1JDTA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with mta and sulfate ion
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
235
structure length
231
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
molecule tags Transferase
source organism Sulfolobus solfataricus
total genus 79
structure length 231
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdtA00
1NW4A 1YR3A 4D8XA 4L0MA 1U1GA 3PHCA 1JE0A 4TTIA 1VHJA 4KN5A 1Y1QA 1PBNA 4LDNA 2P4SA 2HN9A 3NM4A 3GGSA 4G8JA 1LV8A 1SQ6A 1A9RA 3P0EA 5F7OA 1PR2A 1T8SA 1K3FA 3FOWA 1JP7A 4D9HA 1QE5A 4I2VA 4DA0A 2QSUA 3FNQA 4BN0A 1ODKA 1YBFA 4MCHA 4F2PA 4LKRA 1OTYA 1Z34A 2ON6A 1CG6A 1ODLA 4U2KA 3OZCA 3EMVA 1OVGA 3F8WA 5B7QA 3EUEA 1K9SA 4DABA 1JPVA 1ULBA 3OZDA 4BMXA 1RXCA 4TXMA 2AC7A 1PKEA 3DDOA 4F3CA 1TD1A 4GLJA 4QEZA 3DPSA 1OU4A 4NSNA 1JDTA 5IFKA 3ENZA 1A9OA 1N3IA 5F7XA 2QDKA 3LBAA 4YO8A 1Z5OA 5I3CA 5F76A 1JDUA 4JWTA 4UC0A 4L6IA 4OJTA 3QPBA 3O4VA 1PF7E 1RFGE 4PNPA 3INYA 3NM5A 1U1CA 3NM6B 4WKOA 5K1ZA 1T8YA 4WKBA 1ODJA 3E0QA 4OGKA 4MARA 4P54A 2A0YA 3FB1A 4WKNA 1A69A 3OZBA 4DAEA 5KB3A 2GUWA 1T0UA 1Z33A 1LX7A 3UAZA 1G2OA 4TXNA 3FUCA 1M73E 1YRYE 4QASA 3C74A 1V48A 4G41A 1K27A 4MCIA 4DA6A 4FFSA 5F77A 1A9QA 4DAOA 1TGYA 3DP9A 3P0FA 4IP0A 4YNBA 1Y1TA 3MMSA 3MB8A 3E9RA 4EB8A 1OV6A 3D1VA 4TS3A 3ODGA 2QTGA 4D8VA 1Z36A 1PR6A 3ONVA 1PWYE 4TTAA 1Z38A 3PNSA 1JDVA 3OOEA 1U1DA 1V41E 1V45E 4JOSA 1Y1SA 4ECEA 4F1WA 4E1VA 1SJ9A 4QARA 5EPUA 5CYGA 1PK7A 2H8GA 2A8YA 2HRDA 4F2WA 5B7GA 4LNAA 3TL6A 1V2HE 1Y6RA 4GLFA 2AI3A 4OF4A 3DJFA 1Q1GA 2Q7OE 4QATA 4QFBA 2OXFA 2QTTA 1Z35A 4L5CA 1ECPA 1T8RA 1RT9A 1U1FA 1TCVA 5CYFA 4EARA 1FXUA 4DARA 1JYSA 2QPLA 2A0WA 4OEHA 1OTXA 3OOHA 5B7NA 5JPCA 1JDSA 4GMHA 4JP5A 1RXSA 4D98A 3E9ZA 4K6OA 4BMYA 1RSZA 3O6VA 1TCUA 3IOMA 4TS9A 1OUMA 3LGSA 1YQQA 3EUFA 1RCTE 3KVVA 4TTJA 1I80A 5F7JA 3UAXA 1Y6QA 4TXHA 1RR6A 2AI2A 1A9PA 1A9TA 1A9SA 5FAKA 3OPVA 1PR4A 3KVYA 4R31A 1ZL2A 2RJ3A 4X24A 3U40A 3BGSA 1PW7A 4R2XA 4F3KA 5CXQA 1Z37A 3KUKA 1PK9A 4H1TA 5EFOA 1B8NA 4NY1A 3KVRA 1VHWA 3GB9A 2HWUA 3OF3A 1ULAA 3OCCA 1RXYA 5F78A 4LZWA 3UAYA 4QAQA 1YQUA 2IQ5A 1SD2A 1V4NA 1C3XA 5F7ZA 4BMZA 1T8WA 5DK6A 5IU6A 1Z5PA 5B7PA 4GKAA 5EUBA 3K8OE 4PR3A 4TXJA 2I8AA 2PGAA 4WKPA 4OGLA 5C80A 1PR0A 1XE3A 4G89A 4M1EA 2XRFA 1SD1A 3BSFA 1JE1A 2BSXA 1RYZA 4LNHA 2ISCA 4L5AA 2HSWA 3KU4A 1NC3A 3LA8A 5CXSA 4NS1A 5ETJA 1VMKA 4DA8A 4DANA 3FWPA 1LVUA 3PHBE 4L5YA 4OY3A 3IEXA 4TXLA 3BL6A 3SCZA 3K8QA 1RXUA 4M7WA 3EEIA 4D8YA 1VFNA 2OECA 4YJKA 5CCEA 1ODIA 3BJEA 3PNPA 4M3NA 4WKCA 1TGVA 1WTAA 5F73A 2A0XA 1V3QE 5CCDA 1NC1A 2I4TA 3DF9A 1B8OA 1Z39A 1PR1A 2OC9A 3T94A 3UAWA 4DA7A 4R2WA 1U1EA 1ZOSA 3UAVA 1PR5A 1JDZA 1Z5NA 4YMLA 2B94A 3FAZA 3NBQA 4TYMA 1CB0A 3UT6A 1Y1RA 2AI1A 2OC4A 3KHSA 4RJ2A 3OZEA
chains in the Genus database with same CATH superfamily
2J5QA 1XTZA 4H16A 4MVXA 5AOCA 1LU9A 2JIOA 4UU7A 3C3YA 3NAZA 3KDSE 4L0MA 2XMZA 3HDYA 4HTFB 4PZLA 2WWGA 3EARA 4OHFA 4P32A 4PX2A 5KI6A 1RZRA 3CW9A 1N1DA 1DBWA 1SUAA 1X0VA 2H7CA 2HH9A 3S5UA 2CUZA 2RAVA 4GZ5A 2C58A 2P2CA 3R3UA 1Y1QA 2XR1A 3L7JA 5JR3A 4G5SA 4LJ4A 3CB4A 4PS0A 1PDVA 1YHNA 4TPKA 1FFYA 4ZT5A 1U2PA 1NA5A 3DXXA 3OTQA 4KI0A 2Q0HA 1LW7A 3W4IA 4Y0AA 4KSYA 4CMCA 3FDIA 2AXPA 1GZ4A 4EKIA 3CCCA 2YHAA 3H04A 5DGCA 2O3JA 2WSBA 1JWBB 2IKQA 3D8RA 4M1SA 4EKNB 2F1OA 2ZI9A 3CF2A 1PNQA 3OHSX 3D0QA 1JP7A 2BMVA 3MMXA 2H4JA 3PVCA 4ZCLA 4KEAA 1YR2A 1NQWA 4M8IA 3MCWA 3BSSA 3R20A 4HZIA 3G2KA 3OT1B 3AILA 1E1QD 2HZ7A 1U8CB 4WWHA 2PYZA 5ITZA 1KEPA 1O5IA 1EFRA 1IY8A 3ZS8A 1GSHA 3JPYA 4Y98A 1I5EA 1SC4A 1C7EA 1UEXC 4J03A 4ZXFA 4UBLA 3V7UA 3Q9LA 5I4BA 2X0EA 5CVTA 4HDOB 2X0JA 3ADKA 3EZNA 2X7JA 5F9HA 2VF8A 3JARA 2PSHA 4BFTA 5AVUA 3SYRA 5IS2A 4S0ZA 5ALSA 3EASA 3EAQA 5HBGA 2GAOA 4CR6A 3N0VA 4ZIRB 2ZJAA 3UM9A 1CF4A 4JCOA 4WGGA 1GILA 2ZTSA 2C57A 2WJWA 2O59A 2HBZA 2YVKA 3I83A 1OHHA 4MWOA 4QXRA 5E1DA 1NT4A 2IC5A 1K3TA 3EC7A 3M1AA 4RK6A 3UJDA 1GFWA 1YJ5A 5AJWA 1EP2B 2HJ9A 1ZSNA 2I4IA 2X2PA 3LUHA 4BMXA 3KTFA 3AI2A 4LJ5A 4CKWB 5KNBA 4V1CI 2I7TA 4JITA 1OT3A 2R68A 5FTWA 4KBYA 4N6GA 4M0LA 5HZMA 4FMCB 1SVWA 4IS2A 3WL5A 3ETCA 3B6ZA 1ST3A 4XYGA 4OHOA 2AMJA 1U98A 4KAFA 3DBHB 2QW8A 4PYOA 4WBNA 2Z8YM 4RV4A 3FOFC 2P2DA 1A9OA 3I53A 4XLLA 2WPDD 3JZFA 1D6NA 1XJ5A 4N12A 3DFZA 1L5HB 4WI1A 3QX8A 4X1YB 3TLGA 3JVDA 2DUMA 3O3CA 1JXQA 3WMEA 2XW6A 2Z8ZA 3AZPA 3LF2A 4YEDA 2H17A 4O59O 3O4HA 3AY7A 5AW7A 1BGVA 4DV0B 1V8FA 1UXHA 3DWFA 2CDAA 2V7QA 4IJ6A 1ZD5A 4DLZA 1PJAA 2Y4NA 4X64B 3AYXB 1H2EA 2I99A 5EY5B 2DR2A 4LYGA 1T2DA 2FVYA 4R2KA 4ZRDA 4LE0A 3AO0B 2VF7A 3O1IC 1E1RA 3CRQA 1QG2A 4FUTA 2P9EA 4PQEA 4V0SA 4X45A 3IL2A 2R6AA 1DJPA 2RONA 1U1CA 4HSGA 7REQA 2QRHA 4WY2A 5ESDA 5KQPA 2C4TA 1I01A 4IDDA 5DTMA 2MTBA 1MNAA 2BFBB 3AU9A 3MF4A 1GGHA 4JL6A 4MARA 3RADC 1C0KA 3HLKA 4W9MC 5KYWB 1G41A 1NXVA 3CUYA 4YJHA 2A5DA 4MQFB 4YQZA 3T7IA 3EFOB 1P0IA 4TKZA 3FGOA 3PF8A 2C42A 2VLIA 1KK1A 2Z9DA 4GM4A 4JYPA 4EX6A 5A4DA 5DHPA 1XNRB 3K9BA 4H0NA 4WOPA 3DVRX 1LX7A 4QICA 4NTZA 1RIFA 4OJMX 3SKXA 5J2TB 4V02A 4LZNA 2IYYA 4OJQA 4DDUA 1Q17A 4LDQA 5FQNA 1C30B 