1JDPA

Crystal structure of hormone/receptor complex
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
401
structure length
396
Chain Sequence
EALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR
publication title Allosteric activation of a spring-loaded natriuretic peptide receptor dimer by hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 142
structure length 396
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdpA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdpA02
5ABPA 1Z15A 3N0XA 2OQRA 4EY3A 1KMIY 2B4AA 2JCGA 3Q7RA 1NXOA 3N75A 5DKFA 4WT7A 5IEBA 2PJUA 1DRJA 3CG0A 3JPWA 4RK5A 3JTEA 4PICA 4N76A 2FSPA 2WRZA 4RY8A 1QO0D 3KLNA 3TB6A 1CEYA 4WUTA 3QK7A 5JNTA 3CHYA 1TVMA 1Z16A 1QNLA 5ED4A 3EQ2A 3RVLA 3N6VA 4MR8B 4ETMA 5TQ2B 1DRKA 2WMYA 1DG9A 2HQRA 3HDVA 3H5VA 5C5CA 4YGXB 4Z4IA 4QICA 4IRXA 4KREA 1JFTA 5JNUA 3LMKA 1C4WA 1DBWA 3SNKA 4MLCA 1LBIA 1Z12A 4WXEA 3W9SA 3O1IC 1L5ZA 3C3KA 3H1FA 4NCAA 1NATA 1ZESA 1JYFA 4HNQA 1W25A 2ID9A 4ZMSA 3GBPA 2JVIA 2VK2A 3BREA 1A0OA 5DTEA 3IP9A 3QEMB 3N0WA 4KK4A 3NNNA 4RS3A 5IULC 3T95A 3HSYA 2IOYA 1EWVA 3A10A 2XDYA 3GBVA 4XFKA 1QPZA 4OATA 3OLVA 4RDCA 3FFXA 2I6FA 1GCGA 2RJOA 1LK0A 2E4VA 4Q6BA 1Z26A 1JH9A 3D02A 5F64A 3FFTA 1QP7A 1M5UA 2FMKA 1M2FA 4MR9A 4OLAA 3N53A 3JVDA 5TQ0B 1U8TA 5CHYA 2GWRA 1BAPA 2FN9A 2JBAA 5KQLA 4M88A 1ZGZA 2W42A 4QPJC 3A0UA 3HUTA 2PUAA 4F3TA 3LOPA 4RXMA 3NNSA 2PAFA 3KKEA 2PUDA 3QELB 3BRQA 4N0PA 3SM9A 1QMPA 4Z99A 2YHAA 1YTUA 1BDHA 1KRXA 1KGSA 2MSKA 2BGGA 1SXHA 1GUDA 2Q5CA 1E6LA 3DGFC 2FW0A 5TPWA 3LUJA 3FMVA 3GT7A 4KNYA 4NQRA 3Q7TA 1Z18A 4RK0A 1P2FA 3VNAA 4HNRA 1ISRA 4EVSA 3H5WA 4GNRA 1DCFA 2F8SA 3BBLA 3O2SB 3CU5A 4MS3A 2RDMA 3OMWA 2ZAYA 1JHZA 3BILA 4KRFA 3I09A 3MQ4A 3JPYA 3MIZA 4UHJA 1D2AA 4KV7A 4L85A 2MSLA 1MIHA 1E6MA 1PEAA 3P9YA 1P6QA 2FVYA 1TLFA 1YK1A 2JB9A 4OBBA 1E2BA 4MS4B 2IKSA 2QZJA 3HEBA 4PEVA 1NY5A 1CYEA 6ABPA 2JK1A 3EJWA 4NICA 3RVNA 4G0OA 4RKQA 1USIA 4JAVC 1BDIA 5JS1A 3A0RB 2L18A 1DP4A 1LJUA 3O75A 5KI6A 2FXIA 4MQEB 4YV7A 2V0NA 1Z17A 3LFTA 3HCWA 4P1ZA 2R48A 4H3KB 2GI4A 3ROTA 6CHYA 3C3WA 8ABPA 2L2QA 1QP0A 4Z4FA 1VPWA 5KC9A 3ILHA 3SG0A 1U2PA 2QU7A 1FSPA 2H3HA 1BDJA 4G0QA 1R8JA 3QLUA 3I45A 4MR7B 3G1WA 2WWVD 5IBQA 9ABPA 2WB4A 2IPLA 3KSMA 2IDMA 4YRZA 1RXIA 4PE5B 4IILA 1BVHA 3OO1A 1DJMA 2PUCA 5BRAA 4KK3A 2E4WA 3Q41A 2FKAA 1LJLA 5PNTA 5DGCA 2QR3A 3NNDA 3O1JC 3QLTA 1TMYA 3F7NA 3IP7A 4LDZA 3MMNA 3SQNA 3TX6A 2IPAB 1D1PA 4RK7A 2E4ZA 3JS5A 4KFCA 1K68A 3F6PA 1JF8A 1JDPA 2HPHA 1U04A 2VUIB 4NV3A 4Y9TA 3M9WA 4D6XA 3MYYA 4DN6A 3OLYA 1DBQA 2LIVA 3ILYA 5FWXA 3M9XA 3NHMA 3KTOA 4MQFA 1JDNA 1TJYA 3HZHA 3MF4A 4MS1A 3OQNA 3JY6A 2CHEA 2PUEA 4O5AA 2QSJA 5JNVA 5KWSA 1GLGA 3H5LA 1XHEA 3LUAA 3RVKA 5KQPA 4KPYA 2GX6A 2VYCA 2O20A 4W5OA 3GYBA 1EAYA 4LX8A 5TQ2A 4F8JA 4MLDA 1ISSA 1CHNA 4RSMA 2A9RA 1D5WA 3DLBA 2WJAA 3CZ5A 3HUUA 3CFYA 2VUHB 3K4HA 3OMXA 3T6KA 4EYOA 1RXEA 2KYRA 2FQYA 3EULA 1ZVVA 4LZLA 2CWDA 5B3JA 3RVOA 2QXYA 1S8NA 4Z4HA 1BA2A 3T8YA 2ZWMA 5BRJA 4WZZA 1GCAA 1JFSA 1DBPA 1NXXA 2L19A 1LBHA 2NZUG 4ETNA 4RZSA 4RK1A 3EGCA 1ZY2A 1DCMA 3RVSA 3OQOA 1EWTA 3DLHA 3O2JA 1JBEA 4G0YA 4Z9AA 1JWLA 4O1HA 1M5TA 1ZHHA 2LP4Y 3E61A 4G97A 2AYXA 2R4QA 2X7XA 5TPZD 1P6UA 1NXWA 3IP6A 3HDGA 3RH0A 1QO0A 2PL1A 1YS7A 4EVRA 2PLNA 3TMYA 4EYGA 1B00A 1JLKA 2WY2D 3E3MA 4ML3A 2GBPA 1EFAA 4Z4EA 5EWMA 1ZH4A 5IX8A 3N8IA 2OENG 1UDRA 4W5QA 1F51E 1ZH2A 4LE2A 2FQXA 1ABEA 2FN8A 1GUBA 1JL3A 4KQ9A 3N0RA 3H1GA 1OXBB 3CNBA 3CS3A 3H5IA 4MR9B 4ZJPA 4YLEA 2FMFA 4S04A 4KVFA 5EWLA 4B09A 4DADA 3I42A 4UHKA 4ZPJA 5EWJA 3H6GA 3RVMA 1APBA 1YMVA 3M6MD 4RV5A 4QYMA 3D8UA 4MAAA 3RVJA 3QELA 3OQMA 1HEYA 3C97A 3F73A 3O1HB 3FDFA 4D74A 5DLEA 1RZRD 1P8AA 4MRMA 4ZMRA 2H0AA 3H5TA 4S05A 4IMIB 1QQAA 1EHCA 4RXTA 5T3YA 1ZGGA 3LUGA 2F8TA 2A9QA 3DBIA 1ABFA 1DZ3A 2MYPA 4XASA 3HV2A 3F6CA 3IP5A 3H5OA 5TPWB 3R0JA 1AB5A 2QW1A 4YP9A 3C3MA 2NT3A 3O74A 5IEJA 2PUGA 1FQWA 4RK4A 1FFWA 4Z9BA 3KHTA 5JNSA 3DGEC 4MS3B 1H9CA 4MPTA 2JVKA 4RY0A 3SAJA 1YS6A 4FE7A 1PNRA 2FEPA 1AB6A 1Z2EA 1WETA 3QLVA 5FBHA 2FMIA 4GPAA 1Z2DA 5CNJA 3UK0A 1KRWA 3C6QA 1A2OA 4Z4GA 2TMYA 4CBVA 1PEYA 3L6UA 3CKMA 2JVJA 2A9OA 3CRNA 4O1IA 4JB2A 5HM6A 3LUKA 2FQWA 5FWYA 4RWEA 3HM9A 3BRSA 1Z13A 4YWHA 1VLZA 1MB3A 1VKRA 3QX8A 1PHRA 4EGSA 1W9HA 1YK0A 2M98A 1QP4A 3GV0A 1L5YA 3HK2A 2PKXA 5BR1A 1RZRA 4WWHA 2GKGA 4RU1A 1IIBA 2FMHA 1RPJA 4TLMB 5I4CA 4TMYA 2PUBA 2HQBA 3CG4A 3ROFA 4ETIA 1DC7A 2MYNA 4N41A 4JB0A 2FLKA 2E4UA 3B2NA 3H6HA 3QLUC 3KCNA 3RQIA 1SXIA 2WJWA 4FB4A 4XAQA 1ZITA 1USKA 3HO1A 4W5RA 2M1ZA 2NUBA 2IYNA 2YHBA 1Z25A 1XWWA 4YR7A 4F06A 3CTPA 3EAFA 1QQBA 5HKOA 4E7OA 4MYRA 4DQDA 3OO0A 2B1JA 5TE9A 2QVCA 3OM0A 4LRQA 2CHFA 4G0ZA 5D2CA 1I3CA 3CLKA 1C0EA 3KLOA 4Q7EA 4IGAA 3URMA 3HXMA 1NXTA 4IF4A 4L4UA 4F11A 5C5EA 4MR8A 5FWXB 2NZVG 4G0XA 3EODA 1JFVA 4MQFB 1FFGA 4MS1B 3KYJB 4PYRA 3KG2A 4N0QA 5FBKA 5CNIA 3HVRA 2LBPA 3OM1A 1URPA 3QEKA 2NT4A 3KS9A 1D1QA 4LE1A 3GA5A 4OTZA 4XXHA 3IDOA 3T38A 7ABPA 3MM4A 2LPMA 3LUHA 4H3HB 5GQSA 4G0MA 4WXMA 3K9CA 4G0PA 5JNRA 3UUGA 2HJ9A 1MAVA 2FTKE 4RXUA 2PL9A 4IMJB 1SRRA 2HSGA 