1JCNA

Binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
490
structure length
395
Chain Sequence
TGYVPEDGLTAQQLFASADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSPGIPITEVGIVTSRDIDPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVRTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Type I Inosine Monophosphate Dehydrogenase and Implications for Isoform Specificity
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords INOSINE MONOPHOSPHATE DEHYDROGENASE I
total genus 106
structure length 395
sequence length 490
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jcnA00
4GUGA 1X8FA 4UFLA 5D37A 3LBMA 1KLZA 5FF0A 1SO6A 3TMQA 3BK0A 1DQWA 1G4TA 3G1YA 4CNOA 2BTMA 1VC4A 3P5YA 2Y61A 2G97A 4EF8A 1G6CA 1VZWA 1WAUA 3TH6A 5LNWA 4M6PA 3W1LA 2QJHA 4GUFA 2R8WA 3CC1A 3SIZA 3P7YA 1WX0A 4IX2A 3RU6A 5CZJA 4UTMA 1P5BA 2W0UA 1GVOA 1UB3A 2CZ5A 3TQ0A 3O6YX 3W1MA 3MBFA 3EWUA 3L67A 4JTLA 2VEPA 4XWUA 1W37A 7TIMA 3PBVA 4X9SA 1PVNA 3TSBA 2BZNA 4CLMA 1TQXA 3RLVA 4DO4A 3PSVA 5AHFA 2ZTJA 1SSGA 5D02A 1R2TA 3BLIA 1KM6A 3ZFHA 2E1DA 1LBLA 2EHHA 3O1NA 3BARA 4ZZ9A 3USBA 1W3NA 3MW7A 1DJNA 1FDJA 5C6MA 4M7SA 3L5LA 1VPXA 2DJLA 2C18A 3CM4A 2GPTA 3EXSA 1OFOA 2ISVA 3TSMA 4DPPA 3DFNA 3IRDA 4UR8A 3G22A 1P1XA 5C5YA 3S1UA 1IIGA 2W6RA 1J5TA 4R33A 4RR4A 1VHNA 2JKPA 1XKYA 1MZHA 1LZOA 5H2ZA 5EL1A 3YPIA 1RQBA 3MP5A 3W7MA 4O4VA 3W87A 1DVJA 4N9BA 1Q6RA 3LGEA 5E93A 3U8GA 1F73A 1D9EA 5LNSA 3TV8A 1ZALA 3C2RA 1LDCA 4Z0JA 3UQNA 3QEZA 3QJAA 2JKAA 2NXGA 3GDRA 3Q2DA 3P60A 3S5YA 3GB6A 5K9DA 2YDAA 1JCXA 1YDOA 3UD6A 2WOQA 1SQ7A 1OK4A 2QUVA 1N8FA 1JCJA 2WQPA 3S1XA 3PC0A 3WJWA 2WSRA 4Q32A 4UNLA 4O11A 1PCKA 1O4UA 4GUJA 5IM51 1HG3A 4N4QA 1W56A 3M41A 3FA5A 1FWNA 1GQNA 2RH9A 2ZA2A 3W7EA 2YR1A 3GAYA 1HO1A 4O8RA 3MJYA 1NSJA 4AF0A 1TTJA 3GDMA 4DF1A 4Y6GA 5L9FA 3IIVA 3V1PA 1OFPA 1YDVA 3QPYA 1TPEA 3SR7A 3GXNA 3S1VA 3TDFA 1QFEA 3W7JA 2CLOA 1UUMA 4JTKA 1IXQA 1WBJA 4XBSA 1IF2A 2QKFA 3NM1A 3W70A 3W7GA 4YXGA 4LUIA 4K36A 2QEZA 1JCYA 2NUXA 4Q4KA 4A22A 4UUIA 1KFCA 1EX5A 3P80A 3LM7A 3MI3A 4FNQA 3MUXA 1M7PA 2ALDA 4XTDA 3IEBA 1AW5A 3A22A 2FFCA 3NZ1A 2YSWA 4X3ZA 1FCVA 1EUNA 3I7RA 2ATSA 2QCLA 3NGJA 4HNNA 1F74A 3G8EA 4ZQMA 5AHMA 5A8GA 3SY5A 5HUPA 1I2PA 2R91A 1RQEA 3BG3A 3GIYA 1H1YA 4IMGA 2QCDA 2LLEA 4BF9A 2CLHA 4MZYA 1KTBA 2DP3A 2FPYA 4UFHA 3CWNA 3L0KA 3C6CA 3W88A 2YW3A 4IQLA 1NF7A 3W7NA 1QPNA 2G95A 4JY9A 4ZQCA 2QCGA 3W07A 3W1AA 3GX9A 1TPC1 3HGSA 3C8FA 3TQVA 2FB2A 3P81A 2ABBA 1MSSA 4BWLC 4DO6A 1CI1A 4PC8A 5LSMA 3G0SA 3W2UA 1V5XA 1JUBA 3IGSA 3HMJG 2E5CA 4DF0A 3L66A 3DBPA 1ADOA 4RXFA 1GPWA 1JULA 4UTIA 1W5OA 2EKCA 1JRBA 3NXFA 3BO9A 4JX4A 3DHDA 3CQ0A 5AHLA 3LRKA 4ZQRA 4ZQOA 4FX8A 2PCQA 4UFMA 5G4WA 1W31A 5HR6A 4WJEA 3WJYA 2QAPA 2GQ8A 4QSHA 1H51A 4UCGA 3QF0A 4P61A 1A5SA 5DLCA 1TV8A 3PUOA 2ZRVA 1R2SA 3W7LA 1KM2A 3M0ZA 4FX6M 4X22A 4UTTA 5AC7A 1ICSA 2V2HA 3W23A 2AGKA 3E12A 1PE1A 1FWSA 3OEXA 3LLFA 4DO5A 1C9DA 5HULA 3HG4A 4Z1CA 3NQCA 3LTYA 2O7QA 5K4XA 1EPXA 4NNCA 3NVTA 3HPSA 1EA0A 2E6YA 3TCEA 5EA9A 1NEYA 1ZCOA 5CKSA 4CCCA 3MO7A 1ME7A 3SI9A 3QQ1A 1G7VA 4JTTA 2CLFA 3B8DA 1H7PA 2WKJA 1SO3A 1XUUA 2A6NA 3B06A 1FXPA 3QFEA 3NM3A 1QDSA 1O95A 2A7NA 4AWTA 5I3KA 2A5HA 1RD5A 3DENA 3IIXA 3LCXA 3LHVA 3NQEA 5ABTA 1MEIA 2V8ZA 1I2QA 2H3DA 2ZZ6A 4FXSA 2NX1A 1KW1A 3NQGA 5FEZA 1K7FA 1PIIA 2ATMA 3E02A 2Y89A 4OV4A 2G96A 1SSDA 1U83A 2DORA 3I7SA 3EWZA 1H61A 2X1UA 2XFWA 2QUTA 4PTNA 2CWNA 4UTHA 3BW3A 4LUJA 1O5XA 3SW6A 2V2CA 3W72A 1SZNA 4RZ5A 5BMWA 2A0NA 1PS9A 3QQ0A 2J9ZA 5TIMA 4GFSA 1I4NA 2A7PA 3C52A 5K9XA 3GXPA 3THAA 2ZZ7A 1MO0A 2VFEA 4FNRA 3L5AA 4A29A 1GZGA 3W84A 3A23A 1K8YA 1W5PA 3UPBA 1ME8A 4QIUA 5DELA 4K39A 3W22A 3I68A 2I14A 4B5NA 4WXYA 1XXXA 4N2YA 3VCRA 4GC4A 4LVFA 1I2NA 3WK1A 4PCFA 1I2OA 2VXNA 1GT8A 4JD4A 3BGJA 4QNEA 1T96A 3C2VA 5K2ZA 1AMKA 3WK2A 1XBXA 3DI1A 4OT7A 1VCGA 2Q8LA 1LM1A 4IX0A 3DFPA 5CGQA 1Z48A 4CNPA 3PG9A 4K7VA 2Y70A 4S2CA 3E9AA 4WY0A 4MLJA 1OFEA 5CPNA 5D2XA 1PCWA 1KFLA 3KXQA 3LCIA 2CZFA 4TMBA 4AH7A 5E1QA 5HJLA 4I7VA 5LZLA 2HTMA 1OFBA 4JX6A 3UWZA 2J27A 3RMJA 3M9YA 3W9ZA 2QJGA 4NNBA 4FNSA 3NPVA 3S5OA 4IOTA 2C14A 4J9JA 1WV2A 3TFCA 3HF3A 2GOUA 1DJQA 4RKAA 1YLVA 4K8EA 2H6RA 3W1QA 1TTQA 4DBDA 4JS3A 2GQ9A 1K8ZA 4HNUA 4DXVA 1TV7A 2F84A 2HSAA 3C61A 4JR5A 3S6DA 3W71A 4U28A 5U4NA 3F4NA 3SGUA 2V5BA 2Z6JA 3C2OA 3MP4A 3G3MA 5FF4A 5KZMA 4HN4A 3HGOA 3F03K 1L9WA 5SWUA 1Z42A 2YXGA 1DORA 3NQVA 1H62A 2KZHA 1VQTA 1O60A 4WD0A 3VNDA 5I3IA 1LOSA 1XDMA 1J2WA 1F2JA 2QCCA 3W1PA 1K7EA 3G0UA 3G1XA 3VE9A 3LDVA 4N6FA 2ZRUA 5D2VA 3MI2A 3TIMA 4HSNA 5KSWA 4NJGA 1EEPA 4HPXA 3PG8A 1ML1A 2GJLA 4OE7A 3UXAA 3HGRA 4IUOA 4MFDA 5G2WA 1O5KA 5C54A 3S5NA 1THFD 1X6UA 2OX1A 2YZRA 2ZQ0A 4TO8A 5DN1A 2FIQA 4XZ9A 1VS1A 2ZRYA 4KFPA 3H55A 1WOBA 5HMSA 4CQAA 3B0VC 5F2GA 3NQMA 5BOOA 1ZAJA 3O15A 3PULA 4O1DA 2PRLA 3G1SA 5CPMA 6ALDA 2Z6IA 1W0MA 3W7DA 1OX4B 1TPDA 4WUIA 2CZEA 1H7XA 3W6YA 2DJXA 4DBEA 2FDSA 1ONRA 3GDTA 3IIZA 1ZAHA 2QCDB 2E77A 1SW0A 2BLEA 3I6RA 3RFAA 3N9RA 4QQ3A 3TE9A 3UWQA 3V75A 3N2XA 3LXBA 1H5YA 4O53A 1HFBA 1TREA 2VEMA 4M19A 5LHFA 1FXQA 2A1YA 1M5WA 1TPVA 1GYNA 