1JDTA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with mta and sulfate ion
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
235
structure length
231
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 79
structure length 231
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdtA00
3D1VA 4IP0A 4DAOA 3DPSA 1RSZA 3PNSA 1Y1TA 4YMLA 1A9OA 1NC3A 4E1VA 3O6VA 1JE1A 2AI1A 1TGVA 5JPCA 3NM6B 5CCEA 4L5AA 4DA8A 3BL6A 3GGSA 4TTIA 2I4TA 1RXCA 1WTAA 1Z38A 1K9SA 4DA6A 1OUMA 4TXHA 1V48A 3NBQA 4OY3A 1V4NA 3NM4A 4X24A 1SD2A 1PF7E 3MB8A 3FWPA 1VHWA 5C80A 4F3CA 3P0FA 5F7OA 3OOHA 4NY1A 4OGKA 4WKBA 3KVVA 3O4VA 1ULBA 3K8QA 1OTYA 3OZEA 4QASA 1RXYA 2HN9A 3GB9A 5B7NA 3FNQA 4H1TA 1OU4A 4BMXA 4M7WA 2HWUA 1RYZA 4R2WA 2A0YA 1T8SA 4D8YA 5CYGA 1TCVA 1A69A 5IFKA 1M73E 2ON6A 4TXJA 3FAZA 4YO8A 3OCCA 3IEXA 4GMHA 1VMKA 3KHSA 1Z39A 1JYSA 1ODLA 4TYMA 3LA8A 2QDKA 4UC0A 4DABA 1ZL2A 4LZWA 4L5YA 5F7JA 4JWTA 3KUKA 3DJFA 5ETJA 1ULAA 5F7ZA 1LX7A 1T8WA 3PHBE 4U2KA 4MCIA 1PK7A 1Y1RA 3E9ZA 1JPVA 5KB3A 1SJ9A 3FB1A 1JDSA 3OOEA 3C74A 1YBFA 1V41E 3UAXA 4D8XA 1PR4A 4OJTA 2QPLA 3EUEA 1CG6A 3ODGA 1RXSA 1Z36A 1TCUA 1V2HE 2AC7A 4BMYA 3INYA 3PHCA 4OEHA 5F78A 2AI3A 2P4SA 1CB0A 1YRYE 1RXUA 3UT6A 3PNPA 2A0WA 4PNPA 1YQUA 5EPUA 3FUCA 1OTXA 4QAQA 4WKOA 5EUBA 1Z5OA 4D9HA 4DANA 1LVUA 3TL6A 1Y6QA 1PWYE 2HRDA 3ONVA 4R31A 5CCDA 1PR6A 1FXUA 1XE3A 4QARA 5B7PA 1ODIA 4BMZA 4P54A 1Z37A 4TS9A 2IQ5A 4FFSA 4TTJA 4OGLA 3T94A 4M1EA 1Q1GA 1OVGA 1VFNA 4TXMA 2AI2A 4YNBA 1Z34A 5EFOA 5K1ZA 1RFGE 1RT9A 4DA7A 1JDTA 1T8YA 3SCZA 3BSFA 4G89A 4QATA 3UAZA 4LNAA 5F7XA 2OC9A 4WKNA 1A9SA 4F3KA 2OC4A 3UAVA 1NC1A 3DDOA 4TXNA 1TD1A 4NS1A 1JDUA 1ECPA 1PR1A 1B8OA 1G2OA 2RJ3A 4KN5A 5F73A 1A9RA 1K27A 3BGSA 5B7GA 2B94A 1A9QA 1Z5PA 3OZBA 5F76A 4WKCA 4F1WA 4LDNA 3EEIA 5CYFA 1K3FA 4GLJA 3KVRA 4QEZA 3OPVA 4D98A 1U1FA 4TXLA 4OF4A 1U1EA 4TTAA 2QSUA 4L0MA 4L5CA 1LV8A 4TS3A 4BN0A 1U1DA 2A8YA 3DF9A 1PKEA 1T8RA 4DARA 1Y6RA 1ZOSA 1YQQA 4K6OA 1PK9A 1RR6A 2QTTA 2ISCA 3IOMA 4GKAA 1Y1QA 1PR5A 4WKPA 3P0EA 1QE5A 1ODJA 4LKRA 1C3XA 2QTGA 4MCHA 4D8VA 2XRFA 1NW4A 1A9PA 4PR3A 4JOSA 5B7QA 3EMVA 4JP5A 1ODKA 3E0QA 4RJ2A 3KU4A 3F8WA 2OXFA 4DAEA 3UAWA 4DA0A 1YR3A 4F2PA 2BSXA 4M3NA 1U1GA 3OZCA 3ENZA 1V45E 4R2XA 5FAKA 4YJKA 4EARA 3OF3A 1T0UA 1U1CA 1Y1SA 1I80A 2Q7OE 3OZDA 1B8NA 1TGYA 5CXQA 2H8GA 3LGSA 3DP9A 4ECEA 5IU6A 4LNHA 1PBNA 1JDZA 3K8OE 4G8JA 3UAYA 1Z33A 1Z5NA 1SQ6A 2A0XA 2GUWA 4F2WA 4I2VA 3FOWA 1PR0A 4L6IA 1SD1A 3MMSA 5CXSA 3U40A 1OV6A 1PR2A 3KVYA 3LBAA 1VHJA 2PGAA 1JP7A 1PW7A 4G41A 2I8AA 5I3CA 1JDVA 4NSNA 1N3IA 3NM5A 3QPBA 3BJEA 4GLFA 3EUFA 2HSWA 1JE0A 3E9RA 4EB8A 2OECA 1Z35A 1RCTE 1V3QE 4MARA 5F77A 4QFBA 1A9TA 5DK6A
chains in the Genus database with same CATH superfamily
3OQVA 4R9NA 2P5SA 5DTIA 1M7GA 1KYZA 1RSZA 1T8PA 1XKLA 5M2QA 4GRIA 1XF1A 3WGHA 1OT3A 3ZOZA 2JRCA 1TO1E 4PVDA 4MGHA 3WBJA 3IKTA 1E1MA 1BROA 1EZ1A 1ZGAA 3HWX1 2HM7A 4G2NA 5DKFA 3CRRA 2BKEA 2EC5A 5FQOA 1PU2A 4QPPA 5I7EA 3V2UA 4DILA 1V5IA 4M6WA 2Y67A 4BFYA 4ECAA 4P84A 2ZVJA 1E0KA 2VZ8A 3E82A 1N0IA 3O9VA 4KW7A 3N8HA 1UBLS 4PHFA 1RZ3A 1DRKA 1UANA 4EA7A 1EK0A 1PLLA 4L9RA 1WTAA 2OT3B 3VU1A 1COWD 2WT4A 2MHCA 2O6HA 5CCXA 3RK1A 3HUFA 5C34B 3AL3A 3ENQA 1BE8A 4TXHA 1TRKA 4C87A 3FH0A 3KEFA 4Q02A 5AJVB 3OMXA 5KDOA 3EIFA 3I4CA 5E1MA 2D1TA 2AL7A 2H17A 4RF3A 4U63A 3T7CA 1OFUA 3MB8A 2Q6IA 3TKLA 1J99A 3ZJ5A 1N2GA 4MAFA 3UATA 3BRWA 1Z0KA 2GAJA 3O93A 5FWYB 3ON5A 1FVFA 1NASA 1NPDA 5C8YB 1Z2EA 3NX4A 3UJ9A 2XMGA 1HSZA 1QDLB 2CV1A 3QUTA 2VAWA 1P2BA 1SG6A 5IX8A 1WQ1R 3MUNA 4EFDA 3U37A 4RXTA 2AOUA 1BQEA 2F3TA 1H2AS 1KJIA 2C97A 3IEUA 3KVVA 4J1TC 1E2KA 4PXYA 2JJ1A 5D1NA 3B9BA 3VYUB 3TXAA 3HCNA 4BAZA 2EZUA 3OE5A 5DLQC 1NG1A 4LE0A 3R0IA 5EUCA 4AN1A 4O02B 3KFXA 3TUZC 1DBPA 2AR7A 3LU1A 4M0DA 4DMHA 2W98A 4GGMX 4J3FA 4C76A 4ISBA 4NOLA 3F1LA 3MLAA 3ZOKA 2HSZA 5FI5A 5DLPA 3TTWA 3TI7A 1G1MA 5IULC 4YK7A 2WWYA 1NI5A 1V16B 1MU0A 2Q1UA 4NWIA 3RYFA 1OA0A 5KJ6A 1OB2A 2IYWA 1FU7A 1V3TA 1XK7A 2LDBA 4CUJA 4LHYA 4MMXB 1TMKA 1LA2A 1HT1E 3MVEA 4UXHA 2WT9A 3ZWQA 1TCVA 3CX6A 4XYBA 4LQDA 3V4SA 3W5UA 4X9XA 2P3QA 4B3RB 1UJBA 2C4MA 4EYSA 2C5EA 5KNBD 1QP0A 2H0QA 3KQWA 5A06A 2UV8A 4JV5B 4UHHA 1ZICA 1VCHA 3IV7A 3THXA 3IQEA 4MVCA 1YKSA 4PX3A 2R48A 3SS7X 3ZGOA 2BHRA 2RH4A 4N40A 2VJNA 1JJVA 1K86A 1KIAA 4JCOA 3RPEA 5CVEA 2H5EA 5AKZA 3ZE1B 5E4JA 1SKUA 4UBKA 1ZRHA 1HYQA 3CBGA 3OURA 1NUAA 4R1NA 4F1JA 5JBIA 1OWLA 1ULTA 5J63A 3VSEA 1I5EA 2FCAA 3FDFA 2H4YA 1DKNA 2OCGA 3OCWA 2IVFA 2ZT5A 1MXFA 2QTNA 2XKJE 2IIPA 3AHIA 4DN6A 4QBKA 3SZMA 3OCZA 3ND7A 4OIFA 5KPDA 1PWHA 2GCOB 5DDIP 1J8VA 4EJMA 1WVMA 1EWVA 1URPA 4HNQA 1T4MA 1MQ8B 2FVXA 1ADCA 2AMLA 4KQIA 2QXUA 5H3HA 1N6KA 2R8OA 4BQQA 1Q2XA 2OBFA 1JTVA 1SOAA 4HAYA 3AYZB 3SVTA 3L5KA 1LB1B 1FBNA 3NT4A 3TMKA 5FX2A 3AY7A 4IVQA 1WQ4A 3OX3A 4UVEA 3BA6A 3BX1A 1NUSA 2GZAA 1DQRA 2I4RA 1T3SA 3MBIA 5L7YA 3ROQA 3HDHA 4EP1A 3DR5A 3QBTA 3RAEC 5BY2A 4EGFA 1Y3DE 2AN4A 5KOIA 3TGWA 2XA2A 4BLQA 4DCGA 2QRPA 4PO1A 3AONB 3W1EA 4EB6B 3IEMA 3ZVKA 3NJRA 1RWPA 1SJ9A 4YRZA 1N2BA 2X7XA 5BW4A 