3OLWA 1ZAYA 4YS6A 3RVPA 3O2QB 2PMCA 3QEMA 4LDAA 5B3JC 2FEKA 1SXGA 1ZDMA 5JNWA 4XLTA 2P4UA 3HJFA 2A9PA 4W5NA 2MSWA 3H1EA 3VNBA 1NTRA 3OLXA 5IC5A 2P9HA 1EWKA 1E6KA 4Z0NA 2CD7A 1ZN2A 2JRLA 3TD9A 2DRIA 1YIOA 1J56A 2IPNA 2J48A 3GL9A 5TQ0A 4G86A 4D6YA 4YCSA 2LUOA 1DCKA 5BQ3A 5EWMB 3EQZA 2JBAB 5T7BA 4KMRA 1JX6A 4N47A 2HQOA 3RVQA 4RK6A 4EYQA 3TO5A 5EWLB 1YMUA 5EWJB 3FFWA 4F12A 1PNTA 2ID7A 1A04A 5TQJA 1QKKA 5CNMA 4RKRA 2PE5A 1D4ZA 4KZKA 3A3KA 5HQJA 4OG2A 3HS3A 5TPZA 5DCLA 4NCBA 5IUNC 3KYIB 4MRMB 3LKVA 2RJNA 2MYTA 3Q15C 3EDCA 2R47A 1T34A 3L49A 4OLBA 3GWGA 2QVGA 3LKBA 5GOTA 2PUFA 1U0SY 3LUDA 5IUKC 3LUFA 1NXSA 3H75A 4EVQA 3DZDA 4P98A 4W5TA 2R25B 3JVIA 4PZ0A 4ZYLA 4MGEA 1OXKB 2L17A 3O21A 4EYKA 4MS4A 5CNKA 4QYWA 2FLWA 4JP1A 4TN5A 1U2QA 2FEWB 1SD5A 3Q7SA 3IPAA 4JASB 4E7PA 2E4XA 3LUCA 4MQEA 4H60A 1DC8A 1USGA 3NHZA 3RVRA 3QLVC 4YO7A 2N9UA 3Q9SA 1MB0A 4HNSA 2AYZA 1FFSA 4JOQA 5HSGA 5KQMA 3LTEA 3CZCA 1F4VA 1K66A 1RNLA 5FWYB 2MYUA 1M2EA 2E4YA 3NBMA 4MR7A 4XARA 1MVOA 5E3JA 3SY8A 1Y1LA 5IUJC 1NXPA 3GRCA 5JS2A 2RGYA 4KQCA 4RY9A 5KQGA 2QV0A 3I5AA 4N03A 3KJXA 1YVUA 3OLZA 4Z4CA 1TM2A 1JYEA 3QX9A 2IPMA 1XHFA 4TLLB 3IPCA 3FGZA 3MA0A 4JA2A 4Q6WA 1PUXA 4FE4A 1VRVA 4HYEA 3UKJA 1NXVA 4LE0A 4EUKA 3S99A 5KC8A 3G85A
chains in the Genus database with same CATH superfamily
1NDUA 1YRBA 2PLFA 4D9FA 1O95A 2IOHA 1W4AA 3NVKI 3SX4A 3FDZA 2DBZA 1DADA 3FYUA 2NUTB 1IBCA 1MRSA 2XRZA 4K9RA 2FUEA 4C0QC 4KJXA 5D3MA 1TVKB 4B4WA 4BTVA 3JTEA 3KLNA 1XAGA 4LVCA 1D4OA 1L6RA 1KEKA 1CEYA 2AG1A 4OYRA 4XKJA 2AK2A 1A27A 3U4QA 4TMWA 2WKRA 3EQ2A 3VNUA 2PRSA 1YZHA 3QE9Y 4I55A 1YFLA 4BVFA 4DQKA 1BO6A 1A96A 4AYTA 3RHTA 2Z30A 4KI0A 5C5CA 4RUKA 1P5ZB 5EXEA 5DSZA 1JIQA 1U8FO 3JCZA 5ICFA 1OZ0A 1XRQA 3AFIA 3MJHA 1Y8CA 4JQCA 4BNKA 1QLHA 1DKMA 1PWYE 2VCEA 1L5LA 2QZ9A 3WNQA 4H7FA 3PFGA 4O4JF 5EZYA 4YUZA 1I3NA 4FSHA 3DL7A 3G5MA 1BGWA 1T8YA 1JRLA 1ORHA 2ID9A 4EKDA 4UARA 3RYFA 3WB0A 4OQEA 1GQOA 3NHYA 1EZZA 4RSGA 5A06A 2X3YA 1QHEA 3L18A 4YCJA 3N0WA 2QORA 4M4SA 2YINC 1EJ2A 1ZMXA 3OIYA 1J8YF 2VN8A 2VDUE 3C6BA 3KLBA 4KMMA 5E7JA 3WYDA 5M5BA 4MROA 5LOVF 3GLGA 5DHRA 4UTOA 4DDTA 5HKAA 1UC8A 3TLGA 1M0SA 4FFBA 3BHNA 2CJPA 1CUUA 3TR6A 2V5AA 2WD8A 1NBAA 2JFUA 3MCUA 2GFIA 4TLBA 5DHUA 3DV9A 5EL0A 5I5GA 3RUFA 4LJSA 1S2IA 5JC8A 1RYEA 2AD1A 3B78A 4MWDA 2DPMA 3MG9A 5H9VA 2RI6A 4CF6A 2HK9A 1LLDA 1TUGA 3Q6IA 4JBLA 1OB5A 3L8EA 2GWRA 3JVEA 4MQ6A 5CHYA 1XBTA 4KBFA 1AC5A 2WFLA 3HXLA 5AXDA 3ZJTA 2W42A 4C7KA 5EAIA 3NZEA 1QZUA 2YWEA 1RQ7A 3HUTA 4ND7A 3ZUPA 4F3TA 2PZFA 1RWQA 4BDSA 2VJMA 2QG9A 4TMTA 4DPKA 4IZHA 4A10A 1DUSA 3TVTA 1R4NA 4AG3A 3PFFA 2SICE 5AUOB 3C16C 4K86A 3WICA 4D79A 5LB2A 1SPXA 2AX4A 5JZBA 1JVSA 4GH5A 4E21A 5H16A 2IEBA 4HAXA 4F3CA 3D7RA 2XWQA 2OCGA 2DJ5A 1RD4A 3S2EA 1KSFX 4GPD1 3IQIX 4KNYA 4L7VA 4ZQGA 1FDOA 3NT2A 2UAGA 1ISRA 3A9TA 1P4JA 3BQ9A 3WKAA 4EO9A 1U0HC 3ANSA 4QO7A 3ZE7A 1EX6A 2ZI6A 3CU5A 3DNFA 1NI4A 4HI0E 3G0BA 4A23A 3QBVA 2IX3A 2PK3A 1UDWA 1QC5A 1RAFA 1LGYA 4QUEA 2JLQA 2CYAA 3K05A 3W4IA 4UHJA 4KV7A 3FOZA 4LYDA 5ALGA 1FMJA 5EA2A 4O6VA 2AMVA 1T36A 3VYRB 2QZJA 1ZUWA 3L7LA 3IHWA 5IAGA 2QD4A 2PSFA 3TIVA 4JAVC 1QGOA 1UBGA 2P6NA 1J25A 1V7PC 5AKIA 3K8OE 4Z7JA 1DFIA 2FRDA 3AF0A 1LRKA 1EMDA 3C4VA 1P9RA 3FPKA 3HKEA 1RABA 1K7FB 1T4GA 3JQQA 1TCVA 5A3JA 4Q1BA 4DIOA 1CIVA 2R6CA 2RH8A 3ZGYA 4I4TA 1A5ZA 1H2FA 2DUNA 2OK7A 1AZWA 1E2PA 4FEEA 2WSBA 1Y63A 2ZVDA 5F73A 1WDWB 4TX1A 4TQGA 1MPTA 4FGWA 4Q1FA 4F38A 1TTTA 2I7DA 4R01A 2ZUTA 1FXUA 1QHYA 2H1LA 2BFMA 5F1KA 3ZU6A 2P5YA 3IUEA 3S1SA 3IV6A 3BE8A 1UK9A 2NO0A 3IUJA 3OG9A 4LHWA 4FGJA 4WFQA 1H5NA 3OBIA 3TZKA 1XF9A 3A4LA 4O4IF 1N77A 4PM4A 5I4KA 1CUAA 2AW5A 2C2BA 1EFTA 1NP7A 2QMUA 2PQ6A 3NNDA 4MJ7A 1W36B 1T6NA 1N25A 4GOKA 5KKAA 5E6RB 2FRXA 4OXRA 3ESYA 4XWAA 4XCQA 4IIFA 3BYZA 2B0CA 3W1VA 3PS9A 1XKTA 4HT3B 3BJMA 1CUYA 3SDSA 5CTAA 3ANYB 2CFTA 1DPFA 1OVMA 3BGVA 3IAS1 2OQVA 2HEIA 3ZE0B 4ZIRB 2ZWPA 1TKCA 2C77A 4JYCA 5JD5A 4P3OA 1CETA 3IIMA 4BJ6A 4CGZA 1PE0A 2O3SA 3ILYA 4BMPB 4ZMBA 3TQQA 2WPDA 2CLKB 4GQIA 4Y2SA 1D0IA 1TJYA 2ZYRA 5KVQA 4PRYA 1LZLA 2CZGA 5EOVA 4CVNA 2I4RA 4O5AA 2YTZA 4WY2A 1YUBA 3TLAA 4MHSA 5JNVA 4HDKB 5TSDA 4UOEA 4J4TA 3PX7A 4A8TA 4MI3A 1TM5E 1VCMA 2RGNA 3WL4A 4ER0A 4M76B 4WOKA 1WLSA 2RIRA 4ZI7F 1DFHA 1QCCA 1ZD1A 3QBJA 4OHCA 4TM7A 2A9RA 5AP9A 3QUQA 5AXAA 1LU9A 2QN9A 4QQKA 5BP7A 2BV3A 1FSSA 1SBHA 4R8VA 5CHEA 3K9QO 4BQFA 2QPTA 4RGQA 4NY1A 3WYNA 1Z62A 1TADA 1ZVVA 2QG4A 1ST3A 1IOWA 2QTVB 3QXJA 4TV8A 4PCUA 2B4TO 4Y18A 5B3JA 2XYRA 2ET6A 2IL1A 1ZUIA 3DKRA 3S55A 2VK4A 3ZK7A 4PSKA 1SBQA 1Z7BA 2OBYA 2VHQA 1FJXA 3EGCA 2QW8A 5JYCA 2REBA 3QMWA 2QDKA 3RAGA 3TWOA 3RS2A 1U2TA 1Y3AA 2F3PA 3EOBI 3MAJA 1PK8A 4HYQA 5SZHB 3FVWA 4PN3A 4DMMA 4F56A 1UBJS 5EXDA 4JDPA 1W4RA 1GUFA 2VUUA 3C3CA 2IYZA 1ZH6A 2XADA 3THXA 1IN7A 1VRWA 1A1VA 2Z5LA 4J3FA 1S4QA 1UBUS 4ML3A 4Y9UA 3PL5A 4D0RA 3F97A 2K5UA 2CFCA 2ACKA 4KACA 5GZ6A 2FK8A 5HF6A 1HWYA 4ZZ0A 2OD7A 2QLTA 3NVAA 1L7QA 3AOGA 3V97A 4W5WA 5CDUA 5KOYA 2FQXA 2ACWA 4GXRA 1JQBA 3IUSA 1CZNA 2DWQA 4FWIB 4HMQA 4NZZA 5GV7A 4CNBA 4Z53A 3J7AC 1OILA 3KZCA 1MJFA 