1JE0A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with phosphate and tris molecule
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
234
structure length
226
Chain Sequence
PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 76
structure length 226
sequence length 234
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1je0A00
4OGLA 4YJKA 3TL6A 5F78A 1VFNA 5CXSA 4QEZA 2AI2A 4K6OA 3EEIA 3FB1A 4LKRA 4IP0A 1SJ9A 3EMVA 5CCEA 4WKCA 4H1TA 1RR6A 1B8NA 5IU6A 1Y1SA 1JDVA 1PF7E 1C3XA 1PR2A 3UAXA 1XE3A 5EFOA 1VHJA 4OJTA 1ULBA 3C74A 3LA8A 4RJ2A 3KUKA 3NM4A 3MB8A 1LVUA 4D8VA 4EARA 1K9SA 4JWTA 1OVGA 5F7ZA 4YMLA 1A9TA 4DA7A 4DAOA 1ODIA 4OY3A 4DA8A 4GMHA 4KN5A 3DDOA 4QASA 1NC3A 4QFBA 2Q7OE 1YRYE 4GKAA 1JDTA 1OTXA 3NM6B 3D1VA 4R31A 3UAZA 4TS3A 4M1EA 1YBFA 3LBAA 1A9OA 1TD1A 1K27A 3OZDA 4E1VA 1PR1A 1T8RA 1Y6RA 4LNAA 1T8YA 1JYSA 5F7XA 3LGSA 1PR0A 1RYZA 1JE0A 1OV6A 4PR3A 2I8AA 1Z36A 4TXJA 4JP5A 4OF4A 4TXNA 5CYGA 1A9SA 1V2HE 4F3CA 1SQ6A 3INYA 3U40A 3K8OE 2ON6A 4UC0A 5KB3A 2HSWA 4D9HA 2H8GA 1Y1RA 1PW7A 3P0FA 3UT6A 4G89A 5DK6A 1Y1TA 1I80A 3MMSA 4MARA 1G2OA 3FUCA 1CG6A 1Y1QA 3KVRA 1A69A 2HWUA 1T8WA 3T94A 2A0XA 5CXQA 1Q1GA 3KU4A 1Z33A 1A9RA 1LV8A 1RCTE 1Z34A 4BMZA 1RXYA 4TTAA 2QDKA 3OF3A 4L5CA 3ENZA 4X24A 3EUEA 4ECEA 1ZL2A 5IFKA 1M73E 4WKBA 1Z5NA 4P54A 1NW4A 5F76A 1PKEA 4I2VA 5EPUA 4D8YA 2RJ3A 3O4VA 3KVVA 4F2PA 1A9PA 1B8OA 4R2XA 4OEHA 2B94A 3BJEA 4TXMA 3E9RA 3DF9A 4OGKA 1RSZA 1Z38A 1U1FA 3OOEA 4DANA 1N3IA 3BL6A 1PBNA 5F7JA 1PR6A 4GLJA 3DP9A 5CYFA 4DAEA 1V48A 4F3KA 2PGAA 4LZWA 3FOWA 4QARA 3NBQA 1WTAA 4TTJA 4BN0A 3GB9A 1JE1A 1Z35A 2OC9A 4FFSA 1TGVA 3O6VA 5B7GA 1QE5A 1RXUA 5FAKA 5JPCA 2A8YA 1T0UA 1YQUA 4NSNA 3OZCA 3UAYA 1SD2A 1Y6QA 1RFGE 3PHBE 2QSUA 1OTYA 5ETJA 3FWPA 1JP7A 3KHSA 1Z5PA 4JOSA 3QPBA 1NC1A 4L0MA 5F7OA 1JDSA 5F77A 4F2WA 3BGSA 3OZBA 2HRDA 1V4NA 4G41A 1V41E 4PNPA 3OCCA 4WKPA 2XRFA 1PR4A 1YR3A 2OXFA 4D8XA 3F8WA 3IEXA 1V3QE 1ODJA 1K3FA 4DARA 4R2WA 4LNHA 4TS9A 4DA0A 5B7PA 4BMYA 4DABA 3OZEA 1TCVA 2IQ5A 2AI3A 1OUMA 4G8JA 3FAZA 1RT9A 4GLFA 1LX7A 2BSXA 4TYMA 4M3NA 4TXHA 3ONVA 1T8SA 1ODLA 4WKOA 3EUFA 4L6IA 1TGYA 4D98A 3DJFA 1U1DA 1PWYE 2OECA 3UAVA 5I3CA 5F73A 1Z5OA 1FXUA 1OU4A 2OC4A 4LDNA 5C80A 4NS1A 3NM5A 2QTGA 2AI1A 3SCZA 2I4TA 1RXSA 1SD1A 1V45E 3OPVA 1ODKA 4TTIA 2A0WA 1U1EA 1PK9A 1ZOSA 4MCHA 3E9ZA 3OOHA 1VHWA 1YQQA 3IOMA 1TCUA 4WKNA 4NY1A 4BMXA 1A9QA 4L5AA 1JPVA 1PK7A 1PR5A 4YO8A 3BSFA 3PNSA 2QPLA 3GGSA 2P4SA 4QAQA 5B7QA 3PNPA 3E0QA 2AC7A 1VMKA 3UAWA 1ULAA 3FNQA 4TXLA 4F1WA 4L5YA 3DPSA 4M7WA 5CCDA 1Z39A 5EUBA 4DA6A 1Z37A 5K1ZA 3ODGA 4EB8A 4YNBA 2QTTA 2A0YA 2HN9A 2ISCA 4MCIA 3K8QA 3KVYA 4QATA 1U1CA 1JDZA 3PHCA 5B7NA 3P0EA 1ECPA 1RXCA 4U2KA 1CB0A 2GUWA 1U1GA 1JDUA
chains in the Genus database with same CATH superfamily
1CULC 3E61A 4Q24A 3TBFA 1L4FA 2C4VA 2HMAA 1E1CB 2P8SA 2VT6A 1BS1A 3PQ2A 4OK3A 1FRVA 1PZEA 2WICA 5B58C 1PZHA 4CG0A 1EM8A 3ZQJA 1A9XB 5G4KA 5ES3A 3HCOA 4DMMA 3AR5A 4F9TA 5E2AA 1JV2B 4OI1A 3N7TA 1I2DA 4HJXA 4YY3B 5TMPA 3CZ9A 4B43A 4D43A 4X6YA 1QYDA 3ZWDA 3VC2A 1W29A 3OE4A 1EWRA 2RGDA 1VE6A 4ESVA 1WHTB 3PXDA 1YA6A 4MHSA 3AF2A 2WIJA 4D3ZA 2GF9A 1P61B 4NJEA 3O2QB 3G59A 2DPMA 2Q2QA 2XH8A 1KORA 3H5AA 4FR0A 4L8GA 3NW9A 4W8HA 1V6CA 4GS5A 4DM3A 3JQQA 1YBHA 5D87A 1F4LA 1AGNA 1CWUA 5G4LA 2CDRA 2ZBQA 4J1NA 4LY0A 2HV9A 1XZPA 4RDHA 4D9CA 1IAVA 4ZCQA 3U4GA 3ABOB 4BFTA 3DYVA 2PVCA 1TVKB 4K1XA 4HRVA 4QGBA 3VZDA 1PF7E 4QFMA 3MUEA 1SKBA 1FFSA 2WVGA 3A2NA 3QMPA 1WBDA 4N12A 4PRZA 4BKUA 4E30A 2X0DA 4QPZA 2JAHA 3OP4A 4YX9A 2XRYA 1KGSA 1AQYA 3IURA 3P9CA 4XPIA 3U7FB 1L5YA 4KQEA 3ESXA 1ULBA 5EJ4A 2H1LA 3H1GA 3LA8A 4K88A 2YFYA 3DZFA 4LBWA 5KTYA 3WAGA 3KYJB 4W9NA 2DY0A 2JD2A 2PUHA 1SG6A 4FD2A 4LXHA 4C7OB 1YR2A 2BFFA 3KQMA 4B9AA 1BJKA 1IRIA 1U11A 2OBBA 4MJXA 4FFBA 4WXHA 3W5BA 4MDFA 4GM0A 2JZNA 3HY6A 4W5WA 2WOOA 1KK3A 2H1SA 3IE2A 3ZR4B 4HNTA 2WDPA 1EINA 2J6IA 1IXRC 4XWYA 5AM4A 1CR4A 1JQKA 1C9EA 3KM0A 2WPDD 1HOXA 1TADA 3CR7A 3FPLA 3ND5A 4CKCB 1H9AA 4CR7A 4DAOA 2QMZA 3OEYA 5GZ6A 1N6IA 1WM1A 2W8BA 3RC8A 1QWOA 1CD5A 1THMA 4GMHA 5DYIA 1YFJA 1XZMA 1RXIA 5DLQC 5JZ9A 2I6XA 3AF3A 4FFVA 2B4TO 1VSBA 2O57A 3F3YA 3HPRA 3OMLA 3RUPA 4KFRA 2CFOA 3K70C 1H0RA 3FNHA 4IH1A 4DA8A 3SZGA 2Q7OE 4TYYA 1JDTA 4AJNA 4DWJA 2PR2A 1OT3A 3O8NA 5D1NA 5E8RA 1KAHA 1X74A 2B1JA 2C2GA 4CEIB 4M1EA 1OBVA 1SD5A 1TD1A 2ORYA 5IXJA 4PG4A 5MFZA 2HF2A 3WYAA 5JNVA 3BWBA 2NSJA 3JSAA 2IDJA 5IM4F 2DP4E 2R8ZA 4N5LA 1GT6A 1U2RA 1P45A 4OYLA 5GV8A 4JI2B 1R0KA 1W6UA 2J09A 4F4CA 3CH5A 3I4CA 1FP4B 1CJUC 1LI5A 1NIPA 3O7WA 4WXEA 1KO8A 2ISQA 3TX2A 4ICIA 3PD0A 1XZIA 3X44A 2MINB 1B3RA 1DBSA 1PNTA 2XGOA 4OB8A 5FL7D 1GNLA 1FLVA 2I8AA 1JXAA 2AUMA 4WESB 4ZYLA 3STXA 3SYTA 5KHLB 1P2TA 3E4DA 3I0MA 4KN9S 4DV4B 1A9SA 1FFAA 2YH2A 4TWAA 2JI7A 5D86A 3KJXA 1KJQA 3L8EA 2I1QA 3UK1A 1H4TA 2X0KA 5ALIA 2HGZA 3R7FA 5I7FA 1SQ6A 1E8MA 1UXGA 3BUSA 3VPXA 4EI9A 4Q9LA 4C43A 2QT0A 1CZNA 4J4BA 1EP9A 2XOXA 2JGDB 3FPJA 2IF0A 5AVKA 5KNCD 1PJ8A 3M4YA 2JRCA 4Q4AA 4FGUA 1G66A 5LLDA 4ZYXA 1A71A 1YK0A 4LZOA 4MA0A 4Q9NA 2GJ9A 