1JE0A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with phosphate and tris molecule
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
234
structure length
226
Chain Sequence
PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
total genus 76
structure length 226
sequence length 234
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1je0A00
1V48A 2AC7A 5CXSA 5EFOA 4TXMA 1A9RA 1TD1A 3MB8A 4JP5A 1T0UA 1Y1TA 2HRDA 4F3CA 3EUEA 4GKAA 4QASA 3OZCA 3T94A 5I3CA 4TS3A 1RT9A 1RSZA 3P0FA 4DA0A 3TL6A 3DF9A 4WKCA 5F76A 4NS1A 3BL6A 5EPUA 2OECA 2AI2A 5F7JA 1Z5OA 4QATA 1YBFA 1A9PA 1RFGE 1FXUA 5F77A 3KVVA 1NC3A 5B7QA 3UAZA 3NM4A 1VFNA 1PKEA 1PK9A 2I8AA 5F7XA 1V2HE 3KU4A 4QARA 3D1VA 3ODGA 1Y6QA 3MMSA 3NM5A 1CB0A 3O4VA 3OPVA 3OF3A 4OGKA 4TXNA 4BN0A 1RCTE 1ULBA 1OV6A 1OVGA 5ETJA 2I4TA 4M3NA 5CYGA 5B7NA 4WKBA 1RYZA 3KVYA 1RXSA 4U2KA 1WTAA 1ODKA 4BMXA 1U1CA 1LV8A 4QFBA 4DA7A 5CCDA 2AI3A 4FFSA 4BMZA 1Y6RA 1ZL2A 3PHCA 1JDVA 1Q1GA 4OJTA 3UT6A 1PR6A 2ISCA 2AI1A 1T8RA 1Z39A 3F8WA 1OTYA 1A9TA 3PHBE 4NSNA 4TYMA 2QPLA 4TTJA 3INYA 4M1EA 2A0WA 2QDKA 4JWTA 1Z36A 3O6VA 1LX7A 4LDNA 3P0EA 3UAYA 5KB3A 3BJEA 1K9SA 5EUBA 3EMVA 1ODJA 1V3QE 2QSUA 1JDZA 1JYSA 4JOSA 2PGAA 5IFKA 4KN5A 4L0MA 1PBNA 4LKRA 1U1DA 1NC1A 4OY3A 3LGSA 4TXLA 4WKOA 2BSXA 4G8JA 4D9HA 1RR6A 4TXHA 3OOEA 1SD2A 4UC0A 4DA8A 2HWUA 4GLJA 5CXQA 1YR3A 1PW7A 3UAVA 4DANA 4H1TA 2H8GA 3DP9A 3ONVA 4GMHA 4TS9A 4EB8A 1OTXA 3OOHA 5JPCA 2A0YA 3GGSA 4MARA 4D98A 4L5YA 4ECEA 4G89A 1U1FA 1SQ6A 5C80A 1PR0A 1VMKA 5B7GA 1XE3A 4F1WA 3OZDA 3OZEA 5FAKA 3EUFA 3UAXA 1Z5NA 1A9OA 5F7ZA 1PR4A 4NY1A 1C3XA 2OXFA 1K3FA 1OU4A 4R31A 3E0QA 3BSFA 3KVRA 3NM6B 2Q7OE 1YRYE 3OZBA 4I2VA 4PNPA 3QPBA 2XRFA 5F78A 1PK7A 4QEZA 4DAEA 1ECPA 1A69A 2HSWA 1NW4A 3FNQA 4R2XA 1JE0A 1T8WA 1CG6A 4YNBA 5F73A 2OC9A 2IQ5A 1VHJA 4WKPA 3FAZA 3FUCA 1JPVA 3LA8A 4DARA 3FOWA 3E9ZA 4E1VA 4IP0A 3SCZA 1YQQA 1T8YA 4DAOA 2B94A 1A9QA 2HN9A 1B8NA 1V4NA 1PF7E 5K1ZA 1PWYE 4K6OA 1ULAA 1U1EA 3IOMA 3K8OE 4OF4A 3U40A 1Z34A 1TGVA 4X24A 4LZWA 4DABA 3FB1A 4D8VA 1ODIA 1LVUA 4QAQA 3C74A 3GB9A 1G2OA 1PR5A 1Y1RA 4YMLA 3UAWA 3K8QA 4TTAA 3FWPA 4L6IA 1V41E 2GUWA 3ENZA 1JDSA 3NBQA 1Z33A 2A0XA 1ZOSA 1VHWA 1PR1A 1Z38A 4D8YA 5F7OA 4TTIA 4MCHA 4D8XA 4WKNA 4LNHA 5CCEA 1QE5A 1B8OA 2QTGA 4LNAA 2OC4A 1JE1A 4MCIA 4RJ2A 1T8SA 3DDOA 4TXJA 5IU6A 4R2WA 3PNPA 3KUKA 1M73E 1A9SA 3BGSA 1RXYA 1TGYA 2A8YA 1RXCA 4OEHA 1OUMA 3E9RA 3PNSA 2ON6A 4M7WA 1TCVA 4YJKA 4PR3A 3OCCA 1YQUA 1N3IA 2RJ3A 3DPSA 1SD1A 1JDUA 2P4SA 5CYFA 1K27A 1Z37A 2QTTA 1RXUA 1JDTA 3LBAA 5DK6A 4G41A 1V45E 1Z35A 4L5CA 4L5AA 4OGLA 4P54A 5B7PA 1Y1QA 4EARA 1SJ9A 1TCUA 1JP7A 1I80A 3KHSA 1Z5PA 4YO8A 1PR2A 3DJFA 4F2PA 1Y1SA 4F3KA 3EEIA 1ODLA 4GLFA 3IEXA 4BMYA 1U1GA 4DA6A 4F2WA
chains in the Genus database with same CATH superfamily
2WD8A 1XEFA 1IUNA 1JU3A 1PVDA 1LZKA 2CL5A 4D4HA 1XI2A 1RKQA 1CFZA 4H17A 4ITVA 1H0RA 1M2JA 2CLLB 3GCXA 1WW3A 3M82A 4HO1X 3YASA 1KSFX 1RLMA 1F5SA 5JRJA 1LQUA 1DIBA 3EPLA 1JILA 3C16C 1L7XA 1Q1EA 2BMEA 2X77A 3RABA 1HI9A 2VQ6A 5FNVA 5A3QA 1RQPA 1XCBA 4FNOA 1P5ZB 4HTFA 1RI5A 3UMGA 2ZB2A 4AG3A 3AEYA 2R00A 3I2JA 2Z8XA 4GBMA 2OKGA 4X3PA 2IOYA 2XXAA 2B9EA 2SECE 1F0PA 2JIDA 2V5VA 4BP9A 3LCVB 5EUMA 4D0NA 2W6OA 3MIIA 1O9GA 4BJ1A 5FWNA 4G0VA 5K3SA 4QUHA 1VMAA 3S81A 4ZYTA 1U9ZA 3FPCA 3GRPA 1GDDA 3W2FA 4DNPA 1QIDA 2OUIA 4CTOA 3IP8A 3PE4A 5FWDA 2BEKA 4BWFB 2Q3MA 3M3HA 1YA6A 3CRZA 5FCDA 1M2HA 1TJ4A 2YWDA 3OX4A 1E6WA 2IIBA 3NATA 5ARDA 1CD5A 3PWSA 4Q01A 4N6OA 1ISPA 1ULTA 3M9XA 1C4WA 1KFEB 1W96A 3A4IA 3ZGNA 1WMEA 2QSZA 3CVJA 4K9KA 3EEOA 2JFFA 4Y2SA 2CWWA 3I30X 3JATB 1A9PA 1TA4A 1GCIA 4QE3A 3Q3EA 4YP9A 3PEYA 1U2SA 2XGGA 2ZKLA 2BFFB 4YV2A 2DUJA 4N5IX 4URWR 2NU7B 1IY8A 1XQWA 3CV3A 4Y2GA 3W3AH 3U17A 2ECFA 4KGXA 4EZIA 2HA0A 5EJ2A 3KQWA 3IUJA 1K8XB 3LF2A 1DP4A 2QX4A 3JARB 2QX9A 4OYHA 3S2FA 4DXHA 1WU8A 3BTSA 3LMKA 4N7MA 2FPXA 3ONWA 1AS2A 2ONYA 2FP4B 4UVGA 1E89A 5TJ9A 4XSGA 3TEJA 3C3BA 4ILEA 4F85A 1ZVKA 3CNEA 1Y33E 3WR5A 3LX6A 1VCOA 4S1TA 3OPYB 4HT3B 3REFA 2HNAA 1DBRA 4DV5B 2PKXA 1RCTE 4B3DA 2XDWA 2V5UA 1NR1A 3ANTA 3O90A 4OHMA 4AQDA 2R66A 3BQ9A 1BH2A 3FAKA 4XSHA 1RE1A 1ZD4A 1ZHFA 1K7FB 3H1TA 3PA6A 2D8AA 4YXWA 3HUDA 5C3MA 3NWOA 4R0MA 3KYCA 4I5FA 1DT5A 5B3KA 3WGVA 2Z6UA 4CKEB 2AG5A 3EE6A 4YPVA 1ISFA 1HV8A 1V8BA 1E4OA 1EAMA 2WPNA 2JVIA 3AKYA 3TIFA 1F06A 4WESB 1NW3A 5DPMA 4A8PA 1EAYA 3S3TA 4C6RA 1PZXA 2WMYA 2Y66A 1UBUS 1L8AA 4BBAA 5IN4A 2UVQA 3O38A 5ENDA 3V1NA 1UR5A 2O5RA 1DC5A 1PV2A 1H65A 3KL2A 1JDPA 2DFVA 2WI8A 2BRUA 3PKZA 1NLFA 1BMDA 3DL2A 3O1LA 5EJFA 4CDRA 4DCUA 4ND8B 3E22B 1EQAA 1E2GA 4Q4JB 4B82A 1UWVA 821PA 4P3NA 2XBUA 3Q0IA 4DA7A 5FIUA 2ZRJA 2XUHA 4E5DA 5GP1A 1WZCA 2YYZA 1HGXA 3GG9A 4L27A 1JF8A 1ZK2A 2J41A 2OKCA 2VOJA 3N53A 4R1UA 1I4DD 3U0VA 3VYSB 1J5EB 1PX0A 1K7SN 1AY0A 2VLBA 1KQGA 1LLCA 1BKDR 3LD9A 1X1SA 5CGZA 3RG2A 4X8MA 3E70C 4PN3A 3B5IA 1H2EA 2F3QA 4ZQHA 3VR1A 3LKVA 4E11A 4YV7A 3CUYA 3UT5A 3RRXA 1JG2A 2OQRA 1DDGA 3DLAA 4NENB 2V7EA 3A06A 4O2BB 1RWPA 4Z2YA 3RRNA 3G7SA 2DOKA 3GP3A 3IHTA 1E1CB 3GR6A 1NT2A 3L7IA 