3RSCA 4KPEC 4YHBA 1NOIA 2Z04A 1Q0TA 3COPA 3OOEA 1IBKB 2C59A 1OI4A 1T6YA 4B3HA 3EQ2A 4N54A 5ERYA 3FMIA 4URUR 4R1UA 1CWUA 2Y27A 2WQZA 3TLBA 1R8XA 3JAWA 1C3OB 1W29A 4MV9A 4N3NA 3EN0A 3ODGA 3CKLA 1VYTA 4Z0PA 4JCCA 1I7SB 4I9UA 4KODA 4QQ8A 4URHA 2XHZA 3PEVA 1R6TA 1OI3A 2B7CA 4MKHA 3ZQUA 1NNLA 3L6BA 3BC1A 5ERXA 4WZBB 3UHOA 3WNZA 1WW2A 2FPGA 4HZUB 1R12A 4P3PA 3UA4A 4C4PA 3H5NA 2XT6A 4WZAB 2WFMA 3SIWA 1DGQA 2CE2X 2ZPAA 4O2AF 1SZJG 3K5PA 3D2AA 4K3UA 1N5LA 1NMZA 2IHVA 3D7SA 1FUIA 4EKYA 3FYCA 3LY9A 2V45A 3U0BA 3QPVA 3NI2A 2J3IA 2WNSA 1DAOA 2GWRA 2Z3ZA 3AR8A 2VP3A 3FDZA 4UM5A 5GPBA 3ZDXB 3ZXXA 4BNGA 1Z5OA 5BWCA 2B2XA 3GR6A 1U8FO 3KLMX 3O91A 3WYGA 4NCAA 2N3ZA 2HRDA 1T0PA 1S2DA 2V7BA 4QDXA 2VPQA 2ICAA 5IUNC 2D2VA 3U4IA 5FBRB 4TLDA 3VDNB 2FEAA 2I80A 4GE3A 4O3MA 3GVIA 1XJ0A 1PR3A 1SD5A 3KOUA 1XE3A 1NP7A 2ZJ5A 4X7MA 4QC2A 1JBEA 3GIDA 1OE0A 4DYDA 1RQ2A 3Q0IA 4XARA 2OPBA 5CJ2A 3PGKA 3UK1A 5CB6A 3K70C 3DHEA 5C7YA 3SHFA 1PIWA 1XZIA 1QUFA 2B7BA 2IVZA 2C88A 3PP8A 2ZAIA 5AI5A 2YWBA 3DV0B 3QF7A 4QTTB 4ZZIA 5I7SA 3PDIB 4CGYA 1TIPA 4ZQEA 5KTTA 1N3BA 3GCDA 1UWKA 2GEVA 2MU1A 2YX1A 5EZ6B 5LQSA 3JQGA 3SMQA 2EF1A 3C45A 1EDZA 4OBEA 1RXWA 4G36A 1DARA 3BJMA 1VLZA 5BR8B 1R00A 3E61A 1H05A 4TUYB 5E6SB 1FXWF 3HZOA 3FJ1A 1W4LA 3R4VA 3FNIA 1XDSA 1HR0B 3JRXA 3VHLB 1GYPA 1PT8A 5FYDA 3VKHA 4PGFA 3TZCA 1IN8A 3TWOA 1GNPA 2EVWX 4EPTA 3WLSA 1KKLA 1ZCJA 5FCDA 2QXTA 3NOXA 5IN5A 3BSFA 3PYLA 2Y4NA 3OEHA 4LWZA 1GVNB 5FBWB 4IH4A 4MYTA 1T2AA 3BYZA 3V97A 2D74A 4BFUA 3FMVA 2RHOA 2V8BA 2AOVA 3IP6A 3K8ZA 4GECA 1NJ5A 1R37A 4C14A 1G7RA 4AMYA 1VJ1A 2CNLA 3SK0A 2UXCB 4R05A 3RTCA 2DBQA 2XAAA 5IDVA 1HDRA 1RBQA 2CLIB 2ZTHA 3IBSA 5CFQA 4M1WA 2ZJ3A 3OFSA 3E9DA 3UAVA 4MUJA 2GDJA 1KI6B 1J1IA 2QRZA 2W93A 4PWZA 5ALFA 2OXRA 4IUCS 5BRNA 2AFVA 4JNKA 4IWYA 4C29A 1N2ZA 4P8RA 2PY6A 1VJTA 1JDUA 4DLNA 2YXPX 1UP4A 3AFGA 1E5LA 9LDTA 1OW3B 1V71A 3IPXA 3FJYA 4HN4B 1E20A 4Q3OA 2DVMA 2A0UA 4QVKA 5DYGA 1MB4A 3T34A 2VTDA 1YDFA 2R25B 2H1OA 3PFNA 1AZTA 1HRDA 2FSUA 3KR0A 3ML1A 3OUZA 4XFJA 2J41A 2HQSA 4WCFC 2A7QA 1G7TA 1JR2A 2WBLC 3LUAA 2EDCA 4IIDA 4AY6A 3F6RA 1EX6A 1FVOA 2QROA 3THOA 3MJRA 1MW9X 3PLNA 5G3YA 1U8AA 4GQBA 4BQOA 3BH6A 4EF6A 4IILA 2I91A 4U6SA 4ZI7F 1GA4A 2G82A 2O0LA 2VJPA 3R20A 4RZ2A 2BGNA 2IIBA 2JZOA 4NFLA 2CE7A 2QLLA 4W1RA 3HZRA 4WFQA 4DV5B 4UARA 2MJLA 2WHYA 4RZXA 3EEIA 3ERCA 2OBNA 3RYIB 5C8DA 1U2SA 3P97A 2HKIA 1RJGA 4MW0A 4UM8B 3C24A 3LY5A 4XD7A 3TLMA 3GLHE 3VOTA 4HGOA 2P2CA 2VDNB 3DZDA 1P2SA 5D5QA 1DRVA 4OFXA 1DWOA 4RPGA 1KOJA 1GR0A 3HCWA 3ICCA 4OF4A 2QDXA 3NKLA 1JIVA 1DRJA 5C2JB 2P68A 3EGEA 2O2YA 1OLUA 3A2MA 4HGNA 4JAVC 5F1KA 4UUOA 3DEIA 4FGKA 4XB1A 1M2EA 3Q10A 1GSOA 4Q1EA 4WK4B 1J33A 2IYNA 5KHAA 4ACAA 2IGTA 1NQVA 2J3LA 3E9QA 3PD1A 4JP1A 2XDYA 1W4RA 4UVGA 1F38A 1Z13A 5EOVA 2D0IA 5IANA 3P9QA 1W44A 4Q3AA 3SE0A 1N7HA 3LT5A 3EZNA 1E92A 1UBJS 5DNDA 3TGLA 4MYDA 1BXGB 2G40A 3IIKA 2NTJA 1Y5LA 4MW6A 1T9CA 1UBMS 3RSHA 1EX9A 3PT9A 1NFFA 2IF0A 1QHEA 2O7SA 2PQMA 1N57A 3N8KA 3R5SA 3ZE9A 4YP1A 5AVYA 4X84A 4AC9A 2V4ZA 1AS0A 1BU5A 2FEKA 3CISA 2NUTA 2P6MA 1WXWA 3CO0S 1QFSA 3E3LA 1JHPA 4OHPA 2YJ3A 3NNDA 1XFDA 3TPCA 1C3XA 1L4YA 2H4HA 3IYLW 4C0KA 1J70A 3DTTA 4QODA 4N48A 4NR0A 2DUJA 4P2GA 4C4ZA 1H8HD 4NICA 3LUBA 5H59A 5IVDA 3EQ7A 5P21A 3UCEA 1IEVA 3NVKI 2V96A 1JHUA 1FDOA 2GBFA 4JP5A 4IXTA 4D79A 2ARKA 2GZRA 1RLMA 3EB9A 3HHEA 3E0QA 4LRYA 4K0RA 4HNAA 2YC4C 4UEOA 4QT4A 4RJ2A 3IAM1 4ZFNA 4CQLA 5IZCA 2A35A 2WKSA 3RU7A 1JHQA 2JFPA 5DNWA 1U0SY 2M6KA 5ENZA 5LJLA 2IYUA 3DE5X 4JJKA 1QHIA 2BSXA 2M1XA 4HWSA 4C5AA 2GARA 4LOIA 4IDGA 4OLBA 2VN8A 4CLRA 1P8JA 3JAKA 2QW8A 2PFKA 1NDQA 4TKUA 4FE4A 1UIRA 4R2XA 4U7HA 4DZTA 4RJKA 4LBYA 3AB3A 5LQMA 3PHIA 4BGVA 4PF1A 2GK4A 4ZZ1A 4K0KB 4OB7A 1DZIA 3IODA 4K6KA 1KH2A 5ALZA 5IKOA 1CF2O 3GPLA 2Z08A 4YQYA 3N5KA 1LJUA 1N6IA 3F78A 3NWJA 4TVOA 1WXGA 3T7JA 1EIZA 5CGZA 1DQYA 4ZCRA 4RK5A 4Z4GA 1G20B 4L0DA 3NS7A 4UBJA 4M88A 3GJTA 1ILWA 3FRIA 3K8OE 2OZVA 1I1OA 4OFZA 5CX1A 1LCIA 1F4VA 4MKIA 4XDGA 4AUNA 2Y66A 1TZMA 2NTYC 2WR8A 4CF4A 2G1PA 4YP5A 2PX4A 1KDOA 4GR4A 1Q0HA 1UBOS 5LZ9A 2OUKA 1CRQA 1S2GA 4CIVA 1S9HA 3L07A 4F2WA 3EUWA 5A7HA 1XU7A 1QRTA 1UJMA 3OU6A 3X1XA 5E4TA 4MR8A 4EG5A 4ZYXA 1FP4A 4HI0E 1OIVA 3FETA 5IJ0A 3OJCA 1NXSA 4C4OA 2GNOA 2FFRA 2K4MA 3VR4D 4ZHSA 4DZRA 5ICMA 1A2QA 3AF5A 3KL4A 3VTAA 3I1JA 5HCNA 1DEOA 1U6KA 4JUAA 4XIFA 4Y1GA 4G5FA 3CEJA 4LIPD 1DG1G 1O6GA 1MLDA 2CJXA 3E9CA 4E12A 5LPNA 1IJEA 5G0VA 1WCXA 1DAPA 4KO1S 1CERA 2I9PA 1G4AE 4ENTA 3B1XA 4JI2B 4QXAA 1E4VA 1R8SA 1P77A 1ZW1A 4Z9BA 1EDBA 1UC4B 3WNBA 3C0KA 3ZX5A 3HJUA 4ON9A 1XEAA 3EUFA 4DV4B 2XDQA 2C7BA 2YUIA 4E30A 5EXEA 5KQLA 4O8CA 4M8KA 1XN4A 4R98A 2X1VA 4DSTA 5ILQA 1I7QB 3GDWA 3OJFA 1Z35A 3ZLUA 1CS0B 3UT0A 4MARA 3GQVA 3A6ZA 4MITA 4MWTA 4NOMA 4BVAA 4D1YA 3LUDA 1JSLA 3N8IA 4K2HA 2HU5A 2NUPA 3KDPA 1FL9A 1PZXA 4AZSA 5BSVA 5BNWA 3RIGA 1O08A 3CZQA 3WYCA 3ICPA 1WY7A 1T3GA 3ZBTA 5BORA 4NZZA 1HX7A 4ZWNA 1Z25A 2HLPA 4YCBA 2I62A 3I30X 4O1MA 1GUZA 1J07A 2XAUA 4IOLA 5JV5A 4G1MB 3UENA 5ICCA 4OPMA 2Y1EA 1MIHA 2IHTA 1L4GA 4AS1A 1ZVKA 