1DA 2A5HA 3N73A 1UUOA 4XQ6A 1GYLA 3QQ0A 1OX6A 2BX7A 1EP2A 3C4UA 4UFIA 3P81A 1XBYA 1EWEA 5FF2A 1XDLA 1YXYA 5IBXA 1K02A 4IPIA 4GC4A 4ADUA 5DCBA 2NWRA 2WQPA 5HULA 5HNRA 3E02A 1O4UA 2B7PA 2FFCA 4GNJA 2FB3A 1S5TA 2ZA2A 3G1XA 1B9BA 1KLZA 4P61A 4PL2A 4RCXA 1TTPA 2V9DA 3V75A 3WJYA 1WOBA 5D30A 4JNMA 2WV8A 4AF0A 1N7KA 4DBEA 1JJKA 3QPYA 1R2RA 3QC3A 2R91A 2ZZ2A 2I9EA 3W84A 5EBUA 4JYEA 3WFAA 1EA0A 2ISVA 3C52A 2Y7DA 2TYSA 3DAQA 3GNDA 2ZDRA 3NQ2A 3TX9A 3VKJA 4LS1A 3T55A 4AEOA 2QCDA 3EX4A 4RZ6A 1LOLA 5F2LA 1VRDA 3A5VA 1HFBA 3LHUA 3LRKA 1GVFA 1KM5A 3A23A 1FWWA 1ME8A 3I65A 5LSMA 3Q2DA 3B06A 1YLVA 3IIVA 3DFNA 3MBDA 1LBLA 4QQ3A 3NL3A 1PL9A 3MP4A 1JRBA 2VFHA 3LRMA 3STGA 5AB3A 3Q94A 1TPUA 1JQVA 1RPXA 1ZNNA 2QAPA 3PS7A 4AB4A 4IGHA 1G6CA 5AFDA 4HNUA 3LHVA 4MY1A 3GDLA 2XN1A 4JY8A 1MEIA 1TPC1 1FQ0A 3QJAA 1G7UA 2PRHA 3B0VC 1D3HA 3EXTA 1H7WA 2BWGA 5F1UA 4UNLA 1FCVA 4LVFA 1SZGA 3L5MA 1YTEA 2E5BA 2E6AA 4BFAA 1G4PA 2FJKA 2V81A 2RHGA 2G5WA 3UWYA 1L6WA 2QDGA 3M5ZA 1GT8A 3DI0A 1ZALA 4U4MA 2CZEA 4FX6M 1VYRA 1L9WA 1JUKA 4LW7A 4OU1A 3T7VA 4LNYA 3TJLA 1Z44A 5I3KA 2NV2A 4NJGA 3NL2A 3TXZA 3P8IA 3BG3A 2AQWA 4GE8A 2FPYA 2H8ZA 5D02A 3GAKA 3L66A 1SUXA 2DP3A 1YPFA 3HPSA 3WK1A 2YYTA 3PM6A 4BI7A 5U7SA 2XN0A 5G4WA 1ZJIA 3KOFA 3UWUA 4BR1A 4IMFA 3TSBA 1EUNA 4X22A 4UMAA 3W7RA 3L0KA 4FB7A 1TV8A 2QCLA 1DQXA 2Y89A 1QDSA 4M5PA 3L2IA 4WXZA 2BSLA 3LCFA 5DXXA 3O16A 4HIBA 2B7OA 5IM51 4NNBA 3R2GA 3HGJA 1ME9A 3KRSA 4JIQA 4QNWA 5EA9A 4RLIA 4ALDA 4GUIA 5D38A 3G0UA 1H7PA 3WJSA 3I7SA 3FS2A 3E96A 4JYDA 1W3NA 1QR7A 3IVSA 1MEWA 3GR8A 4JGDA 1FUYA 4UNKA 3R13A 3KVKA 4L4MA 4O0KA 5BNKA 3PC0A 1SZEA 1LLZA 2QJHA 2YSWA 3OHIA 1OFAA 3NQ7A 2EF9A 3BV4A 3SJ3A 4UTJA 3LHZA 4N6EA 3TXVA 4AWSA 2A1YA 1HO4A 1LM1A 3IGXA 1QPOA 2GQAA 2Y63A 3HIJA 4IXHA 5DBUA 2A4AA 4K39A 4MUZA 3S1VA 2E77A 2ZZ4A 3TUUA 4HHPA 5CZJA 4JTUA 1W54A 3THQA 1VCGA 8TIMA 3BARA 5DXYA 3IIOA 1DHPA 3NPVA 2A7PA 2EHHA 1JUEA 3EX1A 5F2MA 1IXOA 3TQKA 1QOQA 1HUVA 2QDHA 2TPSA 1ICSA 1W56A 2NXGA 2ISSA 1PIIA 3ABQA 3W76A 3L65A 2JKPA 2G95A 1LOSA 5C2XA 4MY8A 3UPBA 1TQJA 2DZPA 3UXDA 1EWDA 1VC4A 2NX3A 1SSGA 1NF0A 3LRLA 5AC7A 3NEVA 3MJYA 1OYCA 3I7QA 2RDWA 4QSHA 5L6UA 3KHJA 3P61A 4IMGA 2A85A 2VFEA 5KMYA 3G1HA 3Q37A 2VOMA 3YPIA 3CTLA 2R14A 4NU7A 3LTPA 3UWZA 1SW3A 3MHGA 4OV9A 4J9JA 4BI5A 3W7OA 5G2HA 1HTIA 3NAVA 1TCDA 5CSSA 5HR6A 4OQVA 2JGYA 2GJNA 4OBTA 3FEMA 4CQ8A 4DBDA 2YW4A 3G1AA 3W7GA 5LGZA 4GBUA 1M5WA 4LVGA 1XUZA 4OT7A 3DFSA 1CI1A 3UWQA 4E38A 2Q3OA 1OYAA 1FWTA 4HNNA 1I2OA 1EEPA 3LXAA 3S5NA 4A29A 3O63A 3DHDA 3GVGA 3BW4A 1BWLA 3H55A 2B4GA 2HTMA 5AHEA 2ABBA 2ABAA 3WJWA 4DXVA 2A7NA 1LROA 4YMZA 2ZRZA 4AMAA 3B04A 5D2TA 3PB2A 4JTHA 2WSYA 3BO9A 4K7YA 4ZQMA 4NQ1A 1OFQA 1K3UA 4ZQPA 2RKXA 4LVAA 4CCEA 4NVTA 1GTHA 2DORA 1FCUA 1VZWA 2ZA1A 3EEGA 4UCGA 3NQCA 2J24A 1WYIA 2H3BA 1NF7A 2X1TA 3DENA 1VCFA 2BXVA 3MO7A 1TPWA 1VJIA 5LKYA 3FLUA 2LLEA 5HINA 3UD6A 1RQEA 5KITA 4UTMA 2JKAA 4NJJA 4NX0A 2DZXA 4EWND 3UQNA 4MZYA 3G18A 4MFEA 5K3VA 1QPRA 3P82A 4JDBA 1XC4A 2B7QA 2YZRA 1AW2A 2VEPA 4UFLA 3B0PA 2C3ZA 3STEA 4FX7A 3UY8A 1GZGA 4XBKA 2NUXA 4PTNA 2OZ0A 1O5KA 4O11A 2Q8LA 2GVLA 1TJPA 4JS3A 3STCA 2C1HA 1FDYA 4JD4A 3LTYA 3PUEA 3TA6A 4CNNA 1W5OA 3PUDA 4WX2A 1QO5A 1F74A 1TPB1 1F7BA 3SW6A 2XFWA 3GXTA 3EWYA 2BZNA 1Z48A 1SO3A 1AMKA 3FA5A 3RK8A 1W0MA 3W7PA 5FEWA 3GDRA 4NNCA 1OFOA 3P74A 1D9EA 2J9XA 3PR2A 3R8RA 3BG5A 1H1YA 3BGGA 4HNVA 2Y7GA 4U28A 2C13A 2V2CA 3PBUA 2A2IA 1F76A 1G69A 1QAPA 3O6YX 4GJ1A 4O0ZA 3TJXA 4CQAA 1A5CA 1OF6A 1VGAA 3OVQA 3M0ZA 2CZDA 2WOQA 3L5AA 4QISA 5CZ0A 2CLIA 4O4VA 3MI2A 3NPWA 5H2ZA 1JVNA 1SQ7A 5KSWA 3L5LA 1J2WA 3S5ZA 4UC5A 3BGJA 1KLYA 5K9CA 3NQFA 3M16A 4WY0F 3GLCA 4ZQRA 2B0MA 5BMXA 1ZCOA 2DZVA 1TIMA 1KFKA 3O1NA 3LHYA 1I2NA 3W7NA 2EAWA 5C55A 2O7SA 1C29A 1H61A 3CWNA 3G3MA 4ADTA 1TPH1 4JTKA 1EIXA 3EWUA 5D2YA 1H63A 4FXRA 1I2RA 3W2KA 1WOAA 4RK8A 3LCWA 1DL3A 3M41A 1TQXA 4K6AA 3C0JA 3W7DA 4EF8A 3DKJA 2OT1A 3TFXA 1OG0A 4MFDA 3R5EA 1PVNA 1G7VA 1WXJA 6TIMA 3WJXA 3M5VA 4JIPA 1JCLA 3ZS4A 3U6WA 3LHTA 3C56A 3W1MA 3N2XA 1MEHA 3FYPA 3STFA 1KM1A 2WSQA 3QW4B 4LUIA 2Y7FA 2H3DA 1I2PA 4M7TA 2V2HA 4KWVA 1UBSA 3OIXA 1OFDA 4AWUA 3N34A 2V0TA 1XXXA 3W75A 3CEPA 4FNRA 1ZY9A 2WNQA 1VHNA 3L21A 3LLFA 3S1XA 3W7IA 1P5BA 3NXFA 5EKYA 4LRTA 3DXIA 3EKLA 4ZL1A 4GXMA 1HG3A 3LXCA 4ADSA 4ZQCA 1KTBA 3SFKA 2OCZA 1IIHA 4Z1DA 2VXNA 5J5DA 4O10A 1MZHA 2Z6IA 4A22A 2VKZG 3BW3A 3F4WA 1AL7A 4O16A 3KFTA 1H7RA 2ZRXA 3P62A 5FEZA 4LC8A 2NX1A 1RD5A 1MXSA 2FTPA 