1JDPA

Crystal structure of hormone/receptor complex
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
401
structure length
396
Chain Sequence
EALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of a spring-loaded natriuretic peptide receptor dimer by hormone.
pubmed doi rcsb
molecule keywords ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR
molecule tags Signaling protein
source organism Homo sapiens
total genus 142
structure length 396
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdpA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdpA02
2FW0A 4CBVA 4Z0NA 4RDCA 5T3YA 3Q15C 3GT7A 3Q7RA 4KK3A 4L85A 3H6HA 2NZVG 4G0QA 2RJNA 4M88A 1OXBB 3E3MA 1PUXA 1HEYA 1OXKB 1RZRA 4MYRA 3H1GA 5E3JA 3GV0A 3LUHA 3KS9A 4TN5A 1NY5A 3UUGA 1XHFA 2L17A 4D74A 4Z99A 4ZPJA 2FN8A 3A0UA 3NHZA 3RQIA 1QQBA 4MS1A 1PEYA 4LZLA 2A9RA 1VRVA 5KC9A 5TQ2A 3C3MA 1USGA 3DGFC 3HDGA 1ZESA 4Q6WA 2PUCA 3LUFA 5B3JA 4XFKA 1P6QA 2JVIA 4Z4HA 3OQNA 3JVIA 3L6UA 1NXTA 1JHZA 1WETA 4KRFA 3HM9A 5FBHA 5KQMA 1SXGA 2CD7A 5FWXA 3TMYA 1FFSA 4TLMB 1BVHA 1BA2A 1Y1LA 3QX8A 1USKA 4TLLB 2AYZA 2M1ZA 1E6MA 4E7PA 2WWVD 1D2AA 3O21A 3Q7TA 3SAJA 3T8YA 6ABPA 2MSLA 3LKVA 3QEKA 2R47A 4FE7A 4RKRA 1JDPA 2FMHA 2ID7A 4RSMA 1YTUA 5I4CA 3TD9A 3EJWA 4MLDA 4HNSA 3UK0A 2MSKA 5IUKC 3H1FA 3ILYA 4F8JA 3BBLA 1TMYA 2ZWMA 4N41A 4UHJA 3NHMA 3W9SA 3O1IC 2A9PA 1NXVA 2CWDA 3EDCA 2FN9A 4RWEA 4W5RA 1P2FA 3MMNA 4Q7EA 5JNWA 3EGCA 1DBWA 1K68A 5TQ2B 4MQEB 2FKAA 4JB0A 1JF8A 1QP0A 4MS4A 3MM4A 5CHYA 3N0RA 1E6KA 4GPAA 4GNRA 2GX6A 2JB9A 4RK6A 4N03A 3HVRA 5FWXB 3QEMB 5IUJC 4PYRA 1K66A 1Z12A 8ABPA 4G0PA 4H3HB 3HO1A 4JA2A 2IPMA 1MB3A 1DC7A 2PMCA 1MVOA 1Z13A 3MIZA 4F3TA 4MR7B 4F11A 1APBA 4ZYLA 2JVJA 2JCGA 2XDYA 4RZSA 1ZVVA 3O1HB 5HSGA 1IIBA 1C0EA 4Y9TA 3OLYA 1PEAA 1RPJA 5FWYA 1FFWA 4Z4IA 4EVRA 1JYFA 1ZGZA 3KYIB 1USIA 2FLWA 2IPAB 1Z2DA 4NCBA 2A9QA 3OLXA 7ABPA 2VYCA 4S04A 3ILHA 2PJUA 3OO0A 5DGCA 2R4QA 4G0MA 2RDMA 3CRNA 3NNDA 1ABFA 2RJOA 2PL1A 4Z9BA 3GRCA 4IGAA 2ID9A 2WMYA 1KRWA 1A2OA 4MR8A 1QP4A 1GUBA 3MYYA 5IBQA 4MS3A 3VNAA 2E4ZA 4QICA 9ABPA 4O1HA 1NXOA 4TMYA 2GI4A 3O2QB 3TX6A 1B00A 2QZJA 3KHTA 5D2CA 5BRJA 2NT3A 5BQ3A 3M9XA 4YO7A 3VNBA 2PL9A 5EWJB 3ROTA 3IP7A 4HYEA 4DQDA 2WY2D 3TB6A 3OO1A 4KMRA 4KQCA 2FQWA 2FVYA 2JBAA 5FWYB 1EAYA 1NTRA 3DBIA 3N0XA 2ZAYA 2P9HA 3HS3A 2YHAA 3BILA 3G1WA 4Z4GA 3FDFA 1JFSA 3CG0A 1U0SY 3LUCA 2DRIA 2FEPA 3Q41A 3QELB 4MR9B 1JFTA 2IOYA 1BAPA 1S8NA 5BRAA 1Z2EA 5BR1A 4OLBA 3HUTA 4MQFB 4PZ0A 4YP9A 1QNLA 2IKSA 1LJUA 5EWMA 1ABEA 3A3KA 1U04A 3H5WA 2FMIA 2O20A 4MR8B 1DG9A 3H5IA 4QYMA 1CHNA 4MS3B 4YLEA 1ZN2A 3HCWA 2VK2A 4XARA 5KQPA 1RZRD 1YS7A 3BRSA 4ETIA 2PUDA 1D1QA 3M6MD 4WT7A 1NXPA 1DCMA 1AB5A 3RVSA 1DRJA 2OENG 4LX8A 2JK1A 4UHKA 5JS2A 1D5WA 3CTPA 3HUUA 4YRZA 3OMXA 2QR3A 2MYPA 5EWLA 1YIOA 3DZDA 4N0QA 1Z15A 1DBPA 3EQZA 3QLVC 4FB4A 3C3WA 4MGEA 1P6UA 1RXEA 5KQLA 3IPAA 1ZAYA 5CNIA 3H5OA 1R8JA 3I45A 4XASA 4OTZA 4Z4FA 4RS3A 4LRQA 1M5UA 3HDVA 4IILA 3D02A 2PLNA 3RH0A 4JB2A 3CKMA 2B4AA 1ZGGA 3NNSA 4WZZA 3ROFA 3MA0A 1QO0A 4NV3A 2FMKA 4RK0A 4RK1A 3SG0A 4JASB 1DC8A 1U2PA 1ZY2A 1GCGA 2E4WA 3LUJA 3CLKA 2YHBA 1JYEA 4RY9A 4RU1A 3T6KA 1Z16A 1PHRA 4D6XA 1QO0D 2RGYA 3KKEA 3LUKA 6CHYA 2LP4Y 2X7XA 2GBPA 4MS1B 4WXMA 5T7BA 5TQJA 3RVRA 2GKGA 1P8AA 4MAAA 3RVOA 2WB4A 3SQNA 2WJWA 4LDAA 5TPZA 1Z26A 3HEBA 3H5LA 4JOQA 5JNRA 1BDJA 3H6GA 3P9YA 4ZMSA 5IULC 3OM0A 3OM1A 2QV0A 3C3KA 3KTOA 4YS6A 4RXUA 2Q5CA 4IMIB 5TPZD 2LPMA 1ZHHA 1JLKA 3S99A 3H1EA 3FFTA 3KCNA 3RVNA 1GLGA 1I3CA 3HV2A 4XXHA 1NXXA 3QLUC 3RVKA 3LKBA 3JPWA 4E7OA 3CU5A 5HM6A 1XHEA 3KJXA 3HK2A 4OLAA 3CZCA 1CEYA 2QU7A 5IUNC 5GOTA 4MRMA 4RK7A 5TPWA 2E4VA 1SXIA 1FFGA 1W9HA 1VPWA 2R48A 1M2FA 3FMVA 3OLWA 1FQWA 2VUHB 4ZMRA 2BGGA 3LFTA 1UDRA 3SY8A 1LJLA 3BREA 3OLVA 5DTEA 4EVQA 4KFCA 3O2SB 3IP6A 4WWHA 5TE9A 4G97A 5TQ0A 3CS3A 4W5OA 3LUDA 3RVPA 2CHEA 3OQMA 1FSPA 1E2BA 3JTEA 3NNNA 3D8UA 4MS4B 4KK4A 2QVGA 1URPA 2WJAA 4QYWA 3QLTA 4MPTA 3JY6A 2LUOA 5JS1A 4KREA 3QX9A 2FMFA 4LDZA 2AYXA 1Z18A 4HNQA 4YR7A 4WXEA 1U2QA 1VLZA 1DP4A 4F06A 3RVMA 1EHCA 3MQ4A 4N0PA 1DBQA 1JDNA 3K9CA 5ABPA 1QQAA 5IX8A 3G85A 4S05A 1TM2A 2FLKA 1MAVA 4MRMB 2JRLA 4OATA 3N6VA 4W5NA 3RVQA 1U8TA 3GBVA 4PICA 2FEKA 4PEVA 2NZUG 4KV7A 5KQGA 2P4UA 1A04A 2MYNA 2FSPA 3GYBA 5JNSA 3CNBA 5CNMA 3DLHA 4WUTA 2R25B 2NUBA 3O75A 5KI6A 1QP7A 5TQ0B 4OBBA 4KNYA 5C5CA 3HXMA 3HZHA 1BDHA 4KZKA 5PNTA 1EFAA 1Z17A 2PUEA 1NXSA 5KWSA 1JL3A 3C97A 3H75A 1ZH2A 1KMIY 1A0OA 4XAQA 1E6LA 1AB6A 5DKFA 5GQSA 1LBHA 2FTKE 3OMWA 3QLVA 3SNKA 4IRXA 4LE1A 4Z9AA 3JVDA 2IDMA 3EAFA 2H0AA 2GWRA 4RK5A 1ISRA 4EYQA 1LK0A 1QPZA 4EYGA 1ZH4A 4F12A 2PUBA 3C6QA 3T95A 3O2JA 1KRXA 4Q6BA 4ETNA 1F51E 3KLNA 1XWWA 3FFWA 1DZ3A 2B1JA 3EULA 4O5AA 2MSWA 3F7NA 2J48A 4OG2A 3FGZA 2L18A 3JS5A 2PUGA 2JBAB 5JNUA 2QXYA 4ETMA 3Q7SA 4P1ZA 3O74A 2PE5A 4W5QA 2JVKA 1ZITA 4IMJB 3T38A 4EYKA 2KYRA 4DN6A 1SD5A 4EUKA 3H5VA 3N75A 3LUGA 1YK0A 2FXIA 3Q9SA 5KC8A 4B09A 3OQOA 4MQEA 1F4VA 5IEBA 1JWLA 3IPCA 5EWMB 3N53A 1BDIA 1ISSA 3LMKA 4IF4A 3FFXA 1JX6A 1JBEA 2VUIB 4RV5A 2A9OA 3QEMA 2L19A 4G0ZA 3I5AA 3IP5A 