2P4SA 2ZSFA 2FMFA 2R6R1 4JL6A 4ZV7A 1DO2A 4GLBA 3FSRA 3BL6A 3IULA 2J3DA 3RLFA 3W1WA 5MF6A 3L7DA 1P2SA 3ZR4B 1S7GA 4XX0B 1YCGA 4DTIA 1YMVA 1Q0TA 4QSHA 5IJ9B 1LZKA 2V6JA 1TZJA 3MFYA 3PTLA 3R2JA 3OX4A 4MQUA 1XC7A 3PUKA 2Q4EA 1NG1A 3C97A 4YCCA 1MV8A 3CF0A 4ZTBA 4I8XA 1YU6A 5EC8A 1ZM9A 2XUDA 1U2RA 4Q9JA 4B3TB 4ND2A 3T0GA 1K63A 2ZRCA 4N5NA 5KU7A 2MYPA 1LPAB 1HT2E 5AHKA 4D8UA 2OCIA 4MUGA 4P08A 4DARA 1TIPA 2IYUA 3PDJA 1CKEA 1E3IA 1JEDA 2W8BB 2OL4A 4PTLA 3DFUA 3WLPA 3A2KA 1RJ9A 5FYQA 3A6JA 2NSLA 4RK4A 1X70A 3WK8A 1QVRA 5JAHA 3CMCO 3DF9A 3B8EA 1V8PA 3RKRA 3LQ1A 4CKZA 1L5OA 2BEWB 4OL9A 3WGUA 1GRNA 1TLLA 2JCBA 3ABSB 5DTQA 1LBEA 1LTKA 5AKKA 4CMJA 3U09A 2JVKA 2YCBA 4KQ6A 4Q47A 1XHLA 1XR3A 4H7EA 1XF1A 1L0BA 4CM5A 5CA1A 3DDSA 4MV9A 3UK0A 1JQ5A 2ZRAA 3MOIA 4KR7A 5A5DA 3LUBA 4JMLA 3RS7A 3VDRA 4EIWA 3BIOA 1Y98A 2QMYA 7AT1A 2PZLA 3L6UA 1R10A 2JVJA 1E2LA 1QBKC 4O1IA 3VR3A 4JB2A 3TQCA 3G2HA 1GZ5A 4BZQA 3G82C 1SULA 5KYGA 1IZZA 3ICWA 5GONA 2JLXA 1CJTC 1PUJA 2OCAA 1KJZA 5AWFC 4YJ3F 1N6IA 5A1TA 1PS9A 2CN1A 1ECPA 4D5EA 3UJPA 1P1CA 3LC2O 5DP2A 3QKSA 2X1MA 1TA9A 2NO7A 1J06A 5I4CA 3STYA 3A2NA 3HZZA 1EVQA 2IVFA 1GJRA 3OVMA 3TUIC 2CXOA 2Z2ZA 4B48A 2OOSA 1CQJB 1MD9A 1QIJA 3HY3A 1VYHA 5LQUA 2G1PA 4GRAA 5CBKA 2C3YA 1M6YA 3IMKA 4Y6QA 5FTWA 3L6RA 3P5BA 3KCNA 2BN4A 2C4WA 5BW6B 5KTTA 1I6LA 3NRCA 1CXZA 1L4UA 3H5RA 1QFZA 1P1JA 2XGGA 3NHSA 4BO8A 2XMCA 4OH1A 4BECA 4KVZA 3ZC3A 4NEGA 4YR7A 2W2OA 3EAFA 1A9ZA 3QBEA 4NV1A 1NE2A 2R87A 3Q12A 5AI8A 2EV9A 1NLFA 2HA4A 4MP6A 1EFPA 4PAMA 5D1HA 3LQKA 3I01M 2OMKA 5GIOE 3CGGA 3E2PA 1I3CA 2J1LA 5HZGA 1OY1A 1WBBA 3FSEA 5TARA 8AT1A 2G36A 4IGAA 4HDCA 1HZJA 2QZSA 3WIVA 1ETHA 5EZSA 3WRVA 2ZT6A 3COVA 3GGSA 2OBBA 3PKIA 4WLEA 1DIOB 1OJLA 1RAGA 3FVVA 4XIJA 1MHPA 2RK6A 4ZOCA 4N0QA 4WGFA 3HBAA 3SC2A 2YY5A 1MZPA 1VBKA 2A58A 4MZDA 1EA5A 1Z34A 3QU4A 3GPDG 1DTSA 4CM3A 1ZCFA 3HR4A 2DKOA 5JZSA 1I2AA 2HU8A 4WXMA 4AK9A 4XVHA 1OH6A 4J3NA 1B0ZA 1JDZA 4HAWA 2FTKE 3OOEA 2IDZA 4EJMA 3O93A 1NM5A 2QMOA 4L27A 1HORA 3TM4A 2Q0SA 1GPNA 4JLOA 3I05A 4C7BA 2BISA 2OO5A 3A4NA 4DLSA 3E5MA 2P4HX 1EFVA 1KL7A 4CGYA 1ZVQA 4TVSA 1PKXA 1SXGA 2XLCA 1VPEA 4JLJA 5ETJA 3R5TA 3HJFA 1TKRA 5CCXA 1CUCA 1VKZA 3EASA 5E3IA 2BP7B 2BEKA 3P4XA 3H1EA 5E2BA 3TLKA 3EXIA 3EXFB 1P0PA 3OLXA 2P9HA 3IDQA 1EWKA 1Z63A 3H1PA 4DDWA 1L4KA 2XE4A 1AUQA 3FNEA 3HCDA 4FIDA 4DMGA 1BHO1 4K05A 3BXOA 3TB4A 1IJEA 3DTYA 4Y1RA 4KR9A 5HWSA 3WQQA 2EFEB 4D6YA 1T6ZA 1S2MA 3BE5A 3R5KA 4BO6A 4TYWA 2XGMA 4US2R 2W37A 3Q87B 4HADA 3TH5A 3A4VA 4OAPA 3R5XA 3FDIA 4HUTA 3VOSA 2EQAA 4HWSA 2CMGA 1XA0A 1G9TA 2HA5A 4UM5A 2C3PA 3ZWXA 4E0BA 2X2FA 1VHWA 4UUBA 2GILA 4M8KA 5F7ZA 1YMUA 3QQPA 4WN9B 4US1R 4BN5A 3BERA 3I9KA 4EZIA 4L5BA 4TXJA 1QKKA 4H7DA 3W6UA 3B1VA 5EYPA 4AKEA 3KKQA 3ZCTA 4K40A 4K0KB 1CX9B 3LRTA 3AYZB 5DP1A 3AHFA 3S29A 5AVUA 3I9NA 4HP8A 1DB3A 3WBJA 5JJ5A 4MMXB 4D3DA 2DUMA 5T6MA 4BE7B 3I2JA 4YV1A 4AX8A 1MDBA 3W4JA 2WICA 2CFSA 4AMGA 4BGVA 1Q1ZA 2I6TA 3P2EA 1DIHA 5AHRA 5LB4A 1J8DA 5BXQC 1T6XA 4B4KA 3WHIA 1YUNA 4IO0A 3VHXA 1OE0A 1U8YA 2RHDA 3K31A 4GI1A 5DI3A 3OPVA 3LW7A 4BO0A 1OT3A 1SURA 2MR5A 3L9WA 3PGXA 1NUAA 1U2QA 4J7UA 4MVJH 5HKLA 2D74A 4GOOD 2Y1OA 3TRDA 1T4MA 3JQFC 2YXEA 4D3XA 3BWVA 5BN4B 2AQ8A 4HAIA 2IIQA 4TTSA 2RI1A 3WLFA 5KINB 3CZRA 3CH5A 3IBGA 5CP8A 3B6MA 3LC0A 2G1UA 4JK3A 3O1LA 1ZAKA 1ZW6A 1QIGA 4UM7A 4AY6A 4JYZA 1F4VA 2NYRA 2ZRJA 5K3FA 1NOIA 2FPKA 3OJCA 5ER9A 3ACCA 5AKZA 5JAIA 3CE6A 2A1UB 4E2WA 2HK6A 4YI5A 1I33A 3MT8A 4RA9B 4IXNA 1W88B 2IE8A 4ITUA 3VO9A 3K53A 4EA8A 3ZWNA 3QIAA 1EX1A 4JYMA 1G6KA 3AJAA 4B31A 1Z0SA 1N1MA 2NPIA 4DNXA 2D1YA 2VHTA 1GD1O 4MZXA 4O08A 3OTQA 5TGTA 3WKBA 1BVYF 1JYEA 3RC7A 3U7EB 2IPMA 3RRJA 4R41A 4TLLB 3HUDA 3FGZA 4JLPA 3SBXA 4GP9A 2P67A 3N8GA 4DJEC 4BQPA 5B3AA 1R6XA 1XZPA 3EFBA 1RWOA 3IODA 4IIUA 5J5VA 4HYEA 4Z0TA 1ZBDA 3RIHA 2TMGA 5LYJF 2B1GA 3V4VB 4N76A 1IY9A 1KK0A 1PWZA 1TMKA 2AA3A 3GLGE 4DLVA 1NXOA 3GMDA 4KXQA 1N9KA 1KMCA 2Q1TA 2V7PA 3TZ6A 4WCDA 4CE6A 2ZRMA 3H86A 1OKKA 3A3OA 3QVWA 3TBKA 1I4DD 1K6EA 1RYYA 2H92A 3FSGA 3LHDA 4YP6A 4N65A 5AI4A 1Z8DA 2QUKA 3JQPA 3ROQA 1PT6A 1I5OA 4JITA 4FHFA 4UBOA 1BOOA 2CLEB 3HRIA 2UXCB 1FLDA 4P5DA 5ED4A 4RPHA 2H0QA 3AKDA 1PS8A 4RLSA 4ETMA 4Q18A 3T3NA 2GT1A 5FHRA 2J0VA 3ADBA 2BFNA 2IITA 3K73O 1M1UA 2I76A 3E6AA 1KKLA 2HA0A 2R79A 3D6UA 3EIWA 3NU1A 2WQZA 4AWBA 1ZONA 1NX6A 1Z06A 2ZIEA 3HFGA 4N12A 3SXUB 2OPBA 2EKBA 5IH3A 3BTUA 2GXUA 4JJ8A 3QH4A 1TIKA 1C2TA 1NFRA 4FJ1A 4NJOA 1Y6FA 4CQJA 4IGKA 2A5YB 4JB3A 1JYFA 3UV6A 2XWBF 2CE7A 4O8CA 3K9HA 4D97A 2XQGA 5DGHA 2XZPA 2JFBA 3TW4A 5LDHA 3WSVA 4X91A 1P17A 3OPQA 3CH4B 4TTVA 1Y5IA 3DBHA 1G3QA 2FE4A 3I64A 1UEIA 3NNNA 3GRYA 4NBTA 3HSYA 4NMMA 2X0EA 1QIHA 3HJCA 4D4LA 3P5SA 2ES4A 1Y8RA 2ECOA 3RF7A 1E1RA 4Y2RA 5CR9A 1M1ZA 3OOJA 4DV1B 2SCUA 4KVAA 3ZKWA 4TTPA 5B1EA 3F6BX 3AW8A 1I13A 4QDKA 5SZKB 3CLUC 2ZE6A 3JATB 1PL0A 2H07A 4V1CB 4EHIA 4NPHA 4OXXA 5DHFA 3IUMA 4K9LA 3DZGA 5FTKA 3ZWPA 2NUPA 2B35A 1PW7A 3CN9A 2IOQA 2C98A 4JU8A 3BEOA 3IOCA 2YHSA 1YE5A 3HBJA 4LZNA 4R3UC 3O95A 4BNYA 4C7MA 1T2EA 3HLTA 4R3WA 2OXFA 3DHYA 3NGLA 3FZNA 