4HGQA 4PCUA 4YRQA 2P9YA 5EXXA 3ZHXA 1P0QA 2B4TO 3SYMA 1Y6GA 4BX9A 2FVXA 2O8CA 2J07A 1O03A 2UVDA 1C7EA 2CYAA 3CKLA 1QPBA 4TL6A 4EUHA 2IX3A 2E4AA 3M2TA 1WF3A 1ZMRA 3P2EA 4B3JA 4ZAZA 4PFQA 2I6FA 4TT3D 4UTVA 2RH9B 3UMSA 5BWOA 1DSSG 3FNGA 1IFXA 1SXJD 1HQCA 5KDDA 2ZZKA 1SQGA 1IK4A 2J7PA 4I19A 4BL5A 3VBEA 1FDWA 4QPJC 5CVUA 2GS9A 3MT9A 2C9BA 1E1LA 4CHTA 2BUBA 2R2GA 3GOQA 1HDRA 1XLWA 3DR5A 3I5MA 2Z09A 3A4NA 3JD1A 1YS4A 3OUTA 4S2UA 5D00A 4ZO7A 4D9IA 1DZ3A 2ZWPA 4RZ3A 2JD0A 4J75A 4S1NA 5JE8A 1NVFA 2HB6A 2CUKA 1MW9X 2XT6A 1U81A 3H4IA 4A6EA 5EIEA 1V4BA 3JRNA 5IFKA 4EIWA 2ZE6A 2GPYA 2WT8A 2IZ7A 4WW0A 3TXAA 2GF2A 2YTZA 1Z22A 3AETA 4X95A 1QYRA 1VMEA 2HU2A 4BGVA 2ZE5A 5G41A 1BXRB 3HNRA 3QBDA 2CFCA 4FQ7A 1Z0KA 3H13A 1M34E 2R68A 4G8DA 2W8BA 4WQMA 1P1RA 4ZI7A 4FFBB 2JHAA 1AIPA 2BMAA 3SI7A 3ZBPA 4HEA1 1NQOA 2JLUA 2HQ1A 3KXIA 3R3XA 3TXYA 4BMSA 4OLAA 2IUYA 3T06B 1KR2A 2Q2OA 4NZYA 2Y0PA 1JYEA 1FFCA 2PL9A 2AS0A 3HKEA 4IGEA 5JHHB 5BVHA 1E7RA 5DN6A 1SOWA 2UYQA 3CZPA 3NDIA 1CVRA 2BCJQ 1B0UA 4H1TA 3M3DA 2WWXA 2AG1A 1SBZA 3DH0A 5K6AA 3LQRA 1GDTA 4YJ3B 3TLKA 4YREA 3BK1A 4TS9A 1ZOOA 1OYYA 3VDQA 9LDTA 4PX5A 4HX9A 2HTEA 1KOFA 3KELA 3F97A 2IH4A 4ARCA 1OC4A 3D3KA 2JATA 4AJNA 2RHWA 4FYKA 1UM8A 3NTRA 4O4HF 3ZW7A 1X7ZA 4QTYA 2IHBA 4G89A 3I5XA 2WFAA 1DO8A 2EKQA 4KR7A 4BBZA 1AUOA 3H75A 1YS6A 3BL8A 5JZMA 3RSSA 3O1IC 5AK5A 4BIMA 1C41A 4BAGA 2CC2A 1K8QA 2DBQA 4C0BA 1KFKB 2OP1A 1T9AA 3DM9B 1U2PA 2BW0A 1EFLA 4M83A 5EP3A 5EMNA 4FIZA 5E6SB 1BIFA 1LJUA 3QNUA 1GCAA 3UUFA 1G20B 2ZXEA 3R5KA 2BEWB 4IOMA 3RC8A 2X4IA 3KAJA 4MK4A 3WNCA 2OVFA 3L7YA 1XXHE 3L6UA 4L74A 3VZPA 2JHGA 3ORHA 3C7KA 2IZ0A 3JALA 4QLOA 4FW9A 4RIEA 3W77A 1BDMA 1F2UB 1R2QA 1AE1A 2FPWA 2ZRPA 4FGWA 4IDNA 2NO0A 3ODPA 2IYOA 4Q1BA 3TIXB 4MQMA 3ABIA 2HF7A 4AX8A 1JSZA 1JIXA 1L4NA 2Y2UA 5DWQA 1YR9A 5JWRA 3K35A 1C9YA 3DZIA 1QR2A 3C4QA 5ICMA 1MO2A 4W5RA 5JCOC 2VJCA 1J9ZA 1VLVA 1XWWA 6ABPA 4TMVA 1E5LA 2RHTA 2HRBA 3SS8A 3FRJA 4ZCMA 1KDOA 3CRRA 2SICE 1KFJB 1KRHA 2I1LA 3TZHA 3FSRA 1CLUA 1NNSA 4J0JA 5IVPA 3SLGA 5D5HA 5F64A 3UA3A 4LF6B 1N5IA 3H4TA 1IEQA 3QG1A 4OSOA 1FFSA 4XWYA 1YE8A 2JJ2A 3IGFA 1O96B 2ZT5A 4YONB 4KIWA 4OL9A 4OKNA 3UJNA 5DU2A 1JHYA 1UDCA 4KAJA 2X5OA 1JSXA 2HSWA 1ECBA 3VU8A 4RD2A 2W0MA 1WQ3A 5D3MB 2X0DA 3TQRA 2V6BA 5AHWA 4N5MA 1HC7A 3R0QA 2I76A 2FFQA 1EM8A 2ZCVA 4M0DA 1J1UA 1COWA 2KBFA 4P3OA 3ELWA 3BREA 1GGFA 1HE2A 1N78A 3BQNB 4OLHA 4JT9A 2JZCA 1MO5A 2CZQA 4CIDA 4LXUA 1JKJB 1XU9A 4HDKB 3LDFA 4GAEA 4ZAXA 4HGPA 3WLEA 5JAPA 4CIWA 2OQ2A 1L9KA 3SNKA 1X2BA 4RJLA 4LG1A 1QSGA 2WSSD 1HRKA 3D1LA 2C96A 1XR3A 4DBLE 4IP0A 3U61B 3KU1A 3ZWAA 5C9ZA 4PHHA 2PSFA 4MKFA 3CVVA 3A4MA 2IHNA 4KQ6A 3KFXA 3CNLA 4DNFA 2G25A 4YR7A 3QW4B 4RFSA 2W42A 4RVNA 5DM2A 5LMUB 4DT1A 5TE9A 3TLCA 2B37A 1N4DA 5HMLA 5C5IA 3I92A 3QVLA 3IUNA 4R9UC 4YCSA 1DADA 2GARA 2QD4A 1E9FA 3NNNA 3OE7A 3QWFA 2V3VA 4H7KA 4KOEC 1A04A 4FBLA 4R8LA 1U3CA 3BXEA 3CRW1 2FAXA 2VP4A 4P98A 5KMGA 4UHEA 5A1TA 2F1RA 2CV1A 1VYUA 2CV2A 1TGVA 2IVFA 2XB4A 4NWIA 1J56A 1KAGA 2Y1WA 1PK8A 1VYVA 1IWPB 3OI7A 1PDWA 4Y9RA 3KB8A 1A9YA 3VSEA 2PVCA 4Y2YA 3ZE0B 3S8EA 2AWNA 3OIDA 4R98A 4BZPA 1BDJA 3BSWA 1LRLA 4KX5A 5BYBA 1B8VA 4QOGA 3G2LA 3QNWA 3ZLTA 1N2BA 4F91B 3ZVKA 2O19A 5HJ5A 1PR5A 1Y1RA 3SYTA 3UVEA 4XB6B 4D99A 5DNEA 3TRIA 2CDRA 1RP7A 2AXQA 1IN5A 2XCQA 1VIMA 5CBPA 3ZVNA 3B6ZA 4D2IA 3LKZA 2I7XA 3ENKA 2VPXA 2ACKA 4CLDA 3HA2A 1H5QA 3A2MA 4WERA 3VSAA 4DJEC 2C5GA 1GZ7A 2WOJA 3KXDA 4GMDA 2YVAA 1NVKA 3RVDA 3T1TA 4AY5A 3GIDA 2RGNA 1Q7GA 4O33A 4V0LA 1YZVA 5BN3B 2VUUA 3OIFA 2C7RA 2X0RA 1U28C 4J07A 1J6UA 3OIUA 1L5ZA 2WJ6A 3VV3A 1NG9A 5HF6A 2FPUA 3EXEB 2FPKA 2OD7A 3FRIA 1CUAA 1VZ3A 4XEHA 1KAHA 3RKSA 1MPTA 3C8UA 4X90A 3U31A 4AZSA 5DI9A 4CW7A 5LD2B 1FVOA 2P67A 3CZQA 2VXYA 2WJZB 3D0OA 1QH1B 1KC1A 3L1KA 2BHRA 3P2KA 1V39A 1PIWA 2LPMA 2IS2A 4BOYA 1B8PA 4EYGA 3PJFA 5BW6B 4WINA 2XEXA 1JMYA 3K20A 3N05A 3NCHA 4J0FA 5E4JA 5ULLA 1XZKA 4H15A 1EB8A 4BGIA 1AUXA 2RK6A 1E20A 1JQKA 3KUKA 1XF1A 3FBWA 5IMBA 3OIWA 2P35A 1MO3A 4MDEA 4AF7A 2C61A 1DC8A 1NGSA 1W85B 2YN4A 5BXQC 2Q3JA 3B82A 2BKAA 2F3PA 5C51B 2Z5VA 4YAEA 2FW0A 3BZUA 1P7CA 4LY6A 3LUGA 5A71A 2X41A 3VZRA 4P7FA 3GZNA 4CTKA 3P0JA 1FUEA 3HXPA 3AHFA 1MT3A 3BICA 3GXBA 3KR9A 3A04A 5DX0A 4ZCRA 4CJXA 4FNAA 5REQB 5ICEA 4RZXA 4DC0A 3ZK7A 4ZYVA 3ZCUA 1UC5B 2ARKA 1EG2A 4ZAGA 4JVOA 1JDUA 4MGYR 2X13A 3NAQA 4ZPJA 1CWUA 2QTTA 3RHSA 5EJAA 2ZK7A 5BNIA 3ESCA 3WLPA 4A03A 3J7AC 2NADA 4BVGA 4EDFA 1J5XA 3F5QA 1RI4A 2ETVA 3QE0A 3KXPA 1Q0QA 1Z35A 3TOCA 1TM1E 4L4ZA 5AM3A 3HUTA 3IDAA 1X8JA 2ANCA 5LZ2A 2V7QD 2AOXA 1CV2A 1TCUA 2XPCA 2ZDGA 2N9UA 2QLMA 5G40A 5IJ0B 3GK3A 4PC7A 1M6NA 3M9WA 4NJMA 4LJ7A 5EMMA 5T5QA 5EZYB 4DN6A 5ELXA 1X77A 2HX1A 1ST2A 4I1UA 4TQGA 1BFUA 2DMRA 2Q8NA 3CX8A 1Y1SA 2QRMA 5JPIA 5T4HA 1HT2E 1S3IA 1ULSA 1GN9A 3KJHA 4ALMA 5JFGA 1FDSA 2O8DB 3L0ZA 3X2FA 1TO6A 1DKQA 1MV8A 1PLKA 3QX7A 4JJ8A 3BRCA 3K0KA 4KJZA 4D42A 1U8CB 4WXMA 3IEXA 1N2CA 4EPTA 3WWEA 2EGUA 4S05A 1VLJA 1M74A 4GE3A 2C0PA 4RJIA 5MN5A 2IPLA 2FE4A 1J9EA 1KVQA 4EGQA 3VYRB 2BRUC 1DMRA 3ZE1B 1Y1PA 3KFVA 1Z0JA 