1CYEA 1TVMA 3KG2A 2L2QA 2MYTA 3A10A 4MLCA 4JAVC 3CZ5A 3QLUA 2HQOA 4MR7A 2F8SA 3F6PA 4HNRA 2MYUA 3QK7A 1DCKA 4FE4A 1LBIA 5B3JC 3CFYA 3CHYA 3LOPA 2TMYA 4G0YA 5EWLB 1Z25A 1PNRA 5CNJA 1RNLA 1T34A 1GUDA 1DJMA 5CNKA 2NT4A 1QKKA 4EYOA 1DCFA 2FQXA 3M9WA 4RXTA 3SM9A 2W42A 5JNVA 1D4ZA 2HJ9A 3NBMA 4JP1A 4ML3A 4Z4CA 4KPYA 4EY3A 5JNTA 1MB0A 4EVSA 3F6CA 3UKJA 3RVJA 4RK4A 1D1PA 2E4YA 2PKXA 2F8TA 3KSMA 2N9UA 4YWHA 3HSYA 4N47A 3DGEC 2QSJA 3R0JA 3RVLA 3IDOA 5HQJA 3N0WA 1PNTA 3BRQA 3TO5A 3O1JC 4LE2A 3KYJB 1QMPA 3IP9A 4YGXB 5DLEA 4DADA 1H9CA 4D6YA 2HPHA 2PUAA 2IPNA 4G0XA 3L49A 4NQRA 1C4WA 4KQ9A 2IPLA 3I42A 5EWJA 2LBPA 3GWGA 4EGSA 3GBPA 4RY8A 1NATA 1NXWA 3LTEA 5FBKA 1ZDMA 2PAFA 3E61A 5ED4A 4PE5B 1RXIA 5IEJA 1EWVA 1YMVA 1M5TA 1SXHA 2E4XA 2HSGA 2QVCA 4L4UA 3DLBA 1VKRA 4H60A 4O1IA 2OQRA 4RXMA 3JPYA 3URMA 1L5ZA 2IYNA 5F64A 4YCSA 1JFVA 1JH9A 1SRRA 3QELA 4MR9A 5HKOA 2FEWB 5DCLA 3H5TA 3EODA 2WRZA 4QPJC 4NCAA 4MQFA 5TPWB 2PUFA 1W25A 1TLFA 2V0NA 4W5TA 2E4UA 4N76A 4NICA 1J56A 2I6FA 1L5YA 4KVFA 1YVUA 4XLTA 3GL9A 3K4HA 5IC5A 4P98A 1EWTA 4G0OA 1DRKA 3KLOA 1GCAA 4ZJPA 3A0RB 3MF4A 2H3HA 4H3KB 1KGSA 2CHFA 2HQBA 2HQRA 2FQYA 3CG4A 3I09A 3HJFA 4G86A 1YMUA 3GA5A 3LUAA 4RKQA 5C5EA 1EWKA 3EQ2A 3N8IA 1TJYA 1M2EA 1YS6A 2QW1A 1MIHA 1YK1A 2M98A 4YV7A 4RY0A 2LIVA 4Z4EA 4LE0A 3F73A 3OLZA 3B2NA
chains in the Genus database with same CATH superfamily
5HPYB 3CN7A 5T3YA 5G2OA 1E1CB 3LW7A 2H6EA 2PY6A 3BSFA 1WUJS 3FIUA 3WK7A 1RBZA 4G0QA 2H1RA 3E3MA 1HEYA 3PT5A 4BJ3A 4IIFA 4NZMA 2YW9A 2HFKA 3U3DA 1GILA 4R7GA 4YACA 2GEDA 5A0FA 3K0FA 3PYMA 3NBXX 4Q4AB 1M2JA 4B48A 3IUPA 3UPDA 4EFKA 3FZNA 5SY9A 5I7UA 5CA0A 3IBCA 1FMCA 2Q5HA 3ECAA 3FRHA 1UC8A 2QUZA 4ETWA 1SVSA 2V6MA 1N9KA 5AVRA 1K8XB 2DWCA 3ETDA 4C7OA 2BOVA 1Y4UA 3I5XA 1LQTA 1HPLA 3JQCA 2WIDA 4I99A 3HQ4O 4M2LA 4MJXA 1V7CA 4X9XA 4XOUA 1R0XA 4KR3A 3FRIA 3A1VA 3NBQA 3WWEA 1PTJA 1WVIA 5B37A 1BCRA 4IDNA 4BC1A 4EZIA 4NNJA 5AOAA 4QBKA 1HX7A 4DCMA 4DR2B 4I36A 2X5NA 3O5AA 4WBXC 3USZA 3KEGA 3HI6A 3PGXA 1G5RA 1RD4A 5CLQA 3R6TA 1OIXA 3TXAA 5IWCA 3TRDA 1WTAA 4BMOB 5GVRA 1T5BA 2WD9A 4GGMX 4UZSA 5JRZA 3GAMA 1JDPA 1GAWA 4AW9A 2XA9A 3L1JA 3QXSA 1GNQA 1SUFA 5I4CA 4UQPA 4RJLA 3KUCA 3DE5X 3QKWA 1Z33A 2GBFA 1PJCA 2NN3C 5DNDA 5HQTA 4XWGA 5IT5A 4DB4A 4AMZA 2B7CA 2QRHA 3IBTA 2ZIUB 4FMBB 4E4TA 3NV7A 1XRJA 3L7YA 3CRZA 1N3YA 2ZROA 1GEGA 2BMDA 1ZD1A 1GU7A 1NSFA 2C77A 4I9NA 2EFGA 1KP3A 2XQKA 3T41A 1JDTA 3EGCA 2P9YA 3G59A 4OXXA 2JEOA 5H0IA 1Z6AA 1XO1A 2RHDA 2FKAA 3HH8A 2V98A 5HIMA 4E5PA 1I1QB 2XUOA 3B9BA 4JP3A 4FWIB 1KFEB 1M7BA 2Q1TA 3MM4A 3RASA 3E7XA 4K9NA 3W5HA 3HNOA 1CUDA 4K6KA 1CUHA 4RMHA 3WRYA 1Q74A 3QY0A 4I5FA 2Z5VA 4J1QA 4R3UC 4F86A 5AVZA 2H16A 1KBOA 4Q24A 1VG0B 4CIWA 4C4AA 3MWLA 3C5CA 1NJFA 1ZIXA 4LJ4A 3L6EA 1P1IA 2DLCX 1E64A 1DBRA 3P4YA 3K5WA 2NUTA 1WPRA 1KF0A 4KQEA 4OYHA 1KBZA 3IAM1 2QA5A 1C8BA 1VL1A 2Y6VA 3OURA 1RBMA 4Z5XA 1L5WA 2HA5A 2IXAA 3QEAZ 2QD3A 1OBFO 3L1HA 2FCRA 3GT0A 4JC0A 4MK4A 2G1JA 2X8JA 4II2A 3KOZA 3TPCA 4B87A 3DBHB 3MELA 4FEEA 2CJWA 2POQX 4JVMA 4J0IA 4ZIRB 1D1SA 4KAAA 2FPGA 2GJKA 2D5AA 4ALIA 4GVPA 4B3TB 1E18A 2J3HA 5CBKA 4MULA 5FTNA 4I81A 3U7HB 2VYCA 3P9XA 4YRMA 1P39A 4UM7A 4AL4A 3O83A 4MW4A 1FXUA 3OCZA 5DGTA 4V1CB 3INYA 5LQJA 3CKYA 3CRNA 3KOMA 2RJOA 3WB2A 3ZHTA 1VZ2A 2HRDA 4UHHA 2AOWA 3NO4A 1P2BA 1WSDA 2ID9A 2GZ1A 1W88A 2JGJA 4JGIA 3WC4A 1T9GR 1V11B 3AUJB 4J0DA 4U2DA 5DBHX 4AULA 4F97A 3WK8A 4Y6OA 1GZSA 1NUTA 3SZ3A 2SKEA 2G25A 4O1HA 4DCSA 1DAEA 2Z83A 1CZLA 4ARAA 1I51A 1HYBA 1RW4A 1YFKA 4W8OA 1RYZA 3EGEA 5GMOA 3NR2A 1IHPA 1MC1A 4J0HA 2PK3A 4TUYB 4Q9JA 2SNIE 3LHFA 3OM9A 5FOVA 4NULA 5LKAA 4C7BA 1KK0A 3HYNA 1Z37A 1B4DA 3RS7A 1D7AA 3ZGVA 2C1ZA 2VWHA 4C07A 3KHKA 2JJ2D 1IY8A 1E3QA 2OUIA 4HLNA 2BY4A 2ERXA 1EUZA 1IZ0A 4H4CA 1EXWA 3ODPA 1G4HA 4RJIA 3DLTA 2BFPA 2PYZA 4MZXA 3RYFB 5AUPB 2ODPA 3CWCA 3V8NA 4C4XA 4ND8A 3UWKA 2XMDA 4DQXA 3PZBA 3LPAA 4OXRA 3UZUA 3KKKA 3Q41A 3VPAA 4IDCA 5JO0A 2LZ0A 7REQA 4JLJA 3I92A 3TNLA 1GSIA 1PGNA 1J5EB 3D9QX 3K70D 4HZGA 1XAJA 4KIJA 5K0ZA 3AIOA 3D54D 1FX1A 3NIWA 1N0WA 1RLJA 1C3OB 4L9SA 1LJUA 3GXOA 3NYRA 1MA0A 4D9KA 3SIPA 3KKNA 1QYVA 2VSYA 4PM4A 4KXYA 4ARZB 5AM4A 2GAIA 4N6OA 4ZI5A 3E22A 4RPHA 3WK5A 2H57A 4RD0A 3IDAA 4C3ZA 4PYJA 3HBLA 4Y2GA 1LV7A 3O95A 2OENG 5ALDA 3VDQA 3KSUA 3CVYA 3SKVA 2WTAA 4ZDKA 3RSSA 2OV2A 4M1SA 5U4XA 4F9EA 3AONB 3VTFA 3P96A 3KV1A 1R88A 2MYPA 5A02A 1Z56C 3AFGA 5G1OA 4TTAA 4DBLE 1O87A 1D0IA 2HMWA 3E9CA 1OPXA 2PX3A 1H2RS 1ZAYA 1CJTC 4OGFA 1GFWA 4KX5A 1EXVA 4HRXA 2IBSA 4LWQA 2XZTA 4L6CA 1WV0A 2QM3A 4IIJF 2WC1A 3U80A 5B5SA 3IEPA 3GLHB 3FWHA 3KJHA 1M34B 7AT1A 2Z98A 1IBRA 1MAUA 1N5MA 2CXQA 1RMYA 1KH2A 3LP6A 4HAZA 2AF3C 1Z8DA 3W8RA 1BVUA 2PUWA 4C3OB 4RK0A 1QPZA 3QX3A 2GD6A 3G8CA 1VMAA 2H9AA 3ABZA 2W6JA 5CTAA 4EGAA 2ZZNA 4GOXA 2R7MA 2TSYB 3WNQA 2ZRQA 1GQYA 4X7PA 4GPIB 3HN2A 1GPJA 4F7DA 3GUZA 4MVJM 1WMEA 2X7XA 3FNBA 5DTIA 2OBNA 1PYGA 2GD0A 3SFTA 4BP3A 3I0MA 3RWOA 5JZBA 1RM0A 2V4UA 4PIVA 2OOSA 4YRKA 1RE0A 2OKGA 5T67A 4LDAA 1CWUA 1Y37A 5F77A 4HJXA 4XD7D 1PR0A 1ZD5A 1BDJA 3H6GA 1X8LA 3BDVA 3KSRA 4KI0A 3ZE2B 3I23A 1K63A 