1JDZA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase with formycin b and sulfate ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
234
structure length
226
Chain Sequence
PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 76
structure length 226
sequence length 234
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jdzA00
3UAVA 2Q7OE 4WKNA 1TCUA 4IP0A 3OPVA 4H1TA 4ECEA 3FWPA 4D8XA 4L5YA 4D8VA 1Z39A 4M7WA 1K27A 3FOWA 3ONVA 4G8JA 1RXUA 5FAKA 4TS9A 4DA8A 1ODIA 3P0FA 1NW4A 1PK7A 1PR5A 4PNPA 5B7NA 1TGYA 1Q1GA 5F7OA 1Y6RA 4YNBA 1PF7E 4P54A 4WKOA 4F1WA 1JDZA 3BGSA 4BN0A 3P0EA 1U1GA 4JWTA 5I3CA 4K6OA 4LNHA 4DA6A 4DAEA 1JYSA 3UAWA 4UC0A 3KVRA 1B8OA 3OOEA 4GLJA 3KU4A 1TGVA 1Z35A 2HWUA 3LA8A 1YRYE 1RYZA 5EPUA 4WKCA 5CYFA 4GMHA 5F7ZA 3D1VA 1RXCA 1T8SA 4LNAA 1G2OA 1OVGA 1A9OA 1RXYA 1JE1A 1Z34A 4QEZA 5F7JA 1ODLA 5F73A 3UAZA 3BL6A 1OV6A 4L6IA 4U2KA 1Y1TA 3K8OE 1V41E 4EARA 4G41A 4MCHA 4TTIA 1NC3A 1NC1A 3SCZA 3NM5A 4TS3A 1Z5NA 3DJFA 1VHJA 1M73E 4YO8A 4LZWA 1T8YA 3DDOA 3EEIA 1XE3A 4TXJA 1ULBA 4PR3A 4L0MA 1V45E 3LGSA 1I80A 3LBAA 3BSFA 3IOMA 3IEXA 5JPCA 1WTAA 3PHBE 4LDNA 2QDKA 3O6VA 4EB8A 4QASA 3OZBA 3NBQA 4TXMA 5IFKA 3PNPA 1V2HE 3DF9A 1RT9A 3BJEA 1C3XA 2ON6A 3NM4A 1ZL2A 4KN5A 2A0XA 4I2VA 3FUCA 3MMSA 1JDSA 4YMLA 1OU4A 2AI3A 3MB8A 1PR2A 1T8WA 2AI2A 3DP9A 2I8AA 1U1CA 1SD2A 4NY1A 3E9RA 4OGKA 1K3FA 5EUBA 2H8GA 1PWYE 4JP5A 3GGSA 4LKRA 5C80A 1JPVA 3KUKA 1U1EA 4WKPA 3FB1A 3EUEA 5B7GA 4F2WA 4DANA 5F7XA 1A9PA 1Z36A 1A9RA 1U1FA 2GUWA 2OC9A 1T0UA 4JOSA 4F3KA 3KHSA 4TXLA 4TYMA 2QTTA 1RXSA 1A9SA 3PHCA 3FNQA 4F3CA 1ZOSA 3E9ZA 4TXNA 2HN9A 5F78A 5CXSA 2OC4A 1JP7A 1QE5A 4OY3A 1JDTA 2HRDA 4TTAA 2AC7A 4X24A 4QAQA 1YQQA 3EUFA 2AI1A 2ISCA 1PK9A 1T8RA 1N3IA 1A9QA 3KVYA 4DA7A 5ETJA 5F76A 1Y1QA 1Z37A 4MARA 4R31A 2A0YA 3UT6A 3QPBA 3ODGA 1JE0A 4F2PA 1Z33A 3EMVA 4OF4A 1SQ6A 1TCVA 3OOHA 4FFSA 1ULAA 4OEHA 1ECPA 4D8YA 4R2WA 4M1EA 1K9SA 1PKEA 1B8NA 3T94A 4L5AA 5IU6A 3TL6A 1CG6A 1TD1A 4QFBA 5CYGA 1A69A 2QPLA 4MCIA 4DABA 4QATA 1V48A 4TTJA 1CB0A 4WKBA 3U40A 1SD1A 3O4VA 1VHWA 1VFNA 4OJTA 5KB3A 4G89A 5B7PA 1YR3A 5K1ZA 3F8WA 1OUMA 3DPSA 1V3QE 1Y6QA 2A0WA 2A8YA 3INYA 3UAYA 5CCEA 3GB9A 4BMZA 3OZEA 1RCTE 4DARA 4BMYA 1FXUA 1LVUA 1JDUA 3KVVA 1YBFA 4NSNA 4R2XA 2HSWA 1RSZA 1Z5OA 2IQ5A 4YJKA 4L5CA 4OGLA 3E0QA 2QSUA 3ENZA 4E1VA 1YQUA 1Y1RA 2OXFA 2RJ3A 1LX7A 1PR1A 1PR6A 4D9HA 1PW7A 3OF3A 1Z5PA 1JDVA 3K8QA 3OZCA 5CCDA 1LV8A 2BSXA 3PNSA 1VMKA 5F77A 4GLFA 2OECA 1PR0A 4NS1A 1OTYA 3C74A 3OZDA 3UAXA 4DAOA 1Y1SA 4D98A 4GKAA 2QTGA 1SJ9A 1V4NA 4QARA 1Z38A 2B94A 1RR6A 4RJ2A 4BMXA 1A9TA 3OCCA 2I4TA 3NM6B 5EFOA 5B7QA 1RFGE 5CXQA 1U1DA 1OTXA 1PR4A 4DA0A 4TXHA 5DK6A 3FAZA 4M3NA 1ODJA 2PGAA 2P4SA 2XRFA 1ODKA 1PBNA
chains in the Genus database with same CATH superfamily
4ZU3A 1OFHA 2ZRMA 4DVJA 2XNJA 5CVTA 4B7UA 1AKWA 3LQ2A 4HX9A 3L8HA 1VJ0A 2P6MA 1MX1A 2EC5A 2R5WA 5DCWA 1C9YA 3WK7A 2B1GA 3PKIA 1HZZA 3B20A 4S1WA 3X1MA 3PFKA 4C7MA 1SXGA 2MHCA 3DE1X 4LY3A 3RS8A 5EJ7A 2ZAMA 4RSGA 5AK6A 3QH4A 2BKLA 3PXGA 4BMOB 1XUOA 2WJGA 1KP3A 1DXHA 2PD6A 3AR2A 3FA2A 3NNSA 3OPVA 2W6OA 4QFMA 4JKYA 5BSGA 3TO5A 3DVAB 1RZRD 1S02A 1SHUX 1T1IA 3BZUA 3IAM6 4IDNA 4XYBA 4EKDA 5JNWA 4L57A 4POAA 1EWQA 4Y6SA 5EZSA 5G02A 1DUSA 3TK1A 2ZAIA 4XLTA 5ANRB 2GCGA 3CR8A 3V42A 1DPFA 2X42A 2J3MA 1G8AA 2FKNA 4RYLA 3RS0A 1GCOA 4Y30A 3WJ1A 4JYBA 3ZK9A 1KYTA 1FP4A 1PT5A 2MJLA 1PHPA 2O2XA 2QZSA 5CB0A 2ZJ7A 3JWHA 1QK5A 2WUFA 4PV7A 3TLZA 4Y1GA 3K92A 1ONPA 4BJ3A 2H08A 4NH0A 2IRWA 1KMHA 1CVIA 1QHIA 1ZQ1A 2PLFA 3IB3A 5F12A 3L1JA 2HAEA 3BGSA 3I2IA 1QG0A 4Y9SA 3UC5A 3DHYA 2JHFA 3UB3A 4IIDA 5TF4A 3SC2B 2V98A 4DMHA 5ALNA 5B58T 4RMGA 4WINA 3GC6A 1RRFA 3ZU6A 1TZKA 2Z5GA 4BGIA 2WYVA 1FFSA 3G2QA 4M6WA 1CDDA 1CV2A 4MWCA 4LNHA 5DLQC 5FPYA 1ESZA 3ADDA 4I4LA 1PLKA 1YB7A 4G8CA 4DJAA 3VSAA 4BBAA 4ZI7A 2C9YA 2G1AA 2D5LA 1HEIA 1ORHA 3OOJA 4ZTUB 5GZ3A 3TN7A 2Z2YA 3SQLA 1NT2A 4FW9A 5JMPA 2P9JA 3NV7A 4YJFA 3UKDA 1W36B 2WJAA 3ZX5A 3IP1A 4OHMA 4BKOA 4UFPA 1A2QA 2VAVA 4TSFD 3PUZA 1XDBA 1PL0A 2UYCA 2BI4A 2CLOB 1EM8B 2JGIA 3K6JA 2A58A 3O83A 5IBQA 2J32A 3Q2KA 4JJAA 4RHCA 1Q50A 4H16A 3ZBTA 4BRSA 4RW0A 4AQYB 1E4EA 5FBQB 3Q88A 1SXJA 2I76A 3GARA 3LQQA 4Q02A 1PNOA 4X1KB 3V4ZA 3WADA 2OHGA 3UVEA 3SQDA 3H7IA 4EJ6A 4ESHA 1KJ9A 2JCXA 1NATA 3ENKA 3ETDA 2MYNA 2R7KA 4B6JA 1O5TA 1B8VA 3CO5A 3IP9A 2FW6A 1TQ6A 2ECOA 4ENUA 4D92A 1FNMA 4RPIA 5LKAA 2W0MA 1YIDA 3KL2A 1V11B 3Q3VA 2REXB 4KGXA 3WP1B 1DBSA 1VL0A 2YN4A 2ATVA 4ZAWA 3SMQA 4AKTA 3PEYA 2ZSKA 5AVTA 2A9RA 1T6ZA 3BWDD 3IO5A 3KJEA 4OMFG 1BH2A 1U0TA 1Q19A 2CHFA 1UOQA 4LOHA 3ZWPA 6ABPA 3RU9A 2RK4A 3ZIDA 4EW1A 2ALJA 4LXGA 1K9VF 2JANA 2DBRA 2XTJA 4YC7A 1XCOA 2PKEA 4V0QA 4EF4A 4L07A 1EB8A 1CJSA 2V7QA 2NX2A 3WGTA 1LRKA 1U8AA 2AZDA 2XUZA 4O02B 3J81k 1N8SA 1P72A 5AK5A 4GX1A 3IVCA 3O8OA 1T0PA 2G09A 2IU3A 3D2AA 4ZVSA 2ZIAA 5KJ1A 4ZJUA 1NJ5A 1QANA 2QRHA 3W5VA 5K4GA 3HVJA 1JZTA 3CE9A 1HTBA 3MINB 3RTEA 1K4MA 2B5VA 5FWYA 3FGZA 3FKSD 1KQGA 3JQEA 4UTRA 3DPUA 4NQRA 3UFXB 5AUPB 4LCBA 3F98A 3W78A 4RLSA 2Y1GA 5FUYA 3U4HA 4DNQA 