1JCQA

Crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and the peptidomimetic inhibitor l-739,750
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTEIN FARNESYLTRANSFERASE, ALPHA SUBUNIT
total genus 126
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1jcqA00
1NI1A 4GTSA 1TNOA 1TNZA 3DSVA 1D8EA 1TN6A 1FPPA 1TNYA 3DSTA 3E30A 3E34A 1LD7A 1O1TA 1DCEA 1JCSA 2ZIRA 1S63A 3HXCA 1NL4A 4GTPA 4GTRA 1MZCA 4LNBA 3PZ3A 1KZOA 4GTVA 1LTXA 1N4RA 3DSUA 1N9AA 1SA5A 1D8DA 1TNBA 3HXFA 1SA4A 1N4SA 2IEJA 3SFYA 4EHMA 2H6GA 3DRAA 1JCRA 3Q79A 4GTTA 1TNUA 1FT2A 3DSWA 1X81A 3Q78A 3KSQA 1N95A 3PZ4A 2BEDA 4GTMA 1O1SA 1FT1A 3HXDA 3Q7FA 4L9PA 1N94A 1N4QA 3EU5A 3Q75A 4YDEA 1KZPA 3EUVA 3E32A 3Q7AA 3DPYA 3HXEA 3E37A 1TN7A 4LNGA 3C72A 3DSXA 1N4PA 3PZ2A 3HXBA 3SFXA 2H6IA 1JCQA 4YDOA 1O1RA 3E33A 1TN8A 2ZISA 2H6HA 1O5MA 3DSSA 1QBQA 3Q73A 2R2LA 1S64A 2F0YA 2H6FA 4GTOA 3KSLA 1LD8A 3PZ1A 4MBGA 4GTQA
chains in the Genus database with same CATH superfamily
4GMJA 1RZ4A 4F7AA 5CHEE 4DX2A 1FVHA 1TN6A 3EDTB 3DEPA 4B8AA 4AJWA 4KVOA 1PC2A 2HO1A 1K3ZD 4Y6CA 2IF4A 4AY6A 3FWVA 3MKRA 4BSXA 4I6JA 3ZHEA 1EYHA 5CCMA 1TR4A 2DYSE 1JPLA 4XX5A 2LSVA 4G24A 2R17C 4B8CB 2MRIA 3IKOB 3UM2A 5CBNA 4B93B 3CHOA 1ELWA 3JUIA 5B1AE 2MYOA 3FUHA 3PE3A 4HOQA 4GA2A 4E85A 4HB5A 3G2UA 3QWVA 2BF0X 3PNTB 4PUCA 3RAUA 2J9QA 2I1KA 1QNFA 1YCSB 5EN5D 1IXVA 5LX8A 4KBQA 4AIFA 1Z3XA 4HVBA 3EU9A 3ZN3A 4BT8A 1Q2ZA 2L0IA 3UIPC 4LCTA 3MJWA 4DX5D 3VLFA 3AAAC 5ENTD 2OVFA 1U3DA 2F0YA 5CMYA 2FO7A 4FP7A 3OXLA 3D9NA 2I1JA 2LAIA 3DSVA 3ZYLA 3NZUA 1H6PA 3ESLA 1ZB1A 2XHEA 4EBAG 3V2XA 3PEVB 1Z3YA 2ETAA 4GA0A 1EPUA 3BQOA 3I3NA 3NAWA 1SA5A 4O1PA 4FA6A 1MHQA 1AP7A 5CMWA 1SA4A 4GPMA 4KZ0A 1A5EA 1BI8B 3TG4A 3Q49B 1E8ZA 1OCZE 4I1AA 4HOUA 2BEDA 4F6RD 4GTMA 4N3CA 3P1UA 4TRQA 5HKPA 2OEVA 4G1TA 2R5SA 2X6HA 3RO3A 5C1DA 4BX9A 3ZXPA 2XEEA 3RRUA 1IYGA 2XZDG 3MA5A 2DVWA 4U63A 3FTUA 4GA1A 4ANUA 3AG2E 4DLOA 4UI9K 3D9PA 4WUYA 1TN8A 5FWQA 2QYUA 4E6HA 3OXFA 2IY0C 5DBKA 2IO3C 2JABA 2NXPA 4O1OA 3MCXA 4BTBA 5LOZA 4I9EA 1IKND 2E2EA 1LD8A 3RRMB 3S7JA 1FCHA 5FJYA 2BTDA 1SZ9A 5JMND 2VSYA 5J08A 4W9RA 1OWMA 1WM5A 4FLHA 2XGOA 3UM3A 2KC7A 3ZYQA 3CVUA 3U66A 3ESKA 4FJZA 2WQHA 4B89A 2PNNA 4HLEA 4G11A 1H6OA 4EZJA 4UWLA 1Y6IA 4AXHA 3CQCB 3ZYKA 4UWGA 4EZKA 4P29A 2ETCA 3GW4A 3T5XA 3D9KA 2XS8A 3LVRE 4I9CA 3OXGA 1UJKA 1KT0A 4GTTA 3TXMA 4HLLA 5AQAA 4KVMA 4YNDA 4CGWA 4HQDA 1N95A 2KM4A 3UINC 4I1OB 4ANWA 3RU0A 4GMLA 1YMPA 4XEIG 4KXKB 1E8XA 5FZRA 4A3TA 3ZIMA 4PH4B 2PL2A 2L6JA 3C98A 4GB9A 3BG1B 3TWUA 2X3MA 5LFAA 3UKRG 4ILGA 5EIBE 1O5MA 4JHJA 2RD0A 4DUIA 5T3RA 2WXOA 3NB2A 4DI4A 3FULA 4BERA 4PDXA 5ARGA 4U8YD 4BT9A 3MZLB 3W9FA 4I6GA 4DPRA 1K1BA 3TWRA 1IHGA 2A5EA 1DC2A 2CHXA 5ARFA 4ILHB 3L16A 3UM1A 1MYOA 4YDWA 2MHKA 5KWDA 3PZ3A 1S70B 4B0ZA 4UQYA 5BUZA 1LTXA 2WXPA 4JVSA 3JQ1A 1D8DA 1TNBA 2IFUA 3SFYA 4RSYA 1TEZA 1UW4B 5D0QD 3SBSA 3LYAA 1PY1A 1X81A 2CFUA 2VGEA 4A3VA 4ATZD 2X6JA 4J8FA 3R7RA 2KCVA 4GCOA 3B95A 1QYMA 2WXHA 2XPYA 3Q47B 3ASDA 1HH8A 3FUDA 3U64A 3TWQA 3U3WA 2P9LG 3FTZA 3PREA 5BXUA 1NP7A 4MBGA 2QY7A 3UKUG 4OVVA 3J5QB 5ENOD 2A5UA 1TNZA 4CDMA 5CERB 1UN8A 2NC9A 2LXLA 3TWWA 2CHZA 1INZA 4RG6A 4EBAA 3FU5A 4AP2A 1LD7A 2P9UG 4WWPA 1JCSA 4O60A 