3G88A 2LKCA 3B52X 2ZBEA 4HOYA 2Q5CA 3HLTA 4RVUA 2Y99A 4E5YA 5JFTA 3U7GA 2LPMA 1A4IA 1OREA 4L15A 1GZVA 1P7VA 4G4JA 5IC6A 3FXAA 3E7WA 4HTFA 4GH5A 2ZI6A 4DNXA 1KZ6A 4YRBA 5JAZA 4QVIA 3J7TA 5DRTA 3AHIA 1NOIA 2BEWB 2V74B 2WWFA 3KQKA 1BD4A 2HBQA 1FTNA 4O4HF 4UVIA 4LRWA 4ZQIA 3HJAA 1IIRA 4TM8A 3WE7A 3ZWOA 1FVXA 1FXWA 1BZYA 1S3IA 4JB8A 3C7DB 3ENQA 1QVRA 3L4EA 2K6GA 4WY2A 1MRSA 1R0WA 1BS2A 1UXGA 4K8RB 4KQXA 2I7XA 1L7QA 3K94A 1QIGA 3ZHVA 1PX2A 1M1YE 3MOSA 3P32A 4KSCA 2FOIA 1ZBQA 3W34A 3RFUA 1A4XA 1E2BA 1J0XO 1TIPA 1PZXA 4BJ5A 4JHXA 3ZZNA 3U4AA 2HTFA 3OZFA 1Y5MA 1D2HA 2BCEA 1M2OA 2O2HA 3EGDA 4KR7A 4OH1A 3MTQA 1DAGA 3TZCA 1U7DA 4LOHA 1IHXA 2BFDA 2X4DA 5C8YA 3S8YA 1O0CA 4HEHA 4NCJA 5TVGA 4OHUA 5F73A 4CCWA 1KYIA 2V03A 4RF2A 4S1TA 5G0WA 3M6IA 3IUQA 3QFFA 2X3UA 5FLEX 1YU6A 4WHMA 5EYPB 3ZTYA 3ZHBA 1PQYA 2XVYA 1NJ2A 3E48A 1E2FA 4W4TA 2RGNC 1EM6A 1XDGA 3DE3X 4AJJA 1VQ1A 1FPMA 2AFIB 1VJRA 2RAVA 3PUZA 2WPDA 3WNZA 2JI9A 2DECA 5J2TA 5EEHA 2PM8A 3IDZA 4LGYA 3OMLA 3EWNA 1QCDA 4WZBE 3BGIA 1JMKC 1GZUA 3PKZA 5JNSA 1BJRE 3QMWA 3JQ6A 4G5HA 2XI4A 4X54A 4YXFA 4LJSA 3N5KA 2PBRA 1V16A 4R4JA 5CGZA 2F1HA 3O9VA 2J3KA 4DT1B 3R8CA 1M6HA 3O4JA 4XIFA 2YWFA 3M5PA 1TU3A 2ONYA 3AG5A 3BCRA 4G5QA 2FY8A 1XL0A 3VO9A 1EFAA 5HZGA 4QECA 1SG9A 1IPEA 1XZ8A 2OEPA 3EIWA 2V7QA 4Y3UA 1CLEA 2BMFA 3GIWA 2C82A 3KJIA 1LLQA 4MP6A 3PUYA 2GK3A 1RAGA 4QWWA 5KJEA 1G4AE 4YGYA 9LDBA 4XJSA 4OKNA 3IAM6 3ZD6A 3QE4A 2ZXUA 5JXIA 2R7NA 1JLHA 2XLBA 1ZJJA 3EVCA 1A69A 4G9BA 1RPNA 5SYMA 4B3XA 3UFXA 5I48A 1E6EA 3ZJ5A 2OCAA 3X1JA 2XUFA 4RV9A 3M1LA 4MJLA 4C20A 1K0FA 3ZBQA 1DZ3A 2R60A 4BFUA 3HA5A 4RAQA 1XYGA 1DC6A 4MGHA 4N3BA 2CMDA 4H6PA 3H97A 2AMVA 3FGZA 4PFSA 1L4KA 2EL7A 3MWJA 1XN1A 3WDSA 3WP0A 1OXVA 2ZVDA 2CMHA 2DLNA 3MCAA 3NI2A 4E5UA 2QYHA 1DUSA 3TOSA 4XVUA 3VI4B 5C5DA 4TL8A 2PE5A 4W5QA 3DHVA 2WYHA 5K0JA 1FDTA 2FR8C 2OP0A 4J1TA 1X7HA 4G37A 1XZMA 4CM6A 2VYFA 1FJXA 1F0NA 4OF4A 4CCAA 3VNSA 1E79D 2WA2A 3PF9A 4C03A 4MQEA 4UOQA 3UA4A 2VRCD 2WM3A 1FFBA 1NW8A 2Z4TA 5IEBA 1JIXA 2QRQA 3Q0TA 4W6QA 4WN9A 1N9ZA 2YCLA 5ADUS 1JX6A 2CUKA 2X40A 5J59A 2QRPA 3P19A 3MCWA 4J1SA 4Z0HO 3N7AA 4DY4A 2JGLA 1II8A 3KQQA 1QPGA 1EP3B 3SBEA 4GXTA 1D2EA 2B3DA 3PB3A 3UC5A 3ZHRA 1PG5A 5CB4A 2R6CA 2XTNA 1S8FA 4L5IA 3VH3A 3AIIA 1E9SA 3EVDA 2ZVQX 5B3JC 2VS1A 4DDTA 1ZK4A 4ZT6A 1MEOA 3UIEA 2EBUA 3FCCA 3O9ZA 5F33A 5AICA 4BGUA 4P0TA 2C7OA 5FULA 2F1OA 5D00A 1TC2A 3S2FA 3L04A 1U3CA 2IEBA 4HLDA 1IQ0A 3TI7A 1DJMA 3TCXB 4OHCA 4H7FA 5IMSA 4EYOA 3IIEA 1T35A 2AF4C 1U0NA 2P7IA 1SVLA 4W9MC 2AEFA 4O8CA 1E5TA 3RANA 2CEAA 2YBDA 2BF4A 2AB0A 3K1ZA 1WEHA 4HCJA 5FI0B 5BV2P 3U56A 1J6UA 3ANLA 3SLRA 4QBHA 5IF9A 3D3NA 2FWRA 1GPKA 5HKKA 3OE7D 3OPYA 2APJA 3GEPA 1X80A 3DVSX 2YIVX 3CJRA 3IMKA 2UYCA 3V4FA 2BGWA 5T6MA 5F3WB 2PKXA 2O7SA 5LVAA 1B93A 3JZAA 3OEEA 4ARUA 1DV2A 1PJZA 2B0CA 4WY8A 3U3MA 3UW3A 1KAQA 1U9CA 3E1KA 4MITA 4BMPB 5IKXA 2EKZA 4LE2A 4GL2A 1SUCA 4MUAA 4QXOA 5JCJA 4RW0A 3DXZA 3QVWA 4OLJA 3TXXA 4JVOA 2ZKLA 3DBVO 3REGA 5EY5B 2NZ2A 2VXOA 3QE0A 3IA2A 1N2IA 2AI3A 2FK8A 4YC7A 5KOJA 3QJYA 2XUDA 4UJ3A 3MT7A 4D9GA 2Z56A 2Z08A 3EG5A 5LMCA 2YJGA 3QYPA 2RKBA 3LM8A 3U17A 1VJ5A 3CEPB 1EWVA 2W5UA 2E4XA 5I4KA 3M6WA 2DPGA 4A8JC 4BU0A 1JECA 1KI1A 1M73E 2VR1A 1Y6RA 2WAXA 4TVSA 5HKBA 5BNWA 2X2FA 1N34B 1XPJA 2B1QA 5HKOA 1HO3A 5E9WA 1V1MB 3OPVA 2W71A 1PWXA 3EODA 3K9QO 2R751 3FPSA 5HCUA 4DCTA 1TLFA 4JI4B 2C2MA 2V0NA 4Q4JA 5CDSA 5BUSA 3BK2A 1ACJA 2XWJI 3AW9A 3NX4A 1YVUA 4TV9B 1LRLA 1M2KA 3DEZA 1FX0A 4GZLA 4NG5A 3OCXA 4HAXA 4BFCA 4G0OA 1DRKA 1WWKA 2JGRA 4M98A 4Q4LA 4FMCF 4P5EA 1SUWA 3JVEA 4M0PA 4ND1A 5TY0A 2QUHA 4OQQA 3U7QB 3WJ2A 3Q2OA 3TSCA 2PN1A 2FQYA 4YRLA 1VCOA 2ZR7A 3ZTWA 2JI7A 3EQ2A 4KLNA 3ZGNA 5KDDA 3LT2A 1Z4IA 3I37X 3V8RA 4DB2A 4V03A 3TSZA 3WGMA 121PA 4Z4EA 3OJFA 5KJ6A 3ZJTA 2HTEA 3WGQA 1SVMA 3ZE8A 4FFMA 4WXRA 3O1LA 4G4GA 4DUGD 2EFEB 1DAHA 2B98A 1E63A 4XGKA 4BQNA 1BXRA 2B2CA 4A6XA 5AUQA 1P1JA 1N1MA 1SVWA 4DA6A 3IO3A 3TLGA 2O2ZA 3GFGA 2O2XA 3RUPA 4R84A 1XZHA 3BJIC 2R65A 3TZQA 2CHUA 4UASA 1C3VA 3GP5A 3X1YA 4NAUA 1GNVA 3QG1A 3JQFA 3WR5A 5LMUB 3K30A 1GUYA 4JJEA 4GGOA 3VO1A 4WI1A 1MU0A 4XB1A 3KFVA 3UAGA 3WYCA 3LGXA 1H9BA 4TTIA 4EYEA 3A6GA 5K0BA 1NMZA 5JDCC 4EUFA 2GRAA 4EJ0A 2P5TB 4FVTA 1W6RA 4KGVA 3OEYA 4ZPJA 3ZWAA 2IY8A 1PJ8A 2CL6X 2HLDD 1M75A 1R37A 1M2WA 2W22A 4ZOLF 5LQMA 5C1PA 2ZB2A 4H4DA 1E9DA 1SHJA 2YWJA 1ZA2A 5JYCA 2O6HA 1LPAB 2UVPB 3DZCA 4FDVA 1V5WA 3AEYA 4KZPA 4EJMA 1TF5A 1JHDA 1JEOA 1IQRA 4BV3A 1FA9A 1GG5A 4I0WB 4OL0A 3TMYA 1FFSA 4ZTBA 1HDGO 2BHSA 1LK7A 1KC1A 3WLFA 1W5FA 3EC1A 1Z5OA 5IJAA 4GLJA 3TCKA 4ZFNA 5DK6A 1XVAA 3TSAA 2ZWVA 5LA6B 2R8BA 4DA7A 4QPCA 4OXYA 4DKJA 5DYGA 4U7GA 3TOCA 3A1TA 1NT4A 1TQDA 4M3NA 1PK9A 5DGXA 1D6SA 1DQRA 1OF1A 4ZU3A 3LKZA 2YRWA 1FNNA 4F21A 2J3LA 1XLWA 3LCMA 4HAUA 2OCIA 2F3PA 1MT3A 1OH7A 2B1IA 4KIWA 2P7HA 4C22A 2XODA 2J87A 2PG3A 3C14C 4YUYA 2GASA 3E0XA 5E7JA 2AEMA 3IVCA 4OHBA 3UY4A 5IJ0A 5L51A 4ENQA 4IWNA 4LMBA 4XCQA 2QLLA 1PL0A 2PT6A 4CKWA 5L9AA 3FTFA 4KQIA 4Z7QB 1W73A 4ECAA 2F55A 1MJFA 2JIPA 2OCYC 2NZJA 2OT3B 2W4MA 2GAOA 2OD7A 3Q0EA 1KEWA 2JB9A 