3LPNA 4PYQA 2DB3A 1GG5A 3WIDA 2ZJ8A 2P6PA 1T1GA 3LK6A 1XRNA 4IWYA 5DLPA 3IVAA 3LPMA 1XNRB 1EAYA 3DAGA 3PC8C 1QO0A 1KZ9A 2IGBA 5CW1A 3BWMA 1BXRB 4MX8A 4RS3A 1RADA 3LQ4A 4X95A 4AZ0A 4W5TA 1QFJA 1AQLA 5EIAA 3F78A 4L73A 4R81A 1OH7A 1L7QA 1ODSA 1UZAA 1HG0A 2GJ8A 4GVXA 4UHDA 5DNAA 1PFKA 3HKCA 4XFDA 1FNDA 2UZ4A 1XTRA 2BEVA 1WOMA 2LPMA 2CFCA 2Q3FA 3A6KA 5ENDA 4ZVVA 1NM5A 4JJFA 5ES4B 1EP1B 1RQGA 1TLFA 2P62A 2XMZA 3DZCA 5GINE 1NVUQ 3M6XA 5E4YA 5FTWA 1Y63A 3P71T 4PXYA 4YRZA 2I6TA 3F6CA 4LBZA 2BEKA 3FPCA 1I4EB 3LXXA 3QTBA 3O38A 1C7QA 4MW1A 1XCMA 3FPKA 4N3GA 4ZQFA 4MAFA 5JRZA 1GNSA 1GKYA 1LD3A 2AT1A 1D2HA 3O9MA 3BWYA 3GJ7A 2FWJA 2QDKA 1GPH1 1Y37A 3SYLA 2B5OA 2E49A 1RC0A 4NI5A 5DBOA 4KQJA 5CB4F 4C78A 2UVDA 1DO8A 3B6MA 2X2EA 3SC2A 5KPJA 5THQA 5JC8A 1QV6A 1KOFA 4D8WA 4D80A 4DNFA 1XCPA 2RGWA 2G8LA 4KXWA 1D2EA 3DTNA 3HU5A 3NLLA 3S44A 1U3WA 3L2OB 5B1IA 3NHPA 2QX8A 2AG8A 1E1RA 1Z5NA 2RGGA 4Q03A 4I1RA 1R9JA 2DX7A 4HFNA 2CMGA 2JJ1A 4PONA 2O0HA 3IOYA 4N0MA 4IYRA 4RFSB 1ZGZA 1SBTA 1VMDA 4UUPA 2WSSD 1NPDA 3OM9A 3QWFA 2VF5X 3AJEA 1JHAA 1KH3A 1M9NA 2FE1A 4J6FA 1XC7A 2ZI5A 2CB9A 2A94A 4ZCMA 5LQSA 2WAOA 1K63A 3DOJA 2AHRA 4F2PA 4M1TA 1DMSA 3CXRA 2EVWX 2Q50A 1NLUA 5BSMA 3QOFA 3HU3A 5ALTA 1Z0AA 1VG1A 2WG0A 1OQAA 2WIFA 3AYZB 5H1YA 4NCIA 3GHHA 2O6LA 4WGGA 3VV3A 1JQ3A 4JWKA 3AL2A 2HQOA 3DT6A 2F3SA 3MB5A 3U3JA 1E2JA 4QG3A 2AG0A 4FCTA 2ZB2A 3GROA 5T8KA 4WN3A 4I55A 4E4TA 5GJVC 2WWWA 3ASYA 1U9JA 4J29A 4GMGA 4OHKA 3I5UA 1E1QD 2PR7A 1A50B 1GU0A 2PL5A 5FIUA 4IY1A 3OY7A 1CRPA 2M9MA 3RCBA 3IHLA 3JQAB 2PX8A 4I46A 3EYAA 3GIDA 3NWBA 5ELXA 1A5BB 2H9AA 3AP3A 4DCPA 1OHHA 1XZNA 1MXFA 2OBMA 3FOWA 5AK3A 4JLSA 3LDFA 1WQ3A 3VKUA 2BBWA 3E2PA 4AX8A 1QP7A 3OFNA 5FUYA 4BRWA 2JGKA 3KKNA 1QX3A 1USUA 1ZMRA 4JEUA 2IIQA 5LBIA 1K68A 1QPGA 1WUKS 4BN0A 2VOEA 3QFRA 4YAEA 2LW7A 4YI5A 4DLXA 4HAOA 3FTPA 5FUXA 2C7QA 4JI7B 5BUCA 4K6KA 1E7SA 5IP5A 3GBSA 1K4YA 4GM1A 3SVZA 3KU1A 1QONA 2BGNA 4E3WA 5FAKA 1EZ4A 1UBOS 2QLFA 4YMUA 5EZYB 1WW2A 4YDQA 1T0UA 4M60A 5TQ0A 1ZR2A 2DR3A 1HE4A 1DWUA 4JJ4A 4FZJA 1HNWB 2JVJA 1GTG1 4YMTA 3QKSA 2UZ1B 5FTLA 5JT1A 1PWHA 1B23P 1EG2A 4IBOA 5BUSA 5C46F 1NBWB 4IINA 3B2NA 4JELA 1PJSA 3PD1A 4RSMA 4R8LA 2C4KA 1DC6A 3E53A 1I1NA 4KKVA 2Y1EA 1Z5PA 2XCIA 1P91A 3KT6A 4L5IA 5IJAA 1QZUA 3DFZA 4RZIA 3LIIA 3ONFA 4ENWA 1E77A 4Q7EA 4DDVA 4XDHA 1ZK0A 3JARB 1RZVA 2IXDA 1NC1A 2I54A 2YXBA 3T5DA 2V7WA 2YUIA 3EVNA 1BXGB 1ZX1A 4V2UA 1XA4A 3K1TA 3PE4A 3UQZA 4M9XA 3P32A 4I1UA 3WGKA 5KI6A 1U1IA 2XGGA 5AVQA 2ROQA 2XVXA 3SKXA 1QK4A 2ATVA 4BWGA 1QFMA 2J3KA 3L1KA 1E2MA 1GL6A 4E22A 5KYGA 1H1LA 1I36A 3GLRA 3PI7A 1UBHS 4RHCA 3TTYA 2AFIE 2YN0A 3F8WA 3MG9A 4LVCA 4C4XA 4IUDS 1C8KA 3TKAA 4F0JA 1GD1O 2FG6C 4KXVA 3MUFA 2PWPA 1C0PA 2OQIA 1WXGA 2ALJA 5EIOA 4BQIA 4KHZA 4MYDA 2WJ4A 3Q88A 5FPTA 2UZ3A 4TSFD 5HVNA 3BIWA 1N34B 1NQWA 4RGBA 2MT9A 3ZTYA 2B61A 5FORA 1N7IA 3HDTA 3SEFA 3QELA 5DHRA 3ZGLA 2NU6B 2QIPA 3W04A 2OT3B 3N8DA 4DABA 4OV6B 2DUWA 3F8SA 2RHTA 1E63A 1JQDA 1BQEA 1P60A 3HS3A 1A8IA 5KKAA 4BNKA 1RI1A 2YV4A 1XTIA 2MOKA 1KH1A 2P75A 3D6TB 3HYCA 4G0OA 3L1JA 5HF6A 3ZCPA 4DZRA 5KQGA 3SYNA 3F5QA 3K1JA 5KINB 4HDSA 1C3JA 3NJRA 1KHHA 1GAQA 4PLPA 1FP1D 2PBFA 3RS3A 1US8A 4XFKA 4A2CA 2D7DA 1M34E 2NAPA 3Q8WA 5EMMA 4KVGA 1GM5A 1XWIA 3G85A 2I3DA 3OE5A 3HDYA 1EIWA 4O33A 5JD6A 3P8ZA 1ODLA 2FSVA 3GDOA 4L1KA 1DARA 3T3IA 3K05A 4P81A 2Q8PA 5GMOA 5REQA 1W59A 1RW4A 3P9IA 421PA 3GEMA 1ZVVA 3OUUA 5LKAA 1NI4B 4MQ6A 1TGYA 2E5WA 3HB4X 3OURA 3PRYA 5EJGA 5K4GA 3KSMA 4KC0A 1Y8QA 1ZYUA 1MTZA 4YEDA 4EJ2A 2O54A 1QVRA 2G4LA 4BWVA 2GUGA 1CLUA 4KIGA 1HFWA 1II8A 4MYCA 4Q47A 3O93A 4J0IA 2FDCA 1T6YA 3K70B 1E99A 2VDNB 2FP4A 4P3NA 3WYEA 3AP1A 5IAKA 5BV1A 4URVR 2FAXA 4NESA 4CN9A 4F8EA 3V4PB 3P52A 3G0BA 4RVCA 3E82A 2ODEA 1RXSA 3RK0A 1Z56C 2EX0A 2ZLBA 1AIPA 2JEOA 2BTOA 2C1EA 4U1RA 2YXEA 4Z9XA 2HO4A 1IPEA 2JLWA 4Y9UA 2Q49A 3DM5A 5AQ1A 3GL9A 1MQAA 3N74A 4HFRA 1E3JA 1FU4A 1TQDA 3GP3A 3QHPA 2CV0A 2CC2A 3MXTA 4FYVA 3LWZA 1R0BA 4FW8A 5AVOA 3WMEA 4RTRA 1U9CA 1P77A 3NIFB 4C01A 1RWBA 4BO0A 1REQB 3AF4A 3C8MA 3R5KA 1FPMA 1E6LA 3AR3A 3UJ3X 5T3YA 3QHQA 4OM8A 3S55A 2W2PA 2HPHA 4BNFA 2QL6A 4C7JA 3W6UA 2OQ2A 4WKNA 4YCSA 2JHPA 1KYVA 2NZVG 5B3JC 3X1KA 3BSSA 1U8CB 1HDOA 5JJBA 3ENWA 2O3RA 1NKSA 1RHQA 4H17A 4JQOA 4H3KB 1JPVA 2GJAA 1ZFNA 2FR1A 4XH9B 3WRXA 2MSDB 1E96A 2ADFA 2DQZA 2YVKA 3AGQA 3D5QA 2Q5HA 4B73A 5FLXA 4Q7JB 4FPXA 5IK2A 5DXAA 3F3SA 2OVBA 3O4HA 1I3KA 1BRTA 1P5JA 3GVIA 4UM8B 3M6VA 1VTKA 2K87A 4PSDA 2GK3A 3IP1A 1IUNA 1SBNE 3QKIA 1ABEA 4O2AF 3LPCA 4CG1A 5B3AA 1HSZA 2LKDA 1WWKA 3UAWA 1P2SA 1C81A 4HN4B 2HA2A 4DLUA 1TQ2A 4CM3A 2V0NA 2NOAA 4JBWA 4LQ4A 1Y5RA 5AH0A 5IYZF 1V8OA 1NU6A 3T9AA 2Z4TA 1SQFA 2AFVA 3EW7A 4BNDA 6ABPA 5JD5A 1N5KA 3IIIA 4H77A 4KJXA 4AJ4A 5D6OA 2EYUA 4IIJA 1TIBA 3BGOS 4ND7A 2O19A 4NAUA 4IVNA 2XLCA 3GPDG 3K8QA 3LBHA 3TN7A 4BLRA 1JDZA 2OA0A 3U09A 4HAXA 2C20A 3FMGA 3SFTA 3UK0A 4B48A 3Q8LA 3E7WA 3T95A 3UUEA 3VSDA 4MQUA 4ADSG 4TZ6A 2IEDA 4KL8S 1Q7CA 3TX6A 4WBNB 5KNBA 2RH9B 4UU8A 5PGMA 3LSTA 3KDSE 4MR7A 2ZIXB 2OILA 1U9ZA 2G36A 3I2FA 