1JCQA

Crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and the peptidomimetic inhibitor l-739,750
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE, ALPHA SUBUNIT
publication title The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 126
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2001-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1jcqA00
4YDEA 1TN6A 4GTOA 3PZ3A 3HXEA 3PZ4A 1TN8A 1D8EA 4MBGA 1LTXA 4GTQA 3DPYA 3DRAA 1LD8A 2ZISA 3HXFA 1N4RA 1KZOA 3E32A 3PZ1A 2H6GA 3Q7AA 3DSWA 2IEJA 2H6IA 2F0YA 1QBQA 3KSLA 1SA5A 1NI1A 3DSUA 4GTSA 1LD7A 3Q73A 1N9AA 1X81A 3PZ2A 1FT2A 1S64A 4L9PA 1N4SA 3Q78A 1N94A 1FPPA 1O5MA 3DSXA 4GTMA 2R2LA 3HXBA 4GTVA 1S63A 3E30A 4GTTA 1JCQA 1TNZA 3SFXA 1JCSA 4GTPA 1DCEA 3E33A 3Q79A 1NL4A 3HXCA 1FT1A 2H6HA 3E34A 1N95A 4LNBA 3DSTA 1O1SA 3EUVA 1SA4A 1N4PA 2ZIRA 4YDOA 1KZPA 2H6FA 1MZCA 3SFYA 1JCRA 3EU5A 1TNYA 3C72A 1TNOA 4GTRA 1N4QA 3DSSA 1O1RA 1TN7A 4LNGA 3DSVA 3Q7FA 2BEDA 1D8DA 1TNBA 4EHMA 3E37A 3HXDA 3Q75A 1TNUA 3KSQA 1O1TA
chains in the Genus database with same CATH superfamily
2YNQA 3ZGQA 2Y69E 3RU0A 3HXEA 3LYAA 3CQCB 3R9AB 1GW6A 4G25A 2P9PG 4CDRA 3Q9NC 2DZOA 3UT4A 5HKPA 1SA5A 5FZSA 3CHOA 3FUIA 4HOQA 1LD7A 1N11A 3MEKA 3U3WA 3RK6A 1N9AA 1FT2A 2MOWA 3PZDA 4L9PA 5C2YA 2C2LA 3FTYA 3FY4A 1FPPA 3SGHA 1N52A 4A3VA 4U07A 1S63A 3AAAC 2ZU6B 2CHXA 1OXJA 4F7AA 3TXMA 2VSYA 1A17A 1KT0A 3ZW3A 2PQRA 4HLEA 5JJ7A 3VLDA 4GPKA 1N54A 4IN3B 2P9KG 4JD2G 4GMLA 5JJ6A 3MCXA 3ZXSA 3R7RA 3ZEFA 4Z68A 2VYIA 3CK9A 4G26A 2ZIRA 2X38A 4IRUA 2H6FA 5ENRD 5EYPF 1MZCA 3MA5A 4GMRA 2V0PA 5D0QD 3Q4AB 4XI0A 4ILGA 3TWSA 3OAWA 2GRLA 4ILHB 3RJVA 5G04C 5KJMA 5KCMA 3NQPA 1ZB1A 2IFUA 1S0PA 3QB2A 2DCPA 1O1TA 4HI8A 3WG7E 1VDYA 4OYSA 1G3NB 4GCOA 4FA6A 4HXIA 4DPRA 3PZ4A 4UUCA 1BLXB 1OUVA 3FU6A 3QNKA 4FJYA 4B89A 3FH8A 2I2OA 4FP7A 2JEKA 1OWPA 3ENEA 2LUHA 4F6RD 3CKBA 2NXPA 2C0MA 4GTMA 4GTVA 5AQ7A 3T5XA 2AWIA 2DVWA 4G11A 1UN8A 3CEQA 5LOZA 2IONA 4U96D 1ZU2A 5ANLA 2P9NG 3JXIA 2L6BA 3MZLB 5BW8C 4ME2A 3U64A 1SA4A 4JB8P 5LCWC 4GAAA 3R9MA 3D9HA 1H6PA 4L1BA 4A3TA 1TNOA 3NBNB 3AG1E 3FUDA 1N0RA 3PS6A 4N5CA 2XRYA 2EIJE 1HX8A 4HQDA 1WAO1 5DIZA 2X6JA 4G1TA 3KSQA 4KVOA 4U7EB 4EQFA 2I9CA 2XEVA 3TWUA 2VGXA 3RIBA 3IHYA 4HFGA 2LNIA 4MKTA 5AJDA 2ETBA 4DJAA 3EDTB 2WXQA 2GRPB 1NP7A 4FHJA 3C3OA 4O60A 3GZSA 2EIKE 3C3RA 3BG1B 3CHRA 3PE4A 4KT6B 3DSUA 3Q47B 3ZHEA 3FUMA 3CK7A 1UOHA 3Q78A 4N3AA 3QAQA 3ULQA 4CYMD 4U95D 1K1AA 2VSNA 4JW1A 4PS3A 3O4ZA 2P9SG 2WXNA 2XS8A 2LSUA 2OEVA 4WWOA 2X6IA 3UQ3A 3E33A 2XEHA 4AM9A 1H6KA 3ONKA 1IYGA 1QYMA 1OWMA 3DWLG 2GRQB 4I9EA 5HRYA 3FEXA 4AXHA 1ELKA 4YVQC 3SY2A 4PS8A 1P5QA 2GROB 2GRRB 1LF8A 3W9FA 3HVEA 3C72A 2J49A 3LVQE 4GTRA 3S7DA 4X8QA 1MX2A 2WXKA 2B6CA 5CERB 2M63A 3CHPA 5G2NA 3BG0B 3Q9UC 2WXRA 2VTBA 3G2UA 4LSZE 4YDEA 3CVLA 3L6AA 4HNAD 3T8MA 1D8EA 1WY6A 4HRMB 3KD7A 4CRWA 5IY5E 1U3DA 1MYOA 3SBTB 1Z6TA 4JHRA 4M7CA 4DX5D 4FLBA 3D9NA 3UM0A 2AXZA 4R7LA 3TG4A 4J7WA 1ELWA 3SFZA 3C5RA 3FUHA 1N4SA 3Q5MA 1O5MA 1OWNA 1YYHA 4O6FA 5HS0A 3UT7A 4I43A 4C48B 4WWNA 3P1UA 4ACKA 5G55A 3P2BA 3SHFA 1Y8MA 3ASOE 5C1DA 1UW4B 4ZFHA 2R02A 1WM5A 2JABA 4I1OB 4BT8A 3QC1A 4HBDA 1DCQA 2LAIA 4I6JA 4ATGA 3BEEA 1YCSB 5ENTD 2WQ6A 3FUEA 3CGHA 4BTBA 4HOTA 