3RDPA 1Y80A 3AVOA 3DV2A 3U81A 2BUAA 5DHFA 2P1ZA 3SQMA 5AVTA 2PSEA 4BNXA 4MR7B 2HXGA 3ADBA 5IVKA 1AA6A 3VZRA 1F6DA 2VRWA 1GTJ1 1JXAA 5EIWA 4AUEA 4MB6A 3EH1A 2XVAA 3RIMA 4OY3A 1L2TA 2FEOA 1QHGA 3DCNA 2BYTA 3IKJA 4GIBA 4IG9A 3CT4A 1RPJA 2CFIA 3FGNA 4RHYA 3VISA 1NPDA 1V4VA 1H93A 3HB7A 5BV0A 1IB6A 3BFKA 1JYFA 2OFXA 3GN1A 3EDQA 3G9TA 3JALA 1LDBA 3NH6A 4KYUA 4MRVA 3FBTA 1A2KC 1E5QA 1YDHA 4ZI7B 5BNZA 1U0JA 2D5BA 2VF2A 3IJ5A 4D0NA 1DKMA 2C2GA 4WJKB 2R4QA 5F5LA 4IJ5A 3CX6A 3TG2A 4Z86A 3HKDB 2O8BB 1ABFA 1SD2A 2ZAGA 2ZUBA 1CY8A 2FU5C 5LMZA 3V97A 1W4LA 2D62A 1I13A 1UJ5A 2IHVA 2VDKB 3C24A 1Q1QA 4CHTA 1ULZA 4HL6A 2E89A 2JCVA 4ZT4A 3VDNB 4MS3A 4TROA 4ZVUA 4X8OA 2GEFA 1GUZA 3RFVA 1U5BA 3D8TA 5BNIA 2EZ9A 5K0GA 5T4BA 1B00A 2O52A 4OLFA 4ARSA 3VVLA 4EY7A 5BRJA 5BV1A 5HEKA 3Q11A 3F5FA 4GUDA 2J5RA 5TF0A 2R66A 2DMRA 3W7VA 1QUFA 1DT3A 2BM1A 4N9QA 3OESA 1L6IA 4U0KA 2PU7A 4F1WA 5K6TA 3EB9A 3E5RA 2Z2ZA 5I45A 3HJCA 1JG2A 4TYWA 3EXEB 1QH8A 1KY5A 2CJYA 2WW8A 2B5OA 4KYTA 4XJXA 5HJ5A 1OBCA 3HVKA 2C7RA 5IXYA 4P9NA 5CG1A 2AUNA 1NMSA 1TPYA 4WA7A 5HGJA 3W5CA 4FYHA 2NUPB 3UJ6A 4MR9B 2Y1GA 5GJCA 5ECWA 2IOYA 2QS9A 2Z6QA 4YP1A 4XVQA 5A4FS 2WIFA 3QE3A 3F4LA 5JXGA 3S1SA 3AUAA 3OKPA 2FAXA 1KS2A 1Z7GA 4Q4DA 1NNSA 3GZTB 3QWAA 4IO0A 2J3EA 4PLCA 3ZD9A 1Y33E 1ZN2A 4TQAA 1Z62A 4BKRA 5DXFA 2WU3A 3GXBA 4WZAE 3M6MD 4B3JA 3O31A 3VQTA 4Z2AA 3IQIX 3DEFA 1CUVA 4GG1A 5JXJA 2FFQA 2HWUA 4ZI3A 2DH6A 4OAOA 5F52A 1G2IA 1I2ZA 3VVBA 5CTJA 2QZSA 1OU4A 1T24A 4P0QB 4Y1GA 4JXXA 4AWAA 4BB6A 2MJLA 4FB4A 3C3XA 5IM5A 1TB4A 5CLHA 2Q2WA 3DDCA 3U7IA 5F1YA 3FNRA 1SK9A 2UYGA 4FNGA 4N7RA 5CK4A 1IZ8A 2ECKA 2LKDA 4PAOA 5TVKA 4LRQA 2HKIA 3R3JA 1NJSA 2RC6A 3F2IA 1PKEA 1RYFA 4KWCA 4ND3A 5LIRA 4C4OA 4M9ZA 2WUFA 5J40A 1FRFS 3DBLB 1O94C 3EQ8A 3KZKA 2VJPA 4K6CA 1LLUA 2XXAA 2PLNA 4ZVNA 4HPXB 1YS1X 3R77A 1GPNA 1VLVA 2WNIA 5BYKA 2HMVA 1QYCA 1DC8A 4JT2A 1C8KA 2V8BA 4R9UC 2O5VA 3WNVA 2H85A 3TI9A 4RY9A 1AM4D 1NNLA 3DUFA 3AVUA 4H16A 4F4HA 1GUAA 3KKEA 4WXMA 4QQ8A 1UIRA 5TQJA 4A82A 4WRRA 4LJLA 3ZHZA 4PC7A 5DM60 1E6UA 1XV5A 2BR4A 2W98A 1VI2A 3PC3A 2X5XA 3GAZA 3QU7A 3F97A 3DAFA 3OM0A 4HH1A 3SKYA 1GQSA 2PXXA 1MCZA 2QSZA 3C3KA 1I4EB 3EXIB 1IUNA 3MJEA 1FP6A 4JOSA 3KKOA 1TAHA 4WL0A 1KYXA 4MWTA 3UVEA 4B7UA 1KPHA 1DAKA 3KYDA 4YAIA 1W7AA 2ARKA 2EV9A 3FFTA 5JCZA 4E7OA 1MEJA 1GGKA 2WUWE 3QRWA 3VR5D 3ZCQA 5HWSA 3GLUA 3TAXA 1XMOB 3A1DA 2NTVA 4R3NA 2AE2A 4P81A 4RFSA 1F20A 5AW2A 3UMSA 1X39A 2NTJA 3INTA 4Y2QA 4YRRA 2FJPA 1NU8A 2TMDA 2HCRA 1E2LA 2FX3A 3LCVB 5COBA 1KDZA 2BM0A 2GK4A 3IAAA 2FSIA 3E82A 4FZVA 2BFCB 3UFBA 2Y93A 3SKXA 1L8LA 5ULLA 2FRXA 5A0TA 5JBNA 4DIOA 1DRVA 4H1UA 2RHWA 2YVUA 1BFKA 1UAYA 2OG1A 3OTGA 1ZZGA 4WQMA 5FEUA 1KAGA 1QHNA 1T36B 5JJ5A 1ORVA 2AC4A 2CHEA 4I1VA 1NW3A 2P1DA 1NC3A 3I83A 1XXHE 4UJ5A 4QYWA 1UT8A 2LUOA 1K5PA 3NKVA 2C4WA 1ZVJA 3RU2A 2ZKIA 3HJNA 1IDOA 2ZXFA 1ZJZA 2GVNA 3HRHA 4I5IA 4WXEA 4YCAA 3V4OA 3SGLA 1G16A 4AZWA 3WGIA 3DR5A 5FF9A 3T1OA 2W6OA 1EHCA 1OBVA 2OK8A 2JAQA 3OIVA 3Q2IA 5EPUA 4YJ3A 1X7XA 5F5XA 1RE1A 1T4CB 1RFGE 4WADA 3RTGA 2H51A 4XDYA 2XUQA 1EFVA 5BN3A 4LDRA 1DQYA 4UULA 4ALNA 4GOLD 4KV7A 5D6OA 4AD8A 3KYCB 5BMVA 1SBYA 2H29A 4TWBA 1I7NA 4A36A 3H1TA 4G5OA 4DHEA 5DW0A 3UNXA 3DLHA 2E82A 5INTA 2C2HA 4KRGA 4WDQA 3CNOA 3IBFA 2IU4A 4JJ7A 2O4UX 4FDAA 4FIZA 2XTMA 3MXTA 3WQRA 2W93A 3HZHA 3PVSA 2P3LA 4M9RA 4RHUA 2Z8YM 1NW9B 3BIFA 2WOJA 3GK3A 3OG9A 3PL5A 4Q66C 2YUIA 2ZDQA 1NXSA 5ELMA 3C97A 3DOOA 4QGHA 3ZNOA 3LFUA 4CMHA 1C9EA 1C5KA 1O6ZA 2W43A 3ZE1B 3K2QA 2VFAA 2PUHA 4RA6A 4KQHA 2A0KA 3RK0A 4EB0A 1SAYA 4BNLA 3PE6A 4DIBA 2WTEA 1P4GA 2H0AA 1FPQA 3CUWA 4R5MA 4UOZA 4JQZA 5AM0A 1X1EA 5DLQC 4QHSA 4LF7B 3LL4A 3PQDA 4JK3A 2A88A 3ITEA 3BE8A 1EGMB 4P31A 2AMLA 4X85A 1HUQA 1MC5A 5FFFA 4DS3A 2ZIWB 4MDEA 3A2KA 2PNFA 1V8ZA 3I30X 3MT0A 1FSFA 2OB2A 3AERB 1XC7A 3CVOA 3A9WA 1JSCA 1UMBB 2IIPA 3OT5A 4NARA 1R3DA 3BN3A 4XTCS 5JNUA 1XU4A 3L82B 4DSUA 1E4EB 2JW5A 5KQRA 2WTUA 2MTBA 2XD9A 4IICA 1XTUA 4HNUA 4NRDA 3TKLA 3ON5A 4GNKA 3FR8A 2F8MA 1XRRA 3H5VA 1QLHA 1C3XA 2HPAA 3EF0A 3N75A 1PWEA 4KO8A 4UC0A 4R7ZA 4US1R 2RGRA 3ICVA 2ZJ4A 3HKBA 3WQSB 5K03A 3RYCB 3MTEA 1R6VA 1F6WA 3LSTA 4EUHA 2EGGA 2WHPB 3LNCA 4UUQA 2J3MA 1X0XA 1USVA 1SKYB 5A7FA 1R6XA 1WCV1 4PLFA 3WGJA 1KOLA 4YAOA 4ME6A 4DRXA 5JRDS 1O0BA 4IGKA 3EGXA 2WJ3A 1V39A 3JTMA 2AC2A 2IBTA 3T7EA 5FA5A 3VR6D 3QKRA 3K6RA 1Y6ZA 3KHSA 3UHPA 4A0FA 2C97A 2ODQA 1YR8A 4XUCA 2YZ7A 3M6UA 3T7DA 1G5PA 2D6FA 4PF1A 4C4TA 3BSYA 2O6LA 3FCSB 5KYXB 2XPCA 1TA4A 1GNLA 4G0YA 1RYEA 2I4TA 1T5HX 3L7BA 3R6LA 4M0CA 3KSAC 1E3MA 4N0MA 2C84A 1PNRA 4ZV4A 5PGMA 4V39A 4LJ8A 3PJRA 4C6HA 4G81A 1P7ZA 4KXXA 2XHZA 3OHPA 1YR1A 4DR5B 4CEJA 1W4BA 2WSBA 3ASUA 2FEMA 3C87A 2HW8A 4CLHA 2ZUUA 4AP9A 3K9HA 1G3UA 2C4MA 2O7NA 2ZSKA 3FLEA 3SEZA 3TSOA 4DFDA 2HJ9A 2ZTHA 3OE5A 3WOVA 3IAUA 4EW1A 1UK9A 1MB0A 4M86A 3OWXA 4AT1A 1XDZA 1FF9A 4GYYA 3PWTA 4JVLA 4Q7LA 4ZOEA 5EFOA 1JG1A 1X1TA 1FNBA 2B2XA 1UOEA 4P4GA 4C78A 1EE9A 1ATZA 4E5NA 5C0OE 1UT6A 4RF3A 3LWZA 4NH4A 1TEZA 1VJDA 4RYDA 4NR0A 4D8XA 2BLNA 3GARA 3OCJA 4MQUA 1J42A 4R98A 4X7BA 1LPBB 4IJUA 3DEKA 1T2EA 