4DCOA 2ZW9A 2NACA 3H1AA 2PGIA 1GG2A 4NCNA 3OWHA 4RY8A 4EY6A 1Y8CA 3S99A 1YQWA 1IHYA 2B7CA 1VIAA 1CZHA 1SGWA 2X4GA 1VCNA 1VZ2A 3M5WA 4WACA 5AJYA 4LV6A 4CJXA 3ZDDA 5ERYA 3TLXA 1AGRA 3HCNA 2EKZA 2PL3A 2ZTHA 2HTFA 3NAGA 4PQRA 4YT2A 4JSYA 5FPQA 5LQRA 2PFKA 3MT9A 1QIKA 4BBJA 5MGNA 1D6NA 1VJTA 1VB5A 1PX0A 2OBYA 2BDUA 3N2NA 5AM5A 4G5GA 4BTLA 4M0DA 5E6SB 4R2IA 1A4XA 2JIOA 1SCUA 5DWDA 2B99A 3PB3A 5CHEA 3R3JA 2YDYA 1X19A 4FKZA 2HOQA 2V5UA 2WPNA 1MX9A 1C0LA 2ERCA 2X3FA 5H70A 4A5SA 1UDRA 5KWVA 1KQFA 4DBLE 1SO8A 2CCGA 4RTJA 2OHHA 2VATA 3HN6A 5GY7A 3CKLA 4MVJP 5DSXA 1UWKA 3NATA 4ZOLF 2JFGA 1VLMA 3PEWA 1OA0A 2QLMA 4Q7LA 4NV1A 3FB4A 1XQXA 2VL7A 4KRYA 1W48A 3WB2A 1B8NA 3LAWA 1J23A 1MAVA 1T24A 2NGRA 3W77A 1ECJA 4PIPA 3HN7A 3RFXA 3T5AA 4GOLD 2IHUA 4HWSA 2WJJA 4UM5A 2DEUA 2VEDA 2QTNA 3FDZB 1PR2A 2BBOA 2O05A 2GZ3A 2DHCA 2Z5FA 5LZ5A 2P9TA 5TPZA 2R7KA 3RTEA 4KI0A 2W98A 4EM6A 1FBNA 4CQLA 4H59A 4FBLA 1AG9A 1R00A 4ZOAA 1DADA 1HMPA 3GLHA 5KWSA 1HMYA 4DR3B 3IPCA 4LHSA 3HCPA 3QXCA 1ML4A 2Z8YA 1TTPB 4R2KA 5D3MB 3EA5A 4JC4A 1HDEA 3UPUA 2H9YA 3QSGA 4D9IA 2VYVD 4ZU6X 1QG6A 1K9SA 1T9AA 1JB9A 1UPUA 3ZWVA 5BMVA 1ESZA 4G5FA 4Z0HO 2WF6A 2DBRA 4J94A 4DYDA 3F4LA 1TKRA 3A1UA 4LTMA 3DBHB 3GPLA 1DEXA 1AXGA 4JUAA 2X1HA 5FBLB 1ID8A 5BPHA 4BIIA 4PBTA 3MT0A 2QR5A 1JLMA 3HYSA 4MGIR 3OZXA 4PX5A 1N6OA 1TLTA 2D5CA 2XJ4A 5EKDA 4DA7A 4OY3A 2W70A 1MB3A 3AT1A 4LC0A 2W0MA 4BNNA 2ABWA 5KIAA 2G77B 4JDUA 3ZHQA 2OOSA 3CR8A 4URXR 4MRPA 3LQ1A 1FP7A 4MZDA 1P4AA 4Y9DA 5HYVA 3GOHA 3RS9A 3AONB 2BLNA 5HCNA 3VI3B 1R4NA 1GAWA 5K5EA 1DEKA 1ODCA 3KETA 2XWSA 4PG6A 3QEKA 3X1JA 2Q5OA 2G9VA 1DIOB 3BF8A 4FR2A 1G5HA 4U5QA 2PWZA 5IC6A 5HEKA 4AD8A 3GZTB 3CTMA 2IUSA 4QBHA 5EE5B 1GA1A 4E1AA 5BUZA 2M1XA 1X39A 3L7OA 5DTMA 5CB4B 1TMKA 1UM8A 1ZEJA 3HG7A 1QH0A 4Y9SA 2Y8EA 4X90A 1T8YA 1JB1A 4JT9A 1T3SA 4WZZA 3LFHA 4HQNA 1L5LA 1EX9A 3U7JA 3VKWA 1H0SA 3GH3A 4CN8A 4E5YA 9LDBA 2GETA 3HYLA 1IY9A 1EEHA 2HNBA 3QFHA 2EJTA 2BGUA 3QVVA 4REOA 4YRBA 4DV6B 1W2WB 2B0JA 4QM7A 4H27A 5AFSA 3SGLA 2X5KO 4WZBB 3IKTA 2Z6QA 2CBXA 1Z75A 1J22A 3O47A 1XPOA 3NRCA 5LQJA 1JYFA 2WNSA 2OWDA 1S3SA 2YIDA 4OP1A 4UXHA 1M2FA 2VI5A 1RRCA 1FSGA 4L9RA 1C30A 3BGVA 4BVKA 2XADA 1ZJZA 2BTEA 3CVVA 2JCYA 4UASA 4MWSA 3WMGA 2WP0A 3ORFA 2V7TA 1Q7EA 1T2FA 1EFTA 2I8CA 4AUMA 4ZTZB 3DZKA 3PDUA 3S2GA 1PW7A 3Q41A 1T2VA 1R0WA 5DK6A 1CV2A 1U8FO 3ICVA 1SVIA 4L2IB 4S12A 3LPLA 1K3TA 1JQEA 2X76A 4NJOA 4PRKA 2GVDC 2OCAA 2JI4A 2X9QA 3O9ZA 2VKQA 3AETB 3ZG6A 1N2JA 2UZIR 4L4UA 1A69A 3ZH2A 1YO6A 4ARIA 1WXIA 1EVEA 1P0QA 1H5QA 3GT0A 3KAJA 1U02A 4INPA 4FU0A 1SHTX 4AM8A 5CITA 4IDPA 3V55A 2WJYA 1XMQB 3DT9A 4BQQA 1FUKA 3H11A 3F1KA 1QG0A 1WF3A 4D96A 1ZIYA 3K15A 2ZTMA 2XUIA 3I09A 4GQAA 3I30X 4RPCA 4K9PA 4G0XA 3N59A 4YR7A 3TPFA 5H9VA 1I13A 2FE4A 1GQYA 1F6DA 1FDVA 4Y7CA 2I3GA 4L9SA 5EIXA 4A0HA 1S7CA 3O91A 5FD8A 2JAOA 4L7QA 2F8LA 4OHOA 1WV1A 4PWYA 4XW2A 5EUCA 5JLAA 5AVUA 2ZULA 4Q3NA 4AAYA 1E3WA 4HAWA 2OKCA 5JAIA 3ENQA 4PU0A 2IHJA 2WFMA 1M2JA 3P19A 3SQWA 4BLTA 4MI3A 5DO9A 2QNBA 3A4LA 5HG0A 1H3FA 4BKRA 5IFKA 4X94A 3SIXA 4BAZA 1U7ZA 2NV0A 3ECCA 1RFLA 4DL9A 4EUKA 5KYWA 2PJDA 1MJ5A 1J5PA 4NK5A 5I8PA 1YE5A 4BOYA 4JC5A 2H7CA 3LP8A 1PUXA 1D7AA 1DOAA 5KSZA 4RTNA 2QW1A 5GV7A 1RE1A 3NHZA 4F4JA 1YMUA 3MTAA 2YRFA 2GEDA 2Q0SA 3QYFA 3VPCA 1V16B 1WX1A 4H7KA 1Y9ZA 2YASA 1QHNA 2PFSA 1YVPA 1S8FA 5HJ2A 4CMCA 1HC7A 3P94A 1TJPB 2GSDA 2QT9A 3AU9A 4QECA 4RPKA 4XOUA 3AY3A 4HS9A 1HXHA 4PYMA 1LFDB 4WFKA 1EPUA 2WHYA 1B73A 4R2XA 4RCYA 2QAIA 1P81A 5BRNA 3ZCUA 1KC1A 4V03A 2W4MA 1AC5A 3OETA 1QU3A 1EVJA 1HX7A 1BKYA 3DF9A 4HAVA 4OGKA 5F3RA 3O2JA 5DGDA 4AKGA 2Q99A 4WTOA 5LJLA 3EDOA 4PQYA 3WX0A 5ADHA 5JPIA 1JJIA 2EIXA 5IMSA 1MX5A 4YP0A 4TYNA 3WQRA 4EYQA 1OFIA 2G82A 5KYVA 1SOAA 2XYGA 2Z95A 3KJHA 1W5AA 1ADFA 1R74A 2DPXA 2Q8QA 5LB2A 4HDKA 3TKLA 1O9HA 1VSQA 2Q5EA 4G0YA 3W6NA 2UUAB 3X1YA 1PEYA 5JNSA 2UUCB 1U4SA 4PLYA 2CXNA 2WHPB 5FBQB 5FDFA 3OA0A 4YYEA 1Z2AA 1ZMXA 2ZSAA 3EZFA 3FUVA 4O63O 3R7BA 3VJMA 3U61B 2XXAA 2QLNA 3FKQA 3I28A 4IGEA 2MCFA 3SSAA 1R66A 3IV7A 4X9XA 3LQYA 2PU7A 1CY2A 3FYUA 2CVZA 4JEIA 1TA4A 4UCFA 5JC1A 2IHNA 3PPWA 3FA2A 4XCVA 3ONWA 3G0DA 1GVNB 2O2IA 3H04A 4FC7A 1ND5A 2VDJA 3KKEA 3LU1A 1AD2A 2VA9A 4EW3A 1GA6A 1LPBB 2QUIA 8AT1A 4HFJA 1FX0A 2FV8A 3C3MA 4LWZA 4ZYUA 2RGRA 1PCXA 1DTEA 1YKSA 2LDXA 3QXHA 3I2IA 4BHTA 1RLOA 5JPCA 1B00A 2GJKA 2Y99A 2QE7D 3H8VA 2VZ0A 4AU1A 2HV8A 4LJSA 4MKHA 4R2MA 3D3NA 4I6GA 5HNKA 3DBRA 3JYPA 4XQCA 1HL3A 1W75A 3UAYA 2UU9B 1DDOA 3RYIA 2OCYC 3RWOA 1OU0A 2I1VB 2YXNA 3GUZA 3S1SA 1ZM4A 2IXEA 1SKQA 1Q95A 1UWLA 3AHFA 4IMPA 4B8WA 1Z88A 3OIWA 1LS6A 1VYUA 1YD7A 1DJPA 4NOKA 5CX1A 3T7DA 2I2BA 2C83A 4PVDA 2H2GA 3GEEA 1RZ3A 3BWEA 5JATA 1MEEA 3HCBA 4M0KA 3VO9A 3AOGA 3ZGYA 4BXOA 1Q7GA 4IHAA 1HFKA 2VHCA 5JWOA 1V96A 1M6YA 4L72A 4D0SA 2H11A 3PVCA 1R6UA 1ZVQA 3FKJA 1EUZA 1V41E 4Y6LA 4CEHA 3OCCA 3VDXA 3SZLA 2PX4A 1DBWA 2QJWA 2VNSA 1JG3A 2Z08A 2YHUA 3GJ3A 3OPNA 3I72A 1MX1A 4JVOA 1I1HA 3K9GA 3UW3A 1VECA 4CT5A 4NARA 4EJMA 1NMZA 3Q12A 2J6CA 3I2YX 3UGTA 1F0PA 1WQ4A 4ECAA 2BHTA 3ZJUA 2RG1A 1RQLA 