1S63A 1DNPA 2IONA 3APFA 2LSUA 4ABNA 3RRNB 3AU5A 1RW2A 2WXMA 3PNLB 4UWKA 3CK9A 4PS7A 3EIJA 4FHKA 1OWPA 5D0OD 2P2CP 2R05A 3TWTA 4A1SA 2DWZA 5G55A 2YHCA 1H2TC 4DRXE 3CKCA 5M72A 4N2QA 3PEUB 3DBSA 5J90A 5D66A 1H0AA 1HE8A 4GYYA 1FT1A 2WPVA 1N94A 2X6KA 2EQXA 3MV3B 4K0RA 2GROB 2IU1A 3B7UX 2B0OE 2LAHA 2PZIA 4HOSA 2KCKA 1TN7A 3B7TA 1H2VC 3PZ2A 2J07A 3FEXA 3GZSA 2WVIA 2V5FA 3CVPA 2IOSA 3APDA 4QFVA 1W3BA 4GTOA 2BKGA 1OWNA 2ZGGA 4L23A 3ZEFA 2J08A 3L6AA 4H7YA 4EECA 3CKBA 3LJNA 3L22A 3BUAA 4GZDA 3T5VA 3CVWA 3HDXA 4XI9A 1BLXB 5JJTA 1N0RA 2ZGDA 4XI0A 4OAUC 3Q9UC 2EIKE 4CZ2D 4N2SA 2ZIRA 2XCCA 4F1PA 3UMVA 3DSUA 4BWRA 4G25A 4RG9A 2XPIA 2QFCA 5G2NA 3LJ3A 1H2UA 3ONLA 4H7XA 3ZYMA 3KSQA 2GRPB 5LCWC 4HFGA 4CGVA 3PRZA 2C0LA 3CQGB 4L9PA 3JXJA 3C3RA 4XKBA 3UT4A 2WXNA 4I2WA 4HRLA 5LCWJ 3ZU7B 3AU4A 4CDNA 3DEOA 5BXOA 5FT9A 2H6IA 4GYWA 4EQFA 4M3OA 3ZVVA 4RVBA 2V4LA 3S7BA 1S64A 2JEKA 4GZCA 3SFZA 3KSLA 2CG2A 4LNUD 4DK5A 3T9KA 5T8IA 5HI7A 5A23A 4BFRA 3FDHA 5AAOA 5CBOA 5EX3A 4NIKA 3KS2A 3PVLA 3OAWA 3JQ0A 3QDNA 5FIOA 4CDRA 1NA3A 2I2OA 1O1TA 5KJKA 1BPOA 2OVBA 3JXIA 1OY3D 5AQBA 3D9JA 1JWGA 1UG3A 2L6BA 4OYSA 4UI9J 4GAAA 1YYHA 4Z68A 3LCAA 1KZOA 1H6KA 2F37A 4L7TA 2VYIA 3CHSA 4WWOA 3UQ3A 2F8YA 3SHFA 2P9PG 2VGXB 4CEMA 4EHMA 3LKUA 1OWLA 4KMOA 2KZTB 5BT1A 4HRNA 4Q69A 3C5RA 4HXIA 4UI9C 3QARA 3HRAA 3VLDA 4TXRA 4U96D 4EPZA 4HORA 3KD7A 3DPYA 3WG7E 3Q4AB 5AQ9A 3SFXA 1G3NB 2HM8A 3UXGA 2ZISA 3ULQA 2LNIA 4JD2G 4IULA 4DLQA 2Y4UA 3LY9A 3VTXA 3QWWA 4AV7A 1HS6A 2AJAA 3LY7A 2WQ7A 4L1BA 3CGHA 2XZTG 3ASHA 3NOCD 2E0IA 1OCOE 2WM9A 3CVYA 3C3QA 2X38A 2WXFA 3DSTA 1OXJA 4WNFA 5BW8C 3ENEA 4JHKA 2WXGA 4BSZB 1E8YA 4OAVB 2FULA 4RQIA 4GTPA 3FH5A 4LNBA 3MKQB 3FUMA 2IQCA 3UT8A 4N3AA 1E96B 3PDNA 3OTNA 2IOLA 3R7QA 1N9AA 1BI7B 5A7DB 2EINE 3TWSA 1KPSB 2ZU6B 2CG3A 1HFAA 3ABLE 4ANVA 1TNUA 4F1SA 2DZNA 3PZ4A 3IBEA 3ASOE 3KEAA 3IV0A 5IY5E 3QAQA 4ZHBA 2GRQB 3T8KA 3V2OA 3E32A 5HQ8A 2GGFA 1QQEA 4MRUA 3SI5A 4APFA 4Y6WA 3RK6A 4JXTA 2FO1E 4JEHA 4UWHA 1JCQA 4I1MA 3FH7A 1LF8A 4Q94A 5KJMA 3PZDA 1HG5A 3FTYA 3FU6A 3V31A 4FU3A 1H19A 1IQRA 3ABME 2R2LA 2H6FA 2HR2A 3UM0A 1TJFA 3VTYA 3APCA 1MJ0A 1HXIA 4TXPA 2QZAA 3TWVA 2VSNA 4PS3A 1V55E 4WNEA 5T4YA 3Q15A 5A6CA 3FUEA 3RO2A 3FTXA 4JEUA 3NOGD 4WNDA 3V30A 1U2VG 2PM6A 1X5BA 4JZYA 4HS2A 3HXCA 4GTRA 3QNKA 2Y1LE 4I6EA 2VJ8A 1YA0A 2Y0BG 3WXXA 2GW1A 2LUHA 5ANLA 3CEQA 2X6IA 4U7EB 3ML9A 2UWJG 4K5AB 1JUQA 5DIZA 3SF4A 4PS8A 3EHRA 2I6HA 5B3SE 2DBAA 4J0UA 2RKKA 4F53A 4LUNU 3AS5A 1AWCB 4GU5A 4UUCA 3Q75A 3ISMC 5E76A 3EHMA 5FQ7A 4AVXA 5D2MC 2I9CA 2MOWA 3NBNB 1BD8A 1P5QA 2VGXA 3K9IA 3DPDA 4U8HA 3C72A 4A1GA 4EZLA 4HOTA 3JUEA 1QZ2A 3CSTA 4BTAA 1ELRA 3NF1A 4WWNA 5ENNA 3FUFA 4CRWA 2WB2A 2FI7A 5EDSA 4GTSA 3RJVA 2C2LA 5JJ7A 3KEZA 5G05J 4U0UA 4A55A 2A4ZA 4MS6A 3GZ1A 3S7DA 1UN9A 2ZXWE 4ACKA 4AEZC 1WG0A 4K5BA 1DCEA 4GPKA 4JPSA 4HNAD 5HRYA 2P9KG 2RFAA 3CHRA 4JB8P 2BKKB 1NFIE 3PE4A 4U04A 5CEAA 3QC1A 2XGSA 4IRUA 3FTWA 4RLYA 4ACLA 3FUIA 5H7PA 3TAXA 3MEKA 2V5QC 3AS8A 2OV8A 2ILRA 2XPZA 1DCQA 5CCLA 3V79K 4HI9A 3Q7FA 4I17A 4CT4A 4J8SA 3CVQA 5BV0A 3Q5MA 3FFLA 4HRMB 3ULYA 4G8LA 4URKA 4ATGA 4V3IA 4LNGA 2EILE 3CVXA 5JA4D 2FBNA 3R9MA 5FQ6A 3EJNA 5CRUA 2GRMA 1FVFA 3HYMB 3FUNA 3Q73A 3GZ2A 2NYJA 3CVNA 