1RRFA 3A58B 4MPRA 3OG9A 2CFTA 3GEDA 5T4BA 5CXSA 1YXMA 4MWBA 3V8BA 5JRZA 2E4ZA 4LBVA 3ME5A 3WGUA 1VIDA 3OVMA 2HT6A 2F8LA 1T91A 2H1RA 3BWXA 1JAIA 1Z4JA 3K1TA 4RHYA 3TRJA 3V46A 3GI1A 4BKOA 1NKSA 4JC8A 2L19A 5AJTA 3C6YA 4XR4A 3VNAA 3ZV4A 2JLXA 4QQFA 1N6RA 1ZBDA 3U5ZB 2YZGA 1SB8A 3F8TA 2OZEA 2ZSHA 5KAPA 3WHPA 2OGZA 5J58A 4ZVPA 1AV7A 3GLUA 5FTLA 2ZUVA 3FPSA 5A3SA 1G8KA 2CCGA 2W2LA 3ZTTA 3K4HA 3S1AB 2DTDA 1U90A 3SF0A 3I1YA 1S5PA 3IA7A 1G5IA 2PS1A 4CTMA 5FH9A 3A25A 1E64A 1XVIA 1QDEA 1TDJA 1I6MA 2YMLA 5EJ5A 3W04A 1CDZA 3IVXA 2E4UA 5CM2Z 1PNQA 3AR3A 4RVSA 4RHTA 3NBMA 4V0ME 3UMVA 3A26A 3MSCA 3MRXA 4O4IF 3T4UA 2QUKA 4BUZA 3ZGZA 3FTCA 4WIAA 2G82A 4DQLA 1BE1A 1L3CA 1Y7PA 2H4WA 2W6NA 4I5IA 4NABA 4EW3A 4ZK2A 3WIBA 4Q18A 5GZ1A 1RZRD 2G9QA 2RGNC 3I5UA 1B41A 3PHGA 4ABTA 1E0JA 4DQVA 1MIHA 2ID9A 4P4GA 1Y9AA 5B6PA 4MA4A 5EMHA 1Q0PA 3HR8A 2AMYA 3WLNA 2WM2A 2NNLD 3PFHA 2GNOA 4UTZA 2HA3A 2E21A 4GBED 2YDXA 4FONA 3IVMA 2CVFA 4JYCA 2XHZA 2PRKA 1U04A 2HJRA 1FQKA 2WA2A 1VFNA 4IIXA 4JYBA 1UKBA 4R3NA 3ZKWA 4QBTA 3VX3A 3R5HA 1Z7GA 2EHDA 4O4JF 2PGOA 3IAAA 1EVLA 4HXYA 4TWBA 3UA4A 3WYNA 3L93A 2YYSA 2OFWA 2PXHA 1NBMA 3IP1A 4D74A 1KJQA 3GEHA 4C4SA 2Z4RA 2ORED 1U2DA 4QQKA 5FOWA 1AQYA 4TSKA 5FBRB 3B1ZA 3OZWA 5KC9A 1YKGA 2BELA 2GLUA 4EJ0A 4DV3B 1KK3A 3DEIA 4R84A 4CVNA 5K0SA 1W5EA 2F55A 3I39X 2HBZA 4ACAA 2BM8A 1JKIA 1G8MA 3NVDA 3M49A 3UK1A 3AU9A 4JS0A 3Q8KA 3PVSA 1EKXA 4Q16A 4RELA 3JCZA 1I1NA 2RKWA 2I4TA 1TYAE 1TVMA 3FOBA 4YMVA 2FZGA 4NDAA 4U2BA 3F98A 2Q1UA 5CXUA 1ATZA 1O87A 1GXSB 4FEAA 1P5FA 2YWFA 1W73A 2B8NA 4HPWA 1JEOA 4NCHA 2P2SA 3L2OB 4AECA 5A4FS 2P0YA 1EJ6A 2JIPA 3P4XA 3DLCA 2Y99A 5DLPA 3G5LA 2FW6A 2WAMA 3T7SA 2Y0EA 3FZEA 4NENA 3TNDA 4MTCA 1KI6B 5C7LO 1O9HA 1PTKA 2NUTA 3LBIA 1DBSA 4WZBE 1L5NA 5IAOA 4KWEA 3KJGA 2A0FA 3B2QA 3S5UA 1Q6ZA 2PPVA 2XMQA 3BXGA 1LSUA 4C78A 2Y1XA 4YUAA 3EGEA 1UP7A 4M0PA 1J8YF 2SCUB 3SS9X 1AHPA 2OK7A 2PJDA 4H31A 4K6CA 3MYYA 1UBLS 1N9ZA 2OO3A 1EFPB 3NC1C 3MTEA 4HBZA 5JNUA 3WLOA 2PWZA 1NT4A 5BMOA 1JHUA 3D2BA 3QF7A 2SCUA 1D6MA 4BQSA 4D44A 3WRWA 1NHWA 4EFNA 2HMWA 3NI2A 3WIDA 1P74A 1NP7A 1WDMA 2WABA 1KMHB 3GUHA 3WLRA 4QJBA 1KZGB 2FRVA 3RIHA 1DPGA 2EQAA 2JAQA 2RHDA 3FGOA 4LX8A 4O8CA 4YCAA 5H59A 4JI3B 1G4UR 5HUJA 1ACJA 1VSQA 3IB6A 4M54A 1RMTA 5KJEA 3FBGA 1MRSA 4PYLA 4IQ0A 3PQ4A 3WMEA 2AZ4A 1DJLA 1UL1X 1YU9A 3KOMA 3L6RA 1AQJA 4KR3A 2D0DA 2OAEA 2XCLA 5LVAA 1M34A 2EW1A 2C92A 3A32A 2QDKA 3AGQA 3JQEA 4JWTA 5KOIA 3TE6A 1SU8A 1JW9B 1M1YB 3LFHA 2NO1A 1NZDA 4YPOA 3NJ8A 3TJMA 1F6WA 3MTAA 1CCWA 2GYYA 1GNLA 3KXKA 1Z63A 1S2IA 4ER7A 4BKRA 4HWKA 4HJXA 2X23A 5KQPA 1YDGA 2X0EA 1ODJA 3DHNA 3F47A 1I4LD 2EL9A 3JQBA 3M6MD 3QXXA 1IVNA 4FDTA 3BA1A 4KZKA 4RIFA 1NVDA 1CLEA 1A77A 1XTSA 2CVOA 1XXHB 2X7HA 4HFMA 3QV1A 3A2NA 1NBIA 4CQMD 4RSGA 4CT0A 4GGOA 1OXUA 3N2LA 4R2MA 3RFVA 3KQLA 2RGRA 2J0UB 3A9WA 4NR0A 4FB4A 4OD0A 1J2YA 1QHEA 5FTKA 4TQUS 5HGXA 3RSQA 4EI8A 3CUWA 3ZDZB 4OPMA 1YCHA 3VZBA 3WFZA 4D3ZA 5KTOA 3LAWA 3JWGA 1NC1A 3I9LA 5JVDB 4C0QC 4GO1A 4QPDA 1R6VA 3QXHA 4WKOA 2IXTA 1GWNA 3GLRA 3UQZA 3D54D 2QROA 2AOUB 3RKUA 1YUBA 2W0SA 5TLSA 2A9OA 2VF2A 5AWFC 4IUYA 4XJVA 4KP7A 4PNHA 5U1PA 3EIUA 4YHBA 5TQ2A 1ZI6A 3QEMB 2WUDA 5LU9A 3R9XB 1GNRA 3AUXA 2QXYA 3AKEA 4R81A 4X8OA 3ML1A 5EAIA 3K1AA 4ND6A 2BTOA 2IEDA 4R1OA 3P94A 4PU0A 4CIVA 5CFMA 2KM1A 3H2GA 3QFTA 3G2OA 4FYXA 4UBLA 1W76A 4G09A 4KYIB 1MRNA 3PIRA 2ZRBA 1C0KA 1W5SA 1XUOA 1NOIA 5BT9A 2ZRNA 3T1NA 3KTAB 3ETLA 3EPHA 4ZVQA 1PP4A 2H7XA 1TZMA 2Q0HA 4BHTA 3GXOA 4AIRA 5A05A 3AY0A 3U2QA 3LUCA 3I2HA 5DXAA 4HYQA 3VVMA 4OAPA 2PV7A 6PFKA 2NTNA 3K32A 2KBEA 4N3CA 3SZGA 3S6JA 2YNMD 3WQSB 1E4YA 2Y05A 3OJEA 2A3NA 4MJXA 3LUPA 1FDRA 2C2HA 2H9AA 2Z5GA 4W1SA 3H7AA 4AY4A 1P18A 1UIMA 4ZPXA 5BSGA 1KK0A 2NN3C 4EQ6B 5B1EA 2C4WA 1GL3A 1MOQA 1BCSB 1KAQA 1Q92A 3EIFA 3H2IA 4OP1A 4RL6A 4ZEXA 1YJAA 3BGOS 1HLPA 4G24A 4B85A 5JAUA 3BD9A 3CCBA 5BUCA 3QA9A 1E2EA 4PO8A 1Z8NA 3KOWA 4Q4JA 5FUYA 1KU6A 4MVJA 4KQCA 2WLSA 3GFTA 4BCCA 4ES6A 1PR4A 5I4BA 5JYDA 1C0LA 1ONSA 3WSTA 1GXSA 2OXFA 2QD1A 3LWZA 2PTGA 1E61A 3LVQE 4JQSA 1MTZA 3PCTA 1PGNA 1Z5WA 4JVNA 3LQQA 3RC9A 5IXSA 3DYIA 1HYHA 3WP0A 4EFMA 3OCYA 3HBNA 2PT5A 5D6NA 4Z2AA 3RIEA 2YHAA 3GFBA 3KQVA 4D1YA 2R1TB 5CW2A 5EL0A 3L6BA 3P32A 2QLLA 5JCJD 5HF9A 2V9PA 3AU8A 4CF5A 3FZYA 4CV1A 2XYPA 1PQPA 1FXWF 1QTQA 3TEMA 1GZ4A 5JADA 2VS1A 1YTUA 3FTQA 1GRQA 2IW3A 4FUQA 2JIBA 2FETA 4POAA 5K99A 1Q15A 5K05A 3T4EA 2A5GA 4PYNA 3ZWXA 2AK3A 2IPNA 3IBTA 4H2DA 3HY4A 3T3HA 4K6GA 1XP5A 2BD0A 2WR8A 1TKCA 3GUUA 3ET4A 4J6FA 1C9MA 1JPNA 4UXHA 5AKXA 4DEVA 3B3QA 2PLAA 4WXYB 5IDWA 1DWQA 1EX1A 1WY5A 2BFEA 2PGJA 2O9JA 5TXGA 3HV0A 1X80B 1X70A 4Q3AA 4ZCSA 1B23P 3I28A 4YRNA 4N8DA 5FWYB 1RS0A 4FS8A 1QHNA 2SHKA 4TV8A 3HJUA 4F3YA 1VE1A 1YR6A 3FNQA 4S24A 4WOKA 1H2AS 4Y2TA 1PVVA 4FCCA 3AB7A 3AM4A 4AXXA 2QXUA 1ADBA 1TFUA 1U9JA 4RANA 1QIMA 4UAUA 2JCYA 5A03A 5G1PA 1YMUA 3UMMA 1JH9A 3IVRA 3ZD6A 1D3AA 2XUJA 5JCPA 3W5VA 5KWEA 3MHTA 2H08A 4B9EA 1J2TA 1CG6A 1L0BA 1M67A 3PDIB 4R54A 4O1IA 2WNSA 5F73A 3DE1X 2ABWA 3ND9A 3TVDA 3MG9A 5BSMA 3DCIA 4L8GA 2ECOA 