1LBFA 1FWRA 2PRMA 4AHOA 3LTSA 1QMLA 2A2IA 1DQXA 2ZRXA 3QW3A 4EOUA 3NNTA 5GVJA 3KHJA 3VFLA 4RXGA 1WBHA 1A53A 1VGAA 1BWKA 5BRBA 3DAQA 1VLIA 2TMDA 1WA3A 4QM1A 1X1OA 1W5QA 2Y88A 4O18A 3BG9A 3O07A 3F4WA 1SR9A 3CWOX 4JNMA 5LGZA 3QMSA 3CU2A 3C56A 1XI3A 1NFBA 3DGRA 3W2MA 3DU0A 1MEHA 3HG5A 3LRMA 2H90A 1YADA 1FBAA 4AHQA 4FXRA 3NQ6A 1GG0A 4JDBA 1TPFA 4IXXA 1U5JA 4EIVA 1LLZA 4MLRA 1K03A 4IXHA 1ZHAA 1T8XA 4KKXA 3NQFA 1HTIA 1FCBA 4X2RA 3S9YA 3E0IA 1A50A 4MKNA 2NWSA 3ATZA 1H7WA 1FUYA 2CLKA 3QM3A 2ZZ3A 2Y63A 3TAOA 1JQVA 2WNQA 3JR2A 3GNNA 5F4XA 2E6FA 2RFGA 2O7SA 4Z1BA 3GAKA 5HR7A 4ONVA 2QDGA 1VJIA 4PH6A 1D3HA 4LS2A 5AN7A 4LVBA 2TYSA 5F2IA 3GKAA 2PE4A 1ZENA 4O57A 4LV9A 2EGZA 1F7BA 4IMEA 1XBZA 2DZPA 4O0ZA 3W75A 3C4UA 2OJPA 1LLWA 3FJ6A 2V30A 3QMRA 1ALDA 3NOEA 3HOJA 3UNDA 1G4SA 4NJKA 1RV8A 5DY3A 3PM6A 5AYXA 5C2XA 3KVMA 2V9DA 4GE8A 3GZ3A 4POCA 5AOUA 4JTJA 1GVRA 4ORIA 3FYOA 2RHGA 3MWAA 3ELFA 2Y7EA 4TX9A 2ZYFA 3A5VA 4Z08A 1W54A 1GVFA 2RDWA 4C1KA 5AC8A 3PAJA 4FO4A 1DV7A 1OFRA 5A5WA 5KZEA 2CU0A 2J88A 3DFQA 1QO5A 5EBUA 3HO8A 3NL3A 1TIMA 3ZWSA 3UZJA 3PVFA 1VCVA 3W83A 1KTNA 3KRZA 1B3OA 1D3GA 2DZWA 3GVGA 1N55A 3DFTA 2Q3OA 1L2UA 4I9AA 1VRDA 4NZJA 1RVGA 2Y7DA 2QCEA 3TW6A 1Q6OA 4A3UA 4RJEA 3HIJA 4IMFA 1KTCA 2OMAA 5KMYA 1SW3A 1UUOA 5CZTA 3IV3A 5I3GA 3NQDA 3TAKA 2E5BA 2DZTA 1B57A 2X30A 1TCDA 4AEOA 3NQ2A 1XFBA 3INPA 2B7QA 1ZNNA 4E2BA 4N4PA 4M5PA 3A24A 3DKLA 4OBTA 5D30A 3O05A 1HUVA 4ZVJA 3IGUA 3M47A 2WSYA 4NX0A 3R5EA 4WXZA 2AQWA 3BV4A 2HS8A 4O12A 3TMLA 4Z0SA 2H8ZA 4NT0A 1HL2A 4BR1A 3NDOA 4JICA 5HWNA 1KM3A 4AWUA 1Z44A 4LU0A 3BLEA 1TMHA 1GWJA 5DXYA 3W7HA 1YTEA 3P62A 3QW4B 1RPXA 4BFAA 1CW2A 2P1FA 1FQ0A 3IGXA 2CW6A 5DCDA 3OVRA 4RK8A 1FWTA 4LNYA 1M6JA 3BGGA 1OX6A 2B7OA 5F2LA 5FI8A 2A7RA 2Z1BA 4JTGA 4QITA 3TR2A 5D2TA 3ABQA 4NU7A 4UMBA 3STFA 3K30A 4O17A 5G5IA 4QAIA 3SECA 2Y7FA 3PBUA 4JTUA 1LROA 4OGZA 3THQA 2OT1A 3W7CA 3NR0A 3Q58A 4M6VA 3A5FA 3T55A 4IJBA 4UXDA 3EX4A 3RNDA 3G3DA 4JX5A 3N9SA 3PB0A 1IIHA 4PODA 3P74A 1GEQA 4CCEA 3QRHA 1LOQA 3UY8A 4LRSA 4O0KA 3FEMA 4JTSA 2QCHA 4Y8FA 1YDNA 2C0AA 3JS3A 3BG5A 1SZGA 1DKWA 1GVSA 3IIOA 1S5WA 2J6XA 2Q8ZA 3NA8A 1QPOA 4TMCA 1JR1A 1VR6A 2QJIA 1ICQA 1R46A 1S3HA 1RQHA 3MYPA 2B7NA 1OF8A 2V81A 1GYLA 3JRKA 1TRDA 4LVDA 5CPOA 2IQTA 1LCOA 2J9YA 1AW2A 2GVGA 4UFIA 1RZMA 1KFBA 1M7OA 3I7QA 5FEPA 4JTEA 2X1RA 4YMZA 3EEGA 3HQ1A 3S5ZA 5LHEA 2RKXA 1OHLA 1X7FA 1P0KA 4RZ6A 1PV8A 3QSTA 3NPUA 1E51A 4NVTA 4UIOA 1K02A 2BWGA 3O6CA 3DHFA 3GR8A 3FJLA 1KM0A 1ICPA 2ZFAA 4R53A 3B0PA 4ML9A 2YYTA 4NJJA 4UR7A 1QO2A 2V2DA 3B0UX 1TSIA 5D33A 3KVJA 4TIMA 1L6SA 3C2FA 5DCBA 3W74A 3A9IA 1HO4A 4XBKA 4GWEA 3OG3A 4BWLA 1O94A 1OVDA 3NL6A 4K8HA 4MIMA 3QPZA 5F1VA 5HINA 2A4AA 3O16A 3AO0A 4NJIA 1KLYA 1R2RA 4C1LA 3N19B 1BKSA 4WY0F 1H1ZA 3EXTA 3UPWA 2RDUA 3W1TA 5AFDA 3VE7A 2NV1A 3LTPA 3NL5A 4JGDA 1VYSX 2RDTA 3CEPA 3KRUA 4OWGA 4KWVA 1KM1A 1YTKA 3B03A 2NZLA 1XCFA 2X16A 2FB3A 4RZ4A 1I8JA 3ZWTA 4EF9A 3QZEA 3NEVA 1NF0A 3LCHA 1OFDA 5DBTA 2VEIA 4PFMA 3PB2A 2AAMA 2Z0IA 2FPTA 2GJNA 5D38A 3TW7A 3RF9A 3NQ8A 2UV8G 4JY8A 4NZFA 3TC7A 5E0KA 3P8IA 3GXTA 2BX7A 3EX3A 4BI5A 4DELA 4Z1DA 4MY8A 1Q3NA 2F7FA 4HSOA 3EKZA 4UNKA 3RLUA 3W1RA 5CSSA 1ZY9A 3LRLA 4ZQPA 1B4KA 3W73A 3NZRA 3FOKA 4K37A 4PL2A 5K7JA 4FIRA 3EX1A 1VH7A 5IBXC 2FPVA 4UC5A 4PL1A 4IMDA 3IVTA 4O1AA 1W5NA 3IVUA 2XN1A 3LI1A 4TR9A 4E38A 1VCFA 4HNVA 4ZMGA 5LKYA 2CLEA 1X1ZA 1G4EA 2D73A 4AWSA 3L21A 4ADSA 3LHTA 1RR2A 3CEUA 3MYOA 5AB3A 1B9BA 1AK5A 2GVJA 1R47A 1DHPA 3KRSA 3QMTA 5IBXA 4O1CA 4HPJA 3CT7A 3OVQA 1OJXA 3CB8A 2NX9A 4MPQA 4FF7A 3TC6A 3G24A 4H3DA 3C0JA 3LCLA 1FDYA 4U4MA 1LORA 4UTWC 3NAVA 2EF9A 3N73A 1QWGA 4Y90A 1UJPA 4O13A 1WXJA 3HBLA 3CLMA 1LTDA 4GUHA 5TBOA 2V0TA 5AC6A 5F1UA 2FTPA 3N2MA 2BSLA 3TUUA 3UXDA 4DF2A 3DZ1A 5FF2A 1SZFA 1V7YA 1OF6A 3BW4A 3FLUA 2FJKA 1XDLA 2DZVA 1GTHA 1A5CA 4Z1AA 2VEKA 3AJXA 3U2OA 3DXIA 5D2WA 2H3BA 4JXCA 1JCMP 1J4EA 2DZSA 2GQAA 2VELA 3KFTA 1KFKA 1G69A 4LVGA 4AXKA 2DU2A 1Y0EA 5BMXA 4W9TA 3BPWA 3L0GA 2XN0A 3KVKA 3FKRA 3N34A 2VENA 1YXYA 3NO5A 1FDZA 4CNNA 1KFEA 2NWRA 2WV8A 3GDKA 4YLWA 3SGZA 2X1SA 3EXRA 1T99A 4XQ6A 3F1QA 4PA8A 4S2BA 1K7XA 4AF0B 3KX6A 4JEQA 3ABOA 3W7KA 5BW6A 2HS6A 1T0OA 2A6LA 4O15A 2YCEA 5G2IA 1B4EA 1EP2A 4ALDA 3QSRA 4KFNA 4O28A 3TXVA 4Q33A 5K4ZA 3M6YA 3PS7A 3QC3A 1EB3A 5EKYA 3T4CA 4UTWA 2Q3RA 1KBIA 1A5AA 3UWVA 2NLIA 4R34A 1XBVA 4JIQA 5F4WA 3GKFA 3EB2A 5F4SA 4UFJA 1H63A 4LS0A 4GNJA 3Q37A 5HWMA 3HPZA 4FHAA 3S42A 4O19A 5K3VA 5J5DA 3EX2A 4LTSA 3STGA 4UTUA 3WK0A 5G4EA 4LS1A 3STEA 3W85A 1PL9A 1SFJA 1EWDA 1PHQA 3ABSA 3A21A 3NPXA 1EP3A 1YPFA 4YWIA 1LOLA 3G1FA 1GTEA 2QCNA 3WFAA 5CZ0A 5KZDA 1H7OA 4JTFA 4UTJA 2ZBTA 4AVFA 3STCA 3S8HA 3P67A 3TX9A 3MP3A 3HJZA 1OYBA 1IGSA 4MYAA 3UY7A 4H6KA 3PBYA 1YTDA 1NVMA 4MYXA 5C55A 4MVAA 2CLLA 4K6AA 3LCWA 4O4WA 5K9CA 4UFKA 5AYYA 4OQVA 4AB4A 1TPUA 1L6YA 1Z41A 1SZEA 1SO4A 1OK6A 4BI7A 2XN2A 2A85A 1FY6A 5LNUA 3B05A 3C3NA 2ZA3A 3S1WA 1XM3A 1JRCA 4QJ1A 2CLIA 4WOZA 4RV8A 2QCFA 3PR2A 1SFLA 1GVQA 6TIMA 2QCMA 3WJZA 3CIWA 3RK8A 4YCPA 4WY0B 4MY1A 4QISA 3P5ZA 2WNNA 2PRHA 4IGHA 3U6WA 1KM5A 4A2RA 3W7RA 