4N5MA 2ZRCA 3TCXB 4LG1A 2J0SA 4OQMA 4X41A 2O2HA 4RMIA 3TIGA 2DT8A 5IEJA 2HPVA 5K0NA 5HFNA 1XWFA 4KQEA 4DUYB 2RE8A 2FLKA 2P9EA 3M6MD 4FP9A 4Q6WA 4DA6A 1H9AA 1FTNA 1XPJA 1OZAA 1YO6A 3RCBA 1WCV1 1TMOA 4FZ3A 3LNTA 3S7ZA 4WWHA 1T26A 2BEVB 4OHRA 4CM5A 1DC5A 2R1UA 5GJBA 3GG9A 1E60A 1FU4A 3C39A 2XY4A 1S2LA 1SKBA 4AJJA 4BZWA 5A9SA 2JI7A 2YWHA 2H4JA 4L4RA 4MA4A 3USZA 3IBCA 3L06A 1NNEA 1KZ1A 4CL2A 4BO7A 1KTVA 4GYKA 5EJIA 1U9ZA 1YBMA 2DQYA 3RC2A 1O6FA 3THYA 1BX0A 3H2HA 3LX8A 4NH0A 2QZSA 5K51A 2GRJA 1QVVA 2OGUA 4HZGA 5TPWB 1KVRA 2FMIA 5CLIA 3GGPA 5A6SB 1QZXA 3CCCA 5DW0A 2YW9A 1C1YA 3TB6A 3A1SA 3SHOA 4AZVA 3FSEA 3DC2A 5KNDH 3CVYA 3HYNA 1E5QA 1GG5A 1K63A 1E2UA 2YIMA 3ZQKA 4V2UA 1JQAA 1P7YA 2JFUA 3CA8A 1K3UB 3CT4A 4D0NA 5BN3A 1ZJ6A 3DEYX 3GB9A 3GL9A 5DHAA 4B81A 1R0XA 2J08A 2BE7A 2IXTA 3JWEA 1U11A 3WL6A 1Q44A 1W52X 1QAOA 2G28A 4R1TA 3O8DA 2SCUB 1TCAA 1NJ2A 2R44A 2QW1A 2QR5A 2DM6A 3QTTA 3OM9A 4G65A 4O4LF 2W6PA 4U7PB 1L2TA 4EUHA 1JMVA 1Q5PA 1Z6GA 3AUKA 4GBJA 3MTJA 5JNLA 3IMCA 3OCJA 4W5OA 1L4UA 3RVKA 2PBZA 3A1EA 5F23A 1R8YA 1K92A 2CCJA 3HKEA 1N0WA 4XQ9A 4BWVA 4TSRA 4JYAB 1G3QA 3GQBB 2ZXFA 4YJ3B 1M34A 3ADDA 3L93A 3R5KA 3KB8A 3ROXA 3RS7A 4N9QA 5CH5A 4EJ2A 2PX2A 3VR6A 3FAZA 5J1SB 4CEIA 5IASA 2VSFA 2EW1A 4DJFC 3LL4A 4YREA 4JWKA 2QQEA 4KQJA 3QLVA 3FSJX 2H57A 3BULA 5L95A 1NSYA 5GZ6A 2OO7A 5J9FA 4NEGA 1KK0A 5K3SA 1T25A 3IAHA 4BVBA 1T1IA 3CNNA 2JFVA 4IDAA 1N8KA 2EFCB 3MQFA 4MQ6A 5JH7F 2YFQA 3B3AA 1P1IA 2H7VA 1JQKA 2WZBA 4LFCB 2XT9A 5AK6A 1XTZA 1EG7A 5EE3A 1JG4A 3V7UA 5LQAA 4CCSA 1JYSA 3HSSA 2I6FA 1BFUA 2Z2ZA 3FI0A 1JWAB 2IU3A 2NYVA 3KZNA 3AUYA 3ER6A 3G89A 1ELOA 4OQDA 1ZL2A 1IHPA 2DY1A 3LK7A 1L7MA 1H2YA 1REQB 3WLFA 4PG6A 3MB5A 3Q9UA 1TM5E 2PT5A 1C3EA 1E5DA 3F9IA 1MH9A 4N9WA 2QX4A 1XFAA 2ZT6A 1CXZA 3NUGA 3DJFA 4AYTA 5J4HA 3DBRA 4PQYA 3UJ7A 1GTSA 5JISA 5JNWA 3K1ZA 4DR3B 1E94E 1ORVA 3SZUA 1IG0A 4CKEA 2XD4A 2DETA 1KMIY 3JS5A 5HIAA 2GCGA 4DEVA 1K2VN 1QS0A 1SM4A 2YVKA 3KZKA 4Z4IA 3ZDZB 1NP6A 1D1SA 1O0SA 1YK0A 2IZ5A 2JIQA 1BCRA 1YZKA 2VT7A 3AF0A 5LA6F 3NDJA 3OSUA 4X62B 3ZJUA 2M1ZA 4BBPA 2O6LA 4P5DA 3E8MA 5AW7A 2ZYUX 3FY4A 1TUBA 4QTZA 4YB8A 1WB6A 3B1YA 3DOCA 2Q9AA 3G8CA 4MQFA 3TRFA 2XUKA 2OG1A 2VUUA 4K3VA 2HMYB 1BXRB 2O2EA 4ZEXA 1U6JA 2ZDGA 3H7IA 2UYGA 4GOLD 5EGSA 5IDYA 2VJOA 3TQIA 2H1HA 3QG1A 2BGRA 1C1HA 2WMNB 5FWXA 4MA0A 3KWFA 4K9OA 1JWLA 3ZIUA 2JAOA 4LPKA 3KK0A 3O3NB 5AM0A 1YCGA 1PGQA 1QIHA 2GVZC 3N28A 1SU7A 1FTQA 4FKMA 5FWNA 5ALXA 1VHDA 3W5SA 2EYUA 1GTRA 3PD7A 3NTRA 3VR3D 1SXJA 2UZ3A 1G60A 3SLGA 4BMVA 4W63A 3R3WA 1ADFA 4E5SA 1V8BA 3WRYA 5BUQA 1L4MA 1UPUA 1EWKA 3S8EA 5L6LB 4MS1B 3RYCB 3AZPA 2A1UB 1I5OA 1KR2A 3PHCA 3OQIB 3NC4A 4H7PA 4G6ZA 7GPBA 4D0RA 4MRNA 4GQAA 4DVGA 4AROA 2N75A 1N7JA 4YROA 2AJBA 3KQUA 1HDCA 1K6MA 4COKA 5JRZA 3Q3HA 2ZT7A 2XRZA 2QRGA 4F11A 4G0XA 3C5HA 2HIHA 4PZUA 2W2PA 3GA7A 4WKOA 4EM6A 1UJNA 6ADHA 4ZEOA 2I3DA 4AQYB 3OE1A 4ND6A 3PTLA 1AKNA 1SUEA 1PWYE 2R8PA 3PNKA 3QW4B 4PLGA 3RS9A 3VSCA 5BXQC 1XSEA 3B51X 4C7KA 3A4TA 1ZU4A 4WESB 1KVTA 2B1QA 4H08A 4K9KA 2ZLBA 1I0ZA 2C8VA 3WYAA 1OIWA 3FFXA 2ECKA 5LNK1 4WADA 2J5QA 3ACCA 3SVLA 2PUGA 1LZLA 2WNHA 4CUKA 4E4TA 1ILEA 4P0PB 1KK1A 3GNSA 1KI1A 3G85A 2FCRA 3IGFA 4ILEA 5CA0F 5CG1A 4XWTA 4CNQA 4B2PA 1XTJA 5DHSA 1N2CB 3ID6C 2QBYA 1H22A 2I22A 4FYJA 4M8IA 2O1WA 4P3YA 4WBXC 5FUWA 1W8DA 1UZNA 1ZHOA 1G8MA 2NX2A 3SHWA 1PJCA 2X22A 1RACA 1VE5A 3GCZA 1AOXA 4A03A 5FUVA 3AJDA 3FGPA 2K87A 2RBKA 3ETEA 3QI2A 2I4LA 4L85A 4Q3DA 4ZC1A 2OCIA 1NHGA 1YCDA 2H2AA 1HKHA 4GZMA 5TMDA 1VPWA 1QTQA 2ZQ5A 3F3MA 2YH2A 2XMBA 5ALDA 1N8NA 3B78A 1E79D 1XTSA 3QXHA 4O4JB 3WXMA 5T64A 4JXJA 4DHEA 1H6DA 1AUOA 1L5KA 1GTVA 2XE7A 3BHIA 1JHYA 1H2FA 1X8KA 1AIPA 1GRRA 4NBWA 4QUDA 1AK1A 2FPLA 2GJKA 1GAWA 2QLTA 4QSMA 3UGQA 4EJSA 4HH4A 2NT4A 5DNUA 4RNCA 3EZXA 1CJUC 2UZIR 2BN4A 1KERA 4QTXA 2NO5A 2AMJA 4AJNA 3ZDBA 4KPUB 4J8PA 3L8YA 1RC1A 3DDHA 1PL7A 2MINA 4EBFA 2M2IA 1LSJA 5ESDA 2FY8A 1WW3A 2I87A 4D9IA 1S1CA 1YE8A 3GBPA 1K7XB 1S3IA 4V1CI 3AYXB 2HFKA 1KNQA 3UG7A 3VTFA 4DCOA 4RTRA 1DTWB 2X8LA 2PR7A 3AI2A 1SOUA 3DD5A 4YH1A 1N78A 4F71A 3UYLA 5DSZA 2PXXA 3ZS8A 1VHLA 4ND8A 2JHPA 5CP8A 3R7AA 4ZGGA 2ONCA 3UXEA 1RRKA 2AFHB 3KJFA 5K3FA 4ALIA 3CRNA 1DAIA 4AMUA 1N4DA 1H0HA 2LBPA 3BFJA 1J8FA 3HJAA 3THWB 1YB1A 3EXIA 1XDZA 1GR1A 4LOJA 3C8DA 1FFHA 4H7JA 5EN4A 1NPTO 3RV4A 5BUZA 3FTEA 1UBTS 4AJ2A 4GLOA 2IE0A 4I08A 3KCQA 1KKMA 3DE1X 4U0KA 1EBFA 2CV2A 1F06A 2GR9A 4QGBA 1ZD9A 4J0GA 4P86A 4BU1A 3QMWA 4XIGS 1GPH1 5HMMA 4C4TA 2C84A 5AUPB 1V96A 1XDGA 3DVRX 1R0RE 1EIWA 1IN4A 5AKXA 1KBZA 1BD3A 3INNA 2WJGA 3EXAA 4E2XA 1RKBA 4UJ5A 2YJ5A 3KE8A 3MMZA 2F43B 4GF5A 4P7BA 1P19A 2IRWA 2O2SA 2WNIA 4GNRA 4HTAA 2CL7X 1KSFX 4ZYLA 5BSEA 2MYPA 3LWZA 2GF9A 4WW0A 2JLZA 4HQNA 3ZG6A 5MF6A 1OBVA 2PNJA 1Y4UA 2HFJA 3ENWA 3CV3A 621PA 4OXQA 3A3OA 3AR3A 1RABA 3GUHA 3KJXA 2HW8A 4OQXA 4LMPA 5CYFA 4TT3A 5J23A 1A8HA 1UT5A 2BEUB 3KVRA 1DBWA 4Y6PA 5DP1A 4LAFA 1EGHA 2JBAA 4ODIA 3S99A 3U9LA 3WVNA 3ISVA 4W8HA 5KYGA 4NCBA 4Y9DA 2P2DA 1VCOA 5JCJA 4YMTA 3UMYA 4WBSA 4OFWA 2WJVA 4ZO9A 3WRWA 