3UUXA 5EYLA 4DI4A 5E75A 3J5QB 5CMWA 4RG9A 5ENNA 2UY1A 1Q2ZA 2LXLA 4PH4B 4XIFA 5CBNA 4G23A 4BETA 3D9MA 1BU9A 1BI7B 5LCWJ 3ZYQA 3DPYA 3BU8A 4O1OA 1TEZA 3ABKE 3E32A 5A23A 3CHSA 3TL5A 2GGFA 3HHMA 3ONLA 5J08A 4JZYA 2QY7A 1SVXA 3RKVA 1Z3XA 4LRZA 3PVLA 4KZ0A 1DVPA 2RFAA 5EIBE 1TYQG 3LY9A 4UWFA 4GZ3A 3V2XA 3LCAA 3R7QA 3MGBA 2WM9A 2BUGA 1ZBPA 3ESKA 2WXPA 3UTMA 1FVHA 3U4TA 1JCQA 3CVXA 5BUZA 4ANVA 3ULYA 2L0IA 3EU9A 5AENA 4LERA 1NA3A 3SF4A 4O1PA 3Q49B 3IV0A 3VTYA 2PM6A 3L9TA 2ZGDA 3FTUA 2VGYA 4RVBA 2XS1A 4TXQA 2WXGA 4LEUA 3DEOA 5AYWD 1MJ0A 4J8FA 4UQXA 1IHGA 4BESA 4Y6WA 3ABLE 4RSYA 5KJNA 1K1BA 2ZGGA 2WXFA 3TGOA 2WPVA 5BXUA 4CCAA 3OXGA 2EINE 3TAXA 1ELRA 1E7UA 4FLHA 4KYOB 2GW1A 4J8YA 2LAHA 3UM2A 2EILE 4I1AA 2KCLA 4FU3A 3FDHA 1LD8A 3ZRHA 4JL0A 5EN5D 3PZ1A 1HF8A 3EIQC 5CRVA 2FO7A 3DSWA 2H6IA 2WXOA 3PH0C 4K03A 4YDWA 5B3SE 4HI9A 4ANWA 4KVMA 2GRNB 3ESLA 4QQIA 3CV0A 4LCTA 5FJYA 3X2QE 3HXBA 2WXJA 2I1JA 1HXIA 3CVYA 4UQZA 4UWKA 1W3BA 4Q96A 1DC2A 2LXMA 5D66A 3SQVA 2FI7A 4BSXA 1YMPA 3QK0A 2AVPA 4MS6A 3EUVA 1EDUA 2AJAA 3CVPA 2HR2A 1KZPA 3FUNA 3BUAA 2RD0A 4PUCA 4WAFA 3ASFA 3MKRA 5JHAA 4F1PA 3DSSA 3IKOB 5FQ6A 2IOLA 4LNGA 5CHEE 2P58C 3RO2A 1TNBA 4BX9A 3UKRG 3FTSA 3UIOC 4GTOA 1IQUA 5FIOA 5ENPD 1E7VA 5FZRA 2ZISA 4GZ6A 2V4HC 3AS5A 2ETCA 4J8EA 5BV1A 2VJ8A 3CVNA 1SQMA 2PQNA 4TRQA 5FQ8A 4DX1A 1DNPA 2DWZA 5LP0A 3FU3A 3T8KA 4ABNA 3B95A 3ZYKA 1FVFA 3K9IA 2R59A 2KZTB 4ZHBA 3AS8A 3EJNA 5FT9A 2IU1A 3ABME 1DCEA 1K8KG 3PREA 1QQEA 1H6OA 5FZQA 4CGWA 2F8XK 2LO6A 3IEGA 4CEMA 3D9IA 3LDZA 2UWJG 4GB9A 3KEZA 2XENA 2LSVA 3CVUA 4BWRA 4BTAA 2ZXWE 3EU5A 5A7DB 4WUYA 3CSTA 2A4ZA 2Y4UA 2R05A 4ACLA 2R5SA 5ITZF 5CMYA 2XZDG 4BT9A 5ENQD 1MX4A 2BEDA 4GMJA 2NSZA 2XGSA 2J08A 1Z3YA 3CHMA 3T5VA 2DZNA 4G8LA 4CDMA 4WWPA 4RG6A 2WMOA 4K5AB 4A1SA 3TWQA 3ZVVA 3LXUX 3AG2E 2R03A 4DLOA 3DXMG 5FQ7A 3NZSA 4FHKA 4AY5A 1IXVA 3PDNA 4JHKA 3FTXA 4URKA 4PDXA 4B94A 1V55E 5EIDA 4OVUA 3UXGA 1X5BA 2VGEA 2ETAA 1U2VG 1RZ4A 5KBAA 3Q79A 4F53A 1JWFA 3FU5A 2H6HA 3ZXPA 2IO2C 3PEVB 2WB2A 3U9WA 4EZKA 5KJKA 4CZ2D 5T3RA 3ZU7B 3FULA 3DSTA 5FINA 1O1SA 4GA2A 3ULEG 3L82A 4EPZA 5BXOA 4B8AA 1E90A 5AQ9A 3D9KA 3L22A 3G2WA 4HOSA 5AQAA 3S7JA 3Q7FA 4TXPA 4QFVA 5M72A 3O48A 3D9LA 1OCZE 5E76A 3LY8A 4MRUA 4JC8A 3L54A 2QYUA 2OV8A 4DI3A 4APFA 2R17C 5ARFA 3CKCA 4APOA 1SZ9A 5KNGA 3Q15A 1QBQA 3KSLA 2P9UG 3UIPC 1TJCA 4RQIA 4M3OA 1TR4A 2QYJA 3AJIA 3APFA 3PE3A 4NRHB 2Y1LE 5HQ8A 1N94A 2IQCA 4N2QA 3MX3A 4L23A 4EECA 3UM1A 3D9PA 2J4DA 3MYVA 4F3VA 3AU4A 3DBSA 5A6CA 3HXCA 3PEUB 1IHBA 4GZDA 3PUJA 4KXKB 2VSOE 3NF1A 2GRMA 3DXKG 2HO1A 3PNLB 3TWTA 5KJLA 3QKYA 4HRLA 5CRUA 3ZNGA 5AQBA 3V31A 2XGOA 3URZA 4JA9A 3ASGA 1N4PA 3FEYA 2X6FA 4UWGA 2V5FA 3VLFA 1N4QA 2BTDA 4BEPA 4BX8A 4JHJA 4LUNU 3G2SA 4PS7A 3DSVA 4NURA 4U0ZA 1NZNA 4XEIG 2B0OE 4WNDA 3UKUG 2E2EA 1E8ZA 2BKGA 1TN6A 2J9QA 3PZ3A 3T9KA 4HORA 4CT4A 3D9OA 1L5JA 2KC7A 3APDA 4HRNA 3I4RB 3PNTB 1MHQA 2AW6A 2L0TB 5AAOA 2F37A 3ASHA 1EPUA 2IEJA 3SBSA 2DIWA 2WXLA 3ZN3A 4AIFA 4JA7A 3ASDA 3EHNA 2KCKA 4W9RA 3TWXA 2ONDA 2FEZA 5BPPA 3KS2A 1HG2A 1RW2A 2HE0A 2R2LA 2VQ2A 5EILA 4EBAG 2MHKA 2PL2A 3SFXA 2XZTG 5EDSA 5JMND 2MRIA 4D10C 3UMVA 3E34A 1N95A 3E4BA 3HYMB 3MV2B 3LJNA 4MLPA 3I3NA 2X6KA 1IKND 4J6IA 2KM4A 4DX2A 4JXTA 