4I5FA 3TLBA 5A2GA 4GL2A 3GT3A 4INPA 5FNVF 1K8YB 2OBMA 1O1YA 2ZBDA 3PNSA 3RVDA 5ITWA 3L7JA 4MRNA 2PXAA 4KNWA 3VPCA 1MBZA 1ORWA 5B30A 1FFXB 1MVLA 1XTUA 1Q95A 2EJBA 3QX7A 4O29A 3DGFC 2VUTA 3DP9A 3V1KA 1RLUA 1ZD5A 9MHTA 5DB4A 3U61B 4AZVA 1X77A 4D5GA 1SKUA 3AP3A 1YJBA 2D1SA 2NNLD 3PICA 4RE5A 3JQAB 3H5WA 3UK1A 2A9JA 2XYGA 4JN6B 1JU4A 4I1VA 1K0UA 3VHLB 1FDVA 1CP2A 2X77A 3C87A 4QTUB 3N5KA 2OC4A 4YDSA 1AGRA 5CYGA 1KYQA 5K01A 3S2UA 3DCIA 1D2AA 2V6MA 4KAJA 1Q3TA 4PX2A 5JG7A 4JCCA 4N7MA 3LK6A 2WIGA 5DN6A 1TLFA 1YK1A 4PLTA 1PJ4A 5IT5A 2WBLC 3IO5A 1E9AA 2O2DA 3G0CA 1QZXA 4PINA 1G1MA 2VTBA 4M99A 4RKQA 2OUIA 4UD2A 5F78A 2VQSA 3P26A 1ZCBA 5EHGA 5DLQC 1QUEA 3QPVA 2D2IA 3W3AA 1OJ7A 2VRWA 1KJWA 1WS6A 2G5TA 3KU1A 1H23A 3GRRA 1NQWA 4GM1A 4KNVA 2D54A 1JLMA 4M1QA 1FXWF 3N6XA 2HH9A 4R2IA 4CQMD 2P9QA 4U02A 2WABA 5JVDB 3SIRA 2BKAA 2LTAA 4JC4A 3ZQJA 4QXRA 5K7SA 1JIJA 3H8JA 3KJHA 1NF9A 3G1WA 3OJXA 4QYTA 5DEIA 5EIHA 1LW7A 1PN3A 1U7TA 2JGEA 3WAJA 1BVHA 1L7OA 2BUBA 2R85A 4I8IA 1HK7A 4D4MA 2CK3A 1CYDA 2VNIA 3TZLA 3O91A 3Q41A 4UPDA 4NZYA 3WLMA 4DBLC 4LZZA 1Q1EA 3DZFA 1ZBQA 2NSYA 1YRLA 4ZGWA 5HX7A 3NC1C 1H1LB 4LDZA 3HNPA 4HH0A 3RSQA 3WMRA 1KC3A 2RCNA 2OZKA 4LRTB 4MVJP 2AK3A 3GHHA 4RPCA 5ALNA 5AOBA 2XR1A 3EEQA 4GLOA 3DDCA 4D6XA 1JKIA 2PD6A 1L5WA 1F38A 1SCUB 2H9AA 1DBQA 1QJ4A 2FETA 2OZLA 2WILA 3GJZA 3KELA 4DCOA 4TV9B 3OHMA 4WESB 3IOMA 1UC5B 5FWXA 4Z6KA 5F23A 1H9AA 2FRVA 1EWQA 1MLDA 4XJXA 5C80A 3X1WA 1U7ZA 3B1XA 1W30A 2C04A 1R00A 1E0JA 1L7RA 3T7JA 4BB9A 1H5UA 4ZAGA 3WGMA 5FXMA 2NPOA 3FFAA 5AI0A 3MTGA 5J63A 3RVKA 5JCPA 2GX6A 2OO3A 3ZCXA 1GKKA 3BWEA 5FLEX 4P84A 3ETJA 1OH7A 1E3SA 2AI1A 2X6TA 5C9ZA 4PO8A 3UAXA 2Q29A 5I7VA 5HNKA 5CBPB 3LZCA 2B4YA 3JQBC 4BGUA 1O6FA 3LT5A 4ROTA 5ERGB 2WHXA 2HWYA 2PU5A 3T6KA 4B3IA 2E9SA 4OGGA 1E4EB 1B4DA 2KYRA 4YUXA 1XJQA 4IXTA 4YAOA 2C5GA 2W2LA 4NENA 3E3NA 1L5QA 1LLFA 1O0BA 1SUWA 4KQGA 2L19A 4H59A 4ASUA 1OAKA 2H31A 1NR1A 2OHVA 3DLPX 3GLIB 1X9HA 3OQVA 1M5TA 2NV2B 1X8XA 2FY8A 2WHPA 1Q7TA 4XDZA 3JWJA 4GVLA 1XU7A 3Q2KA 3RWBA 4DCUA 2HQ1A 4IEIA 3WDSA 3DLAA 4ZTZB 4K03A 1I3LA 4NZPA 2V7GA 5DO9A 2I67A 3P20A 1JQKA 2DTDA 3WBFA 3TMYA 2QM7A 2ZJ6A 1S2OA 1GITA 2XW6A 4QTTB 4WLFA 2WY2D 4RTOA 3E3MA 2CGEA 5CT6A 1Z0DA 1EHIA 1Y7HA 2XDAA 3E4DA 3TPZA 1I7LA 2VJDA 3B48A 3MWDB 1ABEA 1FNSA 4LSWA 4UASA 1ILEA 2RB4A 3MUFA 1F3OA 3WC4A 3BTSA 5JR3A 4P54A 4R8SA 3UMSA 4KDCA 1ULSA 1H4SA 4BFSA 5JFOA 4JLVA 2AOWA 5GZ1A 3WP0A 4PY2A 1O6ZA 3LKDA 1BHJA 3NEYA 4I9HA 4D4JA 4X93A 2Z3WA 5CFOA 3IQDB 3A4MA 3NT5A 3WX0A 3AGPA 1UMBA 1XI2A 2E37A 2VJLA 4IMIB 1N5DA 2XHZA 5LQMA 4FMBB 3KT3A 4XB1A 2DVMA 2UZ4A 1IUOA 3WB9A 1E9VA 2ZBUA 4BVAA 5E95A 5LWQA 5KVAA 3OT1A 5K0SA 2J3QA 4AECA 2NO6A 3H5OA 1XTZA 2F00A 4NABA 3RAPR 1GAQA 4AI6A 1AB5A 2OLEA 2D06A 4HRXA 2YY7A 2PUGA 1DTWB 3OQPA 3OJWA 5BQPA 2X2PA 1A8QA 2VTEA 4CI9A 1YBMA 5AR1A 5CAEA 2G4CA 3AKEA 3PHCA 5H3CA 5BRAA 2V55B 4QFCA 1GAWA 2GHQA 5CT5A 3R8CA 3QVSA 4CTOA 2MINB 1WQ3A 1BROA 5CCDA 4A6DA 3W2EA 1PT9A 1TPZA 1R9NA 1DKRA 2A94A 3LAWA 2H5LA 1UBFA 2BR4A 2H5EA 2ZYGA 3B9RA 1F5NA 2JI6A 1MXHA 3OI7A 1XNQB 3AVXA 1PEYA 1UMKA 4QATA 1VMIA 1XZCA 2CUNA 3VU8A 5ITZB 4B2IA 2OBNA 3R76A 4RAQA 5HM6A 1Z45A 4B3JA 4RWEA 1BWSA 1KBOA 5F3RA 3OQ6A 4OFZA 4HGOA 3D3QA 2B8JA 1IY8A 3NHPA 3HB9A 4F4HA 1FX0B 4G5HA 3TTVA 3CRMA 2VZLA 2A35A 1RMQA 2LKCA 2X2OA 1G7SA 4KW7A 4TMKA 4RV9A 4PAGA 2ZROA 4MVJF 4S2EA 4BVKA 4HVCA 5HRUA 1U0OC 4CFSA 1DFGA 1U2ZA 3D3JA 4BN4A 4C0XA 3FF4A 1EB8A 3F5MA 3WGJA 2ZRLA 1A4IA 1VJ5A 3E8SA 3WAKA 3VHQA 3ZCRA 4Z0HO 2WUWE 4BNDB 3DOCA 4IJVA 1K7SN 1CRQA 1VYVA 4V0NA 1IPHA 1JEYA 4IIVA 1WD7A 4BMYA 5BSGA 3QVGB 5G41A 1TQ6A 1ZUHA 2EG9A 1EESA 9GPBA 5KSWB 2GB4A 4IMRA 3HCAA 2OV1A 3PBKA 2IF2A 4AY3A 1EXVA 1IUPA 4UNIA 1YH3A 1QG4A 2Z5GA 1I4TD 3IAUA 3NIWA 4MYRA 2A5JA 2ONCA 3AP1A 3EA5A 1YOVA 4GWLA 4HN9A 4GBED 1NUQA 4MLZA 4GO1A 4GSYA 2I29A 1TVEA 4B83A 1SOWA 4Q3DA 1Y7IA 4OM8A 3JAMA 1E9SA 2ZE5A 2O1EA 3CLKA 3FLEA 4YJ2B 3KLOA 1D2HA 1MRNA 2B1IA 3FM9A 3NGMA 4H7KA 4HSEA 1IQPA 2ISCA 2P6OA 5I8ZA 1THZA 4EJ6A 4Z7OB 4CKWB 1HPLA 3KPUA 3PHLA 5HILA 3P96A 4CTJA 1AQLA 1VIVA 2NZVG 5EJEA 4GPTA 3I0NA 1J2TA 1U11A 2JIOA 4DLWA 2WIAA 3NPAA 3O5AA 3T9DA 3M89A 2QAIA 5FBKA 3FY4A 4ZGBA 1HDEA 4EX6A 2OGZA 1CW2B 4EF6A 3FWZA 2G1AA 1WO8A 4U3JA 4GMKA 1WLYA 5AJHA 1IUNA 4AZ3A 3FZGA 2HJ9A 3CW2A 1XJCA 1AO3A 1XNGA 3EY9A 1CJVC 3EW7A 3MTIA 2HJVA 3NDPA 4IRMA 4NJEA 5JQGB 2Q8NA 1PVOA 2JW5A 2ORYA 4J7AA 3RS3A 2EERA 4FPXA 4M38A 4NFLA 3HB0A 3VZDA 5C51B 2BHRA 1A88A 3ORSA 1V2GA 4PSDA 3FHJA 2YBEA 2QBYA 4PG8A 5FR1A 4U63A 3F46A 1VOTA 1O54A 1K2VN 1C9YA 1GNRA 2PS1A 4HWRA 3BAFA 3C45A 5BSHA 4K9QA 4ZC1A 4HZUB 2Y4NA 2X0RA 4JI4B 1GNTA 2VNSA 1X7ZA 2C3MA 4G56A 4ZEXA 1XGKA 3B38A 3GN2A 4ZT2A 3PNYA 3EZNA 4AY2A 2E7ZA 1RQGA 3AM1A 2IYPA 2FX3A 4X8OA 4DV7B 1BS9A 1BDMA 1AUVA 4NARA 4Y6PA 1LX7A 4XGNA 4ZV9A 1HT3A 4B5KA 3A1SA 1JI3A 1SXPA 1KEZA 2AFHB 4G89A 5IH7A 3O8BA 3LBNA 4MX8A 4ZJYA 1NP6A 3ZDXB 3NMUF 2ZYUX 3CVUA 3EQZA 2Q28A 4Z2YA 1U3VA 1X7HA 1Z6XA 2JJ8A 1PV4A 2ERCA 3I62A 1U1EA 3UO8B 1QHHA 4CKEB 3QEAZ 1RJWA 2XZTA 3U44A 2JD2A 4QGSA 2CT8A 3EZLA 2JFYA 2VT2A 2ZE7A 