1E2PA 2FH5B 4MKHA 2QPOA 3DFIA 4FC7A 1M73E 1T0PA 2C96A 4AY2A 3TBFA 1WIWA 3DQQA 3G8DA 1LWOA 4MJLA 4RU1A 1K27A 2YDYA 2OO5A 2G5GX 3BGOS 1D0SA 2AN1A 4RDIA 4CIAA 5JSZA 5K0JA 2D1FA 5F77A 4JKOA 1IM2A 1U0BB 2DQZA 4FONA 4OO3A 3RVKA 3A6PC 4NDZA 1I2BA 2VUIB 3W1EA 3F90A 2F1KA 2GCNA 1XTVA 3RREA 5EESA 3STVA 4MPPA 4C43A 3K70C 2SNIE 1H4SA 1CFZA 1BJTA 1W93A 4XWGA 3KO8A 3RVLA 1XKXA 3SSAA 1L5FA 2Q2NA 3A26A 3QWFA 3HCEA 4KRYA 2I2DA 1EUCB 2Q46A 4F12A 2PR7A 1LLQA 3FOEC 2A0UA 3AINA 3AJ8A 2PLRA 3QFFA 4TRMA 4DNOA 4B8WA 2MU1A 1EM8B 2OCKA 5LUAA 3RVPA 1H4VB 1NVKA 4R2JA 5KHAA 1ZINA 4HN9A 5DNUA 4Z53A 2PVPA 2B0JA 5D3KA 4MVYA 1BZYA 3RUFA 1YRWA 4A2WA 1N3LA 1FF9A 4RGYA 1O0BA 2Q4BA 3RYCB 4UAJA 1UK7A 4G1VA 3DOUA 1GPWB 5DHQA 5LBIA 1E1CB 5ELXA 1F0PA 1LNZA 3O8QA 5KTNA 1JJBA 4IIGA 1SJ9A 4DR7B 2YZMA 3PUJA 4RK1A 3T7JA 5K2MA 4AMYA 1ZK3A 3ZLTA 4CQNA 1BEZA 3LAWA 4B7UA 2HHCA 2WFMA 1AKWA 3BJZA 4IXMA 5CYGA 3F4BA 2MT9A 2Z2YA 5KJ6A 3KOXA 1JIVA 1AC5A 1ZJ6A 4G0YA 4IW3B 2QKYA 2YFQA 5B7GA 5LQKA 4GX1A 5GZ1A 1PQPA 2B4KA 4TL7A 2ZW9A 1X7YB 1YZLA 1DUVG 2PR2A 3MOGA 4D3SA 3EQ6A 1YCFA 2I7CA 1OILA 2XCUA 3I30X 4RY0A 5TJ9A 4MIEA 5CEJA 4EJ6A 5JFOA 1SIOA 2J6CA 3GWGA 1ZP6A 4QQKA 2O8CB 4MDYA 1RM0A 1QHGA 2CLHB 4IDNA 2F3SA 1UBHS 4Q03A 3R5FA 4OIMA 3OEHD 3H87A 4PLGA 4YRKA 3UFXA 3B89A 2PS1A 4LX0A 1JSLA 2XUQA 3PNMA 2NSHA 2C1ZA 4EIWA 5IJ0B 4UE6A 3IKTA 3W3AH 1VJ5A 4RFVA 3GRVA 3L0OA 4BV8A 3IP1A 4YCCA 1ZU4A 5K01A 5AYVA 1ZAKA 1UKZA 4UHEA 3NDIA 3THYB 1CF9A 3G1WA 5AJUA 3SZGA 5LZ4A 2Z5FA 1CR0A 1TW2A 5DISB 4E30A 4XUCA 2GTPA 2VP6A 4NENA 3SQOA 4CKEB 4WFQA 4HYQA 1XJCA 1WZIA 3E18A 3EC1A 2IEYA 5A0FA 1C9DB 2PU7A 2NUTA 3QVUA 2ONKA 4DCOA 3PQ8A 4H27A 4INOA 4ER6A 2P4QA 1L5YA 1J2YA 3ZOZA 1IH8A 1W1UA 1VDZA 4X3OA 4WV3A 5JEDA 3G1TA 3E9ZA 4RMGA 1E7YA 2Q6KA 1D6MA 1T26A 2ZYGA 3M49A 3ZKWA 4CMJA 1LKZA 3H11B 2GK4A 3FLMA 2LXNA 2JGDB 4DMRA 4IUCS 1DOHA 1KOFA 2CYBA 2J3EA 1YQQA 1O9GA 3EUFA 4HK4A 2EJCA 3IDFA 3L8FA 5JATA 3E53A 4WCFB 2OESA 1RS0A 5FBHA 2Y3IA 2ZFUA 1E79D 3O8RA 4TL9A 1DBQA 3QVVA 2JCSA 4KDRA 2E18A 4X93A 4YRDA 4E4TA 1A7AA 3JR3A 4F0JA 1A04A 4QU8A 4WZBE 5I7AA 5M04A 3DE6X 3KS9A 4G56A 2CKMA 1BIFA 3IS3A 3OOWA 4O4JB 1HLGA 4GH5A 1IN5A 3UAXA 4V1CA 1AG9A 4HNHA 5C34B 3W1WA 2WWYA 2EEZA 2MYNA 2BF7A 2P6RA 4Z8YA 3O7MA 5E2BA 2A58A 4LMRA 4B2IA 1MHTA 4J2HA 2QL6A 4N3CA 1EVQA 1NOKA 3L7YA 2I1VB 3GMSA 2XPCA 1D2HA 3FNBA 3OZ7A 3R7FA 1I6WA 2CUTA 2VQ3A 5LXTF 4FYMA 1M5RA 1Z06A 2QZPA 2Z2JA 3IMKA 1UXOA 1GQSA 4PZ9A 4E4RA 1U3CA 3B7PA 4TWZA 1OAKA 3LC0A 4MRMB 1L7OA 2EQ5A 3EHEA 3LFUA 3LYUA 4R2IA 4LZOA 2PQ2A 4MW0A 3MIZA 3WK9A 1TCBA 1XCOA 4CM4B 1WV1A 3TMAA 3SVLA 5FCDA 1KARA 3P4UA 1IY0A 2PD6A 1TA9A 4UJ5A 3TGWA 1XTTA 4FOOA 2Z9CA 4B3DA 1Q91A 4DPLA 4UM5A 1ZOOA 2EBUA 3H5LA 1BQ4A 3LY9A 1CY6A 1NP7A 4EH1A 2ZYSA 4II7A 1WSDA 4XIIA 3QRWA 3UTDA 3DHVA 3TVYA 5IDXA 4D80A 4GAEA 2W37A 4IGIA 4B9EA 1NXWA 5E7QA 4RVOA 2JFFA 1AE1A 1FU8A 3E5HA 3ZDYB 2ODTX 2PZGA 1A9XB 3SC2B 2EQBA 2H18A 5BR8B 1UP6A 3O4FA 4QAQA 1F1JA 3BK1A 3SG0A 3WYEA 2GUGA 1C7FA 2DBRA 2Z09A 3I23A 2NZ8A 4QHTA 1WCXA 4FZ5A 1KR2A 3BIWA 3RS3A 5JT1A 1ONPA 2Y99A 2JJQA 4M55A 4M0DA 5CW1A 1E5XA 5IU6A 5HOQA 3OZSA 4NCIA 1IXRC 2IOQA 3CPSA 1LK7A 2DETA 1MABA 3U0BA 2Q4TA 2ZBGA 1M2EA 1L5QA 4IQ0A 6Q21A 5CVJA 1Y48E 1Y4DE 2H3HA 2P8JA 3UFBA 1XEXB 1TZKA 3M6WA 3NYRA 5ADHA 1BA3A 3OH8A 4UUQA 4QU0A 4XIGS 4BAUA 2Z1NA 2FUKA 2RHMA 3ICVA 4BCDA 4B3GA 4WOJA 1LRJA 1T3SA 4ZAVA 5HKOA 4GRDA 4N5MA 4B3TB 3V9PA 1QYXA 2IYZA 3L82B 3WKEA 4JYZA 1IBMB 3S1SA 4XEUA 3ER8A 3ROZA 4BB9A 2R00C 2PSSA 3GAFA 1WNTA 5GQSA 4B8YA 3GFQA 1CVRA 4LXIA 5JANA 1Z18A 1VRVA 2HA0A 3BSFA 2F3QA 1BMFD 3IAHA 4GLLA 4H2DA 4I50A 2ISCA 1BEEA 3OQHA 1OF1A 3PEEA 3DULA 4ITUA 3VHQA 1MC1A 4XWWA 2F1RA 2FHSA 3F7NA 1JXAA 3R6DA 1Q7BA 4DCPA 2I9PA 1ODTC 3KSDO 3LBHA 2H5LA 5JCOA 4BNNA 3STXA 3E81A 4AM8A 5G4LA 3RVRA 3GMDA 1NI5A 2GGSA 1DOAA 2EATA 3EGXB 5CR9A 4KR3A 3UMCA 5JH7B 3AH8A 3H9CA 3IQWA 2OBBA 4YLEA 5B6IA 4DA8A 4MJ3A 5IAKA 3BREA 4R8LA 4EY6A 3VYWA 1XC7A 4RTLA 3EXFB 1DKRA 1H65A 1KJIA 1LVUA 1CUVA 1C9YA 2WKSA 3GJ7A 3PR3A 3QMVA 4QAJA 3SIRA 3T5MA 5LWHA 2W4QA 2CBZA 3UUWA 1T1RA 2PKYX 1YFKA 3PQ2A 3E70C 1MX1A 2QTNA 5KOJA 4OSEA 2YJ3A 2PZBA 1VBFA 3PQCA 4UFNA 5JBIA 4M7WA 2XMPA 3QLJA 4CPDA 4DHWA 2OB1A 5K0GA 1DVRA 1F06A 3EULA 2LZ0A 4KTVE 4KWCA 1C3OA 1M1NB 4ZYYA 1E4VA 3D5QA 1TUEA 4RKWA 2EGHA 1DEXA 1KQPA 2D0OB 3HE3A 1DAFA 5C81A 4AG5A 3SE0A 4A27A 1JLSA 1NBME 4M3NA 3IBTA 2WU3A 1KJWA 5COQA 3EOAI 3ZE0B 1B8UA 2AK2A 5EWMA 4F9EA 1WTAA 5HMLA 1CT9A 2C9CA 1Y9ZA 1B3BA 2V9ZA 4HR7A 2JIDA 2A0XA 2FZVA 1GKUB 1M8JA 5IVDA 4XWOA 1GL3A 1X9IA 1UXKA 1V3QE 1L4GA 1T4DA 3K30A 5D2CA 3NEPX 1F6WA 1YDHA 3N8DA 4HFNA 5C37A 1ZY2A 3TBHA 3VDMA 1DUSA 4MTCA 4IICA 4AT1A 2OCIA 2QUBA 5CAEB 1UDCA 4TTPA 1O5OA 3TZ6A 4D9FA 1U4NA 1LBQA 1NQXA 3HDGA 4FR2A 4ZMRA 1OLSB 5BN5A 3ZWNA 1EPUA 2HMTA 1TPYA 2QVGA 4ZU1X 3S1AA 2DHDA 2BDTA 2CFRA 1W0CA 4ZMBA 4D3YA 1QONA 1FLDA 4D6PA 2FR0A 3VYVA 4EG6A 3B48A 1E1YA 2ODNA 3EPRA 2CJXA 3LX5A 3OZTA 4I4TB 4RS3A 3VDXA 4HTAA 5AKYA 3M89A 4UZSA 2VPTA 1R66A 2O8EA 1T9HA 5DO9A 2O2SA 3LVBA 1DDGA 1F8YA 2XEXA 3QU2A 4TYMA 1BWSA 