3NYZA 1Q6LA 3HB9A 1Y0EA 3EWBX 3EKZA 1GVRA 2QCEA 2Y7EA 2B7NA 1SZFA 4IX2A 2Y85A 3LCLA 4UR8A 2H8XA 3IVTA 4K8HA 4H6KA 3C8FA 2Y61A 3IIPA 4GUGA 1O95A 1W5PA 5DBTA 2W79A 1W5MA 3BK0A 4KWWA 4RXFA 4CCDA 4RJEA 5AHFA 3KVLA 1EUAA 5AHNA 4EOUA 2C16A 2GQ9A 4PEKA 2CZ5A 2ZZ5A 3CC1A 2YR1A 1B3OA 3W70A 3O8AA 4GRSA 1R47A 2E6YA 1P0KA 4UR7A 4OE7A 4RZ4A 1TTJA 4XKYA 3W2MA 1F05A 2ZRVA 5HMSA 5LHEA 3KXQA 4LC6A 3ANYA 3M47A 1KBIA 3Q58A 1B4EA 1Q45A 3CPRA 4NJHA 4WY0B 1PV8A 5FF0A 4O17A 2P0OA 1OVDA 4JX5A 2HMCA 1ONRA 1K8XA 1KW1A 3PF3A 3NPUA 5LGXA 3LERA 2R8WA 4RX0A 1GVSA 2QUVA 2QUTA 5F1VA 3TW7A 3HGRA 1KM2A 3HO8A 3O07A 4JTSA 1L2UA 4ML9A 3FJLA 4UMCA 4XBSA 4O13A 1X7FA 1GG1A 1TYGA 4UIOA 2VFIA 4P2VA 3DHFA 3PBVA 3ZWTA 1CW2A 3C6CA 1B4KA 2QUUA 3W6YA 1XFBA 3M9YA 2JGQA 3ZR4A 5D2WA 4JTEA 1YDVA 3QMRA 4CQ9A 2YCEA 5FESA 3RU6A 3W83A 1GPWA 1ZAIA 4O50A 1F2JA 3CB8A 3NZ1A 4IJBA 3FKRA 3DU0A 3E0IA 1OFBA 2A7RA 2C18A 2YFNA 3VCRA 4O54A 3NL5A 1TSIA 3F1QA 2IQTA 3MP3A 1A5SA 1FBAA 3W1QA 4WD0A 2VELA 1XDMA 2RDTA 4ZVJA 3W2UA 1XL9A 2HSAA 5CZTA 3W1UA 2VENA 3KRZA 1N8FA 3G24A 3TSDA 3UWVA 3OBKA 4WY0A 2OT0A 4N2YA 2FQIA 3PWAA 1WX0A 2PC4A 1WBHA 3PUOA 1FY6A 3FFSA 1W3IA 3P80A 3G22A 1YXCA 4WQ6A 2C0AA 3NOEA 1K8YA 3GB6A 4UFHA 2C14A 2E5CA 3C61A 3L0NA 3LOTA 2TMDA 3P60A 5CPOA 2X1RA 2EGZA 3TC6A 3IVUA 2VFFA 4LS2A 3TV8A 4M7SA 4X2RA 1OFRA 1JULA 4Q33A 5D2VA 4FIQA 2A6NA 3W1PA 4JN6A 3LV6A 4WOZA 4MKNA 5F4SA 3O6DA 4MYXA 2V8ZA 2C6QA 3M44A 3LV5A 4JTLA 3TSMA 4GWEA 2NLIA 1TV7A 4Z0JA 3MI3A 3N19B 3S5OA 3LCHA 3TNOA 1DV7A 3BLIA 5G2WA 3LTSA 3ZWSA 2V2DA 4QAIA 1ME7A 3ABSA 4N9EA 4XUGA 3NL6A 1W3TA 3W2JA 1KM6A 1UJPA 3W1RA 3CWOX 5I3HA 2A0NA 2ZTJA 4R33A 2PE4A 3MW7A 4GFSA 1G67A 5FF7A 2NXHA 3DKLA 3N9SA 1VHCA 3PG9A 3NG3A 1SZNA 4ORIA 3G1DA 5E93A 4R7JA 2X2GA 3H53A 1TRDA 1O94A 5H91A 1J5TA 1H7NA 4LWWA 4DO6A 3ABOA 3K30A 5CG7A 1LORA 3T78A 1WV2A 4RV8A 3M7WA 4UTHA 3W73A 2ZFAA 4AWTA 3NQVA 3CU2A 2DJLA 1Q3NA 4JTFA 5K4XA 3KAOA 5FEPA 4RKAA 5BW6A 3A5FA 1Z42A 4TO8A 2YGYA 3PB0A 1O60A 3HMJG 1M6JA 3W3OA 2QJIA 1JRCA 3AJXA 3W7LA 1HL2A 2ZA3A 1J4EA 2DZSA 1AK5A 2ZYFA 2YXGA 3HG4A 4OHQA 5EPDA 3NVTA 4TU1A 3M5YA 4QJ1A 1GVQA 3HG2A 4A21A 3TC7A 1S5WA 4TMCA 4ZQNA 4POCA 2GOUA 3WK3A 1TPDA 2G96A 2YW3A 1MO0A 4JYFA 4NJKA 1H1ZA 1UB3A 1YDOA 1B57A 3DFPA 3G1FA 4KKXA 2R94A 3G3DA 3B03A 3RLVA 1YTDA 2P10A 4Z1AA 3NR0A 1G4EA 4OV4A 2QR6A 4K7VA 5AHLA 4AHQA 3G0XA 5C6MA 3DFQA 1AW1A 4MJZA 2ATMA 1OF8A 4AHOA 4ZMGA 1AL8A 1I2QA 5E1QA 1WA3A 5AC6A 1SFLA 4K37A 1QFEA 3A9IA 4HT3A 5CPNA 1NEYA 1WDWA 3W71A 1GWJA 3IGUA 1LCOA 5BRBA 3PULA 3UYCA 4JTTA 4AXKA 1I8JA 1X8FA 1DJNA 3GDKA 3IEBA 4CLMA 3M5XA 4DO5A 1FX6A 5F4WA 3R12A 5EY5A 3HGSA 4O1CA 4HSNA 3WK2A 5K4ZA 5I3FA 1ZHAA 1NAL1 2VEMA 3L68A 1RQBA 3QZEA 5GVJA 3ATZA 5LNVA 3TROA 2QJGA 1GYNA 3G0SA 4MZ1A 1KFLA 1X6UA 1KV5A 1IXQA 5G1TA 1QMLA 2E6DA 1DJQA 4FIRA 4G1KA 2F84A 5HJLA 3UZ5A 2Y6ZA 1DOSA 3MUXA 3RLUA 5AYXA 5DY3A 3HGOA 1M7PA 1SO5A 1IIGA 4CNPA 3PVFA 4WXYA 4O53A 1L6YA 3G8RA 3NZRA 4I7WA 4RXGA 5DCDA 2NX9A 1XBZA 3GXNA 3IIXA 7TIMA 3S1WA 4YCOA 3LDVA 3MBFA 3HBLA 3EXRA 2ISWA 3MWAA 4LRSA 3ZFHA 4M19A 2G97A 1TB3A 2NXIA 1R2SA 1DORA 1FCBA 5C54A 3TFCA 1NSJA 1K8ZA 3E12A 3RFAA 2OJPA 3LXBA 3JS3A 4PA8A 4O1AA 4XTIA 5HWNA 1T99A 3PAJA 1WAUA 2Y70A 3E9AA 4HSOA 3EX3A 4FNSA 4CCCA 3MP5A 1H60A 3L67A 1FWNA 3GKFA 1JQXA 1TTIA 4JX6A 3W7HA 2D73A 1P0NA 2CLLA 1XM3A 2WO5A 3N2MA 1UCWA 3P5YA 4TMBA 2VFGA 1M7OA 2Q3RA 5SWUA 4LV9A 1LOQA 3ABRA 3C2RA 4ICNA 5TQLA 4TX9A 2C19A 4MY9A 5A8GA 3TAKA 2WPBA 1AG1O 4O14A 2QEZA 1A5AA 2E5DA 2CFFA 3SZ8A 3W1TA 4O8RA 3W2LA 4DPPA 3NQAA 4IWWA 2EPHA 4MPQA 4I7VA 3BW2A 2NZLA 4GUHA 3EWXA 2NUYA 1JR1A 2UV8G 4M6PA 3G1VA 4UTWC 1F6PA 4Q4KA 1A50A 4UTWA 5D04C 5AHIA 5HR7A 1FDJA 4UXDA 2FDSA 3GXPA 5G5IA 3TE9A 2CZFA 1THFD 2X16A 3W86A 1VS1A 4D2JA 4XZ9A 4DEFA 1KFJA 2YX0A 3EXSA 4NUWA 5G2IA 3ATYA 1XI3A 2Q8ZA 4FX8A 3N14A 1Q6QA 3QFEA 1R46A 4JXCA 1SW0A 4NZJA 2ZRWA 3EB2A 4K8EA 3QRHA 1RQHA 4BF9A 1T0OA 1H62A 1LRQA 5CZSA 3QSTA 1EX5A 3LGEA 4I9AA 2NV1A 5D32A 1R30A 1JUBA 2QCHA 4NJIA 2FB2A 3NQ6A 3WK0A 3M43A 3GNNA 3N3MA 4MJMA 1JCXA 4AH7A 3GAYA 3S0CA 5A5WA 2YYUA 1OX5A 1OHLA 5AN7A 4LV4A 3HF3A 3O06A 1LRNA 3NNTA 1QCWA 5AOUA 1QWGA 2FLIA 4Z1CA 3C2EA 2BTMA 1FXPA 1LRTA 1X1ZA 3KVMA 3N9RA 4UTTC 3T4CA 3VNDA 3GIYA 1G4TA 3NQ8A 4K36A 2QCMA 4UTTA 1OFPA 4PL1A 3SI9A 3T44A 4GUFA 3O05A 4UTKA 4KFPA 3CEUA 5D03A 4JICA 4MYAA 4UUIA 3TKFA 1ICPA 3NA8A 3NQMA 3IV3A 2X1UA 3CHVA 1JCMP 2YDAA 3DI1A 4FXSA 1C9DA 1XKYA 5KINA 3S6DA 4LOCA 3W7QA 3S42A 2C15A 1TPFA 5KZEA 3F03K 3GX9A 2YFOA 4EIVA 3W9ZA 4H4IA 3QQ1A 1LZOA 1PE1A 1FDZA 1V7YA 3T40A 2QCNA