4IVPA 2EFYA 1JDBB 3X0DA 3ECSA 3OWXA 2JRCA 4I4LA 3NTUA 4KO8A 1FYFA 1TCBA 3RK1A 5FL7A 4B5LA 3IAM6 4QA9A 4L8LA 5AQ1A 1DAKA 4D98A 2EJWA 2GF0A 4CLRA 3NEPX 3WGNA 3ZY2A 3H83A 3SMVA 2PE5A 3AL0C 1G21B 4MPDA 4JJZA 4NCBA 5DCLA 2Q07A 2BDTA 4KO3S 1K89A 3PDCA 3VPBA 3EIHA 2BTQB 4RQTA 4ZXPA 1JN0A 3SJBA 4OP2A 5EP4A 4JYBA 2TSYB 3AR5A 3O8NA 1E1KA 1FP2A 1LD3A 2W8ZA 3Q8WA 4PBTA 3VTKA 3GDGA 1U28A 1ZD9A 4AF8A 1TAUA 2HBRA 2IEZA 3IIKA 1NVEA 3ML1A 4OGFA 1XVTA 3WK4A 4F1KA 4OVKA 4XB2A 1GKLA 5FOTA 4BJ3A 2A1TR 5MFPA 4LKRA 3LCJA 4BMNA 3IUPA 4DNQA 1ZMBA 3GEIA 1RFLA 1NUPA 2UUPA 4NMLA 1SFRA 1ESMA 1CU1A 3QF4A 2VNHA 1Y6ZA 3NP9A 2YNMC 1YF3A 3QE4A 4OHWA 1WKBA 1QR6A 1HYQA 3I8OA 1YHZA 5ENDA 2Z2IA 2JGMA 2PYDA 1D2RA 4N5MA 1NVVQ 4ITVA 4O3FA 4O2AF 1HL3A 4JXXA 1TEXA 2FUNB 2HF2A 3IAEA 1TOAA 1MIOB 2Q6IA 5EQJB 1W47A 4EECA 5LP1A 2BVNA 3FHTA 2Z8XA 3L6CA 2HCBA 3FCCA 3GMSA 5EHXA 1E4OA 1HRDA 2AF3C 4RMGA 1XTIA 3U7HB 4JQZA 5L4LA 1BD3A 4GKJB 1DAFA 1WDLA 1Y7LA 1SKMA 3HUEA 1B23P 1TT7A 2H2WA 2AVNA 2ABWA 3F9IA 3CF4A 3DZJA 4V0SA 5TV2A 2DHQA 1HYBA 1KJ8A 2Q46A 1QYXA 1B1CA 2RC5A 5K6TA 2G06A 2R751 2O2IA 3GPBA 4V24A 2D2XA 3X43A 1V39A 3EIXA 5EIFA 4JP3A 4RKEA 3WFIA 1DIRA 4PQYA 1SCIA 1PWHA 5EP1A 3E9NA 3NHKA 3UH0A 4AKSA 1T5IA 1PUXA 2E87A 1VJDA 4P7KA 2WT4A 4Q6WA 1LSUA 4AG6A 2CF5A 5P21A 3MMZA 2WW8A 2BI8A 3IJRA 3IHTA 4BNXA 3FI9A 4OB7A 4FYVA 3L0OA 3NOVA 2JCGA 3I12A 4KJZA 3T94A 1YE3A 1K5PA 1RI5A 2GM9A 3F47A 3Q3EA 3VAYA 4FU0A 4PNPA 1T1GA 4GQBA 3RO7A 1DRJA 1NASA 2VH1A 2Q4OA 5GINE 2QT1A 3HTXA 2K4MA 3AZOA 3A11A 2AJ8A 5E4JA 4JLAA 3WOHA 2ANBA 1V4VA 2G0NA 2IU4A 2J07A 1IMOA 3U3XA 1MNQA 4H1VA 1WEKA 4WTOA 1DKUA 1CJBA 8ATCA 3EUWA 2A59A 4HN4B 4D0SA 2NO5A 3D0QA 1DG9A 2A9FA 1LPPA 5DHSA 4ARCA 1UJCA 3PUIA 2XT9A 4A0GA 1NW8A 2KM1A 2Q3JA 4MA4A 1QR2A 4WMLA 1E1YA 1RSZA 1VYTA 4YAEA 1C4WA 5IN5A 2W6PA 3DE6X 3BCRA 4J49A 3LGAA 3TSOA 4LYHA 2HREA 5LQRA 1RCUA 4N8EA 3EZ7A 3GMIA 5ADUS 1A9OA 2ZVQX 3C7AA 2BGUA 1KAEA 3W78A 4F3YA 5D3KA 3AWDA 4HEJA 4UUMA 4ZMSA 1CWUA 1ML3A 4L8YA 5GVRA 5EJ8A 4ZEMA 2LCFA 3GFGA 2XEDA 2P77A 3KQMA 5H82A 2V9PA 2WSSA 4MIYA 5AHOA 1H9BA 2IS1A 5DBOA 2JI7A 3STUA 4YYEA 3VR6H 1EGVB 3AR8A 3RHSA 3LDAA 4YVFA 1T1RA 2QE7D 1JLHA 1BEUB 2D1TA 1J0EA 1XEAA 3IUYA 5ESXA 1KNQA 2I1LA 3IEKA 3AUAA 4XI9A 4MMZB 3L04A 1AS0A 2BAGA 2FMKA 3LT1A 4NX2A 4WZBA 4NCIA 1A8PA 5EKSA 5BO5A 5CYOA 1K88A 1NSFA 3FRIA 3KB2A 1IC6A 3PCXA 3UPUA 1BFDA 1VJ0A 1QX3A 4G1BA 1SVWA 1M8FA 4D9NA 1G3UA 1QGAA 4ER7A 4E6EA 2BR5A 4AF6A 5LP6B 4PZYA 3LOPA 1SVNA 2BKXA 4GYKA 4CEJA 3KKEA 3W5UA 3UT6A 3F49S 4AKHA 1XCBA 1JR6A 4EW2A 5DIZA 3KTDA 4JV5B 3MJCA 1ADCA 1YCDA 4MVWA 1WXIA 2CMFA 2WUVA 3V9PA 5ERXA 4NBUA 2HMYB 1LQUA 3GF4A 4TXHA 3THOA 3W7AA 2X15A 3A9RA 3LUJA 4ZOLA 2NADA 3C7TA 2R6HA 5IVPA 4UCWA 1D0VA 2BCEA 5DX8A 4QM6A 3EVZA 4D9JA 3T5AA 4C29A 1WXXA 5F5NA 3W5DA 1HTBA 4JSTA 3UJCA 5L3QB 4NQZA 3L0IB 4V0KA 1L4GA 1SB9A 2OFXA 2O0HA 3O9ZA 3MCTA 4OU5A 3L0CA 4FFDA 1GRQA 1F7UA 2BKUA 1SQ5A 3G6KA 4AY4A 4EGAA 2P9EA 2Q2WA 3P9YA 4ZAXA 1OLUB 1F8GA 2BKEA 1TZCA 1KXJA 3TFOA 1SG6A 2IKSA 5JXGA 4KAFA 3ZVNA 2X6QA 3GLRA 3H9BA 2AZMA 4OI0A 3CO0S 2VT3A 3Q6MA 4UHCA 4D41A 1GARA 10MHA 2R44A 4BFWA 1NWHA 2ALJA 2G08A 1R64A 3O94A 2FG7C 2P8JA 4PXYA 4PIVA 1LJUA 2IE0A 4NCJA 4ZVRA 5BUCA 3D6NB 3JYLA 5BRNA 2KHZA 4QDTA 4JBIA 4QU0A 4X1KB 3T9FA 1YR3A 3LI2A 3KUKA 1GNQA 3U7QB 2QQGA 3OQIA 3PX2A 3E0QA 4CEHA 3KHUA 2P6PA 3KZMA 4ZZ1A 2Z6AA 2PS9A 4A36A 5CM2Z 3D59A 1DRUA 3ZBUA 2ZYHA 5IT0A 3A9UA 3FYDA 3HDQA 5CU7A 3BZUA 1POXA 4NU6A 5AESA 5I9TA 4AROA 4QD3A 3RREA 4RETA 3HXQA 3K2BA 4DCCA 2I3ZA 2OGTA 2E4AA 1L1RA 1P5JA 2DFPA 4BNUA 1KMQA 2KS6A 1ZM4A 3HGQA 5DGCA 3OOHA 4DKJA 3QLTA 5JXWA 1GGKA 1VJRA 2QAGB 1TYEB 1JU9A 2PFGA 2JIZA 2WI8A 3MMNA 3GPLA 5CT9A 5ALTA 1XE3A 5PGMA 1PZHA 3I23A 1XXLA 3EBLA 4HC4A 5EIBD 3M2TA 1JF8A 1F0YA 4Y6LA 1RCTE 4NV3A 4WDQA 1E3TA 2YWHA 2COKA 4RSHA 3HXOA 3MMSA 4DF3A 3Q7QA 3HYLA 3VH3A 1TK9A 4Q93A 2EJTA 4Z8XA 2ZIVB 3M9XA 3KTOA 3CVVA 4RPLA 4IOMA 1IN1A 5DTJA 4Y6OA 1F06A 1MABB 2BW0A 1BJRE 4KRXA 2IZOA 1IQ0A 3QENA 3LUAA 4JI5B 3QUCA 4YJGB 3DPIA 1SHKA 3FTPA 2R6AA 3WK6A 4Y6RA 1VGVA 5INTA 3DWEX 3WGIA 4WSOA 3GROA 1KMHA 3WNDA 1JFFA 4TROA 2QTGA 1D5WA 4WI1A 3CZ5A 3GJ0A 2J31A 5EFOA 4UEKA 5IVDA 1XD2A 2XTAA 2WSYB 4PCVA 4DR5B 2EKZA 3CEPB 3T1OA 2P27A 2O8DA 2QTBA 3KT6A 2W4QA 1A4UA 1Y5MA 1LS1A 1U1DA 3P45A 3RANA 1HTWA 1GEGA 4BO3A 4DM7A 3F6SA 4K3UA 1LBHA 4JJKA 4LUCA 1ZY2A 3EC1A 4GLJA 1JWLA 4GBMA 3F4LA 5H3HA 3E61A 3PVSA 5DM70 2NP7A 3AHCA 4RLQA 1NXWA 1VHDA 1B42A 2C2HA 1YZFA 2GCIA 2DHDA 1HZZC 2RHWA 3NR2A 4HNGA 3A1CA 5EPOA 3KXIA 1W8IA 4B9AA 3V8MA 4YRIA 1PJBA 5DV9A 3I6MA 3SVZA 4IUYA 2PNFA 1P5HA 5FEMA 6ADHA 4KLNA 1KVRA 2G82A 3GQBA 3KB8A 2G9NA 4F5ZA 1D1TA 3Q0TA 1XTTA 2Q9AA 4EKYA 5AVSA 4TKZA 5B5SA 2BZSA 5JD3A 3CNBA 3RU2A 2HAEA 4CTMA 2GPWA 3SM3A 1II0A 4B6GA 1N5LA 1EK2A 3PKJA 3ZU3A 1PEKE 3H6GA 1WKCA 2FJUA 3HY4A 3WGYA 2W90A 4DMUB 3VVLA 4DB4A 1COZA 4M0MA 4AQDA 2W00A 4KLZA 4PYIA 3E18A 1YFZA 5F5XA 5FHQA 4ZO9A 2DH6A 3ENZA 1Q44A 5KHOC 1HE8B 1IWBB 1RCFA 1H8HA 1ZGGA 2PXCA 3AJ8A 5DX1A 4E15A 3P2MA 2V0GA 1E1MA 1PKEA 3OETA 4DW8A 3MWYW 5ARCA 5DHQA 3V7NA 3PEUA 