2VBFA 4CR7A 1ZQ9A 4A8JC 5TB5A 5LNK1 1GV1A 2W58A 1F2UB 1PV1A 5B4VA 4HWSA 4GZ6A 4GXNA 2JG3A 1TQHA 4IX9A 3L9WA 3CB4A 2HY7A 2XMSA 3H9JA 1HY3A 4C7VA 1YDGA 2FB9A 1EYZA 4ALKA 4D8TA 1KR2A 3WMWA 1X1AA 3Q6NA 2KBEA 3G0OA 3DOCA 3TVDA 1ULTA 3VDNB 4AYXA 5C5CA 2PZEA 2HX1A 3AVOA 2NQ8A 2HADA 2JEZA 3E35A 2ZXEA 3OZRA 4IFEA 4QULA 4G9GA 5CLQA 4ER3A 2YV4A 4I1IA 2I7XA 1XTQA 4GICA 4PAGA 2EJUA 2HEGA 3UPTA 3P4YA 3DWEX 3GQVA 3FFTA 3LH5A 3ORSA 2DSNA 3W6NA 3DE6X 1W2GA 4YXWA 3PENA 4MPDA 2WU3A 3OCZA 1J99A 2AOXA 4L51A 3T3IA 4TMKA 2I7DA 3FHTA 2VLIA 3OZUA 3ZE2B 4DIKA 1EXVA 1NRJB 3LQ1A 3PPVA 1R4NB 3WMRA 3R5SA 3IR7A 3RVNA 2O2SA 5FP0A 1HPLA 4JQSA 1TF2A 3LL4A 1RHJA 1NY6A 2D2FA 3C4VA 3SOPA 1PJZA 2CVPA 2RKOA 1SXIA 1NP7A 2FQ1A 4KFSA 4A23A 4NJMA 4XUCA 4XQCA 2AN5A 1OU4A 3KZVA 5JCOC 4UOEA 1JWLA 4C7OB 1D9ZA 3OOYA 4RORA 2Z1NA 4Q34A 2H2HA 2B1QA 4TX1A 3WIBA 1J42A 2YWJA 1QIFA 4UHDA 4PG8A 1ABBA 4XCQA 1JVSA 4QRHA 3Q3CA 3W1EA 4M8LA 1CHDA 1QQ7A 1TJ5A 1G17A 2D2IA 1E2JA 2HCBA 2OY0A 2QDXA 2VDVE 4GQAA 2WU4A 1P2GA 2OWDA 3GRUA 3JRWA 4PCAA 3V4SA 3VR4D 3MGCA 3UIEA 3WDMA 4JQOA 4MB6A 1BMDA 4G97A 5IEBA 1U5BB 1XQVA 2R00A 3UKJA 3HBFA 3JQ9C 2CMDA 3R9IA 3BFVA 4JP5A 3ZVRA 2YMPA 2ZPAA 3G17A 3ZV3A 1F4PA 1K3TA 4BHTA 2X1HA 4QQKA 1XTVA 2G67A 5AXDA 1MIHA 3FB1A 4WK4B 2HUPA 1FC0A 1PGQA 3TRFA 3ZJVA 1H23A 2BKXA 3B38A 3OA0A 3D0OA 2C20A 1W4CA 3I9V6 3LKZA 4RJIA 4JOCA 4KDCA 3GPLA 4Q47A 5TF0A 3FRJA 2RSLA 2BFDB 2FV8A 4ETMA 1ULUA 2OLKA 3T41A 2NVUB 4CQMB 4F5WA 3IE0A 4DOMA 2EYQA 1XZGA 3C3KA 3D7LA 1QR2A 1U1FA 1TLLA 3BC1A 3NATA 3W5CA 1M8PA 5LMNB 4GQIA 4MR8B 2POCA 5CG1A 2IV3A 2J6IA 1JKJA 4X8OA 1C4XA 4UVGA 3IIEA 5H3HA 1RXEA 3TAHA 1DP4A 1IBKB 2WKRA 2P5TB 1TT7A 1NTRA 3FROA 5FOTA 2IYPA 2ODEA 4TXLA 1N2EA 4FNGA 4O4HB 5JD4A 3MJDA 2UZ3A 1JFLA 1NVXQ 4BKRA 1M34A 1IDN1 1UKZA 2Q9CA 3PJDA 1KFCB 1OBFO 3ME5A 5L3ZA 3V9AA 1QQAA 1XQXA 2ZWAA 5HWSA 3NDJA 2HYDA 2O14A 3AO0B 1E20A 3NH6A 3OETA 1M2VB 3H17A 3D02A 4WJKB 1U2DC 3IEVA 3L7KA 2A0KA 1JSRA 4H0CA 4RXTA 4E4RA 1JP7A 4OHBA 4JUIA 1Q7RA 4TRNA 2EERA 1AKEA 1W48A 4WOPA 4X61A 4L8YA 1UZLA 4MA0A 1JDTA 3LRXA 3OJ0A 3UMCA 3I9LA 1CR4A 2DHQA 1YZ3A 3W4JA 3DKPA 1GTJ1 2UVPA 2QRQA 1BD3A 1KFKB 2DQYA 4MZXA 5J2UB 5TS2A 4K05A 4BLPA 1FYVA 1G9SA 1PFUA 2GRJA 2W71A 3FPKA 3O8LA 3TDNA 2XYHA 3ZE1B 3PFNA 4C22A 4ZV7A 3A1EA 3JWJA 3K9NA 3LX6A 1CUEA 4Z49A 3S1SA 4I5EA 3MRTA 1K8QA 5KYWB 4H9GA 1MBZA 4KW7A 4F12A 1QMPA 1GPDG 2JIBA 1Z4JA 4ZV4A 2V9ZA 2YRWA 1AIPA 1AMUA 4ZQGA 1D07A 1YJBA 2DF8A 2UYYA 1NA5A 3QXSA 3N0VA 4Q3OA 4QG7A 5U1PA 4C0SA 1GWNA 3LT0A 4EBBA 3HN7A 5EKXA 5LU9A 1OC4A 3D1JA 3ISVA 2CB9A 1W4BA 3FWNA 3C6BA 4UHEA 3VU1A 4AZTA 1OX4A 4EI7A 5IN5A 4NBUA 4YA6A 3KBBA 1B0AA 1C8KA 1ZN2A 2B92A 5JH7F 3QUQA 2QMYA 2FW7A 1JHXA 1U7PA 1MXHA 4QDKA 3ZKAA 1RM0A 1GZ6A 1SKMA 5L3QA 4UBLA 3DHEA 1AZTA 1H66A 1OWLA 2C3PA 1BX0A 1NJFA 3A7EA 4UFOA 5H80A 4X1IA 3STWA 3TI7A 1JA9A 1E2NA 1UPUA 4ERXA 3LDHA 1E3SA 3HRHA 3DUFA 3E5HA 2NSLA 5DM1A 1XPRA 1NSYA 2OHOA 3EWAA 1MJGA 1Z4QA 5KKCA 1TOAA 4TYWA 1PFYA 3T1NA 4Y8VA 1LFDB 5IM4F 1S2DA 1NE7A 1Y8CA 1Z6GA 2Q4BA 1GNLA 3ILYA 4ZPJA 3T94A 3TL6A 4F97A 1FTQA 2QL5A 3W6PA 2HSDA 2CJYA 4DW8A 4CF7A 2ZDQA 2Q5JA 4EYKA 1SQ0A 1QYRA 1YZUA 1RP7A 2ZT7A 3KSUA 5J9FA 1EWKA 1J56A 1V48A 1XDGA 2CBZA 3G2OA 3MJ4A 5CG2A 2FVXA 3NBMA 1MG5A 1JA0A 1PJ4A 2C4NA 4Z1MD 2XITA 1BRTA 4Q3DA 1T0BA 3GLFB 4PRKA 3MWFA 1VFNA 4OJTA 3KJIA 4OB8A 2PGOA 4QDTA 2VL7A 1YS2X 2VJKA 1U2RA 3VKVA 3WLJA 5JROA 1F6DA 3EXFB 4X6UA 1NXOA 2GLUA 1BGWA 5BPFA 3DT6A 4MVCA 2PUJA 5TLSA 3LKDA 5TQ2B 1NVFA 4E7OA 4YRQA 3HUDA 4Z9BA 1RZ3A 3MW8A 1EDBA 3D4IA 4OHUA 3GB9A 2XYPA 5HIKA 1QHFA 2R44A 2FK7A 3DNPA 1YMVA 3G7SA 1X1TA 4TN5A 1Z25A 3VPAA 1DRVA 4W9RA 3NOQA 5HK8A 4DLPA 2UZ1B 4BMYA 3Q8XB 4DT1A 5CDSA 1Q6YA 1ID8A 1KXZA 4DR3B 1FNDA 5HKAA 4CNQA 1EUDA 1HKUA 3EG9B 1MHPA 3KUCA 4NJOA 5BV7A 1TQDA 1T5DX 5G41A 1WXGA 1U3GA 4WNCA 1GVHA 1U8TA 3IAUA 1UKCA 3F0TA 4AROA 3PQDA 3SM9A 2ATXA 5ARDA 3ENZA 5EJ9A 3I4FA 4K0KB 4W5NA 3LKVA 3D3WA 4Z0TA 4D42A 1U3VA 4WE3A 3ADKA 4JUBA 4D5GA 2HGSA 4M0LA 2NVBA 5EHGA 3HKCA 3VOSA 3K9CA 3OHMA 3OF3A 4UVEA 2FF7A 1VE6A 1OZFA 1EE2A 1ZOPA 2GZDA 3PBKA 1RKVA 5AKEA 4RPGA 3REGA 4KQMA 3K2EA 2O4UX 3L92A 2V9CA 4QYTA 1R00A 4EGSA 2ID9A 3OM8A 2HK9A 3R0QA 1GNTA 2DBYA 2OCLA 2G1KA 2CJXA 1NUSA 3QMVA 4MWSA 5BYBA 4YN3A 4B9EA 3ZVKA 2X0RA 1WULS 5KWJA 1YACA 5HFNA 5G2OA 5KO2A 3O74A 5DNEA 3ROKA 1W5SA 3WK9A 3KDPA 2I22A 5K0TA 4DV4B 5EUCA 1J2UA 1IRIA 1M6WA 1K3UB 2VWHA 4GLFA 1Y3DE 2ZJ0A 3RK0A 4BLWA 2PFSA 4CF5A 4QPNA 1O8CA 4FOOA 721PA 3PJEA 2NV2B 1SFRA 5JSZA 2J3QA 1PZMA 3WYBA 2IC5A 3NTXA 1IEXA 4MULA 5EIBD 3OA2A 3KKMA 4HZUA 1DKQA 3NONA 4TQAA 1YB4A 2QUKA 1BMTA 2G5CA 1X8LA 2H9IA 3EFOA 4OK3A 1TZJA 3QSGA 1QIGA 4RFSA 5BOSB 3OWHA 4EL0A 4RJ2A 2ACEA 4M1WA 4DMUB 4B4KA 2H2AA 1A9TA 1L3BA 5AJTA 5E6SB 4PPYA 3WP0A 4NHOA 1E2LA 1IAQA 1P7YA 2QVGA 3GJQA 1H0SA 4Q3KA 3GT0A 4U39A 4X63A 4YGXB 3T95A 2Q1TA 4B3JA 1IBCA 2CJFA 2IDMA 5HQTA 3K09C 3SFZA 4DV2B 3R75A 4YRFA 1A4XA 4NC9A 2OT3B 4IDCA 3DBHA 2ERCA 3I9MA 3CNEA 4X8LA 3VH3A 1IPEA 3NXKA 3VV3A 1P75A 1YRBA 1DMSA 3JD1A 1E0JA 4DA0A 5I7EA 3CEPB 3BHJA 1E6EA 