3TJXA 1PHWA 2VFGA 1H7RA 3DKJA 3O8AA 3SSJA 1G67A 2P10A 3FYPA 1IXPA 1W3IA 2NX3A 4GJ1A 4L4LA 4ZL1A 3TXZA 2NXIA 5D2YA 4JYFA 2ISWA 3ANYA 4O54A 4NX5A 3OIXA 4XKYA 2NUWA 3LBCA 4MZ8A 4E2DA 3W1NA 3HB9A 3N3MA 2YPIA 3CTLA 4AAJA 5FF7A 2ZZ1A 3LLDA 4HNTA 4NQ1A 1TJRA 3BLFA 3M5YA 2E6DA 3HG3A 4O16A 1YPIA 3QH2A 1EIXA 4FX7A 1TPWA 2PC4A 3B04A 5MHBA 1K8XA 2TSYA 4Y96A 3G1HA 4IPJA 3PF3A 4LWWA 3TA6A 2YW4A 4N9CA 3Q94A 1ZFJA 1F5ZA 5D32A 2Y6ZA 4RCXA 1IXOA 5DY2A 4N9EA 2C16A 1TPH1 4OHQA 1LRNA 4E0CA 4RX0A 4XKYB 1ZAIA 3G1DA 1OYAA 4LC6A 2E6AA 3M44A 4WOQA 3LOTA 3LX9A 1KFJA 3KOFA 3SZ8A 1EP1A 3PSWA 4JTIA 1JUEA 4EVZA 1VHCA 3L2IA 4O10A 4MUZA 3T78A 1H60A 2ZRZA 4IWWA 4JTHA 3M5VA 5CPLA 1JCLA 3LHWA 2JKEA 5HUOA 3DH7A 3BW2A 1S5VA 5I3HA 3H54A 1Q45A 1WQ5A 2QDHA 3CIXA 2CLMA 4UMCA 4LC8A 1CX9A 1TTIA 5CZSA 3DFOA 4GRSA 1GG1A 3NL2A 4A2SA 2VC6A 3W86A 3LCFA 3G8RA 1KBJA 5CSRA 1TV5A 1Q6QA 5DXXA 3O6DA 1DOSA 1OG0A 4NNAA 4L4MA 1W5MA 2WJZA 3W7OA 3R8RA 4S1FA 4MOZA 2FLIA 5F2MA 3G18A 2HMCA 3LCGA 5KTLA 1QPRA 2WSQA 2VFIA 1AW1A 4N6EA 2NV2A 3HGJA 4QNWA 2B4GA 1MEWA 3E49A 1SUXA 3M5ZA 5LNVA 2ZZ4A 1C8VA 2NXHA 3LERA 2JGYA 4YCOA 2TRSA 1JVNA 2VFFA 2ZDRA 1LP6A 4M7TA 2B0MA 4ICNA 5D04C 4IMCA 1OFQA 2P0OA 1H50A 1IXNA 3PBWA 3UWYA 2OCZA 3PUEA 5EYWA 1MXSA 2V82A 2CFFA 2YYUA 3OA3A 4NUWA 4XUGA 1GOXA 4YL2A 2Y7GA 8TIMA 1KV8A 3NYZA 2EPHA 3TQKA 1ME9A 3O63A 4HKPA 5FEXA 4K38A 3CPRA 3MMTA 3SFKA 3LHZA 1OX5A 3SJ3A 1KA9F 3BVJA 2JGQA 1WOAA 2DZXA 1QNVA 3TKFA 1XUZA 1UCWA 1QCWA 2JBMA 4BI6A 1AL8A 4R7JA 1OYCA 2C6QA 4UTLA 1XL9A 1YXDA 1OABA 1JUKA 3EWYA 1OFAA 3S0CA 2BXVA 5G1TA 2ZTKA 4JIPA 2Y85A 2R94A 3W3OA 4WX2A 4A21A 4ZQNA 2W79A 4ADUA 3P8JA 3EWWA 1VYRA 4IPIA 3W7IA 4GUIA 1AL7A 5DCEA 4NXKA 2X2GA 3G0XA 2I9EA 2ZA1A 3OHIA 2X1TA 5FESA 1W3TA 1TPB1 5D05A 3GLCA 3NPWA 3T44A 3NQ7A 2DZUA 5LGXA 2YFNA 1R30A 3ABRA 4ORMA 1BWLA 3NQAA 1W8SA 3W2LA 1FX6A 3M16A 2CZDA 5AYZA 4N02A 4JDYA 3L9CA 1XC4A 3L5MA 1FCQA 3WJSA 2C3ZA 1ZJIA 4HT3A 4JYEA 4FNPA 3QYQA 3N14A 1P4CA 1SU5A 4AHPA 4KWWA 5AHNA 3PUDA 2PURA 1TQJA 3MHUA 4I7UA 3R2GA 5EY5A 3TFXA 2YX0A 3G1AA 3P84A 1QAPA 1F6KA 2V5LA 3W2NA 3OBKA 2EAWA 2VFDA 3LI0A 1SO5A 3FKKA 4DPQA 1S5TA 4O50A 1F76A 4MJMA 1LYXA 3GR7A 3MI6A 2JK2A 1DL3A 4JN6A 4UMAA 1AG1O 4WQ6A 4LRTA 3TNOA 1EUAA 1K3UA 2A21A 2C15A 1QOQA 2C19A 4GBUA 4LW7A 2QR6A 3LXCA 4G1KA 4UTKA 5L6UA 2WO5A 2E09A 2ZZ2A 1QOPA 3TK7A 3P82A 3ZR4A 3LV5A 2J24A 1A5BA 4XTIA 5DBUA 3CHVA 4HHPA 3W1XA 3GK0A 2C13A 1BTMA 1KV5A 2E68A 3PY2A 4LOCA 3LHYA 4D2JA 1G4PA 4Y9AA 3TJLA 1G7UA 3G1VA 1TB3A 1W1ZA 3DI0A 2B7PA 1BEUA 3UWWA 3TU9A 4KFOA 3T7VA 3LB0A 4OU1A 5FF3A 4K7YA 1UASA 1EWEA 5I3FA 3KAOA 4FB7A 5KITA 3W7QA 5FEWA 1L6WA 3L65A 2WNZA 4MJZA 4MFEA 2ZZ5A 1H7NA 4RLIA 1I2RA 4P2VA 3EX6A 2VFHA 2ZCGA 3O06A 4EWND 1QR7A 2VOMA 1I45A 4H4IA 4O52A 1LRQA 4MY9A 3R12A 5I3JA 5AHEA 4ADTA 4AMAA 5HWJA 4DEFA 3HPXA 1JQXA 2ISSA 1Q6LA 1UBSA 1YYAA 3EWXA 4LY8A 3P61A 2R14A 3WK3A 2TPSA 1WDWA 2OT0A 1TO3A 4JYDA 5J5RA 1KM4A 3LXAA 3LHUA 4PEKA 5G2HA 3PWAA 1TJPA 3C2EA 4TU1A 4DQWA 1SW7A 3E96A 3VI2A 1VLWA 2YGYA 3T40A 2I1OA 4CQ8A 2WPBA 1F05A 2E5DA 1F6PA 3FIGA 3WJXA 5AHIA 3TROA 2GVLA 3KVLA 5G1YA 1TTPA 2Z2UA 3M7WA 4FNUA 3L68A 1FWWA 4FEZA 2NUYA 4OV9A 3D0CA 2J9XA 1QPQA 3NG3A 4CQ9A 2OZ0A 5CG7A 4NXSA 1TRIA 5D03A 5KINA 4NJHA 4I7WA 3B4UA 3UYCA 1DBTA 3MHFA 4LVAA 3MBDA 4M6QA 2QF7A 1P0NA 4N9DA 2FQIA 2G5WA 1WYIA 5H91A 5LNRA 3M43A 3UZ5A 3EKLA 5T26A 3OVPA 3M1ZA 3FS2A 3H53A 3M5XA 5BNKA 3W2JA 2VKZG 3ZS4A 5D09A 5TQLA 4LT9A 4LV4A 2ZRWA 3GYEA 1XBYA 4MZ1A 4O1BA 3L0NA 1N7KA 3ATYA 4HIBA 3I65A 3R13A 3IVSA 2YFOA 3LV6A 4FIQA 1GJPA 3W2KA 1TYGA 1SPQA 2QAFA 3DFSA 1NAL1 1YXCA 1FCUA 4BK9A 5U7SA 5EPDA 4CCDA 3FFSA 1LBMA 2ABAA 1LRTA 4FNTA 2GUUA 3R89A 3MHGA 3W76A 4O14A 4WZHA 1VYPX 4UTTC 3GNDA 3TSDA 2QUUA 5HNRA 1OX4A 5HQEA 3IIPA 1C29A 4GXMA 1JCNA 2H8XA 1JJKA 3EWBX 3W1UA 5EMUA 2Y62A 3VKJA 2C1HA 3HG2A 3UWUA 3W7PA 3GDLA
chains in the Genus database with same CATH superfamily
3UU0A 4HU0A 3LBMA 5CC6A 5FF0A 3BK0A 3AIUA 2ZUTA 1I6NA 4CNOA 5AKQA 1IWBA 1PKYA 1VZWA 1WAUA 1TR9A 3ZJ7A 4DUWA 1E5JA 3PPFA 1ISYA 4M6PA 5CJNA 3AIEA 3S83A 1VENA 3WO8A 4IX2A 3RU6A 5KEZA 4KF1A 5CZJA 3SQMA 4PZVA 2W0UA 1UP3A 2UY2A 2CZ5A 3DUGA 3W1MA 3WD3A 3S9ZA 5XIMA 2VEPA 4A4AA 2FZNA 4JCLA 3OGVA 2BOEX 3LQLA 2RJHA 3ZMRA 2E1WA 5FACA 4CLMA 3UZYA 1DHKA 1KQZA 1TQXA 3RLVA 1ZRQA 1HKJA 2ZTJA 3GH4A 4C91A 2W92A 4LFYA 1JFXA 3BLIA 3N12A 4H9MA 4KWOA 1Y7VA 2WVSA 3ZFHA 2GUBA 3WNMA 1CBGA 2E1DA 2RGMA 1XRVA 4RNFA 1RBAA 2BOGX 2EHHA 1H0GA 3MW7A 3L5LA 1ZU8A 3EXSA 3WF4A 3S3GA 2EXOA 3UZXA 4XB3A 3G22A 3S1UA 1AQ0A 4C1NA 1IIGA 1XGEA 2W6RA 5JU6A 2WVVB 4PB3A 4RR4A 2BMBA 1S2WA 2VQUA 4GKLA 1VHNA 1MZHA 4GY0A 2FYMA 3SUUA 2FMNA 4JN7A 4O4VA 1DVJA 4LYQA 2HEJA 1F73A 4WSHA 3IJ8A 2BVWA 2I16A 1ZALA 1XYZA 1LDCA 3UQNA 3QEZA 4G56A 3ZLGA 1E6NA 3FN9A 3U3HA 3RX3A 3S5YA 1EZ2A 1GUVA 3GB6A 3CAQA 5K9DA 3KOZA 4GQGA 1A3XA 1OK4A 1N8FA 4FXFA 2DT3A 3PC0A 3WJWA 3I6TA 3S1GA 2X41A 3E0FA 4N4QA 5LIKX 1W56A 1BSIA 4PMVA 1BF2A 2RH9A 1CXKA 1V7AA 1G0CA 5AY7A 4AZ6A 1TTJA 1YDVA 1R3SA 4G7FA 1TPEA 3EDFA 4FLRA 1UUQA 1W2PA 2D20A 2AMXA 2Y0FA 2C71A 1EOKA 1MFVA 1UUMA 1FWJC 1IF2A 3GY1A 