2H08A 3MTBA 2JK1A 5LDGA 3BMCA 1DAOA 4FOPA 2QVLA 4D0RA 1E2UA 3AJRA 1A8PA 2GJSA 3GQBA 3EEQA 3M83A 1XCBA 2PRYA 3PV0A 1C9JA 4TS9A 1KSGA 2IRWA 2WTNA 3GLVA 3VYTB 4S05A 4FKBA 2WB4A 3P9NA 3WK6A 2Q4EA 3IGFA 1XKLA 3IUJA 4MNTA 2WP8J 2IPNA 2C1XA 3L8MA 4WN9B 3R9KA 3QUCA 2FZKA 4IGAA 4ZCPA 3NO4A 4A15A 2BSXA 3V7FA 3WYFA 3IQGX 1BAPA 2BZGA 4II7A 4UOEA 3URKA 5KOHB 1JQLB 4O2AB 3DMGA 4ZQEA 3V9AA 1NJ8A 1H2BA 3DLBA 1PU2A 3T38A 4Z53A 4PTYA 2OCXA 2P5SA 2XCTB 4UAGA 1M54A 3PNQA 4P4SA 1XZ8A 4UE3S 2HC9A 3GV0A 2NZ8A 1JQ5A 5IYZB 1G2QA 1MO5A 1N4DA 3HB9A 1Q0UA 4HSEA 1VIYA 4DM7A 4QYSA 3OESA 5L8VA 4RLHA 1QFXA 3NVMB 1X1EA 1YUMA 4KQXA 5DN9A 4JC8A 3ZHUA 5FR2A 4JLPA 4JP8A 4HR7A 4K6FA 1P19A 4XPIB 3CIFA 5BURA 2I6QA 3K4PA 1YS9A 4PBSA 1XP8A 4Q3CA 3KOUA 2LP4Y 2PYZA 4Y98A 1NUTA 4I5FA 2R97A 1GUDA 4KDFA 4B3FX 4LYAA 2AI1A 5KKCA 1UZLA 2HHCA 1JU3A 2XMDA 4QJIA 5ABPA 3IAEA 2BFFB 3BXPA 1M2NA 5F2OA 4E70A 2VWQA 1B3BA 1P7YA 4UDXX 4FFWA 5LZ9A 1ZN7A 1E2BA 1JHQA 5J1SB 3EGIA 4G9EA 3OF2A 1N6NA 4BNZA 3MS2A 1DAKA 1YZGA 2A9KA 2WSYB 1RHRA 4WGFA 1E9VA 3MGBA 3Q8MA 5B1EA 1Z18A 3IP5A 1G41A 3L1HA 3WB0A 2W8BB 5DM1A 5FOSA 3REQB 1AB5A 1YQQA 3BXEA 3NETA 4A7PA 3FPFA 2HU7A 3FWKA 3OIYA 2F55A 3QVGA 3NV9A 2XVMA 3A70A 5ELMA 2SKEA 4E33A 1OXVA 2ZS7A 1W7AA 2RC5A 1ONPA 1VYHA 2ZIVB 3SAJA 1H4SA 5AI9A 2AQKA 2QM3A 5HOEA 1QIEA 2HJWA 4BKMA 2O9JA 1QYXA 1PR5A 4BBPA 4EX7A 2P77A 3HWSA 3FTDA 4ZOLB 4BN5A 1TEZA 1QE0A 1I2BA 4U7PB 1KY5A 5F51A 3OA2A 2YX1A 3DOFA 1FDOA 5IULC 2RHJA 3PXUA 1SY7A 4J7CA 3Q9UA 3RVKA 1X86B 3HI4A 1N0IA 4QQFA 1D1QA 3RYTC 4C0QC 3FI9A 5AJHA 4OI0A 4EG8A 2HQ1A 5JPDA 1KTIA 4FLEA 5PNTA 5GONF 5JSYA 5DGTA 3W5AA 1KJIA 3LYHA 1VL8A 2ZIFA 1SBQA 1DXHA 4X7BA 1ZM7A 4RAOA 1R10A 4KE9A 2CLIB 2FRDA 1KAEA 3DCYA 4URZR 2XGJA 1OILA 2QB5A 5JZOA 3WVNA 1BN7A 1O0BA 3KSUA 2FR8A 4PWZA 4S2UA 4PSVA 1N5MA 2YFHA 2A0YA 4MW5A 4QT4A 5LMZA 3ER6A 4LE2A 3C3PA 4LPKA 2ONJA 1C1DA 3OOSA 5CA1A 2J5XA 3KX2A 4D3DA 3IJRA 4O3MA 1OBOA 2Q1SA 3F67A 6GPBA 1H2EA 5EMKA 1U3TA 4RVUA 1QO0D 1DE0A 1SQ0A 2IXGA 3LKBA 2IOFA 2LBPA 1U98A 2PQMA 3H3XA 5L51A 4WQMA 4YBZA 3RQIA 2G9QA 1J33A 2PAFA 4NZNA 1K1EA 1WKBA 4EPRA 3QXXA 1JDUA 1MEOA 1NQAO 3PRKE 4OGLA 2NV2B 4TT8A 4DUPA 2CB0A 2QNRA 4TZTA 3DDUA 3HDJA 3VFDA 2BC9A 4B83A 4L4RA 1G9XA 1Z0FA 3CT6A 1V43A 3PNMA 3U6KA 2F64A 1QXSA 3WNCA 3WBKA 2ZJ2A 2BEUB 3PBKA 1B0ZA 2BEVB 1XNQB 3UJCA 2HPZA 3RANA 2Y68A 3B1JA 3OFSA 3A4TA 5DHTA 3FOFC 3PT9A 1M6NA 1Z08A 3ESAA 3CF4A 1ZR4A 4KPGA 2DJ5A 2O1WA 4TL8A 1LV7A 5AHXA 1LW7A 3AM3A 3DG9A 1XHEA 3DVAB 2XWQA 4CM4B 1H65A 4P4GA 4HYEA 3K2QA 3C14C 4OXIA 1L7BA 2OAEA 1N6PA 2VUTA 4GP6A 4IZHA 5FBWB 3V7NA 4A8TA 2C00A 4C3OB 5CCEA 4F5EA 1QTNA 4LBVA 4WL0A 2CVHA 6NULA 1Z2NX 2IUYA 3TJMA 1XZAA 3MN1A 5DMHA 3RADC 4BECA 3WMWA 1Y1SA 3CZ5A 4N6OA 3RYFA 2C29D 5JLJA 3ZNPA 4QULA 3EEBA 3IULA 1E1RD 2O48X 2E87A 5JY1A 1WG8A 2NPFA 4XCXA 3QLJA 4KPYA 4R40A 3M4JA 1L0BA 1OXUA 1RI5A 2OV8A 3KUDA 2JJ1D 3BQ9A 1SQGA 2VUSA 3C3XA 1SUFA 3ZWBA 2CFTA 1RYBA 2VDQB 3DHYA 3A1VA 3GRVA 2H4XA 2WLSA 1GFSA 3CRMA 3LBIA 4K6MA 3TNDA 3L0IB 3NBZC 4UEOA 2WINI 3EQ2A 2ZR8A 1E3QA 2ATIA 2P2LA 1FA9A 4MB0A 4U9IS 1XP5A 5EQFA 1U0NA 2FN9A 2OG1A 4K9KA 4GKVA 3RIXA 2PBZA 1SCKA 3VJLA 4DSUA 3KJNA 4PINA 2H3EA 5FBHA 2FU5C 1XV5A 3LZ6A 4QUAA 2VDRB 3GRKA 2CE2X 4R2LA 2JLCA 1T2NA 5SYAA 2FQYA 4YS6A 4B44A 3K8YA 4CV2A 2Z8YM 3QX3A 3U48A 3E5MA 3V32A 4QYWA 3I34X 5IJXA 3FMVA 2EHJA 3GELA 3AB7A 3D8HA 2ZR7A 3I2HA 4R98A 1DJQA 1U0TA 2A88A 4GYJA 1NDQA 3QX7A 4DJAA 4XVCA 1T3HA 2OENG 5AW4A 2ZRPA 2JHFA 1P62B 2QTZA 3RARA 4RZXA 3TEJA 4WNIA 3BRSA 3MRSA 1FJXA 5FEMA 4D92A 2O2CA 2DWCA 2ZATA 1MX3A 4GG1A 4V0SA 3T7IA 2C3UA 3NIGB 4JR0A 2Z2IA 3SZUA 2G40A 4P7JA 1BH2A 2A67A 1JHVA 2BGJA 2HI0A 3QVTA 1EJ0A 2YOFA 4XQGA 4MYHA 3NBKA 4OU5A 2WIGA 3DAFA 3H4VA 2WLTA 2EW8A 3EA4A 3W3AH 4TUYF 1OHHD 2VNHA 4MI1A 2QRVB 1J0EA 3GEDA 5G0UA 4LISA 2ODPA 3VNQA 2B92A 4RD6A 5G2OA 3OFND 1SB9A 2IU0A 3EPKA 3EXHC 1OFUX 3K0BA 3COZA 4D4IA 4OOFA 4UBJA 1JVNA 2PH5A 3A06A 4ZHSA 4CW7A 5U1PA 3TIXB 3KYDA 4JR2A 1CNFA 4O6VA 2VJQA 2Q3MA 2R6HA 4U63A 5DWQA 1J8FA 1G4UR 2ZJOA 5CDHA 5KDDA 2BM8A 3UWKA 3RAJA 4KBYA 3ZWQA 2XUHA 3CYFA 4D8UA 4RZSA 1TYBE 1DMRA 4M46A 5I7AA 4OX9Y 3ZHYA 2XGMA 1P31A 1V2HE 2WJZB 4W1RA 5C18A 1U8ZA 4PNEA 5EHZA 1ORVA 1NJ6A 2YJGA 4TMXA 3NDJA 3K92A 1JN0A 1RIFA 1VJ5A 5LZ7A 2ORED 4OFZA 4LSWA 3BHNA 4K40A 2OORC 4RS4A 2XUDA 2DUMA 2GEFA 4I14A 3RR2A 1UMCA 4FONA 2B3TA 1LUAA 3AV0B 3DMFA 2D1QA 2YZGA 4ZFNA 3WLLA 3AESA 3Q2OA 4MTLA 1LLDA 4TQUS 1ECGA 1OLXA 2FMTA 1SQ5A 1TVMA 1CRLA 1I0IA 3TR6A 1OPRA 1D5CA 4J9VA 3DTYA 1ZK3A 3CW9A 4IZIA 3RIHA 2FEKA 2WK1A 1Z12A 2XZLA 4L76A 5AD1A 1ZH4A 1P4RA 2GK6A 3RS7A 1FNNA 3AKCA 1SIOA 2P3LA 1WSDA 3FCYA 1QAMA 3IEUA 1K9VF 1TK3A 4L75A 4X5OA 4B8ZA 2CXSA 1DRKA 4HT3B 1UMDB 1WA5A 4F38A 1U2GC 1AXRA 3M34A 1CNMA 3R4VA 3KU4A 5C4MA 3KQUA 4YBRA 5C2JB 3OCUA 3DW3X 1FQJA 2P9GA 3UAGA 3TCXB 1RQRA 4ZQBA 4DCNA 1O94C 2Q2OA 2GVNA 4GX2A 1H1LB 2LKCA 4RY0A 5CURA 1CR6A 1DX9A 1LV8A 4BLVA 5C5IA 2C8JA 2R0QC 4HB0A 2P6RA 3ZY5A 3TSCA 1P3Y1 2WFLA 2ZU0C 2FJ0A 3IBTA 1ZOIA 4OQMA 1IWOA 1GZUA 3MZ0A 2OUKA 2VJMA 3RFTA 1AGXA 4W9RA 