1JDTA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with mta and sulfate ion
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
235
structure length
231
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 79
structure length 231
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdtA00
3QPBA 3KVYA 3DDOA 3O4VA 4TXNA 4LZWA 4D98A 2QDKA 1Y1TA 2RJ3A 4TXJA 1JDZA 1VHWA 1PR0A 2QSUA 1C3XA 1A9SA 4M3NA 5F78A 1PR5A 3ODGA 4L6IA 4I2VA 1LX7A 1JDTA 3KHSA 4R31A 4L5AA 4X24A 4D8VA 1Z5OA 1NW4A 1JE0A 3DP9A 4BMXA 4OEHA 3EEIA 4F3KA 3K8OE 4E1VA 4LNAA 1YQUA 3U40A 1V48A 3OZDA 4YMLA 4PR3A 4F3CA 4DA0A 2QPLA 4FFSA 2PGAA 1ODJA 3FAZA 3GB9A 1OUMA 3UAXA 2HSWA 2ISCA 5IU6A 4DABA 4D9HA 2A0YA 4GLJA 2HRDA 1Y6RA 1JYSA 1T8SA 3TL6A 1PBNA 1OTYA 4EB8A 4TXLA 4YJKA 1TGVA 1JE1A 4UC0A 4LKRA 4GLFA 2ON6A 3MB8A 4LNHA 5C80A 3OOEA 1T8WA 1RXYA 4P54A 3OZBA 4GMHA 4DARA 4YO8A 5CXSA 4QARA 1Z5PA 1RCTE 1Y1SA 4L5YA 1V2HE 3OF3A 3INYA 2I8AA 5I3CA 1SJ9A 4JP5A 3UAVA 2GUWA 1ODLA 1OV6A 4MARA 4F1WA 4QASA 3NM4A 3FNQA 3P0EA 4RJ2A 4WKOA 5FAKA 3O6VA 5EPUA 4QEZA 1YQQA 1A69A 1CB0A 1PR4A 1Z39A 4L5CA 1V45E 3KVVA 2A8YA 4ECEA 3UT6A 1Z38A 4WKNA 3OOHA 4TYMA 5EUBA 1RT9A 1K9SA 3SCZA 4OJTA 1ODKA 1JDUA 3C74A 3EUFA 3KVRA 1RR6A 2OC9A 2HN9A 3ONVA 1PF7E 4JWTA 4WKPA 2I4TA 3IOMA 4JOSA 4R2WA 1A9TA 1XE3A 3NBQA 1LVUA 3LGSA 3BJEA 1RXCA 3E9RA 1Z33A 5B7QA 4YNBA 3PHCA 1NC1A 4M1EA 3DPSA 4BN0A 4DA7A 1Z37A 1Z5NA 5KB3A 4KN5A 1ZL2A 5EFOA 3OPVA 4EARA 3LA8A 4DAEA 4D8XA 1M73E 1CG6A 5CCEA 2OXFA 3UAWA 2XRFA 3KU4A 4TTIA 1SQ6A 1T0UA 5B7PA 1YBFA 1PKEA 2IQ5A 1PK7A 3UAZA 5CCDA 4DAOA 1YRYE 1RSZA 5DK6A 1RFGE 1A9RA 1B8OA 1T8RA 3FOWA 1OTXA 5B7NA 5ETJA 1VMKA 2A0XA 3GGSA 4TS9A 3K8QA 4PNPA 3PNSA 1ECPA 1ZOSA 4G89A 1Z36A 4OY3A 2AI3A 4OF4A 1V3QE 4TXMA 1JPVA 3E0QA 1V4NA 1FXUA 1RXSA 1QE5A 1JDVA 4GKAA 1PR6A 2QTGA 1A9PA 3D1VA 3IEXA 2HWUA 3E9ZA 1ULBA 4DA8A 1YR3A 4F2WA 1Z34A 1PR1A 4WKCA 3NM5A 4DA6A 5F7OA 1V41E 1SD1A 2B94A 1ODIA 1I80A 5F7ZA 4QATA 4R2XA 3EUEA 2OECA 4L0MA 1PR2A 3DF9A 1JDSA 4K6OA 5CYGA 1PWYE 2H8GA 4TXHA 4H1TA 3OZCA 5B7GA 1U1GA 2BSXA 5F7JA 1A9OA 1TGYA 4LDNA 1RYZA 4QAQA 1SD2A 1Q1GA 4MCHA 3F8WA 3T94A 4BMZA 4M7WA 4OGKA 3P0FA 3LBAA 4NSNA 1RXUA 4QFBA 1Y6QA 1TD1A 2OC4A 2A0WA 1TCUA 1U1FA 3PNPA 1K27A 1OVGA 3FUCA 2AI2A 3BL6A 3OCCA 2Q7OE 1U1EA 3BSFA 4OGLA 5CXQA 1U1CA 2QTTA 3OZEA 1A9QA 4WKBA 2P4SA 4D8YA 4NY1A 2AI1A 1B8NA 5F76A 4G41A 4TTJA 5F73A 5K1ZA 3PHBE 4F2PA 5F7XA 3MMSA 3UAYA 3DJFA 1ULAA 3FWPA 2AC7A 1WTAA 1LV8A 4TTAA 4IP0A 1Y1RA 1TCVA 1NC3A 5CYFA 1G2OA 1T8YA 3ENZA 1U1DA 4U2KA 3EMVA 1VFNA 1Y1QA 4BMYA 4G8JA 1OU4A 1JP7A 3NM6B 5F77A 3KUKA 1Z35A 4NS1A 1PW7A 5IFKA 4MCIA 4DANA 1K3FA 4TS3A 3FB1A 1N3IA 1PK9A 3BGSA 5JPCA 1VHJA
chains in the Genus database with same CATH superfamily
2OWDA 2ECFA 1QOZA 2IUEA 1P2BA 4IDGA 2ZS8A 4HH1A 5BXYA 5FWDA 2A4KA 3R0XA 3WRXC 3CUWA 2MINB 4UUNA 2QMOA 3KEMA 3KALA 4RZUA 3A70A 5EXSA 5KAPA 1A27A 2OZLA 1U0GA 3CSDA 2JK0A 3BMOB 2XZPA 2ENUA 1ZOLA 1GZ6A 5CIQA 3UJNA 3DLTA 1EM8A 2CEKA 4JY7A 3PUYA 4FE3A 3T38A 5KDDA 1S5PA 2PSFA 2QJWA 4KRXA 4HNQA 2ZSJA 3ASUA 3AZOA 3HDYA 5EKXA 1FJHA 4MQ5A 1YB4A 4QWMA 4RVHA 1RKBA 3ROMA 2YHAA 5HP4A 3T4EA 1E89A 2ZSIA 1HMYA 4IIUA 3IFSA 4RY9A 4F2GA 5B12A 4XIGS 4X1KA 4W5NA 4K40A 3NPAA 1YD7A 1LZLA 3E61A 4FB5A 2JVIA 3JALA 5LU8A 3GUUA 4XVRA 5JRZA 1RAIA 4FYYA 1O2DA 3WQRA 3OLWA 4V03A 3TM5A 4GNRA 4UVDA 3OQPA 5JXGA 1DAOA 2AE2A 3AKCA 1T2EA 2QN2A 5CAEA 3MT7A 1Z6YA 4L5BA 2UZ4A 2HJGA 3AB7A 3QU2A 3C15C 3TRKA 3RVQA 3QKWA 3L8HA 4V1CA 4H3VA 1FC0A 3HO6A 5TMDA 1R0WA 3K09C 3PGXA 3I9LA 4MQUA 5DWVA 5TQ2B 2QVYX 1BN7A 3EZFA 3NEYA 4TYYA 3AM1A 3A10A 1ISRA 3TQCA 1NR5A 1B93A 2AR7A 2ONCA 4H4CA 1TVMA 3J81k 2F3SA 2J5RA 2EXXA 3E7WA 3ZE6A 5ESDA 2DJIA 3JWIA 4UNNA 1DRUA 1V1JA 4PGMA 2H31A 2Q5OA 4RH3A 4X3PA 2VAVA 3MUNA 2H65A 3U31A 4BCCA 1EE1A 4ZDJA 3AUAA 4CL0A 3DO5A 4EFDA 1Y6GA 4PXSA 3WLRA 5JCJD 1HBJA 1PR9A 1OUMA 3NBKA 3I73A 3EYWA 1N8NA 3M5WA 2P9GA 5I48A 1U5BA 3NYRA 3Q3JB 4ZQIA 1OYOA 1NVBA 5EMMA 4LCEA 4QGGA 3S3TA 3RKUA 5K9ZA 3CT4A 1QRSA 4HDKA 4BB9A 3GQBA 1E2UA 1P5ZB 1YHNA 1W30A 3EIEA 5KX5A 1V8BA 4BNKA 3I0NA 1FRVA 1PT7A 1G3UA 3EVDA 3RFVA 4NF2A 1UFOA 4FDTA 3NWPA 3RYIB 3SMQA 1JYSA 1MJHA 3EULA 1AMUA 1T1RA 3I2GA 4F93B 2IY9A 4IMPA 1QUFA 3EZ7A 3RS9A 5T6MA 1E3EA 1JE1A 5C5EA 1EP1B 3I9KA 2BFFB 4JNCA 4HI0E 4X62B 3ENQA 4ZJPA 1UMDA 2I4NA 3U62A 2AX3A 3OIGA 3ZX5A 5DBOA 3OX3A 1U0EA 2WD7B 3W2EA 5HIKA 2XCSB 4BQPA 3D6MA 3CW2A 3WAKA 4CXMA 3G7UA 1EZ1A 2DTEA 1XXHA 1Q0PA 2C5SA 3NVAA 5HIIA 3T0FA 3AJEA 4U7TB 4DY6A 1I01A 4RXTA 3JTMA 3NS7A 1KO4A 4PZCA 2ZATA 4TTTS 1MB0A 2E4XA 3LQKA 2GNPA 5C1DA 4ENUA 4DIBA 5HM6A 4L9AA 1P5HA 1YMVA 1ZVMA 3CLTD 1C1DA 1C3OA 3B1FA 4DFDA 4RLFA 2BGGA 2ZUCA 2GN4A 3GRVA 1JHPA 5DTMA 2X3FA 4ND4A 1JQBA 2ID9A 3G17A 3GFGA 2CBGA 1U8ZA 4LG1A 4WL0A 5E9JA 2ID8A 5EZYF 5FV7A 1JDJA 4BQOA 1VRVA 1L1RA 2ISQA 2VP3A 3FOAA 1OD6A 2H4WA 3ZDEA 1Z9BA 2PUDA 4KR6A 1FQOA 3IBGA 3KKZA 1T13A 1P7YA 2TMKA 3RTCA 5K8TA 2JLQA 1ZVQA 1DNPA 3F5MA 2DKOA 5KNLA 1JFSA 4YAGA 3PL5A 4DNFA 5C8XA 5A04A 3W8EA 4ZTZB 3IEIA 3EC7A 3V8EA 1PJBA 5ITZB 2QG6A 