1E9SA 2IDJA 2L18A 5AKHA 4M9UA 4AKIA 1I7PA 3HVJA 3PRJA 1T9ZA 1SKUA 1AKMA 2RAPA 3GLKA 5ALTA 4WVLA 2QOEA 1E98A 4H35A 4MLDA 2GZHA 3U3JA 4ESHA 2EYQA 3MQFA 4AMZA 1HT0A 1U3TA 3KJIA 1LFDB 4OFWA 4X41A 3TLXA 3DZKA 2KJQA 2Y1KA 3HFJA 3NHJA 1N1MA 3G8YA 5B4TA 8ADHA 1ULAA 2VQEB 2CXSA 3STUA 2UXCB 1XRPA 2PKQP 1DBQA 2GN8A 2XA2A 3H9QA 5LP6C 3MTIA 4Q34A 1MENA 4KUEA 3UHJA 4B3RB 3JVEA 4I3GA 1D0VA 1RU3A 1VFPA 4I0WB 3SR3A 5J3JA 4CKCB 2W37A 1DE0A 3GF4A 4N9WA 3PC8A 5EA2A 3Q8XB 3DAOA 4NJOA 1MZPA 3AIIA 4D8VA 1MEEA 2XWSA 3G8AA 5EESA 2IYWA 5EG5A 1WCV1 2AC2A 3WL4A 4QAQA 3WVNA 1UC9A 4IINA 1U7ZA 4EYSA 1GTRA 3B1FA 3UAWA 1T8PA 1VJRA 1ZI8A 2B98A 2OMKA 3EMBA 4JB2A 5JS2A 3FWPA 1MOPA 2E87A 3HR7A 4OYRA 3SSNA 1XMOB 4Q1DA 2C58A 5D1HA 3VJMA 1SB9A 1I9CA 2C4KA 3OSZA 1NJ1A 1T1EA 5LKRA 5CBPB 2H4HA 3G5AA 3AR9A 4IMRA 4KE7A 1P2FA 5IVIA 3B60A 1JFFA 1NJ6A 4DPKA 1Z33A 2WHRA 5DNWA 1GG5A 3W2GA 1TJYA 4LRTB 3V3KA 2Q27A 4J0IA 3WWOA 3ROQA 1GA4A 2ZG6A 3ZOZA 5LZ8A 2DHEA 1SBNE 4TTIA 3U4CA 3GMIA 5D01A 2OXRA 2P3OA 9ATCA 2H1WA 2C0QA 1B00A 5JXHA 2Q4BA 4HAUA 3T5TA 4JI4B 1FTNA 1H9CA 5CA1F 1XZGA 3G68A 1Y42X 3IP7A 4LNAA 4YT5A 1OBCA 3BFJA 3GYBA 1IHYA 5CA0A 2GNPA 2TSYB 2GUGA 5B37A 1GZ5A 4BFVA 1YL6A 4PLGA 1QG4A 1OAKA 1D09A 2O54A 1GA1A 4BEJA 1YJXA 3GZJA 1QJ4A 3JAWB 4UNQA 3C3XA 3HP4A 1YZHA 3O8QA 4YXFA 4H1HA 4F56A 3OKAA 4INOA 4DZTA 1Y1LA 1RXCA 5C8YA 4JXZA 1CR2A 1LY1A 5FXMA 5AFSA 3E9RA 1XJ5A 4ARUA 4JBYA 5KYGA 3VYWA 1Q20A 2V7GA 3DZDA 3ID6C 4CU2A 2WKWA 1DC3A 2Z8YM 4XTCS 3W4JA 2ZXFA 3ECCA 4IZHA 4RA9B 4W5HA 1TCVA 2GCEA 1GFSA 1KH1A 4LC1A 1O6CA 3ACDA 1JKJA 3DO5A 5LJLA 3SSAA 1P9WA 4D57A 3D59A 2NXEA 1N3IA 3AERA 4G9GA 4OMUA 4Q9JA 4EVIA 3K0SA 4EL0A 3MS7A 5KJFA 2RHJA 1HRDA 2D1YA 3GJRA 2GVZC 4ZDWA 2IPAB 1YZTA 1JEJA 3WGLA 1OV4A 3O4GA 4YLGA 1FJXA 3PVCA 2ZUDA 3K8ZA 4D9NA 2HK8A 4G0ZA 2DE0X 2R4TA 3WGOA 4E31A 1FNDA 3UJ3X 5IC5A 4QTTB 4QFDA 4R1LA 1PS0A 1SHTX 2J9RA 4XA8A 3I6YA 2RCNA 3WB0A 2BCEA 2WVHA 4ZT7A 4PC6A 3V4FA 3N0TA 1FYEA 4NJEB 1OGIA 1ZG3A 1MA3A 3HDGA 1O6ZA 4KO8A 4ARSA 1JQ3A 1POXA 1XCGB 1SCNE 1UBMS 3N7TA 1AZWA 3NB0A 4YLEA 1U0HC 2KB0A 5FPKA 1F1BA 4MA5A 5E95A 5K0GA 1FS5A 1L5QA 3B1JA 3IJRA 4JN6B 4ZTBA 5MDHA 3NWJA 1NF8A 1LPBB 2L69A 4HOYA 4GX5A 3H2KA 3ORQA 2H2GA 4P35A 3ITKA 3OCZA 5CLGA 5DEIA 2VUTA 3NXSA 2H4FA 2HRZA 4NYJQ 3HO8A 3IMGA 2OWDA 2PWYA 3QLUC 3SHOA 4A6DA 1IPEA 3ZLVA 2X5NA 3GLIB 2MINB 3IIKA 2SKDA 4LI0A 4BNFA 5HUHA 4JI7B 2IXAA 4G67A 4EK9A 3OAAD 2FZLA 2OHOA 2Y71A 4A6XA 4MW7A 3AEUA 3BH0A 1KDRA 4HMPA 2BR5A 1PQYA 3B2EA 3JYHA 4FZ3A 3A1UA 4XLTA 5E3IA 3ZHCA 3KUUA 5T4FA 5IFLA 3VDRA 1QFSA 1AOXA 1FFXA 4BC1A 1OFHA 3O94A 4G4IA 1KQFA 2W4MA 1JZTA 2FGJA 2P6RA 5J5CA 4YUYA 1T1JA 3F3YA 1L7RA 4F3TA 1XMQB 4OB6A 4EW2A 1PHRA 1UZUA 2AFIE 1ZINA 1QO0D 2ZRIA 2R9VA 5AUQA 3U26A 1VYHA 1QANA 4D43A 4A0GA 1SHZA 5E9QA 2WPDD 3UW1A 1ZGJA 5GAJA 1GNSA 3QBTA 3M5CA 2I7CA 4QYSA 2XR1A 5IM5A 1VBMA 1XDDA 1OAAA 2OV2A 2ZJ3A 1GEGA 3W7BA 2MYUA 1C9KA 3P2IA 3BHJA 4TSFA 4RMGA 4UEJA 5EHNA 4KXYA 4N7RA 1QHGA 5K51A 4EZBA 4MV3A 4WK4B 1PWZA 5G3ZA 5K3AA 3UV7A 3WX0A 3RRYA 5CHYA 4EYQA 1PDOA 3TTUA 3ZDDA 4GZ3A 4MQEA 4XVQA 3QKWA 4MDFA 4FGZA 3SR4A 5CFNA 5EJGA 2XCUA 5EQDA 3FNBA 3CZ4A 4W9MC 3JR7A 1CE8B 2ZDHA 3PTLA 4HWSA 4E2FA 4EJ2A 2YYAA 4KDFA 3NV9A 4KK3A 4J94A 1NVMB 3WWDA 4I6GA 4LF7B 2WP8J 3QTTA 2XZOA 3QWIA 4XGKA 5TF0A 3O2SB 2IU6A 2EKPA 1Q7CA 1B4DA 4JLOA 2OBXA 2NSDA 4BO2A 4ZYYA 3EZNA 3F73A 4EHFA 4FDMA 2RCYA 5DM60 1AV6A 4R2JA 1I8TA 2C2ZA 3I04A 4IYRA 4LOJA 4UMEA 4BRUA 1SXGA 1W5FA 1TZBA 2GKOA 3BWCA 1H94A 2FUNB 3M83A 4PIPA 4WXEA 3ZVMA 2PUJA 4LYDA 2VXCA 3T35A 5IANA 1D07A 2BJWA 3O9MA 2IPMA 5TPWA 1GUFA 3K5WA 2YJGA 4EKEA 5JATA 1N6HA 1EG7A 3WOVA 2X8JB 1K6MA 3GL9A 3KTDA 3Q6NA 1LB1B 1NOJA 4TM7A 4DR2B 2Q6VA 5MHTA 1LQ2A 1EFRD 2OV4A 2VR1A 3ESQA 4QO7A 4BWVA 4YLYA 5KCZA 3OF3A 3AESA 2IXBA 4P0PB 3V4SA 1E5TA 2J6HA 4JODA 1P5JA 3KDSE 1YBAA 2CY0A 5TARA 2XNDA 1W9HA 3AV3A 3ZUGA 2V97A 2Z3ZA 3QM1A 5K4HA 2VBIA 5A5GA 3VTZA 2XB6A 1HEUA 5C5CA 2OPBA 2QTHA 2FPGB 2G0AA 2VEOA 3OJWA 5K0BA 3ZU4A 4JJFA 1UJ4A 3KWFA 4L8FA 1M1NA 2R6FA 3GLHA 2HLDA 3K30A 4JBHA 4MCAA 1VL1A 4X45A 4U7TB 4Z99A 2IPXA 4MP3A 3A1VA 4YUVA 3HCBA 4XW2A 4CUZA 3FW1A 4E7OA 1WULS 3MUOA 3TTTA 3WAJA 1RXSA 2Q41A 3OWXA 3VHRA 5I9LA 3KLNA 1Z75A 3CBGA 3FCXA 3FUXA 4QGSA 2XUZA 1G20A 2GERA 3I09A 4HNQA 4XGRA 4TS1A 3AJEA 4UAVA 1KGSA 4LN1A 3WKAA 4HMQA 4IXDA 3LT0A 3ZDXB 4URXR 1GL7A 3FE2A 2UZ1A 1QH0A 3MD9A 2QN3A 3P9NA 3RUIA 1DDOA 2I2FA 4MHTA 5BORA 3MMNA 3LYHA 1SWVA 1AC5A 1V1JA 2G5TA 3TOXA 3WRXC 2C57A 2O0JA 2IS4A 3REOA 3RYHB 3GRUA 3L07A 1TADA 5IZ4A 3N8NA 1LLUA 5KYWB 2BZSA 2C98A 2XA9A 3OY7A 4EAAA 3QVJA 4Z4GA 1KQOA 1TJPB 1XA0A 1PJZA 4YEDA 3VTFA 4E70A 4GQBA 4RM2A 5JS6A 4B5KA 5MFZA 3QG5A 1R10A 3CS3A 4B3MB 4NQZA 3OETA 1EP3B 4EGSA 1B6SA 3BXPA 4UCXA 2QN1A 3DDSA 3R7AA 1B14A 1E3TA 3AY3A 4MS4B 2F90A 5BVGB 4XCQA 2OY0A 1G5HA 1I01A 4D92A 2J0QA 4EGAA 4RDXA 4HNGA 5GJBA 2OHXA 4Y2JA 3WADA 3D3QA 2G7MC 4PYJA 8GPBA 3AVPA 1P4RA 4PC3A 5EKTA 2FWIA 5BUQA 3TE7A 3EYWA 4CF7A 1DAOA 4UAGA 1TMKA 1LX7A 4FFBA 3AX6A 2W6MA 4GUAA 3RS5A 2PLFA 4UM5A 3UAYA 3W6UA 1S2OA 1MVLA 