4GHWA 1XZKA 4HPJB 3MBIA 1LW6E 4R16A 4ZQCB 4O3MA 1P72A 5F5NA 1T6NA 1B42A 1YIAA 2AI1A 1IONA 2W48A 3OQNA 2A1TS 4K6FA 3UV6A 1GZ5A 3TG8A 4PHGA 5MFZA 3E5MA 3P9CA 1UP7A 3PFNA 5CURA 4DWOA 1G6OA 4FGSA 3CS3A 3K31A 4GC5A 3CVXA 1KZ6A 4LHZA 2WSLA 4J9VA 3MTEA 4MMZB 4HJXA 3MWGA 4LF5B 2CXQA 3IT1A 3QPCA 5FUVA 3HDVA 3NONA 1AKUA 1B26A 2YJ5A 5I9SA 3D64A 1TYCA 2OQIA 1KQFA 2VAMA 2DWOA 2J07A 2I66A 2J9YB 3R9WA 3JVIA 3MGAA 5B64A 1RWNA 2RJOA 4TUYA 5I5GA 5CFRA 5JZVA 2ZKLA 2FAXA 4PO8A 2CCGA 3N8HA 1SUIA 2NQ8A 3EZXA 3IEMA 1VLLA 4PGHA 1VL6A 4QVKA 1A2KC 1ICEA 1X2BA 3ICQB 2FKNA 1JDNA 4I4IA 1GWNA 3KOOA 3GPLA 2PK3A 1HDGO 2BEUA 2OQ2A 3PSAA 5E7JA 3LX8A 3HPQA 3VR6A 3O1LA 4OBEA 5DVZA 1ZI8A 3SU8A 2OBYA 2GYWA 2FPWA 4GFDA 3F9RA 4A0HA 5EIOA 3FHTA 1QGED 1QIIA 3SQLA 4E2ZA 1W30A 3EGOA 4JOBA 4FHZA 2A9JA 2IHBA 2ZS7A 2Q5FA 3TECE 3HBNA 3FNQA 2Q5HA 3BL5A 3ILXA 3K6RA 3JQ9A 3HZRA 2QMHA 4FEYA 4MRPA 4L8FA 1XX6A 1YBFA 3TJMA 3ZU2A 4E2YA 3HN7A 4OH1A 4DNXA 1TO2E 1P2GA 3F6YA 2C5GA 4OQZA 2CF5A 2IV2X 3WYFA 2GT1A 1IM5A 1WB6A 5ENVA 3LUCA 3PDIB 4G5OA 2IEAA 4CFYA 5J40A 3F5QA 1NBWB 2JIMA 1Z2PX 2XNDD 3EUEA 3G2IA 2ZQZA 3NNDA 4NBWA 4O2BF 4UTXA 3SZMA 4QNNA 3OCXA 2ICAA 2NN3C 4IHJA 2CMFA 1IOWA 2WJIA 3JAKA 2Z1MA 3KFVA 4LBWA 3GNTA 3H3XA 3QUCA 1PJTA 1QGYA 5K5EA 2IX3A 3B9PA 3OPYI 1VJTA 4PRZA 4YRCA 2P6PA 1N2OA 4GOJA 3ZD6A 3E22A 2FUG6 1N5MA 5JJBA 3RC7A 2CK3A 5CFNA 1X3SA 1MBZA 4L4XA 1NZDA 3IXLA 3EZ7A 1UMDB 2I54A 3G82C 2R87A 1IWPB 1LS6A 4QEZA 4CIXA 2WMOB 3QP9A 4AZ3A 4DUPA 2IDMA 1N6PA 2HAEA 4IO0A 3UT0A 5SICE 1QR6A 4YUZA 4EYGA 4LISA 4AKHA 3LH5A 1P18A 3W2TA 1N2BA 2G82A 4Y2YA 4PTYA 2C94A 5F7XA 3LNTA 1M83A 5CB8A 4Y6PA 1NRXA 4RZHA 1M2VA 4ZXPA 3OX4A 4LJSA 2G3YA 1ZN7A 1QE0A 3DDSA 1F2VA 3GQBB 3QLVA 4YO8A 2NZ2A 2P9HA 1J9EA 2KBEA 2QD5A 1SA0B 4JWTA 1TJYA 1P19A 2QSYA 3PX3A 1Z5GA 3SZRA 3QPBA 3NHYA 1BCRA 2JIPA 5EP3A 5FUQA 2AJDA 2R3SA 1LX6A 1NP3A 2BEJA 2H08A 4DHEA 2OO5C 3DZCA 5L9AA 4ND6A 1G3UA 3Q8XB 5DLQC 1ODJA 2IU4A 5KU7A 1EXWA 4LSWA 4MW9A 3ZVNA 1M1YB 1QMGA 4OPMA 4OGKA 1K6IA 1PTKA 2B1GA 1HMPA 1S96A 3KKMA 4D1YA 3OBBA 3KQUA 4NU8X 4QNMA 3G9ZA 4ZEXA 2BRUA 2YV5A 3GLIB 3OZBA 4XJVA 1Z0DA 4OHWA 4H18A 4PLWA 3G5UA 2JH9A 3VZQA 1XTSA 2REQA 4LJ6A 2X0FA 3UAZA 3OQPA 3Q7IA 5AI5A 1LQ2A 1TYAE 1Z3IX 2CLMB 2N46A 3OPXA 4R5HA 4C1NA 2VPZA 4ZYWA 4AN0A 4PFKA 3MOSA 4LJLA 4Z4QA 2ACVA 1X15A 2PEZA 4MB0A 3SI7A 1FZTA 3AEUB 5CW2A 5CXUA 1SHJA 4YALA 4KQ2A 2AOVA 3CNLA 1FVFA 4DA6A 4BPBA 3IP9A 1OH7A 4X65B 1V1JA 4BZPA 1EBBA 3Q3VA 2ZBEA 4H6PA 3WLFA 5GVSA 2G76A 4P5PA 4DFDA 3OA0A 4EYOA 1J1UA 3GXBA 2X8LA 4KQXA 3GT7A 3E8XA 3Q6MA 5KQGA 4ER7A 1BMTA 4FHGA 4XIFA 3RSHA 3VU8A 2ID7A 1JIIA 1SQFA 2XSZD 2ZT5A 3DE3X 2FR1A 1B6TA 2PRZA 2F43A 3G8BA 4EBFA 4MO2A 3NEYA 4IHKA 3A25A 5C8DA 4RWEA 2V4ZA 3MMSA 1AJEA 2G4VA 3E9RA 1GZUA 3ZEIA 4CIWA 4B4WA 4OM8A 3S28A 3UTCA 3KQTA 1Z6XA 2NU9A 4BQPA 4C7VA 5C8XA 1M7BA 1AHIA 1B6RA 1W0JD 2D3TA 3K1TA 4N65A 4YMIA 2UYGA 3VAZA 4D8VA 1PR6A 3FPGA 2A86A 1T24A 3IIJA 3M7IA 5EIBC 1E61A 1Z38A 3BN3A 5KTMA 3K0SA 1WWKA 1HNWB 2QT0A 1RJGA 2ODBA 2QTMA 5LQDA 1OZGA 1X1AA 1HGXA 1ZGBA 4BY9E 3PIDA 3ZE7A 2WIFA 3KYBA 4IV8A 1E9CA 2I6GA 4EX7A 3W7VA 3FFTA 3QBVA 4ANFA 3RH0A 4F1WA 1US8B 3CZ4A 4E1VA 1QIEA 4JDPA 1TO6A 2POCA 4RNCA 4MGHA 4U9HS 3FBGA 4WDRA 3HNPA 3DBVO 4HAZA 4RTPA 2GN8A 1WJGA 2IYLD 3X1DA 2ZJ2A 2JD2A 1NVBA 1Z4OA 4U1RA 3TLXA 3ZC3A 2BYTA 3W6OA 5ARBA 5HNKA 4RTNA 3KX2A 2C1EA 1DC5A 3DE7X 1JLLA 1J06A 1UFVA 2A57A 4U2CA 4WBSA 3UHJA 1TA4A 2WOOA 1I7SB 1J8DA 2PZEA 5DN9A 3IJPA 2OOSA 4J7XA 5ALUA 5DTIA 5JS2A 4NEGA 3GAAA 2DWQA 3JZAA 5KYXB 3ZU3A 5EXSA 4ATNA 4EVSA 5K7SA 4GLFA 1PS9A 2FPIB 2Z2XA 2DT5A 4N0QA 4XCVA 5BW4A 2F8SA 2ZXFA 5BWNA 1EA5A 4M36A 3K1ZA 1Z74A 5T8KC 4EO4A 1FRFS 3GLHE 3HCOA 1UKCA 4KQIA 3PX7A 1XMXA 1WCIA 3WWDA 3P9RA 4IYJA 4HNAB 3TOXA 4DWVA 3A1EA 1KDRA 1N9GB 3N6VA 4L5JA 5BSWA 2YIMA 3EVEA 3TAUA 2JBHA 3T38A 1V3VA 4I46A 1Q1EA 1V1MB 4BX0A 2PQ0A 2ZEJA 4R84A 5AM4A 4OLHA 5BSMA 4CKCA 5J2UB 1BHO1 1PZXA 2PA0A 3FMOB 3WLSA 2BHNA 1P0FA 4I2NA 1X7WA 4JJIA 3ZBTA 1Z26A 3P1JA 1RT9A 5J9FA 1ZUWA 2C2YA 4K88A 1DX9A 1E94E 4KMOA 4KO4S 4LXGA 3UG6A 3UQZA 2JLUA 3W8DA 1GLNA 3KLPX 4GX2A 4YQFA 2G7ZA 1ANKA 1HSZA 3IQFA 1KSJA 1MPXA 4RULA 2A0WA 1RPJA 1Z5VA 4OEHA 3P2EA 3KTAA 13PKA 3BIXA 1D0IA 3IV7A 3REQA 5HDBB 2YOHA 4CMEA 3PQEA 2QNIA 3R3WA 3K0EA 3R0ZA 4JP5A 1W2GA 3UB4A 4W5RA 4JV5B 2EV9A 1YQGA 2B83A 1DAOA 3S99A 3UJ7A 4WZAB 3WYCA 1RSZA 2IEGA 2MR5A 3PGKA 4H7DA 3DDWA 4OTZA 2ZG6A 1X7XA 5A1TA 5CB4B 5JNUA 3FRIA 1FYDA 4IUYA 1PV1A 1XAHA 1Z0FA 3KQWA 2C5SA 2C98A 3PWKA 4LY3A 4QX6A 4ZCIA 3TSYA 3REGA 3AR9A 3QUTA 2CJYA 4P81A 3RAPR 5REQA 1FFEA 2QAJA 2WFLB 4Q3NA 4DGQA 3JQPA 3MWEA 3AX6A 3OBIA 1VIVA 1Z2AA 2Q9AA 1Z6YA 3LYLA 5TPWB 3I5UA 4BEBA 3PHGA 4IJ5A 5JYEA 5DT9A 4KHPB 4IJVA 1NAIA 2H54A 3C3BA 3D0KA 1GQRA 1J5PA 3BB1A 5JWOA 1TQHA 5C7YA 3OTGA 4DM4A 5LQJA 4WNAB 2O2IA 2DUWA 1O7JA 2QE6A 3EIHA 3KEFA 4FGWA 1JFRA 5E95A 5EXXA 4E11A 1OI2A 1WX1A 2ATIA 1JVSA 5EEHA 3UCXA 1ZGHA 5BN1A 3IHKA 2KW5A 4OHPA 2GZ1A 5MN4A 4Y2PA 5L3SA 5KBYA 4MWBA 3QEBZ 1DG9A 2E3JA 2VXYA 3B8EA 1H5QA 4FCTA 4OLJA 4QE3A 4B6JA 3CLSD 2RJ3A 4V3CA 