1SC3A 3AHFA 2CUZA 3N70A 4J3FA 3Q4GA 1AMOA 1H1DA 1RXCA 2AUTA 2D0PB 4XD2A 1UAGA 1KI2A 1NLFA 4EPRA 2VF8A 3GBPA 4E51A 1AURA 1NONA 4M0DA 2JIBA 4OQMA 4PXYA 2VPZA 3KAQA 4N7JA 4DDVA 5I4BA 2FG6C 1BIFA 3CLTD 3AJDA 3L8DA 4F3RA 5B58C 3BKWA 4WSOA 3I6ZA 2IUUA 4ZT7A 3UMJA 1DKRA 3GLIE 3GLTA 1Z0DA 1HLFA 2PT5A 4E32A 4PGGA 3AJ8A 1Z83A 1C4OA 5GJVC 5I9LA 4HFRA 2B4TO 3NPAA 4QAJA 1KE1A 1RYBA 2X9LA 3SZMA 4DDKA 5D1NA 221PA 1ATIA 2C0QA 5BR7A 3QP9A 2O5RA 2QTTA 1P61B 2QMQA 3QWFA 4FBMA 4EQ6B 2A5FA 9ATCA 3GL9A 1P3DA 5EMMA 1EWTA 2EVWX 3M0EA 1Y7IA 3AEQB 3KZCA 3BUSA 4WZ6A 2R6DA 4N8DA 1DX6A 1NE2A 3JQDA 4JLAA 3LZDA 2WD8A 4LSMA 1A8HA 2MMCA 4Q82A 1ISMA 4EDFA 2QG6A 1X7DA 3LQ2A 4HJRA 1KVRA 3V9AA 2QRMA 2R7LA 1E1YA 2H06A 4BGVA 3CQ9A 5C53B 2DB3A 3KDSE 2G80A 1GAEO 2JIRA 2ODEA 4LHZA 4PYIA 3TFQA 1TCBA 1L5GB 3ZK8A 5HK9A 4HRAA 2Z8XA 4TKMA 4X1YA 1WXFA 4A0GA 2XBMA 5EP1A 4M1ZA 1H9AA 2C7PA 2OD9A 4Y0AA 4K26A 4YREA 4W1QA 4DIUA 3DH0A 3COJA 4C7JA 3ZXIA 3L84A 2FETA 3BULA 1FFDA 2HBYA 4HWKA 3FHLA 1NF3A 4Z1OA 3NC4A 3QE9Y 3R20A 1Y3IA 4G4SP 1PJBA 1KYWA 2X7HA 1H4SA 3P0EA 2NQTA 1QS0B 5AT1A 3VC2A 2WT9A 1I9CA 4JD5A 3I61A 3FBGA 3GOQA 4RD4A 1IWBB 2DU8A 2GZ2A 2FH5B 4ATNA 3LC2O 3LY8A 5CFNA 3FSRA 3LUHA 4O8ZA 4F85A 5I7VA 2XYVA 1T0UA 5BSTA 4ZYYA 1C3LA 4HVTA 1JVSA 4HGOA 5FQNA 1B8PA 2P4EA 4DZZA 4BX2A 2ZRCA 3QVOA 4B82A 4F92B 1DKPA 5EIBC 5FO0A 4GXNA 2ADOA 3KQSA 4S2EA 5BN5B 3OVMA 2X0RA 5IRCD 3MMPA 5DTRA 4X45A 1IMOA 4HUJA 2FFBA 2HXYA 1PR3A 2FPPB 3U7FB 4BKMA 1CQJA 4K88A 2R4UA 4JC5A 4AZ3B 1WDTA 1U3DA 3TWOA 3ROGA 2XVZA 1RC8A 1Y1TA 1AGXA 1X1AA 1KJ9A 1TMKA 2EIHA 2WZBA 2UZAA 1RSZA 4RFLA 3UJ8A 2O8EB 4KUGA 3IPYA 2PH1A 5JMOA 1NT2A 1N2HA 1PFYA 1RRVA 1H3FA 2NZYA 3K2BA 3QVKA 1LW6E 2RMKA 5ERGB 3WWOA 3E9MA 5T4EA 4YBRA 4LKOA 5LBIA 4AY4A 1X6VA 2X2PA 4RIEA 1MJNA 3LBIA 3ILVA 1TX4B 3HUFA 4IMRA 4Z1MD 3SZLA 1XD2B 2BVNA 3PHCA 5CA0F 5J58A 2Y6UA 4TSFA 3IT2A 1YTUA 2PEYA 1PEDA 1LSJA 1WPXA 3MTDA 1MOPA 3A6HA 5IUKC 4PG8A 3A8TA 4IG4A 5CVEA 1IM2A 3J81k 5A3QA 4CCYB 2OD2A 1WD7A 1VCMA 4TRJA 4AUMA 4FC6A 3AVPA 3IHKA 2FFJA 3EDCA 2ZUFA 1ODLA 2P5UA 5KNDH 2ENUA 3B38A 4YMGA 3UYLA 1KJ8A 4QOSA 4D8VA 1VBNA 4JHLA 2HU8A 2GCOB 3CTMA 5E9QA 4HQOA 2DWOA 1UBLS 5CJJA 1T2FA 5JT1A 5DJ5A 1BMDA 5ALXA 2WUDA 1PFKA 5LOVF 1VHJA 2HQSA 3CRQA 5ES3A 3WKCA 5KJ1A 1S2MA 2CKDA 2Q3JA 4EG6A 4QBTA 3J7AC 2PU5A 5ILQA 4KVAA 1XZAA 2LXNA 5HIJA 3L9XA 1BE0A 2V9CA 2RGEA 2VATA 2VLIA 3IQGX 4GPTA 1KJQA 2XDYA 4GX0A 1Q6YA 3VR2D 1N3IA 4QRHA 3W1EA 5JH7B 4P8RA 4DV1B 1U4NA 1W6UA 2EARA 4G2TA 2OPHA 5FTLA 2EWMA 2VPTA 2I4NA 5KYYA 2H9IA 2ZBGA 2J9GA 4AJEA 1V41E 1OWOA 4EVRA 1M76A 2IYOA 1P5RA 3K1AB 3RHFA 2DETA 3OLXA 4UM5A 1NUHA 3FLBA 3DVAB 3RBXA 3ZXSA 1I9GA 1ZC3A 2IT1A 2SECE 4G0MA 3EMKA 4FB5A 4MVJG 3THYB 1U3FA 3AEUA 4QNMA 4WAUA 3T9EA 2B0JA 3O7MA 1OXTA 1JHVA 1HYHA 1USWA 1QQ6A 1YZVA 1M1XB 3ONVA 3MS7A 2WMYA 4B1FA 4YDRA 3VGJA 4F4UA 1UBCA 2VKQA 3LT0A 1MJGM 3ZHQA 2IYUA 1WU7A 1R2QA 4HLUC 4GE0A 2LCIA 4TMYA 5KX5A 3NVDA 1TUEA 4EG0A 5BSFA 2ZRGA 4HS4A 2R6JA 3ANXA 4PPQA 3IERA 1BJTA 2ET6A 3M4YA 4J0QA 3T1HB 4TLAA 1UANA 3O2NA 3I01A 4RQUA 4UHFA 5ALLA 1HMYA 3CZQA 3L7IA 4HYEA 5EHXA 4BVJA 4Q3BA 5B1DA 3TL3A 4D57A 4E30A 3R9XA 1NC1A 1N2SA 4RTQA 1LA2A 5DSZA 4BFZA 1ONBA 3N0XA 2WFLA 3VHLB 1CQIB 2VF5X 1CZHA 4GW3A 4QJ4A 4CMCA 2YHAA 3RLIA 2IW3A 1XMSA 5HCNA 3Q85A 4X3OA 2G71A 1V3VA 4K81B 4K9SA 1CY6A 2C57A 3PNYA 2Q5QA 1XQ1A 1ZUNB 3KVRA 4IUCS 2FWAA 1SA0A 3NGLA 3K0AB 3I76A 5H1YA 4YXWA 2FPWA 4AJ9A 2GN6A 4KUEA 1JXOA 4EO9A 2ZWAA 2KE5A 4PSVA 1DG9A 4MKIA 4CNQA 3AFHA 2MSEB 1TTPB 5DVZA 3ZE0B 5K09A 3EVZA 1Q95A 2F64A 5JSZB 2BBWA 1N0HA 3ABSB 2WMOB 4CM1A 4X94A 4BVAA 1GFSA 2GN4A 1H5NA 1ESMA 3EVEA 3FKSA 2I03A 5CHEA 6REQB 2PJRA 4Q21A 4D44A 1TM4E 3BGWA 2J5QA 4C0KA 3RQSA 3FX2A 3T9DA 2YNMA 4ZDWA 3BJEA 1U1FA 2OB1A 1XTKA 2R6HA 4ER6A 3GZJA 5MFPA 2QR3A 5FOXA 3HBJA 1DRUA 2XCIA 3CF0A 4JYPA 2QPAA 3E8XA 4KQFA 3ZZ1A 4D97A 2I6UA 4ZEWA 1USUA 3OZCA 3V80A 2QL5A 4QXMA 1ZR4A 1RXEA 3RC3A 5EQJB 2WSSA 4YASA 1SELA 1QGUB 5HS6A 3SZGA 4JL8A 4MTLA 4TVOA 1NOKA 3RG2A 3KD3A 1LTHR 3S55A 4IILA 3V7UA 3B3QA 1DEHA 2C00A 5C7YA 3AMVA 1RM4A 3RSGA 3BD6A 4CZ2A 4L2IA 4N0EA 1T9AA 4NMLA 4LVOA 4URHA 1EESA 5A6VA 3T3IA 3Q5GA 5EZ5A 3SE0A 2VEDA 2DTXA 3PJDA 2F59A 4EB6B 3BTOA 6CHYA 4P34A 3OC6A 3A1WA 4D96A 2DT5A 5EE0A 3S70A 4FYIA 1CUCA 4Y7CA 2ZU0C 2Z9DA 2HDOA 3PITA 2X86A 5E6UA 5B1EA 5LDGA 1YI1A 1VI6A 1JAHA 2BGIA 1Y8ZA 4QYTA 3M82A 2VL7A 5JWHA 2P9QA 3AJ9A 3HDHA 1KI8A 1VHLA 4YBZA 4X1KB 3K6SB 3CLUD 1LKZA 4DSNA 2JGIA 5J43A 3VSCA 3D4IA 1V6AA 4BVHA 1W0JD 4FFBA 3OIDA 4LVCA 1P33A 1JLKA 4JFAA 5ALPA 1UFOA 4FIDA 3KCNA 2FG5A 1AKMA 1DNPA 1I3CA 2EHDA 1HFWA 3IP3A 5F7OA 1NIPA 5DX0A 3TAHA 4L8LA 4M1MA 2O8CB 1Q3KA 1REQA 3DAGA 4A6DA 4KPGA 4UEOA 5C7LO 2VCEA 3WWZA 2YWCA 4R1LA 5K45A 3KXDA 4MW2A 3ZKWA 3NFYA 1TKAA 4B8ZA 1W9HA 4QT4A 1EK0A 3ZZMA 3KB8A 3FMVA 3GRZA 1P80A 4EUEA 4F71A 2TRSB 2EC5A 3RSFA 4YCJA 2ACWA 1RVDA 2BD0A 2EKDA 4BKOA 4M1TA 3M2PA 5CLJA 3H19A 4JC8A 4CM9A 5DFAA 4DJTA 3D2BA 3GJZA 3OLVA 2H5JA 5JIBA 1OA1A 3ZV7A 1TM1E 4X91A 1ARZA 2BCGY 3N1UA 4A5OA 1GV0A 4HXYA 1ESZA 2HV8A 2BGMA 5WRFA 3SZOA 3EVAA 3G2KA 3GCGA 4BEBA 