4J6IA 3ZHEB 1GW6A 3I5PA 3I4GA 1NZNA 4FULA 1NI1A 4K03A 3S7FA 4IN3B 5JJ6A 2B6CA 2KXPC 3C3OA 3O4ZA 5E75A 4XZ4A 2R03A 4GYOA 4DI3A 2AXUA 4J8YA 3E34A 2KZTA 4OVUA 2FEZA 3L82A 1XNFA 3UI2A 5EX0A 3L08A 2LO6A 2VQ2A 1NL4A 2OCCE 3CIAA 4N39A 3ZGQA 4IYPA 2P9SG 3NQPA 3ABKE 1EF1C 4B94A 5BNWA 4TUMA 5AYWD 1HX8A 3R9AB 2IJGX 1WY6A 2XS1A 5JHBA 3CVLA 3DRAA 5KJNA 1N0QA 2QYJA 5CEDB 2UY1A 2V8SE 3LPZA 3FP3A 4L2LA 2C0MA 1UOHA 3QKYA 5FQ8A 2EIJE 3SY2A 4LSZE 4XKCA 5ENRD 5JHAA 2GRRB 4ME2A 2V4HC 1Z6TA 4C9BB 1KZPA 3UTMA 1S0PA 3Q9NC 3QJZA 1OT8A 2Q7FA 2Y4TA 5G04J 5ANRA 4GZ3A 3KAEA 2WMOA 2WXQA 1E90A 5G04C 3IHYA 3TJPA 2UY1B 1O1RA 4AY5A 2HE0A 2RG8A 2J8SD 4JA7A 2F8XK 2VTBA 1A17A 3UUXA 4G23A 3PZ1A 5FZSA 1HU3A 5LP0A 1VDYA 2XGMA 4F3VA 3EHQA 2PM7A 4XIFA 1SQMA 1TYQG 3VLEA 3TXNA 2ONDA 3E30A 5EIDA 3SBTB 3FEYA 4CYMD 4A63B 2Y69E 3QB2A 2DZOA 2HYZA 2FF4A 4DX6D 4GTVA 4LERA 3U4TA 3UIOC 2AW6A 4Q96A 2GRNB 3ZXSA 2PQNA 4U0ZA 3LXUX 3LS8A 3PH0C 3P2BA 3LVQE 1WDYA 2L9BA 3ZNGA 2J4BA 3ZUVB 3ZFWA 4FJYA 1FT2A 4K5CA 3Q78A 3LY8A 4U07A 1JWFA 1E7UA 4G2VA 3QWPA 4U95D 4M7CA 4J7WA 4BY6A 4YDEA 3SD5A 3D3MA 2X6FA 4WNGA 3Q7AA 2R02A 2WQ6A 4X8QA 3CV0A 3DSXA 4N5QA 3G2VA 1MQSA 3ASNE 2JLBA 2XQ0A 3X2QE 3B7BA 2H6HA 4BEPA 4UQXA 2XCBA 3B7RL 1K1AA 4TUUA 5KNHD 1TJCA 4GTQA 5KCMA 4CCAA 2YINA 3B7SA 2KATA 3U9WA 3RIBA 2EIME 1SW6A 4JC8A 1DVPA 1HG2A 4ANXA 3PUKA 3IXEA 4FHJA 2YQ8A 3G2WA 4WAFA 3ML8A 3ASGA 3F6QA 1EDUA 1HZ4A 3JCKC 4BX8A 1N4RA 3ULEG 3IEGA 1SZAA 2P9IG 4J8DA 1OCRE 3HXFA 1KLXA 3FU0A 2WXRA 3EHNA 3D9LA 4UQZA 4HBDA 2AXZA 3DXKG 1HF8A 3SNXA 3AG1E 3ZRHA 3FHEA 2GRLA 3DXMG 3EU5A 1N54A 3GYZA 4LG6A 3HXEA 1ELKA 2J4DA 5B1BE 3QK0A 3BU8A 4TXQA 2LXMA 2OOEA 5BPPA 5FTPA 1IQUA 1SVXA 2KCLA 1UJJA 2VSXE 4G26A 5CECB 3J5PA 4JHRA 3FTVA 4LEUA 3CSFA 3AG3E 2WMNA 4YVQC 5AJDA 4NRHB 4LRZA 2P58C 3AS4A 2M63A 3RSEG 1FPPA 3PUJA 3I4RB 3FY4A 3L9TA 2NSZA 2ETBA 3ONKA 4FLBA 2Y3AA 4DJAA 5C2YA 2BUGA 3BEEA 4KZCA 2VTBB 3FUJA 3G2TA 1N11A 1MX2A 5HS0A 3N71A 3CHPA 4KT6B 3MGBA 3FH8A 1NA0A 4APOA 5AIJA 3D9OA 3DSWA 4BETA 4O6FA 1E8WA 1D9SA 3NZSA 1O1SA 3W9GA 4HI8A 5ITZF 4JA9A 2DIWA 4ILIA 3D9MA 4I43A 1ZU2A 3HIZA 2WXKA 3O48A 4J8EA 5G05C 2J09A 2OEWA 5FZQA 4C0EA 5EKQD 3DSSA 4C0MA 3AJIA 3B13A 5CRVA 5AARA 2V0PA 3ZPJA 1OCCE 5FQ4A 1D8EA 1U3CA 2DCPA 3ASFA 5EYPF 5ENSD 3TWXA 3UX4A 1MX4A 3MKQA 1XGWA 2WXJA 4GMRA 4KYOB 3FUKA 3ZW3A 2VGYA 2AWIA 4FADA 2XEHA 3UPVA 3D9IA 4BESA 5BV1A 5KJLA 2CFZA 4DX7D 5ENPD 3L17A 5KBAA 1KT1A 4CT0A 2IO2C 1WAO1 3MX3A 3RKVA 2XENA 3IHVA 3CVVA 2KBXA 4GZ5A 5KNGA 4NACA 1K8KG 3HXDA 2YNQA 4GCNA 4GZ6A 2DYRE 4L2YA 1PAQA 1E7VA 3EUVA 3MYVA 2RFMA 1N4PA 3SZ7A 3SGHA 3CK7A 2PQRA 3ZKJA 3SQVA 4YDOA 3JYSA 3E33A 4N5CA 3E4BA 4ZFHA 4XE0A 4D10C 1OWOA 3BG0B 3LEWA 3TG5A 4YDYA 3L54A 3HVEA 3TGOA 4DX1A 3HG0D 5ENQD 1TNOA 2QC9A 4FC8A 3CHQA 3T8MA 3CK8A 1N52A 5EILA 5AN8A 3UT7A 1Z5SC 1TNYA 3AG4E 2YHEA 3L13A 3CHMA 3S2AA 4N3BA 3TL5A 3G2SA 1BU9A 3HVEB 1MZCA 4YVOA 1ZBPA 1L5JA 2CHWA 5AJLA 3CLJA 2WXLA 4G8KA 1Y8MA 2XRZA 4NQ0A 2AVPA 5EYLA 3PS6A 3QOUA 3DWLG 1N4SA 1OUVA 2IEJA 3FTSA 2L0TB 2H6GA 4TV3A 4C48B 1JCRA 2R59A 2XRYA 2P9NG 3Q79A 4AOFA 5AQ7A 4JL0A 1V54E 4MLPA 2WXIA 3HHMA 3LDZA 4U0SA 4MKTA 5AENA 3SO8A 1HO8A 3CR3A 3FU3A 4AM9A 1N4QA 2J49A 1B89A 5FINA 3E37A 4R7LA 2AXVA 3D9HA 4U8VD 2VSOE 3EIQC 2XEVA 3HXBA 3MV2B 1IHBA 4JW1A 4UWFA 1MX6A 4QQIA 4NURA 3URZA 1QBQA 4I2ZA