chains in the Genus database with same CATH superfamily
5G4EA 5CLWA 3JZEA 4P8XA 5FEXA 2A21A 2CERA 4D72A 3OOQA 3WX7A 1ZB5A 4J2PA 4IM4A 3OGRA 3UVAA 2VEKA 3QTGA 3CAKA 3U9IA 4DNHA 3GDMA 1FWSA 1D8CA 1Q6CA 4N02A 1P4CA 4M6QA 3FXYA 4ILSA 4UFKA 2CLKA 4AY1A 4MVAA 3SIZA 4PUDA 3HJEA 2ZADA 2QV4A 4OBSA 5C9XA 4O57A 5DY2A 3VE9A 2GFTA 5FJTA 1ODZA 4UNIA 1E4IA 4Y96A 4DM1A 5ABGA 3L23A 1VLWA 4F0SA 4O18A 2BNJA 4B9YA 4M51A 4XG1A 4GYJA 2P50A 1Y7VA 1GOOA 3GU1A 1W9BM 4K38A 3LHWA 1EXPA 3M6YA 2TSYA 3QR3A 4GFIA 4LU0A 4YVPA 3L9CA 4XUYA 1PX8A 3VNMA 2DT3A 5CJMA 3TQVA 5F2IA 1B90A 1BWKA 5DELA 4B3LA 2XYLA 4BWLC 1UD4A 4BWLA 2NQLA 1EJTC 1SPQA 2Y62A 4Y9AA 1EYWA 4PCFA 1Q4NX 3SGZA 2DZUA 5MF5A 4WOQA 4W86A 4FI4A 4A2RA 1V3JA 2WC3A 3PJUA 1KM0A 1TV2A 5EL1A 2HNEA 4DUOA 2KZHA 1E6RA 4NXSA 3Q4DA 5CPLA 1GVOA 2W6RA 3GBDA 5A6MA 3ANVA 1RP9A 3CYVA 1K7FA 4NZ5A 1FWAC 3N3TA 1I45A 4PCPA 4XD4A 3R1ZA 3W7CA 4F0HA 4OKDA 1FWRA 2FPTA 3KDNA 1C8QA 1O5QA 5IHRA 3WH7A 1I60A 3P8JA 4TX6A 2DZWA 1QOPA 1FHVA 1J79A 4JDYA 5TBOA 4GI4A 4A3UA 2D3LA 3WD2A 3BLEA 2DFAA 1K9FA 1X97A 5D4YA 3SADA 1DIDA 2CLHA 1YTKA 1KTCA 1O5XA 3FDGA 3SRHA 2ZX6A 1DEDA 3WLRA 1U1HA 1F5ZA 1Q8JA 4HK5A 1MSSA 4C6OA 4TUFA 3OZMA 2XM1A 3CQIA 2VEGA 2W0UA 3UY7A 3SR7A 3PSWA 5DQPA 1VBUA 4IX0A 1CENA 4RUBA 4UTLA 3NO1A 3PBWA 3SQMA 1QPNA 4FLQA 3RX3A 1PS9A 1EBHA 3MO4A 1BEUA 1VR6A 2B81A 1T8XA 4KETA 1OSEA 4IXXA 4X0NA 3M7SA 3M0HA 3CT7A 3ZIZA 3BVJA 2DVTA 1D3GA 2VRJA 1QBAA 5MHBA 4IICA 2OELA 2EKGA 3ORWA 3A4AA 1H50A 3EMCA 1E56A 3OG3A 3IIZA 1A0DA 1QNSA 1KBJA 2MUCA 3UR8A 4H83A 1TTQA 1XCWA 3BG9A 4FMVA 4KEVA 3C2FA 2R1LA 3RCMA 3TW6A 1M41A 2WBGA 1DJGA 3OZPA 4D8AA 3H7RA 2DUZA 2PP0A 4EXAA 5A6LA 3ELFA 1HXJA 3S9IA 4QIUA 3RU8X 3DX5A 3WLQA 2YDSA 4CU7A 1LT8A 3GYEA 2RH9A 1CGUA 4FNQA 3C3NA 4TV5A 1KRAC 1XYAA 3LX9A 3LZ3A 3GC4A 3MHFA 4ZXLA 2PGRA 5FA5A 1BVWA 3SCUA 3ONCA 5FF4A 1B3ZA 4IPJA 4IIDA 3P7YA 1A53A 3GXFA 3EWZA 3ITXA 1WKEA 3T2PA 2Z28A 1XSJA 1J6OA 1NELA 1TJRA 1FHDA 3EBVA 5EYWA 1OD0A 4YLWA 1BSIA 2WKJA 3LPFA 3LCIA 3THAA 1OK4A 1VLIA 4Z2IA 3E2RA 3NQGA 1BKSA 3OODA 2V6AA 3BXWA 1LDCA 1K03A 3RMJA 4FO4A 2G37A 2PWFA 1FWFC 5C71A 3EB3A 5CGQA 1PO9A 2XIIA 5GJMA 3EX2A 4C1LA 1VAHA 3MI6A 4IP7A 4GLEA 3AQUA 4QTGA 1UKQA 2J88A 3HOJA 3EDEA 1POKA 2BHYA 4V2XA 1RH9A 5HNTA 4H7ZA 5AYYA 2I56A 4GCXA 4K2SA 3VCCA 3WG6A 2YL6A 1U83A 3ARRA 3ZZ1A 1UASA 3Q45A 1CXIA 3PPCA 2CLMA 1Q6RA 2PD9A 4D6FA 1RCQA 3W87A 4AU0A 4AIOA 4LTSA 1HZYA 4GK8A 4C1KA 4J3XA 2EJ1A 4JIHA 3WMBA 2FVLA 5K7JA 2VCBA 1IGSA 4FNUA 1XIGA 4NHVA 5F4XA 1PYFA 2F6KA 4PULA 3WJZA 2OLHA 1KKRA 4B2DD 1NVMA 1N8WA 3I10A 3GW0A 1BTMA 1P0EA 1E70M 4N6FA 4NYUA 1NFBA 3TDFA 1BFNA 1F6KA 1XP3A 3V1HA 4D8ZA 3O0KA 4Z17A 4N4PA 2BGNE 3UG8A 3E0WA 3IK2A 3VZXA 4IQLA 3N4EA 4R34A 1RP8A 3P67A 4Y6GA 4IMCA 1E6SM 3VYLA 3TP4A 2PGEA 3NO5A 5XINA 1SSDA 2DV0A 1KCXA 3TMQA 3TR2A 2FGLA 1X38A 5K9XA 1T96A 2I14A 4KGLA 1J01A 2PDHA 5CPSA 5JU6A 5AKQA 1TIWA 1ADOA 3S47A 1CLVA 1YNQA 4IIEA 1PCKA 2IPGA 2FJUB 2E6FA 5GJPA 1V93A 2P0IA 1SO6A 1DKWA 5AHMA 3UCDA 3F2BA 4X3ZA 1QI2A 3L4TA 2E40A 3SSJA 1WZMA 4V28A 1VRXA 1IF2A 1QW8A 1S2AA 2D24A 4D6GA 1ZP4A 1EC9A 4JIEA 1CXKA 3IGHX 3KBSA 4ZO7A 4IGSA 5HQEA 1YYAA 3KDOA 3FV9A 1ZU8A 4H9TA 5AC5A 2GQ8A 4EAMA 3H4GA 4UFMA 5A8QA 1WUEA 4IIBA 3UA3A 4RDWA 4FEZA 2VYOA 4F48A 3CPUA 1FRBA 4P8UA 1M9HA 4HYWA 3QEZA 2WJFA 3GZ3A 2E68A 1VPXA 3LMYA 1QO2A 2ICSA 1R86A 1DWJM 1IYXA 3UR7A 2W66A 3GXIA 3VTRA 3B8UA 5LA1A 1XYCA 1WPCA 4F8XA 1MUWA 4Z08A 1GOKA 4PUKA 3PP7A 4AHPA 2WAGA 5BWFA 4GX8A 2YB1A 1GEQA 1R5YA 1W1ZA 1OGBA 4L80A 3F4NA 3PTKA 3VGFA 5I03A 2DSKA 1E4LA 1XISA 2OX1A 2BHZA 3NPXA 1B31A 4UQAA 2J66A 4A3HA 3P3BA 3ZT7A 5I06A 1XLJA 2HPMA 4ZZ9A 2UY5A 3RM9A 1TZ9A 3C4UA 3NFUA 1XBYA 4JQ3A 5FF2A 1IR1A 4GQRA 4AYGA 2NW0A 1BAGA 2ANUA 4L6DA 1OC6A 4FS9A 5JH2A 2NWRA 2WQPA 1ZUAX 5HNRA 3E02A 1L2QA 1O4UA 3WKZA 2B7PA 2CNCA 4GNJA 1NWRA 2FB3A 2ZOXA 2AL1A 1A5UA 2ZA2A 4H2HA 5A6JA 1B9BA 2GDQA 4RNIA 4P61A 2PDQA 4RCXA 3M0VA 3VNIA 1AODA 3IWPA 3TYUA 2YL5A 1E15A 2I9EA 3TOYA 2F9RA 3W84A 1AD4A 1F3EA 3TYCA 4Q4RA 1PTGA 2ZDRA 4A6GA 1QW9A 2VO5A 5F2LA 3A5VA 4WGXA 3LHUA 1MW1A 3LRKA 1FWWA 3I65A 2JQXA 3ZYZA 5LSMA 1OGGA 2KAUC 3ARYA 1LBLA 4QQ3A 1VEMA 3NUKA 5AB3A 3PS7A 1V02E 3W29A 3GU2A 1VB9A 1G6CA 4OOZA 3WLIA 5CC7A 3TN6A 2YDQA 1UYQA 1BYBA 4JY8A 4WGHA 1TPC1 1A4MA 1G7UA 5I6SA 4GI6A 3B0VC 1D3HA 1H7WA 2BWGA 3GVVA 3SCNA 1FCVA 3L5MA 1YTEA 4LUSB 2E6AA 2G41A 1G4PA 3TN4A 4PTVA 