4U0SA 2VTBB 3GZ1A 5D0OD 4GZCA 1NFIE 3TWWA 2FULA 5G05J 3NB2A 4L2YA 4UI9K 1H19A 2CG3A 1B89A 4EBAA 3V30A 1D8DA 3AG3E 3TG5A 3LJ3A 4A63B 3Q75A 4AY6A 1OWLA 3CHQA 3RO3A 4GZ5A 2XEEA 4FADA 1TN8A 3TWRA 4GCNA 3APCA 4OAVB 3FUFA 1N4RA 5H7PA 5JJTA 3RRMB 2A5EA 2IJGX 5ENSD 4L7TA 3SO8A 2OVBA 5CEDB 4YVOA 1TJFA 3PZ2A 2BKKB 5LX8A 3LS8A 1OCRE 1H2TC 2PNNA 3LVRE 2KZTA 4TV3A 3RRUA 4YNDA 2RFMA 2P9LG 2AXUA 2XCBA 1FCHA 2Y0BG 2JLBA 2ILRA 4OVVA 3C98A 2I1KA 4N2SA 2XPZA 2A5UA 4Y6CA 3ISMC 3ZIMA 3QDNA 4V3IA 4WNFA 2EIME 4N3BA 3NOCD 4I1MA 2X3MA 4XZ4A 5KNHD 2CFZA 3KAEA 1OCCE 4XKBA 1EYHA 2AXVA 3QOUA 3B7RL 1KPSB 3HDXA 2E0IA 5AJLA 4UI9J 4H7XA 3MV3B 4I17A 4N3CA 3OXLA 5J90A 5FWQA 3JCKC 4DRXE 3FWVA 3FTZA 2Y3AA 2FO1E 2CFUA 4U8VD 2XPYA 3QWVA 3ZFWA 1HE8A 3AS4A 3VTXA 3MKQB 4NACA 3EHRA 4GU5A 1BD8A 1K3ZD 5ARGA 4AVXA 3LPZA 3Q73A 3S7FA 5JA4D 3QARA 2YQ8A 2YINA 3DSXA 2XHEA 1OCOE 1HS6A 4I6GA 3CVWA 4B0ZA 4U0UA 3B7BA 4GA1A 1FT1A 3TJPA 4G24A 4FULA 3QWWA 3L16A 5EX3A 1JUQA 4E85A 4AP2A 4HS2A 4Q69A 1U3CA 4AEZC 1HO8A 1H2VC 1PAQA 4DLQA 2BF0X 1JWGA 2F8YA 4HLLA 1H2UA 4JEHA 2OVFA 4P29A 3B13A 1XNFA 2WXMA 3ASNE 3OXFA 2OCCE 2X6HA 3S2AA 1TN7A 3HIZA 2XGMA 4FJZA 1UN9A 4BSZB 2WQ7A 3GZ2A 3UX4A 2DBAA 4LNUD 5ENOD 4MBGA 3GW4A 3NZUA 3NAWA 1HG5A 3CVVA 2V8SE 4U63A 2H6GA 3L17A 1UJJA 3Q7AA 4U8YD 3JUIA 4N5QA 3B7UX 4TUMA 2KATA 1UJKA 4C0EA 3CLJA 1A5EA 1X81A 3L13A 4EZLA 4DX6D 3SNXA 4J8DA 3FTWA 4ANUA 2YHCA 3QWPA 3IHVA 1INZA 3C3QA 3E30A 4GTTA 4H7YA 1Z5SC 4XI9A 3EHMA 2NC9A 1JCSA 4GTPA 2QZAA 4A1GA 2C0LA 2QC9A 3LEWA 3ML8A 3CR3A 4CDNA 3G2TA 4ILIA 2XCCA 3JQ1A 4J0UA 1PC2A 4JPSA 4C0MA 5CCLA 4ANXA 4YDOA 3FHEA 2KXPC 5G05C 1JCRA 2J4BA 2DYSE 3IXEA 4CGVA 2EQXA 4K0RA 1O1RA 1E96B 2V4LA 3B7SA 3ZUVB 4XX5A 1OY3D 1E8YA 1IQRA 4L2LA 1HU3A 1TNUA 4J8SA 2HYZA 3MJWA 2P2CP 5EKQD 2PM7A 4JEUA 4AJWA 1LTXA 4GTQA 4ATZD 3HXFA 2XRZA 1D9SA 3NOGD 4GTSA 4Q94A 4TUUA 3RAUA 1SZAA 3EIJA 4BFRA 4GYOA 4K5BA 4DX7D 2WVIA 2P9IG 2XPIA 2IY0C 3FUJA 2J07A 2PZIA 3CIAA 4JVSA 3HG0D 5BT1A 5AARA 4BERA 3JUEA 1QZ2A 2YHEA 3EHQA 3PRZA 1Y6IA 4LNBA 1BPOA 2MYOA 3TWVA 4TXRA 3FTVA 1S70B 4HOUA 3PUKA 2KBXA 1BI8B 1NA0A 3UPVA 1TNYA 3I5PA 3SZ7A 4B93B 3IBEA 3JYSA 4IULA 2CG2A 5B1BE 4UI9C 2IO3C 2QFCA 1AP7A 5G04J 3V2OA 4UQYA 4U8HA 3HXDA 4EHMA 4HVBA 4KZCA 4DK5A 3B7TA 1KLXA 2WXHA 3I4GA 4GYWA 5D2MC 4AV7A 2CHWA 5BV0A 2VGXB 2OEWA 3CVQA 3DRAA 4I2WA 4GYYA 1KZOA 4GA0A 4F1SA 5CECB 4K5CA 1EF1C 4AOFA 5HI7A 4U04A 1UG3A 1NI1A 5CEAA 4EZJA 4KMOA 3DEPA 2Y4TA 1MQSA 3HRAA 2DYRE 3ZHEB 3L08A 4FC8A 3CK8A 5KWDA 1TNZA 1HH8A 4UWLA 5BNWA 4DUIA 4WNGA 1NL4A 4OAUC 3ZKJA 4B8CB 3S7BA 2I6HA 2RKKA 5T4YA 5DBKA 3FH7A 4I9CA 3W9GA 3U66A 1N0QA 1JPLA 3UINC 4KBQA 1MX6A 2NYJA 3CSFA 3KEAA 4GPMA 3D3MA 3WXXA 1QNFA 5CBOA 4G2VA 3SFYA 4I2ZA 3HVEB 3F6QA 3ZYMA 1OT8A 4HB5A 4RLYA 3RSEG 4WNEA 2L6JA 4LG6A 5AN8A 3OTNA 3LKUA 5ANRA 3UM3A 1XGWA 4E6HA 3SD5A 1AWCB 1SW6A 3FH5A 3ZPJA 1WG0A 2J8SD 3FP3A 1KT1A 2OOEA 4CT0A 2VSXE 5JHBA 2Q7FA 3ML9A 5AIJA 3BQOA 1PY1A 3MKQA 2F0YA 2IF4A 3JXJA 1V54E 3FU0A 3SI5A 3FUKA 4G8KA 1S64A 4IYPA 2WQHA 3N71A 4A55A 2FBNA 5CCMA 3CQGB 2IOSA 2RG8A 4NQ0A 3RRNB 3UT8A 2L9BA 3AU5A 5LFAA 4UWHA 2CHZA 3V79K 4YDYA 4XKCA 3JQ0A 4NIKA 3FFLA 1WDYA 5EX0A 1H0AA 1HZ4A 3G2VA 3TXNA 5FQ4A 2WXIA 1E8WA 2KCVA 3UI2A 2HM8A 2WMNA 2XQ0A 3D9JA 3AG4E 5T8IA 3J5PA 2FF4A 5FTPA 1HFAA 4C9BB 3VLEA 3LY7A 5B1AE 3QJZA 2V5QC 1OWOA 1YA0A 3GYZA 3DPDA 2J09A 1E8XA 4N39A 3E37A 4BY6A 4I6EA 3ZYLA 2UY1B 4XE0A