5L53A 1MJGM 1ESCA 1PEYA 1QIFA 3PIDA 1VRWA 4NMHA 4DDVA 5GJVC 1XALA 1XRRA 2WTEA 3KB2A 4GXRA 4J43A 4TS3A 1F8UA 4ALNA 1FDUA 1XAGA 2GTPA 1FJHA 3LE8A 4JQZA 1M67A 1OAOC 5TX7A 1U2ZA 3RNOA 3LL7A 1U0FA 4LN1A 2QSZA 1DJQA 4RD4A 3H99A 4QYXA 3EVGA 4RKRA 4AQDA 2FFJA 2PUVA 1ZOSA 1O96B 3WIUA 1PD1A 1CY2A 5JQGA 2PTHA 3NEPX 4XYLA 2IUSA 4EH1A 3VNVA 4FE3A 1AQ6A 2JB9A 2Y2VA 2QTTA 2ZSIA 5LZ4A 5EKSA 3AUTA 3NTUA 3JD1A 4FILA 3D8NA 4ACBA 3DPIA 4YQFA 3IOMA 1J7JA 4K7JA 4LJ7A 1HFJA 3TB4A 2VUIB 3O8NA 3RFVA 3O92A 4MRRA 2GJ8A 2WTUA 1KP3A 1KNXA 2WU3A 3JQAB 4X97A 1ODJA 1U2TA 2XWPA 4IW3B 3CMCO 4QDZA 4LBZA 3UQYS 3ZKAA 3ZZMA 2BELA 1P2UA 4I6JA 4OHYA 5CVDA 3ESAA 5CDSA 4RQBA 2IS1A 3QLUC 2AWOA 2H0RA 1KYQA 2VP2A 3COZA 4WOCA 4WXYB 5FBKA 3WJ1A 5B7QA 4R51A 2D2FA 6CHYA 2G9NA 1R18A 2ZPUA 1RMQA 2HWWA 2X19A 3HXTA 5FV7A 2EWVA 4DY6A 2XOKD 3T3NA 1JECA 4Q9LA 3GAFA 4LTMA 4F4IA 1I3OA 3T5GA 3KT0A 1K5HA 4JYMA 3DDCA 3LLUA 1ESZA 1TM4E 3PNYA 3Q7RA 2YASA 2OD9A 5D8DA 1H5UA 1OI2A 4F2PA 3RKSA 3OE4A 1C0IA 2BFDB 3DD1A 3NZEA 2V55B 4AP5A 2X58A 3UKDA 3I72A 1E0AA 5DCWA 5KYXA 4TX1A 1ZVQA 2FSPA 5IEBA 2FLWA 1VG0B 2R85A 2RHMA 4DR1B 1ZUNB 2PA3A 3M83A 4C3UA 3SFZA 1W2WB 1XTKA 4HDSA 5ALTA 1F48A 2HSEA 1N2OA 4M36A 1UAAA 4OX9B 5KNCH 3K9HA 3C14C 4GM4A 2CVOA 1OLOA 3EGWA 1FOEB 1U1CA 1OX4A 1XIVA 1V25A 4N0DA 1KDPA 2O2IA 3BSYA 5CK4A 1ETUA 2PJRA 2ZYHA 3E2PA 2GN9A 4JENA 2Y0PA 1TGYA 1QKIA 2PKXA 1T24A 4JI4B 2J6HA 1ZM3A 2VK8A 3B85A 4IFEA 4XVQA 4C4SA 2PUAA 1FVHA 1LLUA 5A4FS 4AZ0A 4GI3A 4OQYA 1LQUA 4GT1A 3ORYA 4O25A 2H1IA 2C2HA 2BGJA 3ASVA 4HKTA 3PUIA 1M76A 2DWOA 3EQ6A 4CM4B 3IUQA 4M8SA 1MCZA 2Y9MB 2F3QA 4TQ9A 3I34X 4JJFA 4X6XA 2CYCA 3IQFA 4XX0B 2PZ8A 3FG9A 2BOVA 5AIAA 5F1OA 3W4IA 1U8XX 2AJ8A 3PQ4A 3WKCA 4KGVA 3G9UA 4NMLA 4MVJI 4W9NC 4AMGA 1BKYA 5EP2A 2FF5A 1TW2A 4F3RA 5C52B 2EWWA 2FTKE 2ZE6A 3O1HB 3DAHA 4FDVA 2WJWA 3AHDA 3B6ZA 3DOUA 4DC1A 4DDHA 2GAOA 5AW2A 3TZHA 2HGZA 4MS3A 4MWGA 5CT8A 3T3PB 4FD2A 4NMXB 3BRQA 3RF6A 1Y8RA 1L7PA 4E94A 4EFLA 1LEHA 2KLHA 1FS6A 1C41A 2WJYA 4REQB 4E7PA 5BR7A 5HOEA 5JYBA 1XRMA 4D9KA 1O4VA 3ZVNA 1TEHA 2FN9A 1PW7A 4LVNA 4NDNE 2DQKA 3EJ6A 3CLRC 4KKXB 4W7SA 3ZXIA 4Z4CA 1T36B 3NVAA 5JWHA 4DQKA 4RSRA 5LIPA 1RYEA 3V4VB 4NPHA 2JZNA 3GJ8A 4MXDA 1U65A 2X2OA 4LTDA 3TD2A 3KKPA 3UIEA 3VC3A 4JJ7A 2JRLA 4FNMA 3I76A 4BGIA 1HT3A 1AKUA 1RADA 1R0YA 3D0KA 3PB3A 3A1NA 3M49A 3IHKA 3F6SA 1ZH4A 5D3ZA 2REQB 4P80A 2OBBA 2XWBF 2B34A 1N0HA 3A6JA 4Z9AA 1BMQA 4D4IA 1RM5A 5A3VA 5JROA 2Z9DA 1SC6A 4NAVA 1ZCZA 1E1CA 2OWEA 2UVPB 2VSOA 1ECGA 3Q7EA 4OXKA 3LJKA 1N5DA 4E33A 3PD0A 1D1PA 3BH0A 4KVGA 4PN3A 2FWRA 2RGDA 3H17A 5DI9A 3C3XA 1SWWA 3IAM6 5FWDA 2P2GA 2C8KA 4E1VA 3PRYA 2PDAA 3SIXA 1USUA 4ZV9A 4AJ4A 4LSWA 5KTOA 5HTOA 1YC5A 5H3CA 3RBVA 5F3DA 3U3RA 4HNUA 4LYDA 1F3OA 4PLVA 5A05A 1U2GA 3QKRB 3K0SA 1UT8A 4MW4A 3D4OA 4XWOA 1P0CA 1KP2A 1UFRA 4BEWA 2YZ2A 3LECA 1NN0A 5GMOA 5GONB 5BSRA 3RWBA 5I45A 1KWGA 3W5AA 2TECE 4KG7A 3IVXA 5EWMB 1FFGA 2JGLA 1UEXC 3M5PA 2BY4A 4LECA 3NBQA 3PC7A 5JAMA 2B20A 3LQRA 4X24A 3WP1B 1YBHA 4G56A 2K7FA 5FL3A 4MYCA 2F1KA 1PF7E 3QVGA 4RESA 3W0LB 3WSVA 1V3UA 3O7WA 1N1EA 4TLCA 3WRXA 4OATA 5CEFA 3LS2A 2OOSA 3BGDA 4B7AA 1WZNA 4H6WA 1XZCA 1Y3CE 2CW5A 5I51A 1IZ8A 4ZDIA 1J0CA 2A6PA 4KWTA 2GN6A 1N34B 2C00A 2C92A 3PJDA 1IVSA 1L8OA 1Q17A 1KFBB 5E7QA 5IXSA 5DU2A 4TS4A 1NYQA 5HKKD 3WLKX 3S44A 1NUPA 1JGTA 2BISA 4PXSA 4MDYA 1NQOA 4V39A 3P8ZA 4O2LA 4E22A 1UXIA 2QVBA 3I01M 2ZTUA 2AX3A 4BNDA 4D8TA 2CHEA 3OZEA 3I52A 4YDQA 2HN9A 4KI0A 3L7BA 2OBYA 3UPTA 2XWJI 2O57A 5B1HA 4US2R 1K68A 1OC4A 2BFAA 3BWYA 3S5UA 3QXJA 5C37A 5KQSA 4BWGA 5JZSA 1ZCFA 3O4IA 4PQGA 3V80A 2VVTA 1B42A 3IT0A 3RUHA 2Q1XA 3GWZA 3K96A 4YFVA 2B98A 3REQA 1R5JA 2AXEA 4L50A 3FGOA 1PT6A 2ZQZA 4KL8S 5HUHA 3BKXA 1U4SA 3HMKA 4WLUA 3ZKWA 1FS5A 3ICQB 1SCAA 2XQKA 5ED4A 4TRMA 3BBLA 1WXFA 1W96A 4EL5A 2I8CA 2ZYVX 3D4PA 3SKVA 3TTTA 2ZJ8A 1U7XA 3C6XA 1DWPA 4G5RA 3DMGA 5L4LA 2RJOA 1M83A 2Y92A 4UNSA 3ORHA 2PIDA 3QLEA 4J0FA 4WXPA 3ZD9A 3JASB 2R8ZA 3N75A 4UQLA 4D5GA 4RADA 4BIMA 4J9VA 2F3RA 3CR3C 4HB2A 1MEOA 3RROA 3V8EA 3CZ4A 4ZV4A 3EIXA 3C5VA 3AJ8A 2E48A 3ND8A 4ZCMA 2DHCA 2N9UA 3K0HA 2R1VA 3CE9A 3H75A 2HF8A 3LG2A 5DM1A 4DIKA 5LM3A 3JWHA 4RHEA 3GLQA 2O8CA 1ODLA 5ALIA 4MVJP 5T8KA 3SY8A 5CB8A 2ISQA 4N8DA 1SNYA 1YMUA 4JI0B 3I23A 2XTNA 2PVPA 3LKBA 3AV3A 2I4IA 1EB8A 2VF8A 4Y18A 5ETJA 3WDKA 5MN4A 3O94A 1BWPA 1E0SA 2DCUA 1RPTA 2F9MA 1GPAA 2JVIA 4MCIA 3L7LA 1FSSA 1ZOPA 2QRQA 3OF5A 2SKDA 5SYMA 2V7WA 5IMSA 2J87A 4WXMA 2FPKA 1GARA 3I04M 3W34A 1GCOA 3VH4A 1V39A 5EEGA 3E9ZA 4BLVA 5L3SA 4QTUB 5KEIA 1Q1AA 3CCFA 1NF8A 1QKKA 4LVUA 5EKTA 3CZ9A 2QLBA 2P6NA 2FQWA 2FPPB 3B5JA 4EKGA 1QNFA 1AUVA 4CFSA 3R3ZA 3REFA 4JVMA 5JDCA 3W1WA 1Q6YA 3CJTA 1JVSA 3G6KA 1GZ3A 1K4KA 2WYHA 4UEKA 2IW1A 1S2OA 2ACEA 2Q3MA 2PSHA 1LBIA 3LUCA 2H92A 2BHSA 2IOQA 3QPDA 3AFNA 1YAHA 2I3BA 5FPHA 4EOGA 4BFZA 2YVAA 2C3OA 3QWFA 3ETDA 4Z99A 1QRAA 2C96A 4QBGB 1BVRA 4IIJF 5HCIA 4RSMA 4G5SA 1I7LA 3ZCXA 2Q46A 4WLOA 3V6MA 4CN9A 5DM70 4B3JA 3NBZC 3PENA 1BQ3A 1HT2E 5TMBA 4ZRNA 1RNLA 1V2HE 1Z2DA 2GM5A 4JOQA 4Y1FA 3TOSA 2XGGA 