3B8WA 4S3FA 4PUMA 4EPEC 2G5WA 1UWTA 4WDUA 1L6WA 4NZCA 2QDGA 4PB5A 1IWPA 1XSKA 5LXXA 3BANA 1A5OC 3RLGA 4XV0A 2HEJA 1V3HA 5CGTA 3SQSA 1NDZA 3PZTA 9XIMA 1LL6A 5A94A 4C6EA 3BDKA 3WLHA 1HKIA 4NJGA 3P8IA 1XPYA 4EAYA 2ZC1A 4URIA 4KWUA 5D02A 1SUXA 4QJ4B 1VIZA 3OGVA 4XZLX 3RPTA 3HFYA 3PM6A 4BI7A 3UYIA 1RY0A 1FKWA 1UWAA 2VZUA 3L0KA 1KKOA 1TV8A 1Z9AA 4DZAA 1SMDA 3L2IA 4WXZA 3AHTA 2BSLA 3AU6A 1JGIA 3T0BA 1JPIA 4IGNA 4CD7A 3CGTA 3H2MA 5C9RA 4NNBA 1IEXA 1J10A 3TYAA 3KRSA 4GBDA 4ALDA 4GUIA 3FS2A 3E96A 4JYDA 1EBGA 4Q8QA 1QR7A 2R1NA 2BXYA 4JGDA 4CQBA 1LQAA 3RCNA 3WF0A 3UCCA 3U2ZA 5BNKA 1DWAM 2G3IA 2J62A 4DJEA 1XLKA 4JKLA 4IPPA 1WDQA 2BV9A 4NAFA 2YSWA 2R1MA 4HB7A 4QP0A 1BF6A 1PDYA 4CVUA 1XIEA 3QBUA 2NVAA 4UTJA 3ITOA 2V69A 4Q22A 4AWSA 4H7VA 2A1YA 3IGXA 2GQAA 3AICA 2E77A 1GHRA 2ZZ4A 2I5QA 6ENLA 3CMFA 1R85A 4ZB5A 1V8EA 4JTUA 2ZXAA 3BAYA 2BY1A 1V77A 2D2OA 1DHPA 2EHHA 1OADA 1KBKA 2NQHA 3KOWA 1IXOA 3TQKA 2VX6A 4CN4A 1WO2A 1HUVA 2XIMA 5DFAA 3VIGA 1W56A 2NXGA 2ISSA 1BG4A 2RGMA 3FAWA 3ABQA 1EYEA 3L65A 2WJDA 2G95A 1TE6A 2DUAA 1CXEA 3QC0A 1V79A 2DZPA 4FAMA 3RO6A 3POCA 1Q13A 3T2OA 1XPGA 3N4AA 3I7QA 3W4RA 4D8LA 2VFEA 3KBWA 1YE6A 1H0IA 1VFMA 2R14A 4EPDC 1SW3A 1VFFA 4OV9A 4J9JA 3HA1A 5G2HA 2NVCA 5CGMA 1R3QA 4KWSA 5A3HA 4A8IA 3WL0A 4DBDA 3DC0A 4GBUA 3AMGA 2NSOA 4NP7A 2OEMA 3DERA 4LAMA 4LUYA 1CI1A 3AIWA 3GG1A 3CUGA 4MB4A 2VD8A 4E38A 1FWTA 1I2OA 4BQ2A 3TJIA 4FSAA 1A5LC 3PNZA 3BW4A 5FKYA 3H55A 2B4GA 3H4XA 5ENLA 1F3XA 1V0MA 2A7NA 4ACZA 4YMZA 3RJYA 3ZLFA 3PB2A 4MF4A 3WZ0E 3BO9A 4B5TA 2I5IA 1DXIA 2RKXA 1GOQA 1UD3A 4CCEA 1NQKA 2DORA 3B9NA 3NQCA 1G9HA 2GSEA 1REQB 1NF7A 2CHOA 3DENA 1TV3A 5JBEA 4W7UA 3HPFA 2EG6A 4UTMA 1XIFA 4Z1YA 1UJQA 2PDUA 4CD4A 3G18A 4MFEA 5K3VA 4JDBA 1ZP3A 3VD3A 3R0UA 1E9LA 1TWSA 1R3RA 3B0PA 4KWOA 2DGAA 1BYDA 3M0XA 2OZ0A 1O5KA 3AZRA 1Q65A 1TJPA 3OBAA 4JS3A 3STCA 1CEOA 3BJTA 5FIPA 1TV4A 2FMOA 3PUEA 4WX2A 1EJXC 1XIBA 3BSGA 1EZ2A 4M24A 3VKKA 1SO3A 1AMKA 3FA5A 3WNNA 1W0MA 4NNCA 3PR2A 3AXMA 4GPNA 4HCLA 3BGGA 4HNVA 4U28A 4J1OA 1B3VA 2C13A 3PBUA 5MKGA 4O0ZA 1YIXA 4GJ1A 1X98A 3OVQA 3KHDA 3MDUA 2ZKMX 1SR0A 4ICCX 2QJJA 5CZ0A 2CLIA 1UWUA 1QWKA 3NPWA 1JVNA 1SQ7A 1ITCA 4GIRA 4UC5A 1J2BA 3NQFA 3M16A 3GLCA 5FAGA 5DT7A 3MZ2A 4JQ4A 4OVXA 3W7NA 2O55A 3M64A 3RR4A 4ZE4A 3CWNA 1O1ZA 4JTKA 4E8GA 5D2YA 1I2RA 4RK8A 1YHTA 3HZ3A 4CN1A 2QV5A 4G6CA 4DJDD 2XU2A 2INFA 3W7DA 3BL3A 2F6UA 3Q67A 3TFXA 3R10A 2P5NA 1PVNA 1G7VA 4D6DA 4YIWA 1WXJA 3K8MA 3GFYA 1W3JA 3WJXA 1YW1A 4OECA 3LHTA 3LPPA 4HMEA 2OQYA 3FYPA 4W8AA 4UOJA 2V2HA 3DFYA 4KWVA 3OIXA 1T8QA 3N34A 2V0TA 1XXXA 2JF7A 3S1XA 3S2JA 1KD0A 4OIFA 3W7IA 4L6HA 4AEEA 3CUZA 1HT6A 4HBKA 3BAXA 5I79A 1HG3A 1M01A 4JIIX 4ADSA 1PEZA 2UWFA 4IIHA 3MKVA 4Z1DA 1NTHA 2PTDA 3KP0A 4JHMA 1UA7A 1IQ8A 3G6LA 4XX6A 2VKZG 3FHAA 4O16A 4ACYA 1H5VA 3P62A 2WANA 2NX1A 1RD5A 3DIPA 5HJYA 3NYZA 1BF2A 1Y0EA 4ZSUA 1QHPA 2YL9A 4HU4A 2E28A 1W2PA 2B7NA 3ES7A 1BTCA 3T0DA 3LCLA 3WMCA 3GE7A 3QY7A 4HCHA 5DRIA 4BA0A 1WE5A 2PU1A 3B0XA 3WEMA 1U30A 1I9CB 2WWCA 4KWWA 4CCDA 3OVGA 3EDDA 1RJPA 4IP4A 1F3WA 1S5MA 3EDKA 4H8HA 3W70A 3GC5A 4XD6A 2J25A 1E1CA 2E6YA 1N82A 2ZE0A 3AWOA 1UOZA 2E25A 3WNLA 4LC6A 4GOAA 1Q45A 4NJHA 2R82A 3EMZA 4GKLA 2P0OA 4S38A 2OOGA 2J4GA 2WZIA 2KX9A 5LGXA 2V5CA 2RJGA 3VOHA 4HTYA 1FP8A 3O07A 3FJLA 4UMCA 3KL5A 4O13A 2WVSA 4UIOA 2VFIA 4MADA 4P2VA 1MRQA 4IMAA 3ZT5A 3ZWTA 2ZDSA 2O9RA 3AIBA 3CASA 3E74A 3B9OA 1EHNA 1JPKA 3CZEA 1YDVA 4CQ9A 3R11A 2G4FA 4MWAC 5FESA 2DQWA 4ZCWA 1ZAIA 4NRRA 3FKRA 3DU0A 1WDSA 2XVKA 1OFBA 1DYSA 1QVBA 2A7RA 2UY2A 4L9XA 2VVNA 3VCRA 4O54A 1A5SA 1FBAA 2DVUA 2HQAA 1BLIA 2XIBA 4KS0A 2HSAA 3FEQA 3WLJA 4PGLA 4Q4OA 3M6DA 4ERGA 3OBKA 4WY0A 2OT0A 3BC9A 1YKWA 1Q5MA 2D0FA 1L8NA 4KT2A 4R7WA 3FFSA 1BVZA 1W3IA 3PWIA 2GYIA 2XSAA 3G22A 4MKSA 2PWVA 3UZZA 3A6OA 3C61A 1Y65A 3VA8A 3ZVHB 4GZIA 4C5ZA 4F2TA 2EGZA 4M7SA 1XH2A 1OFRA 1QPKA 4REQA 4H41A 2A6NA 1KBBA 3LV6A 3TTOA 5F4SA 3GFXA 4BQ5A 2E8YA 2V8ZA 3LV5A 4JTLA 3TSMA 2CBIA 4D6JA 3LCHA 4C7GA 1US3A 1BPLB 1H09A 1DV7A 3BLIA 5EB8A 1DJWA 3ABSA 4N9EA 1AUSL 1W3TA 4X61A 3W1RA 3KBJA 5I3HA 1BRLA 4R33A 4U5KA 3MW7A 4GFSA 5FF7A 1QI3A 3SFWA 3N9SA 2OSWA 1ZJHA 3NG3A 3ZSSA 3IJIA 5H6HA 4GYPC 1TRDA 1H7NA 1XS2A 4LWWA 3VKAA 4DO6A 5CG7A 3BLDA 3G1RA 3T78A 4RV8A 2Z2AA 1ZPTA 1AH4A 3CU2A 1LT7A 2EPOA 1Q3NA 4R27A 1IEWA 1Z42A 1GEHA 2QIIA 3PB0A 1O60A 1PIGA 4E8DA 2RAGA 1E6NA 3BE7A 3CUXA 3VVGA 4C6CA 4KRUA 4L7ZA 1AK5A 5D9MA 1EDGA 2YXGA 5CBJA 4OHQA 3WQWA 3NVTA 3VIJA 