chains in the Genus database with same CATH topology
1NI1A 4GTSA 1TNOA 1TNZA 3DSVA 1D8EA 1TN6A 1FPPA 1TNYA 3DSTA 3E30A 3E34A 1LD7A 1O1TA 1DCEA 1JCSA 2ZIRA 1S63A 3HXCA 1NL4A 4GTPA 4GTRA 1MZCA 4LNBA 3PZ3A 1KZOA 4GTVA 1LTXA 1N4RA 3DSUA 1N9AA 1SA5A 1D8DA 1TNBA 3HXFA 1SA4A 1N4SA 2IEJA 3SFYA 4EHMA 2H6GA 3DRAA 1JCRA 3Q79A 4GTTA 1TNUA 1FT2A 3DSWA 1X81A 3Q78A 3KSQA 1N95A 3PZ4A 2BEDA 4GTMA 1O1SA 1FT1A 3HXDA 3Q7FA 4L9PA 1N94A 1N4QA 3EU5A 3Q75A 4YDEA 1KZPA 3EUVA 3E32A 3Q7AA 3DPYA 3HXEA 3E37A 1TN7A 4LNGA 3C72A 3DSXA 1N4PA 3PZ2A 3HXBA 3SFXA 2H6IA 1JCQA 4YDOA 1O1RA 3E33A 1TN8A 2ZISA 2H6HA 1O5MA 3DSSA 1QBQA 3Q73A 2R2LA 1S64A 2F0YA 2H6FA 4GTOA 3KSLA 1LD8A 3PZ1A 4MBGA 4GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI1 A;  4GTS A;  1TNO A;  1TNZ A;  3DSV A;  1D8E A;  1TN6 A;  1FPP A;  1TNY A;  3DST A;  3E30 A;  3E34 A;  1LD7 A;  1O1T A;  1DCE A;  1JCS A;  2ZIR A;  1S63 A;  3HXC A;  1NL4 A;  4GTP A;  4GTR A;  1MZC A;  4LNB A;  3PZ3 A;  1KZO A;  4GTV A;  1LTX A;  1N4R A;  3DSU A;  1N9A A;  1SA5 A;  1D8D A;  1TNB A;  3HXF A;  1SA4 A;  1N4S A;  2IEJ A;  3SFY A;  4EHM A;  2H6G A;  3DRA A;  1JCR A;  3Q79 A;  4GTT A;  1TNU A;  1FT2 A;  3DSW A;  1X81 A;  3Q78 A;  3KSQ A;  1N95 A;  3PZ4 A;  2BED A;  4GTM A;  1O1S A;  1FT1 A;  3HXD A;  3Q7F A;  4L9P A;  1N94 A;  1N4Q A;  3EU5 A;  3Q75 A;  4YDE A;  1KZP A;  3EUV A;  3E32 A;  3Q7A A;  3DPY A;  3HXE A;  3E37 A;  1TN7 A;  4LNG A;  3C72 A;  3DSX A;  1N4P A;  3PZ2 A;  3HXB A;  3SFX A;  2H6I A;  1JCQ A;  4YDO A;  1O1R A;  3E33 A;  1TN8 A;  2ZIS A;  2H6H A;  1O5M A;  3DSS A;  1QBQ A;  3Q73 A;  2R2L A;  1S64 A;  2F0Y A;  2H6F A;  4GTO A;  3KSL A;  1LD8 A;  3PZ1 A;  4MBG A;  4GTQ A; 
#chains in the Genus database with same CATH topology
 4GMJ A;  1RZ4 A;  4F7A A;  5CHE E;  4DX2 A;  1FVH A;  1TN6 A;  3EDT B;  3DEP A;  4B8A A;  4AJW A;  4KVO A;  1PC2 A;  2HO1 A;  1K3Z D;  4Y6C A;  2IF4 A;  4AY6 A;  3FWV A;  3MKR A;  4BSX A;  4I6J A;  3ZHE A;  1EYH A;  5CCM A;  1TR4 A;  2DYS E;  1JPL A;  4XX5 A;  2LSV A;  4G24 A;  2R17 C;  4B8C B;  2MRI A;  3IKO B;  3UM2 A;  5CBN A;  4B93 B;  3CHO A;  1ELW A;  3JUI A;  5B1A E;  2MYO A;  3FUH A;  3PE3 A;  4HOQ A;  4GA2 A;  4E85 A;  4HB5 A;  3G2U A;  3QWV A;  2BF0 X;  3PNT B;  4PUC A;  3RAU A;  2J9Q A;  2I1K A;  1QNF A;  1YCS B;  5EN5 D;  1IXV A;  5LX8 A;  4KBQ A;  4AIF A;  1Z3X A;  4HVB A;  3EU9 A;  3ZN3 A;  4BT8 A;  1Q2Z A;  2L0I A;  3UIP C;  4LCT A;  3MJW A;  4DX5 D;  3VLF A;  3AAA C;  5ENT D;  2OVF A;  1U3D A;  2F0Y A;  5CMY A;  2FO7 A;  4FP7 A;  3OXL A;  3D9N A;  2I1J A;  2LAI A;  3DSV A;  3ZYL A;  3NZU A;  1H6P A;  3ESL A;  1ZB1 A;  2XHE A;  4EBA G;  3V2X A;  3PEV B;  1Z3Y A;  2ETA A;  4GA0 A;  1EPU A;  3BQO A;  3I3N A;  3NAW A;  1SA5 A;  4O1P A;  4FA6 A;  1MHQ A;  1AP7 A;  5CMW A;  1SA4 A;  4GPM A;  4KZ0 A;  1A5E A;  1BI8 B;  3TG4 A;  3Q49 B;  1E8Z A;  1OCZ E;  4I1A A;  4HOU A;  2BED A;  4F6R D;  4GTM A;  4N3C A;  3P1U A;  4TRQ A;  5HKP A;  2OEV A;  4G1T A;  2R5S A;  2X6H A;  3RO3 A;  5C1D A;  4BX9 A;  3ZXP A;  2XEE A;  3RRU A;  1IYG A;  2XZD G;  3MA5 A;  2DVW