chains in the Genus database with same CATH topology
4YDEA 1TN6A 4GTOA 3PZ3A 3HXEA 3PZ4A 1TN8A 1D8EA 4MBGA 1LTXA 4GTQA 3DPYA 3DRAA 1LD8A 2ZISA 3HXFA 1N4RA 1KZOA 3E32A 3PZ1A 2H6GA 3Q7AA 3DSWA 2IEJA 2H6IA 2F0YA 1QBQA 3KSLA 1SA5A 1NI1A 3DSUA 4GTSA 1LD7A 3Q73A 1N9AA 1X81A 3PZ2A 1FT2A 1S64A 4L9PA 1N4SA 3Q78A 1N94A 1FPPA 1O5MA 3DSXA 4GTMA 2R2LA 3HXBA 4GTVA 1S63A 3E30A 4GTTA 1JCQA 1TNZA 3SFXA 1JCSA 4GTPA 1DCEA 3E33A 3Q79A 1NL4A 3HXCA 1FT1A 2H6HA 3E34A 1N95A 4LNBA 3DSTA 1O1SA 3EUVA 1SA4A 1N4PA 2ZIRA 4YDOA 1KZPA 2H6FA 1MZCA 3SFYA 1JCRA 3EU5A 1TNYA 3C72A 1TNOA 4GTRA 1N4QA 3DSSA 1O1RA 1TN7A 4LNGA 3DSVA 3Q7FA 2BEDA 1D8DA 1TNBA 4EHMA 3E37A 3HXDA 3Q75A 1TNUA 3KSQA 1O1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDE A;  1TN6 A;  4GTO A;  3PZ3 A;  3HXE A;  3PZ4 A;  1TN8 A;  1D8E A;  4MBG A;  1LTX A;  4GTQ A;  3DPY A;  3DRA A;  1LD8 A;  2ZIS A;  3HXF A;  1N4R A;  1KZO A;  3E32 A;  3PZ1 A;  2H6G A;  3Q7A A;  3DSW A;  2IEJ A;  2H6I A;  2F0Y A;  1QBQ A;  3KSL A;  1SA5 A;  1NI1 A;  3DSU A;  4GTS A;  1LD7 A;  3Q73 A;  1N9A A;  1X81 A;  3PZ2 A;  1FT2 A;  1S64 A;  4L9P A;  1N4S A;  3Q78 A;  1N94 A;  1FPP A;  1O5M A;  3DSX A;  4GTM A;  2R2L A;  3HXB A;  4GTV A;  1S63 A;  3E30 A;  4GTT A;  1JCQ A;  1TNZ A;  3SFX A;  1JCS A;  4GTP A;  1DCE A;  3E33 A;  3Q79 A;  1NL4 A;  3HXC A;  1FT1 A;  2H6H A;  3E34 A;  1N95 A;  4LNB A;  3DST A;  1O1S A;  3EUV A;  1SA4 A;  1N4P A;  2ZIR A;  4YDO A;  1KZP A;  2H6F A;  1MZC A;  3SFY A;  1JCR A;  3EU5 A;  1TNY A;  3C72 A;  1TNO A;  4GTR A;  1N4Q A;  3DSS A;  1O1R A;  1TN7 A;  4LNG A;  3DSV A;  3Q7F A;  2BED A;  1D8D A;  1TNB A;  4EHM A;  3E37 A;  3HXD A;  3Q75 A;  1TNU A;  3KSQ A;  1O1T A; 
#chains in the Genus database with same CATH topology
 2YNQ A;  3ZGQ A;  2Y69 E;  3RU0 A;  3HXE A;  3LYA A;  3CQC B;  3R9A B;  1GW6 A;  4G25 A;  2P9P G;  4CDR A;  3Q9N C;  2DZO A;  3UT4 A;  5HKP A;  1SA5 A;  5FZS A;  3CHO A;  3FUI A;  4HOQ A;  1LD7 A;  1N11 A;  3MEK A;  3U3W A;  3RK6 A;  1N9A A;  1FT2 A;  2MOW A;  3PZD A;  4L9P A;  5C2Y A;  2C2L A;  3FTY A;  3FY4 A;  1FPP A;  3SGH A;  1N52 A;  4A3V A;  4U07 A;  1S63 A;  3AAA C;  2ZU6 B;  2CHX A;  1OXJ A;  4F7A A;  3TXM A;  2VSY A;  1A17 A;  1KT0 A;  3ZW3 A;  2PQR A;  4HLE A;  5JJ7 A;  3VLD A;  4GPK A;  1N54 A;  4IN3 B;  2P9K G;  4JD2 G;  4GML A;  5JJ6 A;  3MCX A;  3ZXS A;  3R7R A;  3ZEF A;  4Z68 A;  2VYI A;  3CK9 A;  4G26 A;  2ZIR A;  2X38 A;  4IRU A;  2H6F A;  5ENR D;  5EYP F;  1MZC A;  3MA5 A;  4GMR A;  2V0P A;  5D0Q D;  3Q4A B;  4XI0 A;  4ILG A;  3TWS A;  3OAW A;  2GRL A;  4ILH B;  3RJV A;  5G04 C;  5KJM A;  5KCM A;  3NQP A;  1ZB1 A;  2IFU A;  1S0P A;  3QB2 A;  2DCP A;  1O1T A;  4HI8 A;  3WG7 E;  1VDY A;  4OYS A;  1G3N B;  4GCO A;  4FA6 A;  4HXI A;  4DPR A;  3PZ4 A;  4UUC A;  1BLX B;  1OUV A;  3FU6 A;  3QNK A;  4FJY A;  4B89 A;  3FH8 A;  2I2O A;  4FP7 A;  2JEK A;  1OWP A;  3ENE A;  2LUH A;  4F6R D;  3CKB A;  2NXP A;  2C0M A;  4GTM A;  4GTV A;  5AQ7 A;  3T5X A;  2AWI A;  2DVW A;  4G11 A;  1UN8 A;  3CEQ A;  5LOZ A;  