2PDPA 3W70A 4LUIA 4BCEA 2XPKA 2NUXA 4A22A 2VEGA 1EX5A 2QPXA 3XINA 5DEZA 3WELA 5E0FA 1Z8AA 3EWDA 4G2DA 5ENLA 3A22A 2PODA 4IFOA 4X3ZA 1J12A 3H24A 4YJ5A 4UB9A 3I7RA 2ATSA 5FJIA 5IDIA 1E40A 1I2PA 2PTZA 1K9EA 2QCDA 4MZYA 2IW0A 2DP3A 4ZCWA 4ZB5A 2GGJA 2BXZA 2YW3A 1YX1A 2WB5A 3PJWA 2VOTA 2V5DA 5CBJA 1PEZA 2DSZA 3W07A 1TPC1 5DF0A 3TQVA 3NO1A 2FB2A 2C79A 4ZSTA 1MSSA 4DO6A 2P8BA 1MQPA 1W2VA 1JUBA 3IGSA 3HMJG 4DF0A 4ERAA 1YNQA 4RXFA 1DYSA 4MTVA 1W5OA 4NZ4A 2EKCA 4C6JA 3BO9A 3EBVA 3WL0A 4H04A 4QG6A 4ZQRA 4L9ZA 1BXBA 3BGAA 4JQ1A 2GQ8A 1KCXA 1H51A 4UCGA 1W9BM 3DEQA 5DLCA 2ZRVA 3CHDA 1CTNA 1J0IA 1W32A 1LL7A 1MZRA 4UTTA 1ICSA 1A5KC 2VCAA 3ZZ1A 2AGKA 1DJZA 3E12A 4QGCA 3LLFA 2QMJA 3OOQA 4ZE5A 1WDPA 1SZRA 5K4XA 3NVTA 1BLIA 3GD6A 2E67A 3VKBA 1NEYA 3TYDA 1ZCOA 5CKSA 4S39A 4XO7A 4CCCA 4PMQA 2P5NA 3QQ1A 3B8DA 1H7PA 3P6LA 1ONWA 4DAFA 3QGKC 1W3KA 2B31A 1QDSA 2A7NA 5I02A 3TLQA 1KGWA 4GY1A 2PTDA 1IZCA 3GW3A 3UCDA 1MEIA 2VCBA 1I2QA 3PPHA 1KKOA 2XGIA 3IJLA 2J7BA 4TOQA 2Y4SA 2OZ3A 2IPFA 2DH3A 2JIEA 3EWZA 5A8MA 2V38A 4GH3A 1D7KA 2VEFA 4B91A 4PTNA 4UTHA 3BAYA 3NIYA 4LUJA 1O5XA 1TMLA 4PTWA 4Y9PA 4RZ5A 4EXAA 2A0NA 4GFSA 5TNVA 4UBPC 1CXIA 3WQDA 1DWJM 1JF6A 3O0KA 3KL3A 3VGHA 3UPBA 3DC8A 1UQZA 3BUVA 3DFYA 3U9IA 4B5NA 3GRIA 1QWKA 4NP7A 1E55A 3CUHA 1I2NA 2PTYA 1I2OA 3CPGA 5AC5A 3WK2A 5J04A 2UY5A 2OLSA 2Q8LA 1J5SA 3PG9A 2Y70A 3SY1A 4MLJA 2OEJA 1IHIA 2VI0A 1KFLA 4TMBA 2CZFA 2WKLA 3MUY1 4AH7A 4UWMA 1UD3A 3V16A 2BV9A 4I7VA 2VURA 2HTMA 1QOXA 2J27A 1PZ1A 3M9YA 4GZ7A 4FNSA 3S5OA 1U5HA 3EA3A 2C14A 3CXOA 3HF3A 1Q63A 4QEEA 1ZBWA 1YLVA 3N29A 3E0LA 4K8EA 2H6RA 4NY2A 1TV2A 2AAAA 1W1A1 1XLLA 3BE7A 4JR5A 1AMYA 3W71A 1O5QA 3VIPA 2EPKX 2HE5A 4HN4A 2QXWA 1HN1A 4E5TA 2Z24A 2BDQA 1O60A 3GVWA 1VFSA 1S39A 2QCCA 3G0UA 3G1XA 3BMWA 1ZUAX 4N6FA 3DFHA 3AIQA 1FWHC 2P0IA 4H8VA 4JHZA 1R7OA 4WEVX 4HPXA 1JZ8A 1DEDA 2GJLA 5C54A 1O5KA 1K4GA 1X6UA 2OX1A 2ZQ0A 4TO8A 4E2VA 3VNYA 4XZ9A 1C3FA 2QV5A 1WOBA 1OGBA 4CQAA 2J13A 4C60A 3TW9A 2AL2B 5AVNA 3NQMA 4A05A 5BOOA 3O15A 2XWDA 1VFLA 2PRLA 3NCOA 3O7UA 4PTVA 5CPMA 2Z6IA 1TPDA 4WUIA 5JMUA 5M1TA 3W6YA 1X38A 4DBEA 1ONRA 2IKHA 3BAIA 1IWPA 2WYSA 3V0TA 1B5TA 1ZAHA 1BTCA 2GWGA 3I6RA 2EPNA 1HGWA 3RFAA 3TE9A 1XYFA 3DYMA 4UQEA 1TREA 3F5KA 2VEMA 3WZ0E 1JDDA 1FXQA 5ABEA 4PMUA 3ES7A 1J0YA 4AHOA 2OX4A 1V3HA 3GNPA 3T8LA 1LQ2A 1UZ4A 3ITTA 3NNTA 1GGOA 3AYTA 3KHJA 5GVJA 4BZYA 3KBJA 3RILA 5C71A 4S3JA 1VLIA 2TMDA 4QM1A 1REQA 2XIQA 1OEPA 2XIBA 1WKYA 2PU1A 3U2ZA 4DZAA 3WDHA 4ACYA 3CU2A 3SRHA 2PP0A 1VAHA 3RLGA 2H90A 4DUOA 4AHQA 4S3CA 1XRTA 1GG0A 2FZ9A 1XIEA 4HP5A 1AZ2A 3OU8A 3SCRA 1MRAA 3A64A 2GDUA 3PZIA 2NWSA 3QM3A 2FHBA 4DB7A 3QOKA 2Y63A 1JQVA 2WNQA 2YJQA 3JR2A 4BY3A 1NDYA 2C1GA 3BSMA 2DIKA 1S3TC 4KERA 4LXFA 1VJIA 3UR5A 4W8LA 3WBXA 2QDDA 3VOIA 2WPGA 4IMEA 4GCXA 4PTDA 3PANA 3W75A 2PDKA 1LLWA 3FJ6A 3QMRA 2XINA 3HOJA 3ZR6A 5GPRA 4U3AA 1K8CA 3P2VA 4LANA 4F48A 4GE8A 5BCAA 2ZX9A 1B3YA 3F5JA 1J0JA 1GVRA 2ZVIA 3S2MA 3FYOA 1AH4A 5D9MA 1Q4WA 4W86A 2EJAA 1W54A 4C1KA 2RDWA 4S3DA 3OJGA 1EJRC 5A5WA 3R79A 1VP5A 5CJMA 5MKGA 3VOGA 1W8GA 1JIBA 2YDQA 5EBUA 1XIHA 4ZR8A 4ATDA 1OADA 5FL1A 1NOWA 4QX4A 1E3XA 1KTNA 3KRZA 1BSLA 4CNSA 4HBKA 1N55A 3DFTA 3NDZA 1L2UA 4E3TA 1VRDA 1MDLA 1CIUA 4IMFA 1KTCA 2J7GA 3DYPA 4CN1A 3IV3A 1GNXA 4S3GA 4HOZA 3VGFA 3VCNA 3NQDA 1RBOB 1T8QA 2DZTA 1B57A 4C6IA 2CPUA 4PUEA 1V0LA 1TCDA 1UJQA 4AEOA 3USZA 4ROQA 3NQ2A 3K46A 2CNCA 1F8MA 3DKLA 3CZEA 2IXUA 2VZUA 2PP1A 1NDZA 2V3DA 4ASTA 3E2SA 3O05A 1HUVA 2X0YA 3LQGA 1PJ9A 2F6KA 4L9YA 3WX7A 3M47A 4NX0A 4IGSA 2Z7KA 2Q02A 1J8VA 3VDAA 4PUMA 1TUXA 1B90A 1RD6A 2DEPA 1TMHA 2DW7A 4IM4A 5HDRA 4BFAA 1NQ6A 5CZKA 3IGXA 3VIOA 4HYRA 5DCDA 3FGCB 4X63A 1P48A 2ACUA 2A7RA 5EMLA 3VNLA 4QITA 2CLPA 5D2TA 1TZ7A 4UMBA 3WD2A 2EPLX 4PMJA 3CAVA 3UJRA 1E6QM 3SECA 3PBUA 3BDKA 4OGZA 2OT1A 2D3NA 3N6JA 4UXDA 4HHMA 2PWFA 1VPYA 4TVDA 4PODA 1GEQA 4OKDA 1AQFA 3ZIZA 3AIWA 2W4XA 2QCHA 3CL6A 1YDNA 4HZ7A 2W62A 4EXQA 5M03A 3WCZA 3GUWA 1J2BA 4TUFA 3CZGA 2QJIA 3S2JA 2WZHA 3RHGA 3JRKA 2D69A 1TRDA 3SDOA 5T9CE 5CPOA 2GSHA 2IQTA 1LCOA 4HK7A 1XYCA 3WLIA 5JBFA 5D9PA 6CGTA 4NYUA 1KFBA 2X1RA 1MQRA 5FIPA 5H8PA 1OHLA 1Q6CA 3CBWA 4DJEC 4A35A 3O6CA 4QE5A 3DHFA 4P8WA 1QO2A 3B0UX 4LSBA 5D33A 3QR0A 4TIMA 1L6SA 5TF0A 3WLLA 2ZX7A 1ZQ5A 4UZUA 3FCPA 1T5AA 2Z4GA 1CGVA 4GWEA 1XLBA 1JZ4A 3NL6A 3QPZA 4Q8WA 1ZB5A 2OYLA 3KOYA 4GIRA 1PWMA 5F1VA 1TJ2A 3O16A 1KLYA 2ACSA 3WUEA 4C1LA 1BKSA 2ZUSA 3EXTA 2RDUA 1V4YA 3GTHA 2F6UA 4CD8A 3GC4A 1VKFA 3CEPA 4EANA 1UKSA 3ARXA 4OWGA 4MNKA 1KM1A 3B03A 3LNMA 1I8JA 4EF9A 3NEVA 1W91A 3OYZA 1OFDA 1AD4A 1EJSC 4PFMA 3DG3A 2AAMA 3KOWA 3K4DA 3TW7A 1XIBA 2NQ9A 1OT1A 4GC3A 3STPA 1JDFA 3P8IA 3EX3A 4DELA 3L4UA 4QJ4B 4Q8PA 3HMCA 4W85A 2VGIA 1TV3A 3W4RA 4ZQPA 1GJWA 2Y5EA 4J5NA 3AQUA 3NZRA 3SUWA 5HK4A 2X7VA 3O2LA 4PL2A 4D8AA 4FIRA 4R5EA 1VH7A 2OYMA 1Q85A 5I78A 4UC5A 3RX2A 4U2ZA 1CGXA 3B0XA 3I3DA 1W5NA 3GFXA 3IVUA 2V63A 1PIGA 2XN1A 3LI1A 2BHYA 3AUOA 4HMDA 1VCFA 5GNZA 3QKZA 5JIPA 4ZMGA 3L21A 4ADSA 2OODA 3BLPX 3MO4A 1DHPA 3OVQA 4MPQA 2X8RA 3NZPA 3C0JA 3LCLA 3CMFA 3TZNA 3NAVA 2EF9A 1EFZA 3ABZA 