A;  4U63 A;  3FTU A;  4GA1 A;  4ANU A;  3AG2 E;  4DLO A;  4UI9 K;  3D9P A;  4WUY A;  1TN8 A;  5FWQ A;  2QYU A;  4E6H A;  3OXF A;  2IY0 C;  5DBK A;  2IO3 C;  2JAB A;  2NXP A;  4O1O A;  3MCX A;  4BTB A;  5LOZ A;  4I9E A;  1IKN D;  2E2E A;  1LD8 A;  3RRM B;  3S7J A;  1FCH A;  5FJY A;  2BTD A;  1SZ9 A;  5JMN D;  2VSY A;  5J08 A;  4W9R A;  1OWM A;  1WM5 A;  4FLH A;  2XGO A;  3UM3 A;  2KC7 A;  3ZYQ A;  3CVU A;  3U66 A;  3ESK A;  4FJZ A;  2WQH A;  4B89 A;  2PNN A;  4HLE A;  4G11 A;  1H6O A;  4EZJ A;  4UWL A;  1Y6I A;  4AXH A;  3CQC B;  3ZYK A;  4UWG A;  4EZK A;  4P29 A;  2ETC A;  3GW4 A;  3T5X A;  3D9K A;  2XS8 A;  3LVR E;  4I9C A;  3OXG A;  1UJK A;  1KT0 A;  4GTT A;  3TXM A;  4HLL A;  5AQA A;  4KVM A;  4YND A;  4CGW A;  4HQD A;  1N95 A;  2KM4 A;  3UIN C;  4I1O B;  4ANW A;  3RU0 A;  4GML A;  1YMP A;  4XEI G;  4KXK B;  1E8X A;  5FZR A;  4A3T A;  3ZIM A;  4PH4 B;  2PL2 A;  2L6J A;  3C98 A;  4GB9 A;  3BG1 B;  3TWU A;  2X3M A;  5LFA A;  3UKR G;  4ILG A;  5EIB E;  1O5M A;  4JHJ A;  2RD0 A;  4DUI A;  5T3R A;  2WXO A;  3NB2 A;  4DI4 A;  3FUL A;  4BER A;  4PDX A;  5ARG A;  4U8Y D;  4BT9 A;  3MZL B;  3W9F A;  4I6G A;  4DPR A;  1K1B A;  3TWR A;  1IHG A;  2A5E A;  1DC2 A;  2CHX A;  5ARF A;  4ILH B;  3L16 A;  3UM1 A;  1MYO A;  4YDW A;  2MHK A;  5KWD A;  3PZ3 A;  1S70 B;  4B0Z A;  4UQY A;  5BUZ A;  1LTX A;  2WXP A;  4JVS A;  3JQ1 A;  1D8D A;  1TNB A;  2IFU A;  3SFY A;  4RSY A;  1TEZ A;  1UW4 B;  5D0Q D;  3SBS A;  3LYA A;  1PY1 A;  1X81 A;  2CFU A;  2VGE A;  4A3V A;  4ATZ D;  2X6J A;  4J8F A;  3R7R A;  2KCV A;  4GCO A;  3B95 A;  1QYM A;  2WXH A;  2XPY A;  3Q47 B;  3ASD A;  1HH8 A;  3FUD A;  3U64 A;  3TWQ A;  3U3W A;  2P9L G;  3FTZ A;  3PRE A;  5BXU A;  1NP7 A;  4MBG A;  2QY7 A;  3UKU G;  4OVV A;  3J5Q B;  5ENO D;  2A5U A;  1TNZ A;  4CDM A;  5CER B;  1UN8 A;  2NC9 A;  2LXL A;  3TWW A;  2CHZ A;  1INZ A;  4RG6 A;  4EBA A;  3FU5 A;  4AP2 A;  1LD7 A;  2P9U G;  4WWP A;  1JCS A;  4O60 A;  1S63 A;  1DNP A;  2ION A;  3APF A;  2LSU A;  4ABN A;  3RRN B;  3AU5 A;  1RW2 A;  2WXM A;  3PNL B;  4UWK A;  3CK9 A;  4PS7 A;  3EIJ A;  4FHK A;  1OWP A;  5D0O D;  2P2C P;  2R05 A;  3TWT A;  4A1S A;  2DWZ A;  5G55 A;  2YHC A;  1H2T C;  4DRX E;  3CKC A;  5M72 A;  4N2Q A;  3PEU B;  3DBS A;  5J90 A;  5D66 A;  1H0A A;  1HE8 A;  4GYY A;  1FT1 A;  2WPV A;  1N94 A;  2X6K A;  2EQX A;  3MV3 B;  4K0R A;  2GRO B;  2IU1 A;  3B7U X;  2B0O E;  2LAH A;  2PZI A;  4HOS A;  2KCK A;  1TN7 A;  3B7T A;  1H2V C;  3PZ2 A;  2J07 A;  3FEX A;  3GZS A;  2WVI A;  2V5F A;  3CVP A;  2IOS A;  3APD A;  4QFV A;  1W3B A;  4GTO A;  2BKG A;  1OWN A;  2ZGG A;  4L23 A;  3ZEF A;  2J08 A;  3L6A A;  4H7Y A;  4EEC A;  3CKB A;  3LJN A;  3L22 A;  3BUA A;  4GZD A;  3T5V A;  3CVW A;  3HDX A;  4XI9 A;  1BLX B;  5JJT A;  1N0R A;  2ZGD A;  4XI0 A;  4OAU C;  3Q9U C;  2EIK E;  4CZ2 D;  4N2S A;  2ZIR A;  2XCC A;  4F1P A;  3UMV A;  3DSU A;  4BWR A;  4G25 A;  4RG9 A;  2XPI A;  2QFC A;  5G2N A;  3LJ3 A;  1H2U A;  3ONL A;  4H7X A;  3ZYM A;  3KSQ A;  2GRP B;  5LCW C;  4HFG A;  4CGV A;  3PRZ A;  2C0L A;  3CQG B;  4L9P A;  3JXJ A;  3C3R A;  4XKB A;  3UT4 A;  2WXN A;  4I2W A;  4HRL A;  5LCW J;  3ZU7 B;  3AU4 