4P0PB 1YZYA 1OMOA 4U2DA 3UHAA 4F5YA 1DJMA 3HADA 1XRSB 2HIGA 4IOLA 1W0JA 4JQSA 5AKGA 4U7DA 3ZD6A 1DX6A 3H2YA 2CN1A 2HWXA 2GM9A 5JOQA 4K6CA 1A1SA 1J07A 2SCUB 5ALMA 3QVXA 3B51X 3N5KA 4H7DA 5CTJA 1Y6FA 2C2BA 3QPCA 5JD4A 2VLBA 2IYFA 5KMGB 2J0SA 1NN1A 1QG2A 1EFKA 2W11A 2RGBA 3L6RA 1LCIA 4R8MA 4MSUA 3S68A 5A4MS 2J3EA 1J8DA 5C8YF 1T5BA 2KBFA 2QHXA 4I1YA 4OXKA 2B34A 2P2NA 1M5UA 2VVTA 1F5SA 5C37A 3G0GA 4IJ6A 3B3QA 4HDSB 1LK7A 2Q3BA 2XZPA 3D8NA 3FRJA 3JALA 5IUKC 3ZY3A 1PJ2A 2UUPA 5CXXA 4PZDA 2XDQA 2E21A 5FULA 1JFRA 1CQJA 4I2VA 2NO7A 4C0KA 2OXCA 2Q9BA 4P36A 5L3QB 3O4VA 4NLLA 3RI3A 3F7MA 4C6SA 3WE7A 2YQZA 4MUMA 2GX6A 1TKBA 2GASA 3VO2A 4ENSA 2VH5R 3KPJA 5B1HA 1S4MA 2WIAA 3MWJA 1N8SA 3GBVA 1P1HA 1YS7A 4RJLA 4YIHA 3FW1A 1BVUA 1HT0A 2UUBB 1DQYA 5HIIA 4JIGA 1JWAB 4QSHA 2PQ2A 3MS4A 4DLYA 1RSZA 2DMRA 4P0QB 5T4BA 1YZQA 2DULA 1D8TA 4LQDA 4BC1A 4LHWA 3I64A 2GPAA 2GZHA 4H4CA 2N1BA 3VOBA 1ND6A 1D9ZA 1TCBA 1II8B 1QGED 1N3IA 2WVAA 2Q5QA 2ZYAA 3NH6A 1TZ2A 1BQ3A 1QO9A 3IH5A 4M0MA 4MVJI 2FP4B 2F9FA 1JFVA 2AN9A 1GL7A 5IW8A 2DPYA 1F3OA 5IBPA 2VP2A 4HNVA 1DV2A 2O3UA 4XVHA 4TKUA 2ID9A 1U9IC 4H35A 3WLOA 5BN1A 1ZJ6A 3ESYA 3KYBA 2Q3JA 4IDEA 1IHXA 2ZSDA 4FFNA 4G4SO 4R69A 1KPHA 1R2QA 1E20A 1W5BA 4IFBA 4DCGA 3RJ9A 2VYQA 2ILVA 1R6BX 4G09A 5EQDA 4F7WA 4TSRA 1X70A 4J2TA 3ZZ1A 3VVBA 3HY4A 1KH2A 4FX2A 4LOIA 4YO7A 3LT0A 1Y9JA 4MS3B 3KQPA 5C53B 3PXBA 2J0EA 2PJUA 1DJLA 1UQRA 3IB6A 1FX1A 3B36A 3P9SA 3PUHA 3GMSA 3PXEA 4ME6A 3V2UA 2P9YA 3R0XA 3R9XA 5CEEA 3HBAA 3U56A 4V38A 1MENA 1BWPA 3ANXA 1KVRA 1G6Q1 4IXDA 4V3BA 5IT9A 4QJ3A 2BT4A 2W2VA 1TKAA 3A3OA 1KKMA 5KYUB 4TYPA 3M4XA 3RG8A 4UOQA 5IK2D 1WNTA 4KEAA 2PGOA 1WUJS 1YRAA 5BQFA 2ZJYA 1QE5A 4ZVTA 3UUFA 5K05A 3ICEA 4H15A 2C92A 3BIFA 3QV2A 3SHFA 1XEXB 4U5XA 2WJWA 4TM7A 2CNDA 4CPDA 2J3MA 3E2IA 3IAHA 2CYAA 1PJ3A 1SRRA 2GHTA 4PLZA 1X2BA 4Y18A 2IS6A 3OKPA 4S0XA 3ZBTA 1K5PA 1PDOA 4B87A 1JG7A 2DR2A 2OD9A 3IQDB 1ZVJA 4PTZA 4W4TA 2IHTA 5ALFA 1Q20A 2QJFA 1FJHA 4XM1A 2Z56A 5AJVB 3SYKA 4YV7A 3QYJA 3RSSA 2FSUA 1JP7A 1OD6A 1YVDA 4WY2A 3VU3A 3CN9A 1QV9A 4QU8A 3ZXIA 1QIMA 1K6EA 1RRPA 3QBEA 5I4BA 1MTOA 3KSAC 2GAIA 2YMPA 4MUNA 4NHEA 3QPBA 3SX0A 4DY6A 2KHZA 2Q9CA 4C4YA 2JFQA 4DZTA 1FRZA 2WI8A 2IOYA 2ZIUB 3BGSA 3OZBA 2IK8A 4LXYA 3V34A 5JH7A 2ZTVA 5KTPA 3W5UA 2HYIC 3II6X 2J0QA 4ALMA 1X1AA 3PUJA 4MQ5A 4NL4H 1MH9A 1OY1A 2VPWA 1NXPA 1NGSA 4EL0A 2XRFA 2FGJA 3IPYA 1VCMA 4AMUA 5DK4A 1PT9A 4RC9A 3OVMA 4CETA 2XTAA 4MR7B 4D6XA 1H8EA 2VZ9A 1A9ZA 2XT6A 1PS0A 2O8EA 3IDOA 4G1VA 2FRXA 4K87A 4LJYA 2G7ZA 4XJVA 2O0LA 4D81A 1ZKDA 3P2JA 2VQEB 5JSKA 2DRIA 2ZT6A 1T3GA 1L4UA 1UC8A 1QOZA 3GUYA 4KO4S 4N8EA 4EDHA 5C52B 1U2SA 4I66A 2HCFA 2BV3A 4Q0MA 3UYLA 3QF4A 1BW9A 2E3JA 2H1WA 4M8KA 4TLCA 4X20B 2G67A 2PMKA 5HKOA 4ZAYA 3NR2A 4LX0A 3C24A 4PC3A 1P74A 3ZLUA 2JFNA 1MGOA 4ZDWA 5LA6A 2FWMX 1KMIY 1S01A 2ZREA 2AI3A 5CVUA 5IH3A 5T5QA 1SB8A 4NMXB 3D6AA 3NHUA 4F2GA 3GUCA 3ZK9A 5HRAA 3CNOA 4RD4A 1K6MA 2FG5A 2ZROA 1IVNA 3GPBA 3NUZA 4OU4A 3TVDA 4AMZA 2I6GA 1LS1A 3LHSA 5A3QA 3M6WA 1XIVA 5AJZA 2YMQA 3ABRB 5KTRA 4NBTA 3JYLA 3PSHA 2C94A 1UXHA 1II0A 2SICE 1VSTA 4J90A 1N2CA 5FOVA 3NC1C 2VJKA 1XD8A 2QE6A 4W7HA 4YCNA 5DM60 1YOVA 4FE4A 1GSAA 1G8SA 5GONB 1XDZA 4BV3A 5TPZD 3ZY6A 4MJ3A 3U4AA 3FBWA 3EIEA 4BO4A 2Q41A 3OIVA 3HI6A 3ZHSA 5CLGA 2PN1A 4D26A 1F4PA 1GL3A 2VN8A 4DG9A 1ULTA 1D3AA 4D1YA 2OQVA 4BMPB 4HBZA 1FVHA 3JQGA 3A10A 2J4CA 5BXQC 5CBPB 3PGMA 2CJWB 4FJ1A 3MWEA 2VBFA 4TT3D 3RO7A 5K8TA 4QGHA 4ZV7A 5AKEA 1RP1A 2VAMA 5I3CA 3HACA 3GLHB 3U7QA 1OU4A 2OL4A 2OC4A 3RSOA 4R8VA 3RSZA 2V6MA 3B3FA 4PXSA 4LAFA 1XTSA 1BXKA 2IP1A 2FUKA 3DD1A 1D2RA 3FZGA 2IP2A 4QHYA 1ADBA 3PE6A 4Q7MB 3IO3A 4KFCA 1RBYA 2C96A 2RGEA 3EXHB 4Z0TA 1BHO1 2EWVA 2YYYA 3CHYA 4P53A 4BB0A 2FZGA 2NXCA 3OOYA 4ZODA 3HZZA 2C0PA 1K75A 3PUZA 4KZKA 5L3RA 3RROA 4QPJC 1L7OA 4ES6A 13PKA 2R7AA 2A7QA 4IH9A 4HDNA 4KQKA 4M4SA 4O8ZA 4QUDA 4J6EA 1WCXA 2NADA 4OJYA 4OGWA 4WW0A 2XTJA 1T9KA 1HDZA 2NPOA 4GXRA 3ZWPA 621PA 1ZJ4A 1AKTA 1SVWA 1X9GA 2XX3A 1P2UA 3N7AA 5GM2A 3T7EA 5FPHA 4YRDA 2PD3A 1E79A 2QN2A 5BV7A 3OIGA 3ZW9A 3LY7A 3HSKA 2OXEA 2CVFA 4HFMA 3ZV4A 1JHZA 1R4NB 1Y6JA 2PRIA 2DVMA 5D2CA 2QGFA 2I5PO 3AEUB 5IABA 3ZDFA 3N0RA 3TDMA 4Q18A 1JFTA 4C0JA 1F2UB 1SUEA 3KB1A 4Q4JA 1EGQA 3GRPA 2BYTA 5BWNA 2W6ZA 3LX4A 4OATA 1VBNA 2FX5A 2OZVA 1VE3A 3UWOA 4RDXA 1A5TA 4MKFA 4IDBA 3QXSA 2HA7A 3UQYS 2OP1A 3PTLA 5C7YA 4WOKA 2IKQA 4IGIA 4I8DA 3RS8A 1TQ4A 4N0QA 5F98A 1KDTA 3EQZA 5D7NA 3L18A 2RKOA 3RNOA 5JDIC 4PZ9A 3STHA 5CEJA 2G5TA 4H1WA 1J9GA 2PX5A 1L8AA 3JQ9C 5K2MA 1Z63A 3EBPA 3ZI4A 4TRRA 5EUBA 2Y1OA 3KALA 1J1IA 3RC7A 4HNUA 3JU3A 3TRHA 2WKQA 1AGYA 2DFLA 2HN9A 2FTKE 3F98A 4MCIA 4BNJA 1ORTA 3H13A 4HGRA 1IBCA 2PO7A 4LJLA 1K88A 2GEUA 3CKKA 4HX5A 2JH8A 2HRQA 2ZB8A 1OLUA 4EA6A 4C08A 2O8FB 3TLZA 4TMFA 4YA6A 5CG2A 2CL0X 5G1PA 1TAGA 4JR1A 3IRUA 3F47A 3EMDA 2NXJA 4JQCA 2R1ZA 1KI1A 2VR1A 3CX3A 3PXXA 4J4TA 2OV2A 1TRHA 3DEKA 2UV8A 2X8JA 4HPJB 4W6QA 5JCOC 1I9GA 3CZ4A 4Z8XA 2PZFA 4CQMA 1W85B 3HFGA 4LGMA 4YJKA 5JS1A 1P0PA 4DREA 3R8FA 1WB6A 2YVAA 4JCCA 5IMBA 5LD2C 