1L7PA 4C3VA 3R7WB 1POWA 5ILOA 2ZJ8A 2V4MA 4LNUB 3U40A 3G5LA 4ZI3A 2ZSIA 5AW5A 1ONNA 1LBHA 1VBKA 1E5QA 2X9QA 4KE8A 1SXJD 5K4AA 4DRXB 4KV9A 4A91A 1HYBA 4F92B 2YINC 3A6DA 3JD4A 4FS3A 2NZJA 3AUKA 5ALFA 3VAAA 4EZBA 1N7HA 1Z2EA 3W9SA 1N2EA 1QNFA 2P91A 3BWEA 4C6RA 2J5KA 3V8NA 3JYOA 4FIDA 4G2NA 4EKEA 3TKYA 4YCSA 3OEYA 2P2LA 4JJ8A 3X44A 2VF2A 2X8AA 3LKZA 4BNJA 4E07A 1YQEA 16PKA 1HE2A 1HV8A 2XY4A 4K7JA 1E3WA 3BXHA 3TLYA 2WIAA 2ID8A 1X7HA 4WE3A 5IANA 5FHQA 2PFSA 3W5CA 4LZWA 4Y6RA 5EWLB 4B7AA 5FUWA 2B35A 3GJZA 4JI1B 5AFSA 5I4IA 3HDHA 4IIYA 1UANA 1TKCA 4MWDA 4BASA 2Y1GA 3WIDA 4BNTA 2FPPB 1PTJA 4LDRA 1J0XO 4I1YA 4V2UA 1XZLA 2D74A 2B8JA 2RSLA 4OU5A 4X7BA 1EXVA 3WS7A 3AKCA 4RQBA 1HPLA 1DAMA 2CFCA 4WEOA 4R71A 3R3HA 4DCTA 1LFDB 1Z16A 2F67A 3QYJA 4DXAA 5JCOC 2MSEB 3ZI4A 1E9VA 4XTCS 2QD1A 1NVVQ 5DXFA 1F3LA 2VZEA 3DTNA 1TIBA 1YB4A 2XNKA 4FYXA 5TMBA 1H23A 2D8MA 4QDJA 1OXUA 2VVTA 3EVZA 5ILGA 5JROA 2HUPA 3ZXSA 3K2EA 4ISBA 4MW7A 2AUMA 3I9KA 5BOSA 5IX8A 3LKVA 1XT6A 2RD2A 1SAYA 1H2ZA 3QKSA 4XB6B 1BHQ1 3I4CA 5A6SA 4IJMA 5H7XA 1IE3A 4RVHA 4GR5A 3T4UA 4RDHA 2IGBA 3DBRB 2GM4A 4AWAA 3VNBA 2C5FA 2VJPA 4P3OA 3HV0A 4ZAZA 4RMJA 1TAGA 3M3DA 3U9TA 3BFPA 3SQXA 2XKAA 2C9ZA 3IT3A 1R6TA 1JLHA 1GNLA 2PAFA 5A05A 5KZMB 5AOAA 1UBEA 4EZIA 3EMKA 3ZQUA 4DSZA 3RUHA 3KBOA 1WDWB 1RZ3A 2GBPA 4ZHSA 3CY6A 5L4NA 4GP6A 3OM0A 4XPZA 2IY9A 4O0MA 2FMUA 2GAJA 2G08A 1DL5A 1P60A 2X13A 3EXIB 3EYWA 3I8XA 2HADA 4KIGA 4AN4A 4OFZA 3DHNA 2MYUA 2X42A 2LDBA 2FUG1 3CZ5A 2QRUA 3L43A 4D0RA 1VPWA 3PLAE 4YMSA 3ROMA 3LA6A 1R50A 4G1BA 4L16A 2Z6AA 2WPNA 3D8BA 3M70A 4OFXA 4OY3A 3ZJYA 2J45A 3PXEA 5FLEX 3TQQA 3IEXA 3INNA 3PZBA 1W0KD 3E2MA 2R6FA 3VISA 3I64A 2N3ZA 4MMXB 4QQNA 1XBTA 2X8WA 1WV0A 4MQLA 5EN4A 3WDSA 4ASUD 4LCBA 1GFZA 3H5NA 2ZJOA 4BIIA 1OYOA 1EP3B 2PSEA 3BXGA 3D3WA 4DT1A 2M98A 4BFXA 5LMCA 3DZ8A 3HKEB 3NOQA 5CITA 1M67A 1ZU5A 2XIJA 3FNHA 4Q00A 3X43A 1T2EA 3AZOA 3T3IA 2IU3A 3IOEA 3OWOA 5G0SA 3U19A 2I6UA 2VQEB 1PEDA 4M89A 1TLFA 2LWIA 1CRPA 2BTOA 1JG3A 4B3FX 3L6UA 2R96A 3GIWA 1W4CA 5K6AC 1SHZA 2QYOA 1G17A 3D4LA 3I1YA 3JYQA 3MJRA 1PV2A 2WF8A 4ZT7A 1J8FA 4U7TB 5CH3A 1W8DA 2PIAA 2ZBVA 3HEAA 3L9WA 1GG8A 1L5LA 5IJZA 1GD1O 2W00A 3WQHA 2FGKA 5CVUA 4C5BA 3SC6A 2XCLA 3FPJA 5AM5A 3T95A 4EVIA 2HF2A 2REOA 1B8OA 4JK3A 1OLXA 3DL2A 4MPDA 4PYMA 4YP6A 1KVUA 5AOVA 2CL6X 1EAMA 1S2NA 2I71A 3R5XA 3ZD7A 5IASA 4RVDA 4QYIB 5E8RA 1DELA 1K5PA 1L7RA 2IHJA 2M2IA 2DFLA 1H0RA 2G0AA 4IMRA 1CRLA 3B1KA 4RZQA 3EMDA 1XRNA 3RK4A 4LW8A 1M74A 2WJVA 3LQRA 3AUUA 4MS4A 4UUAA 4UTPA 1CY2A 4NVRA 2FFQA 4W1RA 3LP8A 1N5OX 2AOWA 3MK31 2VNHA 5EZSA 1NRJB 2GO1A 1GVHA 4AJHA 2VJNA 1OH5A 2B1QA 1ZM4A 1TZ2A 1M0EA 3I1FA 2OWDA 3BXEA 5AJVB 2OM6A 4XX0B 1R7RA 1T5TA 5F1OA 1RWVA 4TMKA 3V4SA 4ETMA 5I9LA 4EI7A 2YWDA 1LJLA 2YIDA 3I9LA 4JLNA 5JALA 3PEUA 4YPOA 4QG7A 1KWKA 3IO5A 1RI3A 1T5LA 4A5SA 2NNLD 2MHCA 1N2IA 3M9LA 2OYCA 1ML3A 2QA5A 721PA 4CN9A 3FZEA 2HXGA 1W6RA 1GPBA 1QV9A 4N0EA 2P2ZA 3JQ9C 5FWNA 3H97A 4CLRB 2P11A 4GOND 1Q11A 1EDOA 1UBGA 5HWSA 4YGXB 4L4UA 3IDSA 2P4SA 4JBHA 4LZAA 5LXTA 1KYZA 3IKLA 5EMJA 2X5XA 3OKAA 3AVQA 4IIUA 4FGJA 2JZOA 4G8JA 1ZIDA 2P9TA 1QWOA 4UATA 1SUCA 5EMNA 4ZC1A 4LK2A 2WP8J 5K0NA 5E6RB 7YASA 3IEVA 1Q0RA 1LSUA 1FW8A 3QJGA 3WFZA 1Y5RA 2W83A 2WJAA 1GEEA 5G0VA 2FOLA 3I32A 4OMDA 1V25A 3SZLA 3QVKA 4B7CA 4BBZA 4KOEC 3ED5A 3KYCA 2EX4A 2J31A 3ETLA 4H3KB 3PUXA 4YB8A 1SEVA 2Q8QA 5A2GA 2B61A 2EJTA 3NHAA 2FN4A 3BFVA 1YD7A 4IRXA 2FWRA 4L8YA 4LWQA 4P33A 5BUSA 3B3JA 3K4PA 1BVUA 4RTSA 4B35A 1RACA 4WFJA 1JYEA 3EJ6A 3G17A 4J0DA 1C9MA 2IRWA 1ZZEA 3KSZO 4R41A 4QPPA 4XQ9A 4B32A 3G6WA 3MFQA 3OFNA 3QWBA 3GLTA 3KPVA 3ND9A 4AFNA 4F2PA 1NVMB 3PNVA 1XYYA 4TMZA 4Q4HB 2WAYA 1R9NA 1M6NA 2X76A 1BDMA 3OIDA 4RLHA 1DX6A 3SZOA 3I2YX 4TM8A 4YGYA 1HK7A 3EMVA 3COVA 4IX1A 4G23A 1SC3A 1BU5A 1T2NA 2AIRA 2IHZA 3MQ4A 3QLVC 4J91A 1P0QA 3WLHA 3GP8A 3ZLJA 1WVIA 3EC2A 2AQ8A 2PWZA 1R0LA 1SCNE 2Z3VA 3OI7A 5IXSA 4DV1B 3AT1A 3NHSA 5F98A 1YR1A 3O90A 4IPTA 5F2OA 3LTEA 4MUXA 3ZV5A 3OZDA 1W35A 1DXYA 4PVDA 2GNPA 3OO1A 5MFPA 1QLJA 5DNDA 1D4ZA 1YVEI 2PKXA 4G5RA 2CDNA 5D1NA 5DCUA 4F1JA 1TD1A 2YY7A 4IWNA 1AZTA 2BMAA 2NV6A 3ICOA 4UTRA 1CIVA 1P62B 4QKQA 3GDHA 3Q98A 4DC0A 3OOSA 3O73A 3VVMA 3DMGA 3I6MA 3P0HA 3IQEA 2DFPA 3AFIA 4IEIA 3SHQA 2PG3A 2W2LD 1RRGA 1W4BA 1ZMTA 4OUDB 3ZHBA 4EDFA 2BDEA 2QM3A 1T3TA 3E84A 1P1IA 1KYVA 2BRUC 2YWXA 2AKAB 4LEIA 3L6BA 4ND8B 3UNXA 1JHQA 3KFLA 4FXPA 1TU4A 3TFOA 1A2QA 4GXQA 4JQOA 3ZCRA 2AOUB 3KZXA 2UYCA 4GIBA 4XVUA 4Z51A 1X80B 1XF1A 1QANA 2C7BA 2OAQ1 2OZPA 2C2OA 3BF7A 4BRWA 2C77A 1PT8A 3QPAA 4N1AA 4OXXA 4QOJA 4CCWA 2B1JA 4UBJA 3CLTD 4FQ5A 4K9SA 3RNLA 2Z58A 3UMGA 3VH4A 4OP2A 2ZRDA 2OSVA 4DZZA 1Q2XA 4O6VA 3JVVA 5THXA 2ZDHA 3N1UA 3ZGVA 4BDSA 3GBPA 1T8PA 4DIDA 2FY8A 4YJGA 3NM6B 3MUOA 5FI0B 1CZRA 221PA 3D59A 4JYBA 5JC8A 3VU1A 1RQPA 5H02A 1KAOA 1ESMA 2I8LA 2X4GA 3K9HA 4J4HA 3SXUA 2YTZA 2WIJA 2ZR7A 5DB4A 3SLGA 1YS7A 4DRYA 3PXAA 5FLXA 3JD0A 1QPZA 3R23A 2XXBA 1W34A 1GTZA 2PXAA 2ZSHA 3C7DB 4FILA 5E9WA 2ATVA 5GJCA 3KSMA 2O3UA 3F6RA 2GFQA 3FJOA 3K9GA 2P6MA 3GZNB 2QU7A 