2PAJA 3RUBL 4TU1A 3M5YA 4A21A 1CB7B 3GG7A 3WNPA 3GNXA 4ZQNA 5C70A 4DYJA 1TPDA 2GJXB 3ZXWA 4JYFA 4NJKA 2QZRA 4A3QA 3G1FA 2R94A 3LS9A 1KRBC 4K7VA 3EPOA 4AHQA 1BHGA 1F8IA 4L1GA 5BXRA 5E1QA 4HT3A 1S1RA 4L4OA 1WDWA 3VIOA 2QMJA 3AXIA 1IT7A 3UYCA 3EOEA 4JTTA 4IFKB 4ZFMA 3CYJA 1UC5A 5ABFA 3GDKA 4LBUA 3T8LA 3M5XA 5F4WA 3R12A 3MSGA 4O1CA 3M0KA 1HGYA 5C0QA 1Y5XA 4G8TA 4INFA 2VX5A 1MI3A 1QU4A 1RUSA 7ENLA 1GQLA 3TROA 2QJGA 1GYNA 4MZ1A 1X6UA 5BXSA 1IXQA 1F07A 5G1TA 4XO7A 1DJQA 3OU8A 3H24A 4FIRA 2Y6ZA 1DOSA 3F4VA 3RLUA 2PGWA 1M7PA 2A3EA 6REQA 1L6YA 4KH2A 1ZBVA 4PR4A 2WBKA 3CMGA 4GVIA 3AS2A 3LNMA 4C6KA 3CH0A 2CKSA 3EEZA 5BROA 4LRSA 4M19A 2J13A 2NXIA 4X63A 4IFOA 4Q8TA 3V16A 1BYCA 5LIYX 3VIHA 2ZXDA 4MAZA 5JUVA 1SGJA 1UR8A 4WRHA 3W24A 1L6FA 1A49A 4YHEA 4GI9A 3THUA 5HWNA 2ZUNA 3B8TA 4C6PA 1E73M 3OGSA 3QGKC 3L67A 5HAOA 3TR9A 2WVVA 1JQXA 3WL1A 1LUCA 3B40A 3BCJA 2WO5A 4TMBA 4WJXA 4BEUA 2Q3RA 5HMEA 3ABRA 4M1RA 1FFRA 3C0SA 3VIFA 5T8GA 2C19A 5A8GA 3VKBA 3VM7A 1DXEA 4HU3A 2QEZA 3RR1A 1UWIA 3W2LA 1EPVA 1IT0A 4IWWA 2EPHA 3QHMA 4HJFA 2NZLA 1JR1A 2XH4A 3G1VA 1F6PA 5AHIA 1EJWC 5G5IA 3D46A 3R43A 4W85A 3W86A 1EJSC 4ERIA 3K4WA 4XZ9A 4K1WA 2A3AA 3VDBA 2YX0A 3AISA 5G2IA 1RHCA 3T9PA 2YLAA 4UCFA 4FX8A 3N14A 3L4UA 3VABA 3T8QA 2AOSA 4C6LA 4GX9A 4NZJA 3WLTA 4K8EA 1T0OA 4B4HA 1H62A 1LRQA 4EE9A 3UR2A 4AX7A 3PZGA 1W8GA 1U2YA 4IPLA 4ML4A 3NQ6A 3S0CA 3GAYA 1OX5A 3MUIA 2OX4A 1VD6A 4ZO9A 4H9VA 3EPMA 1AZ1A 3O06A 3PZMA 4WKAA 4PRTA 2WQDA 3NNTA 1QCWA 5AOUA 1QWGA 1FWDC 5EGRA 3C2EA 3CQJA 4UTTC 4US6A 2PDWA 2ACSA 2W61A 4K36A 2QCMA 1ITQA 4UTTA 3SI9A 4UTKA 3ERPA 4KFPA 1J0KA 3SCSA 4MYAA 2QQ6A 4UUIA 3NA8A 4TV6A 3IV3A 1XKYA 3D5HA 2O4MA 4F0MA 5KINA 4LOCA 4PUNA 4XZNX 4DO7A 3V7PA 5M5DA 1LG2A 4L65A 1FWCC 2PGFA 2RJHA 3F03K 3W25A 4LQ1A 4AXNA 2A3CA 1X6NA 4QDPA 2QCNA 4IQEA 1O68A 3FYYA 3PZQA 4DF2A 6TAAA 4XIAA 3NM3A 4LVDA 1EKOA 4PH6A 1WNOA 2JALA 4IMDA 3PTDA 1ECEA 4DUWA 5IBXC 1EJVC 3SURA 3TK7A 2OVLA 2Q8XA 3PSVA 1LP6A 3OA3A 4BI6A 3B97A 3MB9A 1LLWA 3AIRA 5EMUA 4C90A 3NTYA 4NZ4A 3GBEA 3N13A 4ZTYA 3UU0A 3WFLA 4HHLA 3MSRA 1L6GA 4B5NA 4L6OA 1F4AA 3CMJA 4WZHA 5CPMA 4WIWA 3VFLA 3S9YA 3E2VA 3ZJ7A 4PC8A 1EEXA 4QM1A 3EX6A 2CXEA 3LBCA 4ZGYA 3HTWA 5HWJA 1GW9A 1W31A 3N6QA 4YL2A 3GYCA 3WEZA 2PLMA 2DJXA 2EKCA 3FYOA 3DDMA 2WHKA 5A69A 4CD5A 2XM2A 3L4YA 3SM0A 3FHQA 1T6MA 4AX6A 1FWIC 2IS7A 4DBUA 1RVGA 5L9FA 1RBAA 4UQBA 3H7UA 2O7QA 2WXDM 4JEJA 1NU5A 2Q02A 1KGUA 2V5BA 2HK0A 1B3XA 3QSRA 1RV8A 3BV7A 3AROA 2VJXA 2DSZA 2WLZA 3TQ0A 3KX6A 1S5VA 3LB0A 3JU2A 1MZRA 4FF5A 3OW1A 4PFMA 3A24A 3A3XA 3S3GA 1XLIA 1YADA 4AAJA 5JIWA 4QEEA 4M6VA 3WQCA 2H9AA 2PBGA 3IGSA 4LB4A 1GPFA 3A22A 1I1WA 1GK8A 1EP3A 4N4QA 4X9SA 3BURA 2ZZ3A 3LCGA 2J7DA 1UKOA 4DO4A 3MKCA 4AISA 1TMLA 2CLFA 4UTFA 1H2JA 1IGWA 1VCVA 1UUMA 2OPJA 2VFDA 3N25A 4HA4A 2GQ3A 3AYRA 4B5SA 3TTQA 2YPIA 1JD7A 4O1BA 4HZ7A 3NIYA 4TQTA 1ZTVA 3U2OA 2Z2BA 2BVTA 3VNYA 1YBQA 4E6MA 2Y24A 4ATDA 1DBTA 1NDYA 2ZX9A 5K9DA 4O12A 3R7MA 3UVIA 2ACUA 3CL6A 3PJTA 4IUOA 1G01A 1NH6A 2ZTKA 4GA8A 4HQVA 5M3WA 4JTAA 3V4BA 4IIFA 2EG7A 2GLKA 1CWYA 4H3DA 2G50A 2QYGA 5M2FX 3W37A 1DQWA 2DEPA 2DU2A 3QYQA 1TMHA 4DF0A 1NDWA 1EGVA 3FOKA 2J7EA 1V08A 1JCTA 2W67A 1V51A 4Y2WA 3C5QA 2ZCGA 4MWAD 1QPQA 2ZZ7A 1HJSA 4CGTA 3VMPA 4I8YA 1AJZA 1JDAA 3AMKA 3W1NA 2OO0A 3CHCA 1VBHA 1QNRA 1K7XA 5LNSA 3HG5A 4H9ZA 1XSIA 3HPZA 3A21A 4ZEPA 4RW3A 3L4XA 2SFPA 2WSRA 3GDTA 3RNDA 4FZIA 1FWHC 2J75A 3TN3A 2DPEA 4KQNA 3LM7A 1W1IE 4CEUC 3A4JA 3GVWA 2Z2UA 3LQGA 2D23A 3C2OA 1XC6A 4S3CA 2ATSA 3SJNA 4MB1A 3OLGA 3BLFA 1J93A 1H7XA 3OYXA 3BTNA 3S1UA 3BCDA 2CIPA 4DHGA 3W7JA 2I1OA 1TX0A 3IUDA 1Q7QA 1E0UA 4BQ4A 1QW7A 1YDNA 4MMWA 3H2EA 2YB4A 4HZMA 4M0XA 3DFTA 4CEXC 1SMAA 1FFQA 3NZGA 2QF7A 1ML1A 2HWGA 4YU1A 4E2BA 1RJQA 4PMRA 3HJZA 3VNKA 4GD0A 1TRIA 4QHRA 2ESCA 1S3HA 4E3VA 3ARPA 2INZA 3FSTA 4MIMA 1LWIA 1YXDA 3W7MA 4F66A 1UQZA 1Y5WA 5D09A 2E7FA 3W7EA 4E4UA 4DZ5A 3WDQA 1IT8A 4K68A 1WP6A 1XGEA 3JRKA 1C92A 1UH2A 3I6EA 3MCNA 3T07A 1IXPA 4HJWA 3VCNA 3W74A 4PUUA 2XH0A 5E5CA 5EFDA 5C5YA 4S3DA 5U4NA 4JX4A 4CCZA 3DG7A 3SY5A 3AIUA 3SECA 2PCQA 3PFRA 1CTNA 3SUUA 2ZWZA 3N4FA 2HS8A 1ICQA 4YWIA 3TAOA 1T40A 3GZAA 3QH2A 5AC8A 3EOLA 1PYMA 3FJ6A 4I8DA 2PURA 2X0YA 1GG0A 3VDAA 1TX2A 3WQ4A 1TWIA 5FSDC 5I00A 4LYKA 4M1BA 1KFEA 2ZVIA 1GQNA 2GVGA 3JR2A 4QNEA 1Q6OA 1I4NA 2PWUA 2ZZ6A 5BRQA 4F0LA 4NZFA 3MHUA 2BHUA 1JYNA 3W6LA 2VR2A 3QF0A 3W6MA 3HPXA 4NX5A 2Z29A 4XK2A 4HA0A 2HPIA 3G1SA 1E0XA 1KR1A 1VYPX 2BVDA 3WDIA 