4GUHA 1E0WA 5AC6A 5F1UA 4LUTB 3CTTA 3N2MA 3S4TA 4A6GA 4DF2A 1W1VA 5FF2A 1MW2A 2INZA 2WMGA 4IH3A 1XDLA 1I1XA 1SGJA 5FA5A 1GTHA 1M68A 1GCYA 4G7EB 3AJXA 2WANA 1QT1A 1JCMP 2GQAA 4WHBA 7ENLA 3KFTA 2DIEA 2X7WA 5BMXA 3KTXA 3KVKA 3N34A 1XH2A 3NO5A 3O0FA 3SGZA 4J2PA 3EXRA 4Q6XA 2WW5A 3AHYA 2DY3A 4S2BA 4AF0B 4I9JA 3W7KA 2HS6A 3K4WA 3D3FA 1E9YB 4YU1A 4F0LA 2ONEA 3EOUA 1QNSA 4AZGA 1FFRA 2GSEA 5K4ZA 3PS7A 4HNLA 5EKYA 2OGJA 1UROA 4IP7A 2ZOXA 3ZO9A 1A5AA 4F40A 2OZ8A 4QBXA 2A3HA 1O5RA 2HJPA 3WMCA 4GNJA 1EC9A 4F9DA 3Q37A 3HPZA 4E4FA 4DUVA 3EX2A 5J5DA 2QUNA 5G4EA 3W85A 1EJUC 1EWDA 4YTRA 2DQWA 2HE8A 4CVWA 2CBJA 4PULA 1YPFA 2XH7A 3T9PA 4UTJA 1EOMA 4KEVA 1EXPA 4AVFA 2NT0A 4J40A 1SJBA 4H6KA 3KEHA 1WZLA 3H7RA 2QT3A 3QQWA 1UR4A 4BEQA 2V5JA 4DJED 2BHZA 3BAXA 4DXKA 3QYSA 1M41A 1GKPA 1OK6A 1SO4A 4CVUA 1FY6A 1JPDX 4WJXA 1WKEA 2OEKA 2ZA3A 4Q3MA 3S1WA 2EG6A 1JRCA 3NJ3A 3K13A 4IIFA 1ZTVA 2CLIA 3VUPA 1SFLA 3EOSA 2QCMA 2ZE0A 4EK7A 1XJBA 3WJZA 4YCPA 4WY0B 3UGVA 3P5ZA 3H2NA 1DJXA 4AYGA 3U6WA 1KM5A 1AQMA 4OOZA 3TJXA 4H6RA 3SSJA 2DV0A 1G67A 1IT7A 4C65A 2PEVA 4S3BA 1QHPA 2NQHA 3F4DA 1IXPA 2NX3A 4JYFA 2ISWA 3VMOA 4NAFA 4NX5A 2VZOA 1A5MC 4XKYA 3SO7A 5DMLA 2V69A 3W1NA 2YPIA 3BJFA 3CTLA 4W5ZA 3C0QA 1HKMA 2ZZ1A 3V3WA 1E9IA 3ZVHB 4HNTA 4NQ1A 3LGGA 2WVVA 2E6DA 2ISDA 2PGEA 3WSUA 4O16A 1LL6A 1KR0A 4FX7A 1U30A 2NSXA 2WWCA 2PF8A 3B04A 5MHBA 2Y5SA 1ADSA 1E71M 1XD0A 3GU2A 1XC6A 4LWWA 2ZX8A 3TA6A 2YW4A 4N9CA 3Q94A 4EPKA 1QI3A 4N9EA 4IISA 2Z28A 1WDDA 4XD3A 5HPCA 2C16A 2WJDA 3RO8A 3ANVA 3AISA 3B8SA 4OHQA 3QHOA 4XSMA 3RO6A 1ZAIA 3G1DA 1JZ2A 4LC6A 4WOQA 3KOFA 1EP1A 1UC4A 7XIMA 3L2IA 4L7ZA 1GHRA 3VX0A 1OINA 3WEOA 2ZRZA 4JTHA 3WDRA 3CLWA 4DAIA 4JKMA 2Q01A 5HUOA 2WMFA 4W93A 4QSFA 1Q45A 3QFWA 1ITQA 1UA3A 1TTIA 5CZSA 3KTCA 3APGA 4JNYA 1K9TA 1KBJA 4DX3A 2DSWA 4HU3A 4REQA 3GHTA 2BY0A 4H8HA 3R8RA 4S1FA 1WKDA 4MOZA 3S2NA 3V5FA 5KTLA 4YN5A 2WSQA 5BU9A 2VFIA 2D0GA 3HGJA 4QCEA 1O66A 5LNVA 5A6TC 2ZZ4A 1ZJBA 1NELA 1EH9A 2NXHA 3QR1A 3N6QA 4PMDA 2XVPA 2CERA 2NQLA 5AYBA 4ZBCA 3K8MA 5C2GA 1OFQA 3ZYZA 1H50A 2OCZA 2V82A 2CFFA 4DWSB 4MAVA 3LK6A 4IGNA 1E1FA 1BHGA 2P76A 1GOXA 4GGHA 2Y7GA 3PZMA 4IPLA 3SFKA 3LHZA 3FYYA 3MSDA 3VDCA 2OYKA 1V02E 1QI4A 1Q6EA 3PZTA 2DZXA 2P88A 4CNUA 4JHMA 3U5YA 4BI6A 4R7JA 1QHZA 1M1BA 3D6NA 1E5NA 3TP4A 1OFAA 2BXVA 4KEUA 3W3OA 4GQBA 2G4FA 4ZQNA 3IAPA 3P8JA 1WZKA 4ADUA 3EWWA 1Y8BA 2I9EA 1PX4A 1U22A 4ZO8A 2YXOA 1ADDA 1W3TA 1TPB1 4JIRA 3NQ7A 1SFSA 2PTXA 5LGXA 4DZ5A 3ABRA 3NQAA 4MKSA 3TVAA 5BWFA 3H23A 3WMSA 1EGMA 5AYZA 2WCGA 4N02A 3U48A 2ZUNA 4JTRA 4I8DA 4Y2WA 3NSXA 7CGTA 4GJIA 3A9BA 2PAJA 1XKJA 3I3BA 3RYSA 3KS5A 2PURA 3R2GA 5EY5A 4DYKA 2YX0A 3P84A 1G94A 3ZQ9A 1CGTA 4M1BA 2PDXA 2G0WA 2WSKA 2V5LA 3W2NA 3T0AA 2EAWA 3H2OA 3LI0A 1Q7QA 2NT1A 4LBUA 4YHEA 4D6EA 1LYXA 1PDZA 3GR7A 3KBMA 3WLSA 1JNEA 1TJ1A 3TNOA 2A21A 1B3WA 4XAYA 1BQCA 2OKOA 2O9TA 3D46A 3SCTA 4F2UA 1JYXA 4G1KA 4Q7BA 2ZZ2A 3P82A 2J24A 2DZBA 4XSLA 1HKKA 4XTIA 5DBUA 3VZXA 2DQXA 2PDFA 1TWDA 3GK0A 1BTMA 4AX6A 4GA8A 3WNLA 1JDEA 2QUMA 3G1VA 2OSYA 1PKNA 1C90A 1GVYA 1TB3A 4EPDC 3II1A 4MADA 1YKWA 3VUSA 1BEUA 3T08A 2QJMA 4KFOA 2PD5A 2OSWA 5FF3A 3THCA 4GI4A 1UASA 1N8WA 4L56A 4W5UA 4C6BA 1G5AA 2DGAA 3KAOA 1A3HA 5KITA 1L6WA 1F61A 2WNZA 3L65A 3S9IA 4MFEA 5C8BB 4JQ4A 2QDEA 4HA3A 2D24A 3WIJA 3NTYA 3FVMA 1QTWA 4I8YA 2VZSA 2ZCGA 3IV8A 4H4IA 1BG9A 3LPPA 3BOFA 4MY9A 3CNYA 4ADTA 4LUTA 3RITA 1EKOA 3HPXA 5HMEA 3EWXA 1UBSA 2QNEA 3URQA 4EAYA 3P61A 2FZ8A 1U33A 4QG8A 5J5RA 4DQWA 1SW7A 1WKFA 1E0VA 1J6PA 1R9YA 2OQYA 4CQ8A 3UVIA 4AZ5A 4QE1A 4L61A 1CLXA 2BASA 5G1YA 3WF1A 3L68A 1RJQA 3TYZA 2OLHA 2J9XA 2QS8A 4Y7EA 1I0DA 1J9YA 1DBTA 4JAWA 1DE6A 4A8LA 4M6QA 4NZ5A 1YW1A 3RR4A 2FQIA 2G5WA 1HVQA 4JPGA 2DT1A 1JG9A 5H91A 4KH2A 5C9RA 2ZUUA 4W88A 1TFVA 3VO0A 1I9CB 5BNKA 2D3LA 3W2JA 3ZS4A 5TQLA 3UGRA 4LT9A 1YE4A 2ZRWA 4KCVA 5C2CA 1UPPA 1XBYA 4MZ1A 4H2CA 4MAZA 3ATYA 4XZMX 3ZLFA 5XINA 2ZX5A 1IE7C 3UG3A 2YFOA 3LV6A 3LLXA 1SPQA 3P93A 1A3WA 4ZB2A 4F66A 3UA3A 4P7NA 3RRAA 5CJ5A 4PTMA 2D2GA 4ZOAA 4BK9A 4IJRA 3N3TA 3AZRA 1VBHA 2CITA 1LRTA 3R89A 1M7XA 4OUIA 3PFRA 1PTGA 4W89A 3N1AA 4G6CA 4L6OA 1JD7A 1B54A 4WZHA 5CCZA 3TSDA 5HNRA 1XR2A 2HPIA 4FXJA 4RDWA 1C29A 1JCNA 2H8XA 4QCFA 3T4WA 3QZAA 2H9AB 1J96A 5ECVA 3W7PA 1W31A 1RCOB 2VWSA 4ZA0A 3TMQA 3BZGA 1G4TA 1H3GA 1QW9A 3SADA 2BTMA 2PDNA 2XSXA 3LS9A 3BMVA 3P5YA 1UD2A 2G97A 4QE4A 3TH6A 3POHA 3W1LA 2QJHA 3CC1A 3U2CA 3P7YA 1WX0A 1M3UA 4UTMA 1P5BA 3ALFA 3MBFA 3W26A 3L67A 4A8RA 1C8QA 1X8CA 2WBKA 4OVXA 2VWTA 1W37A 1WDSA 1MYRA 3FSUA 4LYRA 1UWIA 1VBUA 4DNHA 3TSBA 1JFHA 3AIRA 1RBLA 1UWQA 2QQ6A 3VGGA 3VKKA 1SSGA 3RCYA 3WENA 5D02A 3IJ7A 1KM6A 3UG8A 3DYOA 4KCUA 3S5SA 3W29A 1LBLA 2PDHA 3CB3A 3O1NA 3BARA 3QBUA 3USBA 4ZZ9A 3BCDA 1DJNA 2C91A 3TNBA 4GNVA 2PC8A 2C18A 4C6NA 1C93A 4DPPA 3DFNA 4AZIA 5C5YA 1XGDA 1EF3A 2XUCA 3HQNA 3N4FA 1XKYA 2PWHA 9RUBA 3EAUA 3SUTA 1LZOA 4H7ZA 3B9DA 5EL1A 4MPKA 3W38A 2WJEA 1LG1A 2OELA 3C2RA 2Y5JA 3H2MA 4PE8A 3WNPA 1ITXA 2V3EA 3QJAA 1QNPA 2NXGA 2WHMA 3Q2DA 3P60A 1JCXA 1YDOA 2QUVA 3KW3A 1P6WA 4EXBA 1JCJA 1LUCB 2WQDA 4Q32A 4UNLA 