3JU3A 1Y6GA 4L9AA 3LXUX 4W6QA 2CXPA 5JFOA 1N6KA 5EKDA 1EEHA 1E1QD 2JGDA 3R7FA 1LSUA 2BFOA 4MP3A 4TOIA 4RH3A 1XCGB 2D3TA 2P4SA 4IEFB 1TK9A 5CEJA 1N2CE 4CU2A 5IJZA 4EVRA 5F21A 5DXFA 1E5XA 4N47A 2QSYA 3NHZA 3QK7A 3QE4A 4E5SA 5TPWA 1FFGA 4D8WA 3BQNB 5H4GA 3WKAA 3HB0A 4E5VA 1JBEA 3G5UA 3PUWA 1NW3A 4QM7A 4RMIA 1NPDA 3EAQA 3SYTA 4Z0HO 3ZQ6A 1MABB 1O97D 2XCIA 3HDTA 1HV8A 1W9MA 2V0NA 3PEWA 4C2TA 4LBVA 4ZYVA 2Z56A 2WWHA 1YS6A 4IH1A 4ZQCB 3C6QA 3FCSB 4RZXA 5EMNA 1O87A 1W47A 1F38A 2XGMA 2AW5A 2G71A 3C6MA 4E5KA 4XYLA 3D6MA 4FMDB 3O3CA 1I32A 1MT0A 1N25A 5J47A 3RSFA 1W6RA 4GX2A 5G3YA 1KDOA 2AR9A 2B7LA 4DDUA 1XTSA 1UJBA 4FGSA 4Q19A 2Q3FA 1R5JA 3ICPA 2G80A 4A6EA 2HMAA 2H1FA 4GPTA 3PC8C 1W4RA 3FZNA 5A5VA 1PK7A 2HA7A 4JT4A 3RSHA 1UWVA 3P9IA 3QEOA 4ZDJA 2JJ1D 3AR5A 2P7HA 1IZYA 2YHSA 3RJZA 2CDBA 2IYAA 4L4XA 4XIYA 1V9CA 2OLJA 1CY8A 1GGVA 1PNQA 2NU9A 3GJ6A 1LBQA 1IE3A 1OREA 1LB1B 1I3MA 4MGIR 4A5SA 4DADA 2FG6C 3DEJA 2J6BA 2Y68A 2OM6A 3HZZA 2BEVA 2ZAOA 5JQGF 3DH0A 4B5LA 1T4BA 4F1WA 4M36A 2I55A 2AUTA 3GZJA 1NQOA 4IMIB 3V2IA 3CEAA 3NEPX 3PD0A 2ZRJA 4TKUB 4Y9UA 3ER9A 2XNHA 2WIGA 4O2AF 3VR2D 4YRNA 3DAPA 2CUTA 2X6QA 5GJCA 1U3FA 5DBFA 4CLHA 3C24A 3UAWA 1FVFA 2Y0CA 3WJ2A 4EUEA 2ZDGA 2X0EA 3GLRA 3PT5A 2FN7A 2VRBA 1TGVA 521PA 3HY4A 4FFWA 4FYKA 4PZCA 3VH4A 1G5RA 2Y92A 3K6SA 3A4VA 3C43A 1FTGA 2JVIA 3VKWA 3DW1X 1NVGA 3EPLA 3IPXA 4KBFA 5CM8B 2IBTA 2I03A 2VHVA 1TZMA 2RB5A 3EHDA 2IWRA 2WA2A 3R0IA 2JKYA 3SY8A 5C8YF 2FI1A 5AR1A 3C70A 2DLCX 1DAGA 2I3BA 2QTLA 2OXIA 1S7CA 3QNUA 4DILA 2Z3VA 3EFHA 1AQJA 4YP0A 1F7UA 3D1VA 3O75A 4WFKA 3M6XA 2CUNA 1L8AA 2B99A 3H13A 3M6IA 4KQFA 4Q7KA 1K1EA 3KJGA 2PX8A 4ZAXA 5FCDA 3FHLA 4ZCQA 5KVQA 4F96A 2ONZA 3Q0IA 3E7WA 4UAUA 2CY0A 4IMPA 3L7AA 1GXSB 1V8ZA 4LRQA 3FUVA 4M38A 2E37A 3G7NA 2NYRA 2ZJ2A 2HMVA 2B4YA 1PNVA 3OU2A 5F73A 1X9HA 2QL9A 2VAPA 4HVLA 4RVNA 4YY3B 3EVBA 1YRAA 3K8OE 4L72A 5ERGB 2WLTA 4EABA 3CM0A 4EARA 3X2SA 1PVDA 1EFCA 3BTUA 4B3RB 2CBGA 4QYXA 3DKKA 3IKMB 1BO6A 2Y1WA 2SKDA 4UU1A 2Y76A 1FMFA 4YRMA 3GF4A 1V96A 1Z5NA 2ZM5A 3DJFA 4DMFA 5FUMA 2AEJA 3GNTA 3TD9A 4AIIA 3KOZA 4DEXA 1P7VA 4LJSA 5CA1F 4B76A 1YFKA 2OE2A 1HE3A 1UBUS 1P1HA 221PA 4P58A 3ZYZA 4F85A 3MOSA 4NLLA 4UM9B 1AX9A 3WDSA 1CRZA 1G8HA 1M2OA 1ZSNA 4Q93A 3IOBA 4TXJA 5LFAA 1M6NA 1U9IC 1N57A 1VE1A 4B34A 5LUAA 1COWA 1W85A 3DOOA 1XLTA 2V65A 2SNIE 4G2TA 4AJOA 4KMSA 3S2SA 3AUXA 1QVVA 4O1HA 3F4LA 4B43A 1KYQA 1WD5A 3OUUA 3PT9A 2VUHB 1GQFA 3HDQA 2ZVQX 3D2LA 4YR9A 4UZFA 4JJFA 2HCTA 3EEOA 5G40A 4BNJA 2BFNA 4QT4A 1QTQA 3JATA 4CMEC 5C1DA 1W6UA 1KIMA 3A1SA 2QXYA 4UJ5A 3TMYA 3UV6A 4LYDA 1QB7A 4XDYA 4HR7A 5KOJB 1FDRA 4H3HB 3GLFE 2H8KA 2ZYIA 1MJFA 2QTHA 3MWYW 4WW0A 2YRFA 5LDGA 2DKFA 4A15A 3RARA 4YMVA 3GNSA 3U4AA 4TZTA 5E8RA 1IRXA 5T6MA 2CNKA 2LP4Y 1U81A 2O8FA 2QBYB 3ABIA 5SZIA 3C8MA 2ESRA 3FVQA 4BEWA 4XYEA 1XNQB 1GZ4A 3OVMA 5TT1A 1CR0A 3SK0A 4IIXA 1T9AA 5FLEX 1V95A 1B3RA 3ZZUA 3N2ZB 3KK0A 3TQRA 3UNXA 3WGGA 1OAAA 3QTBA 4Q6BA 5DLEA 1OXVA 4MV9A 1X1QA 2PY6A 4DQUA 2P79A 3UJ8A 1UJCA 1P17A 1NYRA 1UIMA 3OJOA 3T06B 3TPZA 3EBLA 3OCYA 3PIDA 4O4LA 1R6VA 1P0QA 3NM4A 3ZGVA 5JTTA 3HVIA 2F3RA 4G0UA 2W93A 5HIJA 1VLHA 1B14A 1U7WA 2PO7A 3LFUA 4I08A 3SICE 2A7QA 4QDUA 3F3YA 3SYRA 4P86A 1I3NA 5DNUA 3THYA 1YR2A 4B6FA 4OM7A 4JVLA 3ND8A 4PQFA 5FFMA 2EARA 2CDNA 2YV3A 2Q1WA 1UBJS 4RWEA 4C6TB 1KI6B 3KOMA 3EISA 1AK9A 3BX1A 1IG3A 3VVCA 5HVNA 1NBOA 1ADYA 3O8QB 2WAXA 1NTOA 1EHIA 1FYEA 3QIAA 1ITZA 1F8GA 1RAIA 3WLTA 4DNXA 2GEUA 2R47A 1CIVA 1X15A 4Q1VA 4LVUA 5C5EA 5DFAA 3EQ9A 4FD3A 4LRWA 2DQKA 3GLGA 1WHTA 1KI7A 3K8YA 1YS9A 3PNVA 1EGAA 4KWTA 1XEXA 5L6LB 4R8VA 4PG7A 5YASA 3CJQA 4EUNA 3C6XA 1TTPB 3BWVA 2VCEA 3EGXB 4JFRA 3TLYA 1VDMA 5EXTA 1FYWA 3H9BA 1WXEA 3FOEC 2DBZA 1Q1BA 4MRPA 3TOVA 3DQPA 5COQA 2ZDHA 4XX0B 1WTCA 2QJFA 3H1FA 2ZRKA 1SBIA 3P27A 1CSEE 2B0JA 3PITA 3U7RA 4AF8A 4CI9A 1JXMA 5BW8A 2GZAA 3KYCA 1X19A 1TMOA 2GD6A 2ZP1A 3CH5A 4ZT3A 3RPEA 3SDBA 3W9YA 3Q7IA 2HK6A 3AEQB 3PUKA 4QBGB 4WCFB 4EY6A 1T1RA 3F2IA 1O7JA 2XUQA 4Q7JB 4QU5A 3BWXA 3DV0A 5BN3A 5KYTA 4R69A 4FBGA 3GEBA 3NYRA 4F3KA 4GLOA 5LOVA 1AB5A 3AM3A 2QYSA 2PQMA 5CLHA 4PNEA 2P2SA 1QDUA 3KXLA 2AG8A 1QO7A 4RV4A 1JR2A 3A9UA 2C4KA 3HUFA 1IWOA 2XMBA 1ACJA 1JEQA 2HUNA 1R0CA 2G4CA 3E0XA 1VJ5A 1XF1A 4GP7A 2GYWA 4W5JA 4DSTA 4EA7A 3RWOA 3A3OA 3FJ1A 2AMVA 3RBVA 4F04A 2VTKA 3USES 5CA0F 2XUAA 2RBEA 3M89A 2C0CA 4L78A 3IPRA 2AVDA 5TE9A 3DDNA 3BF8A 1OXKB 4DWVA 4N49A 1A1VA 4FNAA 3DFMA 2GN6A 3USZA 1WOYA 3L6EA 1K97A 2ZTUA 4WXPA 4QOHA 2IOQA 5FNVA 5JLJA 4GXRA 1KJQA 3L0YA 4MVJE 2X0KA 1F2VA 2AC7A 1L6IA 3C1UA 1SBQA 2B69A 4OAPA 1YS4A 1ZIXA 4LJ6A 4LY0A 2E0IA 3KYBA 3LPDA 1ZNQO 1KYIA 1P80A 4XVRA 4K9QA 4Q4DA 1T8RA 2Q0XA 3JD0A 1FFAA 3DO5A 4RNDB 1JBQA 4TL6A 5ALXA 4FIZA 4G36A 3S4YA 3T52A 2CGEA 2Y6VA 421PA 3KETA 1XEFA 2HWYA 5I4IA 3U16A 5CYOA 5ETJA 3STVA 3VZBA 2DKOA 1LTHR 2W6ZA 2NTVA 1QSGA 5JJBA 1DNPA 2HQOA 5CVCA 1YR7A 3SPXA 4B80A 3AHIA 4G85A 3QQPA 1N9KA 5F5XA 4ALJA 4ED9A 3X44A 5CBKA 3BCUA 1V39A 2VDWA 4PANA 2ZQZA 3H5NA 1IN1A 1IUPA 1I4OA 1N2CA 1OD6A 1NVDA 2QN3A 3A4NA 3EZYA 4FE3A 5I7AA 