2ODAA 2H16A 4MRSA 5ALHA 1JI3A 1TYDE 2R7AA 5IDVA 3RF7A 5C8DA 2XCSB 1TAGA 3LM8A 1GAWA 2E4WA 2A9FA 4KIJA 3ZIDA 2OR3A 3HBJA 4ATNA 1DQNA 1I7SB 1F3LA 1VMDA 2QW0X 3H19A 1ZN7A 1V3QE 2GJ9A 1XMJA 3R5XA 4IQ4A 3ZDCA 3ESXA 3W79A 1Z68A 3MPUA 5LXTB 3F6YA 1Q3HA 4MV7A 5I3ZA 1P1CA 1DRJA 1PGJA 4KQXA 4JOSA 1DJOA 2ATCA 1MMFB 4MRNA 3SX0A 2XYGA 5AM2A 1EESA 1LF5A 4HVLA 1XL0A 4IHKA 3ZW8A 1E69A 4DJ5X 1ZC3A 5F33A 3LG2A 1RLJA 3EVBA 3JZDA 4R7ZA 1WKCA 3NC0C 1GAQA 4EG6A 4KNYA 1FVXA 4NDZA 3FNRA 2BKUA 5DBGA 5LQCA 3ROGA 3PD0A 3VR5D 16PKA 3QLTA 3PLRA 4HAWA 3IULA 4R8VA 1IDN1 2C1XA 3OOYA 5AKZA 4BU1A 2OG1A 3KAKA 4LJAA 3MTGA 3RJ9A 3EWSA 4I6JA 4C4RA 1R0ZA 1AXEA 2OLEA 4QBIA 2OM2A 3BORA 4EHAA 2CCJA 2Q45A 1ESZA 3QPUA 4H7JA 3LDUA 5BNTA 4MW0A 1VKHA 721PA 1R6XA 2Q0SA 3QTLA 4PHGA 3V1TC 3IUPA 3UJHA 4FC7A 1E18A 3BWVA 4ZOQI 3SP1A 2WG2A 3MYRA 4ZQGA 1U0OC 2CFSA 1KYQA 3H1GA 4IWNA 1WW2A 4I9FA 2EFEB 1N0WA 4PZCA 3T9AA 4ERXA 3Q5DA 3U1BA 3FTFA 1KEPA 2XIJA 1S7GA 3MTBA 3NJ4A 4URFA 4L9AA 3PRYA 4ZC1A 3S1AA 4WNAA 4F04A 3Q5GA 2F43B 2NUBA 1DELA 4LVOA 3K94A 3RIGA 4B48A 3KHKA 4PPYA 6AT1A 2X5JO 5SZIA 3ABQB 2X9LA 3UJ8A 1PR0A 2X22A 3H42B 1HE3A 3I45A 4FNGA 4H4DA 4AFNA 3HWWA 3OZEA 4DG8A 5IK2D 1SKAA 4TTVA 2AYYA 3EUFA 5BUSA 5DGHA 3GDGA 2OHIA 4C1BA 3U9TA 1TZCA 5BN5B 5GZ3A 3E22A 1MABB 3HJHA 1CQWA 4N40A 5CLHA 1RYFA 1GSHA 5BQFA 5DBOA 1LH0A 2ID4A 5C8YF 2FLKA 4XI9A 2Y1FA 4GZMA 4RH1A 4G1BA 1LNZA 5KNCD 2LD4A 1NBAA 2OZLA 1SUPA 4GI2A 4H3KB 2ZZNA 5JEEA 2RB5A 3RC1A 1P6UA 4B2YA 1A9XB 4G0PA 4MLCA 1G20E 2MT9A 2PH3A 3CMCO 4FFNA 2LIVA 1YDMA 2I7DA 2WAXA 4FUTA 3TQTA 4R83A 4B6RA 5CFOA 1DCTA 4K2HA 3BN3A 2H2IA 3NM6B 2Q7OE 4B4KA 4KMOA 3GJ8A 5GJVC 3GNTA 4EP1A 1IXKA 3N8GA 1QQAA 3KSAC 2J0SA 1YI8A 3PFKA 4ND2A 4AULA 3KEOA 5CM8B 2QN2A 4OXRA 1SBQA 2JHFA 2AV6A 1ORWA 4CKXA 5IJWA 4DLPA 1YWGO 2AFIB 5JWHA 5LQNA 4DA4A 5KNDH 5KQGA 1U3UA 1G291 3ANSA 4JEMA 3O0DA 1ZM3A 2HPVA 1KEWA 1KVRA 1VL0A 1QGOA 1ARZA 1G0NA 3N0WA 4JENA 3WA6A 4ENWA 1QUEA 1ZA1A 4OTZA 3MGKA 4Q37A 1E3DA 3TGPA 1Z16A 1T1RA 3C6MA 2VF7A 1MTOA 1GQQA 2FLVA 4ZJPA 3B9PA 1HQYE 3DVRX 3GLGA 3EXFA 3QEBZ 4A0SA 1A69A 4NI5A 1Z07A 4FVTA 4EVSA 3SZLA 3TSYA 4BMNA 3EFBA 2FLWA 1M0WA 1D03A 1E6EA 5DFAA 4CF3A 4YCMA 4FFPA 4DRYA 1F4LA 4IFBA 2GEKA 3DVLA 2WY2D 2G1AA 4DZZA 1VECA 4ZJYA 5C4IA 3M9LA 3K9GA 2JGIA 1EJ0A 3S68A 1DX4A 3VZSA 3ZYCA 1YGYA 1NAIA 1I0IA 1KH2A 1RD4A 2YC2C 3RT9A 1NLZA 3GVXA 1L4KA 2WVAA 2M6KA 4AJ4A 1WXFA 1K7YA 1KYVA 1Q7BA 2VP2A 1GD1O 1ZLYA 1B3BA 1MIOB 3R6WA 4GR9A 4HGYA 4UD2A 3PTAA 3HDJA 3PBKA 1KYYA 1ZNWA 4ZKEA 4KPFC 3IKVA 3CX4A 421PA 2EVWX 2PGXA 1TLLA 2GXUA 1SKYE 4TOIA 3AR5A 3OWHA 3SSMA 2RGBA 4IG4A 1E7SA 2ZJBA 3SQMA 1J33A 2D4AA 3HXKA 3OC6A 1A2BA 1XTIA 1M76A 2PLRA 3FVQA 3H2JA 4OMDA 3USZA 3Q72A 4QTUB 4DM4A 4E1BA 4B8ZA 2Y76A 3AOEC 5CB0A 1SCUB 2B69A 1MLDA 3AIMA 3EIQA 5HQ3B 1CUGA 1HG0A 3R2JA 4PTYA 5HE8A 1X8LA 1AKNA 3ROFA 4U6NA 3T52A 5L3SA 3FX2A 2XWJI 1DAFA 1XZ8A 2FPGA 3ZV6A 1VLHA 4G4SP 2BP7B 1JHOA 1FUYB 3E53A 4QJ4A 1IN4A 3MJFA 1ZY2A 3K70C 2ODQA 3WYAA 2Q9BA 3NHZA 4EA6A 2H0QA 3B12A 3EGVA 3LO5A 5CFRA 3U7GA 2PFKA 2PN1A 5KHAA 5J4LA 1GPNA 1LVUA 1PR9A 2XMZA 3PQEA 4QXPA 4ZRNA 2AJCA 3T4PA 3TQSA 5HZHA 1KEVA 3U3OA 1FFBA 3ZWWA 5SYAA 2DH6A 2Y9PB 1ODSA 4QDOA 3UUWA 3EGXA 3DMFA 2A9PA 2I6UA 1JG3A 3W9SA 1K88A 2YRFA 2ZAIA 5IDQA 1H4TA 3LS2A 2GUWA 2H6EA 4TWZA 4C05A 2P27A 3CWZA 3DOIA 3LUDA 5AW6A 2H31A 4RU1A 4XJSA 4HCJA 1JDSA 2XD9A 2WJJA 4DSAA 3IPYA 3KZNA 2CNKA 3P9KA 3PGJA 4Q03A 2Y67A 2DJIA 2Q9UA 1FX0B 3LK6A 1SUSA 1J4AA 3E7PA 4OXQA 5A7HA 5I9IA 4TRJA 1ZO8A 2XQVA 1W9MA 2Q4RA 3R9IA 3SZOA 3MCZA 4G4SO 3BUSA 4BLPA 1LNQA 4OJNA 1GTMA 3A4YA 2CHEA 2R751 1DCMA 4UU1A 4U6QA 3G1TA 1P0FA 2Q1YA 5AOVA 2QTWB 1K7CA 3U0BA 3EMDA 3AHJA 3MRVA 3QIAA 1TU3A 2WD9A 3GVHA 3V34A 3VO2A 4JY7A 5BRAA 4UUQA 4GOXA 2QTGA 1KSJA 3I2YX 4OHRA 4X92A 4F46A 5AVRA 1F48A 1Q3TA 1UK8A 5LQJA 5SZKB 3LKBA 1DKPA 4CCYB 2B8EA 4M7RA 4EUKA 1QIIA 1GLNA 1FFYA 1Q1BA 1AX9A 4RHCA 1NIPA 3COWA 4K9OA 3RVBA 3T3DA 1VM6A 4B3TB 1XVLA 1R5NA 3ZCRA 4E08A 4IGIA 4PAOA 2WK1A 3CZ5A 3H1AA 5DGCA 2K87A 2P65A 3DBOB 4A3SA 4TLAA 3WGGA 4RXMA 1V5GA 1R6DA 4Q48A 4LZJA 1EINA 4Z86A 4QPZA 5TT1A 4Z1MD 4GOLD 3GT0A 1I7LA 2PSDA 1YR7A 4R71A 2RG1A 1IXZA 1G17A 3I9KA 4UHDA 3HCOA 5C35A 1NX6A 3ZIAA 5K8VA 5JIBA 1EA5A 2WJYA 5K2OA 1RADA 3ICCA 3VR5H 1JIIA 4MXDA 4RORA 1IN8A 3EY4A 4O4JB 2IIPA 4CLRA 1K27A 1ZUNB 1E2FA 2FFRA 1ISSA 3K9NA 2Q8PA 4DIUA 2WF5A 4L8LA 4PAMA 1AGYA 3QFSA 3AINA 3FCCA 5CTAA 4Q21A 1U3DA 4MDHA 3TSAA 1YO6A 1KHTA 2DT5A 5CT5A 1XZBA 2WZBA 2ZJ2A 3C3PA 4RK4A 1YF3A 3R09A 4GYYA 1HE8B 2QVXX 3AGPA 2FN8A 2NO6A 1C8KA 3OIGA 3WB1A 1JQLB 2Z58A 1SJ9A 4AS2A 3FI9A 4B4VA 2LR0A 2XB8A 1OX5A 2YW9A 3B3GA 4ZVOA 3L79A 3WV4A 3PEFA 3F74A 4J3NA 1DOZA 2R8BA 3W6OA 2IBSA 3N75A 5CYPA 1P2BA 4RMNA 2BSQA 3WE7A 1I4WA 3GELA 3IMCA 4RFVA 4URHA 4V1CI 5IT0A 3EEIA 2NSLA 3FTNA 1F7UA 3UMFA 2D2EA 3CWQA 2WQZA 4M7PA 1G21B 2ZRHA 2ZYVX 3Q9NA 5JXWA 1FLNA 5J2TF 1ZPDA 1LLDA 2WUWE 3WMFA 3NBFA 4BQRA 4Y2XA 1ML3A 2OSBA 3RPEA 4GVXA 3RVJA 1OPXA 2NVUA 4OP3A 1OLUA 2KI5A 2G04A 4S1PA 3RYFB 4ADSG 3HDTA 4FFWA 5JAIA 4KQWA 5DYWA 2YKGA 3A9CA 