4QHYA 2H5LA 3IUYA 5AI6A 4C7BA 2XJ9A 3GGCA 2C96A 1MORA 1N2CB 3ISTA 3EXHA 2PUAA 4ZRDA 5IG2A 3AUXA 1LWOA 4INZA 3WBFA 5AYVA 2VQFB 3T1YB 1CY2A 1Z4PX 4YB8A 4GO1A 1ZN7A 4N0MA 3L6BA 3ZJVA 2B0JA 3BCUA 1Y48E 4BNHA 2P4EA 3BZWA 3BCRA 3R44A 5EP4A 2IE0A 5EY5B 2G1UA 3MLBA 1A5SB 4B2PA 4WNYA 2ZITA 3COWA 1XRRA 4MQBA 2RGNA 3C97A 4OBXA 5J2TA 1TPZA 2HHCA 5FPPA 3FNGA 3W9YA 5EPUA 2J0SA 1G18A 3OQ6A 3V7NA 2RHHA 2IYVA 4GWGA 3MSXA 3SYMA 5AQ1A 2C9OA 3OOYA 5CLLA 4B75A 2WJWA 2B6NA 4QA9A 2GZ2A 3F7OA 1JMYA 1V3VA 4KTVE 1JEYA 2UVPA 2I99A 2YMPA 4OI2A 1V45E 1KNQA 4NTZA 2IP2A 1ZNQO 2C2WA 2O4CA 4UU8A 1LS1A 1WUIS 5JLJA 4B71A 4BUCA 4UQOA 1W4AA 2X41A 4UUPA 2VT6A 4B7ZA 5BWOA 1K86A 5JI3E 2DYKA 2VCHA 4OMFG 4BIIA 2Z57A 4QPJC 3PE4A 5DP1A 4LJ9A 1U5AA 4HTFB 2WOJA 4ZKEA 4RJTA 1X2EA 2C3UA 4JR2A 5BORA 4ERXA 3EUFA 3A1SA 1CHDA 2O8EB 5HBGA 4EGAA 1I4LD 1UDBA 1G98A 1SU7A 3BWDD 1U7WA 3V4FA 1Q0TA 3OIUA 3QKTA 4CMAA 4WZBA 1NLYA 2AN9A 4GPAA 2YXDA 4JWTA 2ZCUA 5HJ2A 4YCNA 3VDQA 1GT91 3PT5A 3VR5A 4C87A 4EHNA 3T7EA 5ALVA 4MW9A 4HRXA 5B2ZA 2OD9A 3LNCA 3QEJA 3TB4A 2PSHA 2XQJA 3NHKA 3PC3A 4CV3A 4G3XA 3VV3A 4ZMRA 2HNBA 3NP7A 1NN0A 3LF2A 1Q7GA 5B7QA 3G8BA 2XDAA 3Q88A 3VC1A 2OBBA 4JOQA 4DE5A 3CH5A 2XR1A 3HYCA 4DLNA 1HE3A 1XJ5A 3PK0A 4D0LB 1NVMB 1XTBA 3WZ2A 3WIUA 2C7VA 2BMVA 2OV6A 3AHEA 2VSYA 4YLGA 5K05A 2REOA 3GLFB 1U7OA 3U09A 1DHRA 1T5TA 2OFWA 3I9FA 1TJYA 1M1UA 4WK2B 2P2DA 1UP4A 3ZD9A 4D4IA 3CG4A 3NNDA 4Q7MB 2H1RA 1UZMA 1L4LA 1U2TA 1VJ5A 3AEQB 2O2XA 5ECWA 5E6UA 2H06A 3V1LA 1RQPA 4D9NA 1L1FA 1AO0A 4UBMA 2PX0A 3HU2A 3QLEA 5CDSA 2JS7A 1CJUC 2Q5FA 3TVDA 1G38A 4A8JC 1OI7A 1YBFA 2FEXA 3KOMA 2ZLBA 4P4GA 2QM3A 1PKEA 4XARA 1UXKA 1P0QA 5H3HA 2GZRA 5DM4A 4YHHB 2YJGA 4OM8A 3G0BA 3RLIA 1MX9A 3QLVA 1FCJA 2IITA 4EFMA 1JQ5A 5FWXB 4KDCA 1SBZA 1M1YA 4NS4A 4P36A 3KXKA 5FEUA 4MUMA 1YL7A 1XKQA 3DVAA 5LA6F 2BFMA 4ECAA 5IJAA 4TV8B 4CQMB 4Z0NA 1N78A 1KZGB 1YQ9A 2RH9B 3IOEA 1CWUA 5ICMA 1V5EA 3ZUGA 4AWBA 1F2UB 1OBCA 3H1FA 3T34A 5A02A 5JATA 3OTOB 1YRLA 1EVIA 4PZEA 5KKAA 5H16A 4HEQA 1XNGA 1XU9A 1SCNE 3K8QA 5HILA 4EI9A 3BIWA 3ZW9A 1Q17A 5I8ZA 4DVGA 1N57A 4YV0A 5IDWA 2GM3A 1REQB 1GQQA 2OFOA 7REQB 1OMOA 1S7GA 4F38A 1QE0A 4E5PA 3RUIA 1Q2XA 4AYXA 1BGVA 1J0EA 2K2QB 1EFPA 1FZTA 1VKZA 4KAFA 4HAUA 3R7FA 3S4YA 2BHNA 1MB4A 2EZ4A 4X64B 1UMCA 4B3JA 2UXCB 1Z56C 3KSUA 5I4IA 4NYMQ 4C4AA 1RLOA 5TPWA 1OYYA 2WR8A 1GN9A 2ZBRA 3GRZA 2NXJA 2V6GA 1SXJB 2Y9PB 4QE3A 5F9MA 3GI1A 2R8BA 2QMUA 1DX9A 2IRWA 3H8SA 1CUEA 4OIMA 3WOVA 1L5HA 3W9SA 3DVSX 2J31A 5K3FA 2VK2A 4P31A 1DIHA 2G76A 4FB4A 4HAOA 4Y18A 3VAZA 1Z34A 3BHIA 1O6BA 4FXPA 4EX7A 3ZHRA 3VI3B 4M0CA 4Q66C 3MJVA 2V9PA 1RE0A 3SFVA 4A6PA 1UT5A 1TW2A 1WEKA 3T9FA 4PYJA 2QW8A 3EQ7A 3H9BA 4XWTA 1IUPA 4RLSA 1EBFA 1GCOA 3VPXA 5LP6A 4LMRA 3M3PA 4U6SA 4JDPA 1T9AA 2V7QD 5CA1F 1GPDG 1DPGA 4C78A 2VUIB 2ZSAA 2RHRA 2H63A 4BFUA 3NONA 3MBOA 2X7HA 1U63A 1QX3A 3KL2A 5JSZA 4Z6KA 4HDSB 4JR0A 5A06A 1RRMA 3A2LA 3FPLA 4UREA 5JUWA 1NF3A 3CFYA 4GOOD 5JRDS 1S0UA 3BUSA 721PA 1PO7A 1JG7A 4JB2A 4F9FA 2QPAA 2ZJ2A 2YW9A 1XDWA 1AY0A 3Q7EA 3N1UA 2ZIXB 2FSVC 4JP8A 3EA5A 4EKGA 3CR8A 3PGKA 4ER7A 1TKRA 5G1NA 3GRRA 1A7AA 1BE6A 1ZD5A 3AETA 5JOQA 4ZC8A 2PJUA 4CFZA 4W5RA 3DAPA 4YDSA 5IUKC 3ZTWA 1PG5A 4QD3A 3DGEC 1QONA 3BFVA 5BW4A 5IJWA 2WUGA 5KC8A 4N76A 1NJGA 2IOFK 3FYUB 5KNDA 3DE7X 5EMKA 4URVR 6CHYA 1GLGA 1ZJ5A 2V58A 3DE3X 4OBBA 4QLAA 3DHYA 1GO2A 1R0KA 1NHWA 1LY1A 3WBKA 5BT8A 3ADDA 1JQAA 1WV0A 1YVEI 4NMXB 3C3YA 4EL0A 4FKBA 3CY6A 4OP2A 3A7DA 2D0DA 1YQGA 3EJWA 3S2FA 3R23A 3B3FA 2A92A 3DZGA 2BSQA 1GG9A 4Y6QA 2IHBA 4A2QA 5LN1A 2VTKA 1TCUA 3AEYA 3BDIA 4AY3A 1F48A 4RCZA 3UB4A 4XW2A 1RM0A 1JLHA 2C57A 3UW1A 2HLNA 4L7VA 5HUJA 2E18A 3PC8C 4N0DA 3ZUPA 1XD2B 3PICA 1MHTA 4DJEC 4O6VA 3B5IA 2OQVA 5BVHB 3HY3A 5AVXA 2C77A 4D9JA 1JG1A 2WHYA 2QTFA 3L1HA 4MRMA 1KE2A 3TWOA 2NZUG 1FFAA 1GNPA 4XWAA 3Q3CA 1WW8A 3M1IA 5EIEA 2P2NA 4ZPJA 3ZNOA 5FBWB 5IF9A 2PO5A 4YMTA 3HYLA 2VK1A 3MQ4A 3H65A 4IJ6A 3VO1A 4LZAA 3ZKWA 4DMKA 2G08A 1KEPA 4FKMA 3X1JA 2LD4A 2FDXA 3RNLA 3VOAA 3AP3A 1WNFA 3GRYA 3ZLBA 5ESRA 3PL1A 5LQSA 3GO4A 3UMSA 5D3MA 1Y5LA 1GD1O 2QP4A 3T5GA 2IYUA 1E99A 2CLKB 2PHZA 5LQUA 4EG0A 4D9MA 3VU8A 1WXEA 4EUNA 2VJBA 4LTNA 3GRCA 3S28A 3ABZA 1QCDA 2C07A 3Q7TA 4K03A 1XRSB 3H1PA 1O03A 1OE0A 3C3WA 4LYJA 3ZWXA 4O4IA 5JD4A 2ZXUA 3OPYA 4L1KA 3PXAA 4MGEA 2NZYA 4QLOA 2YIMA 3WGVA 1A95A 3O2NA 2KJQA 4PRLA 3R9IA 2TMGA 4I1OA 1M1NB 1EBUA 2YRFA 1QIHA 4RU1A 2O6HA 4YRMA 3PC6A 1JR4A 1ULTA 4ZQFA 5EJ5A 3DDZX 1G2OA 2VWPA 3O8OB 3PFIA 3PXCX 4ZREA 4QT4A 3UHFA 4OFWA 1O8BA 4DF3A 4M1TA 4OXXA 1AIPA 4B32A 4ZFNA 1XEWY 4HRYA 2JJ2D 4HS4A 4K6MA 4HADA 4JMPA 2CHEA 2JD0A 3H11A 2FMIA 1MGPA 4ALKA 1YT5A 5IZCA 3OQOA 3N74A 4AN0A 2HUNA 3EAFA 4TRMA 1SXQA 2JCSA 2BMJA 4EFLA 5JBQA 2V7EA 1Q3HA 5AVQA 4DDVA 3E8XA 5AW0A 4NS1A 4OAPA 3HVKA 4RC9A 3ZZ0A 4L2IA 5C4GB 4HVLA 4O2BF 5BV1A 4FD3A 2AXPA 1OWPA 4B3SB 1E1CB 5J2TF 3K2BA 1C8BA 3V2GA 4ENWA 4J2HA 1XJCA 1XZDA 5JS6A 4OUKX 4ILKA 1L5OA 1DADA 1G6Q1 5LYJB 5C52B 5C46F 2BEVA 2RJNA 3AM3A 3BQNB 4DLSA 1V71A 4YACA 1M7GA 3O9VA 2GPWA 5CG1A 4ERNA 2ZUBA 3KVYA 