1OBOA 1PVDA 1FFDA 3G0CA 5B1YA 2PSJA 3K0EA 1TFUA 2CXTA 1W0KA 2JAHA 3SC6A 4WDRA 5GIPE 3IPLA 1E1QA 1GKLA 3MT8A 5M04A 1KMQA 5JAQA 4AYXA 4DZZA 1ZGHA 3ANTA 1C3VA 4UCWA 2CDBA 2O3JA 3DBIA 1QAQA 3FPBA 2COUA 4HHEA 5EPUA 2AG8A 1Z63A 2FR1A 2IPAB 1QFYA 3BWXA 2V59A 2GO1A 1CDOA 2E55A 2MYTA 1BE1A 1ZJJA 5E3JA 1KIFA 5T4HA 4HGZA 4MYRA 2GVDC 1XUOA 4ZOLF 4TSFD 3ES9A 3ETGA 4ZVRA 4AKSA 3W3AH 1B8PA 4BMCA 2PG3A 4RJJA 4DMGA 1KEVA 1YD7A 2F62A 3DHWC 4B7CA 4JP3A 1L3IA 3JTEA 3OECA 3MGAA 3QUBA 1K5GA 2XUHA 3JQDA 4JVSB 3HA3A 1D5CA 2ZR7A 4L75A 3ZCQA 1TA0A 1C4OA 1VPTA 2O5RA 5JECA 2F1OA 1EI9A 1M6EX 1O5OA 4Y1RB 1UBKS 4L28A 4AM8A 4B8YA 3DLBA 5K7SA 2XXAB 1E7WA 4URZR 3AG5A 4HDKB 1VOTA 2FPSA 3ZK8A 1J2EA 4D3SA 2BM0A 3O83A 5I9SA 4URVR 4DCMA 3LVQE 4DREA 1VSBA 5LQRA 5K05A 3NAQA 1CD5A 3X1YA 1XZLA 2BZ1A 1VFNA 4TXMA 1JMYA 4TZ0A 2QNRA 3WAKA 5BNZA 2IITA 4OI1A 3Q3GE 4IGKA 4KWEA 5HNKA 2HMSA 2ZE5A 2C3MA 2YWEA 3HMQA 1P72A 4GP6A 4RLFA 4CQMA 2VF4X 1VGQA 3PXCX 3UA3A 1EK2A 3EIUA 3M5WA 4I99A 4HB0A 1ORWA 2DH5A 4ZJYA 2EKZA 2FW1A 2CVZA 2Z56A 5M29A 1S0UA 4G1BA 3CUEF 2KMLA 4LRXA 3CSUA 2XTAA 4CT4B 5TEVA 4DNOA 1AMNA 5K2OA 4KMSA 5AK3A 4FFNA 1H6CA 1C1DA 2IYRA 2R1TA 2IKQA 3O4GA 3OCXA 1UDRA 3DMFA 5H4GA 3B70A 4GP9A 4PQRA 3UAZA 2C9YA 4ZI3A 5AXBA 4L51A 1AO0A 2PWYA 4OG2A 4QE3A 3UWPA 2VXYA 4X90A 2NVBA 4ED9A 1NVTA 5ITWA 2G71A 3GJYA 3IOEA 5HKLA 5HZMA 1H69A 3COWA 3PG5A 1VL6A 2FPXA 2F1IA 4UM9D 4K9PA 5AVJA 1H2WA 4QYWA 1B93A 5K2MA 5IP5A 3SC3A 5JUWA 3PLRA 2YN2A 1J0BA 3DKVA 3QV1A 4MAMA 5ESWA 4L9WA 4MJLA 2YZKA 3WBKA 1RE1A 5CJPA 5EP4A 1NW7A 2RHWA 3AETB 3LQYA 4XDHA 1PR1A 4JLBA 3L4BA 1ANKA 3E22B 4D42A 4TSKA 1XTIA 3HFJA 3K2EA 1E7RA 4UVIA 1OTHA 4RGQA 5DZSA 2VCYA 1KJNA 3HEMA 1JB1A 1MP0A 4AMZA 2AG0A 2YYSA 4JGBA 1NN1A 5LP6C 1J21A 3DKPA 3ZWMA 1RI5A 3EAGA 3EPPA 2LP4Y 5FR2A 4CZ2A 1K27A 2ZS9A 4EA6A 4DT1A 5H4HA 4A0QA 1QQAA 1OWMA 4HEHA 2I67A 4L0CA 1I24A 4IKOA 1USIA 1QF6A 3I9JA 2CNBA 4R16A 1BE6A 4W5JA 5JR3A 2Q1WA 3EA4A 1G59A 3I45A 3IAS1 2G04A 4QBTA 4PC6A 1E99A 1JXQA 3HJCA 2AE2A 3FKSD 3OZFA 1WXDA 5C3MA 1PFVA 2YKGA 3DWGA 1LVHA 2WIKA 4LJSA 5FOWA 1A88A 3M33A 2YY7A 3GX1A 1K3FA 4I36A 2DKFA 2FP4B 1MIOB 1SUBA 4KREA 5AI9A 5HGJA 2IODA 1OB5A 3KOYA 5HF6A 2D59A 3DE2X 3CF4A 3ESQA 2BFCA 2CLCX 3BIWA 4FYWA 1M8PA 3IQWA 4TGLA 4DR4B 2BDUA 3HI4A 5LNK6 3MWJA 2OCYC 3X0DA 5K0GA 1H4SA 2GYUA 3MWLA 2B4AA 2WF7A 2Z6VA 3OEED 3TXXA 5DX0A 3NBYC 2QUAA 2C2OA 1N2IA 4FLEA 3IIJA 2XXJA 4Q4HA 1GCUA 4DPLA 1THMA 5EAIA 2HMVA 4DRXB 4F8EA 3UTCA 3T95A 1EHYA 4LFBB 4O8ZA 4I4NA 3Q3IA 4LYAA 2C7PA 1R6BX 4Q1AA 1V1JA 2GPBA 2GZ3A 3GY0A 4Q4AA 1HE2A 4CLOB 2D4AA 4R0NA 4D57A 4K6OA 1G5FA 3IP8A 3V48A 3K6SA 3GFTA 2F4VB 5A3QA 2G5PA 1FZTA 3DG9A 2IELA 2OHXA 4F46A 1PGJA 3U7HB 1PO7A 4YRGA 5HS4A 2GBLC 3OPXA 3P71T 2OQ2A 4JBWA 3SJ7A 1T1JA 1PR5A 4GR5A 2O8BB 5LYJB 3I6MA 3NTXA 4QFMA 1MABA 2PCLA 4H0FA 4DPMA 3EXHB 3CRMA 2EFHB 2BZSA 3VR2D 3VQTA 5L3RA 1J24A 4OREX 4WV3A 4GS5A 3D7KA 2WWRA 3CNHA 3EVBA 4P5EA 2NV0A 1L7OA 4UTVA 3VJKA 5FJIA 1Q21A 3HL0A 2VAMA 1BQ4A 1FS4A 2J7PD 4RIEA 4DLLA 1M2VB 4HSEA 3K30A 5J1TB 3T9DA 3ZXYA 3HYLA 2PZAA 2BUCA 4G4IA 3EIQA 1YNSA 2CCKA 1CEYA 1TC1A 2DLNA 2O1SA 2RGYA 3OPMA 5K3DA 4BO6A 2MTBA 2XITA 3VI4B 3IVGA 2BE9A 1U1GA 2Q3CA 2F4NA 3KG2A 2CNKA 3I6YA 3KAJA 5FULA 1YF3A 2J48A 1G8PA 1HO3A 1NDUA 1QC5B 1RXIA 1YDEA 2YL2A 4RHUA 4W82A 4BE4A 3DP7A 1DADA 1X3SA 2PD3A 1KYXA 4FC7A 1AGYA 3LC0A 3NFRA 3P52A 3IURA 1UL1X 3FPJA 4TMXA 3WLIA 1E4EB 1Q0PA 4F4DA 1XPRA 2XCLA 1A5TA 2Q0SA 4UQOA 4LGYA 1RRVA 3WQQA 2D7JA 2XUDA 1X0XA 4ZICA 3ET5A 1LS6A 2BGIA 2HC9A 4EGQA 3HCBA 1EXWA 5L4NA 1JFVA 3LO8A 2Q7OE 1E7QA 2IW3A 2PT9A 2ST1A 2ZUWA 5CBPA 1L7RA 3VMFA 3AJRA 4B5KA 3Q7TA 4ZU1X 2WPNA 3JATA 4RVUA 1NRJB 2Z4SA 4LVCA 1TT7A 1MJFA 1T5DX 3AVOA 1XN1A 3EF0A 5FPYA 5THKA 4PIMA 3BCRA 1IK6A 4KR3A 1PAUA 1DWUA 4K9NA 1ZK4A 4N18A 1OLXB 4X64B 1VL1A 1L5LA 3UANA 3R76A 1IB0A 1GNVA 1SULA 3CF6R 2I2FA 4EVIA 2G7ZA 2DGDA 3DL4A 2EWMA 1QYDA 2CLKB 4ER0A 2ZB4A 2M6LA 5ARDA 2QM7A 1VIVA 3X1WA 1I0IA 1YB5A 2A0XA 2ZBUA 2QAIA 3COYA 1YZ3A 5CA1F 3VNRA 1QG6A 2VP0A 3NHSA 3UMFA 2ABWA 3NJ4A 3OIGA 4B87A 2YWCA 1SA0A 2UZ1B 4CDRA 2X0FA 1YQTA 5DBHX 4E51A 3CKKA 1I14A 1CR1A 3VKFA 4B4UA 4DJJA 2YUTA 4M54A 4R3UC 4EEXA 2VKQA 3KYCB 3ZJYA 4I8XA 1NFQA 2PRYA 3NAGA 5CXSA 5DBOA 2IHKA 2EKLA 2GEUA 1VG8A 4QGAA 1RPNA 1TVMA 1PL8A 1PTKA 2OGSA 1GN8A 2VDUE 3E15A 4YP9A 1GHTA 3E5NA 1T2FA 4R6XA 4PNEA 2PQ0A 3KJZA 4NIMA 2IU0A 2BFMA 2C04A 2ZPTX 5LXTF 6PFKA 4EYEA 4CG1A 5JD4A 1FSPA 2J3QA 4FDTA 4POOA 3ABQB 4CM9D 3HXQA 3KQLA 2NZVG 2YVQA 4I8IA 2I8AA 3SOZA 1KL7A 2OORA 3FTNA 4PZCA 3I61A 2DPGA 5I7WA 3QPBA 4MP3A 3BJEA 4PYKA 5C0OE 2P7HA 1YQ9A 2PLWA 3I9LA 3M4NA 4ZEWA 5IAAA 3EVDA 5CH3A 1XZJA 3FPCA 4RABA 1DHTA 3TAUA 1WOMA 1NSFA 1E61A 1N8SA 2OHGA 2DLDA 3A8TA 2JFBA 5H02A 3T4UA 1FQOA 3UMCA 1EXDA 2VR1A 2A1TS 3EVTA 4PSDA 3UHJA 3DSRA 3WL5A 1EINA 3BRSA 1N25A 5G4KB 3P9SA 4FDUA 4OQNA 2YDXA 5LC1A 5AYVA 3IMFA 1JQBA 2GN1A 2I2BA 3TOZA 3T3MB 1TAUA 2V8OA 3A25A 3MJFA 1EB9A 4Q4DA 4BO4A 1RWWA 1K06A 4LY3A 1XTBA 2C98A 2PGJA 2GM9A 4KWCA 4LCBA 5JTUA 4TZ6A 1J20A 3SM9A 5B3JC 5AJZA 5CDYA 