A;  4CDN A;  3DEO A;  5BXO A;  5FT9 A;  2H6I A;  4GYW A;  4EQF A;  4M3O A;  3ZVV A;  4RVB A;  2V4L A;  3S7B A;  1S64 A;  2JEK A;  4GZC A;  3SFZ A;  3KSL A;  2CG2 A;  4LNU D;  4DK5 A;  3T9K A;  5T8I A;  5HI7 A;  5A23 A;  4BFR A;  3FDH A;  5AAO A;  5CBO A;  5EX3 A;  4NIK A;  3KS2 A;  3PVL A;  3OAW A;  3JQ0 A;  3QDN A;  5FIO A;  4CDR A;  1NA3 A;  2I2O A;  1O1T A;  5KJK A;  1BPO A;  2OVB A;  3JXI A;  1OY3 D;  5AQB A;  3D9J A;  1JWG A;  1UG3 A;  2L6B A;  4OYS A;  4UI9 J;  4GAA A;  1YYH A;  4Z68 A;  3LCA A;  1KZO A;  1H6K A;  2F37 A;  4L7T A;  2VYI A;  3CHS A;  4WWO A;  3UQ3 A;  2F8Y A;  3SHF A;  2P9P G;  2VGX B;  4CEM A;  4EHM A;  3LKU A;  1OWL A;  4KMO A;  2KZT B;  5BT1 A;  4HRN A;  4Q69 A;  3C5R A;  4HXI A;  4UI9 C;  3QAR A;  3HRA A;  3VLD A;  4TXR A;  4U96 D;  4EPZ A;  4HOR A;  3KD7 A;  3DPY A;  3WG7 E;  3Q4A B;  5AQ9 A;  3SFX A;  1G3N B;  2HM8 A;  3UXG A;  2ZIS A;  3ULQ A;  2LNI A;  4JD2 G;  4IUL A;  4DLQ A;  2Y4U A;  3LY9 A;  3VTX A;  3QWW A;  4AV7 A;  1HS6 A;  2AJA A;  3LY7 A;  2WQ7 A;  4L1B A;  3CGH A;  2XZT G;  3ASH A;  3NOC D;  2E0I A;  1OCO E;  2WM9 A;  3CVY A;  3C3Q A;  2X38 A;  2WXF A;  3DST A;  1OXJ A;  4WNF A;  5BW8 C;  3ENE A;  4JHK A;  2WXG A;  4BSZ B;  1E8Y A;  4OAV B;  2FUL A;  4RQI A;  4GTP A;  3FH5 A;  4LNB A;  3MKQ B;  3FUM A;  2IQC A;  3UT8 A;  4N3A A;  1E96 B;  3PDN A;  3OTN A;  2IOL A;  3R7Q A;  1N9A A;  1BI7 B;  5A7D B;  2EIN E;  3TWS A;  1KPS B;  2ZU6 B;  2CG3 A;  1HFA A;  3ABL E;  4ANV A;  1TNU A;  4F1S A;  2DZN A;  3PZ4 A;  3IBE A;  3ASO E;  3KEA A;  3IV0 A;  5IY5 E;  3QAQ A;  4ZHB A;  2GRQ B;  3T8K A;  3V2O A;  3E32 A;  5HQ8 A;  2GGF A;  1QQE A;  4MRU A;  3SI5 A;  4APF A;  4Y6W A;  3RK6 A;  4JXT A;  2FO1 E;  4JEH A;  4UWH A;  1JCQ A;  4I1M A;  3FH7 A;  1LF8 A;  4Q94 A;  5KJM A;  3PZD A;  1HG5 A;  3FTY A;  3FU6 A;  3V31 A;  4FU3 A;  1H19 A;  1IQR A;  3ABM E;  2R2L A;  2H6F A;  2HR2 A;  3UM0 A;  1TJF A;  3VTY A;  3APC A;  1MJ0 A;  1HXI A;  4TXP A;  2QZA A;  3TWV A;  2VSN A;  4PS3 A;  1V55 E;  4WNE A;  5T4Y A;  3Q15 A;  5A6C A;  3FUE A;  3RO2 A;  3FTX A;  4JEU A;  3NOG D;  4WND A;  3V30 A;  1U2V G;  2PM6 A;  1X5B A;  4JZY A;  4HS2 A;  3HXC A;  4GTR A;  3QNK A;  2Y1L E;  4I6E A;  2VJ8 A;  1YA0 A;  2Y0B G;  3WXX A;  2GW1 A;  2LUH A;  5ANL A;  3CEQ A;  2X6I A;  4U7E B;  3ML9 A;  2UWJ G;  4K5A B;  1JUQ A;  5DIZ A;  3SF4 A;  4PS8 A;  3EHR A;  2I6H A;  5B3S E;  2DBA A;  4J0U A;  2RKK A;  4F53 A;  4LUN U;  3AS5 A;  1AWC B;  4GU5 A;  4UUC A;  3Q75 A;  3ISM C;  5E76 A;  3EHM A;  5FQ7 A;  4AVX A;  5D2M C;  2I9C A;  2MOW A;  3NBN B;  1BD8 A;  1P5Q A;  2VGX A;  3K9I A;  3DPD A;  4U8H A;  3C72 A;  4A1G A;  4EZL A;  4HOT A;  3JUE A;  1QZ2 A;  3CST A;  4BTA A;  1ELR A;  3NF1 A;  4WWN A;  5ENN A;  3FUF A;  4CRW A;  2WB2 A;  2FI7 A;  5EDS A;  4GTS A;  3RJV A;  2C2L A;  5JJ7 A;  3KEZ A;  5G05 J;  4U0U A;  4A55 A;  2A4Z A;  4MS6 A;  3GZ1 A;  3S7D A;  1UN9 A;  2ZXW E;  4ACK A;  4AEZ C;  1WG0 A;  4K5B A;  1DCE A;  4GPK A;  4JPS A;  4HNA D;  5HRY A;  2P9K G;  2RFA A;  3CHR A;  4JB8 P;  2BKK B;  1NFI E;  3PE4 A;  4U04 A;  5CEA A;  3QC1 A;  2XGS A;  4IRU A;  3FTW A;  4RLY A;  4ACL A;  3FUI A;  5H7P A;  3TAX A;  