2ION A;  4U96 D;  1ZU2 A;  5ANL A;  2P9N G;  3JXI A;  2L6B A;  3MZL B;  5BW8 C;  4ME2 A;  3U64 A;  1SA4 A;  4JB8 P;  5LCW C;  4GAA A;  3R9M A;  3D9H A;  1H6P A;  4L1B A;  4A3T A;  1TNO A;  3NBN B;  3AG1 E;  3FUD A;  1N0R A;  3PS6 A;  4N5C A;  2XRY A;  2EIJ E;  1HX8 A;  4HQD A;  1WAO 1;  5DIZ A;  2X6J A;  4G1T A;  3KSQ A;  4KVO A;  4U7E B;  4EQF A;  2I9C A;  2XEV A;  3TWU A;  2VGX A;  3RIB A;  3IHY A;  4HFG A;  2LNI A;  4MKT A;  5AJD A;  2ETB A;  4DJA A;  3EDT B;  2WXQ A;  2GRP B;  1NP7 A;  4FHJ A;  3C3O A;  4O60 A;  3GZS A;  2EIK E;  3C3R A;  3BG1 B;  3CHR A;  3PE4 A;  4KT6 B;  3DSU A;  3Q47 B;  3ZHE A;  3FUM A;  3CK7 A;  1UOH A;  3Q78 A;  4N3A A;  3QAQ A;  3ULQ A;  4CYM D;  4U95 D;  1K1A A;  2VSN A;  4JW1 A;  4PS3 A;  3O4Z A;  2P9S G;  2WXN A;  2XS8 A;  2LSU A;  2OEV A;  4WWO A;  2X6I A;  3UQ3 A;  3E33 A;  2XEH A;  4AM9 A;  1H6K A;  3ONK A;  1IYG A;  1QYM A;  1OWM A;  3DWL G;  2GRQ B;  4I9E A;  5HRY A;  3FEX A;  4AXH A;  1ELK A;  4YVQ C;  3SY2 A;  4PS8 A;  1P5Q A;  2GRO B;  2GRR B;  1LF8 A;  3W9F A;  3HVE A;  3C72 A;  2J49 A;  3LVQ E;  4GTR A;  3S7D A;  4X8Q A;  1MX2 A;  2WXK A;  2B6C A;  5CER B;  2M63 A;  3CHP A;  5G2N A;  3BG0 B;  3Q9U C;  2WXR A;  2VTB A;  3G2U A;  4LSZ E;  4YDE A;  3CVL A;  3L6A A;  4HNA D;  3T8M A;  1D8E A;  1WY6 A;  4HRM B;  3KD7 A;  4CRW A;  5IY5 E;  1U3D A;  1MYO A;  3SBT B;  1Z6T A;  4JHR A;  4M7C A;  4DX5 D;  4FLB A;  3D9N A;  3UM0 A;  2AXZ A;  4R7L A;  3TG4 A;  4J7W A;  1ELW A;  3SFZ A;  3C5R A;  3FUH A;  1N4S A;  3Q5M A;  1O5M A;  1OWN A;  1YYH A;  4O6F A;  5HS0 A;  3UT7 A;  4I43 A;  4C48 B;  4WWN A;  3P1U A;  4ACK A;  5G55 A;  3P2B A;  3SHF A;  1Y8M A;  3ASO E;  5C1D A;  1UW4 B;  4ZFH A;  2R02 A;  1WM5 A;  2JAB A;  4I1O B;  4BT8 A;  3QC1 A;  4HBD A;  1DCQ A;  2LAI A;  4I6J A;  4ATG A;  3BEE A;  1YCS B;  5ENT D;  2WQ6 A;  3FUE A;  3CGH A;  4BTB A;  4HOT A;  3UUX A;  5EYL A;  4DI4 A;  5E75 A;  3J5Q B;  5CMW A;  4RG9 A;  5ENN A;  2UY1 A;  1Q2Z A;  2LXL A;  4PH4 B;  4XIF A;  5CBN A;  4G23 A;  4BET A;  3D9M A;  1BU9 A;  1BI7 B;  5LCW J;  3ZYQ A;  3DPY A;  3BU8 A;  4O1O A;  1TEZ A;  3ABK E;  3E32 A;  5A23 A;  3CHS A;  3TL5 A;  2GGF A;  3HHM A;  3ONL A;  5J08 A;  4JZY A;  2QY7 A;  1SVX A;  3RKV A;  1Z3X A;  4LRZ A;  3PVL A;  4KZ0 A;  1DVP A;  2RFA A;  5EIB E;  1TYQ G;  3LY9 A;  4UWF A;  4GZ3 A;  3V2X A;  3LCA A;  3R7Q A;  3MGB A;  2WM9 A;  2BUG A;  1ZBP A;  3ESK A;  2WXP A;  3UTM A;  1FVH A;  3U4T A;  1JCQ A;  3CVX A;  5BUZ A;  4ANV A;  3ULY A;  2L0I A;  3EU9 A;  5AEN A;  4LER A;  1NA3 A;  3SF4 A;  4O1P A;  3Q49 B;  3IV0 A;  3VTY A;  2PM6 A;  3L9T A;  2ZGD A;  3FTU A;  2VGY A;  4RVB A;  2XS1 A;  4TXQ A;  2WXG A;  4LEU A;  3DEO A;  5AYW D;  1MJ0 A;  4J8F A;  4UQX A;  1IHG A;  4BES A;  4Y6W A;  3ABL E;  4RSY A;  5KJN A;  1K1B A;  2ZGG A;  2WXF A;  3TGO A;  2WPV A;  5BXU A;  4CCA A;  3OXG A;  2EIN E;  3TAX A;  1ELR A;  1E7U A;  4FLH A;  4KYO B;  2GW1 A;  4J8Y A;  2LAH A;  3UM2 A;  2EIL E;  4I1A A;  2KCL A;  4FU3 A;  3FDH A;  1LD8 A;  3ZRH A;  4JL0 A;  5EN5 D;  3PZ1 A;  1HF8 A;  3EIQ C;  5CRV A;  2FO7 A;  3DSW A;  2H6I A;  2WXO A;  3PH0 C;  4K03 A;  4YDW A;  5B3S E;  4HI9 A;  4ANW A;  4KVM A;  2GRN