1K8ZB 2DFPA 3JQFA 4J0QA 5FT9A 3VVBA 4ZT7A 1ISMA 3OFSA 4FE7A 4ZEVA 1GPH1 2E9SA 3CA8A 2JRLA 4ATNA 3O8RA 3W9BA 3E82A 2XI4A 2OFFA 4FKZA 1THZA 2FSUA 2W2XA 1U3UA 1NPTO 4Y6SA 1Y63A 2B30A 2CLDX 3GGPA 1I4WA 4G5QA 4RL6A 3LQ4A 3OY2A 2C03A 4US1R 3IVAA 4MQLA 4RPLA 3OM9A 3MWKA 3H4VA 2E4AA 1XZNA 3Q8XB 1TAQA 1GUYA 5AKGA 3FMFA 1DC4A 4EPWA 3AVXA 1PT8A 3PEEA 5JAHA 4MJLA 4XQGA 1N6OA 3IIIA 3LU1A 4RVSA 4AKEA 4EGQA 4H7KA 2C1EA 1UZAA 3PV0A 8ADHA 1U9CA 2VDRB 3WL5A 1JU9A 1U0JA 4L0QA 3SX2A 4BMVA 2PQ0A 2RMKA 3JRNA 5AHRA 4LJRA 5C18A 2WIFA 5F21A 4Y2QA 2BM9A 2CVPA 1E63A 4BVJA 5EHXA 1EM6A 5CLJA 3RSQA 3VHXA 2JCYA 1HTTA 4IKEA 3SJ7A 4FYMA 2O0KA 4K2AA 5BYJA 1WY5A 3VPAA 2WJGA 1XBTA 3P9ZA 3IKTA 3IIMA 2JNWA 1TFRA 2Q50A 5E6SB 3WQSB 1R15A 2PMWB 2DWQA 5F35A 2X5JO 1ICIA 1P9WA 1PLJA 1N1DA 2DHEA 1V5GA 2OVBA 2ZKIA 3BMNA 3JPYA 3MOGA 3MWLA 3OPXA 1F1BA 4J6FA 4DC1A 1V16A 2KE5A 4D81A 4KE9A 3L8GA 2GTHA 2BFDA 3AF6A 1HM5A 5ED0A 4E30A 2R62A 2O1EA 3M6FA 2WWIA 1XHEA 5FHQA 4QU8A 2JLRA 4W7IA 3SJBA 1P9RA 2C3YA 2HSDA 4G86A 3AEUA 4RTKA 1PJSA 1Q57A 2BMWA 1IMOA 1NXTA 2WUDA 4RQBA 5D5HA 4AYTA 4ZICA 5JNUA 3JWJA 2P6NA 4LZOA 2DRIA 3TTUA 4QYXA 2H57A 2QPLA 5C4IA 4KQHA 5LL6P 1ODJA 4FFMA 1TEZA 3ETEA 2WPDA 4WFJA 2QUKA 5BQPA 3UAXA 3WZMA 1L0BA 1K3UB 3OA2A 1OWMA 1QHIA 1KERA 2CLHB 4YCJA 5K20A 4CM8A 2LV8A 2LDXA 4D3ZA 4AX8A 3WLPA 1OGIA 2W2LD 1DWOA 1HE2A 1HDCA 4ZI7A 2J0EA 2WAMA 3ZY2A 4DZZA 4WN9B 4HK4A 4W1RA 2QRQA 2IP1A 3AR2A 1NFRA 2FN9A 2BD0A 2PKEA 4RDIA 3SF0A 4ZZ3A 3HM9A 3DOUA 4D1YA 3ANLA 2LCQA 1YBHA 4TKLA 2WHPB 1SUWA 2H1LA 2H5EA 3RTGA 5KOJB 2G9RA 3CLRC 5CK4A 2G3YA 4DQDA 1Y3FE 1SRRA 4RK6A 4F4DA 3KZVA 3LECA 3I5UA 3FNFA 1UT8A 5LZ2A 5FR2A 1BVUA 2WVGA 1D1SA 1Z16A 4LHZA 4YX9A 3FM9A 1OXSC 3ZDRA 2VTDA 3D4NA 1NP3A 1SZPA 1U7HA 4KO8A 4BTVA 2A67A 4E3ZA 2JBHA 1W5AA 2FUG6 4TUYA 5KZMB 4DLVA 3P5SA 4WDRA 3R24A 2NVUA 1KF0A 1WCIA 3QX8A 2GEUA 4RKWA 5T64A 3FN4A 4QC2A 2CLEB 4B4VA 1VLMA 1X86B 1ZZGA 1JSCA 2WFLA 2XGOA 3FVWA 3CB2A 2R7AA 4C4RA 1YB5A 3MT9A 4WTOA 1GAXA 2ZT6A 5FIUA 2R8OA 2X5XA 1JIIA 4DARA 3ILVA 2XVMA 1MNQA 3FKJA 3PKJA 2PYIA 4MS4A 1OX6A 3EXFA 5AWFC 5GP1A 3HZZA 1SURA 2WLTA 4KSBA 1GTMA 5EJGA 3N2GB 3KR0A 2GJ4A 4DA4A 4CM7A 3FG9A 3IBFA 4QARA 1K88A 3IKJA 3LT4A 3A1UA 5CP8A 1KZ1A 5D7BA 5BSGA 1U2EA 3O90A 3UXEA 5EJ9A 4OSEA 2OLJA 5CH8A 4YAEA 2V5AA 4QUIA 5I3CA 4DV2B 2RH5A 2JIBA 4S1VA 2NUTB 4WOJA 4E2ZA 4EHLA 3V4VB 5JTTA 3A58B 4CTKA 1FUEA 4HEA1 4WJZA 3ABQB 3QYPA 4A2PA 2PWAA 3LQQA 5C5CA 1YHZA 1RTTA 2N1MA 2R84A 1C7FA 4OSPA 1Z4OA 3P9PA 4K05A 4PC1A 4XYGA 3ZXYA 4PWYA 4MW0A 2VF8A 5ADUS 4QUBA 3IEUA 4MV3A 4OQZA 3K6KA 1JSLA 3VPDA 1PTJA 4CKWA 1ZQ9A 3JSAA 3Q72A 3DL7A 4CL3A 1PSDA 2YBDA 3EVFA 1YSCA 4RVNA 4IX1A 5FBLB 1JHAA 4R84A 5LP6F 3QHQA 5F3RA 3IHWA 1L6IA 4JVMA 2DAPA 2OGSA 4RIEA 4LHWA 3RDPA 5CPBA 2BZ1A 2BUBA 4BWVA 2I3DA 5GM2A 2CHVA 2Z5VA 3NWJA 4FHDA 4GPIB 2Z6VA 3TZKA 1MF7A 1SOVA 1AKNA 1ZX1A 3KXPA 2AXNA 1E4EA 3MLAA 1IN4A 3FW1A 1T2VA 3RVBA 1NBMD 4ALNA 1PR4A 2XVAA 3HZOA 4N12A 2HREA 3GDWA 2GN9A 3KUXA 1HV8A 4ECEA 4H6PA 1R1DA 3O7WA 1L4EA 1I7PA 4H16A 5D01A 1MTOA 3KTFA 4XJVA 3KE8A 2EWVA 1GUZA 1Z75A 1NG1A 2PS0A 3ED5A 3WGZA 2VBCA 5DEIA 3HDGA 4R1MA 4YRIA 5E7QA 3ESRA 1F4LA 1V95A 5HS6A 3ZXSA 4EMSA 2CMHA 2BDUA 3RK1A 1EKXA 4HX5A 3SCZA 4EENA 3DL4A 2QYSA 4GMXA 4PAGA 3EIOA 2UXDB 4BNJA 2PR7A 3TW6A 2GQ0A 1NY6A 5ELLA 4IRUB 4UNSA 4FOSA 4DMMA 4G4SO 1LNQA 4BDSA 3AVQA 4IV8A 2QD2A 1DG9A 2OC9A 2J9XB 3PTAA 2GYWA 1HTBA 2PZBA 4LAFA 4N18A 3AGQA 4QICA 2MINA 1NG9A 2BLLA 5JNTA 1T8TA 3E7XA 4HBGA 1A3CA 1IONA 1G5PA 1YS9A 2D5AA 2LIVA 3F78A 1ADCA 2WSSA 3JQAD 2DPGA 3BMOA 4O4JF 4WY8A 5EXEA 4CEHB 4H4EA 1MW9X 2Q4RA 4PLWA 1W29A 3ORQA 3X0DA 3GJXC 3HJTA 4A82A 4BFZA 2J0QA 2ABWA 3LRXA 3QQ5A 3FLBA 4KKVA 2B34A 4Y8VA 3W4KA 5AM1A 1FDSA 4RV9A 3DWIA 5TX7A 5BUCA 2EZ9A 2WF5A 4RGVA 1DGQA 1F9EA 3R0QA 2D4HA 3IA7A 1VQ1A 4L07A 4UFPA 4YLEA 1ECFA 1S2IA 2COUA 3EC1A 3SBXA 4LPKA 3FOEC 3H3FA 3KB6A 3N5CA 3CM0A 5CT4A 4GOMD 1KDRA 3VAYA 4B0OA 2JIPA 1MC5A 2XE6A 3KWJA 4GP6A 1FU4A 1S01A 1L4FA 1NMZA 4TMYA 2B1IA 3I9OA 4PVCA 4JFAA 5JYEA 4DC0A 4G0QA 1B41A 2AA3A 4IDQA 3T4UA 1XLTC 1NF8A 1UFKA 2PT5A 1JRLA 5LB2A 4BMDA 1BEUB 4CV0A 1GAEO 3O83A 3HWRA 3WRYC 3VJRA 2GCGA 5JJ5A 2W93A 2H7YA 1W5SA 1SQ6A 1T0UA 2OMEA 2QAJA 2R5NA 3AI1A 2XHEA 2XH8A 3LC1O 4O4IF 1H2WA 2G9NA 4BU0A 5C1PA 3OZXA 1YDGA 4AO8A 3WIDA 2DFDA 3AMVA 3VO9A 2YNMC 4B6SA 3FTEA 5TQ2A 2VDOB 1XCBA 2HA7A 2JGAA 4RD3A 4ZVMA 2J5XA 3NORA 3TX6A 2B8EA 5HBRA 4FMPA 3K1YA 1B6TA 5JDIC 3D43A 4BATA 1W6RA 2VP0A 3AKYA 3L4BA 1L7OA 3F96A 1KFKB 2WV7A 3C3XA 1PFKA 2WM8A 2G07A 2A33A 4HDQB 4ZARA 1ZESA 2IPXA 3HCRA 3HJHA 4FSHA 3LCJA 1I30A 3OTHA 2OBMA 2ZREA 4I6GA 2HGSA 4EVIA 1XWFA 1I6WA 3FZGA 4KFUA 5D00A 1P6QA 5CDTA 1J90A 1ZXBA 3COPA 3CWCA 2P41A 3R0JA 1M8GA 3KELA 3IUEA 2ZJ0A 4ZN6A 4NCHA 4QTZA 1L4HA 1LF0A 2PQMA 3G85A 5HSGA 3O73A 2I7TA 4Y67A 3H87A 1XMIA 3RYIA 1Z6TA 4N47A 4N5HX 3NETA 5TPZD 2WSIA 2AMJA 3U9TA 4KUGA 3GCZA 4F8YA 4BO9A 3FNHA 3G2JA 1T4CB 4GRIA 4RKYA 4UFOA 4E13A 4EHDA 5LCXA 2BFFA 4WUVA 2EWMA 3O31A 3PNLA 3NQ41 1B0PA 2I1LA 2X13A 1JSZA 3AIMA 2A58A 3ND6A 3PPYA 