4O1IA 1H4QA 1OX6A 4K8RB 2Q3CA 4D26A 2PYIA 3EW7A 5E4TA 2P6OA 2PZFA 2J48A 3N8GA 4KYVA 2BMFA 1KI6B 3OP1A 3QYFA 1IYZA 2ZE6A 3E3NA 1S3SA 2C7RA 3VV3A 3HXMA 3LGAA 2XA1A 5A7GA 5DBHX 4W1PA 1U0OC 4RPHA 3W34A 3QVLA 4UTOA 1RFLA 1RAEA 1I1HA 4MYTA 4OIFA 1E60A 1V1RB 2VHVA 821PA 1QAQA 4M0MA 2PU5A 1PJCA 3T9AA 1L8AA 2IV7A 2I4LA 4A8JB 2QE7A 3CNHA 5HQ3B 4ZQBA 2OCBA 2GBFA 3T9EA 4R6WA 1E1CA 1I6KA 2G9RA 3Q2OA 1SCIA 3V8BA 1L9XA 5J58A 4EPVA 4YNBA 1G0NA 1Y1TA 2DWPA 4JR0A 3ZVLA 4QM6A 4UE2A 4EY4A 3U4AA 1HETA 2MINA 3AF5A 4XIYA 5IJAA 1NPDA 4F21A 1ZGZA 1EP9A 1PWEA 1ZH6A 3FUXA 3FSJX 4GT1A 4K9DA 4PAWA 5BSRA 4CJXA 5EJ5A 2OCPA 3PFHA 2W42A 5C1DA 3GDOA 1I24A 3GDGA 4LQLA 4HGNA 1ILEA 1V35A 1X7YA 3TUZC 2UYQA 4RSRA 4D9GA 3EQ9A 4GWKA 1MQ9A 2PUAA 1CY1A 4GX0A 3D9QX 1AUVA 4KBGA 3DR3A 4HWRA 5EHQA 4YP9A 1LPPA 1DKUA 2D7JA 3H7IA 1HURA 3HJGA 4WKGA 5DI3A 3ZHUA 5AUOB 3PG5A 1Y1SA 3ICCA 1F4LA 3GMIA 1QHEA 4NMLA 5ULLA 2A5FA 4Z1MD 4ZARA 1EUDB 5C51B 1C2YA 2A3RA 1GPMA 5IMSA 4MNTA 4W7IA 2B78A 2VZLA 3GGGA 4JLJA 3WYDA 2NUPB 4ZREA 3AU8A 3HNRA 3DEZA 3FCOA 3HJBA 3FXAA 1I36A 4UBNA 1ZNYA 1E66A 1IBCA 3FKSD 5IRCD 2ZJ7A 4J0IA 2Q5EA 3RVBA 1L8LA 1NKTA 4EMBA 3P5SA 5GM2A 2CDCA 4BLTA 2FWNA 5JCJA 1SG0A 4QYMA 1LD3A 3RODA 3L06A 4C22A 1D8TA 2ORED 2X3FA 4IEEA 1JEYB 1D9ZA 3LVRE 1K92A 4JOCA 4CMEC 1WP4A 2QL5A 1OX4A 4QOGA 4G6ZA 3B12A 4UCXA 3VO2A 2JEZA 3CCFA 2XX3A 1EINA 3UJ9A 1NJ8A 1QUFA 3T4XA 4LVNA 4BU1A 1ENYA 3AHEA 3Q15C 1JGTA 3H4TA 1Q7EA 2IUUA 1GPJA 1RPTA 2UV8A 4MUFA 4Z0HO 1QOQB 2PKCA 3CA8A 3CRMA 3QVGB 1KSGA 3DHEA 4CM1A 2P9CA 2JJ2A 2O7NA 1CUFA 1T8RA 3QJ5A 4NMXB 1OXKB 2C2GA 3WGOA 3J81A 3H11A 4H17A 1FP4B 1T15A 4LMAA 3D6UA 5HIAA 5ALNA 4FCVA 4F4IA 1CDOA 1M0SA 4E0BA 3PXUA 1Z3CA 2QPLA 1M33A 2WTEA 3VR0A 3MWKA 4WCFA 1B00A 2FE4A 1VE6A 1PL0A 4BWVA 4EG7A 4U6QA 2DFKB 3L92A 3O4IA 4CMIB 3GA0A 4BGVA 5JOQA 1KFJB 5ITVA 1RYNA 3IT2A 5D7BA 4YREA 2R47A 3P2JA 5F9MA 2AN3A 3KHUA 1U0FA 1ZH8A 3IPLA 3NRCA 4C9BA 1FFHA 1SKBA 2PFKA 4O4JA 3L7IA 4OB6A 3P2MA 5BWMA 5BYBA 4G4IA 4ENRA 3C0KA 4ETIA 1IULA 3ZHOA 2FW8A 1AMOA 4O2BA 2ZWAA 3C3MA 1V43A 2QJRA 2E7ZA 1HI9A 4X00A 5HUJA 3K6SA 1WU8A 3HCPA 3PIRA 3DAOA 1K4YA 3DP7A 4HDSB 3U7FB 1D6JA 1CUSA 2FCAA 3KPJA 3QVWA 4F46A 5KSWB 4D99A 4AJ2A 4S04A 1Z7YA 1Z6ZA 1MJFA 4XLZA 3M9WA 1Q1AA 3CIOA 4KMMA 2H4FA 2WM8A 4ND4A 1EGQA 1L4YA 1I2DA 1MGPA 1LBSA 3V7WA 3BBLA 1QGOA 2EX0A 3ZWYA 4WOBA 5EGSA 3ZXYA 4PCUA 2BMDA 4LSZA 3AFNA 2LV8A 5K3AA 4RTQA 4AUNA 3H9JA 3VJKA 1ESDA 2C5BA 1NN3A 2GEJA 4ALIA 2PJZA 4PSDA 2G8LA 3NBKA 2QD4A 2Z2KA 5FO0A 1LBIA 2GK7A 1MXHA 2CD9A 2HXSA 2INGX 2YWJA 3ER6A 1ZS9A 3KVYA 3LPCA 2FP3A 3OSZA 5KOIA 2XRZA 2JGNA 2P77A 5ABPA 2XZLA 2HI0A 3HVRA 2RIPA 2H8KA 2GBIA 1XMSA 3S55A 1GEGA 1NUSA 2IOFK 2GJKA 4Y67A 1JJ7A 1PTJC 1THMA 1WQ1R 3COWA 4R8RA 3FPHA 4Q34A 4M9SA 4TVBA 4XSVA 3VKFA 4MHOA 5CX4A 3KALA 1PS8A 3TZBA 1A1VA 2V74B 2Z4SA 2B1IA 1I14A 3EEOA 1B3RA 1J8VA 4LRXA 4UEWA 4AJLA 3P9YA 4Z4EA 2B82A 4PAOA 3GUUA 2PKRA 5E4JA 2VPWA 1ZAYA 2CZCA 2EJBA 3AM1A 3VI4B 1TD9A 2B34A 4RORA 4TMWA 2I2CA 3V1MA 2W93A 5C1OA 1PJRA 4AY4A 1XWWA 4DIFA 5IKMA 2GEVA 3I37X 4YECA 4CLHA 3GAZA 4Q7QA 3AG6A 3FR8A 1X77A 1BJKA 4BTEA 1ZHOA 1SQSA 4J0EA 5L7YA 1N2XA 3ELWA 3F2IA 3T1OA 3ZHXA 3MTIA 1XQVA 2SKCA 2XTZA 1KEVA 2PRSA 2E0IA 3GJ4A 1TW3A 1SXGA 2PUTA 1H85A 3GUCA 3OE7A 4PYRA 4M60A 4RZXA 5CHEA 4RHUA 2WDZA 4ZOBA 1KHHA 1VJRA 4LXHA 4IINA 4YT2A 2IDZA 2YXBA 4HC4A 2XOKA 1O0SA 3ORQA 4IHQA 5EE3A 3UWKA 3PUIA 3RRMA 4CMBA 4V03A 5JSUA 3GLGE 3VR5H 3IV6A 4U9IS 1EX1A 3VYRB 3KNZA 2IS2A 2EX1A 3OJXA 5ICGA 4JL5A 1M34A 1DCTA 4FR0A 4URZR 4IHAA 1F8GA 5FLKA 4BVJA 1RXIA 4CQMA 3C8HA 2HPVA 3QLEA 5F52A 4LYDA 2BHLA 3MCAA 4QOIA 1N5LA 4QTUB 1G98A 4PC6A 3WLPA 1H3EA 4BNMA 4UHDA 4BO0A 4N18A 2NG1A 3GP3A 2E5WA 4NYIR 4RELA 4XAQA 3U16A 5FUXA 2GEBA 1DMSA 3PDJA 3M4JA 3OECA 3H3FA 3ZDRA 3GA7A 4ZYVA 3HG7A 2A7QA 3GAMA 5CVCA 1MX5A 4B3BA 1WB9A 1AM4D 1FLAA 2Y4OA 4J76A 4E2FA 4G67A 1Y3HA 2BV3A 2G71A 4YYEA 4KJXA 3EXFA 4X63A 3TZEA 2P6NA 2AJ8A 3SMQA 3FYUA 3LXMA 1AHNA 1R3DA 5CD1A 1J25A 5BXYA 2R0QC 1G38A 1DRKA 2PLAA 3K92A 3QXCA 4L0DA 4LHEA 5EJ8A 2ZUDA 3S5JA 3UK0A 1A2OA 4PU0A 3RVQA 1GZVA 2X0RA 1OXBB 4AIRA 3LHFA 5KQSA 9GPBA 1M10A 1U0TA 2PAAA 5SZHB 4XFJA 1B23P 3QE0A 1J09A 4ACAA 2UUAB 2A9RA 3DZDA 1QS0A 4GRAA 5GOZA 3E9EA 1SVIA 1ZO8A 4DDMA 3ZDBA 5KOYA 2OQVA 2OK7A 4NXNB 3PC6A 4KNVA 1TLLA 5JXHA 1SXQA 2W43A 2BR4A 3MELA 4Z7JA 2IYTA 4ROSA 4B6EA 2GH1A 2O4CA 2W4IA 2FMKA 3OKFA 3D7SA 2BJWA 4MP3A 3TTSA 4E5NA 2IYNA 4JLUA 1SVUA 2YMLA 1XRRA 1DIHA 4OM7A 5C5CA 4P0PB 4EB3A 1E6CA 5JBQA 3U7HB 3PFBA 5FA5A 3IUJA 1QH0A 3VH1A 2BEVA 1NVWQ 2J3QA 4CV1A 4DSNA 3C5HA 1RZRD 4KAAA 3O9MA 1OLSA 1E89A 2NUAB 2ENUA 1PNOA 3EE6A 4QU5A 5G0WA 3HCCA 3Q72A 3AV0B 3H9UA 5CT4A 5IULC 1CBUA 2WU4A 2WF7A 3V32A 4D8WA 2ZRLA 4YUWA 5ED0A 4Z3DA 1TGVA 3UCFA 3AZQA 4OI2A 3FIUA 3FWKA 4XB2A 1JZTA 3A10A 4HDRA 1N4AA 4D9JA 5LP6F 1TADA 5EFZA 1KVTA 2R11A 2VWPA 3B7WA 1PZGA 2JI6A 2QLLA 2Y0DA 3C3AA 3FMPB 3LHKA 2MMGA 5LCXA 3NDPA 4IGKA 3OCJA 5AVZA 2Y1KA 4C88A 1EE1A 1JFFB 1T5HX 2GJ9A 1SCUB 3C14C 3LT4A 4NK5A 2EG5A 4O2AF 1W5BA 3E2IA 4GI7A 4BEWA 1EESA 1OC4A 3SSOA 