2HDOA 2YWFA 3R5HA 1JHXA 4GICA 5FTKA 1M33A 1F8XA 1WEKA 1YKFA 2IUTA 4R68A 3LXRA 6AT1A 3VHXA 2QMQA 3DC2A 2I9PA 4WUTA 4DJTA 3BD8A 4Q4HA 3UCEA 2DBVO 2IDMA 5HE9A 3U31A 1K92A 3UOGA 2RI0A 2FSIA 5K0GA 2EARA 4DTCA 3DL4A 2EZTA 3NHKA 2FK7A 4K8RB 3F5SA 2HLDA 3L8CA 4IP0A 4JI6B 2XMCA 1YC2A 1UK6A 5F5XA 3WLHA 2WKWA 4QTUB 1C80A 5IKPA 3EAQA 1DWQA 2TECE 2BMFA 5K8UA 4NFSA 5FNVF 1E2FA 4V39A 3CF0A 1OIVA 4UUOA 2PT7A 4FFRA 3UXEA 1K7YA 3UC9A 1CDDA 1D6SA 1XU7A 1GRRA 1ZA2A 2ZPUA 3G1TA 3HYNA 3KB8A 3PPIA 1KZ4A 3IAAA 2Z4RA 3LT2A 3O8QB 4IIYA 1JHPA 4X1OA 1E3WB 3B7PA 2WB2A 4E2WA 3AOEC 3LL7A 3LNTA 4GSLA 1EWTA 4LVNA 1M8GA 1YA8A 4O4IA 1QRAA 3EG9B 2V7UA 4IV5A 3UAXA 1M7HA 3GJ8A 4ZEMA 1G21B 3AVWA 5KYWB 3SP1A 2JFXA 2Y71A 3MNFA 2H0AA 4ZT4A 4TV9A 2RHMA 2WWYA 1GPKA 3EDYA 4BJ1A 1ORIA 5E6RA 1V3UA 3REOA 1PQPA 1XTVA 2G1UA 1P18A 4J03A 4RBNA 2CFSA 1JIXA 2CFRA 1GEGA 1QO7A 2H5IA 3IE1A 4HXEB 1U80A 2C2HA 3N0VA 4UHEA 1WMAA 1AF4A 2W9XA 3SIRA 4CGYA 1HI9A 2VHEA 2W8ZA 1B43A 1Z8FA 3N2YA 4DA9A 5I8WA 1XXHE 4C0AC 1FTQA 1Z0SA 1PTJA 2X15A 4DMRA 3N53A 3PGKA 5KOJB 1JG2A 4XGNA 2HBZA 3A7DA 2R00C 3SSOA 1G7TA 4Q1DA 1I3LA 3RBXA 5HIKA 3K0CC 3RSHA 4DSAA 1MOPA 2FMUA 1QDUA 2ZXEA 1YS4A 1ST2A 4QUHA 4BBAA 4CDGA 1XLTA 4KACA 5HS4A 1IXSB 4BPBA 1JILA 2ACKA 1U6IA 3SDZA 3ORYA 4IXMA 4JMPA 2HD4A 4PFQA 4U9HS 2GTPA 5D85A 4D9MA 3QHAA 3SVTA 3JYNA 1MVOA 1THZA 2QPAA 3P5SA 5DI3A 2B4YA 2OP0A 4QREA 1AQUA 2PT9A 2ZS9A 3N2IA 4M21A 1Z13A 5EPEA 1E5XA 1O6FA 2D2FA 1A04A 4OBBA 4RENA 4NF2A 1UJ4A 1PSWA 2C4NA 2IODA 3JWPA 3C6BA 1KAMA 1VSVA 1PYDA 5BNWA 1L9KA 2ZITA 4OQZA 3VVLA 3D8SA 5CLJA 1KI3A 3MCVA 5AKKA 3T0FA 4MA5A 1CX9B 4WOPA 5F21A 2WTMA 3EXIA 1I24A 5J1TB 1OV6A 2GQ0A 4X3CA 5JROA 4KQCA 4INJA 1RXVA 4YC7A 3L6OO 1Z2DA 4MKZA 1N1GA 4QFCA 1QLHA 2ACWA 2JJ2D 3D54D 2AX4A 4MVXA 5F1KA 4WOBA 2YCLA 2EDCA 2X5OA 1GTL1 2VEOA 3TGLA 1Y42X 3A2LA 3GMIA 3LX8A 5A05A 5FH9A 3HXTA 3Q1LA 2B98A 2YY5A 3K09A 4HEA6 3B70A 1JR3A 4BO9A 2IPLA 1LW6E 4ZHQA 1JMYA 3I58A 4MIEA 1C8LA 1E1DA 2HSWA 2H2DA 4A2PA 2H4JA 4D9HA 5BQ3A 1D4OA 1Y1RA 1Z4KA 3G5LA 3RU7A 4KFTA 2G9NA 3PCRB 1UUFA 1TOAA 2W4QA 3RS2A 3LKVA 5CX1B 1FFHA 3L4KA 1TB4A 2CCKA 2GHQA 3H3JA 2XA1A 4LRYA 4RM3A 1UKZA 2C07A 1L9XA 1YUNA 1PZXA 3CPSA 4IV8A 2AG1A 4ARUA 5P8WA 4R3WA 4RMIA 1MOSA 1QAQA 3V1YA 1YI0A 1YRLA 2A0XA 2HAEA 2HQRA 3AL3A 3OJFA 2IV2X 4CCYA 4QYMA 5GVRA 3ORHA 3CJRA 5JADA 2Q45A 2VQSA 4R4JA 4AI6A 3ICCA 3KK0A 5IKOA 3A1CA 3F74A 4I50F 3LLCA 3R5SA 1YE8A 2DQSA 2VUUA 3OO1A 2HBQA 3DT8A 3IMCA 1FMLA 1Z6PA 2GM3A 1NRJB 1YKGA 1XALA 2C95A 3GBPA 3IUNA 4MPRA 3T7RA 3AR2A 5D7BA 1QPZA 1YV9A 2PRSA 4HNRA 1L4KA 2IYRA 5EYPB 2AZMA 1QLWA 4BNHA 2G08A 3IAS6 3DBLA 2J6BA 4LV8B 5J4YA 4Q39A 1LBSA 3L0ZA 2IYAA 1XTTA 3GQBB 3EGEA 3OQ1A 3WK7A 2IBMA 4D0GA 1LSOA 1H66A 3FROA 4K46A 4ARSA 1USKA 3NV7A 3BHIA 3N6RA 1NW5A 2HEIA 4HG2A 4JXJA 1EJ2A 3INGA 1CW2B 4UQLA 2IU3A 3H0CA 2WZQA 4LCEA 4RKWA 5BWBA 1ZH0A 3K4HA 4IPTA 5FWYB 3SJZA 8ABPA 2XE7A 3AFOA 3DWGA 2Z43A 2XY4A 2YNMA 1R3UA 1T9GS 1MO4A 1V1RB 2BFCA 3FZQA 3C8ZA 3K0KA 3NIWA 3UT0A 1IN1A 1F60A 3EUWA 1VB3A 3WLMA 1SZJG 1MQSA 3BJRA 3ZYCA 5IX8A 4NH0A 1ZAKA 1Z6TA 3LRXA 5GZ1A 2ZRKA 5K8VA 2E4AA 1VLHA 2YJ4A 3PTAA 4AJIA 2IPAB 4XWTA 3WRWA 1TYDE 4K5QA 2MR5A 4ACAA 2YS6A 5EE3A 4CT4B 4NE2A 4ZOEA 1U28A 3MJCA 4UHBA 4EF5A 4BFWA 1ZD9A 2NTNA 1P8JA 2EFHB 2ISSD 4F84A 3BEDA 4DUZB 3E9RA 3MLAA 4OHWA 2AOWA 2X5XA 1H9CA 5DN6D 2Z2ZA 2JGIA 3EHEA 2V96A 1ZESA 2FW6A 4E03A 4NJMB 4PTLA 2IS2A 4DANA 3MCWA 1AU9A 4U2BA 1YULA 4Z86A 1KXZA 4XUCA 4OHUA 3AERA 2CDAA 1AHHA 3A3PA 3EMBA 4IKOA 5EVCA 1UDAA 2GEKA 3DZIA 4NYJR 2YWRA 1N5JA 3RVDA 1UZUA 4BRUA 2YFKA 3RGGA 3RVSA 2W2OA 4ZT7A 1QOPB 3E1GA 4UD6A 1YJCA 2VZLA 3GXOA 3QX8A 1FW6A 1R64A 3U9TA 4YRAA 5BSFA 2VPTA 3AR4A 1EGAA 4KN6A 2YR0A 1T36A 5E4FA 3MS7A 3SJUA 3N05A 3QOWA 5IWAB 5C1BA 1A4RA 1OLSA 3E1SA 4MP8A 4V0MA 4I4IA 5FO1A 4PN3A 5I48A 4UFNA 5JZSA 1LK0A 1NPTO 1XK6A 2ZPAA 4IMJB 3CB2A 1T29A 3NBQA 3IAM6 3OH8A 4LTNA 1RI3A 5SV2A 1RKUA 3WOVA 5BYJA 4FYYA 2V59A 1V7PC 2W90A 4XGIA 2RK6A 1KQOA 5DM2A 3WY9A 4AZVA 4HKTA 3WV5A 5K8JB 3E6AA 2ZB3A 1GDTA 4COKA 3VU0A 5A3JA 1QB8A 1L4YA 4WZAE 2AK2A 4QJ5A 3JWEA 2Z3ZA 1KO4A 4ZI3A 2D06A 1TMOA 2Q3DA 1PLJA 1HGXA 2A6PA 1KAQA 3BILA 1PR9A 4JDPA 5DKFA 3B3JA 4YAWA 6REQA 4US2R 4QYXA 1TLLA 4NSNA 4QFDA 1KMNA 2XAUA 3AR6A 4YT5A 3DTTA 3U7GA 4JJIA 4BO7A 4EY8A 4L5JA 3LVQE 2V7EA 2VUIB 1ORDA 4JL6A 1KL7A 5FLEX 4NH4A 2G1KA 3WZ2A 1Y1PA 1KI2A 1XNHA 1NULA 1R4MA 1KFBB 4RD1A 1NBAA 1RYYA 2Q5CA 2VWHA 3W1VA 121PA 1KETA 3S7TA 4BFUA 4Q7QA 2P6NA 3A6JA 5LD2B 2GD6A 1CUDA 2PDAA 3VU1A 4L0MA 5ALWA 2QRQA 1S3IA 3O1JC 1KNQA 2DHRA 1N2SA 1IQRA 1BOFA 4JHLA 3NGLA 2HCJB 3L01A 4JGGA 3DYBA 4G41A 4RU1A 1D4FA 1YXMA 2QXTA 2CCJA 2FY8A 1DAMA 3KL4A 3MCTA 4IJWA 4P32A 3SEAA 3VHQA 1CUYA 4PLWA 1U04A 4IJQA 4XDYA 1U63A 2CKMA 4TKVA 3OCWA 2OXFA 4OLFA 4H4EA 4HB4A 4PX2A 3SLKA 2O8BB 1P44A 5HKLA 4F91B 4GPD1 1HYEA 3G9QA 1HE5A 2X6RA 3LPAA 2F1KA 4V0RA 1UAAA 1VG0B 3ZWWA 2VT2A 5JYEA 2HBRA 1J5EB 1ZGHA 3C85A 4QBTA 5CT6A 2QTFA 4I1IA 4EQ6B 3R7WA 1LI7A 1OXTA 1WL8A 3DEHA 3PEFA 4H2DA 4LA4A 4AS3A 5L3VA 5KYNA 2Q3EA 5EWLB 2FZWA 1GRVA 3K9QO 