5BPHA 1YL5A 4UU8A 4D80A 1E58A 1OYOA 1XEWX 3B6MA 4BL5A 4H3KB 4F0JA 2Y3IA 4FJ1A 1ZK3A 5CTAA 4GC9A 4UNIA 4YMWA 2X76A 3V8PA 4R0VA 4AY3A 5KNDH 1MDFA 3GN1A 2QRZA 4EHJA 4KAXA 1IN5A 3G6KA 1X77A 4HDMA 1NN1A 2IL1A 1ULAA 1G6Q1 2IYTA 2JFNA 4E1BA 5EMJA 2FSVC 4RVUA 2ZQYA 2WSSD 4JC8A 3RHTA 3V80A 5GM1A 3VMMA 3ETCA 2CE7A 2V5AA 1AUVA 5ESDA 3BBLA 2GN4A 3NT4A 1G59A 4L5AA 1L7XA 2JS7A 4Q1FA 3L6CA 1BXGB 1LQ2A 1XHFA 1GDHA 1ZN9A 2JW5A 2ZBRA 4KDFA 4LJ7A 2XY4A 5E1DA 1VC2A 2GI4A 2HF2A 2Z08A 3B1XA 2AYXA 2PMDA 3QVGB 3RO7A 4YQFA 3HDGA 4CWAA 2QZ4A 2QF7A 3HDYA 4R7TA 1UZNA 4AL4A 1ZZEA 1MRSA 2G4LA 4TMZA 1M66A 3RVOA 3UJDA 1I3CA 2Z2ZA 2WE7A 2ZB3A 3GT7A 2QYHA 1T0JB 4C5BA 5LMCA 5JJLA 1XZCA 3RRMA 4B4DA 1KJNA 3R24A 3PU6A 2FOLA 2XQFA 1CETA 1QNFA 2AHOA 2DR3A 2PPVA 1C4OA 3ANXA 3CX8A 3HBJA 4N9QA 5DO9A 1A4UA 5E4JA 2AG5A 3LTEA 2V3CC 2QTMA 5CYPA 3BAFA 1ZW1A 2K2QB 3BMQA 5BNFA 4F5DA 5IAKA 1SRQA 4AXBA 3PVCA 4ER5A 2UYGA 4RGQA 2YYAA 4O2BB 3ZY4A 2BFFB 5BWCA 2PNJA 2D1RA 2DFVA 2PEYA 3TLCA 4UKDA 3PKJA 5K3FA 2EFDB 3R7BA 4DLXA 2AG1A 3H4MA 1II8A 1YOVB 3OE1A 1ZUNA 2DPLA 3BERA 1KAEA 3MNFA 4PHGA 3C3CA 1OIVA 1WPRA 4RMJA 2JJMA 2QGNA 3WWOA 1XBTA 1V43A 4YDRA 4AG5A 3HWX1 5E95A 3T5TA 3UK6A 1O57A 1VYTA 1ADBA 4QVIA 3GFQA 4BVLA 3T15A 1DV1A 5JHGB 1MDBA 1N5LA 2XD4A 3QKRA 1Q7TA 1WCWA 4MLDA 4GI1A 4H15A 2AS0A 1V35A 4Q82A 3ZYCA 4GMXA 1HFWA 3W8EA 1RAEA 4J0GA 3FCOA 3LLUA 3WRXA 5ELXA 2AFHE 3NOVA 2XMGA 1JEDA 4MQMA 3S1AB 3AI2A 4AJPA 5HZHA 3CJRA 3HR4A 3TJRA 3BDAA 4IV5A 4RSMA 4E1AA 2YWCA 5ITZB 3U2QA 3DZHA 1GRQA 5LUBA 2AJTA 1VPVA 1D0IA 2VJOA 4LJ8A 2E4XA 3IAS1 3U7QB 2I0FA 1KOGA 2ZRAA 1JDVA 3K8QA 4ZI5A 1TMGE 1DRUA 4Q4JB 4KNYA 4COOA 1HYGA 3DUWA 4KJXA 4X8MA 1T2UA 5IF9A 3U09A 3O8DA 3QX7A 3A31A 3VI3B 1A1SA 2JLVA 4CMGA 3FF4A 3S3TA 1C3OA 2VQ3A 1CE8B 3AFNA 4Z2YA 4H4CA 1IYZA 2DWUA 1M3SA 2EFGA 4ERNA 1N34B 3L0DA 1RYNA 3O03A 3EDMA 4KXQA 3ZKWB 1F20A 4BMDA 5KWSA 4CQNA 2XLBA 4U2GA 2WI8A 3H2SA 4KUEA 1XSEA 2J9FB 1FNBA 3F46A 4IHJA 1E9SA 3L7YA 1QAMA 1VLZA 1NMSA 2ZJ1A 4G4GA 1HLPA 5LXTF 3ONEA 2ZKLA 4JI4B 4I55F 5IJ0B 1SJ9A 2N75A 2VA8A 1C3LA 3AQ4A 4PNZA 5JO0A 1OLSB 4CCYA 4EOGA 5KNDA 3OM0A 4S1TA 1PJCA 3ZDZB 1HM5A 5DTQA 4DDMA 4J0QA 4QUIA 3KZOA 4MUGA 4WXHA 3SSNA 5MGBA 4OA5A 3M4YA 4DIDA 2ZRIA 5EFOA 1S1MA 5LSAA 4ARIA 5FADA 4KP7A 1O0SA 2EAUA 3LY5A 2IE0A 4ZRMA 3ACBA 4ZCIA 5CDYA 1O95A 1DKPA 2X7HA 1ICEA 3W0LB 4KO8A 4UDXX 4DCTA 5JAPA 3FI0A 4HV4A 3ONDA 3A0UA 1DRKA 1E8DA 1NP3A 3IURA 4IQFA 4PC6A 1ESEA 1VG1A 4GBJA 2XKAA 3K20A 3NUGA 2VEOA 4P53A 4PPQA 3H97A 4N5IX 4NARA 4ENWA 3DMYA 2TMKA 2B8EA 1J8VA 1ADCA 1SKYB 3KSMA 1KSGA 4O4IF 1WEKA 3E9MA 4TTPA 1RZUA 4OHFA 2DBVO 3OZWA 1RLUA 4BMPB 1QK4A 2RGEA 2Y0BA 5K2OA 2O05A 4ZKDA 2LGJA 1BN7A 3A1DA 1ZPDA 2WOOA 4Y1RB 5HCIA 4CFZA 4PLHA 2WZBA 2BH9A 2Y99A 4YJHA 3WWYA 2IS2A 4NAHA 2YFKA 4U8GA 1ECJA 1GD1O 3ZXYA 2XUIA 3VYRB 4BKUA 1XZKA 3KHKA 4ESEA 4YASA 1U94A 3GCWA 4PLWA 2VSNA 2P77A 4QYIB 3R7AA 3V33A 1IXZA 2ACKA 3HNPA 1U5CA 1G2PA 4II7A 2AMFA 1OBCA 2H5IA 2XMZA 2GKSA 4I3FA 1QGOA 3B5EA 4ODIA 1KKMA 4G4SO 3GROA 3NHLA 2JRLA 1JDPA 3GUVA 5C53B 2IY8A 3HDVA 3N05A 1IUOA 4DC9A 3I6QA 3FZGA 1FW6A 1JG4A 4GX0A 4I9FA 4KE8A 4RVHA 3B1FA 3U4DA 3ONVA 1M1YB 1MB3A 3BTVA 4ZKEA 4BNDB 4ESVA 1ZM2A 4PZEA 4N41A 1TAGA 1P1BA 3VR5A 1F9EA 3RT7A 2BZSA 2PQ2A 2DWCA 4N7BA 1Z29A 2R48A 3F7OA 4HDRA 3RUHA 4XDHA 3D5EA 4ZALA 5FA5A 5IBCA 1E3JA 3FWKA 3D3EA 4RMHA 5M3BA 2ZE8A 1W4LA 1A9XA 2C9BA 2ZI3A 3IALA 3N70A 1ZXBA 2FWJA 5TDHA 1NW8A 3ZEIA 2G4VA 2QAGB 3E9YA 3MG9A 2Q3HA 3NETA 3LKBA 3R44A 3OQ1A 3QKSA 3FYUA 3OQ6A 5B6IA 3ZOKA 5T7BA 4YV0A 3C1AA 3UJBA 3WJAA 4BUZA 3RIYA 3IBCA 5F2EA 1EFVA 2EZ8A 2VK8A 1KY5A 4QXRA 3WWEA 2P91A 2O5VA 2ID7A 3B89A 4JQYA 5EZYF 1YE5A 4LXYA 1S2GA 3G2KA 4IIYA 3WDKA 3FOFC 4LN1A 1N7GA 5CIQA 2Q6IA 2A1TS 5HRAA 3GAFA 1WBDA 3KVRA 5KQSA 1X8JA 4BX9A 3V1NA 5JTUA 4PHHA 2P11A 1JMYA 1KEZA 4RD1A 3ZCTA 4TVSA 4KWIA 2OCBA 4JLVA 5J5VA 5K8JB 4WCDA 1G0OA 2QVCA 4P33A 4ZQEA 2Q3CA 2O8DA 3R7SA 3LHDA 4KXLA 1XB2A 5IJWA 1ZXLA 1XJCA 1CUDA 5FI1B 3ORYA 3O9VA 1FQWA 1X7WA 2GBCA 3D8RA 5ALEA 2JFYA 5DX0A 4YK7A 3HXMA 5C1IA 4C21A 1B43A 4EIWA 3C3BA 4ZCPA 2NNLD 4G09A 2ZIGA 2GK4A 3WGKA 3LECA 2VQSA 3W90A 2GNOA 1JMVA 4G1UC 2YXLA 3MHTA 1OI7A 2V6BA 3EVCA 1N2SA 2R7MA 2WILA 2J0UB 2XWPA 4B84A 1N36B 2PE5A 1QYXA 3EA5A 3K30A 4BQOA 5GIOE 4N5LA 5GPBA 5IG2A 4DR4B 4U2KA 3WGOA 1HT2E 1U1IA 2AFIB 1QCZA 1AC5A 2M1XA 1BXRA 3KWLA 3Q6IA 2P9BA 2JPDA 4RTKA 1FNCA 4Q4AA 5ALLA 1J00A 4LYEA 4ZYTA 3DT9A 4FWTA 1W1IA 1I9GA 3FMGA 3HA7A 3FWHA 3ISTA 4UE6A 2ILTA 3A37A 1OKKA 1EU1A 1AV7A 2NSJA 3EA0A 3FPAA 4MVJA 4TV9F 5ALJA 2X5NA 3G9TA 5JCJD 1UJ2A 1WIWA 3DE0X 1M73E 1Z8HA 3WLQA 4GYWA 2HJWA 2QSZA 1L0BA 1GGFA 621PA 2A6PA 3O1LA 2H2GA 1JIVA 1D7OA 1T8YA 4M37A 4RADA 5F2NA 3C97A 3AEKB 2C2WA 1RWQA 4NMXB 1CR2A 2I7VA 4DC1A 3HXTA 3MTGA 4YTEA 1JHYA 1JQ3A 3OE4A 3WMEA 2DFLA 4U6QA 3UMSA 4E7PA 1J5EB 2Z6AA 1W76A 3R23A 3ZJYA 4EPRA 1A4RA 1EHCA 3A1FA 3H5TA 3KKKA 4DCNA 4WXYB 3BQ9A 4OLAA 5IARA 1O3YA 3FFAA 3JAWB 4FCWA 4BX8A 2NV0A 1NXSA 4Q4HB 3KUDA 4TWRA 2HSGA 3QOYA 1FSSA 4QPJC 2FZKA 4HAWA 5ALMA 4BCBA 4BZZA 2HLDA 3CR3C 2ZSAA 