5CLTA 1PCKA 4ZO7A 1I75A 1FWNA 4YHGA 5FJUA 5A2AA 3PJXA 2E9BA 2ZA2A 3IUHA 2YR1A 4L1GA 1HO1A 3MJYA 1NSJA 4FOUA 3OZYA 5L9FA 3V1PA 1EDQA 4QFUA 3QHNA 1OFPA 2IS7A 3GU9A 4NSBA 3QPYA 1V8EA 3GXNA 3SR7A 2Q71A 3TDFA 1QFEA 2CLOA 2PWVA 2G3IA 4Q8MA 2PDQA 4XBSA 5HQMA 2QKFA 3W7GA 1JCYA 2INFA 3W82A 4Q4KA 3SCSA 3OLIA 4CQCA 1GQJA 3A3WA 4FNQA 3MUXA 3T2OA 1FCVA 1EUNA 5FKYA 1YHTA 3FSTA 2PDIA 3MUZ1 3G8EA 1P0DA 1Z9AA 5AHMA 3SY5A 3CWHA 3TONA 1XRSA 2R91A 1NWTA 4IMGA 4U33A 1DIDA 2LLEA 4HA0A 2HBXA 3THUA 4L1WA 3XISA 3CWNA 4PCTA 3W88A 3T6CA 2UBPC 4GFIA 4PB5A 3CHEA 2G95A 3GX9A 3C8FA 2E0PA 1DJWA 1UWAA 4BWLC 1C7SA 1CI1A 4LAKA 3G0SA 2PD9A 3V1HA 3DBPA 1ADOA 1TIWA 5LA1A 5LIXX 1JULA 2BG5A 3NXFA 4DBWA 4ZSUA 4JX4A 4HB7A 3DHDA 2BVTA 1QI2A 4JIHA 2PCQA 3N15A 5HR6A 2VD9A 3WJYA 3L4ZA 3NQBA 1E15A 1A5SA 2QIWA 3U57A 1NWRA 3W7LA 1JF5A 1FWBC 3U4AA 3M0ZA 4FX6M 5AC7A 2VC9A 1GQLA 4H7CA 2V2HA 3H2FA 3W23A 1PE1A 1FWSA 3LENA 1C9DA 4NZCA 4KWSA 4OBSA 8CGTA 1F6YA 3HG4A 3R4IA 4QQUA 3AWOA 4BF7A 2O7QA 1CXLA 3LY0A 1EJWC 2ISFA 1UH2A 1HX0A 3TCEA 5EA9A 5EBAA 4H8UA 4MWAE 1MDRA 3K8KA 1NU5A 3WNKA 3QC0A 1ZPTA 5JBDA 4JTTA 2WKJA 2D22A 3WD1A 3WLTA 1WB0A 3RCNA 4XZIA 4AIUA 1EJVC 1W1TA 1O95A 2ZIDA 4G5DA 2A5HA 1XV8A 1XYAA 4NZ1A 2I9UA 3HFTA 3LCXA 4HTBA 3LHVA 3GW0A 5ABTA 2SFPA 4AUBA 4FXSA 4TV6A 3QV6A 2NX1A 4JTDA 1K7FA 1PIIA 1US0A 3GC5A 4JTCA 2G96A 2ZXQA 1TWIA 1SSDA 1U83A 3I7SA 4KEMA 3BLDA 2XVNA 2RJGA 2WK2A 1H61A 2X1UA 4W4QA 3N9KA 3BW3A 4HPNA 4GOAA 5BMWA 1EDTA 1OG6A 4X9YA 2A7PA 3K1GA 1XH0A 4LEQA 1E6ZA 3B97A 1VIWA 2VFEA 2YA1A 2D0FA 1U1JA 2BXYA 4AWEA 2DFAA 2P53A 5LXXA 1W5PA 2ACQA 4WVXA 3AU6A 2I14A 3S47A 4WXYA 5A6KA 2FVMA 2EQDA 1UOZA 3SSZA 4KEZA 4JD4A 4QNEA 5JQ9A 5K2ZA 4OT7A 1VCGA 3AI0A 1LM1A 4IX0A 3G77A 4CNPA 2VMFA 2GFTA 3CIVA 1PCWA 4BQ2A 3KXQA 3LCIA 4XISA 3AHTA 1O68A 4B90A 4XIAA 2YCJA 3UWZA 1LT8A 3H22A 2QJGA 2EKGA 4J9JA 1WV2A 2VVNA 1DJQA 3LN3A 5CBBA 3G6MA 4F79A 4O0QA 2FDMA 3VNZA 1OIMA 4UQCA 4B5SA 2O4QA 4DXVA 1TV7A 2HSAA 2DSVA 4U28A 4X0NA 1C9WA 3C2OA 3BQ5A 3G3MA 1PTDA 4Z2HA 4KMQA 3HGOA 3F03K 5BXTA 1MW0A 4NYYA 5CC5A 3HURA 2YXGA 3NQVA 3IS4A 2Y8UA 4YVPA 3VNDA 5I3IA 1JGMA 1J2WA 2PLMA 3IARA 3U2EA 1K7EA 2REQA 3LDVA 1XLIA 2ZRUA 3KP1A 3MI2A 4HZ6A 1UD4A 3A4XA 4P8UA 1EEPA 1PBGA 2W5FA 3UXAA 5G2WA 3EA2A 3S5NA 1THFD 2YZRA 1DJIA 4ACZB 1HZYA 4MJ2A 2ZRYA 1P6CA 5FJTA 1ONXA 3B0VC 4GZJA 2R1LA 3PULA 4BJHA 3BICA 3F2CA 2ZUWA 3G1SA 2ON3A 4P7QA 1W0MA 3W7DA 3ZXWA 1C8XA 5BRPA 1H7XA 2PI6A 1KO0A 1V77A 3VC6A 2OOGA 2OWXA 5I7GA 1XLAA 2BY2A 4X60A 4GZEA 3IIZA 2QCDB 4E8GA 4QQ3A 3MMWA 2GZXA 3V75A 1HFBA 2HQAA 2BBFA 4GVHA 2NSOA 1UZDA 4S3EA 2OZTA 2A1YA 1M5WA 5C9ZA 1FWRA 3FA3A 2A2IA 4JNZA 2PGRA 1UG6A 1M04A 3MY9A 4EOUA 4ZE4A 5I24A 1BYDA 2G3JA 5I3DA 2XHYA 4RXGA 4HCLA 1A53A 1BWKA 3QXBA 4JIIX 5BRBA 3DAQA 3MVTA 3WUBA 3P0WA 1V3JA 4XD5A 3O07A 1SR9A 4HD5A 3T81A 4JNMA 4R27A 5LGZA 4Z2LA 1BKHA 4PCPA 3C56A 5BOEA 1XI3A 3AS3A 3DGRA 3A3XA 1MEHA 2WKGA 3ZSSA 1YADA 4FXRA 4JDBA 1EDGA 4D6GA 2UY3A 4MLRA 1ZHAA 1GORA 1R86A 4KKXA 1IQ8A 1HTIA 3S9YA 4YVVA 4R88A 1A50A 4CD7A 3PTKA 3ITGA 1H7WA 1DIKA 4JFTA 2PBGA 1BG4A 2CLKA 3EPMA 2ZZ3A 3IACA 3MUCA 1U2YA 3HPAA 2HNEA 2RFGA 4Z1BA 5DRCA 3UP8A 4EPBC 3OZMA 4W8BA 4LVBA 3DN5A 3SCPA 4C6DA 5F2IA 4NKCA 3GKAA 2PE4A 3HTWA 1K6AA 4O57A 5E70A 2QMKA 1XBZA 4I3GA 4QAWA 3B0YA 4WLCA 2GUYA 2OJPA 2V30A 3NOEA 1R9XA 2VDHA 1AUSL 3PM6A 5H6HA 4K2SA 5LYRA 1J0ZA 1Z32X 2V9DA 2WMJA 1RP8A 1K9FA 3GZ3A 4POCA 1IGWA 3WG6A 4JTJA 3T2QA 3B40A 3LMYA 4CQDA 3ELFA 1ZP3A 2GGHA 2ZC8A 1LL4A 3A5VA 1GVFA 3PP7A 5AC8A 3PAJA 4AG0A 1I1WA 4FO4A 3B8TA 4C6PA 5KZEA 3F4VA 3AHVA 3DFQA 3ZJ8A 4YIWA 3UZWA 1CT5A 5REQB 2D23A 3NL3A 1BGGA 1J79A 3ZWSA 1XCWA 3PVFA 3ZT7A 4HPHA 3RUBL 3CASA 1B3OA 2YL8A 3GVGA 2CEQA 2Q3OA 2J75A 2Y7DA 3WLOA 2QCEA 1Q6OA 4A3UA 2OMAA 1FWIC 1SW3A 3QKEA 2IQDA 3L2MA 4E4PA 1FA2A 1TG7A 3TAKA 4DXXA 4PMZA 2E5BA 3GXFA 3MANA 5ABFB 3UESA 3AYSA 1HF6A 3NSNA 5EMYA 1XFBA 4HU4A 3WH9A 4N4PA 1UMYA 2OFJA 3IJQA 5D30A 1SJDA 1XWYA 3IGUA 3EOLA 3OIHA 4Q8VA 3T07A 4KRTA 3T05A 4WXZA 3WQEA 2E8YA 4F0HA 5M5DA 3ICJA 3EOEA 3NDOA 2VGFA 1GWJA 5DXYA 4GPNA 3W7HA 3P62A 4RPQA 1TJ0A 1MWOA 2JALA 4GACA 2P1FA 3QY7A 1MXDA 2WC4A 3ONCA 4RK8A 1FWTA 5HNTA 2B7OA 3AMKA 2HROA 3E0VA 2Z1BA 5DT7A 4JTGA 2HCVA 2W91A 1MMFA 3CHFA 3K30A 4DM2A 1GOIA 4O17A 3L4WA 4R7WA 4IZGA 4P7LA 4KW2A 3Q58A 3A5FA 3T55A 4IJBA 1ZBVA 2H9AA 4JX5A 3QR3A 1IIHA 3VDGA 4MB1A 3ZR5A 2VC7A 4GYKA 4CCEA 3M0JA 1F9CA 4HHLA 5IFTA 1VPQA 1AVAA 2C0AA 4IJCA 3JS3A 5C70A 1V6YA 1GVSA 3IIOA 1W3LA 4DBUA 2Q8ZA 4V2XA 1XRFA 2QW5A 4TMCA 4QLKA 1ICQA 3MYPA 2FJUB 1OF8A 1TKKA 4JL2A 1GYLA 4GQRA 7REQB 1E0TA 4BS0A 3WQWA 4UFIA 1RZMA 4GCAA 2HPMA 3FK4A 4B2DA 4ICMA 4YMZA 3BV7A 2J8FA 3HQ1A 2PZ0A 1E1CB 3SM0A 2GDQA 4DJEA 1X7FA 1PV8A 2GOKA 3NPUA 1E51A 1Q5MA 4UIOA 1K02A 3I3EA 4IGMA 3TJ4A 1NH6A 4Q8NA 4RDVA 4R53A 2AKZA 2YYTA 4RNIA 2V2DA 5C7VA 1LQAA 3KVJA 3A4JA 1Y5VA 3C2FA 5BRQA 1TX2A 2VD8A 1HO4A 4PSRA 4DBSA 1EGZA 3K2GA 3OG3A 4HZ8A 5LIUX 4BWLA 4DLFA 3RM8A 2CZVA 4AIOA 1TVPA 1VEMA 3HA1A 3CUGA 4WY0F 3T2PA 4MSSA 4JGDA 3ZLHA 3KRUA 2FZMA 4F2BA 2NLYA 4MUPA 1FHUA 2X16A 2FB3A 1XIMA 1AJ0A 1GYMA 1GZ1A 3ZWTA 