2GPBA 1E9SA 1VJDA 2EF1A 2I99A 4M87A 3WFZA 4CMGA 1VLQA 2VBIA 1NQTA 3KQYA 2XUQA 5J4KA 4UKDA 1L7XA 2ZT5A 2Z83A 2C58A 4G0QA 2IHBA 1EQ2A 3PNKA 3OTHA 3ZVMA 1Y8RB 2XMBA 3TW4A 3PUXA 4EKYA 4CUKA 2HHHB 4BYGA 4BVFA 1JAIA 2FPWA 2GD0A 3R5JA 1IQ0A 3TEFA 1RACA 2IXBA 2ZBDA 4UBOA 3T7CA 4MR9A 4C87A 4PRLA 2NVOA 3CUEF 1Y3HA 5JS6A 4XI9A 1SN7A 1ZPDA 5TF0A 4X65B 1CJBA 2O0MA 2WZCA 3C48A 3G13A 4NG5A 1RAGA 4GOKA 4CMBA 3RYFB 4G5QA 1Y9DA 3ZW8A 3A3NA 2QT1A 4JI5B 1PGPA 4RCVA 3ZHXA 4Y9RA 4Q1EA 2D3WA 3EUFA 4ZVRA 3IIKA 3H2JA 5E0KB 1TCCA 5TR9A 1MC8A 4FGSA 5DB4A 1ACJA 2GHIA 3V2IA 4C6TA 4GMDA 1E60A 1G4HA 3H1TA 3JAKA 1PFGA 3KE9A 1YZLA 1BD4A 1BE8A 2XRZA 4UVEA 5CPBA 4YFYA 3LC2O 5KHOC 4NCAA 4RPIA 3H0KA 2WHRA 3E03A 4PC6A 5TT0A 3NX4A 3LYUA 4XYEA 5JNRA 1ZM9A 4FYMA 1IEVA 2WHEA 3CPJB 4ZJZA 1FDSA 5LLTA 3A1WA 2ZRQA 1L8LA 3KTDA 4QPNA 4QNMA 2JHGA 3FETA 4KH1A 4P7FA 4PX3A 4NZOA 2AH5A 1L7RA 4QE3A 1U2QA 1JTFA 3DFUA 3PKJA 3SQOA 3DEJA 5AI8A 1ODKA 3BH6A 5TS2A 3UENA 1VOTA 5K9ZA 4C2TA 4QDXA 4AJ9A 4O29A 3U0VA 1T0JB 3FCAA 4NC9A 1NVVR 1T1EA 3L6BA 4L16A 3T7JA 2KI5A 3TW8B 4P3PA 2YWGA 4ROSA 4BVJA 2EOAA 4NYJQ 2H07A 3UWSA 2QM7A 1NE2A 3LS2A 1DRWA 1X3SA 5D00A 5K0BA 5U9CA 4G0WA 3MCUA 3VC1A 3VAYA 4IEIA 3DSRA 2RKWA 4KAJA 1A9YA 1Z73A 3ANNA 4DR7B 2JGMA 2XYPA 4KMOA 1ISIA 1DFIA 1MT3A 2HREA 1GUBA 2NXNA 3EVAA 5AI6A 4OMUA 4X7MA 5E1MA 2P4QA 4NBKA 2ECPA 5FNVB 3QEBZ 1S9HA 2FSHA 2HMWA 2TMKA 3KEFA 3QTTA 3H1BA 4Q21A 1PE0A 1WVIA 1Z2OX 3EZYA 3LRPA 3MT8A 3TIVA 4MJLA 4F4HA 4XSGA 1GPBA 2JAPA 3UCFA 4LYHA 2LTAA 3VAAA 5HP4A 2HGSA 2IY9A 1I14A 3I1YA 4QL3A 1MAWA 1OFUA 4WK4B 5BWMA 2NNLD 3RDPA 4ARCA 1A2OA 1NHGA 2PBRA 4M7RA 1XTZA 4UBKA 3OTOB 4Y2RA 4ND8A 2R6DA 4AF8A 4TS4A 4J1TC 4CKXA 3SI7A 2PFGA 4LDRA 4CMKA 3AKDA 3FNFA 4KYIB 3SIPA 3BK7A 4BNIA 4CWAA 3P2MA 4TV9F 3SQDA 2WQ7A 2QTTA 3KR9A 3L43A 3A4MA 1QYWA 5CG1A 3M3HA 1RPAA 4UM7A 4Z0PA 4BMDA 1F8FA 1PZNA 3TXXA 3BD6A 5BNFA 1UMCB 3PWKA 1HRKA 3NBMA 5I4IA 1XXLA 4UATA 3CZAA 4TWJA 5F4ZA 5T64A 1OE0A 821PA 3DO6A 2XDYA 3OIUA 521PA 4EPTA 2QN7A 1ZZEA 4DF3A 1FSZA 4JP3A 5CDFA 1MPTA 1ABBA 4X1IB 3N3BC 1XZCA 3ICOA 3QE2A 1UH5A 3ZE9A 3KT3A 2F2TA 2UXDB 4Q3EA 5TQJA 1YMQA 3O2SB 4M38A 3P2OA 3VNBA 1T1JA 1UK8A 2B35A 1GZ4A 4MYUA 3TGWA 2VF4X 3GFSA 1QVZA 1XFAA 3MLEA 3VPDA 1WB4A 5HRCA 2JAXA 3I9NA 4FNAA 3PNBA 3LOPA 1QRTA 1VFNA 5CXSA 5T41A 1GPWB 3EJWA 5L45A 1DIGA 4CGZA 2Q29A 1OOEA 2HT6A 4FFMA 5ECWA 1QGUB 5C3UA 2CSXA 3QVSA 3HBNA 1O6CA 1XU9A 1FS6A 3PDCA 3ZK8A 2VIIA 2WFLB 2Z2KA 3IIMA 3WBJA 4PO3X 3FRHA 3EMVA 2E1PA 1DAPA 1W0JD 2W00A 3F71A 1GPNA 5JAPA 1Q2UA 3H9BA 3IHWA 4MIKA 2QP3A 3DMDA 4Z8YA 5HA5A 3ZV7A 4B5LA 1DUIA 4OLBA 5E6UB 4CIYA 2NN3C 1W1WA 1KR5A 2A9FA 3KZOA 4ON9A 1UBKS 3HNPA 5DIFA 5TMBA 2NU9B 3ZU6A 4BGIA 4OO3A 5IASA 1GSOA 1IBRA 3G9UA 4KLRA 4BVBA 4MEBA 4N3BA 2OMKA 5TNXA 4YHBA 1JPUA 1B6TA 4CDMA 2WKRA 4RH0A 3E3AA 2ZVPX 2OOKA 1XMXA 2H7YA 1D6MA 1XR3A 1HFJA 4HQRA 4DC0A 4M54A 3KSRA 4C0SA 2BDTA 4ISBA 3UTDA 2ZCVA 1VP3A 3GRAA 3O3MB 3QU9A 2FPLA 3WA7A 3S2ZA 5K8LA 1R0SA 4BUJA 1KEPA 3QRWA 2XUJA 1TQ6A 3BYZA 3JALB 5EJMA 4DN6A 4QDJA 1CE8A 1LA2A 1G7RA 4L4SA 4DCUA 2DWOA 2XDQB 1VJGA 3OZIA 2WQ6A 1N6HA 2EP8A 1Z62A 2D00A 2EEPA 3GG9A 2HSDA 5F1PA 1F7UA 3TZCA 5K0JA 4YMHA 3W3AA 2V9CA 2H2WA 4R0VA 4P2GA 1MO2A 1W2GA 2X2PA 4AN1A 1FQOA 4P93A 3OUTA 4JWTA 3WGVA 3TZHA 4JUIA 2K5UA 1P9WA 2YV1A 1RWVA 2CXUA 3B13B 4UDNA 1ENYA 2HMSA 4LUCA 4YV0A 3C6QA 1NZFA 5EIBC 3LNCA 1TYEB 2D59A 3GO4A 4LECA 4EDFA 3LLUA 7REQA 4DSOA 1A9TA 1NUSA 4WY8A 4UAUA 1ODIA 1H23A 1U7WA 1P7VA 3TR0A 3ZE0B 1ORWA 4CR8A 1GLGA 5HQJA 4F97A 1O5IA 2KSQA 2P2SA 1PG0A 3OQVA 1JFFA 1EU1A 2VJAA 4IRXA 1U5BB 1FFXA 5BVGA 2V8OA 4M2LA 2NUBA 3T1TA 5EHQA 3OOWA 4RQBA 2V0GA 4I50B 2QLLA 1CEXA 1MB0A 3Q85A 2WIKA 4AT1A 1QIFA 1XK7A 2C97A 1V7ZA 4TKUB 1UC5B 3I01A 1M5RA 2XNDA 5JJ5A 2IYXA 4RMGA 2QP9X 5FO0A 5DYNA 2VOJA 2J9RA 3UVEA 5ILOA 3L49A 1BS2A 1B0AA 3S8EA 2VAVA 5TDHA 1NVWQ 1ZRHA 2PKXA 4KTVE 3R9IA 1C7IA 2VH2A 2W83A 4L5BA 2RI1A 5C5CA 2F62A 2RHLA 4XARA 4K0KB 1UXKA 1Y8ZA 4PGFA 3LLVA 4A6XA 1U8TA 3O4GA 3ZQ6A 1R6AA 2VXYA 4OP2A 3BFKA 4BO8A 2PZKA 4H16A 2GXUA 5T67A 1SKYB 2ZSBA 4X6LA 4EI7A 4OJKA 4A1FA 5A6VA 2MR6A 1VSUA 4HVTA 4UCXA 5CMLA 3PHLA 3WR5A 1E4EA 5CNMA 4W5NA 1GYPA 4EYSA 1SXHA 4XYLA 1X6VA 3V4FA 1G3QA 1G8GA 1JSRA 2G07A 4JVNA 5I9TA 3BRWA 3AP2A 1CPYA 4Q3BA 4DFDA 1B42A 5JFGA 4IL5A 2COEA 2A35A 1L4BA 1XMJA 4NBLA 4B2YA 2O4UX 3NHAA 4JLKA 1Q0QA 2YZMA 3E7PA 5DI9A 3T3NA 5FOTA 1LNSA 5G1NA 3EOAI 3DNFA 2VNIA 3BA1A 2HJHA 4FE3A 3FGNA 1DG3A 4GRAA 1RCFA 1QBKC 1BFKA 2PO5A 2IZ0A 1T34A 1UJ2A 4NULA 1MP0A 1QJCA 5AJUA 4R0MA 2BMDA 1FFWA 4GBGA 1BNCA 1DKRA 4OQXA 1GUFA 1BWSA 4FSXA 4B9EA 4Q4CA 2DG2A 1T8UA 4KSBA 3WWZA 5A4FS 5JH7B 4HMPA 3R6GA 4P5DA 2D8MA 2PMFA 2P4EA 4LSZA 4GKKB 5I9NA 5DYTA 1H8ED 3N3AC 1XN1A 3DA8A 1TJ3A 2DPLA 1SC9A 1T1RA 3L0OA 1HYGA 2FN3A 4M6WA 1U2ZA 3CBGA 1DXQA 2QBYB 4YXWA 2G63A 3Q72A 4Z7NB 4GMFA 5J3JA 2FCRA 5DDIP 5EP2A 2HMVA 3OD1A 5DCLA 4LFAB 5GP1A 1J2JA 4JB2A 3UMSA 4BZZA 5E7QA 2ZE5A 3IESA 3OZWA 1G8AA 3SKVA 4H7IA 4M9UA 4Y7DA 1MW8X 1A7AA 3U5ZB 3QF4B 1BW9B 4QPCA 2CHGA 1ZGBA 1H3EA 3WBBA 3KLBA 4L15A 