3I23A 2H07A 4MA5A 2CZCA 4GSLA 5DNWA 3ROXA 3FXAA 8AT1A 3H0CA 4FILA 1RWNA 2HV9A 1NMXA 2GM3A 3UMFA 2GM9A 2CLHB 3M34A 4PC7A 2JBWA 3KUXA 3CSDA 4K9MA 3AJ9A 1NFQA 1HQKA 1C1XB 1N4DA 2WUVA 3LLMA 4FFDA 4HAUA 9MHTA 1A95A 1USUA 3WS7A 3KKZA 4WLUA 3R5FA 4TLDA 5EHNA 1JEJA 3I32A 4FU0A 2C9CA 4LIPD 4N18A 4I4CA 2E4UA 4Q7LA 2RJNA 1N3YA 4GR4A 4M1YA 2O2JA 2WPDD 3LSTA 5E2BA 4ACAA 4WZ6A 2EJTA 1XWIA 3WO1A 3T5PA 3MCAA 2ACWA 3B12A 5LYYA 1T29A 4TTTS 4J91A 3U7EB 4RM2A 2OK8A 1EQUA 4HDCA 2PH1A 3BXXA 4L1KA 4AUNA 4MUXA 1ZDMA 1TA0A 3ESDA 2WY2D 3B82A 1LXCA 3ETNA 5KNCH 4UDOA 3HRIA 4AXXA 4RZHA 2HXGA 3TEFA 1E1CB 4UVHA 2VKQA 2IEAA 1OLXA 3AW9A 2V5VA 4JBNA 3T9FA 1T8TA 2SECE 2XT0A 3D0RA 2XUKA 2ZZKA 1VG8A 2ZRFA 2NLOA 4K6GA 4CMJA 2PK3A 3NG1A 1GPKA 1Q0LA 1EFDN 3RRFA 5BYKA 4F6LA 1ABEA 1W8DA 2FEWB 2J85A 2BPOA 3PFIA 2VHXA 4GGMX 4H4EA 4EMSA 3PC3A 4I4TF 5JJIA 1R10A 1LBIA 1PJAA 3ANMA 4HLCA 4NY1A 3DOIA 4LYAA 4CTOA 2NUBA 3O2JA 1U7XA 1E2EA 1YE3A 3EGDA 3A6DA 2EP8A 3R6LA 4NYJQ 3H1TA 5FTNA 1W1WA 3V3TA 1GAXA 3DO6A 4DDHA 4D3YA 3E2MA 2HQBA 2YJ3A 3TTUA 2G8LA 1UMBA 2IYQA 1F1BA 2ZRGA 4A8JB 2AFHA 1LPAB 3JYQA 2NUPA 2VR1A 1Z8DA 2WINI 4WOBA 1IZ0A 5BV0A 2R2GA 4B85A 1FK8A 1E7WA 3GN2A 4NVRA 3WBJA 4DYHA 3LUAA 3RJTA 3B3AA 3X1DA 3OP4A 2FFJA 3AY3A 4YUAA 3BQMB 3N0WA 1DC5A 2B4KA 2G88A 3A70A 5I47A 4JEMA 1Z8NA 1YRWA 2I4IA 1I01A 3Q5DA 3QHQA 4IJWA 4GO1A 4MJLA 2R86A 5A4JA 5IK2D 1HNWB 1OU0A 4FLFA 1RLJA 4E21A 5HUQA 1AURA 4YRJA 2C88A 4NI5A 4ONEA 2IV7A 4K1XA 4ZFNA 4GEGA 3P2YA 4M83A 4MHOA 1DLJA 2BEWA 1G4AE 3FLBA 4V03A 5A5FA 1D6SA 5CB6A 4PVDA 4AG3A 2QL6A 3WL7A 3OQIB 4M8NE 5HIMA 3B6KA 5J4HA 3R7LA 4Q9NA 3WSTA 2NT3A 2J5BA 4DWJA 1NJSA 4C0BA 4F3CA 4HRYA 4ZOLA 1XEAA 2MT9A 1B7GO 5DDIP 1D4FA 1I3KA 5AHOA 5ALYA 3OFSA 3RUCA 3WNVA 1WMBA 5CXSA 2M6LA 4K6KA 2Y05A 4HNAA 4KTVE 1HC7A 2C2HA 3GJ4A 1KE2A 3RT1A 3TNLA 2F2TA 3VH2A 2QPOA 4Q66C 4CKBA 3ICQB 2FUCA 4TTAA 3ZWAA 1S89A 1QYWA 2PV7A 5ALQA 3CLTD 4TT3D 5EJEA 5AVXA 1E1DA 2YINC 4J43A 5CNMA 5B37A 4JKOA 1N6LA 4HLDA 3L7MA 1N1EA 1PYOA 4O08A 1CRPA 4RKEA 3PIRA 3ZHVA 1T2EA 1KO1A 4OHYA 5KOHB 2BFEB 2QGZA 1T2NA 4N0EA 5EWJA 2V7TA 4R2LA 3VKHA 2PYIA 5EQTA 4MARA 1E9FA 2UXCB 4MEAA 5BW6B 2IYUA 5KTMA 3DTTA 3F5MA 4W5HA 3X1JA 5LPNA 3QITA 1M76A 4NOJA 3KJQA 5TGDA 1R4MA 2XXJA 3IIJA 4GR5A 5E7JA 2W2XA 1OFVA 1V7PC 2XKBA 1YB5A 2C1ZA 4H35A 1CUVA 1GRCA 3K6RA 4IGEA 5DBGA 1DOHA 4NU5A 4ZJZA 2VT3A 3A04A 5LA6A 2SICE 1JE0A 4P35A 2YZMA 3BTOA 3VSEA 3U0VA 2NU6A 2Y4NA 3QG1A 2JLUA 1M0WA 1J8YF 1M74A 2PR2A 1EFPB 3IAM1 3IAEA 4G65A 4S24A 5KNLA 4COKA 3KPJA 2FYTA 1X7ZA 4BU1A 4F72A 2V6JA 3BMNB 4TYPA 2NO9A 1HE8B 2VDRB 4I1PA 1I4EB 1D03A 4FYJA 4PWZA 4POOA 1YIOA 1ESMA 1ZMOA 3G0CA 5C1PA 1VHDA 4BE9A 1JHDA 4G0WA 1CG6A 1UQRA 2Q4TA 2V96A 4K03A 2QPLA 2XBUA 4KQIA 3JSAA 4C7BA 4ZK6A 4GWLA 4KZKA 3PG5A 1E2UA 3LO8A 4JELA 2A88A 4MYRA 4WTOA 4Y2JA 4FHFA 4J7XA 2PKYX 3D6VA 3FMFA 3P9YA 4F93B 2L42A 2I29A 2RHGB 4C1BA 3ONNA 2B1JA 2FEPA 3LYHA 1VE3A 1Q83A 1XPJA 5BUSA 1NSFA 4V3CA 1DDGA 2AKEA 3QF7A 2O1SA 4O0LA 1H6AA 1TT5B 2H4JA 3LW7A 1E6UA 3W34A 1MO6A 2YX1A 2DTEA 5J4LA 3EVEA 5F33A 1JV2B 2GFQA 4G89A 5H83A 4C01A 1ZFNA 3C3PA 4INZA 4ZCLA 5K6AC 4JI7B 1OX6A 2IOYA 2JL1A 2VP3A 1B2RA 5ECWA 2H6EA 1DC3A 4BVJA 4MVJM 1OYVA 2ZOSA 1A50B 1BDBA 3VC7A 4PZAA 1IQPA 5HEKA 5HDQA 4ZGGA 4CKWA 3T1HB 1LC0A 4KVZA 4RA9A 1N5MA 1FDWA 3DTVD 5CCEA 3UUWA 3WHLA 3ZCRA 2QRNA 4LHVA 1UFVA 3C7TA 3CTMA 4DLBA 5BRAA 5FWAA 3PGLA 3QYFA 3RYHB 4AP5A 5L3SA 5J3JA 3T4XA 1AZSC 3CLHA 3Q87B 4MUEA 2AFIE 2WAOA 1MVNA 1FX0B 5LKRA 3PRJA 2PMFA 4K9PA 2FLKA 3ST7A 5B30A 4Q39A 1H3EA 2AE1A 3NHYA 1E1KA 5CP8A 4ATNA 2VEDA 3CRMA 4HGZA 3E48A 2W00A 2OFOA 2YZ7A 2QSUA 2XDWA 3P5SA 4BNLA 4OX9B 2FVYA 3NIFB 1Y8QB 2A5YB 2E5WA 3PGVA 5G0VA 4RFVA 3RVRA 1RPJA 5TEVA 3N28A 3PCRB 2JBAB 3ER8A 1G3IA 2DUWA 2WUWE 3T5GA 4NPCA 4RXMA 4ECAA 4A4DA 4BP9A 3ZJTA 3ZDYB 1JA1A 2ZCVA 2FMHA 3G2HA 1C30A 2B82A 3QMWA 5LU8A 3FPEA 2HA5A 2XGSA 1IONA 5AJVB 2JGRA 2X8JA 3LZ6A 4MKXA 1ECFA 3RHZA 1BXZA 1M7HA 3G6WA 1SVUA 4BZXA 1WZUA 3W2EA 3I1JA 2FPGB 1ISRA 3TPCA 2IWHA 1ZWKA 2Z6QA 1QNLA 2CLLB 1XMPA 3IJPA 2IHBA 3ELWA 1D0VA 4J0DA 2B8JA 3GJRA 3GJZA 3PJRA 1UKVY 4PLTA 5E38A 4LV6A 4JEUA 5CBPA 2OECA 1T5SA 3EDYA 4LXIA 5FFNA 3NC1C 3I58A 4CDNA 5AIBA 3EF3A 2IIPA 3A2LA 4IFIA 4R7GA 1FCJA 4FSHA 4OQZA 1K8RA 5I4KA 2GCEA 4Q4LA 3VKUA 4AYWA 1V16B 4MS3B 4U2CA 3E3OA 1A27A 2DWQA 1DQSA 4Y2UA 3KQQA 4FEAA 3HJTA 1Z38A 1HTWA 1RR6A 3EQ7A 4WA7A 1V71A 4NHEA 5B2ZA 4CEHB 2WFAA 5C5DA 4M2LA 5G1PA 5E4FA 1SCQA 4IJQA 4UQPA 2XOEA 5ARCA 3W7AA 1G3MA 4Q9JA 1X2EA 2BT4A 2PD4A 3EXEA 1ORDA 3FUTA 3NHUA 2FPUA 5EMHA 5HTKA 2QAJA 3L4BC 4LK2A 5IW8A 3RYFA 3VR6A 3ZXXA 1Z18A 1DV2A 3B7PA 6GPBA 3EDOA 4PLYA 3UBMA 3OQVA 3M6WA 2F43A 5IXYA 1PZGA 1K7FB 4RIIA 1ORIA 1OTXA 3GO4A 3OT1B 3MCWA 5EXEA 1ADJA 3CN9A 3CTPA 1ZYUA 4B6QA 1FTNA 2YVQA 4CMAA 4Y2PA 1P4HA 2FUG6 1QGUB 1O9GA 2PN1A 5AKLA 2XRZA 1MGPA 5JYCA 3SQXA 4AUKA 3A6PC 3MPUA 4K87A 1JH9A 3GYGA 1FTSA 2JAHA 3UENA 1AQNA 4GZ5A 2D5BA 4UBJA 4A1OA 1M0EA 3U3RA 1J9GA 3F7NA 4RTMA 3RSGA 3SQNA 5ICGA 5BN4A 3PR3A 2J9XB 1EA7A 1PQUA 2HRZA 3Q9LA 2E6UX 2YC4C 5E9AA 3T7RA 4TMTA 