B;  3ESL A;  4QQI A;  3CV0 A;  4LCT A;  5FJY A;  3X2Q E;  3HXB A;  2WXJ A;  2I1J A;  1HXI A;  3CVY A;  4UQZ A;  4UWK A;  1W3B A;  4Q96 A;  1DC2 A;  2LXM A;  5D66 A;  3SQV A;  2FI7 A;  4BSX A;  1YMP A;  3QK0 A;  2AVP A;  4MS6 A;  3EUV A;  1EDU A;  2AJA A;  3CVP A;  2HR2 A;  1KZP A;  3FUN A;  3BUA A;  2RD0 A;  4PUC A;  4WAF A;  3ASF A;  3MKR A;  5JHA A;  4F1P A;  3DSS A;  3IKO B;  5FQ6 A;  2IOL A;  4LNG A;  5CHE E;  2P58 C;  3RO2 A;  1TNB A;  4BX9 A;  3UKR G;  3FTS A;  3UIO C;  4GTO A;  1IQU A;  5FIO A;  5ENP D;  1E7V A;  5FZR A;  2ZIS A;  4GZ6 A;  2V4H C;  3AS5 A;  2ETC A;  4J8E A;  5BV1 A;  2VJ8 A;  3CVN A;  1SQM A;  2PQN A;  4TRQ A;  5FQ8 A;  4DX1 A;  1DNP A;  2DWZ A;  5LP0 A;  3FU3 A;  3T8K A;  4ABN A;  3B95 A;  3ZYK A;  1FVF A;  3K9I A;  2R59 A;  2KZT B;  4ZHB A;  3AS8 A;  3EJN A;  5FT9 A;  2IU1 A;  3ABM E;  1DCE A;  1K8K G;  3PRE A;  1QQE A;  1H6O A;  5FZQ A;  4CGW A;  2F8X K;  2LO6 A;  3IEG A;  4CEM A;  3D9I A;  3LDZ A;  2UWJ G;  4GB9 A;  3KEZ A;  2XEN A;  2LSV A;  3CVU A;  4BWR A;  4BTA A;  2ZXW E;  3EU5 A;  5A7D B;  4WUY A;  3CST A;  2A4Z A;  2Y4U A;  2R05 A;  4ACL A;  2R5S A;  5ITZ F;  5CMY A;  2XZD G;  4BT9 A;  5ENQ D;  1MX4 A;  2BED A;  4GMJ A;  2NSZ A;  2XGS A;  2J08 A;  1Z3Y A;  3CHM A;  3T5V A;  2DZN A;  4G8L A;  4CDM A;  4WWP A;  4RG6 A;  2WMO A;  4K5A B;  4A1S A;  3TWQ A;  3ZVV A;  3LXU X;  3AG2 E;  2R03 A;  4DLO A;  3DXM G;  5FQ7 A;  3NZS A;  4FHK A;  4AY5 A;  1IXV A;  3PDN A;  4JHK A;  3FTX A;  4URK A;  4PDX A;  4B94 A;  1V55 E;  5EID A;  4OVU A;  3UXG A;  1X5B A;  2VGE A;  2ETA A;  1U2V G;  1RZ4 A;  5KBA A;  3Q79 A;  4F53 A;  1JWF A;  3FU5 A;  2H6H A;  3ZXP A;  2IO2 C;  3PEV B;  2WB2 A;  3U9W A;  4EZK A;  5KJK A;  4CZ2 D;  5T3R A;  3ZU7 B;  3FUL A;  3DST A;  5FIN A;  1O1S A;  4GA2 A;  3ULE G;  3L82 A;  4EPZ A;  5BXO A;  4B8A A;  1E90 A;  5AQ9 A;  3D9K A;  3L22 A;  3G2W A;  4HOS A;  5AQA A;  3S7J A;  3Q7F A;  4TXP A;  4QFV A;  5M72 A;  3O48 A;  3D9L A;  1OCZ E;  5E76 A;  3LY8 A;  4MRU A;  4JC8 A;  3L54 A;  2QYU A;  2OV8 A;  4DI3 A;  4APF A;  2R17 C;  5ARF A;  3CKC A;  4APO A;  1SZ9 A;  5KNG A;  3Q15 A;  1QBQ A;  3KSL A;  2P9U G;  3UIP C;  1TJC A;  4RQI A;  4M3O A;  1TR4 A;  2QYJ A;  3AJI A;  3APF A;  3PE3 A;  4NRH B;  2Y1L E;  5HQ8 A;  1N94 A;  2IQC A;  4N2Q A;  3MX3 A;  4L23 A;  4EEC A;  3UM1 A;  3D9P A;  2J4D A;  3MYV A;  4F3V A;  3AU4 A;  3DBS A;  5A6C A;  3HXC A;  3PEU B;  1IHB A;  4GZD A;  3PUJ A;  4KXK B;  2VSO E;  3NF1 A;  2GRM A;  3DXK G;  2HO1 A;  3PNL B;  3TWT A;  5KJL A;  3QKY A;  4HRL A;  5CRU A;  3ZNG A;  5AQB A;  3V31 A;  2XGO A;  3URZ A;  4JA9 A;  3ASG A;  1N4P A;  3FEY A;  2X6F A;  4UWG A;  2V5F A;  3VLF A;  1N4Q A;  2BTD A;  4BEP A;  4BX8 A;  4JHJ A;  4LUN U;  3G2S A;  4PS7 A;  3DSV A;  4NUR A;  4U0Z A;  1NZN A;  4XEI G;  2B0O E;  4WND A;  3UKU G;  2E2E A;  1E8Z A;  2BKG A;  1TN6 A;  2J9Q A;  3PZ3 A;  3T9K A;  4HOR A;  4CT4 A;  3D9O A;  1L5J A;  2KC7 A;  3APD A;  4HRN A;  3I4R B;  3PNT B;  1MHQ A;  2AW6 A;  2L0T B;  5AAO A;  2F37 A;  3ASH A;  1EPU A;  2IEJ A;  3SBS A;  2DIW A;  2WXL A;  3ZN3 A;  4AIF A;  4JA7 A;  3ASD A;  3EHN A;  2KCK A;  4W9R A;  3TWX A;  2OND A;  2FEZ A;  5BPP A;  3KS2 