3LGDA 1NF0A 1RXOB 4DLMA 3VIKA 1O6IA 4WRHA 3BQ6A 3NQ8A 2UV8G 3VKDA 3QLDA 2X2YA 1W9DM 4JZ5A 3C8NA 3GXTA 2BX7A 3QTPA 4BI5A 4Z1DA 4MY8A 1Q3NA 3EKZA 2CBVA 3RLUA 3W1RA 4B5UA 3HPFA 1TWSA 1WDQA 3TC3A 1YNPA 5BZAA 3EX1A 5IBXC 2FPVA 3KCOA 4CD6A 9XIMA 1MUMA 4IMDA 4O1AA 4AD0A 2CBUA 4YTSA 3VGDA 4TR9A 5I00A 3W28A 4HNVA 3G2GA 4J4KA 5LKYA 1X1ZA 2D73A 3LHTA 3MYOA 3CEUA 1AK5A 3KRSA 3QMTA 3FXGA 2XVKA 3CT7A 4FF7A 3G24A 3OODA 5AC4A 3O6AA 1FDYA 1LORA 3GBDA 3T0BA 8XIAA 3OLDA 1QWGA 1UJPA 4O13A 4OBRA 4LJ3A 2FTPA 3BC9A 4Y9NA 1CXFA 4C6MA 2BSLA 5I09A 4AEFA 3BW4A 4C6OA 4Q4OA 3FLUA 4C5YA 1XIFA 3TR9A 3I4EA 1JNDA 4WK9A 3AMDA 3U2OA 3SUVA 1B3VA 3ARPA 3GG0A 1KFKA 1G69A 1BVWA 2DU2A 1Y0EA 3BPWA 3MUIA 3L0GA 3FKRA 1YXYA 5EMKA 4CNNA 1KFEA 4HOXA 4D8LA 1T99A 2HNHA 4KCWA 1UR3M 3PZGA 4JEQA 3CZJA 4NZ3A 5BW6A 3VIFA 2A6LA 5E09A 1U1UA 1ENUA 1XHGA 4O15A 5G2IA 3ITVA 3AC0A 3BH4A 3QSRA 4O28A 3VVGA 1G01A 2HBVA 5ABGA 4GABA 4U31A 3T4CA 3NOYA 5A3HA 2BGSA 2E4TA 1KBIA 3CUJA 1HGYA 5C9XA 1UC5A 4MWAD 5A8OA 5FSEC 4H6EA 3W6MA 3JW7A 1XBVA 3OB8A 4GO9A 3UF9A 3EB2A 3K1DA 5F4SA 4LS0A 3GVQA 3GNOA 1SFTA 3S42A 4LTSA 3WK0A 3STEA 3UETA 4C6CA 2CKSA 1PHQA 3ABSA 4J3SA 1PWLA 3A21A 3NPXA 4EKJA 3CUIA 4IPNB 4AD2A 1WE5A 3WLJA 3TWBA 3WFAA 2Z27A 4LCSA 1C91A 3WUFA 4UQAA 1H7OA 1GKQA 1PX3A 4MYAA 4M29A 4NHVA 3WDIA 3EDKA 3QGAC 4U3CA 4MVAA 4Y9OA 2BGQA 1R3VA 3WQCA 1KGXA 3MMUA 3KL0A 1MRQA 2YA2A 1TPUA 2XSBA 1J6OA 3G5EA 3UCCA 4JHOA 4PBGA 4BI7A 3ZVIA 4R9OA 3ZJ6A 4AY8A 3MB9A 1IWAA 3KDOA 4XV0A 3VKAA 1WDRA 3IJ6A 3GM8A 1OCJA 4WOZA 3ZT6A 2QCFA 4XVEA 1W6TA 1GVQA 1UKPA 1K1DA 3CIWA 4MY1A 4N42A 3LYEA 2Y8VA 1W1B1 3AMGA 4HTYA 5BXPA 2F38A 2WNNA 1A4LA 4QR6A 3GTXA 5F7UA 2PRHA 1YNYA 4H7VA 2Y8KA 4LYPA 1PHWA 2CKRA 3DKJA 3O8AA 3EMZA 1S5NA 3ARYA 5C0QA 3KP0A 4J3WA 4L4LA 3TXZA 4Q8OA 3ANYA 4O54A 4AY1A 1PKMA 4E2DA 5KETA 4LALA 1FP8A 2QULA 1Z7AA 2XFFA 5HOSA 1V0MA 4AAJA 5FF7A 3TTSA 1TUFA 3AXHA 5FAJA 1D8CA 3WLPA 2VCCA 1YPIA 3QH2A 3N25A 3UEQA 4QDPA 1K8XA 1TVNA 4Y96A 3PF3A 4IPJA 1XG4A 3LZ3A 2Z1WA 3V36A 5CGMA 3GH5A 4RDZA 4DWSC 3MMDA 4RCXA 3I4KA 1BYAA 2FGZA 1EZWA 1TPH1 3SBFA 1GK8A 5IXEA 1LRNA 2VDIA 3GE7A 4XKYB 4REQB 4H9UA 4B9ZA 2OEMA 3VA8A 2W27A 1HXJA 1KFJA 2HK1A 3PSWA 3KE0A 3EDEA 4IP4A 1WZMA 2DH2A 4O10A 1DPMA 7REQA 3V4BA 4MUZA 4TX8A 2J79A 4IWWA 3M5VA 5CPLA 4JQ2A 3WD0A 4YTUA 1JCLA 1QHOA 3LHWA 3DG7A 2JKEA 3BW2A 5BWAA 3U7BA 2BY3A 2EBNA 2DPEA 3KM8A 1E72M 3R1ZA 4LC8A 1YRRA 4G1NA 3NL2A 2HV5A 3NXLA 4URIA 3WF0A 3W86A 1EHAA 1EHNA 3QPEA 2PDGA 4UQ9A 1IEXA 4PFHA 1DOSA 2ZUVA 4JEJA 4D6DA 2VM8A 3G18A 5A1AA 4KQNA 5I2UA 3LCGA 3MTWA 4CU7A 4Z2GA 1QPRA 1JPMA 2ALRA 1NP2A 1AW1A 5FJOA 2GGIA 3CHCA 4D6IA 3M5ZA 2QHAA 3GC2A 3GFYA 3ITLA 4W8AA 1JVNA 2ZDRA 1LP6A 5HATA 4GG9A 1IXNA 3UWYA 2CESA 4NUWA 1E0XA 3PWIA 4YL2A 8TIMA 5LIWX 1KV8A 3NYZA 3IJIA 4HKPA 5FEXA 2FKPA 4K38A 4A3HA 3ITOA 3RMEA 1OX5A 1BQGA 3V0UA 1VFHA 3AMLA 1KA9F 3T1GA 3WDJA 1WOAA 1VBGA 3TKFA 4GGBA 4UTLA 4LX4A 1Q8JA 4AD1A 3N2OA 4DJDD 4X2PA 3E5BA 1K70A 3EWYA 4AD5A 5G1TA 2XZ9A 2Z26A 4HCHA 2Y85A 1P0BA 1E1CA 2DSKA 3E0WA 5CAHA 2W79A 4CN4A 5EGRA 3VABA 1VYRA 2F2KA 4GUIA 4E4UA 4NXKA 2X2GA 3OHMB 3G0XA 3BTNA 3AJ7A 4WCJA 4ZO9A 4K68A 1B2YA 2G4JA 7A3HA 1TV4A 4AFYA 1VEPA 3GLCA 3NPWA 1NARA 2ACRA 2PMQA 2YFNA 1XLGA 1R30A 1JGIA 3W2LA 5H8UA 3GWQA 3UR2A 1EBGA 1R87A 2NV9A 2C3ZA 1ZJIA 1EO7A 2P50A 4BHYA 1MW1A 3QYQA 3AFBA 3HQPA 3ERPA 1P4CA 1SU5A 4KWWA 3PUDA 1TQJA 3MHUA 3TFXA 1QAPA 1F6KA 3BXWA 4ERIA 3OBKA 5CSUA 2Q09A 4OTKA 2OPJA 3PNUA 1EIBA 1S5TA 4A3QA 4O50A 1F76A 4E8CA 1IT8A 4MJMA 1SM9A 3MI6A 2JK2A 4UMAA 4Q8TA 1H1NA 1EUAA 1K3UA 2C15A 4GBUA 2QR6A 4I6VA 4UTKA 3FA4A 1HL9A 4GLEA 4Z1YA 1E0UA 3CHVA 4HHPA 1HJVA 1KV5A 2Z7GA 4GYPC 2E68A 3LHYA 1G4PA 4B5VA 3NGFA 3GS6A 3QY6A 3EB4A 1RP9A 2J25A 3UWWA 3TU9A 3SIMA 3PBGA 4OU1A 4D8ZA 4K7YA 3PPCA 4L1XA 1SMAA 4N7QA 4I5XA 3RAOA 1HKVA 4IUGA 2I17A 2X42A 1RLCL 3URNA 1V6UA 2FGBA 3EX6A 2VFHA 1A5LC 4RUBA 4EWND 1QR7A 2VOMA 3TYEA 1R38A 3GNXA 1XLEA 2EPOA 3LSCA 1UQYA 5AHEA 4AMAA 4DEFA 5A6BA 2ISSA 1Q6LA 1YYAA 1UHVA 3WK3A 2OT0A 4JYDA 1V79A 2E9LA 3LHUA 5A6SA 4IP5A 1BD0A 1TJPA 2DUAA 3S2LA 2P3EA 3ARSA 2PZNA 4N0RA 1XQKA 1F05A 1UWUA 2QV4A 4M3PA 3TROA 3KVLA 3RN6A 4FNUA 2YLAA 1FWWA 2NUYA 4OV9A 4GQ0A 3NG3A 3MS8A 5CG7A 5FSDC 4NJHA 1A80A 3ARVA 3MSYA 3MBDA 1QATA 5B7YA 4D6HA 1A5UA 2QF7A 1H0IA 4TV5A 1QBAA 4L6HA 5LNRA 4V1XA 3UZ5A 3EKLA 1XFCA 3VC5A 8XIMA 3M1ZA 3H53A 1CXHA 4LV4A 3WH8A 5IHSA 3JU2A 2VTFA 4O1BA 3L0NA 4M24A 4QG9A 3R13A 3IVSA 1WAWA 3CH9A 4FIQA 4YYCA 5B80A 1GJPA 3W2KA 3DFSA 4ZFCA 2ZXAA 4IT1A 3GXMA 3BLOA 4AISA 4AMCA 1XIGA 1YXCA 4C90A 1FCUA 2F8QA 3FV9A 3HFYA 1XDJA 3L4XA 2GUUA 5D4YA 3L23A 3CPUA 4KCTA 1VYPX 4UTTC 3GNDA 1HW6A 3EWBX 3BCJA 5EMUA 4L80A 3HG2A 2ZXBA 3UWUA 1X8FA 4UFLA 5D37A 4DUXA 4DN1A 3PZVA 1TVLA 1PUDA 4DWSA 3ARQA 1DQWA 3G1YA 4M1RA 3ZOAA 1VC4A 2Z2BA 5KZ6A 2Y61A 4J7RA 4EF8A 3S2CA 2XM1A 1QNQA 1LWHA 3CAKA 1GOOA 1WXZA 5C9UA 4GUFA 2R8WA 1CDGA 3CZLA 3H2CA 5DMNA 4B2DD 3GSMA 4XKMA 1UB3A 3TQ0A 1VIZA 3DIPA 1NOUA 1QI5A 3EWUA 3VNIA 2WZTA 3PTQA 3QHMA 4JTLA 4XWUA 7TIMA 3PBVA 5CEWA 4B5TA 3AXMA 3SQSA 4X9SA 1PVNA 1IR1A 4ROPA 4U5KA 1W9UA 2NQZA 1RY0A 