1JSXA 4F2DA 4NPAA 1XQWA 1EFRD 1WPQA 4H3VA 5HM6A 4GZ6A 2DLCX 5FD8A 2I7DA 3EIEA 3GGPA 3UOGA 4TRRA 2CKDA 4FYVA 4RENA 3D31A 3V8PA 4NBVA 1LTQA 1K6EA 1P8JA 2L0XA 5AIAA 3EUAA 3QEAZ 4B80A 2F3PA 2WHYA 2O23A 4UD6A 3MNFA 3T7TA 1TOAA 2XNHA 3F8TA 1D9XA 1MC8A 4KFTA 1FDIA 3BTSA 1NJ2A 1OHHD 2J3JA 1LRLA 2RGDA 2OAEA 2PWAA 3T5PA 1JFTA 1YMVA 4Y2RA 1H6DA 1GTSA 2QBYB 2XBUA 5F7JA 2C4KA 3TMKA 2ZB8A 2K4MA 2WKQA 2XCQA 1ISHA 2JIRA 5KNBD 3I2IA 2R8YA 4AG3A 1U1GA 1PZFA 4QBHA 1IHUA 1F5NA 5CVVA 3S4YA 1XVTA 1Z6TA 4DR6B 2C97A 4AJKA 1J6UA 1KFKB 1ZGAA 4OHZA 3VV2A 5I7HA 1TVCA 1DKOA 4R3WA 3RYHA 1SBHA 5D84A 5ICCA 1WBJB 3MM4A 2WZBA 1CY0A 3QTLA 3WZMA 4YACA 5DZSA 4LOHA 2PSFA 1T9CA 1AOXA 1GSOA 3EG9B 1RQ2A 3MSXA 3BXZA 3IBYA 3N76A 1GPAA 1ZN9A 3II6X 5HKBA 3LDAA 1JIXA 4EAAA 1VCMA 4BO9A 1TUBB 4MKIA 3KJNA 4ODIA 3T6KA 3N75A 3UPTA 4N76A 5BNTA 5F7OA 2H00A 2V7QD 2ZUCA 4X0EA 1F7UA 3HA2A 2O54A 2HMYB 3CT6A 1FQOA 3N3AC 5I45A 5AKKA 4TRJA 3G79A 5D3MB 1E1RD 3NOVA 2EKPA 1EFLA 3LTNC 2BCJQ 3OIVA 3X1XA 3JYPA 4YCBA 1QRUA 3AF4A 5FFMA 2IHYA 5EXTA 3UJ6A 5L4SA 3L0CA 3DQPA 5IXJA 1E0KA 2XMGA 2Q0QA 1QZUA 3PHLA 4HDKA 4NARA 1U0RA 4WK2B 2ON6A 4BLUA 4O1HA 3AR7A 3DE0X 3OM1A 4I1OA 4JI7B 5KYKA 4QWWA 3JALA 2GXSA 3V4RA 3R5KA 3K53A 2CV1A 1LPAB 1E2NA 3T0GA 1M8GA 3W6UA 3GRUA 1V8OA 3FYCA 4NCJA 5JAMA 5AI9A 3T3OA 3K94A 5EVCA 1A71A 2ZE8A 1TM1E 2GCOB 4G8DA 2CNNA 1IZ0A 1LB1B 1OW3B 2GRJA 4YJ2B 3LUGA 3X3HA 3IHWA 1E4OA 1RXCA 5CX1A 4ND2A 1YH3A 3U7JA 1KBZA 5IM4F 3F6SA 3LXXA 4TWIA 1PS0A 1ZJZA 4I8XA 2HQOA 2DR3A 4I9UA 3DPSA 3RWBA 1P6XA 5I8PA 1PEKE 5FEUA 5KVSA 2EWVA 5AVSA 4Q1DA 1FXSA 2JLCA 2BW0A 2XITA 5G0TA 1GR1A 1A8PA 3HA5A 1XDUA 4RSGA 5ICSA 3SVTA 1N3IA 2DBZA 3SEAA 1KIAA 1OXXK 5E4FA 2C2MA 1JKFA 2FEAA 1JSRA 3W9BA 1ZSVA 3ZDAA 4RA9B 3F3KA 4YAFA 1JG1A 4JLMA 5CEEA 5L7WA 4PS1A 3C97A 1T6ZA 1H05A 2C8KA 2O2XA 3NFRA 4Z0NA 2XA2A 3GJ8A 4LTDA 4OJTA 2WWRA 1DHRA 3BWDD 4AECA 3BTVA 3D43A 1HLFA 2ZZKA 4QPCA 4YP0A 5DYWA 3X0DA 4AMZA 2ERCA 4PAMA 4X62B 1WZEA 3LQ1A 2VSNA 2VDPB 2VDMB 1GFSA 2NMVA 4A3SA 4K81B 4ZK2A 4WZBB 4TTSA 5LD2B 1OIVA 5AVWA 1H2WA 1N8SA 3GP5A 2H16A 2DWCA 3ZNPA 3NTRA 2CDRA 4IBOA 1IVNA 4KQFA 4XQCA 3EVGA 4P08A 3IHTA 4YFVA 2D2IA 3ZXXA 3AUYA 3G49A 3RQIA 4M37A 1AZSC 4RKRA 3T3HA 4GRIA 3TOCA 1CJCA 4EYKA 1B8VA 4UDXX 1SKMA 1P4AA 2QTCA 2IUYA 2VDWA 2F17A 1CP3A 1M2OB 4KV7A 4N5DA 4DRZA 3IBCA 2ZRBA 4HRYA 3AUFA 4M1WA 2Q50A 1HYEA 5BVGA 10MHA 3B36A 3QK7A 4JBNA 4WASA 4YROA 2PMEA 1EWKA 2WUFA 2PVCA 4Q7JB 2G28A 4IOLA 4CQLA 2RI6A 2JEYA 2IPOA 3NG1A 1NVDA 4PAGA 1YRYE 3WWZA 1XLUA 1XA3A 4XB1A 1NN0A 5EIBD 2WQZA 4CF7A 3BGVA 3AL2A 3F9CA 1C0EA 1JQBA 1CFJA 2XGOA 3H17A 4A2CA 2BF4A 4ETNA 2PHZA 4OU4A 3E1KA 3EFEA 3VH3A 4FZRA 1P2TA 1RMTA 2R8XA 3IUYA 4HDMB 3RC1A 1GCUA 4DAOA 3L0SA 2WZDA 4EPYA 4C76A 1R4MA 5IUKC 1XTBA 5K3DA 1N5IA 2V8BA 4DBLC 3MJEA 3H75A 4N49A 4BEJA 2C5HA 4KWHA 5HTOA 2JVJA 2WUWE 1Q44A 1Y63A 1XP5A 3HBMA 3RT9A 4B4VA 1JQLB 2Q3HA 3IQHX 3I3SR 1E8NA 4EGCB 5TDHA 1F8XA 1F8UA 3A28A 1VLHA 3E0XA 2ZIVB 4FQ7A 4RZSA 4S1VA 3GGJA 3DLAA 3LDHA 3G8CA 1PX0A 4WLFA 4MV0A 4A15A 1NJ5A 4YVFA 4UAGA 3ZZNA 4BE7B 3PNSA 3FHOA 2HB6A 2VJBA 5F2NA 1EDEA 4DR1B 3L8HA 3OOEA 2V6FA 1WQ4A 2H65A 4V0NA 1GLVA 1QO9A 1PT5A 4HNRA 1A5BB 2WSSA 4NJMB 5DYIA 3BQ9A 3NZEA 5KQMA 4QOFA 2V0GA 1A2BA 1KMHB 5G2OA 3ZX5A 3SC3A 5AKEA 3ZJ4A 2QOEA 1A50B 2P69A 3LWDA 1TU0A 1U0SY 3OLXA 3AEKB 3D8SA 3TGPA 3N58A 1E9EA 5CFLA 1YR6A 2IPMA 2BH9A 1EFHA 4E12A 3K4HA 3W2HA 3TK1A 4FGZA 4B81A 5J2UA 2AYYA 2JAQA 1I7QB 4ARIA 3NV7A 2FG6C 3W6NA 4WN9A 3EA5A 5CDSA 4B46A 4KO1S 4LYYA 1X1CA 3R9XA 4H7EA 2DMRA 2PZAA 1TZBA 5CYOA 5K3SA 1ZL0A 3M6FA 4EG3A 5KCZA 1QYCA 1XKLA 2O7RA 4OF4A 3WB2A 4WOKA 1PGPA 2E37A 3KT6A 5JLAA 1F7VA 2ZDGA 3C15C 4HB0A 3LI2A 2R7NA 4AZTA 4ERNA 4TKUA 2BTQB 2GM5A 2GXQA 2QV0A 1R4AA 1U2DA 2VNIA 3G89A 2DLDA 3GT0A 3KQHA 1KC3A 1QM5A 3JVEA 2C4NA 4KYTA 2BH2A 1WRBA 2RJNA 3EB9A 2CL7X 4MVJP 5CDUA 5GZ6A 2BUCA 5EJFA 1NQVA 3DW3X 4CZ2A 1M2FA 3DL4A 4QUGA 1THGA 2KB0A 2AD1A 1U7XA 2VBIA 3BIJA 3G9TA 1UZAA 3LUPA 4D0NA 1ORWA 2ZI5A 3HR4A 1YWGO 4QUHA 5HJ2A 2VA8A 5TX7A 2RBGA 1MZVA 1H2XA 5IMBA 2IZ1A 5GV7A 5JXGA 3GVCA 1TCVA 2IYAA 3LBYA 1Z63A 2CV2A 4N01A 4WACA 4KHZA 3RB8A 4R7TA 3UPUA 1SXJE 1U7DA 2X5JO 3WMFA 3EWAA 5EJ7A 4OAPA 3FUVA 3D6AA 1YZUA 4E09A 3DMDA 4UVEA 3PS9A 1O95A 1U02A 2JIZA 2IZ6A 4XFDA 4ZCPA 2C4VA 4Y2GA 1UWVA 5JE8A 3I04A 1N7GA 3UEOA 1YHZA 3OZAA 2DRIA 5E0KB 4ZJUA 2V03A 5ITZB 3VU3A 4EGFA 1GPH1 1OAAA 2AOTB 4C0HA 2HRZA 1WE2A 1MQAA 3IQGX 2O1SA 3AJDA 3INTA 1GNQA 4TN5A 1IPEA 3L4JA 5DX8A 1ZXXA 2QUZA 1V8ZA 2Z98A 3CZAA 2OM2A 3W04A 4R68A 3FOBA 3IUMA 4EITA 4UHCA 1K7XB 2XB4A 1P5FA 1QQTA 3D8UA 4G0XA 3OEWA 4IDOA 4JJGA 3RJTA 3F3MA 3RV3A 3L7DA 3S2GA 2OR3A 2QZJA 4Q82A 4LRTB 1BE1A 3ZWXA 1U3TA 4DRXA 5LQNA 3TIXB 3W4KA 3C85A 3E9CA 1JB9A 1E9FA 4IQ4A 1Q19A 4BXOB 4QUEA 2X6RA 1DJOA 3O8OA 4CDNA 2BFFA 1F5SA 4FMDF 1XG5A 1QG4A 1FFWA 2Z8XA 2DT8A 2IXBA 2Q5QA 2W4MA 3HYRA 3I1IA 3IQDB 4H7PA 4MR8A 1E6UA 1R4NB 2CXRA 2HPHA 2GJ4A 2QAGA 3BWMA 3LWNA 1XI2A 3N2KA 1RBZA 4CWAA 4IV5A 4HNUA 1I9GA 3D54D 4TKLA 1AU9A 3D2LA 3F46A 4GMGA 2ZS9A 5IKOA 3GEBA 1T8TA 4AO7A 4JUIA 3C43A 