A;  1HG2 A;  1RW2 A;  2HE0 A;  2R2L A;  2VQ2 A;  5EIL A;  4EBA G;  2MHK A;  2PL2 A;  3SFX A;  2XZT G;  5EDS A;  5JMN D;  2MRI A;  4D10 C;  3UMV A;  3E34 A;  1N95 A;  3E4B A;  3HYM B;  3MV2 B;  3LJN A;  4MLP A;  3I3N A;  2X6K A;  1IKN D;  4J6I A;  2KM4 A;  4DX2 A;  4JXT A;  4U0S A;  2VTB B;  3GZ1 A;  5D0O D;  4GZC A;  1NFI E;  3TWW A;  2FUL A;  5G05 J;  3NB2 A;  4L2Y A;  4UI9 K;  1H19 A;  2CG3 A;  1B89 A;  4EBA A;  3V30 A;  1D8D A;  3AG3 E;  3TG5 A;  3LJ3 A;  4A63 B;  3Q75 A;  4AY6 A;  1OWL A;  3CHQ A;  3RO3 A;  4GZ5 A;  2XEE A;  4FAD A;  1TN8 A;  3TWR A;  4GCN A;  3APC A;  4OAV B;  3FUF A;  1N4R A;  5H7P A;  5JJT A;  3RRM B;  2A5E A;  2IJG X;  5ENS D;  4L7T A;  3SO8 A;  2OVB A;  5CED B;  4YVO A;  1TJF A;  3PZ2 A;  2BKK B;  5LX8 A;  3LS8 A;  1OCR E;  1H2T C;  2PNN A;  3LVR E;  2KZT A;  4TV3 A;  3RRU A;  4YND A;  2RFM A;  2P9L G;  2AXU A;  2XCB A;  1FCH A;  2Y0B G;  2JLB A;  2ILR A;  4OVV A;  3C98 A;  2I1K A;  4N2S A;  2XPZ A;  2A5U A;  4Y6C A;  3ISM C;  3ZIM A;  3QDN A;  4V3I A;  4WNF A;  2EIM E;  4N3B A;  3NOC D;  4I1M A;  2X3M A;  4XZ4 A;  5KNH D;  2CFZ A;  3KAE A;  1OCC E;  4XKB A;  1EYH A;  2AXV A;  3QOU A;  3B7R L;  1KPS B;  3HDX A;  2E0I A;  5AJL A;  4UI9 J;  4H7X A;  3MV3 B;  4I17 A;  4N3C A;  3OXL A;  5J90 A;  5FWQ A;  3JCK C;  4DRX E;  3FWV A;  3FTZ A;  2Y3A A;  2FO1 E;  2CFU A;  4U8V D;  2XPY A;  3QWV A;  3ZFW A;  1HE8 A;  3AS4 A;  3VTX A;  3MKQ B;  4NAC A;  3EHR A;  4GU5 A;  1BD8 A;  1K3Z D;  5ARG A;  4AVX A;  3LPZ A;  3Q73 A;  3S7F A;  5JA4 D;  3QAR A;  2YQ8 A;  2YIN A;  3DSX A;  2XHE A;  1OCO E;  1HS6 A;  4I6G A;  3CVW A;  4B0Z A;  4U0U A;  3B7B A;  4GA1 A;  1FT1 A;  3TJP A;  4G24 A;  4FUL A;  3QWW A;  3L16 A;  5EX3 A;  1JUQ A;  4E85 A;  4AP2 A;  4HS2 A;  4Q69 A;  1U3C A;  4AEZ C;  1HO8 A;  1H2V C;  1PAQ A;  4DLQ A;  2BF0 X;  1JWG A;  2F8Y A;  4HLL A;  1H2U A;  4JEH A;  2OVF A;  4P29 A;  3B13 A;  1XNF A;  2WXM A;  3ASN E;  3OXF A;  2OCC E;  2X6H A;  3S2A A;  1TN7 A;  3HIZ A;  2XGM A;  4FJZ A;  1UN9 A;  4BSZ B;  2WQ7 A;  3GZ2 A;  3UX4 A;  2DBA A;  4LNU D;  5ENO D;  4MBG A;  3GW4 A;  3NZU A;  3NAW A;  1HG5 A;  3CVV A;  2V8S E;  4U63 A;  2H6G A;  3L17 A;  1UJJ A;  3Q7A A;  4U8Y D;  3JUI A;  4N5Q A;  3B7U X;  4TUM A;  2KAT A;  1UJK A;  4C0E A;  3CLJ A;  1A5E A;  1X81 A;  3L13 A;  4EZL A;  4DX6 D;  3SNX A;  4J8D A;  3FTW A;  4ANU A;  2YHC A;  3QWP A;  3IHV A;  1INZ A;  3C3Q A;  3E30 A;  4GTT A;  4H7Y A;  1Z5S C;  4XI9 A;  3EHM A;  2NC9 A;  1JCS A;  4GTP A;  2QZA A;  4A1G A;  2C0L A;  2QC9 A;  3LEW A;  3ML8 A;  3CR3 A;  4CDN A;  3G2T A;  4ILI A;  2XCC A;  3JQ1 A;  4J0U A;  1PC2 A;  4JPS A;  4C0M A;  5CCL A;  4ANX A;  4YDO A;  3FHE A;  2KXP C;  5G05 C;  1JCR A;  2J4B A;  2DYS E;  3IXE A;  4CGV A;  2EQX A;  4K0R A;  1O1R A;  1E96 B;  2V4L A;  3B7S A;  3ZUV B;  4XX5 A;  1OY3 D;  1E8Y A;  1IQR A;  4L2L A;  1HU3 A;  1TNU A;  4J8S A;  2HYZ A;  3MJW A;  2P2C P;  5EKQ D;  2PM7 A;  4JEU A;  4AJW A;  1LTX A;  4GTQ A;  4ATZ D;  3HXF A;  2XRZ A;  1D9S A;  3NOG D;  4GTS A;  4Q94 A;  4TUU A;  3RAU A;  1SZA A;  3EIJ A;  4BFR A;  4GYO A;  4K5B A;  4DX7 D;  2WVI A;  2P9I G;  2XPI A;  2IY0 C;  3FUJ A;  2J07 A;  2PZI A;  3CIA A;  