4R85A 4E2VA 4DQWA 4NY2A 1Q85A 1XUUA 2VGBA 5G1YA 3FXGA 1V5XA 3PPHA 4D6EA 3LU2A 4MNJA 1EX1A 4ROQA 3TNBA 4FF7A 2XH2A 5DT5A 1AFSA 1Q2RA 3T0CA 2Z26A 4DBSA 4WSHA 1RK6A 3KM8A 4CNSA 4S2CA 2HV5A 4GG9A 3WF2A 1P0DA 3CLMA 4B3ZA 2JK2A 1U33A 2Y8VA 3I7RA 4V1YA 1BXCA 4R53A 1KA9F 5DMLA 3USBA 2XVLA 2BB0A 3UG4A 1HP5A 3KLKA 5HNUA 3P5ZA 5C7VA 2AGKA 2C1GA 1QUMA 3RDKA 1VFOA 3AAMA 1YMYA 4KPLA 3PZIA 4OFCA 4CU6A 3LBMA 3BJSA 1KFCA 4G7EB 1GOWA 3FKKA 3KCLA 2YA1A 2YDRA 5LZLA 2IXVA 4FNPA 1K9DA 1XLFA 3O15A 3ZO9A 4DM2A 3WN6A 2QLYA 2AAMA 2A79A 5BOEA 1LBMA 4O1FA 3AZSA 3MQTA 2OO6A 4TVUA 3GKAA 4RNJA 3WD3A 4PMZA 4LT9A 4IL0A 4PUJA 2TRSA 3CZ8A 4RDZA 1QRQA 1BQGA 2AQVA 4C6NA 3VGHA 2HVMA 1OC7A 4Q4PA 4I7UA 4F0RA 1QATA 2OU4A 4Q7BA 2NV9A 2JBMA 5FI8A 3MCMA 4FNTA 4LYPA 3KTXA 2OGJA 3BCFA 3R0DA 1Y5VA 2E1DA 2O92A 1FH8A 3N73A 4H19A 3PTMA 3A13A 1OX6A 3II1A 1EP2A 3KOYA 2EPKX 1EWEA 4HOXA 1J18A 3O3RA 7A3HA 1YXYA 3WD4A 2HRWA 3H7VA 5IOBA 5E09A 3IUIA 3WFZA 2AL2B 3SN4A 4IPIA 4GC4A 4N42A 1XWYA 1S5TA 4YYFA 3KS6A 1TZZA 2ADAA 4TTGA 2Z1VA 5DX7A 1U22A 8CGTA 1GONA 1WOBA 5I0DA 3N6JA 4JHOA 4QQUA 1JXKA 2OFJA 5CZKA 4AF0A 1N7KA 4DBEA 1W1TA 3QPYA 1R2RA 3QC3A 4IF2A 4GIEA 2OEJA 2VR4A 2R91A 3OLDA 2Q01A 5EBUA 4JYEA 3WFAA 2ISVA 2PF8A 4LBRA 3R58A 4DB7A 2YKKA 2XFFA 1WZLA 2BOFX 5BU6A 2QCDA 1F61A 2O0TA 2OZTA 1VRDA 2FH8A 3KL0A 3CO4A 3A23A 4AMCA 1ME8A 4PUWA 2PDNA 1ZGDA 4JTRA 1R9XA 2IMRA 3ARQA 1HVXA 3B06A 1K9TA 1YLVA 3IIVA 4Q8PA 1HW6A 2VM8A 1DWHM 1PL9A 3MP4A 1JRBA 1VFLA 1JQVA 2VCCA 4XBJA 1EDQA 4AD2A 3TLQA 2WKGA 4AZCA 5AFDA 4HNUA 3VAVA 3UBPC 2D0HA 3GDLA 2PDLA 2GUBA 1CECA 4AVNA 4YYCA 5BU9A 2OQHA 1XKJA 4HK7A 3CZGA 5JIPA 3H23A 1J0YA 3ZOAA 2YL8A 4MM1A 2QJMA 2WC4A 4BFAA 3EWDA 4KIRA 4YN5A 4RPQA 3WY1A 1RVKA 2IKJA 5E9AA 1X39A 2RHGA 1NM9A 1ZS2A 4YTTA 2Y5EA 3UFYA 4IH3A 3BGAA 3DI0A 1ZALA 4C6JA 4U4MA 1PIFA 2CLPA 5M03A 1MRAA 4D6IA 3DUGA 4LW7A 4OU1A 1EGZA 4LEQA 5BRPA 3DBNA 3I3BA 3RN6A 1Z44A 4NAFB 4J2MA 3CZKA 4KIEA 3C0QA 1J96A 1C3FA 1S1PA 1YPFA 3HPSA 4PMXA 4R5EA 3KOFA 3USZA 4IMFA 1EUNA 1GKPA 4CQDA 4RDVA 3EWCA 1DQXA 5AVHA 3FCPA 2Y89A 1J11A 4PYSA 1QDSA 3A4WA 2Y5SA 3UT0A 5DXXA 3RM4A 1XYLA 4HIBA 4ZOEA 1GCYA 5IM51 4IJCA 4I6KA 3R2GA 2ZX8A 1W9PA 2NVDA 2XZ9A 3REQA 3FAXA 2V67A 2ZWYA 5D38A 1MVYA 1W6TA 3G0UA 3S2MA 3SRFA 4KESA 1W3NA 3IVSA 1XLEA 5LA2A 4QSFA 3NJ3A 3LZ5A 3ZMRA 2J7FA 5HPCA 1SZEA 1LLZA 4MAVA 3D6NA 1OFAA 3NQ7A 3CIVA 5CEWA 3BV4A 3VIPA 3SJ3A 3LHZA 2CBJA 1V3MA 1EO7A 3HIJA 4GZEA 4MUZA 1X7IA 1OZMA 2OYMA 3TUUA 3V0TA 1C9WA 2Q71A 4S3GA 1S2TA 5CPTA 1Z3NA 3B9DA 3KUMA 2V5KA 1QI5A 2J7GA 5DXYA 5GNZA 4ZXOA 1X6LA 1CYGA 1QOQA 2QDHA 3GG0A 2GVEA 4PEEA 4R9XA 3GNPA 4AFYA 3QGAC 4WLCA 4DJFC 4ACZB 1LOSA 4DJFA 4LEFA 1EWDA 3Q65A 1UZ4A 1BWVA 1OCNA 1SSGA 3APGA 3MJYA 1Q7MA 4QSHA 3KHJA 2A85A 1NWSA 2BY0A 3N11A 3K5XA 2D22A 4NU7A 3LTPA 2X7VA 2I9UA 4LXFA 4P7RA 1XHGA 1AA1B 3W7OA 1KXQA 1HTIA 1W3HA 2ZUMA 1TCDA 1BD0A 1JGMA 4OQVA 2WHJA 1ECQA 2GJNA 3CAWA 4CQ8A 4XZMX 2YW4A 1HL9A 4MB3A 1DJYA 1M5WA 3MJMA 4OT7A 4QEHA 5C2GA 1OYAA 1KO0A 1PXGA 1A4LA 3DHDA 1Y8BA 3WMSA 5AHEA 4F2BA 3ARUA 3KEHA 4ENLA 2ABBA 2ABAA 1LROA 1P1MA 2ZRZA 1AH3A 4AMAA 3B04A 5D2TA 3B9AA 4OUEA 4JTHA 3QVQA 2HXTA 3WLKX 1K3UA 1U1UA 4NVTA 5GNYA 5MKGB 1FCUA 5GPRA 4HMDA 3DGBA 2X1TA 4J3WA 3WUFA 1TPWA 1UIPA 1VJIA 2FMNA 3V35A 5LKYA 5T9BG 5HINA 3UD6A 4NJJA 4R7OA 4NX0A 2QS8A 3UQNA 1E6QM 2VEPA 4QE1A 4M56A 1GZGA 4JPGA 4A8NA 3ARWA 1RA5A 2GVLA 4AD4A 2VUYA 2D20A 2C1HA 1G1YA 4QBXA 1IV8A 3KLLA 4JD4A 1QBBA 4DAIA 2PU0A 3B9EA 4GIAA 3AYTA 4MSSA 3EWYA 4GVHA 1Z48A 3WSUA 2WM1A 1JI1A 4LGXA 2YCLA 1OB0A 3P2VA 2BXZA 4CN6A 3O6YX 3TJXA 4YPJA 4Z2KA 4FLRA 2CZDA 2HJPA 1ONWA 4BKNA 1VEOA 3L5AA 3H4WA 1A5NC 1MYRA 5H2ZA 1Z89A 2OXNA 3S5ZA 1KLYA 1D2KA 5K9CA 2B0MA 1RALA 1ZCOA 2AKMA 2QPSA 1TIMA 2PDPA 5M1TA 3UGRA 2EAWA 1YX1A 1C29A 3WQ6A 4DVOA 2ASHA 1VFTA 4WF7A 3ANUA 5I23A 3UERA 1DL3A 2VWSA 1HKMA 4P5UA 2QVHA 1EA9C 3C0JA 5E9XA 4TTUA 4EF8A 1WZAA 1XG3A 2E9LA 2OT1A 1OG0A 4JNZA 2OZ3A 1Z8AA 4MFDA 4N0RA 6TIMA 3TQPA 1Q8AA 2BGSA 1AJ0A 4H6RA 2I57A 1PKLA 2VOTA 3N2XA 2Y8UA 1DJXA 3ZR5A 4C6FA 3QW4B 2ZVRA 4M29A 4LUIA 4M7TA 3BH4A 5CAHA 1OFDA 2QDDA 4AWUA 4PTDA 4JNYA 7PTDA 3W75A 3SCVA 3L21A 2FVMA 4E4PA 1P5BA 3T2QA 3CHDA 4MNMA 1UHVA 3UXLA 1CB2A 1LG1A 2FH6A 2WWDA 3SCOA 3LXCA 1JYWA 2OCZA 3CQKA 2VXNA 1PBGA 2EG8A 2Q6ZA 1C7SA 3F4WA 3NZQA 2J74A 3DYOA 1H7RA 4ZFCA 5FJIA 4HYRA 1SFSA 4LC8A 4IHCA 4LAOA 3HM7A 1K6WA 1EFZA 2Y7EA 5BWAA 3IARA 4IX2A 1OM0A 4UR8A 2H8XA 1DJIA 4Y7EA 4G5DA 3S2CA 3C8FA 2Y61A 4GUGA 