2IWHA 2GN0A 4KK4A 5KVAA 3ELYA 1SXJB 4RZQA 1YQXA 1GQRA 3MYRA 3JQ9C 1W0KA 2ONJA 3JU3A 3B6EA 2AOUA 5E1BA 1ZIOA 3H2IA 4GYJA 1RHRA 1YZUA 2EYUA 2I2CA 1TI7A 4Q9DA 3W3ZB 1U2QA 3JVUA 4OIFA 4B3CA 1X74A 1I2MA 1DP4A 4PLGA 4CLRB 1KVUA 3JWPA 4N0PA 1N0UA 3GDGA 3LWNA 4N7MA 4NY1A 4BFVA 1GN8A 3TMKA 4IDGA 2CLIB 1U1IA 4L74A 1FDSA 5GIOE 2B9EA 2I7VA 4UTOA 4Q9HA 5ALKA 1OAOC 1E3SA 2OCXA 3IOBA 2JLUA 5FYDA 2ISSD 2FVXA 1Z38A 1A04A 2R2AA 1KYTA 2RK3A 4RCYA 1PAUA 3U4HA 3P9IA 1I1HA 1TMGE 3U9TA 1NBEA 4WBNA 1LB1B 3DDSA 1WMAA 9LDTA 4HGQA 4UTNA 1EK1A 1U2RA 2ASEA 1WDKA 2QUKA 4IV8A 3ISTA 3PEFA 4KZKA 1V1JA 3AHEA 2VJCA 5KIAA 4UVGA 4O2AA 1IJEA 2ZYRA 1RABA 1UBHS 3DZ8A 3L8MA 4BKUA 3V4PB 2EJUA 2WF7A 1K5HA 3OCUA 3BS4A 5GQSA 2IQIA 2EFYA 1D2RA 2A0UA 1MC8A 1TYBE 2CK3A 2G06A 1XN4A 3L02A 3N86A 1ISRA 5JI2E 4B73A 3AJEA 1VMIA 1K7CA 2HV9A 4KI7A 1IVSA 5E3IA 1GRRA 1VSUA 2FG7C 1TU0A 2DR0A 3ENKA 4ETNA 1T9CA 3KLNA 1D03A 4IIJB 4L5AA 2YZKA 1G8AA 2F7SA 2GD1O 2ZDGA 1O08A 2X19A 4IYRA 2PKWA 1Q3TA 2Z43A 2CD9A 3GQBA 5DYNA 1IVNA 4Y6LA 5FWAA 3ZS9A 4YROA 1B0PA 1UBUS 2Q7OE 5FA6A 3MHPA 1M72A 3O4IA 3RD5A 3Q7SA 1W0CA 3RRXA 2Q62A 3LXMA 4AKEA 3O74A 4HEJA 4XI9A 4EY5A 2HMTA 3SHWA 1E1QD 1FFXB 3RIYA 3E7FA 2G5TA 3IV7A 1EVQA 4RD3A 3T5CA 4BFYA 2X6TA 2AGVA 2FWIA 3LUGA 4ZZIA 3GHHA 2IHNA 1HC7A 2VDPB 4NAVA 3S2GA 4R1OA 4TWZA 1P0QA 5C52B 5HNKA 2WJ4A 2ZBFA 4Q1BA 4UDXX 4V0OA 4CODB 1TZCA 1MW9X 3AKCA 2QVLA 4MVJP 2H18A 4NF2A 4U8GA 5EXEA 1Y89A 1G1AA 4IJQA 1KSGA 4NYJQ 5ECGC 4CBVA 4NTZA 4A10A 1GNRA 1C30A 1SU7A 4TXMA 2J3DA 4EHJA 1QIEA 4RKYA 4Y1FA 4KH1A 3H5RA 1HK7A 2J9FB 4JAVC 3KYBA 1Z82A 2F3SA 5L53A 1JR3E 4ZVKA 1Z5PA 2IVZA 2VJAA 2OQIA 4JBXA 4Y30A 3KXPA 2HWXA 3HTXA 1M0SA 1TIBA 1RXVA 4G3XA 1AQIA 2WWGA 4PO1A 5E9AA 2NADA 4HATA 4MUGA 1L1RA 4KV9A 4BN5A 4ZEVA 5F7XA 3U60B 1YO6A 1P19A 5EWLB 4CTKA 3OU6A 2C5HA 1JDJA 2VT7A 1HTWA 5JSUA 3W6UA 1U5AA 1Y8QA 2O57A 3QMPA 3GFPA 3MRSA 2AJCA 2I4IA 4GPD1 4R1SA 5CNJA 3T0GA 4ZCMA 2FDCA 5JMPA 3AB7A 1PYDA 3JZFA 4FT2A 4OI1A 3TGPA 2Y4OA 2ZJBA 4HWSA 2DQZA 4P93A 3WLNA 3SZRA 4BP8A 2DHCA 4F3CA 1QFZA 3TF5A 4LYFA 4AJ2A 3CZMA 1BO6A 4BJ1A 1H6DA 2VZ8A 3RUFA 1UP7A 1V43A 4J2HA 4YO8A 4CNBA 2IOQA 4O2BA 2RHCA 3PWSA 4MVJI 2ZGVA 4WKPA 3DDHA 2ILVA 1FP1D 1E7MA 3L8HA 3LYAA 1MX3A 4QEKA 3JXEA 3SQWA 2X8BA 2XMSA 3EYAA 4HXEB 3ZWQA 5F12A 1R15A 1B42A 1MB9A 3DEJA 3N2KA 5FJJA 1QHHB 2HPHA 4AK9A 2DGDA 3ETHA 4G0XA 1GKYA 4EUNA 2WB2A 3C1TA 3ICEA 1TE2A 1QYDA 1O6FA 3H2KA 4XRRA 2KBEA 2PD6A 1A9OA 1OXXK 2RHGB 3PGKA 2OCGA 2A2ZA 1GNTA 3R7WB 3BXXA 4NU6A 2QRZA 3SOZA 5B4VA 5JD5A 1JHYA 5A71A 2YXBA 5EKTA 1WXQA 3BHMA 3HDYA 3WJ7A 1VA5A 3SLKA 4YUVA 3AUUA 1R0KA 1P4HA 1W5TA 2ZSUA 3FOBA 3LQQA 4BO6A 4O1IA 1MGOA 2OQRA 3GQVA 1NI4B 2C2KA 1E1CA 2HNBA 2AWNA 3REQA 1JP7A 1D9ZA 2XB8A 4DC0A 2HI0A 2QL7A 1N9GB 3H5TA 3YASA 3Q3CA 5E1OA 1BXKA 5KVCA 1YQQA 3SOPA 2Q6VA 5EKDA 2ZTUA 1CZKA 4B6RA 3LLUA 4M22A 3X0DA 2GBCA 2BM8A 2OHIA 3B48A 1B14A 3KPYA 4Q4AA 5D5PA 3UUWA 1ZUIA 2A5JA 2HT6A 4QXPA 3GT4A 4JMLA 1ZSNA 3GUVA 1Z63A 1H8ED 2ZYTX 3CZPA 2JJ2A 3UJ9A 1YUBA 2OCPA 4H17A 1KXZA 2DTEA 2YXLA 3N5CA 4QU8A 3AM4A 3SDZA 3MTBA 3I9LA 1P9RA 2BBSA 2HJVA 1FE8A 4MYDA 1P31A 2Q41A 4FSHA 4A0HA 3VR4D 3PE3A 3M6FA 1OLSB 3QTLA 5EEGA 3RJ5A 1T9KA 4C14A 4AO7A 2V3VA 4XB6B 3WAJA 4LF9B 2IJGX 1A82A 1L5SA 2YV2A 1HV8A 3GROA 4GLBA 3UWOA 3B2NA 4MI6A 4R9NA 4H9GA 5GWXA 1BHQ1 2J3IA 4DIFA 3C4VA 1FZTA 5KWJA 3DHEA 1YJ8A 2JHCA 2RG7A 4PO9A 3KQOA 4M8SA 5EFZA 4M1OA 3ZQKA 2H1VA 3K53A 4GQAA 1P7WA 2XQIA 1IK4A 4Y2JA 4TT3D 1K6IA 3T06B 3DWFA 1IH8A 4B8WA 1ZIPA 1OH6A 3BEOA 4MX8A 4CF6A 2VNKA 1G41A 3N2NA 4J2TA 4YT4A 2ROQA 2VAMA 4NYMR 1IEVA 4RVDA 2G09A 2GHIA 1FMJA 5CLIA 3U3XA 4YJHB 1KYQA 1PJ3A 2W8BB 4D74A 1ABBA 521PA 1OGYA 5AJUA 5KNBH 4LRTB 2GVDC 4BNUA 2XEDA 3RBVA 3GY0A 3JYNA 3RBZA 4BBJA 4PO3X 2XT6A 1PEYA 5ALIA 2A9RA 2PVCA 1USGA 1WBDA 1B6SA 3ZU2A 7GPBA 1FP7A 4FDLA 1A9RA 3BXOA 3MS4A 1VOTA 4WK4B 4S1PA 1UMCB 2FPSA 4EG3A 3OZVA 3WKAA 2VT2A 2WOOA 1UDAA 4Q3CA 4WINA 1LCIA 1WB6A 5EZQA 2P4QA 1E0JA 4UE6A 4D82A 1UEXC 3R9KA 1QTNA 4M6WA 3LKVA 2BL4A 5TARA 1I5EA 4K3VA 4OUKX 2CNWD 3G68A 4GFDA 1X3LA 3ZWWA 4AF7A 3FYUB 3AFIA 5MN4A 3A70A 3EJWA 3WQQA 1Z88A 3DBHA 4H7HA 2VSNA 4HLCA 4ZIRA 1DQSA 3H16A 1L4LA 4MVXA 5KSPA 2WSIA 2VLBA 4NJEB 4ZA2A 4JBIA 2XH8A 5P8WA 4KO2S 1SUIA 1YB1A 2NP6A 3WMWA 3GPCA 1N5JA 4I1RA 4W5RA 2R7AA 1PV1A 3F2VA 1RXYA 1ZRSA 4Q05A 3WLJA 4V1CA 1DBWA 5KDOA 3RBAA 2C9YA 2Y1CA 4UNPA 4NMWA 5IKPA 5KVVA 1R6BX 5TQ2B 1CB0A 1THMA 2AW3A 3VU1A 3M1IA 3TBHA 4MS4A 5AW6A 4OHWA 4Q00A 3N0RA 3LT1A 1V11A 2MR6A 3CR3C 4NXMB 3RUHA 1DU4A 3GHYA 4U9IS 1WTCA 2GNAA 1UK6A 1AGYA 2GHRA 4LQLA 2Q4OA 4RGBA 4V3CA 1EH5A 1K5GA 3F90A 3ID6C 1K66A 4R71A 1M0EA 4MYHA 1QCYA 4NENA 3L8GA 2AJ8A 3P9CA 5EPOA 5EHQA 3U31A 1LPOA 5G1PA 1Z4LA 2EFHB 1GN9A 2C4UA 2CZQA 2Z8ZA 4MUEA 4RZSA 2QN7A 2RK6A 1RI1A 1X92A 1E3WB 3QBVA 4IS2A 4D9IA 3RS4A 5ALOA 4G1CA 4B6QA 4ZJZA 2HPZA 4R2WA 1VPWA 2CV0A 4S3MA 1QB8A 5FO1A 1EUDB 1NBMA 2EEPA 2XCUA 2BMEA 4RACA 3DBRA 3CISA 2VAXA 3HXOA 2AC7A 3KETA 1HNNA 4O1MA 1HH4A 3EEFA 2HCJB 5GOZA 3RYFA 1U3GA 1AU9A 1NBWB 4UHEA 4YP0A 2FQQA 3U4DA 4RHFA 4OJMX 1NRJB 2X6RA 3L77A 4LEIA 