1FB5A 4I50A 1XTUA 5CNKA 3PFGA 3EIHA 4TXMA 4N8SA 1JQ5A 3PEWA 2OXEA 4MRMA 3A1DA 5EN4A 2X2FA 1QLHA 3F5SA 3KFLA 5D3KA 3R24A 3U7QB 5BP7A 1YZ3A 2ST1A 3I8SA 1IEVA 4WFQA 3T7CA 4EHKA 4LK2A 4E5YA 1SURA 1REQA 2GBLC 3FHLA 5T8KA 1H8ED 1SFRA 5JZVA 3TUZC 1ZEMA 3LVFO 4BYGA 1YE3A 1ZYUA 2R25B 3BQMB 2IUFA 2Z08A 4KYUA 3MAJA 4RF4A 4P6VF 3OTIA 4HATA 3O9VA 3LNTA 6LDHA 3RADC 1IWBB 1DBPA 1QGUA 1Z26A 1HUQA 1K2WA 4FFVA 4US1R 1YUMA 5G4LA 4RTSA 2QW1A 2Y3IA 2ZJOA 3JWHA 2TMKA 1FS6A 3AY6A 3DE6X 3KS9A 4BFUA 3FIJA 3IJEB 1YMQA 2HQSA 4XVRA 1RSZA 3DCYA 3HZZA 2DBRA 1YZQA 3P0FA 4BQOA 3KZ1E 4ITUA 4IY1A 4LIPD 2OHJA 4JL8A 4N9QA 2CDNA 3NHUA 3ZS9A 2JJ8A 5AQEA 2V6GA 2GD2A 5B7NA 5JI3E 1U0GA 1CK4A 1V96A 3N2KA 4BVFA 3EODA 1U99A 2PRIA 2ID7A 3KQYA 1UCFA 2FPPA 3NRJA 7MDHA 1BCRB 1CERA 2JH8A 2Q7XA 1NF9A 4KQEA 1JG7A 4LISA 5IYZF 3UC5A 1LRKA 1ISJA 2AI2A 3WYCA 2D3TA 2W43A 2HJ9A 4D26A 1H2WA 3LUKA 3E48A 5EP4A 6YASA 1SUAA 2J08A 1RRPA 4CI9A 3FCSB 1SC6A 3L06A 1YL5A 4FKBA 4BNVA 4F2HA 3AEZA 3VH4A 3LLUA 1LSOA 3VMMA 3IQDB 2YWRA 1PTJC 1PKEA 4N39A 4QUGA 3UKOA 3T3EA 3GCZA 1HTBA 2V59A 4KGDA 5CLQA 2ZROA 4K9RA 2GWRA 2E4XA 4DF3A 1WD7A 3BJIC 3L18A 1VIYA 2BDTA 3H8WA 4US2R 1M33A 1KSHA 3Q4GA 4NBRA 3OU2A 1L1RA 3AR2A 3DMYA 3Q8MA 2D0IA 5JYCA 5LZ7A 2PGLA 1UPUA 4DDHA 1IZZA 1K97A 2GSWA 4PONA 2C03A 2QP4A 4RY0A 5C1BA 2IF2A 5AW4A 3LLSA 3EZ6A 4IQGA 2YNMC 3S99A 1OVGA 5KTKA 5HFJA 5C2JB 5K8IA 1KI2A 2PCJA 4UREA 1QM5A 4HXGA 3RFUA 2J9XB 5HK9A 2FSPA 3NG1A 3RKRA 5GOZA 1KH3A 4NE2A 3V4PB 4Y2VA 4D3SA 5DWDA 4JD5A 4EECA 4Z8YA 2EATA 1FF9A 3L46A 4HDRB 1H1LB 2UYYA 2HW8A 3JRXA 5ECYA 1V8PA 3PQ6A 3HLKA 4Q6BA 4RXUA 4Y8VA 3KJFA 3NPMA 4PRLA 3HB4X 2KLHA 4QULA 5GPBA 3ND6A 1WDWB 5JD6A 5AW2A 3DFMA 1GTZA 3WIVA 2YHUA 2YQ4A 5FP0A 3ZD8A 1H6AA 1ZM2A 3P9YA 2BBOA 4II3A 5BQPA 4RCZA 5IT4A 4Q3OA 1F0KA 1D4AA 4QUDA 3K5HA 4N0EA 5CCDA 3O47A 4MV6A 4OA8A 2RSLA 3DMTC 3PC2A 3CXRA 5CG1A 1FDUA 1XZQA 4WY8A 2QS9A 1WSAA 1NE7A 1AKRA 4UVEA 3FIUA 3SSOA 1VPEA 4AJLA 1RM4A 1PX2A 2BDEA 2HLPA 2P6OA 4IZIA 1U0NA 3PHCA 1UFQA 3FWKA 3U49A 4IAOA 2MJLA 1OWNA 1YS9A 4OJTA 5AKGA 5KJ1A 2B8WA 1PR6A 2Z98A 2ISCA 2JS7A 5COAA 5AVSA 1XD8A 3OQ1A 3H2HA 4CFZA 2ZT7A 1BFDA 1OLXA 2XB9A 3KTOA 5E7QA 3EC2A 2EBUA 1N2XA 3L6DA 4GSLA 2QE7A 1X80A 5JWOA 2OCBA 3FYTA 3Q40A 3TOZA 4ZN6A 1HNNA 1FTQA 2R6GA 1J0DA 4H18A 3BH6A 2YWCA 4EPRA 4S1VA 2F3RA 1B8UA 5KNCH 1Q74A 5FPSA 1JPJA 3UNXA 2AVDA 4BVHA 3D6JA 1RTKA 3IT3A 5EYPB 1NXPA 4A4DA 3T9BA 3DZ8A 3IS3A 3W2TA 3W1WA 2E2WA 1B43A 4Q9AA 5IP5A 5CAEB 4BEWA 2B30A 4Q7QA 4Z3OA 3OCXA 1VGVA 2XTNA 2YIMA 4PTLA 4G56A 3P0EA 5FEMA 3FI0A 3QGMA 3WNVA 1ZN8A 3UFBA 1PJ3A 4AUMA 3AJAA 5DM1A 3OPYI 1EDDA 1M8KA 2C42A 2XRMA 1DV2A 1LPMA 3KT6A 4NV3A 2HJWA 5BSTA 5DF1A 4UCQA 1TKBA 2C4NA 3CEHA 3LVBA 3VH1A 4JUCA 4HNUA 2NG1A 1EP9A 2B2CA 2CK3A 3DXYA 2NTJA 4L4UA 1Z25A 1SHUX 4ARZA 4ED9A 1U63A 2QRKA 3HSKA 3V6LA 2CKDA 3EIWA 5C34B 5JZBA 4GRAA 1RRVA 2Z57A 4K05A 1HE1C 1UKAA 1YS2X 4CM8A 2JDID 3OTHA 4MGZR 4F45A 1PBNA 5FBZA 1LKZA 1E2NA 1YVDA 2Z9DA 3NU1A 3ZX5A 1UMCA 2I4OA 1LDNA 1D2RA 1GTVA 3GJ5A 2GRAA 3BE6A 1EK6A 1Z56C 1WO8A 2B82A 4CMIA 4ZMSA 1KTIA 5HF5A 3R0XA 3PUKA 3DUWA 1XMPA 4DMHA 1J20A 4C04A 3W2HA 1L7PA 3MCAA 2VZ9A 4MVCA 1P4AA 1QFYA 4Y9DA 4Z0HO 1J2RA 2D4HA 2GZDA 4LJ4A 5CA1B 1PT6A 4XM0A 3S2GA 2WWWA 5E4FA 5JUWA 1GADO 1SC3A 5KWJA 3R20A 1F9EA 1O3YA 2P77A 2PMBA 2VA9A 3CPHA 3UAVA 4Z8XA 5AOBA 1XA3A 2WWFA 3WQRA 4NMWA 4RPIA 4OQPA 2DUMA 4Q4HA 3WIOA 2WTUA 4G1MB 5F3RA 1Q2XA 2EDCA 2VDWA 4LZZA 3COSA 4RPCA 4B09A 2ERYA 1GTG1 1PFVA 3DP9A 4L5BA 1OXTA 4V0SA 2VA8A 3WLJA 2DUUA 3T5AA 4BY9E 1NW5A 5E9WA 1G4HA 1CVIA 2JGEA 3OOHA 4MYSA 2QAGC 4MVJP 1BQ4A 3C6QA 2HR1A 2OQIA 4WY5A 2DSTA 2OK8A 2JRLA 2W2KA 1EIZA 4TYQA 2J09A 2NQ2C 4BC0A 3L8MA 5KYYA 1PZFA 2Z8ZA 4WL0A 1GZDA 5C80A 4TGLA 2XBLA 1VMKA 4FN4A 4BS9A 1GRVA 1W2WB 2VCEA 5JHGB 3IPLA 1ENYA 2B7LA 4DBVO 4MWCA 2A5DA 3WV5A 3D3WB 3TNYA 4X94A 1XCOA 4A10A 2PX0A 4JSRA 1U8TA 1HDZA 3QLUA 3PPYA 3CPJB 4MIYA 4F96A 1XJQA 5C8XA 2QAJA 2Q6IA 2O7QA 3LPCA 3MC1A 3ZI7A 1BYUA 4NZMA 4R6WA 3OH8A 3ELUA 1PD0A 3OQIA 3A1NA 5DSXA 3AIOA 3D3JA 4B40A 3NX4A 1FTGA 2BI4A 3UK0A 4R68A 1ZVQA 4D41A 4DQ0A 2HA2A 3S0JA 4RVUA 4RPGA 3U7JA 2DPHA 2CHQA 1RXEA 3B6EA 1P33A 4MV0A 4LMBA 2KQUA 2AFIA 3FHTA 1E3WA 4DCPA 4QIHA 2AZXA 3JQGA 1DIRA 1MT0A 1N2IA 1B1CA 2D13A 3MT7A 2PQMA 2C83A 3CWCA 3DULA 4C87A 5CEFA 3NPAA 1NURA 3RTBA 4H27A 2GA8A 4BXOA 2F1HA 4DDMA 4OQNA 4NS4A 4WOCA 5AVQA 2BEVB 4UZSA 3TXXA 2FW1A 3T61A 4RVOA 1U8FO 2WIAA 1IM2A 1U7HA 1FMCA 2A9KA 2NYRA 1LZLA 3FTDA 1Z2DA 3I3SR 2WG1A 2OCAA 4HZUB 4RE5A 3DTVD 4DUZB 3RV3A 1CUHA 1U0SY 1Y82A 5FNZA 5AW7A 4MHOA 4RNDB 4XYBA 1KI4A 5EIBC 3LJKA 1H2BA 1NW4A 4YJFB 5A6VA 1V8DA 4AY2A 2DHCA 3FYHA 3OZRA 1ZGAA 3RT1A 4B75A 1CQJB 2DHDA 1X39A 1CZNA 3GV0A 1JSLA 1A1SA 3PPXA 2P5YA 1XC7A 5CHEA 2A2ZA 5FBLB 4KDEA 4TYYA 2C2KA 1RYHA 2NU7A 1XN1A 4JOCA 5E7MA 3AT1A 2GJ4A 3VBCA 4OKSA 2BFOA 4HGNA 5G1OA 5ILOA 1WPGA 2BP7A 4LJSA 1OHHA 4UM9D 3BXOA 4WEOA 2ODTX 5BOSA 1MH9A 1SXJB 1TM4E 2D7CA 2CFIA 2IE0A 4YH1A 4DARA 3OZTA 1E0KA 2X2PA 1XZCA 3SEZA 1SBTA 2XBMA 5I7OA 5EIFA 1W8DA 4X3OA 2FE1A 1KYZA 1WNTA 4RAQA 