1O95A 1W5PA 5DBTA 2W79A 1W5MA 3UJRA 3BK0A 1I1XA 1JF5A 3B4YA 4RXFA 1WXYA 5AHFA 4MWAB 3KVLA 1EUAA 5AHNA 1TELA 1XLGA 2GQ9A 4EOUA 3M07A 1K9EA 1E6ZA 2VDGA 2VRQA 2FFIA 3NVDA 3T05A 2DZBA 1JXJA 3H8AA 3TYZA 4OE7A 1BYAA 1D8WA 1XICA 4JFSA 5LHEA 1NIUA 3NSXA 3CPGA 3KBVA 2YA0A 3M47A 3APYA 4W8LA 2WZTA 4W89A 3Q58A 1B4EA 3CPRA 2WPGA 4WY0B 1R3WA 1TVPA 4G7FA 4RZBA 1OVDA 3URAA 1ONRA 4GZ7A 4ZOCA 2PDBA 1ODUA 4HMNA 4LYRA 4P7OA 2W5FA 3R6IA 3HGRA 3HO8A 4ML9A 3MSYA 2DQXA 2V3DA 1SJDA 4REQB 2FGZA 1CW2A 1XCXA 2QUUA 4FXFA 2WCAA 1XFBA 4PMVA 2JGQA 3ZR4A 5D2WA 4JTEA 4E3TA 3RU6A 3GH4A 3IJ7A 3W83A 4GI8A 1R8LA 4O50A 3CB8A 3NZ1A 2NQ9A 5BYWA 3CV7A 5DEZA 3QOMA 4NI3A 3SSZA 1Q6FA 1M68A 4DNMA 3NL5A 1TSIA 1XW8A 3W1QA 2RDTA 5AVNA 1BRLB 5HMFA 4F3HA 3VD7A 4Y8EA 3W1UA 4HP5A 3VO0A 5A6BA 3KRZA 4GGHA 1N8FA 2XGIA 2PWEA 3G24A 4PFHA 3UWVA 1UA3A 2Z1KA 4ERAA 3PWAA 2PC4A 1WBHA 1K4HA 2DT2A 3B3DA 1UMYA 2C0AA 1K8YA 1JL8A 2C14A 2XFYA 2TMDA 2D0GA 2X1RA 3TW9A 3IVUA 3OP2A 1JYXA 3GY1A 1XINA 3EOOA 1UP3A 3ZVIA 4WOZA 1S2CA 3RRAA 4XZBA 3GXMA 2C6QA 2F8QA 1GW1A 1UPPA 4GWEA 4Z0JA 5A6SA 3N19B 1UZ1A 4MDPA 3LTSA 2YXOA 2V5JA 1S2WA 4QAIA 1HL8A 3W2JA 1UJPA 2XUCA 3AYSA 2A0NA 3BJFA 5AYBA 3N2TA 1QK0A 3H2AA 3CNYA 3I4EA 3MDWA 4ORIA 2EO7A 5E93A 1O94A 1J5TA 3J7HA 3ABOA 3BLPX 3PNUA 4UTHA 1Q2SA 2ZFAA 3CUFA 1JZ3A 4AWTA 2E8ZA 3DYPA 2GWNA 1W32A 4XZWA 4RKAA 5ABFB 2G8ZA 5T9CE 3ZT6A 1M6JA 3EDJA 1HL2A 4KEZA 2DZSA 1S38A 5I07A 3WBEA 3AMCA 4QJ1A 2WMIB 3TC7A 4B4FA 1S5WA 4TMCA 2GOUA 3WK3A 1XRVA 2YW3A 3SY8A 5B7YA 4ATWA 4KKXA 3RLVA 3MV11 2P10A 3NR0A 3WUGA 8XIAA 3MY9A 3OLIA 1P43A 5AHLA 6REQB 4J28A 4MJZA 2ATMA 3EA3A 1JPMA 4AHOA 4GYFA 3U57A 3CUIA 3LY0A 5CPNA 5EMKA 1NEYA 1LWHA 4Q4MA 1GWJA 4UQEA 3W71A 1LCOA 5BRBA 5JH1A 3PULA 4W4QA 4AXKA 2IKIA 3UESA 1J5SA 2DH3A 5ECVA 4GH1A 4JKMA 3AHZA 4YVXA 2QHAA 4C6QA 4DO5A 3OBEA 3HFTA 3RX4A 4L1WA 5IXEA 4HSNA 3KTCA 1V3LA 3WK2A 2DT1A 2BVWA 5LXEA 5I3FA 2L5HA 1NAL1 1OQFA 2WSPA 1T41A 4N7QA 1RQBA 1VF8A 4H9UA 2WVVB 5GVJA 3ATZA 3G77A 5LNVA 1LUCB 1UD8A 4ZOAA 1WCGA 1E9IA 3H70A 1GVYA 4UQDA 2E6DA 4G1KA 2F84A 1R6WA 1SO5A 1IIGA 4WXYA 2R24A 2OODA 4B92A 3G8RA 4I7WA 3E0VA 5DCDA 2ON3A 5CBBA 4NI8A 3S1WA 3LDVA 3MBFA 3XIMA 3HBLA 3EXRA 3MWAA 4D1JA 2G97A 3MZNA 1VFHA 1R2SA 1HNYA 3TFCA 1NSJA 4HU8A 2R1PA 3RFAA 1JNDA 3LXBA 3JS3A 1LWJA 4XTIA 4A35A 3VILA 2DSVA 1GJUA 3PAJA 4RPPA 3ARTA 2GZXA 3SCPA 3TC3A 1FWNA 1TTIA 4PMOA 3DG6A 3W7HA 3VNZA 2Z27A 2CLLA 3PJWA 3N2MA 3SN0A 3P5YA 3TTEA 1W1A1 2VFGA 3FGCA 3QHOA 2XVPA 1EIBA 5SWUA 4LV9A 4UWMA 5TQLA 4TX9A 1DXFA 4FALA 1AG1O 3CJPA 1A5AA 4QJ3B 4ZTXA 2CFFA 3SZ8A 3AS1A 1JEZA 3WQVA 2XHYA 1AQMA 4PN2A 5ABHA 4PCTA 4JN7A 4GUHA 3WLSA 5CLTA 4M6PA 1AJ2A 3W28A 2CYGA 1XLLA 1W9DM 4UTWC 4KBXA 4UTWA 1F3TA 2JIEA 2FDSA 3TE9A 2CZFA 3TYDA 5LIWX 4D2JA 3NO3A 2BVYA 2OLSA 2PDIA 1KFJA 3BLKA 1JI2A 3CV2A 4NUWA 3ATYA 1XI3A 1H11A 2JFEX 1DTNA 2PTYA 2DIKA 5IFPA 3QXBA 4JXCA 4DYKA 3EB2A 3WBYA 3PZVA 3AALA 4DIAA 3QSTA 1RJRA 1EX5A 3LGEA 3JVAA 4UOZA 1DHKA 3IS4A 1JUBA 4W7VA 3VMOA 3P14A 4DWDA 3WK0A 3AYVA 3IACA 1XIHA 3V5FA 3TONA 1KFWA 1OHLA 4JBRA 4LV4A 4ZO8A 1GJWA 1LRNA 1W91A 5REQB 1ZJAA 1B54A 1EOKA 3QKEA 4DWSC 4DWSA 1UROA 3WO8A 2BTMA 1OGSA 4B15A 1X1ZA 3T4CA 3GIYA 4YVVA 1OFPA 4GUFA 4Q4SA 5D03A 4JICA 2C7FA 3NQMA 3ALGA 4IUGA 3CHVA 2YDAA 3QOKA 4UB9A 2XH7A 3R4IA 3S42A 3VK5A 3W7QA 5AY7A 2C15A 5I24A 1GKQA 5KZEA 2HE5A 2YFOA 5G4HC 4EIVA 4H4IA 1EJRC 3QHNA 3PPFA 1PE1A 4MB5A 4HKPA 3W0KA 4ZO6A 2QKFA 3T6CA 1FWJC 3G1YA 5CG0A 3IJQA 3KCJA 1NFGA 1JDDA 1V6TA 1U5JA 1JZ4A 1CBGA 3KRUA 2TODA 3EGJA 1PDZA 2CBUA 3AFBA 2Y1HA 3PANA 4NL1A 4NXKA 5HBFA 3GTXA 4J5NA 4PSRA 4WJEA 3CM4A 1EXBA 1LBFA 6PTDA 3BZJA 5LNWA 1VEPA 3GK0A 1JDEA 4NSBA 1WQ5A 5LHFA 5CPQA 4DX3A 1ALDA 3SUVA 1FHUA 1TZ7A 1ZQ5A 1NOUA 1J0ZA 4ORMA 1YQ2A 1FOBA 1NOWA 2QPUA 1HJXA 2E67A 3ME3A 1XRTA 2QT3A 2X1SA 1KTNA 3UZJA 3M0MA 2EXOA 2RDUA 5TD4A 4AIUA 1CT5A 3LSBA 4ZQOA 1ELSA 4Q7NA 3PY2A 4O28A 4XSLA 3F4DA 3DYMA 1DWGM 3EB4A 1DVJA 2VMFA 5DRCA 1B1YA 3GH5A 2Z6JA 1GOXA 2F7FA 5TIMA 4G1NA 1ITXA 3ITYA 2VD9A 2XSXA 4EPKA 7REQA 1O7AA 4L9ZA 3EPNA 4EVZA 1IEVA 4C6DA 3AUOA 3P84A 3B8VA 1OIFA 3W02A 3ITGA 4M82A 4EPBC 3GNRA 4C91A 3JW7A 2GUUA 2YCKX 4MHBA 5D9PA 4XD3A 3UW6A 1FHLA 1ONEA 4PCNA 1ADDA 1YBQB 1XCFA 1WKDA 1JNEA 1XH1A 1CNVA 3FA4A 1P6BA 2PRLA 1IWAA 3VC6A 3M1ZA 4KERA 3CQ0A 3N12A 2VUNA 4NG3A 1HKVA 4MOZA 4JIRA 4JFWA 5T26A 4XTDA 1E5NA 2HVNA 2PDCA 2BLEA 3BZGA 2JEQA 4Y8FA 1X1OA 1XLDA 4CUCA 4KFNA 3KCOA 4PZVA 5EMLA 3W07A 4HPJA 4WK9A 1Z6KA 4LY8A 4DPQA 