3BRQA 3DMPA 4J90A 2YY6A 2CVOA 3NNDA 5GOTA 5GONF 1O94C 3ICCA 4EENA 5C1OA 2JJ2D 4J3FA 3LCRA 2QM0A 1LLDA 4TSKA 3FCEA 5A0TA 2MDTA 2V3WA 1H1LB 2Z57A 5AVUA 3D6UA 5CK4A 4AFNA 4EW3A 3EGVA 1YJ8A 3GLUA 3PF8A 1TKRA 3ECSA 5F1OA 4ECEA 4IZHA 5J2TF 2QV7A 3LWBA 1Z39A 1YZKA 3ILSA 5K3OA 1A9ZA 4CL2A 1JQEA 2KS6A 2W6NA 1ZCFA 4YAFA 1X0VA 2PKRA 4BNXA 1U2ZA 4N3AA 2ONYA 2V1XA 1QS0B 4IEIA 4NE9A 4QUDA 3VI4B 1XTPA 4Q9HA 4LDZA 1NW4A 4HQKA 3W9BA 4JV5B 1UINA 4B7ZA 1LDMA 4IH9A 5ER9A 4RD0A 1Z63A 3P0JA 4R9NA 3DYBA 3G68A 3ZS9A 3V4RA 2PWPA 1JAYA 4GEKA 4I4IA 5K9ZA 2RIPA 4GG1A 4U7HA 3OX1A 3KPWA 2EFYA 3PICA 1KSJA 1UJNA 2P2ZA 3EMDA 4WPGA 2FJ0A 4JSTA 4KKVA 4UD6A 5F1KA 3RADC 4HX5A 2R8BA 4ZEVA 4LF7B 1UP4A 3VZPA 3I9V1 1JSZA 1JNXX 1L8QA 3BL5A 4FC6A 1K6IA 3HVUA 4UHKA 4AO6A 1YR9A 5FLKA 3P0EA 1Z5GA 1ZI6A 5EIAA 5JAHA 1J5PA 3CF6R 4E4YA 5HYVA 1QOZA 4NEHB 1JHUA 4RABA 3N2KB 4QIHA 1JYSA 3VAYA 1ZY2A 3ULKA 4B7AA 4ZVPA 1ULHA 4Y7CA 3AHGA 1STOA 3SE0A 4D3SA 3SEFA 1IY1A 3ESAA 1CLUA 3J7TA 4JC4A 3UJAA 1UK9A 1PS8A 4U7JA 2OXCA 4QE3A 2V6IA 4W5RA 4IJMA 2RKBA 3LCJA 4S0ZA 1F8UA 5EC8A 3RTBA 5EE3A 4ILKA 1DIOB 2Q1SA 5KTKA 1E2KA 4MWDA 3OU6A 1EQAA 1D2MA 1JFFB 4GPD1 2Y0EA 4P4NA 4WKCA 2H63A 2D00A 4MYDA 2FR1A 3TZLA 4QFDA 2X0NA 4R3WA 1U8CB 3OZAA 4PSVA 5I7UA 3VVMA 4AUMA 2C8VA 2Q46A 2BKVA 2PMKA 1OZGA 5AYVA 4C7XA 3UXYA 1I7PA 1T36B 3HCBA 1HDRA 2C2BA 1C1HA 2HU8A 3PFGA 1H6BA 1E2GA 1Y6JA 2IPNA 3TSCA 2EGUA 3O4RA 3S2GA 2G5GX 4PYIA 1L5SA 4RZSA 3SBDA 3LSYA 4FFVA 3Q3GE 3L40A 4LUCA 1XCBA 1YI1A 4JN6B 2COKA 4M76B 1LBSA 3HPQA 3QOWA 1S01A 4EUSA 1ICIA 4BLUA 1I6WA 2VHQA 4IKOA 4UQLA 4BEBA 1W73A 5EJ5A 4D81A 5LDDC 2F1HA 1CQWA 4ZTBA 2R68A 5B1DA 4A5OA 5LP1A 4IQ8A 2MR5A 1ZBDA 3EBPA 5BR4A 2F48A 3QY9A 5FBZA 2P78A 4DJJA 4EY5A 5I48A 4ZVNA 3CUUA 2E89A 3S40A 3G5TA 3SAJA 3TCXB 1X7GA 3VPHA 2ZJ5A 3RYCB 4AS3A 1ZJWA 1RJWA 3JARB 4XLZA 4PFJA 1JB9A 3NJRA 4PU0A 5FBLB 4PG6A 3U62A 4PX3A 3QWHA 5HOQA 4FMPA 2GCNA 2JZOA 2ZUWA 1FFCA 1KJZA 1XX6A 3C7DB 4R3NA 4Y6RA 1Z88A 2JIDA 2X2OA 4ACBA 2WSMA 3FSGA 3DVLA 4G37A 1XE3A 3PRHA 3I09A 1RQLA 2A30A 3MIZA 1T5IA 4UTZA 3U60B 2VT6A 1V6AA 5L4SA 4S35A 5LB4A 3T7TA 2K6GA 2V7VA 3PQ5A 1PUXA 4JXJA 4KL8S 2HA6A 1B6GA 2YYYA 3CZRA 3HPRA 4O2AB 1XG5A 2V8OA 3ANNA 1K7EB 2GEVA 4I9HA 5EWLA 3RJ5A 5A4AA 1NI4B 4AD8A 3GXBA 2BGIA 4PM4A 4B2PA 1I4WA 3C45A 1IZZA 1HZZC 2ZYSA 1WETA 3WJ7A 3L6BA 4BUJA 3Q9SA 1P18A 1FYFA 4YPFA 4CEJB 1NOKA 1CEEA 1IPFA 1P5JA 1UODA 3RVSA 1KZ4A 1OWPA 2HBZA 2WG2A 3AFMA 4JBHA 2FWAA 3CSSA 5A9RA 4HAIA 2X0DA 4FGLA 3CUKA 1JR6A 1BKDR 3AGPA 1ZP6A 1Z2NX 1XA3A 3IAXA 3UOWA 4BKPA 5C8YB 4I1YA 3WKEA 3BS4A 2LIVA 4D0LB 3P7MA 2V4UA 4QGHA 1F0NA 3QEKA 1FX1A 1G9XA 2PZKA 2Q21A 1O6GA 2ZJFA 3DG9A 3LD9A 3OEED 5K45A 2Y4OA 3QELB 1X80A 4A91A 2VTBB 2XE6A 4J0FA 1DO2A 3VXKA 1WO8A 4R98A 1P9LA 2QJOA 3LMKA 5DX8A 3E7XA 5K3EA 1IQ0A 2QKYA 3INNA 3RS3A 5A9SA 3VYUB 2Q1XA 5KNBD 2O3TA 3MA0A 3ZJUA 1R2QA 4AKSA 1U0NA 5D3MA 5FWXB 3V2HA 2N9UA 5I9SA 2UYHA 2PV0A 3HP4A 4J4HA 1CHNA 4RPLA 2QW8A 3UHJA 2WM9B 3EWIA 3MMSA 4IMRA 4P7JA 4URFA 4WAUA 3CZCA 2AN4A 3AOGA 5HP4A 5AJYA 2ICAA 2UUPA 3KXIA 4ZI7F 2CNWD 1MX9A 1I1OA 3IDOA 2BBWA 4KE6A 1EI9A 1HEUA 4RF5A 3U3ZA 1R16A 3O0TA 2F1JA 3H8WA 3I1YA 4QPZA 3RRYA 2PUAA 3KZCA 4AS2A 4LCJA 1UIRA 3W5UA 4EHLA 4IM7A 5AJZA 3HYRA 2PAAA 3UPDA 2WNHA 4UNNA 5CPBA 1NZJA 2WQZA 3LT5A 2B2NA 4M60A 4OO3A 4JVOA 3SGLA 2P3QA 1YZGA 3C7AA 2X7XA 1FS4A 1SU7A 3BB4A 4ZVRA 3IIKA 1DIGA 1WE2A 3QJ5A 2I3AA 1CQZA 1U0FA 2VSXA 2I6SA 1LJLA 3ZBUA 3JALB 3LVBA 2ZUUA 4J07A 1IY8A 3VNUA 2Q3BA 4BNUA 1RMTA 2X23A 2YVLA 3AG6A 5I9BA 1T2FA 1ODSA 1K2WA 3HUUA 2CYBA 4D5EA 4WBNA 1WEHA 2WDPA 1LKZA 1P5HA 4LX8A 3AB3A 1QJCA 5T64A 4GOJA 3TEJA 2A92A 3PEFA 4M54A 4KOAA 1F4VA 4WXMA 1AGPA 2PX2A 2QUIA 3ZHOA 3HJAA 4HGOA 2CXQA 1WSBA 1WUHS 1CKEA 5IDWA 3QEBZ 1BVUA 4KPEC 2EEZA 5KBYA 3N8HA 1XRLA 3OG9A 2A78A 4LE1A 4KSBA 1JKIA 1C7RA 1Z13A 1ZCBA 2P27A 1OJLA 3I1FA 5I51A 1WSDA 2X8WA 3FZYA 4Y2GA 1T5TA 5FIUA 5DVZA 1S8FA 2HCRA 2FOXA 2J8ZA 3A11A 3DGEC 2BGNA 1NIPA 1UC8A 4MINA 4IIJF 1VXOA 3IMGA 4LHXA 3ID6C 4BU0A 1Z6TA 1YO6A 4NJEA 2R6HA 3UA3A 3V00A 2PT5A 1E7RA 5KKAA 2UUAB 4QGAA 3RFFA 2F1IA 1WU8A 4QTUB 4XGIA 4MQLA 2HO5A 3BD7A 4AZ3A 2FPIB 4FKBA 3X43A 2ARKA 1Z0ZA 2PXCA 3E9ZA 4LCEA 4TXNA 4ZQBA 4P4SA 3RVLA 4GMGA 1B41A 1OA1A 5F78A 3GPCA 3DOUA 2GXUA 3F2VA 1KH2A 1E2IA 1PLJA 1VKNA 2DGDA 4JP2A 4AJKA 5BQFA 3K71B 3LGAA 3G8BA 2EKPA 2O52A 1S3SA 2C3YA 3WIDA 1M6VB 1JALA 3H3XA 1BG6A 2RK6A 2I9KA 2AI1A 1WQ1R 4YRRA 1BKSB 1UBTS 2GZMA 4TWJA 3S8EA 1JPJA 4DV0B 1KARA 1IJKA 3MWJA 4BP8A 4HJXA 4FN5A 4RZ2A 4YP1A 1GTG1 3LOUA 1XVIA 3PI6A 1KPIA 4KKXB 1U8FO 4O2RA 1V6CA 1G4HA 1VL1A 2J5KA 3AY0A 4TKLA 1I1HA 1T3LA 1XTKA 2P9CA 2ZS9A 3LYAA 3LWZA 4GOKA 1AGNA 5DTEA 3V48A 4KN8A 1GSOA 3DDUA 1AN0A 1VYHA 2BF7A 1NUQA 2WHXA 1V5EA 4M7OA 2B9EA 2EHDA 4J75A 3NT5A 1YIAA 2EU8A 3FW1A 2EWVA 3K72B 3UG7A 5ES3A 2CDRA 1UOOA 3ENNA 1EJ0A 2ZITA 1TJNA 4MKGA 5E4YA 1O8BA 1UM9A 2CLKB 4B3XA 1BMFD 2DTXA 4RC9A 1RABA 3L41A 3UW3A 4QBKA 1CRWG 2CDCA 1PD0A 4EUKA 2RGNC 3NEAA 5D5PA 3X1KA 1T8PA 1KVUA 2G82A 2LBPA 3LCCA 3NB0A 3S6JA 4D8UA 4MRNA 4BECA 4ZO8A 2AQ8A 