3PSVA 5AHFA 3F4CA 4FA3A 3TQPA 4ILSA 4C7DA 5TD4A 4OJYA 2XWEA 1X1NA 2PWDA 2GLKA 1X6LA 5T91A 3AHXA 1FDJA 2XH2A 4M7SA 5CPTA 4PMYA 1VPXA 2DJLA 3RU8X 1CGWA 2GPTA 2ISVA 1XLCA 3THDA 3P14A 4UR8A 2OO0A 4J3UA 4S38A 3N4AA 1P1XA 3PN8A 2TAAA 1J5TA 4R33A 3B9OA 5H2ZA 4MNMA 5A6AA 1A5NC 2DVXA 5ECUA 3VM5A 1BXNA 3W87A 3ALGA 4N9BA 1Q6RA 3M0KA 2D0HA 1QASA 3U8GA 1Y5WA 4LB3A 5LNSA 5CC3A 2RUSA 2MUCA 4E3VA 4JFUA 4IFRA 3GDRA 1L6GA 3TA9A 1QU4A 3FAWA 4GYFA 3UD6A 4K1GA 1SQ7A 3IJDA 2L5HA 2XVLA 4XAGA 1EYEA 2WQPA 3S1XA 4JKLA 4O11A 3VU2A 1HG3A 1Q6FA 1X98A 2ZUMA 3M41A 4PYSA 1HKIA 3GAYA 1BYBA 4Y6GA 1RALA 4JN8A 2J4GA 4XZWA 2BVDA 3NVDA 2AL1A 4JTKA 1IXQA 1WBJA 3NM1A 4YXGA 3NO3A 4K36A 2QEZA 3AICA 4UUIA 1V08A 2VR2A 3P80A 3MI3A 2VGGA 1JEZA 2VRQA 2BS9A 2G41A 2XIOA 2ALDA 4XTDA 3RPTA 3IEBA 2FFCA 1BWVA 3AHZA 3WLNA 1POJA 3QV8A 3ANUA 2QCLA 3NGJA 4HNNA 1F74A 1J0KA 2XDFA 2J7HA 4IFKB 4ZQMA 4GI6A 1US2A 5HUPA 2IMRA 2GJPA 4F9JA 1RQEA 3Q4DA 4MNLA 1H1YA 1PDYA 2JQXA 2CLHA 3GR4A 1GKRA 3L0KA 3C6CA 1JDCA 4LBSA 1BF6A 3W7NA 1QPNA 1TE1A 1M03A 3CJPA 4ZQCA 1K9DA 1P7TA 2YBTA 4PMNA 1W9XA 5A95A 2B81A 3P81A 4RE0A 5LSMA 3W2UA 4CQBA 3PWGA 1ZCCA 4FI4A 1UP0A 2OU4A 3W02A 4QJ5B 4DI8A 4C1NB 3N17A 3WDPP 3BLLA 1REQB 4UTIA 3CQKA 3MKKA 4ZOCA 2J8TA 4KT2A 1JRBA 1R5YA 5AHLA 3LRKA 1V3LA 4NASA 3SRDA 1C7TA 3WFLA 4UFMA 3EMCA 1OSEA 3IJ9A 3WH7A 4WJEA 2QAPA 4AQLA 4RW5A 3ZJKA 1VFTA 3PNZA 3QF0A 1RCQA 2G37A 1TV8A 2WM1A 4GIYA 1DE5A 1R2SA 2WC7A 5FL0A 3E74A 1XICA 2I56A 4HZMA 3RG6A 1XPGA 1P7TB 3H8AA 1M53A 3LPOA 2ZX6A 7PTDA 3N11A 1KKRA 1M65A 4W84A 4LCQA 2DDXA 5HULA 3UW6A 5E0CA 1DQUA 2E28A 3LTYA 1A5OC 3AUJA 2I5IA 2E6YA 3QLLA 3VOHA 1NQKA 3SUSA 1ME7A 1UBPC 1UWSA 5IHRA 1KWKA 2XM2A 4DJDC 1IEIA 1G7VA 1FFQA 1BVNP 2A6NA 3VMPA 3A3HA 4YPJA 3TYUA 1CYGA 3UJ2A 1OC7A 3EKGA 4RL3A 1RD5A 4HK6A 3DENA 4IG2B 1HQTA 3GFZA 4PRTA 1RK6A 2ZZ6A 1KW1A 4CEUC 2ATMA 2W67A 1RVKA 2Y89A 4LH8A 4OV4A 3TYAA 2J7FA 3GG1A 1XLMA 2PBOA 2O0TA 1K4HA 2DORA 5T9BG 3NFUA 3WQPA 4AZCB 1OGSA 2QUTA 3UFYA 4Z2KA 3XIMA 2CWNA 4INFA 3P0XA 2V6AA 3SW6A 1SZNA 4MKVA 1TR1A 3AIVA 1PS9A 2J9ZA 5TIMA 1EA9C 2C0HA 3THAA 4FNRA 5JIWA 4QTGA 3IGHX 1M9HA 1K8YA 3GO2A 4K39A 1GOWA 3B3DA 5ABHA 4W7UA 4KBXA 1XXXA 3KBVA 4H41A 4N2YA 3VCRA 4M8UA 3MUAA 3WK1A 4IQEA 2VXNA 1GT8A 3BGJA 1T96A 2DUXA 1XBXA 1ITUA 3VD5A 3SN1A 3FXYA 3DFPA 4RE4A 5CGQA 1Z48A 1T6MA 4K7VA 4S2CA 4GVGA 1DJYA 1POKA 2ZADA 4WY0A 5CPQA 3IPWA 3PTDA 4ZOEA 1OFEA 1XP3A 5D2XA 4QXIA 4R85A 5E1QA 1XSIA 3RMJA 2X0SA 4HPGA 4KIEA 5GJMA 4D1IA 3NPVA 4IOTA 4E6MA 2GOUA 4MB5A 2JIWA 4AU0A 5HANA 1Q8AA 2NVAA 2XIIA 4LQ1A 4FZIA 1RY8A 4JS3A 2GQ9A 1E56A 3AXIA 2F84A 4MWAC 1AD1A 1E6XM 2VJXA 3S6DA 4EX4A 3F4NA 3TZFA 1TCMA 4KWUA 3O3RA 2V5BA 2VP8A 3MU7A 2YDRA 5KZMA 2V68A 1XD1A 2O9RA 4XVDA 3GDBA 5SWUA 1YQ2A 3REQA 2CC0A 4H9XA 1Z42A 1P6BA 4XAPA 4F3HA 2OR2A 1H62A 2KZHA 1XYMA 4WD0A 2TODA 4V1YA 4IQDA 3E1F1 3VE9A 3C5QA 2YOCA 2VRJA 3TIMA 5KSWA 2R9RA 2XH0A 4NJGA 1ML1A 4OE7A 4PRRA 3HGRA 3N18A 4IUOA 2XYLA 2FIQA 4NILA 1V93A 1VJZA 2PTWA 3H55A 3CL7A 1GOKA 1E6PA 4DJFD 3ID7A 1V03A 3IUDA 2FHFA 3H6OA 2CZEA 1C92A 5CBIA 2E8ZA 3E2QA 3OO2A 4KRZA 1J10A 3T09A 2DJXA 3F7JA 3UXKA 3CYJA 5H1WA 1OM0A 4LEFA 3MKCA 2ASHA 3PPGA 2F6XA 1IYXA 3M0LA 3WY1A 1NFPA 2R24A 5LA0A 4O53A 1A4MA 4M19A 6XIAA 3H7UA 3CH0A 5DX7A 1MW3A 5LHFA 1XLJA 1GYNA 1LBFA 4B5WA 1QMLA 1QNOA 1NP0A 2PWGA 3QW3A 4RDYA 3FHQA 2G3NA 1KCZA 3WQFA 3ORWA 4YS1A 2P8CA 2Y88A 3F4WA 4DM1A 3HV8A 4U10A 3RIKA 2R82A 3WD4A 3D5HA 3RPMA 2VVSA 1V0KA 2AGTA 3W2MA 3DU0A 3CV1A 3N13A 2WMHA 3LRMA 5I79A 3N6HA 3FVDA 2OOFA 3Q45A 3NQ6A 4QDWA 4JOMA 1TPFA 3WEMA 1BXCA 2GSJA 1LLZA 1K03A 3NQFA 1FCBA 4MKNA 4V15A 3BAWA 3AS2A 1ITCA 3REQB 1CXEA 3DG6A 3TAOA 2QF8A 3GNNA 3GAKA 4ONVA 2JFEX 2QDGA 3H70A 4PH6A 1KCKA 5AN7A 4V28A 1KGUA 2TYSA 1HJSA 3ARUA 1ZENA 3DECA 4LV9A 3UWEA 3LZ5A 1JZ5A 1EJ7L 5AYIA 1MVYA 2IUZA 5JXQA 3PHAA 2WXDM 3UNDA 1FVPA 3PZOA 1J0HA 3VNKA 4NJKA 3NWRA 5DY3A 5AYXA 2OO6A 4LNCA 4I9TA 5I77A 3QZ6A 3VZZA 4UZSA 5AOUA 4ORIA 1ZBCA 3MWAA 2Y7EA 1UIOA 3GVVA 1NDWA 5I6SA 2ZYFA 1G1YA 4Z08A 3R11A 2IQ0A 1A49A 1DV7A 2WHJA 3R10A 1OFRA 1V6XA 2CU0A 2YDSA 1AQHA 1TA3A 1Z6KA 1UKTA 1XSJA 1VCVA 3W83A 1EXBA 4BQ5A 4WF7A 2DZWA 1FKXA 3PTMA 3ABXA 4NZJA 4AIEA 1JXKA 1ODZA 3M0XA 4HJWA 3TW6A 2PPGA 1EEXA 4RJEA 2YBUA 5KMYA 1UUOA 5CZTA 4DHGA 2KAUC 3V5OA 4NRRA 5I3GA 1KR1A 1UPMB 2AMGA 1XGZA 2X30A 3B9AA 4YYFA 1XLKA 2WHKA 4P8VA 1QNRA 2B7QA 4E2BA 3MDWA 1B1YA 3A24A 3DESA 3WL1A 4ZENA 4OBTA 4M56A 3Q67A 4MG4A 3UCQA 1OC6A 3U7VA 3WBYA 5JH1A 1GPFA 3JZUA 5FJRA 2WSYA 4H6QA 1UD6A 3W6LA 5BXRA 3R5EA 4O12A 3DGBA 4K1WA 4Z0SA 4C6EA 2H8ZA 1HL2A 4BR1A 4JICA 5HWNA 1KM3A 4DWDA 4AWUA 1Z44A 3KS6A 4US6A 1FRBA 2VZTA 3QW4B 4HMEA 2CW6A 2HXUA 3OVRA 4R7OA 4HU8A 1M6JA 4ATWA 1OX6A 1R9ZA 5FI8A 4NI3A 3CQHA 9XIAA 2PSNA 1J11A 2CETA 4NI8A 2PFHA 4D6JA 3B4YA 3TR2A 4IIBA 4C5ZA 3H7VA 4NU7A 1CWYA 2V3FA 4QAIA 3F2BA 2MANA 4JTUA 3W7CA 4M6VA 3TN3A 3RNDA 3N9SA 3PB0A 2ZWZA 4HNOA 1XSKA 3P74A 3BWWA 1LOQA 3BZJA 3UY8A 4LRSA 4O0KA 3FEMA 3AXKA 3E2RA 4JTSA 3DCPA 1SZGA 1CNVA 1DKWA 1DXEA 1X97A 4PGLA 1S5WA 1XIJA 4PCNA 1XQLA 4J3TA 2WMKA 1JR1A 3CO8A 2QPUA 1R46A 1XX1A 2B7NA