5KYGA 3RI3A 4AZSA 3SHOA 1DI0A 1IK6A 4L0CA 3KWMA 4GL2A 3PSHA 1P0PA 4E3ZA 4IZ6A 4CM5A 4YMVA 4XWAA 2NPOA 4KC0A 3NETA 5SY4A 3TRHA 3LPLA 5FPKA 1VCOA 1K7CA 3KZNA 4J2OA 2R2GA 2HNKA 2AB0A 2I5PO 2Y0BA 1OXSC 1EE9A 2KWIA 3P8ZA 4L3VA 5C4MA 4DQXA 1NI4A 1L3CA 1W1WA 4HG2A 4X3PA 3V5NA 3E7WA 4YWJA 1ULAA 3I5XA 1C1XB 3WGZA 1RXYA 4MUGA 2Y8EA 2YV2A 2QG6A 4BYMA 5FNVB 1VSVA 1SIWA 1EQAA 4L4ZA 1JKJB 2BKXA 4RMHA 3QW4B 2MSCB 1YQUA 3FYUC 4B83A 3B2QA 4W7HA 4FFNA 5CK4A 5I4CA 2O0MA 2X8JA 3T3PB 2DQKA 1TMGE 4TV8F 3R8FA 1RQGA 1I2CA 4RAQA 2JFWA 3STUA 2JFYA 2V7TA 3N0WA 5TE9A 1DIBA 1BTOA 2EZUA 3LO5A 4TMTA 5CMLA 1DX4A 3E35A 3JZDA 3VZSA 4B6GA 1IQUA 1P7CA 1UMBB 4RCVA 1W7AA 1UKEA 5FYDA 3JQDA 4LHSA 1W36C 2PV0A 2Q4EA 2IZ7A 5K51A 2FZGA 3NVKI 1FSPA 3NHLA 1T2VA 4UARA 1AKEA 1XEWX 1XQXA 2AJCA 3Q9NA 4Q3KA 4LYHA 4GGOA 4HADA 1RVV1 4KLAA 2QSZA 3SYMA 3KUDA 1IN6A 3DKKA 3G0CA 3DMHA 1WOMA 1EB9A 4QPJC 3SJZA 3VZRA 1LDYA 5DN6A 3VPBA 2NVBA 3W5BA 2D1TA 3NHWA 2FXVA 4DE5A 5U9CA 3WISA 1JH8A 2HEIA 1LBTA 4ZO6A 2CFSA 3GOHA 6ADHA 3UW3A 5C0OE 4EUFA 4M99A 1RQLA 3CNNA 1USGA 4YUYA 5DYGA 1V71A 1YBHA 2DAPA 2V0NA 4FVTA 4S12A 4E88A 3R5HA 1RXVA 2H2HA 3L01A 2PUEA 2VO1A 2CB0A 2XUAA 3DF7A 4ZVRA 2XXAA 1EIZA 1NR7A 1EDBA 3MVEA 1KEEA 1ADBA 3WQBA 4PSUA 2QD3A 3KU4A 3WRYA 4C87A 1BOFA 2G9NA 3ADOA 2YC2C 3EVAA 4MVJM 1D2AA 4N03A 3WDMA 2LTAA 3G0HA 1IJKA 3PJDA 3R5JA 1EYZA 1NVFA 3BDVA 1G60A 2OLJA 3N7TA 4D45A 5HS4A 1Z13A 5DGIA 2AH5A 5DEIA 4ESOA 4UTVA 1P1FA 2ESRA 2GPAA 1Y34E 3QKRB 3ENWA 1D0VA 1W75A 1EFUA 2AR9A 4ZAYA 1FDUA 5TF4A 3L18A 3PKIA 3ZQ6A 5LFAA 4LCEA 1A5AB 3ZBPA 1J21A 2CMGA 3QIAA 4J9UE 4NPHA 4CNQA 4D4LA 2XBLA 1Y8QA 4ZEVA 3VX4A 3WZ2A 3PITA 1NZJA 3AERA 1L1EA 1OYVA 3K3PA 3QX7A 1QAOA 5DBIA 5HSGA 4R1SA 1LTHR 4MUNA 1G21A 3OE5A 4DMMA 3IAAA 4BO4A 1RYYA 1COZA 4Q1VA 2DHEA 4YJKA 1NSTA 1XFDA 1Y3BE 3R0IA 1Q77A 3KZCA 5F3RA 2RHTA 2GDZA 2E21A 4MPRA 4UCQA 3R7AA 3WSWA 3WY9A 4ALMA 5DRTA 2OAGA 5MN5A 3IB3A 1QJ4A 3IOCA 4Q1AA 1KY5A 1NYTA 4E70A 3F5SA 3PRJA 5FBLB 2ABWA 1PNVA 2O7QA 5CFOA 1XZJA 3CX6A 4PRYA 1I51A 1TDJA 2BY4A 1KC1A 2ZTHA 3AKEA 3O9ZA 3BSWA 2OXIA 3U13A 1UL1X 2WAXA 2JK0A 3KPUA 3U3ZA 3UKDA 3PQ5A 2TYSB 4BBPA 4EVRA 1W1IA 3OP4A 1DBVO 3C3DA 2WYHA 3KAPA 3VR6D 4HQRA 2WWHA 3L8YA 1BOOA 1R10A 1HYGA 3BXXA 4NHEA 4RYDA 1RJWA 3U80A 4QJBA 3STWA 4HRXA 3UF0A 3M1IA 1FP6A 2W6JA 2X15A 4NYMQ 3AVWA 2ASEA 3BWBA 4G37A 3DEIA 4HFJA 1ZCZA 5DE3A 2FG7C 2PUHA 4GUAA 3C3PA 4NIMA 3ZE8A 3L0ZA 5AW1A 1KTVA 1U8FO 5ALMA 4ZPJA 3W1VA 4LRSB 4W9NA 3CRZA 2GKOA 1QSGA 5AVKA 3WMRA 4PR0A 2YN4A 4HAXA 1QVZA 5A06A 1ZW1A 3VHXA 2Q3BA 3IVRA 2DVMA 3KSUA 1OFIA 3R7SA 2MOKA 5L3ZA 5IT5A 3PX2A 1L7VC 4AZWA 3E48A 3QUQA 3B85A 3CZPA 2X1MA 4NABA 3FAZA 1XCMA 4R8KA 5GIPE 2XDQB 5EL0A 3T15A 3RTEA 5LB4A 3U7IA 4UUMA 3EH1A 1OH8A 2C1XA 4JLSA 1NHGA 2DTEA 2J0UA 1XDWA 3UT6A 4UNNA 4EM6A 3QX3A 1EZZA 5LQUA 1XZBA 1Z45A 3BHNA 4TS4A 3ROFA 1ZWLA 2FZLA 4QGGA 3D5EA 1JA9A 5FA8A 1Q0TA 4JHLA 4ZOQI 2J9FA 5CBPB 2UZAA 1OI4A 5DYYA 2P68A 2WIGA 3D8TA 5EJMA 3QMPA 2AXEA 5FOWA 2ONJA 2PXXA 1XNHA 2QZSA 4E94A 5A5VA 3JWJA 1BH2A 2CK3D 2NXEA 1GL7A 2HLDA 4RZ3A 1RTTA 1H0KA 4EKYA 1D6SA 4B9AA 3P19A 4CF6A 1FFCA 4C07A 2VKQA 2OHVA 4NV0A 3LP5A 3FLEA 3UA3A 3V4LA 3G2HA 1WSWA 4OA8A 3RC2A 2WKWA 3M6MD 1NFFA 2AQKA 1N2CE 1K8QA 2V6JA 1LV8A 4JT9A 3ZR4B 3G2OA 3ETGA 2HD4A 3OLYA 1V5IA 1WULS 2BFDB 4IX9A 4EY5A 3U44B 3AESA 3AFHA 1CNMA 3P0EA 3TQCA 2UKDA 3U61B 4PNZA 2HJGA 2O7SA 2W2QA 1KZ1A 1W2HA 3H5WA 1K3FA 3FOWA 3LBFA 3EEFA 1XVVA 3WWEA 1KOJA 4OVKA 4KNYA 4ZPXA 5ER6A 1GKYA 4K6GA 1WM1A 2FOIA 4B6SA 4I2VA 4V0QA 1FB5A 2QQFA 3EQ2A 4QUJA 3GOQA 4YQYA 4MR7A 2QRGA 3WNZA 1FFSA 2AE2A 4OL0A 4DA0A 3EPKA 1DP4A 2ZBPA 2ZJ4A 2ZU6A 4JFRA 4K05A 3TPCA 2M1XA 3WHPA 3GLHB 1UOOA 2FPGA 1QIKA 2V7EA 3OE4A 3QLTA 4YQEA 4Q39A 2JGAA 3MC1A 3QU4A 4LKRA 3FD8A 1O4WA 4KVAA 4TKVB 1T3GA 1SU8A 3G0OA 4U2KA 2A9QA 3BIOA 3GBSA 4FT2A 3NMUF 4I1IA 1KO1A 4UUOA 4R05A 4ARUA 1NE2A 5CA1B 1XU9A 1B1CA 1S3GA 4MQEB 4ND5A 3V9AA 3ZK9A 4DKJA 1EGHA 4ZOEA 5AUNB 1N2ZA 1XRMA 2C9DA 5I7VA 1RM3A 3ZTTA 2BP7B 4UU8A 1IM8A 4LN1A 2HF7A 2G0TA 3U3KA 3DXZA 4BQNA 8AT1A 2ZYWX 2I6TA 3CSUA 2OTCA 3HVUA 2V5VA 3LG2A 2ZQ5A 8ADHA 4GKKB 1JAZA 1EVLA 1PEAA 1L7AA 4HNSA 1N8NA 1R18A 4OQMA 3ABSB 3NP7A 3HS3A 4NSNA 5EIHA 4MVJH 5DP2A 1GGKA 1YQ9A 2H1CA 3JAWB 2XLCA 1BGWA 1C5KA 2RARA 2ZIAA 3LDUA 4AUEA 4C7MA 2EKQA 2LE0A 5BSEA 4RA6A 5K0LA 1Z4QA 3OKCA 1CE8A 3UK2A 5LSAA 4MPJA 4BMVA 3EEBA 4MMYB 1MU0A 3IRUA 3GNLA 3WLIA 2H52A 1ORIA 4CUKA 4A16A 1RD4A 5GOTA 5A9TA 3JQAA 4CEHB 1NBAA 3DV2A 4CGZA 3U31A 5HVNA 5EHGA 2P9BA 2X19A 1D2CA 3O4VA 3HABA 3N59A 4YUVA 3RIEA 3SM9A 5DM2A 1VBNA 4DR5B 1SBNE 3KQNA 1CZNA 1NM5A 5AH0A 1RVDA 1D2NA 5IBCA 2O05A 4RCZA 2W22A 3O8LA 3W8NA 3RS7A 5HQTA 1VYUA 3IA7A 4NFSA 4HP8A 3LRPA 5KYYA 1ZUHA 3WOVA 2W2NA 1UWKA 2RIRA 1XCJA 1FMTA 1G8YA 2JAWA 2YQ4A 1BC5A 4XA8A 1IJFA 1AXGA 3PTAA 4ZAGA 3MD0A 2QMUA 1A69A 3D0RA 1HBJA 1P77A 4W9RA 4XD2A 3V34A 1LJUA 5HG0A 4D6YA 4D9EA 5J3JA 3H42B 1FMCA 2B2NA 1DAPA 2PX0A 3ZQKA 3GCXA 3VSBA 1J9GA 5ESXA 1H2FA 5JS7A 4BNDB 2AF4C 4OHCA 3U3OA 1P6UA 4AJEA 4US2R 2FW9A 3EVNA 3QKTA 2V9CA 3AIMA 3CR7A 4KN6A 