3MEK A;  2V5Q C;  3AS8 A;  2OV8 A;  2ILR A;  2XPZ A;  1DCQ A;  5CCL A;  3V79 K;  4HI9 A;  3Q7F A;  4I17 A;  4CT4 A;  4J8S A;  3CVQ A;  5BV0 A;  3Q5M A;  3FFL A;  4HRM B;  3ULY A;  4G8L A;  4URK A;  4ATG A;  4V3I A;  4LNG A;  2EIL E;  3CVX A;  5JA4 D;  2FBN A;  3R9M A;  5FQ6 A;  3EJN A;  5CRU A;  2GRM A;  1FVF A;  3HYM B;  3FUN A;  3Q73 A;  3GZ2 A;  2NYJ A;  3CVN A;  4J6I A;  3ZHE B;  1GW6 A;  3I5P A;  3I4G A;  1NZN A;  4FUL A;  1NI1 A;  4K03 A;  3S7F A;  4IN3 B;  5JJ6 A;  2B6C A;  2KXP C;  3C3O A;  3O4Z A;  5E75 A;  4XZ4 A;  2R03 A;  4GYO A;  4DI3 A;  2AXU A;  4J8Y A;  3E34 A;  2KZT A;  4OVU A;  2FEZ A;  3L82 A;  1XNF A;  3UI2 A;  5EX0 A;  3L08 A;  2LO6 A;  2VQ2 A;  1NL4 A;  2OCC E;  3CIA A;  4N39 A;  3ZGQ A;  4IYP A;  2P9S G;  3NQP A;  3ABK E;  1EF1 C;  4B94 A;  5BNW A;  4TUM A;  5AYW D;  1HX8 A;  3R9A B;  2IJG X;  1WY6 A;  2XS1 A;  5JHB A;  3CVL A;  3DRA A;  5KJN A;  1N0Q A;  2QYJ A;  5CED B;  2UY1 A;  2V8S E;  3LPZ A;  3FP3 A;  4L2L A;  2C0M A;  1UOH A;  3QKY A;  5FQ8 A;  2EIJ E;  3SY2 A;  4LSZ E;  4XKC A;  5ENR D;  5JHA A;  2GRR B;  4ME2 A;  2V4H C;  1Z6T A;  4C9B B;  1KZP A;  3UTM A;  1S0P A;  3Q9N C;  3QJZ A;  1OT8 A;  2Q7F A;  2Y4T A;  5G04 J;  5ANR A;  4GZ3 A;  3KAE A;  2WMO A;  2WXQ A;  1E90 A;  5G04 C;  3IHY A;  3TJP A;  2UY1 B;  1O1R A;  4AY5 A;  2HE0 A;  2RG8 A;  2J8S D;  4JA7 A;  2F8X K;  2VTB A;  1A17 A;  3UUX A;  4G23 A;  3PZ1 A;  5FZS A;  1HU3 A;  5LP0 A;  1VDY A;  2XGM A;  4F3V A;  3EHQ A;  2PM7 A;  4XIF A;  1SQM A;  1TYQ G;  3VLE A;  3TXN A;  2OND A;  3E30 A;  5EID A;  3SBT B;  3FEY A;  4CYM D;  4A63 B;  2Y69 E;  3QB2 A;  2DZO A;  2HYZ A;  2FF4 A;  4DX6 D;  4GTV A;  4LER A;  3U4T A;  3UIO C;  2AW6 A;  4Q96 A;  2GRN B;  3ZXS A;  2PQN A;  4U0Z A;  3LXU X;  3LS8 A;  3PH0 C;  3P2B A;  3LVQ E;  1WDY A;  2L9B A;  3ZNG A;  2J4B A;  3ZUV B;  3ZFW A;  4FJY A;  1FT2 A;  4K5C A;  3Q78 A;  3LY8 A;  4U07 A;  1JWF A;  1E7U A;  4G2V A;  3QWP A;  4U95 D;  4M7C A;  4J7W A;  4BY6 A;  4YDE A;  3SD5 A;  3D3M A;  2X6F A;  4WNG A;  3Q7A A;  2R02 A;  2WQ6 A;  4X8Q A;  3CV0 A;  3DSX A;  4N5Q A;  3G2V A;  1MQS A;  3ASN E;  2JLB A;  2XQ0 A;  3X2Q E;  3B7B A;  2H6H A;  4BEP A;  4UQX A;  2XCB A;  3B7R L;  1K1A A;  4TUU A;  5KNH D;  1TJC A;  4GTQ A;  5KCM A;  4CCA A;  2YIN A;  3B7S A;  2KAT A;  3U9W A;  3RIB A;  2EIM E;  1SW6 A;  4JC8 A;  1DVP A;  1HG2 A;  4ANX A;  3PUK A;  3IXE A;  4FHJ A;  2YQ8 A;  3G2W A;  4WAF A;  3ML8 A;  3ASG A;  3F6Q A;  1EDU A;  1HZ4 A;  3JCK C;  4BX8 A;  1N4R A;  3ULE G;  3IEG A;  1SZA A;  2P9I G;  4J8D A;  1OCR E;  3HXF A;  1KLX A;  3FU0 A;  2WXR A;  3EHN A;  3D9L A;  4UQZ A;  4HBD A;  2AXZ A;  3DXK G;  1HF8 A;  3SNX A;  3AG1 E;  3ZRH A;  3FHE A;  2GRL A;  3DXM G;  3EU5 A;  1N54 A;  3GYZ A;  4LG6 A;  3HXE A;  1ELK A;  2J4D A;  5B1B E;  3QK0 A;  3BU8 A;  4TXQ A;  2LXM A;  2OOE A;  5BPP A;  5FTP A;  1IQU A;  1SVX A;  2KCL A;  1UJJ A;  2VSX E;  4G26 A;  5CEC B;  3J5P A;  4JHR A;  3FTV A;  4LEU A;  3CSF A;  3AG3 E;  2WMN A;  4YVQ C;  5AJD A;  4NRH B;  4LRZ A;  2P58 C;  3AS4 A;  2M63 A;  3RSE G;  1FPP A;  3PUJ A;  3I4R B;  3FY4 A;  3L9T A;  2NSZ A;  2ETB A;  3ONK A;  4FLB A;  2Y3A A;  4DJA A;  