4POOA 5LNK1 2WD7A 2VJYA 2NYRA 2R97A 1F06A 5DSZA 2IYWA 1QKJA 3DE1X 1YWGO 5DPMA 1WIWA 1BMDA 1W36C 1WDTA 4ACAA 1WB9A 1NVUQ 5AJYA 3NU1A 1LLDA 1THTA 1N8KA 2JGRA 2WT4A 1Y5IA 3MXOA 1DMRA 1EQAA 5LU9A 3ZHBA 4UZEA 3DFIA 3DSRA 2AVNA 4J7UA 2AF4C 3FZEA 5LYYA 3F5FA 4XJSA 4QJ5A 1JI3A 4UUQA 4NBSA 1QGAA 4WLOA 4X1YB 4FYVA 4W6QA 1PR2A 1P91A 3KNZA 2OP1A 5JT1A 4I50F 4EVQA 1YVUA 2RCYA 4KH0A 2G83A 3R6GA 4OP1A 3UW3A 1BOFA 1DE0A 1PK8A 3AL2A 3K6JA 2YZGA 3H2YA 5AKZA 1WDMA 4YUWA 4GVPA 2P9HA 5AW9A 2A59A 1JXOA 5SY4A 2V6MA 2IYQA 5ITZA 1MUUA 4KXYA 3CLHA 1SCJA 2OM6A 3KOXA 4G65A 4V0RA 4M86A 2QJFA 3QP9A 3GH3A 1DAEA 5CITA 4MAMA 3MIIA 4IJ5A 1FDIA 1L7MA 2B2CA 4UQPA 5G3ZA 1SD2A 1FVXA 4KQMA 4M98A 1EP2B 4CKCB 4IF4A 3EGWA 4ZHQF 2O48X 1EX7A 3OMLA 4MB2A 4C5BA 1UDRA 5DEOA 3WXBA 4BVAA 1O54A 4GBMA 2VH1A 2VSFA 5JRJA 3USES 4X60A 1DHTA 4QGAA 3ZWKA 4H6XA 1OXVA 1WM1A 3LT2A 1PGOA 3QIVA 1QSGA 3RYFB 1UDCA 2J3MA 1K8XB 3F7NA 1FNNA 2PXCA 2XNDA 1LTKA 4MPTA 5TDHA 1YZLA 2QN8A 1KOFA 2YRXA 2QIPA 1II8B 3NIDB 1E58A 4KFTA 3EF0A 3U19A 4EVRA 3ZV6A 3U26A 2IH5A 4YS6A 4XSGA 2WF9A 3O1JC 1SMKA 3NWOA 3SPXA 2FPLA 2H1IA 4M1ZA 1X15A 4YRLA 1Z8NA 4I5DA 4EGSA 3I39X 5CXQA 3KKMA 3N2YA 2YQ4A 1P2SA 3DKPA 1M0TA 3DMTC 1U98A 2IHJA 4IQ0A 4L8VA 4MTLA 5KYVA 3VR2A 1TQHA 2V6BA 1L4YA 3PQCA 4IIJB 2YWHA 3NG1A 1SVIA 1MAWA 2P0AA 3F97A 3WB1A 4FGUA 1V25A 1Y1LA 3AR6A 4HTFA 2ZIWB 4R1OA 2Q8NA 4RA9B 1R18A 5FTMA 5EKUA 2ZWAA 1AO3A 4D4LA 4HAIA 4F21A 2B36A 1BMTA 1Z4MA 4R9VA 1LBTA 2O8EA 1O6ZA 3KJXA 2RD2A 2XRMA 5LZ7A 1HQCA 4Z99A 3UCXA 1NBIA 3UOGA 5B1EA 5IEJA 2LUOA 2ISSD 3EARA 3ONFA 3UWSA 3JAMA 4DB2A 3MGGA 3PQ8A 3JQ9A 4S24A 5EAIA 4GKJB 4FOLA 4UZSA 2RGYA 2W2KB 5LB4A 1E2DA 5B53A 1JDNA 1SD5A 4AWXA 2Z4SA 1QM5A 1W4ZA 5BN4B 5A5VA 4OKNA 4ND7A 2YXBA 4AM8A 4ZOCA 5TEWA 2WHQA 2J46A 4S35A 5L40A 1D0SA 3FPJA 1F1JA 4CDRA 3BIOA 5DBIA 1N9KA 2Y0DA 4RKEA 3B3AA 2KM1A 3L8CA 1V8ZA 4EX6A 2G25A 1T8YA 4KR3A 4BLSA 3AOGA 1I51A 3HCFA 1NVVR 4PLZA 1E1RD 3SXJA 2G5TA 3ZCUA 4MV5A 2YZNA 2M6SA 4I7EA 4A3SA 2XSZA 4MVJG 4CEIB 3FTPA 4L76A 2EW1A 1FJ2A 3CX8A 3PDIB 1AKVA 1W4BA 4DG8A 1ZICA 2EF1A 2VHEA 4TT3D 1M54A 5BMOA 1CJVC 4URHA 3AEQA 2QVXX 3EVBA 3NTUA 2WWWA 5KYWB 1EUYA 3OY7A 4RVOA 3JD2A 4D42A 4LSMA 2HO4A 1GQRA 2OO3A 5CDHA 4TL7A 1OOEA 2D13A 2ZJZA 4Y2PA 4G5FA 1UBEA 1EB9A 2WICA 2MSDB 3FHLA 5TS2A 4JSYA 1CZRA 4K6KA 4NFSA 2AFIE 3K9LA 4NV0A 1P0MA 4AZWA 1W52X 3NANA 1Y80A 3JD3A 3FMOB 3AM4A 5BWCA 4CQNA 3O4IA 3PFBA 5AHKA 5FWXA 3T3DA 1PV1A 4G97A 5CLIA 1S3GA 4A8HA 3CF0A 1NQVA 4D98A 4TV8A 4CQMA 4JI8B 1U4NA 4E08A 3TXYA 2ZSFA 2Y68A 3I6IA 1ATZA 2ACWA 2HYDA 2J45A 3QYJA 4MYSA 3MJ4A 4NKRA 2X4IA 2NYVA 4X6XA 3RRZA 4OX9Y 1KRHA 3A4MA 2H18A 1F2UA 4OYRA 1NVEA 3GLSA 4RPKA 3BWYA 3I6MA 3IUSA 1ISFA 1DEAA 4R8LA 4LWZA 4A0HA 1UBHS 2ZI9A 3HCOA 4GQAA 4UJ5A 1KC3A 2Q2VA 3AI7A 4QEDA 1CIJA 4M9XA 1REQA 3D64A 4DDUA 1VIAA 3OIYA 2F3QA 3UB3A 4ZVPA 4A0QA 7REQA 1ZIXA 4P0PB 4KR2A 2J9GA 2JB9A 2EHDA 1S8FA 1CDOA 3PGJA 3MJDA 1TMGE 5SV2A 3BOSA 1IOZA 1LPSA 2QSJA 3F7TA 4KOAA 3ZEAA 4YDQA 2I66A 1DAFA 1R9MA 2DUWA 2G8NA 2DPLA 2FPWA 3BB1A 3L06A 4U63A 4ETMA 4C2TA 1UXHA 2DQYA 2VH2A 4L0CA 3ABRB 1J5EB 4UEWA 1LQUA 1SXJA 3G7SA 3L1VA 4NESA 4NNOA 4N8EA 2PZAA 4KLAA 3TE7A 1H94A 4FLMA 4KO3S 3VV2A 1V5WA 3EW7A 3P2YA 4AD8A 1Q7BA 4X3CA 4DG9A 1KJ9A 1OFIA 2VP2A 1XKXA 1KIAA 4PTYA 4UBOA 4BJ1A 2Q5IA 2VUUA 3K8OE 4D92A 5KWVA 2P2ZA 3LS2A 4I1SA 4UM8B 3H99A 4MQ6A 4RIHA 5AW4A 2PTHA 4LTDA 2VKQA 2X0RA 3FPSA 1W2HA 1YQUA 3F6SA 3LPNA 3RH0A 4ZQEA 3KJIA 1W49A 1YZQA 2AJTA 4LW8A 1S8NA 2ENWA 1OFUA 1YR1A 3HXTA 1GYRA 4QU5A 1ZHOA 3BD8A 2I55A 3CLSD 3D2LA 3EPJA 1CY7A 4TMTA 5ALOA 1H6BA 1SKAA 1N0VC 3T7AA 1G8GA 5MFPA 2QX8A 2D4AA 1NJFA 5B1IA 1YOVB 2HF9A 4I8IA 1X1RA 4D2IA 3OPMA 3IELA 3PI6A 4U2FA 1CC1S 3AR3A 4TWRA 1WP4A 4U9HS 3TYXA 2D5IA 2P4UA 2RAPA 4U02A 5I9TA 4NQRA 1JWBB 3E84A 2OZKA 1H5NA 1TU4A 1VKNA 3HSYA 4QG7A 3KB2A 1V39A 3I30X 4BLOA 5LIRA 2KS6A 3NBMA 3ROGA 2ZIXA 4F6LA 1T4DA 1SUPA 4NONA 4ZEOA 3JASB 1A04A 2WKSA 1P1IA 4ZCLA 4LYAA 1PGPA 2CSUA 4BMCA 3ZU5A 1Y6RA 4XR4A 4RS3A 3D3NA 5CLQA 4US2R 3L84A 3LUGA 3RJTA 4DJJA 2WMNB 4WBNF 3DXXA 3ZJYA 3DXZA 4XRGA 2L18A 3FYUA 3EK2A 2YMLA 1Z8FA 2ZTVA 2AS0A 1T2DA 2HC9A 3TRDA 4NU0A 3RC3A 3MJTA 4YJGA 3DC7A 5JIBA 5JANA 1Q50A 1CXZA 4MUGA 1CQIB 5JMWA 5L7YA 4FQ5A 3FSGD 3UK2A 5IXYA 1AZWA 4KP7A 5LBTA 2BDEA 1NJSA 3U37A 1EJ2A 3GD7A 1AT1A 4JDUA 4D3YA 1GQYA 2C2BA 1GXSB 2HZ7A 3L46A 1PZMA 2O0HA 1J9ZA 2K7FA 2DETA 2D2IA 4ETNA 1UJCA 2WTUA 2GERA 3HRIA 3LD9A 1QHNA 3UWKA 2WT8A 3P2KA 3UMMA 1UL1X 1XD2A 3KRTA 2BGTA 4G1MB 2XUDA 3J81A 5ENZA 5H81A 3PXBA 3AO0B 1PFVA 3ACBA 3D6VA 3S6JA 5H1YA 2DWPA 5E4JA 5JE8A 3V8BA 1TCCA 2J0UB 2AJCA 2I6QA 3AUTA 2IIQA 3GZ4A 1TQ8A 4JAVC 3RU9A 1NSFA 1EHCA 5HFNA 4AL4A 2A78A 4BO3A 4ZU3A 3VOSA 3BULA 1YUBA 3ESAA 1G5FA 2ONYA 4HRAA 4WLNA 1JGTA 1RU3A 3BAZA 1OB5A 3P2OA 1WEHA 5LDGA 3U4MA 2BOVA 2V7PA 3LZCA 4URFA 1QP4A 5BNFA 1OV6A 2JJ8A 2OKGA 1HT2E 1MVLA 4K9LA 3M5DA 2GFIA 1JQKA 4BNDB 1P9OA 4I8DA 5GGXA 3GT7A 5DRTA 2A9FA 1K06A 4DWJA 4YRZA 2AN4A 4O2LA 3LY7A 4J0KA 3L18A 5AI9A 1IN8A 1UPFA 2RE8A 1VLZA 3IUPA 2GHIA 4UATA 3U4AA 4PLPA 