1EI9A 1QCYA 3DLIA 4RQTA 1UZNA 1AHPA 4ZVTA 4UMDA 4ZQHA 3PVZA 3GARA 2YN0A 621PA 3ZHZA 3OFVA 3OFSA 5FWXB 1F20A 1YE5A 2VHCA 3CWCA 4PNEA 4J0HA 1SKUA 1NYQA 1A9QA 5H3CA 1JA0A 2VJMB 1IRXA 4QPZA 5H9WA 1GDDA 2BGTA 4K2AA 1K8RA 4UHKA 1NYRA 2Q5LA 3CNOA 2QZZA 2VRBA 2ZUWA 3JQEA 3FTFA 1E9SA 5LP6A 1UR5A 2Q8PA 4U3JB 4E22A 1NMSA 3U3DA 3NWOA 1C14A 3VZPA 3USZA 2AVNA 5FIUA 4G1EB 1Z4JA 1GNTA 3PWSA 3T1TA 5F1PA 3I0NA 2XGMA 5EZYF 2OEPA 4O2AA 3TL3A 5HJEA 3NUGA 2ZUVA 4K5QA 2NT3A 2UZ3A 4KCGA 5ALXA 1G66A 5K03A 3G8YA 3C16C 3EODA 2EJWA 5LZ2A 1KF0A 4D7AA 1A96A 5TPZA 3E82A 1SD5A 3AHIA 4GPIB 4JROA 1E9BA 2DQSA 3IDZA 1K7EB 3O1JC 2NPIA 4AP6A 2KSQA 3GPDG 3PC4A 3QUBA 4QIHA 1PL7A 3K96A 2BBSA 1U2DC 4J4BA 4EENA 3K16A 1FQJA 1LGYA 3CH6A 4E5MA 4D4GA 1GCAA 3PNOA 1DFHA 5A71A 1YZHA 2R7AA 3HHPA 5JLJA 3C4QA 1N0IA 1TEHA 2AEJA 3OF2A 4ZAXA 5F3DA 4F56A 3QNUA 4X20A 4B44A 3WO0A 1RP7A 2PKQP 4EK9A 3KOMA 1TYBE 3RNOA 1AY0A 2ONYA 2A35A 2AS0A 1NNUA 1Z17A 1SURA 3Q12A 5DTJA 2VDKB 4YO7A 4K9KA 3K0FB 3GEGA 3LCCA 1SR8A 1ITZA 3HFRA 4I55F 3PEYA 2LBPA 1E7MA 1WZUA 3NRBA 3QYPA 1O95C 1W85B 3KXIA 2XKKA 3FOCA 3HJAA 2VT6A 2ZB3A 2E6UX 1O96B 3AGQA 1MRZA 4HH3C 3BD8A 2PMCA 5DYNA 4KPUA 1Y7IA 2OCLA 3RLIA 2R8OA 4L2IA 2AE1A 2P78A 4E2XA 1RABA 5T41A 4YS6A 2I6XA 2NPFA 4EYEA 1ORVA 3AFOA 3M5PA 2WD9A 1UJBA 4DVJA 1IQRA 1P9OA 2A3NA 2CXNA 1MGOA 1YS6A 2VTKA 4PINA 5EOVA 4CHGA 4Y9TA 5JY1A 3ESAA 3UJCA 2DQ4A 4INJA 3TW8A 4KPEC 1TJPB 3RSZA 1M72A 1J8QA 1G5RA 1PUXA 4WESB 5JXIA 4MEAA 3BHMA 4WK6A 1K0UA 3I1JA 4URFA 1TTTA 1A27A 3VFDA 1I0IA 4AY6A 3WNCA 2ZZNA 4ZHQF 5B7NA 1JNYA 4D3FA 1WABA 3QITA 2IPNA 1PSZA 4K9NA 4M7OA 1ZCBA 4YRTA 3WR5A 3TS1A 1Y33E 3DONA 3GCWA 4C3UA 4RTJA 5BN3A 2Q3EA 4K6OA 2J1LA 4ARSA 1CRZA 2IW3A 4A0RA 2QAGC 2NXNA 1CEYA 5GPBA 4JC8A 1ZMOA 4PYLA 4DNQA 5B55A 3KEGA 2YXNA 1WMDA 2YW2A 3CLUC 3O38A 4IFTA 4K28A 1NMZA 4V39A 2V7VA 3AUJB 1SY7A 1VBMA 1ONBA 4JGGA 4FKBA 1HT0A 3HXOA 3IAS6 2VDNB 4U7GA 4CTNA 4NZPA 3FUWA 4ZOLF 1G4AE 2OHIA 1XZIA 3NBFA 3AQIA 4JUBA 4Z9AA 5IM4A 5BR4A 2J9RA 4IIJB 5AK0A 2PX3A 1VL8A 5IAGA 3OKPA 2XWSA 3GFFA 3NXSA 4NAVA 3USES 2R7LA 3BS4A 3NOOA 3PXGA 1BKSB 3SBEA 1E6WA 2P90A 2AC4A 3OQ1A 4MZXA 4BFUA 1I5OA 4AJ1A 1X7DA 2XYPA 3BMNA 3I9V1 3OT5A 4RE6A 4TXHA 4XM2A 3X1WA 4YT8A 5JDCA 4TL8A 2HY7A 3MJ4A 1DOZA 1R8QA 3LKDA 4R6XA 4RK5A 1NI3A 1BS1A 2WTMA 3HSYA 3GA5A 1WSAA 2GVDC 4F9TA 4CDRA 1CUHA 1DBRA 5FWYA 4NEHB 2FPUA 1AO3A 4FI3F 4H4DA 5I01A 1W48A 1RWMA 2P8SA 1HEYA 4ND3A 3ZHRA 5JJKA 2XYGA 4B31A 2PWBA 2JJMA 3HCAA 4OQFA 4Z54A 4U7JA 1BN7A 2EU8A 4K26A 1B2LA 5FWDA 3DAFA 3G2QA 2P62A 3L4BA 1RWOA 4MA4A 1JLKA 1UPBA 2ROQA 3FGZA 1LC0A 2GHRA 3FTPA 3QVJA 2FU5C 2YN2A 4FN5A 2H0RA 3RIGA 2FP4A 3V4VB 4RVFA 1JL3A 1H2RS 4G0PA 2YWFA 4RY8A 3WQRA 5HR5A 3JAMA 3ZGZA 1TEXA 1V3TA 1LH0A 5TQVA 3RFCA 5DX0A 3MS7A 2NYUA 5HIJA 3RT1A 5TMEA 4LC1A 2JG3A 4E5UA 1PZNA 5EIAA 4ENPA 4DJ5X 2FPLA 3D8NA 3PFKA 3CBQA 3WLOA 1LPBB 3UT5B 2ASVA 3GZ4A 4HUQB 5EMHA 1M0WA 1V4NA 4N4AA 3JASB 1RZUA 5F7ZA 1OBFO 4BMZA 4RD4A 4F5YA 2WHPA 1U3VA 2G1KA 2J0VA 3JQ7B 1IOLA 3OU6A 3U62A 1KO5A 1TTQB 1X1RA 3ZE6A 3BGWA 1NPTO 1DUIA 1REQA 3BE6A 3H1GA 2ZYUX 1NZFA 4QFMA 4RGBA 3AI7A 3WRYC 1QYIA 2AC2A 4ZO8A 2RGRA 3SOZA 2Y68A 3E7XA 2PJRA 1Y7LA 4X3CA 3QWIA 1CS4C 4TWRA 2GXUA 3TOSA 1ISSA 4EHLA 2ZI7A 5JQGB 3UAOA 2DPYA 2C0PA 2EYUA 4HT3B 3NFYA 3A14A 5IBRA 3TIIA 2YHIA 4LTNA 1D5WA 3H18A 1H42A 4UUBA 1I10A 2BFPA 1YRBA 1JU4A 4B33A 1PG0A 4JLPA 3WIOA 2ERYA 3KQVA 4JVLA 3ZZTA 1UBOS 1T9KA 3HDJA 3S6JA 1SELA 4G89A 4M1EA 1GGJA 1SCAA 2XRFA 3FTEA 2Q3DA 5MN6A 1JBQA 1YZNA 2JS7A 2J46A 3WGJA 5LL6P 2HLNA 2YWCA 5FPQA 5DHRA 1AURA 3T3DA 5KWJA 3DUFB 3OHMA 3MAJA 2JVKA 4M21A 1GPDG 1ESEA 1YBMA 2IDJA 1BQEA 2NZYA 4YR9A 1TZMA 4EUKA 1IZ9A 1HT2E 1YCGA 2WF6A 4PANA 2PT7A 3NYWA 1D7OA 1NBIA 4HFRA 3RJZA 5B1EA 3PP8A 3HP7A 2PX8A 5F51A 4AO8A 4IMJB 1SNYA 3CJRA 4C14A 3TTWA 2HJRA 3CX7A 4QYSA 1XD9A 3Q7TA 4NL4H 1M5TA 4ROTA 3K5PA 1FTQA 1UM9B 3DTVA 4NOKA 1IZYA 1C2TA 1MA3A 1PV4A 1W4RA 4FFBB 4O4LF 2CE7A 5CT5A 5EUQB 5B2EA 5C1PA 3FETA 1HWYA 4NCNA 3V2IA 3J81k 3FNIA 1EKXA 1SIUA 2DFNA 1VPTA 1T9GR 5LLTA 1XZAA 3MZ0A 4HGZA 4BVBA 4J07A 2EP5A 3ELYA 2OCAA 2RB4A 3SVZA 3EXHA 2CUNA 5TJHA 3AQ4A 3ZIAA 4WDQA 1QK3A 3ORRA 2I29A 2UDPA 4OXQA 4O1MA 4A2QA 4D74A 1SCUA 1O2DA 1AIPA 4LY6A 1V95A 3DEHA 4GUDA 4W9NC 4B4DA 1JQ3A 1TRHA 2Q28A 4TTTS 3UW1A 1ZIXA 3FUTA 1W19A 2ZSFA 2FFHA 3GVXA 5D3ZA 1Z7WA 2BZSA 3IKVA 3RYFB 3VU0A 5BWLA 1U0NA 2C3PA 4YAKA 3CR8A 3U4QB 2X4LA 5A0TA 1T36A 3ZBQA 3H7AA 2EP7A 3QFCA 1A8IA 1N75A 2G67A 4I5EA 1AGNA 4AYTA 4EB6A 1Y1KE 2OCYC 3DA8A 1DKNA 3LLVA 3GR6A 1L4LA 5HJ5A 1JHRA 2KM1A 1ZLYA 4F7WA 5LYJF 4MCAA 2Y2UA 4TMYA 1R0SA 1V0JA 4GOKA 4N5LA 5B1IA 3N6XA 5BNFA 3S27A 5JRZA 3STYA 2G04A 4X6XA 3DF9A 1F0YA 3X1YA 2AZTA 1GTMA 2GCEA 4INPA 4DC9A 4EKDA 3ZZ1A 3A1FA 2AG6A 4OD0A 1L3BA 2B7CA 2BGIA 1FLVA 1LSOA 2OKGA 2AJLI 4KIUA 2XI4A 3DWEX 3THXB 3CQ9A 2J6BA 4FSDA 4F4DA 2NVOA 2GK3A 1GCOA 4L4RA 5K3FB 5KSZA 3OFND 5ECWA 2BJHA 5HCNA 1W44A 1NW8A 2APJA 4H7FA 3U39A 4MK4A 4FFPA 4LRWA 1KJJA 3N2GA 1FCJA 1K3UB 3U81A 2B94A 3RTDA 5JAOA 4Y1RA 2C7QA 2CLDX 3N6RA 5COBA 2O8DB 2I55A 2WY2D