4DAOA 3FY4A 1FVHA 2Z5LA 2BFCB 4MR9B 3TFWA 3QZUA 2OXTA 1M1XB 3VPXA 3OEEA 1U3FA 3HWRA 2RB4A 4MAAA 3T3MB 2J1LA 1TU0A 1LDYA 5FORA 4D9EA 5LQAA 4DRZA 2I2CA 4R2HA 1DUVG 2JI7A 3AFNA 5JCZA 1YGPA 2DUWA 3IR5A 1EMDA 2A5FA 3QYPA 5L9AA 5BWMA 4KW7A 1SHJA 4HQOA 1XDSA 3SLRA 1YBHA 3IMKA 4HL6A 5CDTA 1J8DA 2FPRA 1E60A 2M98A 3JTEA 5CA1A 2D0OB 5KQLA 1Z4MA 4MYDA 2IX9A 4BU0A 5HPYB 4QECA 5JYBA 3HO1A 3ZG6A 1T6NA 4PPQA 3UMRA 4HTFB 5EQJB 4YN3A 4RETA 3H5LA 4WFJA 5B6IA 1FLDA 4YJ2A 1VRVA 3DXZA 3FMIA 3CU5A 4NOJA 3DBLA 4ROSA 2Z6QA 4Z4EA 5FQOA 4GL2A 3QOWA 5CDSA 3JQAD 2JA2A 2PA3A 5AVUA 4OSEA 2PR7A 4KACA 1I0LA 5L8VA 4MPJA 1ZW1A 3JZFA 2FN9A 4KZPA 3RAGA 1QCZA 5HGJA 1PEAA 3FA2A 1NBMD 5DYGA 4P92A 4CM3A 5JDIC 3FPJA 1VE9A 1FSFA 2PQ6A 3QY9A 3T7DA 1PHPA 4RJJA 3FYSA 3GMTA 3I8OA 2VBGA 2C5AA 2ZVQX 4EGJA 1XHFA 3KOZA 3OIVA 4NFSA 5B1HA 5ISMA 3DEKA 4FHFA 5DW0A 1SN7A 2OBYA 4D9JA 3LQKA 1AMUA 1QE3A 4MKRA 4Y2QA 3BK7A 5JJLA 4JC0A 2J9FB 2DB3A 2E5WA 2I3GA 1IK6A 3G79A 5ELLA 5LOVF 3BGWA 3G9XA 2FUKA 2XMBA 3KQSA 4UXIA 2V6IA 3OE5A 4ZVMA 5B2ZA 1OFIA 4U8HA 3DEJA 4D8WA 5LZ9A 2O2HA 2UVPA 4Q1AA 4IRXA 3SWWA 2HL6A 4TLBA 3L1UA 1V1MA 3NZEA 3WOHA 5EHXA 4LECA 1SKBA 1I3CA 3PDWA 1PEYA 4H08A 4CRWB 4P31A 5LNK1 1FSZA 4A82A 3WDKA 2DR2A 3CHYA 3WDLA 4J03A 3AQIA 3PNLA 5IU6A 1DJQA 1IONA 3T3NA 2PMWB 1B74A 4UTXA 4MITA 2RGXA 4Y98A 5TY0A 3K4PA 4JVLA 4WBNF 1VIVA 2AHRA 1C30B 1FTWA 1MV5A 4HNSA 5L4SA 3O3OB 5I7EA 1TZKA 3HJBA 3DFUA 1Q0RA 4ICIA 4JI6B 2Z2JA 1GFZA 3RQSA 2VUIB 2IV7A 2FGKA 3PQDA 4YJKA 3L8GA 4XLZA 1OQAA 2ES4A 1C9EA 4KLZA 1MC1A 3I1IA 1EB9A 2J30A 3HKCB 4QXRA 4DUGA 2R86A 1NQAO 3FPHA 1CW2B 3Q6MA 5JBQA 2FKAA 1CR1A 3GGOA 4C07A 2J5RA 3STTA 1T2AA 1ZCFA 1ZCZA 1JSRA 1NNUA 2QJWA 1J90A 2CNWD 1G7RA 3EY9A 3LBAA 1N32B 5EIBD 2EJTA 4G5GA 1KZHA 2WB4A 4A8JC 3IRVA 4TMTA 4XRGA 3PX2A 4YI5A 2VK1A 5IAKA 3V9PA 2UXDB 3OQJA 1K3UB 5IC6A 2LV8A 4CNBA 4RTKA 3VOAA 3EVCA 1Y8AA 1T35A 4HG2A 3NHWA 1RP1A 1X13A 4IS2A 2VL7A 3L1VA 4ZCQA 5SICE 4NCAA 4UQPA 2Q07A 3I2FA 1AXGA 1IBCA 1TA0A 2HKIA 2Q4DA 3KHSA 2YS7A 2YUTA 2EQBA 3HACA 3DAYA 4HX2A 4LJRA 2HFJA 1JZQA 2PPLA 4LRXA 3LPNA 5TGZA 4F8JA 4OQYA 2H7VA 3L5OA 1P5HA 4LHEA 2AMFA 4MVJG 1F3OA 1XTTA 1QE0A 1OIVA 2PUHA 1N1DA 4GSYA 4QJ5A 3KBBA 4UDOA 2QRHA 4DE5A 2WB2A 3EISA 4ZVKA 5KU7A 1N2HA 4ETMA 1WXHA 2I6TA 4RZIA 1AUPA 2HK9A 3UEOA 1DQSA 1URPA 5LZ5A 1WXGA 3V7NA 2FEPA 5JS1A 2ZSJA 2BN4A 2VSOA 4IDOA 1BO6A 2Y9MB 3DAGA 3VFDA 2FW9A 2N3ZA 1GGVA 1II8B 2A35A 3R5SA 3R6GA 4TZKA 4XB2A 1SR8A 1UPTA 3DPUA 3MWKA 3RSCA 3S2ZA 4E6PA 3B1VA 2OHVA 3VR2A 3UGJA 1FK8A 3UYLA 2H4ZA 2KS6A 3TOSA 4EUSA 4OX9B 2QG6A 1I10A 3A9RA 2EP8A 4GR4A 4ZKDA 1BGVA 2FMFA 1E9CA 3EZ9A 5FLKA 5T67A 5AMXA 1TL7C 5P8WA 3VR5A 5KVSA 2P2GA 3L7DA 3CEAA 4FYVA 4ZAWA 4YRFA 4FMBB 5J40A 1CF4A 2HRDA 3OA2A 3FYUB 1GL9B 2CXXA 2IZOA 3A14A 3N8HA 5U4QA 2X9VA 3RC3A 1IXRC 3HJNA 1SC4A 3Q7QA 4GP9A 4R8KA 3SM9A 3N8IA 4DUGD 4YGYA 1RTTA 3T0IA 2PT7A 2FWPA 4UULA 2J59A 4LCBA 1SELA 2RAUA 3F78A 3TS1A 3ZGVA 1EXMA 2B3TA 4HDSB 3A2KA 2FZKA 1CUBA 5IABA 5A7FA 1SHLA 2PSJA 2VG8A 3FLEA 4EYOA 5JFTA 5KX5A 4QHTA 3GP5A 2H2HA 5EJ7A 3L77A 3IT1A 5BWBA 1RWWA 1Z6QA 1AB6A 1XN4A 1TFRA 3VTKA 3GBPA 2BFMA 2NSHA 2ZR8A 3RVMA 2VCYA 2P0EA 3LGAA 1Y3IA 4HS9A 2BFAA 2DECA 4MI1A 3BGDA 4FI3C 2AJLI 3E82A 1VPLA 3HVUA 1YVEI 2XZPA 2HH9A 2FQWA 1IB6A 1Y8QB 2WZCA 3RVKA 4G6ZA 1GNQA 1Y7LA 4BMOB 3EAQA 2J9GA 4FXOA 4YCJA 2CL6X 1B16A 4QATA 3FVRA 3SQOA 1ISHA 4XVUA 1FXUA 2OZVA 4LBWA 2R6HA 1JZSA 2MSEB 3IDSA 1KA9H 1NTRA 3PGVA 1JHAA 4OP2A 3FMPB 5AOCA 1J22A 4AL4A 4BASA 4EMTA 7REQB 2FQQA 1NPDA 3FDZA 1NNI1 1NI4B 3MJHA 4LE2A 1C7QA 1ZP6A 2NZJA 5GIPE 3GQVA 1BS9A 4I2NA 2G5PA 3QELB 5FBHA 1CRZA 4MRMB 2GDZA 1B26A 1KVUA 1QV6A 3FR7A 5FPHA 5B58T 3L40A 4PWZA 3LPDA 3MM4A 3PFCA 4RQTA 2QQFA 4BVKA 1XU4A 4X44A 2JZOA 1J25A 2HWKA 5DNCA 2V03A 3RTCA 3MMSA 4E94A 3FUVA 3U1TA 4EJMA 3N2GB 2AZTA 3T38A 4UBKA 2GPJA 4YB8A 5FD8A 4HFJA 1N34B 3V8EA 1BOOA 2R6R1 3WLMA 2IKQA 4A5OA 1LS1A 1U5BB 1TTQB 5DI3B 1T9DA 4YY3B 3K7EA 1Q6YA 3SC4A 4G5HA 1US8A 3ROXA 3UF0A 3CH7A 3ND8A 2ZI5A 2C4MA 5F4ZA 4C4OA 2EFCB 2HREA 5JXGA 2VAWA 2PJZA 1GPUA 1R0YA 3MA0A 4OI2A 4DB4A 4FLEA 4QJ3A 2OV6A 3KR0A 5JLAA 1GSAA 3PK0A 4PSKA 4E5PA 3BIOA 3WGIA 4B4WA 1S7CA 1RJ9A 1YIAA 3GHHA 3VU9B 4JSTA 4PWYA 2GZ1A 1O4VA 2DPLA 2PAFA 1S8NA 4NESA 5TPWB 5LYYA 1V11B 2CUTA 2O6HA 5EWJA 2Y77A 1NUUA 4XIGS 3L04A 3C7DB 4RJTA 4DSOA 3GAMA 3UGTA 1EXNA 1OR8A 1T0BA 3H65A 2AIRA 4FKZA 4QFBA 3ZIUA 3I3OA 2UZ3A 1HT1E 4YRAA 4IW3B 3GLFE 2W8ZA 3TSWA 3MWGA 3U7FB 2C94A 4CG0A 4RENA 4OBEA 4BLSA 2JGNA 2I8LA 4I3FA 3SR0A 2A6PA 3L8HA 4YAGA 3TL3A 3G0BA 1MX9A 1OHHD 5DK4A 4OHWA 4XQEA 4KMRA 5EPOA 2JEOA 5LQDA 4LGVA 2JGAA 1JDNA 5ITSA 3VPSA 2GEFA 3G85A 2CL0X 4KIUA 3P97A 2ZQYA 4PGAA 1ESMA 3KIPA 5ER6A 4MQEB 3F8WA 4AVYA 5THQA 4WZ6A 1UFOA 3GLQA 4IIEA 1D6SA 1G9SA 1OTYA 1T6XA 2GM9A 4LUCA 4XIIA 3LSYA 3SHVA 1A5AB 4M9SA 1NXOA 4WMLA 5BVHB 5KINB 2H63A 3U6KA 2P2DA 2GH1A 3H05A 1QYXA 3V1YA 3FR8A 1U02A 1GVHA 4XX0A 3CF0A 2DLNA 3I42A 4GDFA 3U7EB 2H2DA 4TWAA 3VV2A 5EE9A 1J1ZA 3ZWYA 3OBBA 2D2FA 1VL8A 1GUAA 3N07A 4ENVA 3AFGA 4EKGA 1MX1A 3WK6A 4IH1A 1FW6A 221PA 