5HOQA 2PDAA 5BWOA 1BS9A 2RDMA 1UP6A 3EBOA 4FMCB 4QU9A 4JUFA 3HPQA 2P62A 4IXMA 4Q1DA 4DTIA 4EFNA 3HNRA 2CNKA 2NO0A 2B94A 2WT4A 1XZPA 4WD3A 1K92A 1Y9DA 5FFMA 3FPGA 1M74A 4JGGA 2C07A 1PT9A 1VMEA 3DD1A 1TQ4A 2DUWA 3A6LA 1EEXB 3LPNA 2R5FA 1SUAA 2SICE 2XF8A 3MYYA 4PZUA 4BNNA 3HCDA 1E2KA 4JVSB 5AKZA 4ARZA 1AD2A 2GI4A 1T2CA 4DGQA 3TDMA 3THRA 4GMXA 3OQIB 3AIKA 4CM5A 3DHWC 5JCOC 3L1KA 1CC1S 1FFYA 3TG8A 1L9KA 1P8JA 5CFLA 4EYSA 3VHXB 3TQFA 1DV1A 3PU6A 4CMBA 3JYQA 2B4QA 4DQDA 1TF7A 4E3ZA 3CBGA 4BQRA 4UBOA 3NXKA 3KHUA 1ZM3A 1FRZA 3PIDA 2QNIA 2QRVA 3M2TA 2I6SA 3ROPA 3OX4A 3FW1A 3UH1A 2EEZA 4EA9A 1DAMA 1FU7A 1NN1A 1JJIA 1UFKA 4JR1A 3LUCA 4PZDA 4Z3DA 4N49A 3PSHA 4TLDA 3T3HA 1QV9A 4R2LA 5H4GA 1S8NA 2I99A 1Y81A 1W85B 2BUCA 3PL1A 4MQFB 3VPXA 4BC0A 2PS9A 3F4BA 2WG2A 2QT9A 3I9NA 3EFBA 1Z2NX 4C5BA 1ADJA 2R1VA 1BN7A 2YJ6A 3A3KA 4ILKA 4QUHA 5EJMA 4CKYA 2JBWA 3N07A 1JU9A 1L8AA 2J5KA 4NBKA 4TTSA 5MF6A 4Q3KA 1EVJA 3VYVA 4LCJA 3V8MA 1R10A 1EJ0A 1WB4A 2YFKA 4TXHA 4H35A 4ZGBA 3NFRA 5KSOA 3TTTA 2J5XA 4WT7A 1R4NB 4UBMA 2D59A 2ZVPX 3ICPA 5GINE 1J33A 1Z36A 3KZVA 3IP1A 2HSEA 5KS2A 3PUKA 5K2MA 5JS6A 1DQNA 4LYHA 5DX8A 4DMMA 1JT2A 3HUUA 2XCRB 1SCUB 1FRNA 1JNXX 3KXIA 3C7KA 3JQGA 4A2QA 4KIFA 1JEQB 4K28A 1U0GA 4DZTA 1CY2A 1P6UA 2IA5A 4FSDA 5BW5A 4GKAA 4YRCA 1UQTA 4BMCA 1YWGO 5CPFA 2RGAA 4N5HX 4B35A 3X2SA 3VNQA 1Q15A 3MJTA 5KUTA 5LMNB 4MDHA 4IINA 3N8KA 3C1AA 1Y3DE 4B17A 2M6KA 1LH0A 4AMBA 3L8EA 2BEWA 4H18A 5FWNA 4BFWA 4EB3A 2P2YA 2VWGA 3H2HA 2Z3VA 4WZZA 4Y2XA 1ETUA 2I8LA 2LW7A 4EKGA 5A5GA 1H4QA 1SC1A 1RKBA 1K6MA 4GOMD 2F2TA 5EPEA 5EMKA 2PMEA 3VTAA 3WL6A 4C0HA 1OFTA 3OEHD 4FFNA 4CWAA 4ZXPA 4A6EA 2R00A 1NWCA 2VJYA 2Z9BA 2ZRMA 5DCWA 4G5FA 3NHKA 2XYRA 3V4ZA 2LP4Y 2VP3A 2B6HA 3LA8A 4BLPA 1G2QA 3UYKA 5JADA 1D07A 1A9QA 1SU4A 1W59A 2XAUA 2QDXA 3LBYA 4MQ5A 1XLTC 5H59A 2AN1A 4ZK2A 4U2KA 3EXFB 3LQ1A 3CNNA 3H5LA 3NB0A 1DXHA 3S0JA 1Y5NA 4A2WA 4DMRA 5CB0A 5JNRA 2I3BA 3NANA 1RRPA 2A78A 1DMRA 1SZDA 3A7DA 1CRLA 3HCAA 1EI9A 2YXEA 3P9ZA 4D5GA 2QV0A 2V7GA 4ZMSA 3TUZC 3PP8A 2V6GA 2GXSA 3DAHA 1OIWA 3P2KA 2YJTD 1T5DX 1N8KA 2I2DA 2IHYA 4M0MA 1ZHHA 1MJ5A 3H1EA 3OE7A 3PDUA 3QA3E 3AH8A 3F1KA 4REQB 1VKHA 4XXHA 3QHAA 3GF4A 3LKBA 2Y27A 3EIUA 2WJGA 4MGZR 1E8DA 3EWIA 3U16A 1SVIA 5EYPA 1QR2A 2VH2A 2J09A 2VWQA 2Z9CA 1EVEA 1IM8A 4MWEA 3FWNA 1A7AA 3FUWA 4OLAA 2ATCA 4GM4A 1E0SA 3VBCA 3W2IA 2AFIA 2WI8A 4J43A 5HBRA 2VH5R 4ENWA 4AS1A 1SQ5A 3SX0A 1Q2UA 1Z8FA 4CT0A 2CLSA 1K3TA 1P0MA 1O8CA 1SVOA 4K9PA 1MC4A 2QPOA 1U6KA 4RPCA 3PBKA 3R3YA 4W9NA 2GZHA 4X93A 4MPDA 3H99A 5J2UF 4DT1A 3LRPA 2JH8A 3D4OA 3CS3A 3R5HA 1HETA 2MOKA 4JU9A 1IM5A 1QWOA 3EZGA 4YFYA 2F90A 2CMGA 4OQFA 3NNNA 4L9WA 3KLMX 1FSGA 5IBRA 2ZUSA 3ZI0A 4B85A 2CXRA 3I6MA 4AZVA 4RLHA 2FOLA 3RRNA 1XCLA 4LFCB 1AUVA 1PL8A 3BJZA 1X70A 1NLMA 3QX9A 3A06A 3LPDA 1WULS 2KWIA 4TYMA 4DJ5X 1Q1BA 4DLKA 1ENYA 1W35A 4AG6A 4F06A 5IAAA 1QU3A 4DLPA 1KVTA 1N8SA 4RNDB 4US2R 4R2JA 2PH3A 4C30A 4CEIB 2XB9A 3GG9A 3PQ3A 5LP6C 4IL5A 1ZXXA 4D4IA 4IF6A 4ZANA 1G7TA 4WK0B 4UNSA 1DG3A 5LU8A 3SICE 1CJMA 3SQLA 4M1KA 3VRHA 1E9EA 3FE2A 2QL6A 4D80A 1SKUA 4HYTA 1N1DA 3WQHA 3KLBA 2CB9A 2VXYA 1VGQA 2YASA 1DDGA 3DAPA 4GI3A 2HO5A 4GO1A 1N6OA 4TGLA 4TZTA 4BS9A 4AUKA 3CNBA 3LPCA 1P44A 1RXUA 4TMKA 1ICEA 5KAPA 3EAGA 2PVSA 2WJJA 4DJDC 2H48A 1L0BA 2FWMX 1P4RA 5C5CA 3RF6A 3W3AH 2YQ4A 4QGBA 4KPEC 1P2VA 2JI4A 3W5AA 2C3MA 2CL7X 1WOYA 3ZBUA 1M6YA 2Z3WA 4NDZA 1ZCBA 3NWOA 3DXFA 4WK6A 5DLYA 1Z47A 1KMIY 4I1UA 5FI1B 4YV1A 2IVFA 4DCNA 3QLVA 4UZFA 1CDOA 2W58A 1VJTA 4Q39A 1WDWB 2C3YA 4GMFA 1ZM7A 3PENA 1LK0A 1B26A 3DG9A 4EBBA 2OZVA 4PSKA 1H85A 3RYIB 1Z0IA 5D3MA 5CH3A 3QOXA 3WO1A 4F9GA 1LTKA 1NF9A 4TTRA 3UK6A 4HGPA 1IHYA 4A27A 4A8JA 4DR6B 3Q1LA 1PR9A 3WNDA 2NSJA 3GUUA 4N5IX 3INNA 1N0VC 2VO1A 2V58A 4URZR 2G0TA 2KW5A 2OESA 4JA0A 1ZMOA 1P0PA 1L1QA 4LYJA 4L07A 1BWQA 5BYBA 3PA8A 4E15A 4Q7JB 2D74A 5AXCA 5DM2A 1KZ9A 1QFSA 3K09C 4C3UA 4UNRA 3IIKA 1EVKA 1EZ4A 2BISA 3HZOA 3GUYA 3AINA 5AYVA 2KX7A 4C6TB 5KC8A 4DUYB 1FDVA 4WJZA 2CCJA 5E9JA 3QVJA 5BSVA 1VHTA 2AFHE 2WWTA 1S4QA 1U2GA 4A8HA 1EQAA 5K8TA 2QTZA 5IHXA 3AM1A 2QTLA 1H6CA 4QOHA 1G8PA 4YJFA 1NL3A 5EE1A 4KN9S 1CY1A 4EPWA 1IBKB 3QEMA 3D1JA 1IE3A 1UPCA 4BTLA 1NJGA 5K4HA 1SO8A 5H68A 3WISA 1G17A 4V2UA 4IEEA 4GX5A 4O0MA 3ZNQA 2JFBA 3SS9X 5IJWA 3DSRA 5DNCA 1E9FA 1J8VA 4MVJD 1RAFA 4PAMA 1MHTA 4YEDA 4LZJA 4ZREA 2QLJA 4JUAA 4NBSA 4FE4A 3UOAB 1EJ2A 4BX9A 2FPUA 4IHJF 2P9BA 2Q1YA 1LS6A 2OO3A 4QC2A 5CM9C 2J7PD 3HR7A 1U7ZA 3G2IA 2Q0HA 4LOAA 2O3TA 2VQFB 1JV2B 2L0XA 1QOPB 2V7WA 2H0RA 4CM3A 1TFUA 3BAFA 2NT4A 3ZHCA 5J1SB 2GEKA 3GLFE 3GLGE 5DBEX 3F6RA 1NFRA 2QSYA 3LXXA 3MT9A 5CX1B 1Z4NA 4A6PA 5LLTA 5FTKA 1IBMB 1NX6A 2WKRA 1BHJA 1C29B 2WAAA 3C8HA 1A77A 1RMTA 4EHIA 4CTMA 1FMFA 2C3OA 2RGGA 3RVJA 2Q5FA 4ENSA 4QTYA 2I87A 3Q6IA 4GMKA 3ETNA 1OILA 4JLNA 4PYLA 3RS8A 3K9FC 1NYLA 1Q57A 1XA3A 4GICA 3BF8A 1PYOA 3PXUA 3ELBA 4IMPA 2C0CA 3IOCA 1ZFNA 3ONFA 3D6HA 3IDOA 2Z30A 3W5BA 4P3KA 3EGWA 2QX6A 5LZ5A 2ZG6A 3FJYA 3O1JC 3ZHXA 1CR6A 2WBLC 1I3NA 4TKVB 3M6XA 4D9HA 3U7QA 4DADA 2YVQA 4WE3A 1GM5A 4C89A 4DQVA 2F4NA 2PBFA 