2BI7A 3IB3A 5ITSA 2BFBA 2ZUFA 2WSYB 1TGVA 4JSRA 2I55A 2K2WA 2ACWA 3CLHA 1AE1A 2EP7A 5AO9A 1GTZA 2G72A 4E5MA 4L5AA 2V5UA 4UAGA 1JVNA 4KN9S 3QP9A 3GGSA 3H9JA 4TTTS 1ZO8A 4V0QA 4EVSA 4ARBA 3EDRA 3JZIA 3NC0C 4OH1A 1KXZA 1ZY2A 2W4IA 1SCNE 3JYPA 3L1JA 4LVOA 4Y9TA 5CNIA 5T4BA 5FBHA 5A5EA 5KQRA 4N0PA 1XTPA 4XRRA 4QJ5A 3ZI0A 3UM9A 3QWIA 4MVXA 1JDBB 1P4JA 3ZJTA 1I6KA 5BRAA 1C9DB 1EX7A 1HDEA 1SD2A 4OK3A 3RAFC 2X9LA 2DX7A 4G1UC 4HLUC 4OQEA 4ND1A 3S2EA 2ZRGA 3PHGA 2C8JA 4J7AA 3C41J 3Q9NA 1NVAA 4RE5A 3T06B 4F56A 3PEWA 5J5AA 2I6UA 3HJTA 3ZZ1A 4EF5A 2PH7A 3MINA 4ABTA 5AW1A 3H9GA 1N9GB 3AESA 1DRUA 5KMGA 2WM2A 4HDCA 3V1YA 1OBCA 4G09A 3RT7A 3CLUC 3BMNA 3PI7A 3BB3A 3HACA 4O2AA 3T3DA 3CVVA 4HEA1 1DG9A 2GLTA 3I5UA 3WL3A 1NMQA 2BTOA 3MOGA 1MB0A 1CNMA 1VP9A 1YIAA 3KQSA 3LRXA 4WKBA 5JSKA 4IQGA 2I29A 2JLCA 3TRHA 4DTIA 5FBVB 1EUCA 2WYOA 2ZWAA 3F7OA 3LUFA 4MB0A 2OQVA 1CZNA 3CNQS 4KRXA 1V1RA 5TNXA 4QM7A 1EFTA 1JLSA 1ZW6A 5KWSA 2O8EA 3BMOA 2W6ZA 3KUXA 2XNHA 3IUEA 2VRCA 1KHTA 4P93A 1QLHA 1MAVA 1YOVA 2WF8A 2V7TA 4NLLA 1B4DA 4LMRA 4WUVA 2VWPA 4XSGA 2JJQA 2VA9A 1DCFA 4R9UC 2VUTA 1I30A 3QU4A 2NTNA 5EC8A 3TLXA 4CQJA 1EPUA 3SF8A 3NEYA 5LQKA 1W36B 2EIXA 2ZATA 5ES4B 3H0KA 2OQRA 2WFLB 4FS8A 4MQUA 1DJOA 2NSJA 2FWPA 2L69A 2E4UA 5EZYB 4EPRA 5C1PA 4BMXA 4I55B 1CQIB 4U2EA 5FT9A 1O58A 4XB6B 3GRRA 1RYNA 4DRYA 4F91B 3P32A 5ADVA 5IBPA 5J2TF 2QD4A 3ZHXA 3OX2A 4WLNA 1WHSA 3FBGA 1WV0A 5FTKA 1HGXA 5I4BA 5KTYA 1G55A 4OP3A 1SG9A 6LDHA 3BXPA 1YC2A 5JU6A 2XSZA 2G9UA 4MVYA 4ZDKA 2UUOA 1K7CA 1GTJ1 4KE7A 1B7GO 4PRYA 5GJCA 4GMHA 1B6GA 4K1LA 1Q92A 1MDFA 2VWHA 1FXWA 4EQ6A 3FWNA 1H0KA 1IB6A 1Z8FA 1GFIA 1O4WA 1C5KA 3EMKA 2A7XA 4KAAA 2AEMA 3OM8A 1M5TA 3M4YA 2HBRA 3DAYA 4GYWA 3T5AA 3VJLA 3BTUA 4UC0A 2XUOA 1G3UA 1O95C 3IUSA 3TR6A 3GFQA 1WO8A 1QO0A 2PZJA 4LZWA 4V1CA 3IAEA 2P5UA 2BCJQ 2FMHA 5DGTA 4AY3A 3D8TA 1X7GA 1LVGA 1MA3A 3WLMA 1WVGA 3DZBA 4OI4A 5K03A 1VI5A 2BAGA 1R3DA 3KPVA 1ZOOA 3OO1A 1ONOA 1FDTA 1Z0DA 1CC1S 1GZVA 1V9CA 1QV7A 1RKXA 1IN5A 1C9EA 2J07A 2P11A 3B3JA 1J25A 4B85A 3EE6A 4IFBA 4RA6A 5BN5B 3WHIA 1SCBA 4MLZA 3JQCA 5A02A 4ZYVA 1LNZA 3O21A 5EJ7A 2I33A 4PZDA 5JATA 5D85A 5TPZD 1ADYA 3RQSA 1JHVA 5CLJA 4O4HB 1IM2A 3MCAA 3G13A 3MCUA 2P3LA 2GD2A 4ZARA 1VJGA 4BNWA 1XD8A 5EJGA 3SC4A 1UMDB 2CZQA 5CTJA 3TZBA 4JJ8A 1AZSC 3KOZA 3H9CA 1XMSA 5B58C 1GV0A 5JW6A 4TZTA 2NVOA 4KITB 1YRWA 1L4FA 1LNQA 1RXEA 1EJ2A 1PD0A 5IUJC 2C0QA 1G8AA 1A7JA 4ZREA 1R6XA 4UHKA 2OHVA 3NB0A 4OJTA 1IEQA 2FN3A 1XAJA 4HLCA 3SVZA 4QQRA 3U4AA 3A31A 4R2KA 4DY4A 3SU8A 4E4YA 3TIFA 4ENRA 3I64A 1XD9A 2ZBEA 3PPYA 5CXUA 2C3PA 5JHHB 5FLXA 2GJ4A 2NU6B 3BOSA 3FF4A 3HXPA 5LBIA 2OG2A 1NVGA 3OZ7A 3AEZA 4M9QA 4BC1A 4ZI7A 5FI1B 5J2UF 2P6RA 1V11B 1HBJA 1H1LA 2GUGA 5ALLA 2Z2JA 1E7SA 1OBHA 4MV3A 2O0HA 1KRHA 2WKPA 3D3WA 4HDQB 1ZIDA 3SIPA 3FYUC 3RS0A 2ECPA 5JSQA 3K6KA 3O82A 1ZA2A 2W6JA 2W6QA 3NTVA 4CIDA 1FP2A 3IMGA 1YS2X 3KKEA 5K0FA 2Y9PB 1P0PA 4LISA 4OI0A 1XNHA 2OZLA 3UFXB 4Y30A 1VXRA 5GINE 1GNSA 3IMKA 2HADA 2NNLD 4J0CA 1OH8A 1UXOA 2GXAA 3QU7A 3AKEA 2J0UA 1IYZA 3VI3B 2OMEA 3TSWA 1AGNA 2BM9A 1HI9A 1MT0A 3OA2A 1V35A 1T2VA 2RGGA 3N2KB 1PJRA 1K7YA 3THSA 1BS1A 1XBTA 2RSLA 2WRZA 4DV0B 3TR5A 3RG2A 3OO0A 4EY8A 1SBHA 1HLFA 3ESCA 3A14A 1GKIA 4TKZA 2V9PA 1P39A 3DBHA 1Z3IX 4RJLA 5I7HA 5AM5A 4WK2B 2DUMA 3E8XA 2IKSA 2VAXA 3OIDA 3IPAA 3PHJA 4Y1EA 5IH3A 4AFNA 2ONYA 5KOHB 4LC0A 2IYAA 1FLVA 1E1RA 3PNVA 4Q12A 2AEFA 2QAGA 4FI3F 2G5GX 3PC8A 4V0KA 3OOWA 2GD1O 1SVKA 1RMYA 5EFZA 1TE2A 1IZ0A 1ZLYA 2YXDA 3T9EA 3WB0A 5C8XA 1N0UA 1G1AA 3BBPA 2WP0A 2Y0DA 3I1IA 4Y2XA 6GPBA 5LOVF 4M6WB 3N8DA 3ZDEA 3AF3A 4JI7B 4TPKA 3SQWA 1P44A 2ZYAA 2RKWA 2PD4A 1IXRC 4UUQA 5KYUA 5UKDA 4BEVA 4DQDA 5DWDA 3PZBA 1V8PA 3LLVA 1M2KA 3PQEA 1MC1A 1LDEA 3Q8WA 3EGXB 2GPYA 4XWYA 5JXIA 3OY2A 2O8DA 3M70A 4BY9E 3SS8A 2GK7A 3CZ5A 5DK4A 4CCAA 5IVHA 2A86A 3SS9X 1ZVMA 3OLCX 5ALJA 4RKEA 2F90A 4AUKA 1ID1A 2WTBA 4R1SA 3ZNQA 2FWBA 1E4YA 3TE7A 1C3LA 1JA0A 3A28A 4RBNA 3O8CA 1Z6AA 3DDUA 3NHYA 2QIPA 1Y63A 3CLRD 4NX2A 2Q5FA 4B4KA 4LQCA 2GTHA 4WKGA 3ZW9A 5EHNA 4X1IA 1CUBA 3IPRA 2AOUB 4M0MA 1HEYA 2HH9A 4EHIA 2WJIA 4JA2A 4RJTA 1Y9DA 3BICA 3UK7A 1BGVA 3VVBA 3I8SA 3C7DB 5AQ1A 3LCRA 4YT4A 2FZ5A 3JZAA 2ZIZA 2E4AA 4FBLA 4B3FX 5P8WA 4RIHA 4DBLE 4KACA 1QIJA 2C29D 4A5OA 4G67A 3AERA 4I2NA 4LV6A 3I5XA 3IQXA 4Z3KA 1CRWG 3O8BA 4Q5IA 4HFRA 5AKIA 1C7IA 5B3LA 1SZDA 3VAAA 2P9GA 5AVSA 3RYFB 3Q3VA 4FLMA 3ICWA 4WFKA 4K6GA 4HD8A 3UB3A 1JR6A 4PC7A 4EUEA 5CFLA 5F73A 3F0TA 3H16A 4JUIA 2OXTA 3WLPA 1KEZA 3E23A 1G3RA 2I71A 1CJKC 1KZGB 3ZWOA 5KJEA 2HF9A 4YRQA 3THXB 1Z2PX 1K7SN 1QAMA 3WA7A 1EVYA 2HA6A 4UU8A 5I8ZA 4FR0A 1MDBA 2H2FA 5KVVA 4XCVA 2IUYA 3L8CA 3PTAA 2BIFA 3A26A 4DV7B 2VCHA 3W04A 2AKYA 4X8MA 3UV7A 2V6MA 3P94A 1VMEA 2QN7A 4FOTA 1QCYA 4WL0A 1BVHA 1U3CA 1Z7WA 3CRZA 4MWOA 5TF0A 3ZDCA 4NU0A 2L42A 5WRFA 2EBWA 3K70B 1ADBA 4XGNA 2PLAA 4WEOA 1M74A 1F6WA 4GPTA 3VNUA 1AG9A 2A9OA 4OKIA 4BB0A 1ZONA 1X74A 1MENA 4ARCA 3EPJA 2XEXA 4MI3A 3ZHOA 5ELXA 2HBZA 2GSWA 3HG7A 1JHXA 2CNNA 3PC3A 3BS4A 2ECOA 3PRJA 1PK9A 1XEWX 1FRZA 2VQDA 2DY0A 