2ZRNA 3R0JA 1ZEMA 1BXGB 5IEJA 3QPBA 2SECE 1T0BA 4B34A 2VT7A 1NVMB 3SK0A 1DI0A 5BYJA 1IE3A 2WWIA 5B55A 4WBNA 4WKCA 4C76A 2NTEA 1ESCA 2R7KA 1NPDA 3VC3A 1SKYB 1F2TB 1H9CA 2PMWB 2QA5A 3AUKA 1EFDN 3EHEA 3PE3A 3WRYA 4ZO6A 1S2DA 2DTEA 2H6EA 1AKTA 4XIIA 2I4OA 2AXQA 1QNFA 3FOEC 3CBGA 4LDQA 1TQ2A 4GPAA 1ENYA 3W6ZA 3AEQA 1MOQA 1PQPA 3K8QA 1P6XA 4JNCA 1JG7A 1FZQA 3I6YA 5F33A 3RUEA 4HGRA 3W5HA 3M6AA 2QNBA 3TOCA 4B3BA 3M4XA 5AJVB 2HADA 3CUVA 4M1SA 4EJ0A 1PGPA 3RABA 5I7WA 3WAGA 4YWHA 4QE3A 3QRWA 1V1RB 4TTQA 2CUKA 5JY6A 3NATA 5DISB 1QWSA 3O73A 4NFYA 1ODKA 3MW8A 4MP3A 3GFPA 2HIMA 1NONA 1WZ2A 2M98A 1G8MA 4BYGA 4NPCA 2C7GA 1OV4A 2YV1A 3TOZA 3TR5A 1H4VB 2ZRIA 4I4NA 1A77A 1I1QB 3D8RA 4KN9S 1X7YA 4TMYA 3V4OA 1X1BA 2PLAA 3PEYA 1PT5A 2FLKA 3Q40A 1WZNA 4KWTA 1REQA 3EZXA 2XB2A 5FO0A 3AI1A 2FW7A 3H6KA 3AESA 3O4JA 4GKAA 4OCZA 1V9SA 5FLYA 3BH7A 5DLYA 5JMOA 3I1IA 2C4KA 1KA9H 1C9KA 3R3HA 3FE2A 3U19A 1G20A 2FUCA 3P0HA 1SVUA 3VXKA 5DNDA 3JWEA 4FW8A 3THWA 4M9XA 2CL5A 1VDMA 2FAXA 3A37A 4FQ8A 4I2NA 1L3IA 4AD8A 3ED5A 4U9UA 3IPRA 4D8YA 1XOIA 3DKVA 2YZ7A 3HKBA 2DBVO 3PXXA 5H02A 4P82A 4GUDA 1ANKA 2AJDA 3I9JA 5D3MB 3OJLA 3GZJA 3ZS8A 3IR7A 4GRDA 5DT9A 1KP2A 2F1KA 1H65A 1PO7A 3KUDA 5SY6A 4AL4A 9LDTA 2PMEA 1KZ1A 1NXTA 1U63A 3AVTA 4K9DA 3CZMA 5C2JB 4EMTA 2V6IA 2V98A 3NC0C 3N74A 1QHXA 1T29A 4MS1B 1Q0UA 1LQ2A 1OAOA 2ZJ2A 4IQFA 4XVRA 1OWOA 5T3UA 3CZQA 4LC0A 3ELBA 4BP1A 3OKFA 3QQ5A 3KS9A 2HY7A 2J3LA 3JQ7B 2VDWA 3CRQA 1ZOOA 3ZCQA 5FR2A 3HUFA 5JTUA 3CEAA 2INGX 3KSAC 4N5HX 4IDEA 8OHMA 1JIVA 4ODIA 4RXUA 4MTLA 1SRRA 2E2WA 1A7UA 4Q4HB 4RQBA 3L9XA 4Q9NA 3KKNA 3PQ3A 3KJFA 5DWVA 5KYNA 1PGQA 2PGJA 3VR6D 3CIFA 3M1YA 1G5QA 2FCAA 1P4SA 2OLJA 3HN7A 2ID8A 4NDNE 4WFIA 1N75A 4E88A 3WBBA 2WKQA 4QOFA 4TUYA 3IKMB 2QPAA 2PBLA 1Z74A 1G98A 5CVTA 4G0WA 1CRLA 1PSWA 2NU9A 2O6HA 3OCUA 4FFBB 2O05A 3DH0A 5BSMA 1OYVA 5BQXA 1A82A 2N1MA 2CDRA 3M4YA 3ZHCA 3LP6A 3OUTA 5I4IA 1L4EA 4B6RA 3NEJA 4MKXA 3GL9A 4KE6A 4NYIQ 4FB5A 3IMEA 1SA0B 2GEJA 1I6KA 1NV9A 2P2YA 3TN7A 5FOUA 3SKXA 3VV3A 3V4ZA 3G49A 2KBEA 3UK6A 1P29A 5C8YF 2Z04A 3R4VA 1K4YA 1ODLA 1TAHA 5ILOA 3FFBA 4LYAA 3ZV5A 1CRWG 1BZYA 1V95A 3AVWA 4GPIB 1JEJA 1OBCA 4DT1A 1MJNA 1BGVA 1JQEA 3MAGA 2A0WA 4INOA 1JUDA 3USCS 4TM8A 3ZHBA 5M7EA 1KI8A 1E20A 3UC5A 1L4HA 3IQEA 4FD2A 3RUCA 1SVKA 1G0NA 3ONFA 1YZLA 2WU4A 4G4SP 2JLBA 3QLEA 1RJGA 1BEZA 4I08A 2C61A 4MCJA 1VSQA 3A70A 3ZPXA 1SK9A 4KR2A 2MYTA 2FKNA 4LCEA 1DC4A 3MJTA 2X8LA 5CFZA 2QVGA 4KTTE 1JWAB 3OQJA 2IHJA 1YIAA 2R8RA 4IIHA 2ZUCA 4EB6A 2FN4A 3ZE8A 3PP8A 2Q5EA 4W5TA 1MJ5A 5IT4A 2VNKA 3L46A 2I2FA 1LBSA 2XCQA 3D1JA 4OQMA 2A8YA 2IXGA 2L17A 4QLOA 3TSCA 4D0GA 1C4OA 5KYWA 3OCYA 4K26A 5LMUB 1FYDA 3AFGA 3B3FA 1Z6QA 2NVUA 2JAPA 2ZI4A 1PZXA 4JP1A 4PLGA 3EE6A 4K0RA 5HYVA 1NVDA 3RFXA 2PSHA 1U0EA 1OMOA 5JI2E 3M5DA 2QZZA 1O5IA 1USGA 2EIHA 4J29A 5G3ZA 3AFOA 3A6KA 4R2JA 3M6IA 4F6RA 2XT6A 4H6WA 4R9NA 2X3FA 4RANA 4UM9D 4B73A 5KQMA 3U1BA 1COWD 1XVIA 2XZLA 1K66A 2BFDA 3EXHB 4BGEA 4FDTA 4H7JA 3UXHA 2BHLA 3HHPA 2MYUA 4QJBA 4Q4AA 1BE1A 1NGSA 4I3FA 1TJPB 1JXAA 1Z0IA 2RH9B 3QUBA 2VRBA 1J97A 4Y2TA 1R15A 4ZI3A 2Y9PB 3AUJB 4WK6A 4CKBB 1GZ7A 4RTSA 1KJ9A 2ODAA 3PWTA 2WF5A 5A04A 4ZD6A 3OZVA 4HWTA 1G3RA 4KQFA 4QXOA 4V3BA 4D0NA 3OLZA 3QJGA 1G63A 4GSKA 5AYVA 1G16A 3FSJX 3L8YA 4DUYB 2YWBA 2QS9A 4PNHA 4R5MA 3FUXA 4LQLA 3KC2A 3V5NA 1I7NA 4E4TA 3HL4A 4WL0A 1VA5A 1FDWA 1N3IA 4G5OA 7MHTA 2OT3B 1YDFA 3GGCA 4UCFA 8MHTA 3N07A 3T7DA 3AF1A 4RHCA 3BA1A 3U3JA 2XDQB 1N0UA 1VRVA 2R8YA 1IRXA 1P91A 4MWZA 3TZCA 3UV3A 4BMZA 4NCAA 5FQNA 3VO2A 1AGXA 5ABPA 5IDVA 5AXBA 5AMXA 4IDCA 4C7JA 2VF4X 4YMTA 3B1JA 4W8OA 1BU8A 3CH6A 1F0NA 4KKVA 1KEUA 2G7MC 4WH0A 3T5DA 4WT7A 5B4VA 2P68A 5ELMA 3B8HA 5B7NA 2XMGA 1YT5A 2J0QA 4WZBE 2YKGA 4I1PA 1DQNA 5JBNA 1D7AA 3ETLA 3VPFA 4WVFA 4W9RA 1E3QA 1YB6A 4CL2A 1QNLA 3OC0A 1PWEA 1QF7A 2YWDA 4BKQA 1JB1A 2GN9A 2WMYA 4WDRA 5HQ3B 5IYZA 3C1TA 1NT2A 2IF0A 3BMOA 4RJIA 3ESAA 3HGMA 3KEGA 2QTCA 4RADA 3LIPA 3ICVA 4ZOBA 1M8KA 3OHPA 3F8WA 4UDXX 3V1NA 5LM3A 1PL8A 3EG5A 1GYQA 2C78A 4M55A 1V5WA 1OH8A 1RBQA 1QRAA 2RI0A 2WU0A 2OFOA 3T5PA 4JLMA 2QTAA 2QGFA 4LZJA 1E7WA 3LUPA 3H8SA 3IC5A 3BREA 4E6PA 2VOEA 2YS6A 3B7WA 1H4QA 4UZEA 2CVPA 5MGNA 4S0ZA 3J80A 1UEXC 3OX2A 2NOAA 2V6FA 3E9DA 4MTCA 2HD4A 2RHHA 3FB1A 2OGUA 4O4JA 3M6UA 4BX2A 1QRTA 3GJ5A 4MJLA 4RZIA 3S68A 5HOEA 1W5SA 4V39A 4BP3A 3N2KB 4PYLA 1D9ZA 3K9LA 3NLLA 2RJOA 2ZYVX 4NPAA 4RHFA 3ZBQA 4ZANA 4BX8A 4RH1A 5ALYA 4UUPA 4F2PA 1VZ2A 4MYSA 4CU5A 4EO7A 2C29D 4JNKA 4QUIA 1S02A 5CEJA 3UAOA 5LOVA 2WF9A 1NG9A 1FPQA 1J7KA 1UBEA 2QSYA 2A4MA 1ZQ9A 2ZJ1A 1GSOA 1EG2A 4R0VA 4RX1A 5FP0A 1EB9A 1HEUA 2H29A 2O7RA 4GW3A 4AMVA 1E98A 1V9CA 2BBOA 3TDKA 2Q3DA 2YN4A 2RKBA 1T1JA 4JJ6A 4V3CA 1SC4A 3MD0A 3FZYA 1RQ2A 2GCEA 5JS8A 2R62A 1JSLA 3QZUA 2XCUA 2HBZA 1YGYA 4TSRA 4MCIA 4QWWA 5BOSB 3TQSA 2HMUA 4G5YA 1HO3A 2OCBA 3AEYA 4PYQA 4WEQA 4M8SA 1E6LA 1EBFA 4BO2A 3AB3A 1XRJA 3OFND 3DOUA 4P83A 4Z3OA 1Q0SA 4Z0PA 3VR4H 1QU2A 1NUHA 5KX5F 4ZV4A 2XZOA 1SVIA 1H6DA 1YJAA 2NSHA 3T41A 4JQYA 1UQUA 1UCFA 3NVDA 1LLCA 3K09A 5LLTA 1FC0A 3NKVA 4ZCSA 3SSOA 