1JKIA 2D1FA 2JAQA 1C29B 1P4HA 1M1NA 5AHWA 3RRFA 3TW0A 4FUQA 4GX0A 3FDIA 4NBTA 4V3CA 2GKOA 4CM4A 4GZ5A 1VHDA 4AZSA 1VSTA 2DVMA 2GPYA 3EN0A 3O8OA 4D80A 5CVDA 2H48A 4EY4A 1RZVA 2FMFA 4XUGB 1U3VA 2JJ1A 3A9RA 4RYLA 1RYMA 3U3OA 4QGFA 3ZYZA 5A5FA 3BB3A 4JJ4A 5EJ2A 3HL4A 2YOFA 3O0TA 4O4HF 5H5JA 3VKFA 4DXDA 2H0RA 4QSMA 1PNQA 4A1OA 2LBPA 2WUFA 4JIGA 2YDYA 4PAMA 5BP7A 3UVEA 1YJCA 2VWHA 4IVNA 3WNZA 5DYIA 4C4TA 2QN9A 3L0IB 3LHSA 3WIEA 4PGFA 4G1UC 2XXAB 3N8IA 3Q6NA 4L95C 3GEEA 5KYYB 1MRNA 3D7LA 3AF0A 1JMVA 4IJMA 2DT8A 4ZMSA 3KKEA 1E1CA 2NSYA 1PJRA 4FIZA 5EGNA 3GIDA 3HXKA 3BSYA 1B42A 4Z7NB 2Z4TA 3MS2A 1GZVA 1JDUA 2JASA 1SC4A 5LYJA 3WYNA 3BE4A 4X8HA 5I4BA 2QYHA 1T2AA 1ZLYA 2WIDA 1R27A 3I32A 1V8DA 2R2AA 3DFUA 1EP3B 5EOVA 1TC1A 3M7IA 3Q3GE 3E5RA 2SCUB 1DFIA 1KY3A 1Q1BA 1ESDA 3G9TA 2QQGA 4IW3B 2YHBA 2DR0A 1G6HA 1Z2EA 2XUQA 3D3WB 5I7SA 2DERA 2FW6A 4AQ7A 1EP9A 4DCMA 2P6MA 3KQUA 1LBIA 3UKDA 1QYWA 1KTVA 3UG7A 2QJRA 3LDHA 4BBAA 2I3GA 3TBHA 1GPNA 2I54A 2ZANA 3FUWA 4YRPA 2CVZA 1M2GA 4PFQA 1Z7EA 2ZYRA 1J20A 1RHJA 2QAIA 3PHCA 4M7PA 4TYNA 1J24A 1MFZA 5BQXA 3UEOA 1XVAA 3DBLB 2V1UA 4RY2A 5KJEA 4YUYA 1A5BB 1V96A 3A32A 3Q3VA 5CIYA 4HY3A 1VBNA 3NHBA 5EFOA 3UGTA 2C8LA 3LA8A 3TVYA 4DAEA 3QVWA 4ZPXA 3WLHA 1CYEA 1OHHA 3F9IA 2CUTA 5E6SA 1AQLA 4ZXFA 3SSNA 1QHHB 2BTQB 2IYYA 3QRWA 4FGLA 3AVTA 4YQYA 1D4ZA 2F9FA 1ST2A 5CNKA 1E6KA 2W2LA 3PR2B 4FS3A 4G2NA 5FUXA 3ZGLA 2WJ3A 1E98A 1SFRA 1X1TA 4M7OA 1VBFA 4HZGA 4P8RA 5L8VA 3OJEA 4JI6B 2JFZA 2OXEA 2YBEA 3I1YA 3ESYA 4BVGA 4GM4A 1CP3A 4GE0A 1X39A 3OSUA 3ENVA 2RG1A 2EL7A 3CPEA 1W581 5HNKA 2IPAB 4HOYA 1HRDA 3FOWA 4OMCA 1L5RA 3N8HA 1GDTA 1WKCA 1T3GA 2AH5A 2RDMA 4Y2SA 4PPFA 5GGYA 1GA6A 3FTFA 4Y98A 2JANA 5C1IA 3VXKA 4LIPD 1FYEA 2X1HA 5FV4A 2C0CA 4IO1A 3TL3A 1PG0A 3RAGA 3MCAA 1XRJA 1FSSA 4KN6A 4IL5A 2DOKA 1O6GA 2P9FA 1CUGA 4WRRA 6GPBA 4QJ3A 4WN9A 5KSYA 1N6LA 1RIIA 4M89A 1G6OA 3E15A 3JQ6A 1M6YA 3QBDA 3DQPA 4KMOA 1Q19A 1ZRHA 4X7RA 5JH7B 2JEYA 4DQVA 2WHPA 4DZRA 3KHKA 2CLSA 5KOJA 1EGMB 4PLFA 4PW0A 3AG6A 1NA5A 2D2FA 3A1TA 4ZJZA 1EA5A 1LSUA 4PYKA 4RWZA 3TAXA 4K81B 4MRNA 4Z4HA 1W0KD 2ID7A 2RC6A 3KHUA 4IDOA 5DJ5A 1ZM4A 1JFTA 4CCWA 2B5WA 1G8FA 3LPLA 2EIHA 5IAEA 1TJNA 2G9QA 4XCVA 2C29D 2EX0A 1E79A 2H3HA 2ZYUX 1L4NA 3TZLA 2ZJ5A 2HBZA 2DHRA 4Q0MA 2BBWA 4L0DA 4EUEA 3K05A 1YFZA 3DDHA 4PQGA 2OQRA 4E46A 4EG3A 2BLNA 1OXTA 4OHUA 1WAMA 4G5HA 3EG9B 5ANRB 2ZB7A 2GBCA 1F8GA 1TDJA 3OFVA 1G2IA 2C5LA 3QOYA 1WHTB 5SZKB 2QX6A 4B8ZA 5HMLA 1QAQA 4EUKA 1HL3A 1DBQA 1N2XA 1ONNA 3OLCX 4HAYA 3FRHA 2AG5A 1GTVA 4QPZA 5EQJB 4Z2YA 5AVZA 1BHQ1 1H93A 4KZPA 2E87A 4JJEA 3P4XA 1TJ4A 2ZYIA 3O8DA 3PVSA 3OETA 2YWRA 4JJIA 4NU5A 2CHGA 2NUTA 4EW3A 1W46A 1US8B 4GSLA 3DYVA 4UMFA 4XGKA 5CXXA 4NFYA 4S0XA 3E3NA 4UTNA 3ZDAA 2TMDA 4UDYX 3SFTA 2UDPA 2O2DA 1E1QA 1AJEA 1ZJYA 3JXEA 3OEED 4EYEA 4Z54A 5EWLB 1IVSA 3FFTA 4QOEA 5IC5A 4L9RA 1NNSA 4MVXA 4ZP1A 2YHUA 3SQLA 1VBMA 3I3SR 1X3LA 4P98A 1HY3A 1NYQA 1Q1GA 4JQZA 4C7XA 4RTSA 2YVKA 3QKSA 5IAAA 3H16A 2QRKA 5C37A 1RLJA 1XYGA 4JUBA 4PF1A 1E6WA 2YWJA 4RF5A 1B6RA 2WJYA 1ZEMA 2ZYDA 3ESDA 4MYHA 3BF8A 4OGKA 5T41A 3GVIA 4OFXA 1KDZA 2RK6A 2HIGA 2NYAA 3MF4A 4RK1A 2QYTA 5HMMA 3U80A 1DT3A 1GGFA 2V7UA 2VF7A 1DI0A 1GPKA 5LYJF 4XWWA 1COWA 1FFWA 3GIWA 4X0EA 4RTLA 4B09A 4JNKA 5BMVF 3AILA 4UXJA 2POCA 3V1MA 5JQGB 5L3SB 5CVUA 1XU7A 3WKEA 3SZMA 4XM2A 3TIGA 2IUUA 3PPWA 1P72A 4BFWA 2CB0A 3I9V6 1AG9A 1OVGA 1DZIA 2DBZA 4NH4A 3HQ4O 2Q4OA 2GCIA 3ORRA 4R4JA 4EO4A 4AZ0B 2RKBA 3FOZA 1CJSA 4JLOA 2YTZA 1KJJA 5HE8A 1QP8A 1XDUA 3HTXA 2OBLA 1FQKA 3IAEA 1U1CA 3NXSA 3EPLA 3ZIUA 4D3XA 1A9QA 3GEDA 4LRWA 4I36A 3O75A 5LKAA 1BU8A 2KBEA 4ND5A 2Y6VA 3UV6A 1OV4A 1MAVA 4PPNA 1IXSB 4V0SA 5D86A 4OQYA 1ELOA 3VGPA 4ASUD 1C81A 3LPMA 5A3JA 1RI1A 2EQBA 1YBVA 4LJ6A 5T4HA 2V9ZA 4K1LA 1GT6A 4AMVA 4X94A 4BJ5A 4EPVA 2QW0X 4HDNA 2HDWA 3TGLA 3AVOA 1CCWA 1XFAA 2CCJA 2RHLA 5J59A 3D0QA 5BR7A 3HU1A 4A16A 1V37A 4MV0A 4CEHA 4EPXA 5GQSA 3MWGA 2HU8A 2UYYA 2NUPB 3SXUB 3IR6A 2C84A 3FWPA 1D1PA 3F5DA 2E85A 2QENA 3ONNA 4K9SA 3SYLA 4C4ZA 5J58A 3JYPA 2JI6A 3IX7A 1O77A 1L4KA 3E22B 1LPMA 2EP7A 3UHOA 2B1GA 4M54A 4CIAA 4UOEA 5INTA 3C39A 4LSZA 2PRIA 1G3IA 4GR9A 4F5WA 2I29A 3FFXA 5FI1B 4YUVA 2WHXA 1BGWA 5IRCD 4JT8A 4U7GA 1FDUA 1RCUA 1U1DA 1YQDA 3DR5A 2ECKA 5C8ZA 2C3PA 2ZJ7A 5D2CA 4C20A 1ATIA 1E94E 1TF7A 2QNIA 4QGSA 1TO6A 2ZGVA 1YZFA 2VZ8A 4QX6A 3TIIA 4BMYA 1O0CA 2YWEA 2GF9A 2G63A 3KKOA 3E70C 4B3DA 3TG2A 3KUKA 1IB0A 3WAGA 2E4WA 2RIRA 1D09A 1D4AA 1P61B 4I5FA 2EGUA 2DFNA 3A11A 3TW8B 2F4VB 3FCSB 4YDHB 4EHFA 5I9MA 3IIKA 3KTOA 1JDBB 2LTAA 1E9CA 5AKHA 4HRVA 3IVMA 1Z6AA 3BZBA 4ZZ2A 3UN1A 2ZRBA 3UWDA 4BKQA 1W48A 3ZW8A 3UAGA 4TZ6A 1ZEJA 3BVPA 3UKOA 1M5UA 1RAGA 3HR4A 3PD0A 4UOQA 4KK3A 4S2EA 4I3FA 1QQ7A 3WE7A 1UBLS 4OB7A 4CHTA 3QPBA 1Z7YA 4AJPA 1VSUA 4CVNA 3CUKA 3EIUA 1JHVA 3HFJA 2ETVA 1NN1A 3LBYA 3O4VA 3WGHA 1X80B 3G2NA 1G8SA 5T3UA 3UH0A 2ZM6B 3R76A 2XOKA 3GYGA 2LPMA 3N75A 4CF5A 3PXGA 2V6IA 3SIXA 2VZLA 4D8UA 1K8YB 1KYVA 2HWWA 1E2MA 3LO8A 4GGPA 4TZ0A 1HDEA 1H0RA 2DH6A 3AU8A 3P2JA 1YASA 1O5TA 4JT4A 4RCYA 