4HAUA 3U49A 2H9IA 3HVUA 3ISJA 4NMMA 3LTNC 4TOIA 1FYVA 1H0SA 1WUJS 3OG9A 3VHRA 1KHHA 1FFEA 1RWNA 1ST2A 2PRSA 7ABPA 3MGBA 1GM5A 5KOYA 4P98A 1XOIA 2HF7A 1RCUA 4RV9A 2YJZA 2ZUDA 2ZSJA 4V24A 4BKUA 1QR2A 3U62A 5CAEA 2H1RA 1VCIA 2VQFB 3RVSA 4O08A 4G1CA 3M6AA 1PYDA 2CXNA 2B69A 1GAEO 3FTPA 3W7AA 4XVCA 2AG6A 4D8VA 4FFRA 5LQNA 3PBKA 4GSKA 1EZZA 5AK0A 1CZHA 3GLKA 2JIDA 2IBSA 3JAWB 4P7JA 1MN6A 2SNIE 2ZDQA 2FDCA 1D7OA 2DMRA 4JUBA 1Z73A 1YZNA 1DC8A 2OXFA 2YWRA 4TM8A 2HEIA 4DAEA 4DTCA 2IHJA 2F1RA 3QPAA 2PZLA 5A2GA 3DMNA 2FPGB 1RBZA 3L82B 1Q14A 4L78A 3TTYA 4CM9A 1Z17A 1DKQA 1TZCA 1IRIA 5MGNA 3GFVA 1UAYA 1W581 2XYPA 3D6AA 1ENOA 1V45E 2C20A 5DCYA 4ZVSA 3GFPA 3R7LA 4D4MA 2PGLA 2GM4A 1XVTA 4FZVA 3ZE6A 1FB5A 1KVUA 3JQBA 5FAKA 5ICGA 4YJKA 3WGGA 3NDRA 4QGFA 1SK9A 2WG2A 2OTCA 3SM3A 4NU5A 2BW0A 2A88A 3L49A 4BBJA 4MUFA 2KPOA 3AP1A 1GDHA 3FDZB 4IZOA 4RFSA 5TRTA 5DOVA 5CLHA 3ND6A 4H17A 3OF2A 2XB2A 2RC6A 2AG5A 2PLNA 5AVTA 3QMVA 5BWNA 4KGZA 5CXQA 1BRMA 1MT3A 1BS2A 1DUIA 1NX6A 1KMMA 3FWHA 2DFPA 1QLJA 4HMPA 4O2BF 4QREA 5GV8A 4BYGA 4EGCB 3L4EA 2RIRA 3VPDA 3M4ZA 3ONWA 3RC1A 4XUEA 2BC9A 4WMLA 1JLLA 3TI9A 1C50A 2DPLA 1JDZA 2EBHX 1S02A 3DTVA 3L8DA 4RSHA 1XCMA 2FUEA 1Z5NA 1B0ZA 4LXGA 4HTFA 3ZCSA 3EHEA 1AJEA 1GFSA 2ZTVA 3X44A 2O5CA 2AUTA 2V1XA 1N2JA 1BEUB 1PJ8A 1UPAA 2ZIXA 3N0XA 4YCSA 4GM0A 1J2UA 3SJBA 2J4CA 1TAQA 2YNMC 4O4LA 4Y0VA 3HA2A 3TQOA 3OH8A 4G86A 3M8KA 3QYFA 4Q7JB 5FYQA 4EAAA 3VC2A 4JMLA 4P3OA 2C82A 2IYTA 4KIFA 1H4VB 1Z0JA 2QGZA 3JQGB 3OFJA 3GZ4A 4PS1A 4Q9AA 2Q4DA 4KXFB 4D4GA 1CHDA 3QQ5A 2CLLB 2YJGA 2RCYA 4KQ2A 1AZWA 2NXJA 4GGPA 5DCUA 4CL3A 1YL5A 2CV0A 2Y0EA 1W19A 2NZWA 4Q4JA 3PE4A 1PW5A 1PQPA 1SVIA 5G3ZA 3CMMA 4DLXA 3DMTC 4FXOA 4I5IA 3HEAA 4RY9A 3DAFA 3EXEB 1RHMA 4JBIA 1RZRD 2GM3A 3AVXA 3EODA 1IVYA 5AXDA 4YUWA 1WUHS 1Q7GA 5PNTA 4JFAA 5TV2A 1PBTA 2BGKA 5A3SA 1KQGA 1VLLA 3EFOA 5JH7A 2VDJA 2XQFA 1QNLA 4ZVLA 4WOKA 2LZ0A 2W6NA 1E2PA 5ITZA 1E7YA 2WYIA 3PDJA 5E38A 1Y3AA 1BG6A 3BGIA 1BD4A 3DZJA 2HUNA 2IY8A 1IPHA 2R00A 3LCMA 4FCVA 5DEOA 4ER7A 5JSHA 3PUVA 3UVEA 1XWWA 5CIYA 2J4FA 4ND5A 4W1SA 5EZQA 3BFKA 4B2YA 2PFSA 1R15A 4W9MC 3H4VA 5ILGA 5JJ5A 1DAFA 5FPQA 1IWOA 4TWIA 3RRFA 5JZBA 3IO5A 3GNQA 4IVRA 4F04A 4L4XA 4A8HA 2F3SA 3H2GA 4BNLA 1YFLA 5HK9A 4AY2A 2FG6C 2PBFA 4C03A 3D1VA 2RGCA 3PNSA 1KQ3A 3KTDA 5CBPB 4EO7A 3H6KA 2WVHA 1LBQA 4S1VA 3MJDA 5I47A 2G5TA 1RRMA 5LA6A 1EDDA 2WOJA 4KQFA 3PA8A 1I1QB 1CFJA 3UMSA 3GLIE 5DT2A 4H9GA 2VOJA 1JKJA 4NZYA 4BN5A 4IKPA 2B9VA 2B6NA 2C5SA 2PM8A 2W42A 3BXOA 5AI8A 4HH1A 1QORA 3S4YA 3SAJA 1E2HA 1TQ8A 3QEOA 3S2ZA 5B55A 1KQFA 4XGIA 2WJ4A 2JZCA 2Q5IA 1K8QA 3PGVA 3SSOA 5KU7A 1JHRA 1UC9A 3FCYA 4HDAA 4NQRA 3CFYA 4CKZA 4C0HA 1BNCA 3DR3A 5EGNA 1VBFA 3BQNB 4JVOA 3O03A 3PPVA 4D8WA 2A67A 1SHTX 2XNDD 3L1HA 1NXQA 1G8GA 2GTIA 3HVHA 2QN6A 2PAAA 2CXQA 2XUIA 4IBOA 1JRLA 1Z8HA 4A23A 4RVOA 3DQPA 4LDZA 1GNTA 1GYQA 1NYRA 4YP6A 2A9KA 3IQIX 1SVMA 4B6FA 4DMCA 2AYXA 4AULA 1JHAA 1JSZA 4EPYA 2XCRB 3K6JA 5DXAA 1OLUB 3PF9A 1YMQA 1GUDA 1DEKA 5CLQA 1D2GA 2O2CA 2X2FA 2XB9A 1PJLA 3DEHA 4FFMA 2QZ4A 4WRRA 3G5LA 5K0ZA 1A97A 3KQHA 5DGCA 5AW9A 1S9DA 2Q21A 4IHAA 1MO4A 1DAHA 2B61A 3GZJA 5KNBH 3JZMA 4H31A 1QYIA 1DC3A 2BT4A 2RKOA 4FEEA 5H7XA 4BTEA 1D8AA 2P75A 5JLJA 5K6RA 3BHNA 4KX5A 5JCPA 1LDYA 2EDAA 2IY9A 2WYUA 1IEWA 2ZSFA 4JT8A 4Z8YA 1X2BA 2NUTB 1EQAA 4FMPA 3IE0A 4WAUA 4Z86A 4IFIA 1N3YA 4NONA 2FFBA 2PL1A 4RFVA 4FJ0A 3RJMA 4UPDA 4JDPA 3LFUA 1GZ5A 3M3PA 2GESA 1VGRA 1IAQA 3E84A 5F12A 1BX3A 2HHJA 4L7VA 3DNFA 4D99A 3NRBA 2ODAA 3QW2A 2GEBA 3HNOA 1JFFB 2Q9CA 3FMOB 4LRUA 1L5HB 2AQKA 2POCA 4B4DA 1X77A 2FMXA 1YI0A 1QCZA 4GUDA 2PD6A 2HOQA 5FBLB 3U7JA 4HNAB 2ZANA 4KQXA 5JJKA 5CVCA 2O07A 4CQLB 1RM3A 3DVAA 2Z5VA 2EW2A 4KPYA 3HY4A 1M8KA 2DFLA 5AK5A 3F7TA 3QM1A 5AVKA 3WJ2A 2HJWA 2JIRA 3B6EA 4N7MA 3RC7A 3F8TA 2GILA 3IOYA 4CLRB 4D92A 4J2TA 1U0LA 4GDFA 2C5BA 3JAKB 3UBTA 4TKUB 3N2GA 4D9MA 3GROA 4JYCA 4DF3A 2G5CA 4I1OA 3LA8A 4UBLA 4A82A 3AP3A 4XJVA 1CUGA 1WDKA 1X70A 3ADCA 4RHCA 4HVAA 3IRVA 3G2IA 3D4LA 5DSXA 3SJUA 3WC4A 1TM7E 4G8DA 3FUXA 3GH3A 4JWTA 4AMBA 1T8TA 4D8UA 1V47A 1CUJA 1P29A 2CF5A 2FZLA 2QUBA 2YHUA 3BJZA 2YDYA 4I1VA 1U3WA 2WUEA 4HDRA 3RWMB 4AI6A 5GTDA 3HGMA 3O7MA 4IY1A 3VR6H 4ZGWA 3T0FA 2HNKA 2OFXA 5E4FA 1N32B 3LGXA 1C8LA 3NWPA 4O2RA 3W9SA 1Z2NX 1Y4SA 2GVNA 1JPVA 1ZD8A 5CX1B 2QX6A 2CVHA 1D09A 2NYAA 3EFBA 4JC8A 3D1LA 4X3PA 5LUBA 3G2QA 2ZCUA 5HRAA 4HXYA 2OYRA 1L8LA 2IXEA 5A1TA 4A0FA 3NNSA 4WNAA 4MHTA 3T0IA 1H4TA 2VDMB 2COKA 2PU7A 3KPJA 4CJXA 4XTRA 3JR7A 1AH2A 1EBBA 3AEQB 4NJEA 1MO6A 3A1UA 3OZRA 1W5AA 3GMTA 5LB2A 2BFEB 4GOKA 4CCYA 3FPEA 4MR8B 4LOAA 1FP4B 5IJ0B 1NUTA 5JS2A 4TWBA 3TD6A 4EO9A 5D5HA 5GOZA 2VTEA 2AE1A 1OAAA 2WHPA 4YJ3F 3L6OO 2Z98A 3CH4B 3VPSA 1RQRA 4HEA6 4BQIA 1EAYA 2J1LA 1O5TA 2L2QA 3B1KA 4PICA 1PSDA 3QSYA 4IWNA 3LDAA 4MLDA 3DCYA 1XP5A 1OX6A 4WCDA 1LPMA 3FGNA 2QQFA 3DW1X 2G1KA 1L7QA 2YZMA 4WINA 5B1SA 3U2QA 3SDZA 2O20A 3HPRA 3NBUA 3KXKA 3WKEA 1M3SA 2IZOA 1RS0A 1U9JA 4JUDX 3MHPA 3NVMB 1SUPA 2I1WA 2GJSA 3QUCA 3FPHA 2DWQA 4F2DA 2YIJA 4D45A 4HYQA 2ISSD 