5C2Y A;  2BUG A;  3BEE A;  4KZC A;  2VTB B;  3FUJ A;  3G2T A;  1N11 A;  1MX2 A;  5HS0 A;  3N71 A;  3CHP A;  4KT6 B;  3MGB A;  3FH8 A;  1NA0 A;  4APO A;  5AIJ A;  3D9O A;  3DSW A;  4BET A;  4O6F A;  1E8W A;  1D9S A;  3NZS A;  1O1S A;  3W9G A;  4HI8 A;  5ITZ F;  4JA9 A;  2DIW A;  4ILI A;  3D9M A;  4I43 A;  1ZU2 A;  3HIZ A;  2WXK A;  3O48 A;  4J8E A;  5G05 C;  2J09 A;  2OEW A;  5FZQ A;  4C0E A;  5EKQ D;  3DSS A;  4C0M A;  3AJI A;  3B13 A;  5CRV A;  5AAR A;  2V0P A;  3ZPJ A;  1OCC E;  5FQ4 A;  1D8E A;  1U3C A;  2DCP A;  3ASF A;  5EYP F;  5ENS D;  3TWX A;  3UX4 A;  1MX4 A;  3MKQ A;  1XGW A;  2WXJ A;  4GMR A;  4KYO B;  3FUK A;  3ZW3 A;  2VGY A;  2AWI A;  4FAD A;  2XEH A;  3UPV A;  3D9I A;  4BES A;  5BV1 A;  5KJL A;  2CFZ A;  4DX7 D;  5ENP D;  3L17 A;  5KBA A;  1KT1 A;  4CT0 A;  2IO2 C;  1WAO 1;  3MX3 A;  3RKV A;  2XEN A;  3IHV A;  3CVV A;  2KBX A;  4GZ5 A;  5KNG A;  4NAC A;  1K8K G;  3HXD A;  2YNQ A;  4GCN A;  4GZ6 A;  2DYR E;  4L2Y A;  1PAQ A;  1E7V A;  3EUV A;  3MYV A;  2RFM A;  1N4P A;  3SZ7 A;  3SGH A;  3CK7 A;  2PQR A;  3ZKJ A;  3SQV A;  4YDO A;  3JYS A;  3E33 A;  4N5C A;  3E4B A;  4ZFH A;  4XE0 A;  4D10 C;  1OWO A;  3BG0 B;  3LEW A;  3TG5 A;  4YDY A;  3L54 A;  3HVE A;  3TGO A;  4DX1 A;  3HG0 D;  5ENQ D;  1TNO A;  2QC9 A;  4FC8 A;  3CHQ A;  3T8M A;  3CK8 A;  1N52 A;  5EIL A;  5AN8 A;  3UT7 A;  1Z5S C;  1TNY A;  3AG4 E;  2YHE A;  3L13 A;  3CHM A;  3S2A A;  4N3B A;  3TL5 A;  3G2S A;  1BU9 A;  3HVE B;  1MZC A;  4YVO A;  1ZBP A;  1L5J A;  2CHW A;  5AJL A;  3CLJ A;  2WXL A;  4G8K A;  1Y8M A;  2XRZ A;  4NQ0 A;  2AVP A;  5EYL A;  3PS6 A;  3QOU A;  3DWL G;  1N4S A;  1OUV A;  2IEJ A;  3FTS A;  2L0T B;  2H6G A;  4TV3 A;  4C48 B;  1JCR A;  2R59 A;  2XRY A;  2P9N G;  3Q79 A;  4AOF A;  5AQ7 A;  4JL0 A;  1V54 E;  4MLP A;  2WXI A;  3HHM A;  3LDZ A;  4U0S A;  4MKT A;  5AEN A;  3SO8 A;  1HO8 A;  3CR3 A;  3FU3 A;  4AM9 A;  1N4Q A;  2J49 A;  1B89 A;  5FIN A;  3E37 A;  4R7L A;  2AXV A;  3D9H A;  4U8V D;  2VSO E;  3EIQ C;  2XEV A;  3HXB A;  3MV2 B;  1IHB A;  4JW1 A;  4UWF A;  1MX6 A;  4QQI A;  4NUR A;  3URZ A;  1QBQ A;  4I2Z A; 
#chains in the Genus database with same CATH homology
 1NI1 A;  4GTS A;  1TNO A;  1TNZ A;  3DSV A;  1D8E A;  1TN6 A;  1FPP A;  1TNY A;  3DST A;  3E30 A;  3E34 A;  1LD7 A;  1O1T A;  1DCE A;  1JCS A;  2ZIR A;  1S63 A;  3HXC A;  1NL4 A;  4GTP A;  4GTR A;  1MZC A;  4LNB A;  3PZ3 A;  1KZO A;  4GTV A;  1LTX A;  1N4R A;  3DSU A;  1N9A A;  1SA5 A;  1D8D A;  1TNB A;  3HXF A;  1SA4 A;  1N4S A;  2IEJ A;  3SFY A;  4EHM A;  2H6G A;  3DRA A;  1JCR A;  3Q79 A;  4GTT A;  1TNU A;  1FT2 A;  3DSW A;  1X81 A;  3Q78 A;  3KSQ A;  1N95 A;  3PZ4 A;  2BED A;  4GTM A;  1O1S A;  1FT1 A;  3HXD A;  3Q7F A;  4L9P A;  1N94 A;  1N4Q A;  3EU5 A;  3Q75 A;  4YDE A;  1KZP A;  3EUV A;  3E32 A;  3Q7A A;  3DPY A;  3HXE A;  3E37 A;  1TN7 A;  4LNG A;  3C72 A;  3DSX A;  1N4P A;  3PZ2 A;  3HXB A;  3SFX A;  2H6I A;  1JCQ A;  4YDO A;  1O1R A;  3E33 A;  1TN8 A;  2ZIS A;  2H6H A;  1O5M A;  3DSS A;  1QBQ A;  3Q73 A;  2R2L A;  1S64 A;  2F0Y A;  2H6F A;  4GTO A;  3KSL A;  1LD8 A;  3PZ1 A;  4MBG A;  4GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...