4C1NA 4N9CA 1RLDA 1PCWA 4QLJA 2CXGA 3VUPA 2VC6A 3HPAA 2OWXA 1MW3A 3W72A 2GGJA 1CGVA 1RZMA 3OVPA 5FJUA 1KGXA 2OWCA 2POTA 6CGTA 1KRMA 3CTTA 5HWMA 3G8EA 1SW7A 3E49A 2JIWA 1GZJA 1OABA 3MUY1 2VZVA 2IPJA 1HVQA 3RPMA 2V3FA 3M0YA 2ZUSA 3WQGA 1WDPA 3PZNA 4LS0A 3VI2A 2QVNA 5ABTA 4U2YA 1CZ1A 1D7KA 1E5JA 1UR3M 2F38A 2P3ZA 3FJ4A 3H26A 5D2XA 1OK6A 1YPIA 2WVTA 4N9BA 4XAZA 1ESWA 1EB3A 1JAEA 1SJCA 4HN4A 5HDRA 3GR7A 4YXGA 1ITUA 1FXQA 4DJEC 3VPLA 1ZAJA 2Z0IA 1M7JA 4JY9A 3F5JA 4WUIA 2WMGA 1TPVA 2INEA 2J6XA 4Q32A 1J12A 1W1VA 4DLFA 5I3IA 1EDTA 3C2YA 4HNLA 4B2DA 2X42A 3PHAA 4MZ8A 4A4AA 4K3ZA 2D2GA 1SU5A 3XISA 3NQEA 3I6TA 5A6BD 1P6CA 5E0FA 3MC5A 5LYRA 3AUJA 1OX4A 3NDOA 2OMAA 4Q8UA 4GQQA 5H1WA 4BHYA 1EP1A 3AXXA 1RY8A 3V0SA 3BSHA 5CSYA 5EMMA 4W9TA 2NSXA 4QDWA 4YTRA 1IXNA 1TG7A 3WLMA 5FCZA 2BG5A 3UPWA 3URNA 1UH4A 1KWKA 1BSLA 4QG8A 1EOMA 2WSKA 3H54A 3SIMA 1NWTA 4OBRA 3MTWA 1ZAHA 1UKSA 3CV6A 1V7AA 3H22A 4O1DA 4S2BA 3HG3A 3W22A 2V3GA 3AO0A 3LD5A 5KZMA 1EO5A 3MYOA 5C2CA 3QZ6A 1EPXA 3QZAA 1VFUA 3QMTA 4Q6JA 1HF6A 2X41A 3TWBA 5I02A 3DBPA 4EP8C 2HS6A 4QAWA 1V6VA 5I77A 1WDDA 1H51A 1R87A 1CIUA 1HQTA 3RO8A 3VNLA 1FCQA 2CWNA 3KTSA 1N8IA 3OEXA 4O52A 1A0EA 1EF3A 1DE5A 7CGTA 1RCXB 4H9MA 3B0UX 2CCRA 4NNAA 3GWQA 3LI1A 4Z42C 1VQTA 3WH6A 3WBWA 3OLEA 4KRTA 1AQHA 3GXDA 4LAZA 2YBUA 3GVQA 2X0HA 3WLLA 2JKEA 1GTEA 4PBGA 4WJ8A 3KL3A 2G0WA 2FIQA 4RNFA 2W62A 4XAPA 1SR9A 5CQ1A 2VC5A 2C71A 1RBOB 3SRDA 3WUBA 4HZ6A 3CHEA 3S5SA 1TR9A 4QG9A 3W7KA 2PRMA 3ALFA 4D1IA 3FIGA 5HPOA 3PZOA 1LQ2A 4UMBA 3NGJA 3RITA 1CLXA 2AAAA 1R3VA 2VC7A 4ROPA 5FSEC 3D47A 4S3JA 3VX0A 2MNRA 1P0BA 2I5GA 1XGZA 3ZLGA 3I68A 4MLJA 1W5NA 1GNXA 2ZRUA 5I3DA 4KCUA 2HVOA 3RHGA 3FJNA 2WMHA 2FPVA 3AOFA 4O15A 3TMLA 3RMEA 3GTIA 4Y90A 1LYXA 5AECA 1R7OA 2ZUWA 4I9MA 8RUCA 1UUQA 3CH9A 5C9ZA 4Z2GA 5F2GA 1P1XA 3HQ1A 1ZFJA 2V5LA 4NZ1A 1OG6A 5FD0A 3W01A 1KV8A 3TA9A 1VP5A 1QNVA 3GC2A 4XO6A 1R2TA 1BGAA 1BKHA 3AMDA 3ZLHA 2ZRYA 1GQIA 5I3GA 4PTWA 1TV5A 5DN1A 1PX4A 3HMCA 2Z1XA 3PTQA 4ZENA 4IL2A 5CAKA 4RZ5A 2XISA 3TCEA 2J9ZA 2X30A 5C9WA 5XIAA 3WDHA 2CLOA 3BICA 3W81A 2CWXA 3QV8A 2PDYA 2DZTA 3CIWA 2PDMA 4JTJA 2QDEA 2J8TA 2VX4A 2EPMX 2GDVA 2QCCA 3MYPA 5DANA 4HMCA 2GOKA 2XJ7A 1XBXA 3WF4A 1ZCCA 4ZB2A 4KFOA 4A3YA 4RR4A 2VR5A 3VE7A 1A80A 3CUHA 5BMWA 5E0KA 2P1FA 3K2GA 1RAKA 2DH2A 3I4KA 1JCJA 1CXFA 4P7NA 4JR5A 1E4MM 3JUGA 3O6CA 1H5YA 4U10A 3UCQA 2NWSA 1GORA 3V1PA 5I5RA 4AF0B 4Y9PA 5A1AA 2WW5A 1VPYA 3ONBA 2WLYA 3DZ1A 5BOFA 4AD0A 1OINA 1KM4A 1JF6A 3WDJA 4HPXA 3QYSA 5D37A 6ALDA 4O0QA 2GK1B 1L6SA 2QCDB 4JTIA 1PZ3A 3QLDA 4XKYB 2O9OA 1UMLA 4Q7IA 1TE1A 1UUOA 4JQ1A 4L61A 3FVMA 3QQ0A 5LIUX 4UFIA 3P81A 3H21A 2PWGA 3APTA 1XDLA 1V03A 3KZPA 2MANA 1E0WA 1K02A 1Q6GA 4ADUA 5J8LA 1E3ZA 2FFCA 1TWWA 4AZCB 4PL2A 1TTPA 3L7RA 2V9DA 1JIBA 2XFRA 1K6AA 1XG4A 4QE4A 2WV8A 4JCLA 3OG2A 1JJKA 2OQLA 3HV8A 1ZL1A 2ZZ2A 4FPSA 3SEPA 1JD9A 3PPGA 3GR4A 3C86A 4WKFA 1PUDA 2TYSA 1GVEA 3GNDA 3NQ2A 1OC5A 3MT1A 3S9ZA 3L4WA 4LS1A 3T55A 3EX4A 4RZ6A 4GJJA 4H8UA 1E0TA 1GVFA 1KM5A 4IISA 4NAEB 2VTFA 3F4CA 1XFCA 2EJAA 1W1PA 1H0GA 3Q2DA 4PRRA 5C9UA 2PPGA 3DFNA 1UQYA 1ONXA 4DWSD 1O66A 3LRMA 2VFHA 4M8UA 3STGA 3Q94A 3R8HA 4AIBA 1F9CA 1TPUA 2QAPA 4IGHA 4UZSA 1W9UA 3LGGA 1DJZA 3LHVA 4MY1A 3IJ6A 2XN1A 1IR2A 4IZGA 5TNVA 2PRHA 3FVDA 1B2YA 4S23A 1MXDA 4E4FA 8A3HA 5F1UA 3PN8A 1YNPA 2YCJA 2WCGA 1UD5A 1SZGA 4B91A 2FJKA 3LYEA 1GOIA 4FP1A 1FKXA 9XIAA 8XIMA 3REQB 4QGCA 3M5ZA 2P8CA 1GT8A 4UZUA 1WAWA 1Q63A 1VYRA 3GTNA 3SCTA 3T7VA 1AD1A 4LNYA 5A2AA 4GZJA 4PB3A 5KZ6A 1GVIA 3FK4A 3TXZA 1W2VA 3BG3A 3WQPA 4GE8A 1QASA 1CGWA 1P7TA 2H8ZA 1QOXA 4OZOA 1F4HA 2DP3A 4KEUA 3WK1A 2YYTA 5U7SA 1ISVA 2FVKA 2XN0A 4F2UA 3UWUA 4BR1A 1NQ6A 3TSBA 4UMAA 4FLSA 3UJSA 5DMYA 3LCFA 1XIIA 3O16A 2B7OA 4LCQA 3WQ8A 4Q4QA 4W84A 1ME9A 3DEQA 4JIQA 1XH0A 5EA9A 3TYEA 3A3WA 1OY0A 3O6AA 1H7PA 3WJSA 3I7SA 1QHOA 3GHUA 4HNOA 1MEWA 1SJAA 1FA2A 2OYKA 3VUSA 2GJPA 3U5UA 3R13A 2CEQA 3GVRA 3KVKA 3NXLA 4L4MA 1I75A 4NIRA 3PC0A 1MWOA 5JBFA 1XQLA 2D2JA 2E3ZA 3KW3A 3QV7A 3GG8A 3H2OA 2IUZA 3R0KA 4Q6XA 2XTKA 2D3NA 4N6EA 3GS6A 1R9YA 4QLLA 4AG0A 1QPOA 2Y63A 4NASA 4IXHA 2A4AA 1QXLA 3PK7A 4K39A 3DHPA 1OT2A 3BWWA 3RXZA 3K4DA 5CZJA 1E71M 4F40A 2PBOA 2OGYA 4YTUA 4KCTA 3THQA 4X0VA 8TIMA 3BARA 4L5ZA 1M1BA 3IIOA 2A7PA 1JUEA 3EX1A 3URBA 3SO7A 4LAUA 2TPSA 2GSHA 3URQA 3A12A 1PIIA 2HBVA 4PSPA 3W76A 3QV6A 3R79A 2PCEA 1XD0A 4XISA 4AZ5A 4F9DA 4B5VA 2NX3A 3ITVA 1NF0A 3LRLA 4NKCA 3LNPA 3ITLA 5FOOA 3NEVA 2VQTA 1OYCA