3DBRB 3AWDA 4X1OA 4D0SA 2RHCA 2YIVX 1B1AA 1KEUA 4E2WA 2Q62A 1G8GA 1GTRA 1FYDA 1YKSA 4Z7OB 3KPUA 2VDOB 3A9CA 2ZR8A 4KPUA 2VYNA 5FULA 1EDZA 4QFBA 3HJUA 3E61A 4GVPA 5SYAA 1R74A 1XQWA 4DMGA 4BLVA 3VNSA 5D1HA 1E98A 1P61B 4XR9A 5JD6A 3DL2A 2XVYA 3LUGA 4OOFA 4FGUA 3OZVA 2HQRA 3INGA 5BMVF 5K3CA 2JFWA 3DLTA 1EUCA 3JZDA 4GOND 1Y4UA 2IDZA 3H4IA 3T1OA 4A16A 3NUZA 1JL3A 2IZ5A 2OCDA 2CLIB 1NLZA 3O4VA 5HKLA 4MVJI 5B6JA 3IVMA 3C15C 4PLGA 2R00C 4PRZA 5AXAA 5CA0B 2EJWA 3K9FC 4F92B 2N47A 2PL1A 4F38A 3G5AA 3W7VA 2AZXA 4QOIA 1NW5A 1QHXA 2VP4A 5AJUA 3KQSA 1ST3A 4JT8A 4IKEA 2Q27A 1FJHA 2J3LA 5D6NA 2QRGA 3T0IA 2HHAA 1BSVA 3O1HB 4RCYA 2CF5A 3JQGB 3PHLA 4O4JA 4TTRA 4F5YA 4DARA 3PX7A 5I7FA 1KO7A 2XWBF 2VJNA 4E0BA 5LLDA 1E77A 1LVUA 3L8DA 3OBIA 2G9QA 4K3VA 2QMZA 4YWHA 3K0KA 1X1BA 1XVAA 1RP1A 3NGXA 3PDIA 1DCFA 2HRBA 2IQ5A 3ND7A 3ZD7A 5LQKA 3IV6A 4MKRA 3PS9A 1JT2A 5JCOA 4Z4QA 3OMLA 4O3FA 4KIGA 1LF0A 2HPAA 4D02A 4MO9A 3MAGA 3TSAA 1QCYA 2OXFA 1MAVA 2ZI7A 3TCKA 5DU2A 1PI3A 1X74A 3C2QA 1QKIA 1Z6ZA 2AR0A 2QZ9A 4RF4A 4WH0A 4EEZA 4HGPA 5C1BA 4DR1B 3O82A 3IVXA 4P4TA 1EP1B 1X1EA 5BSMA 1EZZA 3EXIA 2UUOA 5K3AA 3NNNA 3OFKA 3O31A 4X8HA 3K4PA 3ZI4A 3BFXA 3ODPA 2KBFA 1GEEA 4MMYB 3G0DA 4Q21A 5JVDA 3T34A 3OZCA 4MMXB 1OWNA 3S8YA 2GN8A 1H2EA 1I3LA 1MMFB 1N8NA 1U0JA 3CX3A 3HO6A 3JQ9A 1KEPA 1L7PA 1YH3A 1F1JA 2HA3A 2YOGA 3VJLA 1KMQA 4ZIRA 4OG2A 5KYYA 4EHBA 4AT1A 5DK4A 1DL5A 1YZFA 3M0EA 4MWGA 1NOIA 4DCVA 4L22A 4JLUA 4JB3A 2XHEA 3ZZNA 1DS6A 4GBMA 4O3MA 2WF5A 3Q40A 4MAFA 3ZV4A 1TZBA 2A0UA 5E6RA 3R7WA 2E4ZA 3PLRA 2NP6A 2J07A 1H2HA 4E22A 2UAGA 4NABA 5JSUA 1VKOA 4D9EA 4LI0A 1SUBA 2H5JA 2QPTA 3OFVA 1I14A 2B78A 4UNQA 4W63A 3CX7A 4Y0AA 3M5DA 4W6ZA 1VBKA 4B79A 3HMQA 1W0CA 2HPVA 4UE3S 5BYJA 2XGOA 4C4OA 2R9VA 4N12A 1OGJA 4PYQA 4B71A 2Q9BA 2WVGA 3T0GA 4UM8B 3RVJA 2YN2A 3VPXA 1CY0A 3I2YX 2FMKA 3ZBQA 3ZWWA 4DUPA 2PMCA 3GLQA 2BONA 3CYFA 2O3QA 1G8JA 5DIZA 4BQQA 4CL0A 2WV9A 1RQGA 4B6EA 1ECGA 1I2MA 4I6EA 1YB2A 4FDMA 1IG0A 2VJMA 3HU5A 1IMOA 3M82A 3SYKA 1S6YA 4J94A 3F5FA 4K28A 3EA4A 4M55A 4M3NA 2D4AA 4PR0A 1K75A 1U2DA 2A33A 2CLEB 4L0DA 4JXKA 3DAOA 3I6BA 2C4UA 4NMMA 5DTIA 1TADA 4F5EA 1GDTA 1EP9A 4G24A 3ED5A 3EF1A 4JL6A 1XXHB 1MIOA 1YC5A 1OHHA 2OAGA 1CUWA 4ZO6A 4CNBA 5L9AA 7ABPA 3HNOA 3FIJA 2Y1EA 3MILA 4WNAA 1PBNA 1Y8RA 4E5MA 4LYYA 4ZOAA 3AUJB 3TZCA 3ZDFA 3TQIA 4KQCA 2DQZA 4FB5A 1MUUA 2IEBA 4IGKA 3MLBA 1N9GA 5FQNA 2PANA 1EJ6A 2QM7A 2H29A 2QTVB 3BPSA 3PF9A 3X1YA 3I1IA 2JIZA 3EIUA 2XD9A 2XMDA 3ILHA 4K9SA 1SUFA 1JFRA 3HUTA 3OJFA 3EVAA 2JIQA 5H3LA 2OFFA 2YWFA 4ARBA 4HNVA 1QH1A 2NSDA 2DE0X 3OCVA 3BWCA 5BXQC 2IBSA 2NYAA 3OIWA 3OAAA 3EIQA 1RI5A 4F60A 1XDUA 3E15A 2QENA 3PEEA 4N65A 3RHFA 1ONOA 4OI4A 1K6EA 2W98A 5IJ9B 4GOXA 2B37A 3E81A 5FI3A 1SCBA 1ND5A 3ABSB 1CY1A 1ZKDA 4J7AA 1QG6A 2RMKA 3TZ6A 2G04A 1C0IA 1LBEA 1X1RA 1YDHA 3IR5A 5AW8A 5JJ5A 1LNSA 3A6EA 3CZQA 1QO0A 2GD1O 4CJXA 3KQUA 1INLA 1U98A 3PCXA 5B7NA 1Q1AA 3OECA 1GL9B 2CC2A 2GJKA 4F56A 2YXBA 2HLNA 4MVYA 4MHSA 3FYCA 3L1UA 3TAUA 3LRPA 3FMVA 3WGMA 1SXJD 1YU6A 1U2SA 5IDQA 4RVFA 1DAFA 5HK9A 3CUSA 4WKOA 3BCHA 1LNZA 4HDQB 4ZHQA 4JGIA 2WHRA 2AVNA 3I0ZA 3LDUA 1Q1NA 3U3MA 3RTGA 4Q4CA 1H22A 8ATCA 2J41A 1B73A 3QU2A 2FN3A 1XFAA 2G7MC 3PL5A 3QJYA 4HYQA 4RY0A 4WNYA 4IFTA 4GVXA 1Y4SA 1LWNA 4G1EB 1WOMA 4RK0A 4OHXA 2ERXA 4WLEA 3KJZA 4DA6A 4P80A 4V0SA 3GLTA 1UKEA 2ASVA 1CS0A 2GK6A 5LCXA 3IAFA 1ENYA 4OOEA 5CURA 4F2GA 5A6SA 4TYYA 1KI1A 2QX9A 2R87A 3QP9A 3H1EA 3PGA1 1ORTA 3FCXA 2NU7B 4H7PA 3ZU3A 1MH1A 3QY0A 3GRPA 4EITA 1VLQA 3EZ9A 2HWUA 1XALA 3K2QA 1GYQA 4MJ3A 1XJ5A 1YRYE 2R1TB 3GW8A 3KJFA 3BGOS 1G21E 4IL5A 2H48A 1E1MA 3IUMA 1NNLA 3RVDA 2H4FA 2OENG 2I2BA 5JE8A 5CAEB 1E1YA 1Y9AA 2QLFA 3PRKE 4LVCA 2WT4A 2WAAA 2COUA 3GGOA 3UBTA 1TQ2A 1D2HA 5AXBA 1SAYA 5LYJF 4R2IA 3WRWA 3AERB 4GC5A 1O4WA 4M88A 5DHUA 3UWPA 4D4IA 4DTCA 1RKXA 3D8SA 4DZTA 3OY7A 3G89A 3A9TA 4JL8A 2QR5A 3QEMB 4G5RA 1MB9A 2R66A 3AXTA 1Y1KE 4KE9A 4U6NA 1AKVA 5LZ5A 2ZIXB 2Z4RA 1PSDA 2JFOA 2A9JA 2BGRA 3ND6A 4MK4A 4MKZA 4NCNA 1KYVA 3AZOA 4BNGA 5IZCA 5IUKC 5EP4A 4XD7A 1ORVA 2XCOA 5SZKB 5C8ZA 2LRHA 3SP1A 2OHIA 1N6PA 4MJ7A 1BHJA 5FJIA 2AYYA 3VZRA 5L3VA 3AONB 3F49S 1CR1A 1RTTA 1SM4A 3B85A 2V45A 1QRUA 3PLAE 1I2DA 4FZ3A 1Z2AA 3TBKA 4N40A 5HGXA 3N58A 1I7LA 1BDJA 3FGPA 3NM5A 5EUMA 3K73O 1YU9A 1BCRB 1QTIA 4MA4A 1L7BA 3IODA 1HQCA 2F00A 1J6UA 5ER6A 3WLMA 2WQ7A 1PK8A 3HWRA 5SY9A 4IDPA 4OJNA 3EEIA 3MPOA 1AZLA 4IQGA 3C3DA 2BCJQ 3EIHA 4Q6WA 1P6UA 5CB4B 4R1MA 3CMMA 1YJQA 2G6BA 3T3MB 1YR6A 1DKUA 4NH4A 2C0PA 3A1WA 3O2SB 1YULA 2I7TA 4BWVA 2GX6A 1M2HA 4IH4A 3X3HA 2A1TR 1EX9A 4YMUA 5KOYA 4WD3A 3P9SA 1HH4A 4MUKA 4OLFA 3VR1A 4HQ6A 2XF8A 3TJMA 5JWRA 4HNUA 3A4IA 2YHIB 3BSFA 2ZIVB 3DQQA 3ENVA 3KTOA 1E32A 3N1UA 3TKYA 5CLGA 4ANFA 3BORA 4NOLA 2FGKA 3JR3A 2ODQA 3TW4A 4BO8A 3C3WA 1EGVB 2BMEA 4WLNA 2ZETA 2INGX 3NIGB 5PNTA 1ONSA 2P5YA 3MSXA 4DMKA 1WTAA 1J2EA 3EVDA 3QFTA 2QLBA 1NL3A 1E1RA 2ZSDA 2CK3A 4UBKA 5AKIA 4DQXA 5FUQA 5HW0A 4EHNA 3DO8A 1C3JA 4GOMD 3DFUA 3H05A 1N8TA 4PXSA 4UD2A 1DIAA 2ZYAA 1S3GA 4N4AA 1C7ZA 2WUEA 4DEVA 3CRZA 