2P6OA 4TWIA 3PUHA 1N5LA 2HLPA 5LOVB 2FUNB 1TQDA 4MIEA 1TQ2A 2G9UA 3B7PA 3AC0A 4R1SA 5AT1A 4KPYA 4F9EA 1C3XA 1ES9A 4GEKA 3T5BA 1CUZA 1JWAB 1NP6A 2IXFA 2Y66A 4JBIA 4UUMA 1N4DA 1J25A 4EM6A 4C4SA 4LGVA 3EVEA 2Y1WA 2ZRLA 4LVUA 3L0BA 1KJZA 3OIVA 1DEKA 4FPXA 1T4CA 1G20B 1YCHA 4HX9A 4TS1A 4UFNA 3U13A 4GXRA 4U7WA 1YL5A 2OCPA 2G6TA 4WERA 2R6DA 1UJ2A 3SDSA 2V7BA 1PZEA 2XWPA 5EE1A 1E20A 3K0SA 1RYEA 1TC2A 5JZOA 4R3NA 4MHOA 3VDRA 4ZV7A 2F2TA 3AI2A 3AWDA 3FRIA 2VHCA 1CUUA 2AR9A 3AQ4A 2BAGA 3OZFA 3OWXA 5M5BA 1ETHA 4I8XA 1DFHA 3C1OA 3CZAA 2JHPA 2BGRA 3VNVA 3INGA 4JHXA 4OPMA 1KEWA 4IYJA 3RG8A 3U9LA 1K6MA 1ZA2A 2RGWA 3RS5A 2YKGA 1ZU4A 5T8KC 3L4KA 3I4FA 4XWGA 3TK1A 1M6HA 4GVXA 1OBHA 1FTYA 3O2QB 2HA5A 4RPGA 4X1YA 5BWBA 4MW2A 2WMDA 2JAXA 2W42A 1MRSA 3UGKA 4U2EA 4ENTA 1D4FA 1GEEA 1HE8B 1A4RA 1NN3A 2JFXA 3KSDO 3PDJA 4UMDA 4H6VA 4GX2A 1CR6A 1X1SA 1DU4A 2Z09A 3K0KA 5HA5A 1IU9A 3WP0A 4BLTA 4E5YA 4TQAA 3ZIDA 4HQ0A 5AVWA 3VMMA 4BLPA 1EE2A 3LQFA 5HK9A 2W6JA 5AVKA 1FFHA 4IDEA 3Q5GA 1CEYA 2FRDA 1BCSB 2ZJ6A 4TKVA 1RWQA 2DMRA 2QA5A 4EMTA 3W3AA 2BGUA 3C1TA 4PZPA 4F86A 3ST7A 1HLDA 4QNNA 4CKCA 3QUSA 2Y3IA 4PXYA 4CDMA 1HK7A 4NYJR 1QR2A 3RJZA 1QYXA 1CVIA 1WCYA 2WIAA 3ABIA 3E3OA 1DIOB 1NMQA 3ELYA 3RYFA 5B6IA 5HHTA 5AKJA 1YCFA 4IPTA 3KVOA 1VPLA 2K4MA 3MB8A 3N59A 5I9BA 3SC4A 1E4VA 4POAA 4PPQA 4RKRA 5JD6A 1QQBA 5TQ0B 4NIMA 1UZLA 3V7FA 3OOWA 5EJ8A 1L8XA 3Q6MA 1F8YA 4QXPA 4Q1FA 4ZEMA 4B3TB 3EISA 2WG2A 2Q6OA 1W76A 4BV9A 2QUZA 2CK3A 1NX6A 2EJCA 2I33A 3TI9A 1HYGA 1NNEA 4MVJI 1EFTA 3AFGA 2RGAA 4PSCA 2ZSKA 3A37A 4RETA 4YCBA 1BJKA 2HMSA 3PD7A 1WZCA 4ARSA 1Z07A 5IARA 1CR1A 2FF7A 4IIJA 2XYGA 1X7XB 3EQ9A 3SJZA 1T8PA 4DJFC 5CFPA 1JG2A 1V2HE 1YUNA 3BE5A 2I8LA 5IWAB 3OF3A 1UF9A 2WYHA 1TYBE 3GF4A 1CHNA 3S7ZA 5JFOA 3CNBA 5KS2A 3ZS9A 4YRGA 1IBKB 1QKKA 4US0R 1LJ8A 4QODA 3RFUA 3UAVA 5MDHA 5CM2Z 1MRZA 1E9AA 1SCDA 5IM4F 4KDEA 5HTOA 4ZV4A 1XMXA 3QA3E 3E8SA 3NBXX 4UM7A 1ZK1A 3KDSE 3ETDA 1E4YA 4RMNA 3B6EA 2F1RA 3PC7A 4E22A 2C0QA 1IYZA 3G0DA 4TT3A 3L4JA 1LXCA 3A1EA 1CVRA 1HETA 1RQ2A 5FPTA 1PHPA 2AG0A 3LOPA 1J97A 1A7KA 2W2KA 3GPCA 4P4LA 1DWUA 1X7DA 3RUAA 5JECA 3DS8A 4BPBA 4AKGA 3GJ8A 3ELBA 2G4LA 2XCLA 4U9UA 2PFKA 5BSRA 3UMFA 5DCYA 3P0EA 1OZFA 4BX2A 5JZ9A 2FX2A 2OV2A 1S89A 1IN5A 4K3UA 1A76A 2BKLA 1G9SA 2YVLA 4IGKA 1RADA 2JLBA 1U2RA 4LVCA 4RJIA 3Q3IA 5FLXA 2VHXA 1N33B 3IGFA 1TCBA 3NR2A 1K7SN 3SNHA 1C9YA 4CI0B 1EMDA 4HNTA 1AX9A 1GP2A 2I2DA 1RBQA 3OO1A 3Q9NA 3LL7A 3SKYA 1FX1A 2WUEA 2ZAOA 3MA0A 2AXEA 1SVOA 4DTIA 5L4NA 1W4CA 1O9BA 4KMSA 3N0WA 4KO1S 2KMLA 3V1KA 4L78A 4CEIA 1TU3A 4F4FA 3HPRA 3QE2A 1QFXA 3PDIA 5P21A 1J06A 3NGMA 5AJUA 1E2LA 3OCZA 4MIKA 4YJ2B 1E3WB 1IVYA 4RKQA 4FDVA 3URKA 2IELA 3I0MA 3K0FB 4C4XA 2H1FA 1USUA 5KYWA 2WEKA 1E7YA 3JW8A 4FJ2A 3FRJA 1JEJA 4KWTA 5EXTA 4G2TA 4R8KA 4Q01A 4H3KB 4OJTA 5B4UA 1EFVB 2Y0CA 5IDXA 2P90A 3OE5A 4YONB 1UAAA 5B6PA 3EASA 1LBEA 2FAXA 5SZHB 1I1OA 2ZBFA 3PSAA 5JO9A 4CLXA 1N1MA 4KQEA 4OB8A 2C5AA 2DLCX 1FJGB 1ADYA 3CS3A 1O8CA 3SEFA 1XN4A 4NCKA 2X6RA 1I4DD 2ALJA 2MWMA 3ONVA 2I6GA 3LXMA 3WB2A 4EYQA 1Y7LA 3LSTA 1L8QA 5ISMA 3U56A 5LQNA 5TLSA 4FFNA 1W93A 2CMKA 1XZMA 3H75A 5CVJA 2ZCJA 4XFDA 3AOEC 4C3ZA 2AG6A 2AX4A 2GJAA 3B12A 3SXPA 5JSFA 2NAFA 2IWRA 5BUSA 1X8JA 5FLEX 1JQLB 2IZ6A 1SIUA 3K15A 3HFSA 2ZJ4A 1E5TA 2GNAA 1CUIA 2XLBA 3ECSA 3U4IA 2JIZA 2L17A 1OLXB 3IB6A 3JYQA 1OVMA 1SHZA 2YV3A 1CR2A 3N87A 1KY4A 2OOKA 4FJ1A 2VJLA 5D3KA 4DLTA 3QVKA 2PJDA 1GZ7A 3DAYA 4YWJA 4YJHB 3ZZUA 4PLTA 3FKQA 2YZ2A 4JITA 1Z37A 2IVZA 3HP1A 4W5QA 3P2IA 1YS4A 4R83A 3PF8A 4OI4A 1T5DX 3G49A 3KU1A 1JFFB 3MTAA 1MGOA 3SOPA 4KFCA 2CT8A 3KEFA 4DLAA 4R9NA 2X0IA 2P5UA 1R6UA 1ZNZA 4C6RA 1AK9A 4I5EA 4O63O 2JCXA 3KEGA 2H4FA 2ZB3A 2F3PA 4Z7JA 2RSLA 2X1MA 4Y2YA 3RYCB 1Z63A 2VHVA 5DIFA 1GNQA 1NMEA 4HFJA 4YC7A 5EKTA 3IDSA 1CUXA 4TQGA 1QMGA 3AUJB 4P84A 3P26A 1B3RA 2CNLA 1W0JD 1VCNA 2PPVA 2VP5A 1H9BA 3DVLA 3B6JA 1FUUA 5LQMA 1JTEA 5K0JA 3KAPA 3AVUA 3BMCB 3EXG2 2H1HA 2WP8J 5AKKA 5CCDA 4DAOA 3PB3A 1G3MA 1PLLA 3DAGA 1Y6ZA 1KAGA 3DNFA 4QPDA 1PNRA 5K8JB 4M9ZA 1DXHA 2JIQA 2H2DA 3D54D 3KR9A 3NIBA 4N82A 1CV2A 3PHGA 3JYNA 1LDBA 3VHRA 4F4UA 5BWLA 1QF6A 1IG0A 4AJKA 2X1VA 3F73A 5KTPA 1HA3A 1YOVA 4C2UA 4IFEA 4Q93A 1BFUA 4QYIB 3CB4A 3FYCA 4O25A 4Q4AB 3ZV4A 4F72A 3ELUA 5FI3A 3S7TA 3PUWA 3EDRA 5A3RA 1S02A 1C9KA 1BW9B 1OX5A 1YTLA 4J43A 3KUUA 1S4QA 2LE0A 4I14A 2A30A 3N8NA 2GN0A 3FPAA 3PNSA 5JBIA 3JYLA 1RWPA 3SNKA 2B7LA 1QVZA 2NYUA 3KD2A 2CJYA 3JASA 4OF4A 4PE5B 2HK8A 3SC6A 1QHGA 2FWRA 4I1IA 4W63A 4WN3A 2H2IA 1Y8AA 3QIAA 5KQSA 1N7JA 1USWA 2QTBA 2ZP1A 3G9XA 4QYMA 1CETA 3PDHA 1HNNA 5JZBA 1MOPA 3T7CA 1O6CA 2VRCD 4M1WA 1C9JA 1CX9B 3KSZO 4MA4A 3USCS 2ZIFA 1XCLA 3FZQA 4FFPA 3K71B 4JI4B 4GKVA 3BT7A 4J2TA 3SYTA 2YUTA 1CQIA 4EYGA 1AGNA 1C7EA 1QIJA 2G71A 4JLSA 3GRKA 4ZOQI 4JOBA 2CJFA 2ZBVA 2P1ZA 1GXSA 3HI4A 4LVNA 1ID8A 1P2UA 1C30B 4PHGA 1QDUA 1IHXA 4X6YA 2Y1OA 3OKAA 1K0FA 3HI6A 3KT6A 1EEHA 4NNJA 2Q9UA 4NAUA 4UVEA 3RGGA 3UFXB 4TL6A 3WNDA 4D99A 3VR4A 5C32A 5F7OA 1BHO1 2C4HA 3NTVA 2CBZA 2HB6A 3QMVA 3OMWA 2FGKA 3O2JA 3G8AA 