2JFZA 2AN3A 2PH7A 3DKRA 1JFLA 1M83A 4J1QA 3O93A 3U3ZA 5DBFA 2B5VA 4EJFA 1B73A 4FK8A 2F1KA 3EMKA 4E46A 2CMDA 5BSKA 2P6NA 4PX9A 3NDBB 4REOA 5CB6A 4BKUA 4O3MA 2Q3FA 4A36A 5FL7A 1XNQB 4QT0A 4Y1RB 1XQ9A 5KHLB 4CU5A 2R11A 3DE3X 2WYIA 3SZ3A 3KUDA 1YC5A 2YBEA 3FJYA 3ACBA 5DTJA 5BO5A 3RK1A 3BMXA 3W6PA 1PL6A 3EWIA 3DLHA 5T7BA 4MUKA 1T2UA 3NHYA 5B6JA 4KTTE 3GU3A 1QHSA 4MQFB 3FUTA 1PZNA 1BDHA 1EYZA 4L0MA 3HYTA 2Q9CA 1LGYA 3QKSA 1E0AA 1S1CA 2VZLA 3EEQA 2Q28A 4F6RA 1G8PA 1R8XA 4GX2A 4KO2S 1YI0A 4RLFA 2AJTA 1S1MA 4L8WB 3LT5A 5J43A 2YOFA 4KQ1A 4UC0A 4ERNA 3K6JA 3CM0A 2WVJA 4NK4A 3FYCA 4GLJA 5SZHB 2O8VA 1YZLA 5E9JA 2O8CB 3EJ6A 4AF8A 5KNLA 1YB7A 5DRYA 1AJEA 2JAPA 3UWMA 3DVAB 3CBQA 4IJKA 4JP1A 3FCAA 2JANA 2DUNA 3TRHA 1DIHA 3K09A 3P20A 5A2QA 1NPYA 3RE1A 2AF3C 3PFBA 4E1AA 4WCFC 3BKXA 1RABA 3ABOB 3HL0A 4L8YA 4U7PB 4XJXA 8AT1A 5K3CA 1VB3A 5DN9A 2V7XA 3W5UA 1SIBE 1SCQA 1W30A 2VNSA 4N3AA 4Q82A 2IY7A 2QDXA 1Z7BA 1Q22A 3EASA 1ZSYA 2ZI7A 4YUXA 5FHQA 1PGQA 3TTSA 3L01A 5KBYA 3MF4A 4EF4A 5H1YA 4LRWA 1SH7A 5C5EA 4OG2A 4Z0PA 2EWVA 4QUAA 4MPDA 4UTRA 5EHQA 3FZGA 4CPDA 5H80A 1AGXA 1ATIA 3AP2A 3I4CA 1Z6XA 4HNAB 2H11A 3BTUA 2A1TS 3MEQA 3Q7PA 3RUEA 2DLDA 4PFSA 4UNIA 1SUWA 4FB5A 5L3ZA 3A1CA 1JIVA 4HR7A 3KK0A 4DQDA 3LTNC 4FJ1A 3RAJA 3IA2A 3O3CA 4I3HA 1NRJB 2NUPA 4GRDA 4BO4A 5ARCA 3OU6A 3F6EX 4LRYA 4M1TA 3RFCA 3ZKAA 5EUCA 4A6PA 5A4AA 2WE7A 3C5HA 4QVIA 5FA8A 1V43A 4HUQA 2J3KA 4RD3A 2W48A 2WU0A 4CIAA 1ZJ4A 1N4AA 1K2VN 1OXVA 1R4MA 4TRMA 4U02A 1U0JA 1Q0UA 1TTPB 3LCCA 1I4EB 3BF8A 2FSGA 4CEJA 2JEZA 5CURA 4WN3A 1KQNA 4ALJA 2W90A 3DFKA 3TL2A 4PNPA 2FN4A 1Q19A 1E3WB 2G4CA 4DSUA 1NXXA 3H8JA 1GITA 1UF9A 4RHUA 3ZZUA 2FA9A 2J7PD 3V8NA 4TM8A 1FVFA 2EX1A 2C97A 3RV4A 3UW3A 5KREA 4NPCA 2XOKA 2RHRA 3D7LA 3U4IA 4QOEA 1F0NA 2QWXA 4EPXA 2VAXA 1EUZA 1YMVA 1OKKD 2TMYA 3PUIA 5THXA 3HM2A 4Z1OA 3HN7A 4CN8A 1CYEA 2P4QA 3JQAA 4IUCS 2ZRQA 4J0HA 3WBJA 1ZK0A 2DHRA 5LD2C 1MUUA 1TTTA 3TNFA 2G8LA 5BY2A 1PN3A 1XRSB 4RTMA 3P9IA 3PL5A 1A5BB 2LNDA 4RF2A 2IGTA 3B7PA 3T12A 4C0KA 3AF1A 3IUEA 5E6SA 2B0CA 2QG9A 4M46A 1L7QA 3BRQA 3GLSA 2QQEA 1T8WA 1GAEO 5H9WA 3HUEA 2FUCA 2Z2XA 1E7YA 4OX9Y 5CT4A 1A8PA 3WDSA 3HKCA 4JITA 5DBHX 2V7WA 3ZPXA 2GJKA 2JLCA 2ZSEA 1CY8A 1T4MA 3PHHA 2X8BA 1XIVA 3CN9A 4X84A 1G7SA 2WAYA 2CUZA 4HX5A 5EIOA 3K71B 4QOIA 5JLJA 3BULA 1HYQA 1GQ2A 1HK7A 1DLIA 3RS4A 1ECCA 1V4VA 2B9VA 4C6TA 3K96A 3RWBA 4GI7A 2P6MA 4NBKA 3S29A 1JH8A 1T8YA 2GCOA 1C14A 1AMNA 2PZAA 5F5LA 1R6BX 3RYCB 2G8NA 5HG0A 4L0QA 2C7GA 5A9TA 2NAPA 4KYTA 3GFPA 3LT2A 1XTPA 4FOOA 1FLVA 1HLGA 1NM5C 1F2TA 2FQ1A 5C4GB 1N33B 4EBFA 4PV7A 1R37A 2IP1A 1G8YA 4FCWA 2P1RA 2XGOA 4NE7A 2V3CC 4YRCA 2QR3A 1J8FA 3B3JA 3BEDA 3OTOB 3EN0A 1EE1A 4C6HA 1QWOA 5BOSB 1E3EA 2OLJA 1G9XA 1K8YB 4II2A 2E5LB 3VZCA 3OQVA 2W9XA 4IJVA 1U7TA 5EPEA 4LOKA 1BKYA 2ACEA 2I3ZA 2FOIA 5D3QA 3W8DA 4AJPA 3LBHA 1OFVA 2H1IA 5EINA 3CF2A 3DOOA 1ORHA 3N0XA 4I4IA 5FI5A 3DCJA 2GJSA 2BGRA 3SE7A 1E3SA 4IWYA 1EWYA 2Q62A 4C2TA 3TLYA 2J3JA 4ZHSA 1YQEA 2V4ZA 5D2CA 4K6FA 2F7SA 3ZCTA 5J59A 3S55A 5F51A 1SVWA 4LWQA 4CMAA 4OATA 1NW6A 3WKEA 4C01A 3I32A 4AS3A 5B3AA 3RSFA 1U0LA 1U9YA 4X1KB 1C3OB 3O8BA 5AJUA 4YT4A 4L0DA 2DFKB 1FFHA 4GYJA 5JJIA 2VHTA 4B6FA 3LIPA 4IDGA 2KMLA 1FNBA 2BBTA 3FH0A 5AI0A 3M4YA 4TYNA 1L7EA 4FEEA 5GVRA 3QNMA 2CXQA 3BAZA 4XE5A 2A33A 5AXAA 3ZQJA 5K3EA 3K6SB 1E2UA 1Q0LA 3E6AA 1WUHS 3EWNA 2OBMA 1T5OA 1E5QA 3GJ7A 1HORA 1P7PA 2FX2A 1QRAA 4H7HA 4LNHA 3MELA 1UPXA 3VRHA 1MJGA 5DVZA 1C1XA 1ADYA 1JHQA 1KJJA 1G60A 2Z3VA 3IV7A 5SYNA 1BS1A 1F8UA 2ZJFA 3EJWA 1UJNA 2ZDQA 2WV7A 3GPDG 2R6AA 4JEIA 5JC8A 5LLDA 2R97A 4Z9AA 4EA7A 1ZS9A 2XJ9A 3ONDA 4MS4A 4U6SA 4JB0A 1WTCA 1QORA 4ESEA 3IDQA 2IZ5A 3X1ZA 2GYVA 3GQBB 1UK6A 3F1LA 4U2EA 5DSTA 1BFKA 4A0HA 5BNWA 1O8BA 1E0DA 4EAQA 5IZCC 3A6DA 4YQYA 2HBRA 4YAWA 3TMAA 5B55A 1OUMA 1VDZA 3HA3A 3KOYA 1QTNA 2X58A 2CLFB 5FR2A 5AXCA 5JCJA 1TRHA 2JD2A 4EY3A 1UXKA 4QKQA 4C7OB 2DT8A 2B8JA 1SUBA 3ZWQA 2D06A 3IMFA 4HQKA 3HB5X 4TKUA 3ZX4A 1ADFA 3EVGA 1XD2A 1EFVA 1QC5B 1UDAA 2A5YB 1T0HB 3NYQA 4PR3A 2HCFA 3S2IA 5L4NA 2DBVO 4X6YA 1CR4A 1N5KA 3BHIA 2GFIA 5A9RA 2NUTB 2ZXUA 3PC7A 1SQFA 3GROA 3PNKA 1C1YA 1NLYA 3FOCA 2B1RA 1PZGA 3IT0A 4M36A 1RQ7A 3V2GA 4MJ7A 3ZHBA 3NASA 2QZPA 3HU1A 1CUJA 1YB4A 3W9BA 2I6SA 4I9HA 1U8AA 1PT8A 1V45E 4L5CA 4F12A 1XLTA 4HYEA 3Q41A 3O4FA 1V35A 3FLBA 4WZBA 1FYDA 3Q3GE 4HZUA 1T24A 1KE2A 1S01A 3ESYA 4ZU3A 2BLLA 2GD6A 4M76B 1UWLA 4FC6A 4OFZA 4YDHB 4K9LA 3P9CA 2AL7A 4O2BF 2FSHA 2ODNA 5BMVA 2PBRA 3Q11A 4TLLB 3DJFA 4XD7A 2GDJA 3TO5A 5HIAA 4ECAA 2QN6A 1X1BA 2AYZA 1AHHA 1PQUA 2GB4A 2M6RA 2PKEA 4HUQB 4OO3A 4KVZA 4F97A 2P69A 4BFCA 1EGVB 3QLVC 4ER0A 2XH8A 1KQ3A 3ABZA 3JQFA 4TSRA 4FHZA 2OMEA 4TRRA 1HSOA 2X8JA 3C3CA 1V48A 2F48A 4FMPA 5D8DA 4MEBA 4DLAA 1PAUA 2ZT6A 3CNHA 3PZRA 5ALRA 4UFNA 3TGLA 1G64A 4B33A 4XZ3A 1YAHA 3LVRE 5K2MA 3JPWA 4Y6LA 1L5VA 2BH2A 3I9V6 2CYBA 4JP5A 4MWSA 2IHUA 5ALXA 1Q91A 1GFIA 1P4SA 1II0A 3DQZA 3L3BA 2VUSA 3T54A 3HY6A 4DLLA 5L3RA 1S2LA 3LQ4A 2Q3BA 4YRGA 1XEXB 1UFVA 2GTHA 2IYEA 4L5IA 2F62A 3AVYA 2NZVG 2RHHA 4ZVLA 4NOMA 1VS