3CPHA 4HDAA 4YMHA 1VM6A 2ZVJA 1VHLA 3RNOA 1JHOA 2NZWA 3CWZA 3A9SA 4DIKA 4P92A 4XW2A 4LTMA 3GY0A 2P0AA 4KYVA 2EXXA 3KQPA 2HC9A 4HJRA 2Q5HA 1N2OA 2QOEA 3L77A 4M36A 1T9AA 4OXNA 5CA1B 1AQIA 3KBBA 2NQ8A 1MPXA 4MS4B 3VU9B 2IHBA 4H1UA 4BWGA 4AN4A 2J7PA 4S24A 1SUCA 2BF7A 4EY4A 1OZAA 3NTOA 4FN4A 1BDIA 5EERA 2GSWA 3N8KA 1FUKA 1T5BA 3A0RB 4PRLA 1VCNA 3KQYA 4Q4JA 3DKPA 2EW1A 5KO2A 1XZLA 2B8EA 2RH5A 2XUZA 1TO1E 2ZSKA 2RAVA 4UJ3A 4UTZA 5TGDA 4JUBA 1P3JA 2XSZD 1WF3A 1HDXA 1A2QA 1Z4QA 1YI8A 3QVTA 4IP0A 4PHCA 3U31A 2WAAA 3U81A 1DOZA 1PTKA 5CMLA 1J24A 2IHVA 4OUDA 3O8RA 5DASA 4ENPA 2HWWA 2L0XA 3OPYA 3PSAA 2NU7B 1JZSA 1N92A 1VPTA 3LDFA 3WG9A 5KNLA 5JMTA 4BB5A 4IQ0A 2P4EA 1EVIA 1XMPA 1V11A 3ZHTA 5HR5A 3HLYA 1C1DB 4HXEB 4BEVA 4NOMA 4FGSA 5FFFA 3HJGA 4J1TA 2EW2A 2REQB 5LXTF 4HGZA 4QBGB 3RRXA 1WMDA 3BXXA 3FW1A 4MUNA 1PD1A 1KK2A 1T1EA 5J2TB 1JE0A 5DTIA 1AKRA 5M29A 2CD9A 2PSSA 2W70A 1AKQA 3AM3A 3O38A 4D4HA 3S44A 3E1KA 2E4ZA 2X0NA 1USVA 3ESBA 3ONNA 4PLCA 2ECQA 3HBFA 5H1YA 4P0QB 1JDPA 2VSOA 1Z33A 2Z8YM 1UT8A 1EFPB 3DEAA 2NX2A 3L06A 3MMPA 3GAZA 3TRIA 2Q8PA 3RKSA 5BW4A 1PFUA 1LFDB 3L6EA 5KIAA 1P5FA 3W9YA 3UCXA 4AXBA 1YQUA 3MTJA 1PW5A 3ESDA 2IZ0A 1IRIA 3H4TA 2UZ1A 3DBOB 5EIEA 3BFPA 4DPLA 1FS6A 4FZRA 1QFYA 5EVCA 1GLGA 4B6QA 3VGJA 1XMQB 3CUTA 3LHIA 4QARA 4ZWNA 4CR7A 4CDRA 4KPYA 1XZGA 5DBFA 1WHTB 1JTVA 4KB5A 3EPHA 3EZFA 2Q4BA 1LX6A 3FOAA 1SXQA 1VLLA 4LDNA 1N6RA 4PC3A 1LQTA 3FNFA 4MLDA 5KNDH 3IKJA 2NW6A 3LYAA 3QU7A 2ZSBA 4C2TA 3QWAA 4MRAA 3DD1A 4MV7A 2P69A 3QEJA 1QZTA 4XE5A 4AJ9A 1MC8A 1J2RA 2GUWA 3KP1A 1K97A 1YDEA 4TZKA 4UU0A 2XX3A 4IV8A 2CNWA 4NEHB 3C14C 2VDJA 4DR3B 1QRDA 3PZRA 5CJPA 3GZ4A 4ZI7A 1EFVB 4JOBA 3CURA 5BURA 1AMUA 1QBGA 1PJTA 3WK5A 5LDDC 1P0CA 3RIMA 3F3MA 4NJMA 1DHRA 2G7ZA 4CIXA 1E0AA 2W4MA 1V47A 3NHAA 1P6UA 4KXNA 4HQKA 5FPTA 1II8A 4FHCA 4ZKDA 1B76A 3HDGA 1IH8A 5AVWA 2EKLA 3B12A 4A2CA 5JYDA 3EAQA 1NQTA 4EYGA 2CNBA 3DEYX 5AI6A 2C9MA 1ACMA 1ZH4A 4Q9HA 1YDHA 2BFBA 3EFEA 1XRRA 1HKUA 1BXRB 2A6PA 3DCJA 2GYYA 1YI1A 3BGIA 3VKVA 3ZLJA 4F7DA 4TKVA 2Z4TA 2QT0A 1O87A 2TS1A 1CUJA 2FJ0A 1K98A 2DE0X 2UV8A 4AUNA 5I9SA 2QMHA 4HPXB 2R8BA 3T7TA 3EEOA 2JJ1D 3M6MD 3NASA 1UM9A 1UZMA 3BRCA 1ZSVA 1H0HA 2JDID 3ORFA 4XM1A 2YDXA 1S01A 2Z3VA 4J7CA 4AJOA 4A8HA 4F6CA 1A9XA 4N54A 2DCUA 1M72A 3GEBA 3ESCA 4RLFA 3A06A 1JDBC 4R1LA 5FI0B 1WAMA 4B43A 3U0BA 5HJ5A 2CDBA 5M3BA 3W06A 5AVRA 2HF8A 3GGOA 3JQ9C 4RS3A 3PHJA 2PLRA 1CZUA 4I7EA 4K6GA 2HA7A 4WLNA 3VMMA 3ZCVA 4GZ5A 3BWCA 2GLUA 2FSUA 3T7RA 3ZJVA 1D03A 5C35A 1Z88A 5DCWA 2JC3A 3DEJA 3FJ1A 4EW1A 1N0WA 1ONPA 1J8FA 2QZPA 3GDWA 4KQHA 5JNSA 1G20E 4MW4A 1Y4SA 2QR5A 2F1HA 1HDIA 1ZMTA 2P7HA 1WXFA 3EWNA 5J2UF 2VC2B 2G8LA 3UMJA 5KYUB 2W6JD 1Z2NX 5D85A 1P4HA 5FBHA 1O94C 1A7AA 4BCBA 4BEWA 1L3BA 1Z2DA 4LV6A 2IA5A 2BD0A 4ILKA 2TMYA 4X44A 5LA6F 3U37A 4YLYA 1GXSA 2A57A 2IYEA 4QUGA 2GF9A 4IIDA 3RHZA 2JAQA 4MV0A 3R7LA 3KYDB 1K1EA 1O95D 2OG1A 2QLFA 5LMCA 1KQOA 2F43B 3Q7IA 5ALLA 3RHFA 1TT5A 3ZZ1A 4GX0A 2VVTA 1JBQA 4B6SA 4L0MA 4BE9A 1WMEA 2GZMA 1ULBA 1F2VA 2AXPA 2GBLA 2OYSA 3DS8A 2B4KA 1B7GO 4KH0A 1DJQA 1CS0A 4BX0A 1Q0RA 4BV9A 1XIVA 3AI2A 5EJ9A 2CVFA 2XCRB 3W0LB 5K0TA 2YVUA 4RABA 2R1TA 3G3EA 1SOMA 2I9KA 4S1PA 4YJ3A 2ZIXB 1IU9A 1HDRA 1IEWA 2C9BA 5EMLA 5K3BA 1RQRA 3RQIA 4FB4A 1F6DA 4F5DA 2WLSA 2O5EA 3KVVA 5A7FA 2NN3C 2IYLD 2HFJA 5SICE 5FUYA 3KDAA 3KXDA 4GR9A 3GCWA 4XB6B 1OA0A 2WJVA 3QNMA 3D2LA 3R3SA 2ZIAA 4LWOA 3TOVA 3R9XA 1ZO8A 3H9JA 4QUJA 5ALWA 2UUOA 4R1MA 4IH4A 3U4CA 5LPNA 3I8SA 1AKUA 5FOVA 1OT5A 1WQ1R 3DWGA 3K9GA 1U99A 1UK8A 4RS4A 3DE3X 4JVNA 4J76A 4KPFC 1HNXB 1DDOA 2CHFA 2X19A 4FKMA 1D09A 2AQKA 1WPXA 2H4ZA 3FNIA 1VXRA 2A84A 3H99A 3VR2D 1IN6A 4RY2A 1GPDG 3QPDA 3HJNA 4G0XA 2EX0A 1RKXA 4HNHA 1S4MA 4O4LA 3V48A 2Q62A 5YASA 1AV7A 1EA7A 4NLLA 7MDHA 2G5CA 2FGKA 3CINA 4LNUB 4M9QA 1KXZA 3W2GA 2UDPA 3IB6A 4LBYA 1JDVA 4HOYA 4OPMA 4Q1EA 3V00A 5HQTA 1A2KC 1QG6A 2JK0A 1MVNA 3C85A 3EBOA 2IYQA 4JLKA 4KP7A 2AFIA 4OHKA 4OTZA 1FVFA 4DDKA 1UQRA 1SRQA 2BFAA 3JYOA 2BLNA 4IL5A 1WBDA 1LDGA 3FPEA 1D6SA 5J4YA 1KYTA 3K6SB 1QH1B 3NBZC 3AIKA 4ICIA 3OLWA 1OI3A 4ZVQA 4X92A 4Y98A 2V54A 3R9IA 3GAFA 3VJKA 3VYWA 2OESA 1DZIA 2NAFA 3IKTA 2WJGA 1JLLA 1C7RA 4A92A 3ZHQA 1NMXA 2G3YA 2HDOA 3MCVA 1A1SA 3DBHB 4XLTA 3WNBA 2JEYA 3SE0A 2YL2A 3V7FA 2BH9A 1T25A 3B3GA 4J0EA 1WV0A 3MOSA 1B8UA 3PC8C 2G72A 1FS5A 2V3VA 5K3OA 3RW9A 1R12A 3O8LA 1Y3CE 4IWNA 4CMHA 1M8PA 1EHYA 5FUWA 3PF9A 3C1UA 2XXAA 4FC6A 2DSTA 1JKMA 5IKXA 4Q7QA 2QN6A 2V8BA 4XA8A 5I9BA 3ZKAA 5B1IA 5KVCA 3D8BA 1XZIA 2J4CA 3VPDA 1QGED 2AZTA 2D5CA 2J0EA 3R23A 1QE5A 1OROA 2QF7A 1M74A 1QYWA 3FNBA 1CSEE 3GUHA 3HJRA 3R3JA 1YL5A 3W6PA 1D07A 2FUG6 4C0SA 5LN1A 5BNWA 2GDJA 2A5FA 3K9BA 2VP4A 2ZULA 3JQGB 5E1OA 5FD8A 5CCBA 4F12A 1MFPA 4XVCA 5LP6C 4XLZA 5IZCC 2G25A 4UTVA 4RKRA 2BM1A 1D4ZA 4O1MA 4XUDA 1I0ZA 1L5KA 1PJCA 2ORED 2PUTA 4PZEA 2IUUA 2I6XA 5EE9A 2Y8EA 4EW3A 4KIUA 3Q98A 2BWJA 1EGMB 5B37A 3T4UA 1W36D 2WNSA 1RJDA 1SBZA 3P0FA 2NU8A 5BORA 5BY2A 3CIOA 3REQA 1QIIA 2J5BA 1SU4A 3R0VA 4HDSA 3AR6A 4L4RA 2YUIA 3JVIA 4XFDA 3I83A 1CERA 1M2HA 3NBUA 4ZYLA 4A0RA 