4FYPA 5GIPE 4X3OA 4MS4B 5DASA 3PQ7A 3EC1A 4KIFA 5BSVA 4NXMB 3K94A 4OQQA 3VPSA 1LNZA 5LA6B 3KTAA 5IAOA 1T4DA 3I53A 2O4CA 2PU5A 2YN4A 1YGPA 5KHAA 3FYCA 4YQFA 2PH7A 1KXJA 3AFGA 4WJKB 3ZDQA 5JDCC 2ZSEA 2L82A 2OZLA 3GFTA 3QPVA 5G0WA 5JG7A 3ZU5A 1U3DA 2GB4A 4B6GA 4UTPA 4GMXA 3WLEA 3M6MD 4KR0A 2Q1UA 2QXYA 2ARKA 5DT9A 5HZMA 1RYFA 4KH0A 4OQPA 3IUEA 1JG6A 1X7YA 3KYCA 5KREA 1WD7A 3H0EA 4PZPA 5H7XA 3K6KA 1RZRA 4FNMA 3BZUA 4P82A 5J40A 1YOVB 3DDWA 2AYYA 4OH1A 1FNSA 1U2DC 3CQ9A 1GYQA 4BRZA 1B8OA 2VDUE 1B8PA 1JJ7A 1GGJA 2ID8A 4BMOB 5JQWA 5DP1A 3ST7A 3IJPA 1VRVA 4DT1A 4H1VA 4WE3A 4B33A 1UDWA 5BV8A 5CW2A 3PDJA 2QPTA 2HB6A 4ZRMA 3UMGA 3JQGB 1Q0RA 2O6HA 1NVDA 4FX5A 2VP0A 4KWIA 3CLSD 1XZKA 5E9JA 2D2EA 1OWPA 1T91A 5KCZA 4YRJA 2Q27A 1PL7A 1ZEMA 2B78A 2EW2A 3U7QB 5A9RA 4DLVA 4PS0A 3I3SR 2ATCA 3SHVA 1I01A 3RC9A 3GLIA 1GOTA 1XDSA 4IQ4A 5IAEA 4FR5A 1X42A 4ANFA 1GCIA 1E8DA 3LBFA 2QRGA 2VF2A 4U2CA 3LT1A 3LJKA 4GE0A 1EVYA 2IV7A 5FBRB 4IYJA 4JLNA 4YUVA 3U1TA 2IEIA 4RXMA 2VAPA 2I67A 1X7WB 2GPTA 3I12A 3PD7A 4UDYX 3TNLA 3W7AA 4DIDA 3RC2A 3QPUA 5TRTA 5JZMA 4P86A 1MO6A 2R48A 1L5HA 3OAAA 2XCQA 1DB3A 4AP5A 4CEJA 2CJPA 1E79D 4NQRA 2C3MA 1VL1A 1XSEA 1XZBA 2X7JA 2XD9A 1I7DA 1NVFA 1XI2A 1HWYA 4I4NA 3ASUA 1U5AA 1YB2A 3DEYX 3HP7A 4KE6A 4WXPA 4MPDA 2P0EA 1KO7A 5AK4A 2P65A 1NWCA 1ZD2P 2G1PA 2P90A 3M4ZA 3TLGB 3JYHA 3FVVA 1MDFA 4RIGA 2BGTA 3EULA 2BUAA 1GGMA 3SF8B 5KYXA 3K35A 3GN2A 1Z47A 4JNKA 2OC9A 4KR3A 1F4VA 1PNOA 1VCIA 2X0FA 3WGOA 4X41A 2PUGA 4WV3A 4TN5A 1DPFA 5TV2A 3W9SA 3H42B 5LYJF 1EFAA 2ICAA 2GN8A 2KPOA 5AK0A 3EODA 1CR1A 3EWSA 1NJSA 3W6OA 4YCAA 1AK9A 4KXQA 4QRHA 3P2KA 3S7ZA 1SEPA 3U3MA 2XMSA 3WL5A 1N2CE 2NU8A 5LXTA 4XXHA 2GRUA 5KEIA 1SD2A 4HTFA 2F1JA 3GARA 1AK1A 1P2GA 1RFGE 1XQWA 1YB5A 4MITA 1Q14A 4QLAA 1G5QA 2VSFA 1WNFA 4L3VA 3I6IA 4YRMA 2F67A 2ZTUA 1NMQA 2UZAA 3R3VA 3A36A 4FYIA 4L8YA 3S6JA 3BAZA 3KPVA 1V11A 3DMTC 4RHTA 4HUQA 4QIHA 4NU0A 3FTNA 4M76B 3U49A 4LGCA 4KDCA 1A8QA 2NQ2C 3PXGA 4LYFA 2JEZA 5A9TA 3S1AA 4IDCA 1ACMA 1J09A 4XWGA 2PTHA 3C1AA 4ITVA 3CVWA 3QEAZ 4OHRA 4MUEA 3SD7A 1CY1A 1S7GA 3DWEX 4PICA 5ANRB 3TSOA 3Q5EA 4AJOA 2PKRA 2WSIA 3D3JA 3KAKA 2GTHA 1J2TA 3L0PA 3MGKA 2BHRA 1R5JA 3GJTA 4PFKA 2OYRA 3ZD9A 3DKRA 5LQKA 2YWXA 3ZE8A 1H1DA 1NG1A 3VVMA 2HA0A 1CHNA 1BMTA 2AG5A 5AW9A 2NIPA 4CQMD 3E1KA 4TLLB 2ODBA 3JVVA 4WNYA 4WEOA 1UOQA 2Z1MA 4OGGA 1PYGA 1Q7RA 4LPSA 4RFVA 2WSMA 2B9VA 3GA5A 4U2FA 1BDBA 4NDZA 2ZVQX 2NT3A 3HBLA 2NVWA 2OV3A 2PIDA 2CXHA 3O95A 3I8OA 3Q3GE 3W5SA 1Y3AA 4BMCA 1DQRA 2HLDD 3VHXB 1XDWA 2MU1A 4QYIB 1E58A 4EJ0A 1R8SA 4Q4HB 3ZCSA 3F46A 1H4QA 4LYEA 4DG8A 3GEBA 1M1UA 2PD4A 4IQGA 5IBQA 1LBIA 1KVTA 3TIIA 1ZC3A 4GLFA 5E95A 3B12A 2GF2A 4R83A 3O1HB 4FINA 1SUAA 3EZ6A 4ZCSA 5B55A 5ITVA 2GM4A 4F4UA 1BJTA 1EWVA 1L2TA 2XA9A 1SHKA 3O2NA 4YP6A 4YRNA 4DR2B 1DJNA 5F4BA 4XWAA 1U65A 4YK7A 1Z17A 1QR6A 3PUYA 4G2TA 2EJCA 1HZZA 1K6XA 1QVVA 2GBLA 2OV1A 4XX0B 5ENZA 3JZAA 5BQ5A 5IRCD 1FDIA 3DMNA 2IHVA 5L3SA 2FHPA 1UR5A 1YS6A 1JJAA 2KX7A 2IYOA 3RIMA 2ZBVA 4O4IB 2IHZA 3CZPA 2EWMA 1DBQA 3THYA 5IN4A 1JDNA 3EGCA 3KZMA 2BGRA 2GO7A 1RAIA 3H5RA 1K66A 4MMXB 4TV9B 3AVTA 3JQ8A 3L1VA 2ADMA 4R1SA 4RQUA 3P4XA 4J16C 3K1ZA 3AY6A 2FPOA 3PDHA 2C82A 4MGEA 5E6RB 3UAVA 4B3JA 4DKXA 4AZ3B 3QMWA 2BZSA 2G7MC 4FFLA 5AESA 3KCQA 1OAKA 1EA5A 1FK8A 2VPZA 3B3AA 4LDNA 2KQUA 2GCEA 4RSHA 5EJ7A 2I4TA 4BGUA 1P9OA 1SVOA 1MGPA 5NLLA 4HNQA 3RG2A 1JBEA 1OWMA 1GTZA 1GZVA 2PRJA 1CDEA 3WZLA 4B4KA 3R0ZA 4HMQA 1EFPA 2J45A 4MO9A 2Y2UA 5FCDA 3Q15C 4EBBA 3EE6A 4JKOA 4MYRA 1K8XB 3KSDO 2BGLA 3DAOA 1JSLA 1QIHA 2OO5A 1PZGA 1RWWA 3E7XA 4URHA 4YH1A 4YGYA 5IM5A 1D4ZA 4D74A 2NSDA 1CEEA 4ZCLA 4F86A 2ONCA 3NIBA 1OZHA 2PS0A 4WK2B 4EYOA 2GYVA 4AKSA 7YASA 1IATA 2L18A 3C5WP 4NMLA 4UQPA 1ZLYA 1X7GA 1JMKC 3E9MA 3Q7RA 2AL7A 3BB1A 3EX7C 4BB9A 1DO2A 1J24A 2Q6TA 4INZA 5DI3B 3VXKA 1VE7A 3MYYA 1RRVA 3THWA 1Z4JA 4RETA 4KLCA 2A1IA 3AW8A 4Z7OB 1HLDA 2JBAA 3UM9A 2TMYA 2CJYA 2EG5A 5CX4A 4BFSA 1DRVA 1EESA 1EFHA 1P0MA 5LZ4A 3UWPA 1Q15A 4A10A 1N75A 1RLTA 2EFDB 4XRRA 2YXLA 2H65A 3L9WA 5F3DA 5L6MB 3FGZA 1PHPA 1GY8A 4PNPA 1A4UA 3BZBA 3EXIB 5B64A 5D8DA 3ZZTA 5TGDA 3AJDA 4GLOA 4K2HA 4RK4A 3D31A 1FMFA 3L4BC 3WAKA 3L77A 3OQJA 1VBMA 1Q1BA 1NJGA 1W88A 3OC6A 1U8AA 1JR3D 3VR5H 1L4GA 4A8PA 4DA6A 5IDQA 3UJDA 2NZXA 1J1UA 1A8HA 1CF9A 2R6AA 1SZCA 2RHWA 3A6GA 4S1TA 1DTWA 3G0IA 4YNBA 3USZA 4DV0B 1QHGA 4X44A 4MGKR 3CX7A 4MW6A 3DVRX 5DWVA 3H2BA 1HT1E 3DUFB 3KRTA 3I5MA 2PQ6A 1X7DA 3QGMA 5HIMA 2QWXA 4LXXA 2RGYA 4MGYR 1JSCA 4G01B 4ND2A 2QRKA 3BWVA 3C3CA 3ZLBA 4MUXA 4R6WA 1GIAA 2F43B 4R9VA 1LPSA 4S04A 1V71A 1E92A 1WAMA 1XMVA 3L8FA 1OASA 3H8JA 4UARA 1ZH6A 2GUWA 4WVFA 2IEBA 2H48A 2F48A 3OTQA 3PYXA 3V3TA 1DC8A 2H16A 3FLEA 4MV3A 4ER7A 2X0IA 3GWGA 3R3YA 3I83A 1YRHA 4MYSA 3W1WA 4DIUA 3AJ9A 5ALVA 2IH5A 1NRXA 3EZLA 5JS2A 3QKRA 1Y98A 1UDCA 1ZI9A 4X1KB 5K8IA 3VV2A 4AC9A 3SR3A 2OLEA 4TRNA 3AI2A 2ZM5A 4NYMQ 4FB4A 4B2PA 4YRFA 3BMXA 3L1IA 3SF0A 1Z28A 4BNGA 2NTVA 1MXHA 4TWZA 1B1CA 1QHSA 4GT1A 4O4HA 4GD3Q 2XCLA 1E3LA 4URWR 4BN4A 3EEIA 2X0NA 5IVIA 3SZOA 4Q16A 1MFZA 2BZ0A