3PNPA 1F5NA 2HMAA 2PMKA 4PNPA 4EEZA 2XDQB 3CSSA 8LDHA 4FGUA 4REOA 3ZWCA 3GG2A 3ZGZA 1XTVA 3OZXA 1EGVB 4OOFA 1YXMA 4QAQA 3E1KA 1SBNE 4DM4A 3D6HA 1YE5A 4YRFA 5EPOA 2LWIA 1GSAA 1H8ED 2IOYA 2ODEA 2FZGA 5K4HA 4RTOA 1LVUA 2H5LA 4QQFA 3KALA 3NW9A 2W90A 1D0VA 1Y81A 3DC7A 4URYR 2DKOA 4QDTA 2KB0A 5A4JA 5C46F 5G0WA 5LUAA 1DIBA 5FA8A 2WG0A 6REQA 1HY3A 1HE4A 2AS0A 3AIIA 4KQMA 3C3CA 4PLPA 2ZJZA 2NUPB 3IBFA 4FDAA 1Q84A 4RMHA 2Z4RA 2PX3A 1G6KA 1NI3A 3AUFA 1CB7A 4MYSA 3EAQA 1P80A 4RZUA 5IARA 2AW5A 2I4MA 3RSSA 3SZRA 1KYVA 3DKKA 4MV0A 4XDYA 4RVCA 3QYAA 4BX0A 5JO9A 1I2BA 1TW3A 1YJ8A 1K3TA 1IQPA 2CC2A 2D3WA 2QNBA 1VJRA 4PIVA 3K5IA 4XR4A 5KYKA 1ADJA 4CMKA 4Q3EA 1EGAA 1ZC4A 1AV6A 1NF3A 3DEKA 1IN7A 1E18A 2R4QA 1TVEA 3A6DA 3FCCA 4QYSA 4RHXA 1LDGA 3SYTA 3KEMA 4YAWA 2C95A 4JDUA 4PPNA 4MCJA 4G5OA 4ND2A 2WVAA 1QBKC 3EH1A 4HDNA 1E3QA 4Z9XA 4DA4A 1R6UA 4S1WA 3WA6A 1HURA 2X8AA 5EFOA 2YJTD 2JG3A 3QE0A 4RAOA 5HR5A 2ZI9A 2Y1FA 4EY3A 4NECA 1W5TA 4IHKA 5C5EA 1G19A 1SAYA 3Q40A 3T1OA 1LPBB 4ZOQI 1HMPA 1G9SA 2BPOA 5CK5A 3JQ9C 3VO9A 1SUDA 1OWOA 4JLSA 4XASA 5A9SB 1GGMA 4KPFC 3K5WA 3LPNA 2R60A 1PV4A 1Z4QA 3CGWA 3THYB 4TL8A 2UUCB 3ONNA 3HU1A 3AHJA 4PY2A 4PAOA 3CURA 3O8OA 1E6LA 3ZQJA 3NHJA 3Q15C 3R9KA 2HDWA 1IZYA 5DCLA 3F6YA 5U4QA 1ODSA 3D6FA 3DFZA 2CBZA 1TPZA 3DDNA 4PC3A 1E2GA 3MS7A 3P19A 4UBOA 1U99A 3ONFA 4WY8A 5DN9A 1V4VA 4W4TA 5E2IA 2MR6A 1NAHA 1UXKA 1XKQA 2WSSA 3QOFA 4UUAA 5BN3B 3AFHA 2MOKA 2UYYA 2YXLA 5EHQA 1VLJA 4FQ7A 1W5FA 4WXRA 2IZ0A 4R1PA 2BRUC 4MEJA 1P2GA 3AOEA 2ZSAA 2JGNA 2W6MA 3CONA 1JEYA 3PC2A 5JD6A 5JC1A 1NN3A 5IZ4A 2WT8A 4K87A 4GWGA 2JCBA 1XTUA 4R83A 4TKMA 3PV0A 2QJOA 4DLSA 2Z0MA 1CK4A 2CXSA 3AOGA 3D43A 4Z1MA 3HKEB 2D0OB 2ZIGA 1DKLA 2ZTMA 4UFPA 1CTQA 1W73A 3MQ4A 1GLNA 1TL7C 1M34B 4L72A 4YDHB 4HB4A 1JR3A 2EZ4A 1QH8A 4K8OA 1EVLA 1NU6A 1Y8AA 3UH0A 1KRWA 2QLFA 3ILSA 4DIUA 5TT1A 2VYND 4O4IF 3WK7A 1X1EA 4CEIB 5EYPA 1WMSA 2X13A 4TV9F 2N47A 2V7QD 4C2TA 3PNLA 1YCHA 4RVFA 4C6HA 5A4KA 4OUKX 4IPTA 3CWQA 5HIJA 4ZIRB 4LDNA 3L05A 4IEIA 2FEOA 3AVUA 2VG8A 2A5GA 3TBKA 2HRBA 2OM2A 2PRZA 5ENVA 1H3FA 3G9TA 3VAZA 2W2XA 4Q21A 2R7MA 3UWOA 1U0BB 2OCDA 3CPHA 4ZYUA 3QFTA 4ZAYA 4B80A 1SRQA 1L7EA 2L0XA 3A05A 5IYZF 3L0CA 2QD3A 2WA2A 1AV7A 2ODNA 2VO1A 4WEQA 3Q2KA 5DBFA 5DP2A 1ZXLA 5K99A 4L0MA 2IP2A 3FCSB 1QVZA 3G8BA 1IBSA 3QOYA 1FMLA 3CH7A 1V6SA 4YVFA 4AKTA 5AUQA 1NV9A 2WAMA 2VJKA 3L01A 2JCXA 4PYLA 4AAYA 2F9LA 2GEDA 3BWMA 1TYEB 2QTBA 1GPMA 2XDAA 3DBRB 3GI1A 3WFIA 1I9GA 4CDGA 1A7AA 3CLUD 2GYYA 1PKEA 2LV8A 2B78A 4ND7A 4G4GA 4CM4A 4CKEB 2HHHB 3LA6A 4QX6A 3RYHA 3TOCA 3G1TA 3DOEA 5EXPA 1ONSA 1UFOA 1YQQA 1T3HA 1ESNA 1BCSB 4MPRA 5HMLA 1TKBA 1QS0B 1X7WA 2HIAA 2JIZA 4KLAA 2VDQB 3DPUA 3URKA 3ECSA 1BCRB 2NN3C 1NVEA 2QORA 5FJJA 3AH8A 3VZCA 1U3DA 5EP1A 5GOTA 1Y5NA 4FSXA 4ZRMA 1WU8A 4UTZA 5JYEA 4TROA 2EHJA 2BJHA 1TUBB 4EMUA 3Q3JB 2G70A 1GPBA 4OVKA 5ALNA 2X1HA 2IPLA 3NGLA 4Y2SA 4CM6A 1L8AA 1TQ4A 3LMKA 3QNWA 4JY7A 2F67A 2L18A 4YJGA 5H9VA 5EHXA 5K8CA 3UEOA 2R4UA 4FIDA 4M55A 3A06A 4UUBA 4R84A 5DW3A 5K01A 2JLYA 4PR3A 1CEEA 1ZESA 2TSYB 4MUAA 3NEAA 4NBNA 4UD6A 5JTTA 1NMYA 2Y76A 3G2HA 3MUFA 3A36A 3DE4X 2LRHA 3TL3A 2Q5HA 3I12A 3VOAA 3G5UA 4ESOA 1RIFA 2XMCA 4UTOA 1G41A 1SXJB 2ZI3A 1DDOA 3LRPA 3OZSA 2Z1DA 1AVTA 1SUAA 1U9YA 1PS0A 1PTJA 2J3EA 4TTPA 4XQEA 5AM3A 1QU2A 3UYKA 1LC3A 1EXMA 1IJFA 3OUUA 2XOEA 3P5SA 2Q5EA 4RNDB 3V1LA 3WGYA 3K6RA 4ZAZA 1NATA 1MEJA 4GD3Q 5IM5A 1ZMTA 1II9A 1KQNA 1P8AA 2O59A 3GFFA 4R4JA 3NHRA 3KR1A 4Q48A 2NU7A 4D6XA 2PE5A 2ID9A 1JHMA 1R4NA 2PNFA 3GZTB 4JMPA 4NBTA 3K71B 4F97A 1N5JA 2C5GA 3BMCA 1YI8A 1XXLA 3I5MA 4JB0A 4ZAVA 3RC3A 1MJNA 4DUGD 4C3VA 2VF2A 3UMRA 1T3TA 2XX3A 3EC1A 3IB6A 2X40A 3IIEA 4FKZA 1O95D 4ZP1A 1LF5A 1PEKE 4B3XA 4TN1A 4CLDA 2G4VA 4LXIA 4RD0A 3VPFA 1XQ6A 3Q6MA 4D3DA 2A5DA 3VR4H 1LRKA 1H4QA 3A6GA 3ECAA 2ODPA 4OJQA 3RASA 2C42A 2OCLA 1VA5A 2X23A 2ZI6A 2PUHA 2VZEA 4YCMA 1AQLA 3WAJA 4GVLA 2WMYA 1CSEE 5FEUA 3BD8A 2ZEJA 2V65A 3ISTA 4IAOA 4JBXA 4WLVA 4EJFA 1GPUA 3TTUA 5BMOA 1PJ2A 3L7KA 3OIFA 2ZM6B 1V26A 4XM0A 4EF4A 4DNFA 1YVEI 4QJIA 1NAIA 2CDRA 1DQPA 1P74A 3A9UA 2C83A 1EKXA 3GVHA 3HUDA 1YZUA 4Q4LA 2ZP1A 1P33A 3GGCA 2QP9X 4KKVA 4KO4S 2J0QA 4MV8A 1M1NA 4W5TA 1PR0A 3P45A 4D81A 2BFPA 2CDCA 2EX1A 2X15A 3OMLA 4I5DA 4KCGA 1ZWLA 4OQQA 4OLJA 4Z49A 1Q7CA 2YINC 1LBSA 2AFIA 4HMQA 4HWGA 1BZYA 1A8QA 4X93A 4YYZA 1CQWA 5TVGA 3LQ1A 3CGGA 1B14A 4C0BA 5A6SA 1A72A 2FZKA 2GI4A 5A62A 4KSCA 3GFSA 2F48A 1WCIA 4NBLA 3I09A 3VUEA 1YQGA 3TUJC 4E03A 5SV2A 3EW7A 4MQMA 5KSPA 1VHJA 1EXVA 3HXKA 4FEYA 4XYMA 1HL3A 4EJSB 5KJCA 3VV3A 2JJ8A 4BDSA 3TNYA 4DG8A 2HXGA 2JCVA 4KMMA 4YRBA 3LK6A 1Z9BA 5K09A 1KJYA 2P2SA 3A7EA 4P35A 2MINB 2WHEA 1DDIA 5B57C 2OAP1 4G1VA 5AMXA 2P1DA 4BV3A 4RHTA 5LFAA 3I1YA 2R47A 3I6ZA 4HP8A 3HWRA 4JQOA 4YMWA 4U6QA 5TQVA 2W6OA 4AECA 3ABIA 1M72A 1F2UA 4R2HA 4ZOEA 3MERA 3HABA 4ZAGA 2Z2XA 1PT7A 2RB5A 3MJVA 1U0NA 4ND8B 3ESDA 4W6QA 4OQPA 5BOSA 3ZV3A 3RNLA 3ZI7A 1E3TA 1SC3A 5M3BA 5K3FB 5KJFA 1SUFA 1D3AA 1DBQA 2B1JA 2CFIA 4D26A 4KFUA 4ZO7A 4MGZR 1JHDA 2ZRKA 4LWOA 4M46A 5FTMA 3EXIB