1ZUNA 4ZVUA 3UMYA 5I9NA 5DHTA 5JADA 1AGNA 4H4EA 4QT0A 1GQYA 1AKNA 3N3AC 5IAEA 2VXYA 1A2BA 4OSPA 5DYGA 4Y9SA 5DNEA 4BMCA 5BWMA 3CGWA 1SVLA 3Q7SA 1P0QA 1QU3A 2VTBB 4WLVA 3ND8A 1Q74A 1WSAA 4K81B 1N2JA 4MQEA 1Y4DE 2C4HA 4R69A 4F5EA 4PONA 3K0AB 3L2OB 2O48X 5K99A 2DSNA 3OWOA 3PHBE 4BHTA 5K51A 4O0LA 1YDMA 2R5FA 4NMXB 3LF2A 3UN1A 5FWYB 1P60A 3Q9UA 3PFHA 3GD5A 4BB6A 1K3TA 1RIIA 4PLHA 3IDZA 3N2GB 1MVOA 2Q1SA 3JX9A 3DJFA 2Q0HA 3GT0A 3PVZA 1QV9A 3PPYA 4KQCA 1E96A 1OU0A 4P4GA 4MYTA 2E5WA 4B2YA 1R5NA 5C5IA 1NNEA 4WY8A 1XV5A 1QZZA 2YWGA 2C2WA 2FR0A 3AJRA 4EHAA 1HBJA 4RA6A 1DUIA 3A7EA 4D6PA 4F92B 3CJTA 3REFA 3VZRA 4PHTA 4OQ4A 4RMIA 1JLRA 4KXLA 1BVUA 2BMVA 4E1AA 1PI3A 3FR7A 1RR6A 3LM8A 5DRTA 3L8ZA 4UHFA 2CJWB 5FYDA 3WK7A 4D46A 1DELA 3N1UA 4R7ZA 1LK5A 1XVUA 3RYCA 4CQLA 4EEKA 1A69A 2VHVA 2QAGC 2EVWX 3PJDA 4EQ6A 5KC8A 5BR8B 1IUKA 2OZLB 3OTIA 3WL8A 3GDFA 5A2QA 4I6JA 4H3SA 1GGNA 4JLBA 3T7CA 4CJXA 5FAKA 1FMCA 1ZSNA 3AIIA 3EWAA 2PJUA 3COWA 4OJMX 1PQYA 5E9QA 5KHAA 5KNDD 5FWNA 1T13A 3VI4B 4OXKA 4RTRA 3UUWA 1G7TA 1QOQB 2WRZA 1ADGA 3UGTA 2CKDA 3M3PA 1Z82A 3QPUA 4WPGA 4TRNA 4ZCLA 1E79D 5KKNB 2G6TA 2R1VB 1OC2A 3WYGA 2JKZA 4IUCS 4QRIA 4RIEA 1SQGA 3QLJA 1C0PA 1VSTA 1KI9A 2CVOA 2VHCA 3LHSA 3O8DA 3AVPA 1VIAA 3FKJA 3K9FC 4PHHA 2JFHA 4YGXB 4H15A 5ULLA 3USES 1Z5WA 1C4KA 1MJGA 3N2NA 3DPUA 3Q85A 4H2DA 3ASZA 1ULAA 3ME5A 1Z8FA 4CRWB 5LYJB 2J9RA 3WNVA 2FUKA 1OTYA 4MLCA 1E18A 3L4EA 1JIUA 5IYZB 3GLHB 5FIUA 3DUFB 3FCAA 2ATXA 4K46A 5F4ZA 3R8FA 4M6WA 2XGSA 4TLCA 2OECA 1GGVA 2AE2A 2VK2A 4HNUA 2WFZA 4Z9XA 3VMFA 3WWPA 2HMVA 3TQOA 2IBTA 1JECA 2O8VA 4W1RA 2BBWA 1K27A 1XKQA 2WIJA 2KE5A 1OLSB 4EG6A 3MB5A 4CXMA 4YAJA 4DY4A 1WA5A 2FSSA 1UPFA 4I1YA 3DMNA 2FSHA 1H6BA 3F67A 2CXUA 4H6VA 5I3CA 2WOJA 2PY6A 4BQQA 2I6FA 4IPTA 4DMKA 4NAHA 4FQ5A 2VJKA 5F77A 1LK0A 3A04A 3WNCA 4CV3A 1ABBA 4R31A 3Q88A 5JASA 3ZGXA 1S8OA 3CVXA 4D3ZA 4F5WA 1YONA 3FKSA 4UU8A 5DYIA 1ZN9A 2G28A 2HT1A 4YPOA 2BELA 3EZ2A 3LWBA 1CS4C 3EIUA 3K0BA 5KQLA 5KJEA 1H3FA 1WW2A 1IQUA 5F7XA 3UANA 3I30X 5I8WA 3VU3A 1SUIA 3TM5A 4F9TA 1OLOA 2YZKA 4X3OA 3RTAA 1M73E 4IDNA 1TAGA 5AW4A 3B5JA 3DE1X 2X4IA 3VV2A 1X7XB 3BHMA 1BYIA 1ODFA 4Q34A 5J4HA 3D3WA 2EJUA 2VDKB 5K2MA 3VR3D 2N1BA 3SM9A 3RNLA 3ZHRA 4KXFB 4J75A 1ICIA 2ZRKA 3SVTA 4WK2B 4XTCS 3RSSA 2DPYA 3DR5A 1WOMA 1I2DA 4TMVA 4DOMA 2QD2A 5CB8A 2BGGA 3VKGA 5FUBA 4AURA 1FBNA 2QK4A 2QN7A 1NMZA 3PQEA 5JAOA 4I81A 1QV7A 2WIFA 1RPTA 1UBHS 1QGUA 3FHOA 3KPWA 3KR0A 4KFTA 3EXG1 3MYRA 4X61A 1IK4A 3E1GA 3O6VA 1DCFA 4GNRA 5FNVA 2ATEA 3WYAA 1T9GR 1FL9A 3CKYA 2VHWA 5E1BA 2R4TA 1UJMA 4TWRA 3S8EA 3V80A 1IPEA 1NRXA 3URKA 2O19A 3MQ4A 1I36A 4LJ9A 3GP3A 1U7XA 4WJKB 3F6RA 4K1LA 2OAP1 3TVYA 5LU9A 3T1TA 2QD1A 4DUZB 4BJHB 2FG6C 4ZCPA 1FDSA 3F6YA 4QLAA 4UC0A 3KLMX 4E46A 1WZUA 1NY5A 1JVBA 2IUTA 2QVYX 3QMPA 3ENWA 3SSMA 4DCSA 5IDYA 3SHWA 2Q2QA 2WYOA 1BEEA 5D86A 1S7CA 1GVNB 3T4EA 2PDAA 4KFUA 3RRNA 4CCYA 1Z17A 2IHTA 3SEQA 5C3MA 1OFHA 3EIFA 3FPFA 5H83A 3HCWA 1NW7A 2H9IA 4YYZA 2GM4A 4S0XA 4LFAB 4OFXA 2YWXA 3ROTA 1EFCA 3WGKA 2HPAA 4ZVKA 1M2KA 4QOGA 1V5EA 2R6JA 2IP1A 3MRXA 3OF2A 3U13A 1QAOA 1UWVA 2GCPA 4BVJA 4FVTA 1EFHA 4G0QA 4JUCA 4MNTA 4DLBA 4LJ4A 4XYLA 5B12A 1Z47A 4ENWA 1F8FA 2X4GA 3E82A 1RLOA 4DNOA 4YCLA 1RXIA 3GMTA 3F7MA 2PZMA 3NBXX 4RIIA 2PUCA 3G17A 2OFPA 5A62A 2E4WA 4B75A 2AZDA 1LJLA 4FKZA 3WYBA 3L7NA 2H65A 1DRWA 4FHEA 1TA4A 4N18A 5CX4A 5GAJA 3SQNA 1UXGA 5THXA 5H9WA 3B1KA 3FCYA 4KCGA 3X1KA 5JS7A 1SOAA 1XU4A 2GNOA 3X3HA 1YOVB 2EP5A 2ST1A 2IEAA 2IX9A 3CNHA 3DMGA 2J45A 3S2SA 1MQ9A 5HUHA 5ALEA 2H1FA 2X8JB 1KYVA 2AE1A 4Q16A 2O8FA 2V8OA 2UXDB 5E4TA 4OI4A 1RHQA 2CBZA 3SZOA 4ENUA 4LF5B 1IG3A 1XTRA 4EKGA 2X42A 4QWMA 3WZLA 4L3VA 3SR3A 1JDNA 4EPWA 3KQOA 2PMBA 2VKTA 4L0CA 4YMUA 5ER6A 4LSMA 4RH3A 4CF5A 4FNMA 4EHHA 3QNWA 4A5OA 5FORA 3BGWA 3RLIA 2R96A 5AKEA 2JGIA 4WLUA 4Q19A 4CQMA 3ORYA 1CQIA 2PQ0A 4ENRA 2C0CA 1HYEA 1WV1A 2OOKA 4INAA 4DLAA 4XWWA 1MAWA 2NTNA 2IY8A 4BFZA 1FEZA 4MI9A 1VCOA 4AULA 2X40A 2QUHA 4UFPA 3ZE2B 1Z2PX 1AKYA 1W6UA 4D9HA 1FTNA 5JRJA 3E48A 3MILA 2VUHB 2CXNA 1RXEA 4D8XA 1Q16A 2WIDA 2HB6A 4ZI2A 3PNVA 3GRVA 4KH1A 4X8LA 1X7WA 4I0WB 3T8YA 3LA6A 3RRBA 2FHPA 4JQOA 3NDBB 3IQGX 4QQNA 3RVSA 3HKCA 3I0MA 4G9EA 4LECA 2QRNA 2VEDA 4LJ8A 5BMOA 3AK4A 2F9FA 1OCEA 5GOZA 5J59A 2CXPA 4NV0A 5JQWA 1CB0A 1RHKA 3JVVA 5A5FA 2GXAA 3M1AA 5AHWA 3MXOA 3LLSA 4E4RA 2VCHA 1Z38A 2QL7A 4KX3A 2N46A 2PLNA 3OIUA 1QGDA 1FTSA 4LNHA 1U3UA 2LCQA 1OZFA 2X7HA 3I73A 1CUFA 3S6JA 2P35A 1ZNYA 1CIPA 2P5UA 4LRSB 4YJKA 1CY8A 3N8IA 3Q0EA 4FGKA 2PRZA 4LMAA 4KQ9A 3MZ0A 3N0RA 1J5XA 3H5IA 3H97A 1I80A 2O7QA 4MVCA 4MR9B 4PV7A 1QHHB 4MW5A 1V96A 5BXYA 2A86A 2Z8ZA 1JHUA 1E3LA 4BLQA 5M34A 4UHKA 5EIOA 3OF3A 3RVMA 2O5VA 3V3KA 4DJFC 3PT9A 3VTAA 2O8EB 4JBNA 4PO3X 3DM5A 3W5IA 4BEJA 1OBOA 4G9BA 4CLRB 1EUCB 2PWPA 4XIFA 1JXOA 2QX9A 5EEGA 4ALMA 3G23A 3ZDYB 3O1HB 4EB0A 5AIBA 1P8AA 2OCDA 4ZAWA 1B74A 3OPMA 1I3MA 2D0DA 3IHKA 3VO8A 3NORA 2F3RA 1MENA 2AMFA 1JEEA 3A1UA 3DBIA 5FUXA 1N2CB 1UDCA 4G8BA 4FFMA 1SCJA 4N1AA 4OF4A 3ZE1B 4XSHA 4E5DA 3NFRA 1XEWX 1WMAA 2H18A 4N7RA 3I28A 4UE2A</