1QH1B 2HU5A 4PU0A 4CM7A 1T3SA 1YRWA 1B8OA 2I7CA 3R76A 1HLGA 5DLPA 3P9QA 3HMKA 1SXJC 3PRJA 4WNAA 5FIUA 3TW8B 5A0VA 2PAFA 2ZAMA 2QM7A 5AVSA 2GETA 2B2NA 1AN9A 2DQSA 2ZYWX 1T4GA 3ZE7A 4A91A 2HSGA 2Y68A 1C50A 1F6BA 4GWLA 4H60A 3ZLUA 2PR7A 4G1UC 2ZM5A 3ABRB 4RSRA 4YCSA 4FDUA 4I55F 3KUXA 4RZIA 1JH9A 1NXQA 3C1UA 4S1VA 4HDNB 2LTAA 1IXRC 2NU7B 5KJCA 1H94A 1S2LA 4NCAA 3VR5H 4CG3A 1ZSYA 3OPYI 2XCTB 4R1NA 2X9QA 4OPMA 2I22A 3V2IA 5B2ZA 1PG2A 1GPYA 3M3DA 1H2BA 1N92A 2E18A 3V2UA 4BPRA 3RAGA 4L73A 2VYVD 4H4EA 1ZIYA 1P73A 5LNK6 1DSSG 2Z6AA 1VPDA 1RACA 2VDWB 3FPLA 5CURA 3ZWMA 3JQRA 3UJBA 1UC4B 1SNYA 1T2AA 1RPAA 3R5TA 2GVZC 3R24A 4WLUA 3HJFA 3ZE9A 1M3SA 1P5HA 1PTKA 1YMUA 3GA5A 2D0OB 2ZT8A 3IUEA 5CT6A 2UVPA 2WFAA 4J3NA 4IXWA 3UICA 4O4IF 5CDFA 3P9PA 3HR8A 1M10A 4WN3A 3BICA 5FOSA 1THTA 1W4CA 1MORA 2PH5A 2G17A 4JDPA 4RY0A 4C3VA 1XJQA 4JL5A 1MFZA 1AUQA 2AXNA 3R3WA 5F78A 5DN6D 4JYBA 1TO2E 3AQ4A 4KK3A 2DUUA 4GBJA 2G6TA 2PX0A 1J1IA 2YQ5A 4FP9A 3RS3A 3AKEA 4GYWA 5LA6A 1B73A 1E3EA 5AKEA 2FWNA 1K97A 4WH0A 3C5WP 1ZG3A 3WDLA 2IZ7A 2HF9A 4BQPA 2UUBB 1Q20A 3U7EB 4L8YA 4UBJA 1H2EA 3B82A 1SKAA 4QG3A 3EARA 5CIYA 4DLSA 3T3OA 4IIGA 3K70C 3DFFA 5TQVA 5HKLA 3F71A 2CNDA 5ELLA 1EIWA 1KFBB 2MT9A 2VT3A 3TOVA 5AVQA 4MS1A 4QZVA 1Y3HA 4FHZA 1EFPB 3JAWB 4D8TA 4O59O 5J3JA 4GBMA 4LF8B 8ATCA 2QYOA 3JX9A 2H2GA 2QRLA 3UEOA 2QU8A 2I2AA 2JFUA 2WP8J 4MI3A 2HU2A 4WCFA 4XCXA 3K0CA 4YJ2F 3HI4A 2C4TA 4M8LA 3NEAA 1TYZA 5SY4A 3SX4A 4O63O 3W5VA 3HB0A 1YOVB 3B2QA 2QKYA 4P35A 3T5BA 2COUA 4DLRA 1Y1LA 2HSDA 4LW8A 4MRSA 3X1MA 5CR9A 3ZS8A 3N3AC 1Z06A 1USKA 1O97D 5A3RA 4V02A 2XGGA 3FOWA 1D2AA 1QKJA 4U5XA 1EGHA 4BP1A 6ABPA 4DLAA 1G6OA 4DWJA 4JQCA 4YJKA 1AMUA 1XYVA 5DN9A 3UCFA 1DWOA 2ZUVA 3OX1A 3N8GA 3S2YA 2I8AA 10MHA 1E2HA 5F2OA 1EIZA 1J21A 3IEXA 4EA8A 2A9PA 2JFVA 2ONCA 3PVZA 1D4OA 3BWCA 4LKRA 4Q7EA 2FHPA 5JNWA 4N48A 1VRWA 2O8BA 4MO9A 4R2KA 3K2IA 1TUBB 2WSMA 2W6PA 4IS3A 4Q1EA 2XSZA 4K8OA 1A9XA 4GRAA 1WXXA 2B92A 4MLPA 2H54A 1KARA 3BB4A 1RI3A 1XUOA 2GSWA 5E4FA 4TTPA 1OHHA 4BRUA 5KQGA 3HVRA 4LHEA 2RG1A 1P2SA 4D8WA 3G6WA 3OE1A 1QG0A 4OMCA 4JA2A 1ZM4A 3Q7IA 1Z13A 3OZXA 4KPUA 1HBJA 1S9HA 1O6GA 5C8XA 3RFTA 3VH1A 1CT9A 2NPIA 2QRKA 2Y92A 4Q16A 4LNUB 4W8GA 3EDYA 1VE7A 3IDFA 5I5EA 1APBA 3EW9A 2ZRKA 1FP4A 2OAQ1 1CR1A 3WGNA 4UDNA 4GP6A 1RWKA 3KZ1E 3N05A 1S2NA 1MXFA 3OY2A 1UZNA 3NM4A 2D5LA 3QNWA 3CMCO 4LOIA 1QO9A 1YAJA 4OGLA 4RFVA 1RRMA 5JQGA 2HCFA 2G36A 1F8FA 2YYSA 2D7DA 4Z4IA 1XIVA 2KSQA 4GKJB 1USIA 2WSLA 4FNAA 2QMHA 2QJWA 3RAFC 1O95A 2JCXA 3OTIA 5FBZA 3RRBA 2PJUA 5SZHB 3DJFA 2NUPA 4D9CA 4QJ5A 5G0TA 4JKYA 3R6GA 1KWKA 5C3UA 1XZIA 4FGZA 2QP3A 2Z5GA 3T12A 5I8ZA 4HYQA 2VYNA 4LZWA 3RRMA 5JW6A 3D7LA 2Q8QA 1KMNA 4K2AA 1GZ5A 1YQGA 4ZAGA 1Q0QA 5J63A 3A6FA 1L7VC 1PJTA 1A2OA 1QP4A 1K7XB 4F6LA 3H4IA 4GKBA 2CVPA 1Z4JA 1CIJA 2ZSBA 3EPPA 1TYDE 2W48A 4C5AA 3WGOA 1N57A 3U37A 1ZA1A 3B20A 3MWEA 4M7RA 4MUMA 2C5GA 2VPIA 5AW5A 4D6PA 5TF4A 4MUHA 4JP5A 1AZLA 2ZQ5A 3IODA 3QUCA 4EO7A 4WOPA 5HMLA 1OVMA 2QD2A 6LDHA 1T1JA 3U48A 5JWOA 1JJFA 4KDRA 1C7RA 1EXDA 1AKTA 3OIYA 5K0CA 1EAYA 3DBIA 3QVGB 4H7DA 5FBLB 3R0QA 2A5LA 2IUSA 2GBLA 4WUVA 4JZYA 3FZGA 1S0UA 5FBQB 1J70A 3FDZB 3BXHA 3Q0IA 1PZGA 3ED1A 3QELB 5EC8A 3T52A 3DWIA 4EA7A 1Y7PA 1SXQA 1NPTO 1XEWY 4M99A 4BMNA 4PZ0A 1J9GA 1GZHB 2RBEA 4YALA 2ZJZA 1UJ6A 2IKSA 4ID3A 3K96A 1B0UA 4Q12A 3MVEA 1AKNA 4GRIA 1Q0RA 3QFHA 3H5IA 3WBFA 1EVZA 1Z6ZA 1ZN9A 3KPJA 2OORC 3D6FA 3NEJA 1X0VA 4P83A 4ETIA 2PUDA 1XMJA 3I05A 1J1ZA 5CM2Z 3W6OA 4Z49A 5EKSA 5IYZA 2EZ4A 1W1UA 3D7NA 2O14A 3DULA 2JK1A 1AKQA 3QVMA 3V5NA 1WL8A 1U5CA 2VNIA 4IDBA 4KTVE 1I3MA 4LJ5A 4OHRA 3ZHYA 1XVLA 2GN8A 4YRZA 3ML1A 1QLWA 4TQUS 4ND4A 3EQZA 3ZWXA 1H1LB 1I7LA 3EXIA 3LQKA 5LU9A 4EDHA 3JWJA 1JQBA 1Y8RB 3MD9A 2C9ZA 2GXAA 4XDHA 2P1RA 4OTZA 4XASA 4Z4FA 2GPYA 1UWLA 2M6SA 2O8FB 1RVV1 4N40A 1QANA 2WNSA 5LZ2A 2BP7B 1F06A 3ROKA 4L6IA 5K6AC 1XF9A 9MHTA 3MJHA 3NWJA 3FYUC 1DB3A 2ATEA 2CE7A 3U7JA 1M6VA 1QO0A 1YULA 3VR6A 4W1SA 1U65A 3SWWA 2A3RA 2FP3A 4XGNA 1U2PA 2G9NA 1S4MA 5DCUA 1RAAA 3GUCA 3L7AA 3HZZA 1GCGA 5LOVB 3RGWS 1U7XA 2XDQA 3MLBA 4KC0A 1CFJA 1ZRHA 3EQ7A 3JQPA 1LBTA 2Y67A 1GT6A 4NHOA 2XRMA 3TEFA 5T7BA 1NF2A 3G02A 2W6JD 3EK2A 3UANA 5L7WA 1KJWA 1X7YA 1YASA 2G7MC 3DCYA 5D1HA 3L3BA 5EESA 3W5UA 1W36B 5HTOA 3KQUA 1G2OA 4UTRA 3IILA 1RFLA 4YCMA 5AXAA 3UT6A 1MMFB 5KOYA 3PRHA 1IAVA 1BGWA 2C88A 4UBKA 4QLOA 2A92A 5TMEA 4JENA 3V7WA 2C8JA 4TWIA 4AI6A 3ENNA 1G3QA 1F5SA 4GC9A 3KT8A 4UAVA 2MMGA 1PV4A 4NOMA 5DNVA 2CNLA 3KQVA 2PCLA 2YJNA 4QFDA 4MWCA 1ZCJA 4C2TA 1LGYA 4JI8B 3WGUA 4POOA 1OLXA 1OSNA 1QE0A 2XQGA 4G5SA 5KWSA 4CKXA 3CPHA 4S1NA 3CU5A 3LPMA 1ZNWA 4IHKA 4AY5A 2IELA 2C4KA 3MCVA 1T4CA 2W6QA 1E2EA 1RAHA 1KETA 4GMDA 5KNCA 3H4MA 5KYTA 3GMIA 1CE8A 1P1HA 3ICWA 5EJ5A 2WJVA 3KYCA 4BBAA 4NXNB 3T34A 3MCTA 5LC1A 3A2MA 1D8AA 2PZAA 2RH9B 1ZP6A 3AEKB 3ZR4B 4GSKA 1E99A 4Y2TA 3HXQA 3L4BA 3BE6A 3QTTA 5DM1A 4TMXA 1I33A 2R44A 3K8YA 2UZIR 3OHMA 3IQXA 3ND6A 1LSUA 1M1YB 2P8JA 3O8LA 2JFQA 4JQSA 3WLPA 1AV7A 4CYMA 2W2TA 4H7IA 2GYVA 1LD3A 1O1YA 2VTVA 1O58A 3GPIA 5GZ6A 2GXQA 3O90A 1T25A 1U31