1P2DA 1B2RA 3JWPA 5LPNA 1CEQA 1NLMA 2J0UA 2R7MA 3DZCA 4KWEA 4YJFB 4XLTA 1V6CA 5HIJA 4WCFC 2M32A 4NV3A 3WWPA 4DMRA 3OQNA 3S8YA 3EVCA 4TTRA 5AW6A 3D6NB 1VA4A 2KHZA 5CYGA 5AXBA 1WPGA 2BUCA 2CXRA 4CN8A 1JKJB 4BU1A 2JH9A 5A7GA 4Z4CA 3OZCA 4C30A 1EE9A 1T10A 5J4YA 2AG8A 2F1KA 2XKAA 3CWZA 5HIMA 1YR8A 2WOOA 1A9OA 2HQBA 3FPKA 1Y6JA 3N5KA 1CE8B 3FR7A 1PGJA 1GAQA 4BNDA 5AJXA 3WAJA 2PUCA 1ZA1A 2XDYA 3UK6A 4MTCA 1T0JB 4AF8A 2C4KA 3EVAA 3WHKA 4HBZA 4J76A 1MB3A 3EWIA 4Q00A 1CY8A 3R7LA 3VBEA 4PO9A 1U2PA 4Z8XA 3X2SA 5HM8A 2FLKA 1RRVA 1J49A 3T1HB 1RLMA 3A3PA 3EEBA 2ZS7A 4CI9A 3KQOA 4NK4A 2EKBA 2QORA 5FTNA 4CM9A 5ESWA 1KYQA 3IYLW 5JXHA 2ZYAA 3G23A 2W6NA 3W05A 1FUYB 4A8JB 5BRAA 2Q27A 2AYYA 2A7QA 3UG6A 1UPTA 3QWIA 5I51A 3PWSA 2BKXA 2XCUA 1E1YA 3C98A 4IMIB 4NX2A 3ZV7A 3IS3A 2A57A 2PIDA 5TVGA 2W11A 1TTPB 5CFZA 4NJEB 3V8MA 4I1UA 1NUPA 1QORA 3H2ZA 1XVVA 3CO0S 4TMVA 4I55F 2PBFA 5CDFA 4EB6B 3F9CA 1SKYE 5I8PA 1AS3A 4D5GA 5JD5A 2XXAA 4PG4A 4YRSA 5KYYA 4N49A 2AUNA 3DZBA 3SJAA 4LF4B 1LTQA 2X8WA 3SHFA 4WZZA 3DZIA 2Z3WA 2M6RA 3SFZA 4KXWA 4EHBA 4REMA 5JZVA 1P81A 4G6ZA 1T5LA 2P4SA 5LUBA 4BKRA 4DV5B 3CT6A 1E7MA 4CKXA 3HZHA 5LJLA 1P19A 3VSDA 4NXNB 3LRTA 4L50A 2XKBA 2R5FA 3QUCA 3RSSA 5F73A 3PYLA 3DCJA 1GFIA 2FX3A 3H6HA 5KYUB 4PRKA 3JARA 2SCUA 3K9NA 2XB2A 3AX6A 3LKDA 4C08A 1GRCA 1FDOA 2VDQB 2I4LA 3U7RA 3D3WA 3OT1B 3MMSA 4BRSA 2HXGA 1R3DA 3SX4A 4ZGGA 1PWHA 1XJWA 3HRHA 5CFMA 4V1CI 3VKHA 2HA3A 3P27A 1ZXXA 3KYDB 4HCJA 4Z4EA 4FTWA 3ETHA 3SBOA 1Q7RA 1JILA 2FQWA 2DH5A 4BNTA 1GG8A 4AJLA 3QXJA 4UNIA 3JVEA 5GAJA 2FHSA 2TMYA 2QG9A 4IOJA 3TQTA 2OV4A 4JZYA 3A1WA 1TK3A 4G25A 4BY9E 2OXRA 1DC6A 1M8KA 3EEOA 4IH9A 1G4AE 2BCEA 5IKOA 1RHUA 5KPJA 3O26A 2PGXA 4I4NA 3DBLA 3QU4A 4C6SA 2EF0A 3BIFA 4UD2A 1OFVA 2AFRA 3RBAA 2JKZA 4LEIA 4DWOA 5EXDA 2ACKA 4CLDA 5E3IA 2RGBA 4DRYA 2PMCA 1VFNA 4EECA 5EP1A 2HF8A 1QJCA 4BZPA 4MMYB 2J4CA 2PWZA 5IK2D 1HEIA 1OU4A 4HPWA 2VQ6A 3C1AA 4HQRA 2ZVJA 3DMYA 2CNNA 2OO7A 5JBNA 1QHHA 2BTQA 2PM8A 3NHSA 4INOA 4NK5A 2DFKB 4MHSA 3DB2A 4HGYA 3TZBA 5HF5A 3QPAA 4WFKA 3WNBA 1THGA 1P1HA 3SE0A 1TF2A 5TS3A 4JB0A 5EJ4A 1YZYA 1OI3A 3IXQA 1DXOA 3DXYA 5DLDA 4Q19A 1FMCA 2X0KA 4XVHA 4TM8A 3NAMA 2VSXA 5EHQA 3OJ0A 2HWXA 1XKLA 3VNRA 1FYXA 5K0TA 2XGGA 3QXHA 1NXSA 3RT7A 4J1NA 2QIOA 5FF9A 3PQ2A 4OH1A 4ITVA 2HCRA 1W0KA 1P60A 2SKCA 3H8VA 1EVEA 3JWGA 4Z51A 4DEXA 4RE6A 1G7TA 4BNXA 2QQEA 3B1ZA 5BN3B 4UBKA 2CXSA 2EOAA 2OZPA 2GLTA 3D4PA 4M76B 2QI9F 3WOHA 5U4QA 1UBRS 4R7TA 2FQYA 1DEXA 2GO1A 3GNLA 3TCKA 4PSVA 2MDTA 2JGKA 1G5HA 3IKVA 3NRBA 1BXZA 3D8HA 3CH6A 3ES9A 1V4BA 3S99A 1A9SA 1CUDA 3TSWA 5C9ZA 3G2QA 2PE5A 4Q4CA 4G5RA 2I03A 4MWGA 4F7DA 3AP2A 3EPRA 3PRJA 4PZYA 2VK8A 2Z8XA 5JH7A 1O0BA 4ZVTA 1JDTA 1XVLA 2C9BA 3M2PA 3RODA 1E9DA 5ARBA 4LF8B 1UC4B 4LS3A 1UBUS 1VDMA 1YMQA 2A1IA 2C98A 3ACCA 3T0GA 5JV5A 4BL5A 1MT3A 4PYRA 3R7WB 1RWMA 1Z73A 3DPUA 3TBFA 2FB9A 1EX1A 4N8SA 3TRIA 1DQPA 3L6EA 4BP9A 5J1SB 2TRSB 3KDPA 1KQNA 1WMEA 1TT7A 2Q6VA 1ACLA 2VQDA 1O9GA 4JOCA 1Q84A 1RPAA 4GXTA 3A1VA 3ROFA 3NDJA 3DE5X 4F6RB 4C0KA 4PG5A 2H07A 3GP3A 1AQYA 3AF4A 3FPGA 3MM4A 5AKEA 5DU2A 3PX2A 3GLIB 3PC4A 5FHRA 1QHYA 2Z8ZA 2AFHE 4ZMBA 2BJVA 3HB9A 3ZWCA 3EG9A 3KB8A 4TYQA 5TT1A 1DAMA 4Q05A 4B45A 1XDBA 1H0SA 3ND8A 4HS9A 3QX3A 4MWDA 3T7TA 3D6HA 1WHTA 4H1VA 5EQTA 1NRJB 4G8CA 4MWCA 2FUG1 3EDMA 3B53X 4KMMA 5HF9A 4JR1A 3T1VA 1Z22A 3KFXA 5BSVA 2OQIA 3H86A 1G5TA 4K9QA 4NCAA 4I66A 1KZ4A 3THYB 4B3GA 2Q5QA 4WWHA 1E18A 1YU6A 5L95A 4J49A 3WJ7A 1LX6A 2KPOA 1US8A 2HSWA 1GTRA 4XX0B 3C3DA 5K51A 4WBXC 3RTBA 2ZRMA 4GR5A 3EVNA 4PCVA 3AHFA 3G68A 3BCHA 3EIWA 1XZBA 1NUUA 3H5OA 4ZO9A 5ALLA 2C4MA 1O94A 2BFEB 2HA0A 4P7FA 4BFSA 3KOOA 2X2EA 1XYVA 2EYQA 5EWLA 1L7VC 1FUIA 4GLJA 2WQZA 3GR6A 3KZKA 3L4SO 2XB6A 1JF8A 1AS0A 5K01A 2ZZMA 3ZVLA 1MH1A 1SVKA 4OXRA 1GCUA 1YJ8A 2D5BA 2FG7C 3PENA 4PFSA 3U4CA 3AIIA 5JXIA 3W5CA 2ETXA 3PE3A 5IH3A 1MAUA 1DSSG 2OV1A 2QDXA 3KZCA 1FNCA 1V9CA 2IYXA 2WE7A 3D6TB 3ME5A 4JLUA 2XGMA 4LXUA 4AMUA 2QD4A 5A4MS 4ROSA 2H5JA 4L9WA 1B4DA 2PLWA 2XNKA 3V4SA 4ZVQA 1T1EA 1D1QA 1X7YB 4YRTA 1AHHA 4OOEA 1W44A 4AZVA 1Z7GA 2UYHA 1N7HA 1I2BA 5JQGA 5L3SA 1E2BA 3VOTA 4IDNA 4AF7A 1T35A 4Y6LA 1ZITA 1DDIA 5FLYA 3FDFA 3BBLA 1TZCA 3WLEA 3LJKA 4Z1MA 4YR9A 3SZLA 2JCVA 4GDFA 1SH7A 3IA2A 1AF7A 4F84A 1F5SA 4FGWA 5JCOA 3KHTA 4KBYA 4GMHA 4AZ0A 1C7ZA 4NCIA 4Y1GA 1E7QA 3CUSA 3WYCA 3B8EA 1R0XA 3ORYA 4QRIA 5FPYA 2XBLA 1E69A 3KG2A 3OCVA 4P2GA 4P3NA 3AR7A 3OTQA 3SIPA 5C81A 2DY1A 2VHJA 3GARA 3PA6A 2RH8A 2Y05A 5EMJA 3VAAA 5J4HA 2WU3A 3EE6A 4RQAA 4M7RA 2MR6A 1YQXA 3E1GA 5KINB 1H2BA 1F2VA 4DLXA 1XVUA 5HOEA 3EBOA 4AROA 1KBQA 4U2DA 3DKKA 3RTDA 2JL1A 4P86A 1ZGBA 3L92A 1ZJJA 2J6BA 3K92A 1W6UA 3DD5A 4NENB 1NRIA 4ZYXA 2VJDA 4NEGA 3OFND 1VLQA 4G9BA 3G79A 3I5MA 3GDGA 1X8LA 2XUHA 2NUPA 1N0UA 3GLKA 4LJYA 3SXUA 1N0IA 2VS1A 2C2OA 3DBVO 4NOJA 2PUJA 4U9IS 1ZIPA 2ILVA 4BTEA 3E22A 2BY4A 5JADA 1NW5A 3N2NA 2JLWA 3HK2A 2P2LA 1TKBA 3ASZA 2JLYA 1LFDB 3D6JA 4K8OA 1W96A 4MRRA 2X76A 2O2CA 5TSDA 4PVDA 5IHXA 5I8WA 4Z3OA 3AVYA 2NP6A 4L6CA 2GD0A 1YQQA 4XSVA 4AMZA 4B80A 