1O0CA 5HE8A 5FH9A 3K09A 3KKNA 3TOCA 3VNRA 3F9CA 2VJLA 1BS2A 5THXA 4AKEA 1DC4A 1T1EA 4HNTA 3RSQA 3WLFA 1ZS9A 1USIA 4G1VA 3SC3A 1UPCA 3KL4A 3QUAA 1RT9A 5CW2A 5LQCA 1E2BA 1C3XA 1Z62A 3PWSA 5DGTA 3RRXA 4DCMA 3K9GA 4B46A 1H9CA 4DR2B 2KPOA 4TQGA 2BGUA 1HG0A 2A0XA 2RC5A 5LNK6 2QLMA 2RC6A 3PD1A 4MYSA 4W8OA 5GIPE 3DB1A 3S0JA 5JDIC 2ZG6A 3EOAI 2AHRA 2PQ6A 5JIBA 2BE9A 3TQQA 4C0LA 1U90A 2OKCA 1BC5A 5DM2A 1PJQA 1GARA 2F3TA 1MA3A 1OI2A 2HDHA 2G9VA 3PQ6A 2R0QC 2C99A 3U26A 4HFRA 1EFRD 4RHXA 4XE5A 2QRUA 2XUGA 4O4HA 5BWOA 4QU8A 4XPZA 1G41A 3ZGXA 4X41A 3WYNA 2FPSA 2PJDA 5HKOA 1JSXA 3JRNA 5LQNA 1PWHA 2X86A 3DDSA 3OTGA 4I50B 4P3KA 2CBXA 1O9HA 2H1IA 1R9NA 2JGAA 3KHTA 2CV0A 2RGYA 1M2VA 1J0CA 4C03A 5KDOA 3HYTA 2IT1A 1AQYA 2X3FA 4RE6A 3DP9A 3H9CA 1D0SA 2XNKA 3KOXA 1BE0A 1ZH2A 1HDXA 1JPUA 4DLRA 2VSQA 4TVBA 1DKOA 4CM7A 4LQCA 4E2ZA 3HCRA 3O7WA 4RVOA 4X90A 1KWKA 2IPXA 3O8RA 4ME6A 4F9GA 3TIXB 1ZGCA 2OVFA 4HWPA 4K2HA 4DR6B 4L7QA 2G25A 1AA9A 2P2NA 2O48X 1XELA 4RESA 5GM2A 4CI0B 2WB4A 3GBPA 4AY5A 4KYTA 9GPBA 2ZI6A 3PC8A 5GOZA 1O77A 2BLNA 1PVOA 1PWXA 1DWOA 3UXMA 1OGIA 3G49A 4ZVQA 1B6TA 2Q7DA 4UTNA 2VHJA 4UNPA 1SQFA 3MCUA 6REQA 4JLSA 1XPUA 3N39C 4Y9TA 3L0ZA 4Q7EA 3MSCA 2OLEA 5FORA 1DVRA 5FTWA 4AX8A 5AP9A 3AESA 5F7XA 4R5HA 1UANA 4GI3A 3VPFA 2VRCA 4EUFA 5G0WA 4H1UA 2VPIA 2XGGA 4FOLA 5AM1A 3KTDA 1IXRC 1S4MA 4U5QA 1M2NA 2A5FA 3ZCQA 4CW7A 3H1GA 2RHRA 2COEA 2RHBA 3L05A 3PTLA 1BHQ1 2C2ZA 2XZDA 4X45A 1HETA 3UH0A 4BTVA 2O8EB 4P3NA 2XOKD 2IYSA 4V0OA 2V9PA 1NU8A 3PNMA 3QZUA 4G84A 4HAOA 1RE1A 1QQTA 2H3HA 2RKWA 2IUTA 4JASB 2ZFUA 5BWMA 1JVNA 2FN9A 1JIIA 5BR7A 4U7GA 2DKNA 2FPXA 1WMAA 1JEOA 2Q0HA 3GRAA 3GHYA 2I2XB 3FYSA 4BVBA 1ATIA 1RXSA 4IOLA 1JI3A 3REQA 3PPWA 4QXQA 4INAA 3I9JA 4L74A 1XLTC 2WJZB 4P31A 4FMCF 4AKHA 2X9LA 4X94A 5TR9A 3W2GA 2HU5A 4AAYA 1XD8A 4BGEA 1CZLA 1H85A 3GUCA 2IUUA 4TS1A 4JITA 1HLGA 2PWBA 4A0RA 2HM7A 5K0LA 4S05A 4IRXA 2XHZA 4TYQA 2HRDA 3UK7A 4BVEA 2JHCA 3NCHA 4HDNA 3LCMA 2XMCA 1YRQA 3DV9A 3O93A 5CNIA 1GL7A 3CUYA 2W9XA 3PP8A 5H02A 3D7SA 3HKEA 4HS9A 5ALDA 2K7ZA 4MI3A 5JY1A 1TYAE 3WR5A 1XCJA 1RHUA 5T3UA 4C7KA 2AZTA 2XUPA 2GZ3A 1VCOA 1Y3BE 2BN4A 2ORYA 2QRVA 3DFZA 1G5IA 3JSXA 4R01A 4ZHSA 4K26A 1MAUA 3O4IA 1M1NB 4RTQA 3AETA 3AM1A 2XQIA 1Z37A 2O1EA 3ZE6A 1DUIA 3EOZA 3TLKA 6PFKA 4AF7A 1PG2A 1T5BA 2O0HA 2XCTB 4AJHA 1T2CA 3UCFA 1IL0A 2NZYA 2HLPA 3S29A 4DSOA 4F8EA 4RPKA 4D45A 1BE8A 5T4EA 3ZD6A 4HC4A 5EP2A 3UWKA 3KQOA 1FSPA 1EX7A 1NBEA 4UPDA 4R6WA 5EXSA 1W25A 4ZC1A 1BU5A 2AGVA 2YJGA 1QIEA 4R1UA 2C83A 3ZQJA 1DKLA 4P2GA 3FNGA 5EHXA 1Y9EA 2HJGA 2PBRA 1FVHA 1GUBA 4I5GA 5EVJA 5I7HA 1GZDA 4MI6A 1SQ6A 5FQOA 2FG5A 3EN0A 4FX2A 4K9RA 1L5KA 1ZLXA 3JQBA 1I10A 1U9IA 1VP9A 3KJHA 5K0CA 4IZOA 3UCXA 5BVGB 2NVOA 4M7PA 3OLYA 4WK6A 1WZCA 1XHLA 4MXDA 2ZQ5A 3C3MA 3GRYA 4R2WA 5A5GA 5T8KC 3AF1A 4LZLA 1V5IA 3T3NA 3GNLA 2BMWA 2FP4B 2C0QA 4KO4S 4P83A 1B8NA 2QUZA 4RJLA 2W8BB 3PGXA 3VSBA 2GB4A 4WY2A 4EVQA 1J9EA 1KH1A 1NR7A 1PAUA 4TRMA 4AZ0B 5A03A 3KFVA 4OX9Y 3Q3HA 3VR3D 4XQ0A 1OZ0A 1NW9B 2QIPA 4GWGA 1RJ9A 4M9RA 5AOVA 3HP1A 1DQNA 3BE8A 4LRTB 2HU7A 1OTHA 1RNLA 3ELUA 2BF4A 2X4DA 1V7QA 4HFJA 1L6RA 3OPYB 4B3CA 3P9QA 4N39A 2NXEA 1VKHA 3H84A 2P1RA 1R6UA 2Y2VA 4JT9A 2QRLA 3L18A 4HPJB 3U1TA 2F3UA 1KVTA 5JCXA 5A02A 3DPSA 4NCXA 3KD2A 1U6IA 2Q2WA 3S1LA 3IDQA 3SF8B 1R0LA 2IP1A 4QNNA 3TTSA 4P5EA 4BVGA 5A5EA 2VSYA 3U7FB 2A1UA 1ZCAA 2YJTD 2Z3WA 3GH3A 3OFNA 4H6PA 4LWQA 5DN6D 3P4UA 1AMOA 4JUFA 3MGGA 1LQUA 3KSZO 2Q4OA 4P92A 4R1OA 3GDOA 1FOEB 5IC6A 3ZW9A 3HB4X 1JDUA 4WFJA 4K9KA 3RREA 2PCJA 1VSQA 2EJBA 3C6YA 1XWFA 3D8NA 3MRSA 4ITRC 1DC8A 4WZAB 5CLIA 4L28A 4MS1A 4LHSA 4TMYA 3VNQA 1LLCA 1SR8A 4Z4HA 5LOVF 1SUEA 1YZQA 5EL0A 3RODA 4MNTA 3GLKA 4RY2A 1H8HD 5HMLA 4E1VA 1KEEB 1YGYA 4L15A 3EXHC 1UP6A 1YQUA 2QM3A 1N4AA 5TSDA 4ZZ1A 4RTSA 3BXFA 3IBSA 2J08A 4YT5A 3IESA 5K0BA 1MX3A 1KS2A 2I1WA 2IVZA 4IHAA 3VPDA 1O6BA 2OEPA 2FRVA 3EFBA 5TX7A 2Z9BA 3ESCA 1QF7A 4HDSA 4NEGA 2QUJA 5EGNA 4Z99A 3RYIA 4DRZA 2Q8PA 1XVUA 2Z98A 1KY4A 3IUJA 2BRUA 3U61B 1LS1A 2W6JD 2CW5A 4H7IA 1RLMA 3W8DA 5JRDS 5EUQB 3W6UA 3F3KA 3FSRA 4YJGB 5DTJA 2ZEJA 3GXOA 3N9IA 3ZPXA 1P2UA 3KFLA 2IW1A 3MWEB 3QQ5A 3QFFA 4DXDA 3FF1A 4E13A 2ZAGA 5T4HA 2CE2X 5DWVA 3GD7A 4WQMA 1MZVA 4V39A 2OZVA 1LX6A 5JXGA 2WZQA 5H9VA 3HU2A 2BSXA 3HBNA 3SYMA 4N6NA 1VMKA 2VDQB 2YHBA 3Q7PA 2ZVDA 1SK9A 4Y6QA 1NPTO 1XU7A 3CUWA 1AUQA 4OAOA 1Y81A 1DFHA 1OCEA 1B0ZA 1F14A 3F9IA 3OJWA 4OQQA 4DQVA 3QLTA 3BK2A 1ZVJA 4NS1A 4E14A 1JX6A 1YUBA 1ECBA 1LPPA 2V74B 4OL9A 1E69A 2BKUA 1I1QB 2B6HA 4OGWA 4OQNA 1VOTA 2W2OA 4KREA 2ZI5A 3KSAC 1J5XA 3NDBB 3PWTA 3NOOA 2Q2QA 2XB9A 5C3MA 4ZT2A 4BB0A 3WAJA 4ZAFA 4X20A 2H0AA 2RAVA 3OZXA 1HT0A 2JCYA 3PXDA 1MFPA 4B8ZA 1XYYA 3DWIA 3NM6B 5B7QA 1RFGE 4R54A 1Z75A 3F4BA 1OH6A 4M9UA 3RLFA 3H42B 4HXEB 5EI5A 3IPYA 2PT6A 1N2ZA 1NVVQ 4TXHA 5AVSA 3UKOA 1CIPA 2QW1A 5EVCA 1UXIA 4URYR 5EJ4A 2ZS7A 4V1CA 4OMDA 1IIRA 4QPCA 3NKVA 1IJBA 1E9VA 1VTKA 2HLHA 2RJOA 2XWJI 3NALA 4I1RA 3EGIA 4QQFA 1PDOA 1RC8A 1IBMB 3FD8A 3NORA 4QUHA 1U5AA 3OEHA 1XL0A 4IJVA 1AVTA 1SUIA 1XJ0A 2I4LA 2NXJA