4JVS A;  3HG0 D;  5BT1 A;  5AAR A;  4BER A;  3JUE A;  1QZ2 A;  2YHE A;  3EHQ A;  3PRZ A;  1Y6I A;  4LNB A;  1BPO A;  2MYO A;  3TWV A;  4TXR A;  3FTV A;  1S70 B;  4HOU A;  3PUK A;  2KBX A;  1BI8 B;  1NA0 A;  3UPV A;  1TNY A;  3I5P A;  3SZ7 A;  4B93 B;  3IBE A;  3JYS A;  4IUL A;  2CG2 A;  5B1B E;  4UI9 C;  2IO3 C;  2QFC A;  1AP7 A;  5G04 J;  3V2O A;  4UQY A;  4U8H A;  3HXD A;  4EHM A;  4HVB A;  4KZC A;  4DK5 A;  3B7T A;  1KLX A;  2WXH A;  3I4G A;  4GYW A;  5D2M C;  4AV7 A;  2CHW A;  5BV0 A;  2VGX B;  2OEW A;  3CVQ A;  3DRA A;  4I2W A;  4GYY A;  1KZO A;  4GA0 A;  4F1S A;  5CEC B;  4K5C A;  1EF1 C;  4AOF A;  5HI7 A;  4U04 A;  1UG3 A;  1NI1 A;  5CEA A;  4EZJ A;  4KMO A;  3DEP A;  2Y4T A;  1MQS A;  3HRA A;  2DYR E;  3ZHE B;  3L08 A;  4FC8 A;  3CK8 A;  5KWD A;  1TNZ A;  1HH8 A;  4UWL A;  5BNW A;  4DUI A;  4WNG A;  1NL4 A;  4OAU C;  3ZKJ A;  4B8C B;  3S7B A;  2I6H A;  2RKK A;  5T4Y A;  5DBK A;  3FH7 A;  4I9C A;  3W9G A;  3U66 A;  1N0Q A;  1JPL A;  3UIN C;  4KBQ A;  1MX6 A;  2NYJ A;  3CSF A;  3KEA A;  4GPM A;  3D3M A;  3WXX A;  1QNF A;  5CBO A;  4G2V A;  3SFY A;  4I2Z A;  3HVE B;  3F6Q A;  3ZYM A;  1OT8 A;  4HB5 A;  4RLY A;  3RSE G;  4WNE A;  2L6J A;  4LG6 A;  5AN8 A;  3OTN A;  3LKU A;  5ANR A;  3UM3 A;  1XGW A;  4E6H A;  3SD5 A;  1AWC B;  1SW6 A;  3FH5 A;  3ZPJ A;  1WG0 A;  2J8S D;  3FP3 A;  1KT1 A;  2OOE A;  4CT0 A;  2VSX E;  5JHB A;  2Q7F A;  3ML9 A;  5AIJ A;  3BQO A;  1PY1 A;  3MKQ A;  2F0Y A;  2IF4 A;  3JXJ A;  1V54 E;  3FU0 A;  3SI5 A;  3FUK A;  4G8K A;  1S64 A;  4IYP A;  2WQH A;  3N71 A;  4A55 A;  2FBN A;  5CCM A;  3CQG B;  2IOS A;  2RG8 A;  4NQ0 A;  3RRN B;  3UT8 A;  2L9B A;  3AU5 A;  5LFA A;  4UWH A;  2CHZ A;  3V79 K;  4YDY A;  4XKC A;  3JQ0 A;  4NIK A;  3FFL A;  1WDY A;  5EX0 A;  1H0A A;  1HZ4 A;  3G2V A;  3TXN A;  5FQ4 A;  2WXI A;  1E8W A;  2KCV A;  3UI2 A;  2HM8 A;  2WMN A;  2XQ0 A;  3D9J A;  3AG4 E;  5T8I A;  3J5P A;  2FF4 A;  5FTP A;  1HFA A;  4C9B B;  3VLE A;  3LY7 A;  5B1A E;  3QJZ A;  2V5Q C;  1OWO A;  1YA0 A;  3GYZ A;  3DPD A;  2J09 A;  1E8X A;  4N39 A;  3E37 A;  4BY6 A;  4I6E A;  3ZYL A;  2UY1 B;  4XE0 A; 
#chains in the Genus database with same CATH homology
 4YDE A;  1TN6 A;  4GTO A;  3PZ3 A;  3HXE A;  3PZ4 A;  1TN8 A;  1D8E A;  4MBG A;  1LTX A;  4GTQ A;  3DPY A;  3DRA A;  1LD8 A;  2ZIS A;  3HXF A;  1N4R A;  1KZO A;  3E32 A;  3PZ1 A;  2H6G A;  3Q7A A;  3DSW A;  2IEJ A;  2H6I A;  2F0Y A;  1QBQ A;  3KSL A;  1SA5 A;  1NI1 A;  3DSU A;  4GTS A;  1LD7 A;  3Q73 A;  1N9A A;  1X81 A;  3PZ2 A;  1FT2 A;  1S64 A;  4L9P A;  1N4S A;  3Q78 A;  1N94 A;  1FPP A;  1O5M A;  3DSX A;  4GTM A;  2R2L A;  3HXB A;  4GTV A;  1S63 A;  3E30 A;  4GTT A;  1JCQ A;  1TNZ A;  3SFX A;  1JCS A;  4GTP A;  1DCE A;  3E33 A;  3Q79 A;  1NL4 A;  3HXC A;  1FT1 A;  2H6H A;  3E34 A;  1N95 A;  4LNB A;  3DST A;  1O1S A;  3EUV A;  1SA4 A;  1N4P A;  2ZIR A;  4YDO A;  1KZP A;  2H6F A;  1MZC A;  3SFY A;  1JCR A;  3EU5 A;  1TNY A;  3C72 A;  1TNO A;  4GTR A;  1N4Q A;  3DSS A;  1O1R A;  1TN7 A;  4LNG A;  3DSV A;  3Q7F A;  2BED A;  1D8D A;  1TNB A;  4EHM A;  3E37 A;  3HXD A;  3Q75 A;  1TNU A;  3KSQ A;  1O1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...