2GBLA 3NMUF 3U2QA 4O2AF 2BHSA 4YCCA 1EFRD 1FEZA 4MK4A 4LOAA 3BWXA 5DNDA 2PRJA 1N75A 1W35A 2PYZA 3EUWA 3ZN2A 1EESA 1P1KA 3Q1KA 1OJ7A 3KVNA 3TZCA 4MI9A 3N7TA 1ODTC 2D7CA 5I6DA 5EIXA 2H2GA 4LV5B 2QTLA 4OLFA 5HOQA 3RSOA 3TW8A 1QBGA 2EDAA 3DONA 4L8GA 1G5IA 2YQZA 3FI9A 4Y6RA 3B38A 5JS2A 2BT4A 4CF4A 3KXLA 5IMBA 5DDIP 2ZOSA 3Q7RA 3WYBA 2AJ8A 2AN1A 3PWKA 4Y2RA 1DQSA 4MP8A 2HKIA 2PA3A 4II2A 4GMFA 2ROQA 1MIOB 1I7NA 1VE3A 4XRRA 4PANA 4R68A 1YRQA 1FDRA 4A2WA 3RE1A 1Z82A 3NDRA 3C4QA 3FHJA 4HV4A 1FSPA 1TUEA 2R8EA 4UKDA 4LF9B 1VYTA 3I2IA 2FJ0A 1B0UA 3L1IA 3PX3A 2GHRA 1R3UA 2FTKE 2X8BA 3KKLA 1X80A 3VZDA 3HB5X 1DX4A 2RGRA 5A2QA 5IJ0B 1XEXA 5TGZA 4XGIA 2D0PB 3CF4A 3SHOA 5IH7A 5ITSA 4U7PB 3IOMA 1KZYC 2YCLA 1U99A 2ZVQX 2FKNA 4LSWA 7GPBA 1Q1ZA 1Y34E 3M89A 4JP1A 1H22A 3RSLA 3L3BA 4NV1A 4ZT3A 5LOVA 1XE3A 2BKAA 3Q9LA 4HVCA 4RK7A 3HO1A 1JBEA 2G1AA 1HWYA 2FWPA 1NXXA 1TUIA 1WS6A 4WEQA 4B3RB 3UY4A 1ZVKA 1LI5A 1PJLA 4GOND 1QPBA 1GA4A 1JSRA 2W4IA 4RYDA 2J87A 3DPSA 4M1EA 1UKYA 2O50A 2J3DA 4NBLA 2ORED 4BN0A 4CF6A 4DRXB 3QUBA 1WSDA 1YC5A 3EPKA 2ZJ1A 1Z3CA 3IAM6 1G20A 1K98A 1ODSA 2PCJA 3R3VA 2JDID 3ZBQA 1WL8A 4X8LA 1XXLA 5CU7A 3NGLA 4ZO8A 1TFUA 2GSWA 2NACA 4R71A 2X40A 2QMEA 1IIBA 1DJNA 3CKLA 3IP9A 1X87A 4TL8A 2HK6A 1M0EA 5CCEA 4G0YA 2XCRB 3HUTA 2BE9A 3TEMA 3EGVA 2GZAA 3TO5A 3CLRD 4JLMA 5B3AA 1Z13A 2GJ9A 4P82A 1MB9A 4JBLA 7MDHA 3VSBA 5LKRA 2PGNA 2P3OA 2WZCA 4FEGA 3K94A 1QAMA 1HKHA 3WXMA 1G8YA 3VUEA 1SM4A 1E3IA 3L6UA 4QGHA 4O2RA 3X1ZA 5K0BA 3PUIA 4ARCA 4BKPA 5K8UA 1BVYF 1NX9A 3K35A 5DMHA 4YRJA 2VYFA 2YFYA 5ILOA 4A5SA 3DQQA 4MROA 1IK4A 1Z5UA 3OQBA 4B9EA 2XQGA 4DT1B 3DE6X 1M6NA 1XQVA 3EF1A 4A8PA 4EF4A 3OZWA 3RS2A 1U0LA 5AW3A 3LUJA 3E2PA 4MW7A 1N2JA 3JQBC 3H84A 5LDHA 4JK3A 4X20B 1DJOA 4K86A 2IYTA 3KJEA 2Q2OA 1Z45A 2AZDA 4TLDA 3NASA 1P3DA 1YL6A 1BCSA 4E11A 2XB9A 4OY3A 4L3OA 4DMGA 2OUKA 1PD1A 1C9MA 1ND5A 1R4ZA 4LA4A 1ZRNA 2II6A 4HTAA 4Y1FA 1BXRB 2GAJA 2X9NA 3DMRA 4YREA 3G9UA 2QQ5A 4ZO4A 1RP7A 1JG3A 3DH0A 3C1UA 3M1AA 4RENA 4MRVA 4U1RA 4HC4A 4E94A 4LMAA 1QJ4A 3KPWA 3VPFA 3AGPA 1V7CA 3CX6A 3WY9A 1JEQB 3MCTA 2O7QA 1EB8A 2NN3C 3LBIA 5L3VA 3SWWA 2Z1MA 4NMWA 4Q3OA 5CX1B 3TOXA 1ZK0A 1IBMB 4HGNA 4RW0A 3FA2A 3R9XB 1F6DA 2FYTA 3L8YA 1EI9A 1PL6A 5JMOA 1ILEA 1H4VB 5DHPA 5TQ0A 1YR3A 5COQA 4JASB 3TBKA 5JDCA 5LIPA 3OPYI 3DHVA 2GGSA 4ZYLA 4UHKA 1P7WA 3P2EA 4ZRMA 3T7RA 3RWMB 2P6UA 5ABPA 4ESHA 1JUDA 4WBSA 2WJVA 1SVNA 3MTQA 4YAIA 5E4YA 4IXDA 3PNOA 1DBIA 4Y2XA 1CRLA 1BE1A 4ZTBA 2ZPAA 4K8RB 4R2XA 3VR6A 5JH7F 2P68A 5L53A 4QZVA 3KQLA 2FZGA 3DEHA 1X7XA 1ZD8A 3A6EA 3IDFA 4R6XA 1ESMA 1VL0A 3CF6R 4EBBA 2HD4A 2G9ZA 3AKZA 2VOEA 2BC9A 3UWOA 2QMZA 1HKUA 4PQEA 1KGDA 2Q0XA 2QZ9A 2YJZA 1MZVA 2OXTA 4DKJA 3CW8X 2H8GA 3UV7A 1QO0A 1QR6A 3QNWA 2VF5X 3QX9A 4WGFA 4Z7OB 5B7GA 1G8JA 4MMXB 4AUKA 5F9FA 4HH3C 4P7BA 4LE0A 4MUYA 3C3MA 2OOSA 2W4QA 4GC5A 2VRBA 4HLNA 3OAAA 4PFJA 4QAQA 5T6BA 2IXDA 4EFNA 1UJ5A 4NECA 4HO1X 5DHRA 4DLWA 3RTAA 2ZSBA 4FZVA 5LJIA 1Y37A 2WBLC 4IIDA 2IZ7A 4FT4A 4LOLA 1X7ZB 5AJZA 3T94A 4F8JA 1J0AA 4IH1A 2GAIA 3ZPXA 1L7EA 1P8JA 1YDHA 2VNJA 3ORFA 2LZ0A 4B3HA 1CF2O 1NUSA 1R2QA 4RDXA 1M34E 3E58A 3TNDA 2JBAB 2ZRGA 2D0OB 2O5VA 2FPGB 1QVRA 3AKDA 3NV7A 3I76A 4KC0A 5SYNA 4DJ5X 4W9MC 4RWEA 4YI3A 4KCGA 4PYNA 3U1TA 4ZI2A 4FDAA 3ZHQA 4E4YA 3DBRB 3G8DA 3QE3A 2XT9A 5B64A 1OFGA 1PJZA 1ZL0A 1N5KA 5J47A 1I3CA 1YFKA 2B1JA 1A50B 2G7ZA 3H7AA 3RVNA 3T12A 5LQRA 2I8CA 2R6R1 3TOSA 2I91A 1VKRA 4OCZA 4AJ4A 4D96A 3DFMA 3DLAA 10MHA 4ND2A 4ZDWA 4CEJB 1E59A 2HXYA 3NZEA 4YJ2A 1E3WA 4IUYA 4NE9A 4W5TA 4DB4A 3ETNA 4TS4A 3K0FA 1HNWB 3AJDA 3IKLA 4M36A 1TYAE 3DT6A 3OE7A 1MDFA 3S1LA 2Q2QA 2V0GA 1LBSA 3C7CB 4JKIA 1XCGB 1IM5A 4MKGA 1XELA 5FUVA 2OWEA 1XPOA 1D8TA 3BX1A 3ETCA 2WHEA 1EFVA 1VKJA 3L6RA 4J16A 1ZN9A 4NU6A 3HCDA 4OVKA 4S1TA 4YFVA 3EZLA 3R8CA 5HQ3B 2BI8A 4QDZA 4IDPA 3VTFA 4IDDA 5AK4A 3NAZA 4Z49A 5KTYA 5BOVA 3HDQA 2R44A 1IY1A 1KK0A 1GPMA 2Z30A 3L7BA 4MWBA 3Q9UA 5E6RB 2PGJA 2PZMA 1GNRA 2UZIR 3AXTA 4Y7DA 4CTJA 3PHBE 3R77A 5C2JB 3NH9A 2FCAA 3M34A 2M98A 2WYUA 1Q1NA 2YNMD 5EZYB 4DXHA 3OLXA 4KLZA 3DF7A 1WCV1 1M7HA 3HV0A 3TE6A 1DMSA 1WPRA 3U48A 5EJ7A 1EU1A 4B31A 3HBJA 3O84A 5T4BA 1UP7A 3UAYA 4K26A 3FSRA 1EH5A 3PBKA 4GMDA 4P81A 5KSOA 3NOQA 4N5DA 3U3DA 2C9CA 1WTAA 3W79A 1SUIA 4HN9A 2N3ZA 4Q48A 5DHQA 2GN6A 3V4LA 4KO2S 4ML3A 2VQSA 2MSKA 1LLQA 1OLXA 1XLWA 1R74A 2GLXA 4TVKA 4I3HA 4HAZA 3AFMA 4BUJA 4HWKA 1RWWA 4OQMA 4BV3A 4JZKA 4AP6A 1YK1A 1W36B 2DTDA 1G0NA 1YGYA 4E0BA 5ELMA 4BGUA 2VSOA 4LMBA 2V65A 3WDMA 1N7IA 3JQQA 1JFFA 3A6KA 3EXHC 3FBTA 1YQTA 3TIXB 5JFTA 3A04A 3FCEA 4GOLD 1GL9B 4G8JA 3WGNA 4D25A 1WXWA 4UHCA 3B2NA 3BJRA 4GP9A 1OWLA 3L82B 4LJKA 2O19A 2VNKA 5JVDF 3VDNB 3RYCA 3SVTA 3QKRB 4NARA 1DBSA 3NALA 1Y4UA 4F85A 3QFSA 3QLJA 5D84A 4A10A 1PW7A 5KUTA 2IV2X 2BI7A 3R40A 4IJWA 2PL9A 4CMHA 2RGNC 5TE9A 4C04A 2JVJA 1CZUA 3BMCA 4F11A 2ZRIA 4GYWA 4QVIA 4RL4A 2J3IA 3M5CA 1M3SA 1JAHA 4MP3A 3OCUA 3E5HA 3J80A 1DJQA 1J0DA 3BGSA 3EY4A 5JPCA 4RF4A 4HL6A 2RI1A 1JZSA 1KMNA 1UDWA 5DOZA 3QVUA 2CNKA 3ZKAA 1E9RA 3B52X 3LX8A 3T5AA 5KVQA