1JE0A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with phosphate and tris molecule
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
234
structure length
226
Chain Sequence
PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 76
structure length 226
sequence length 234
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1je0A00
5JPCA 1RT9A 4WKNA 1Z34A 4K6OA 5B7NA 4DABA 1JDUA 1A9TA 3F8WA 4U2KA 1ECPA 4LZWA 4OJTA 4OEHA 2A0WA 4OF4A 1VFNA 1A9RA 1Y6QA 4P54A 1A69A 3UAYA 4D8VA 1A9QA 1YQQA 3MB8A 1K27A 4TXHA 2P4SA 3OF3A 4L0MA 1OV6A 1PK9A 4L6IA 1V48A 1TCVA 3EUEA 4G89A 4TS3A 2I8AA 4WKPA 2AC7A 1PBNA 1V41E 1Z5NA 4D98A 1SQ6A 3D1VA 3EMVA 2PGAA 1U1DA 3E0QA 3DP9A 4OGLA 3UAWA 1NC3A 3E9RA 1PR6A 4RJ2A 5B7PA 4MCIA 4QASA 4NS1A 3KVRA 1A9OA 1CG6A 1SD1A 4M3NA 4KN5A 4WKCA 2OXFA 1Y6RA 4EB8A 2HN9A 5DK6A 2B94A 3QPBA 3KU4A 4MARA 4BN0A 4L5CA 5F73A 3PNSA 4D9HA 1C3XA 4LDNA 2QTGA 4YJKA 3UAVA 3P0EA 2I4TA 1K9SA 1PR1A 3GGSA 1T0UA 3OPVA 1ODKA 1SJ9A 3FNQA 3OZBA 3KVVA 4WKOA 4OY3A 5F76A 3IEXA 4NSNA 4TTJA 2AI2A 2GUWA 5EFOA 4TXMA 4QEZA 4GKAA 2A0XA 3LBAA 3FUCA 4DAOA 1TGVA 1Z5OA 2ISCA 4LNAA 1JYSA 2AI3A 2QPLA 3OOEA 1FXUA 1Y1TA 1V4NA 3FB1A 1ODLA 3GB9A 1OUMA 5C80A 3UAZA 3DPSA 1LVUA 1WTAA 4H1TA 1VHWA 4EARA 2A8YA 5B7QA 1RR6A 1V2HE 1Z37A 3NBQA 4I2VA 4BMYA 5F7ZA 1OU4A 4F3CA 1M73E 3OZEA 1JDTA 2AI1A 4LKRA 1RXSA 3BL6A 1OTXA 4DAEA 2IQ5A 2H8GA 5F77A 4R2WA 4TTIA 4R31A 4G8JA 4TXLA 1PWYE 1B8NA 3DDOA 1Y1SA 1U1GA 1RXYA 3U40A 1JDZA 3NM4A 1Z35A 3LGSA 4IP0A 1RYZA 5F7XA 3INYA 1CB0A 4F2PA 1ULBA 4DA8A 3IOMA 3NM6B 4FFSA 5I3CA 1ODJA 4TXNA 4YNBA 4LNHA 4JWTA 1Z38A 1Z36A 1OVGA 1JE0A 3K8QA 5ETJA 5CCEA 5F7JA 1Z5PA 3O6VA 4UC0A 1JE1A 1PW7A 2QSUA 4L5YA 5CXQA 4YMLA 4QATA 1RXCA 4QARA 4D8XA 1YRYE 4F1WA 3BGSA 4WKBA 1Z39A 1N3IA 1PR0A 3OZDA 1OTYA 3PHBE 5CCDA 4BMZA 4JOSA 1PK7A 4DANA 2HRDA 1RCTE 3KHSA 1QE5A 4PR3A 2BSXA 3E9ZA 3KVYA 1RXUA 3KUKA 3FOWA 5IU6A 3P0FA 1VMKA 1XE3A 3O4VA 4TS9A 1VHJA 5B7GA 1JDVA 4G41A 3OOHA 2A0YA 4DA6A 1RFGE 1Z33A 3PNPA 2QDKA 3NM5A 1ULAA 3K8OE 1TGYA 3ENZA 4ECEA 1PR4A 2OC4A 5F78A 1PR2A 4TXJA 1PR5A 4GLJA 2OC9A 5KB3A 1LV8A 1YQUA 2XRFA 3UT6A 5F7OA 5EUBA 1T8YA 3EEIA 4M1EA 1K3FA 3DJFA 4NY1A 1U1CA 1JPVA 3BJEA 5EPUA 1Y1RA 3MMSA 1SD2A 3C74A 2RJ3A 1ODIA 1T8SA 1NW4A 1NC1A 1A9SA 4TYMA 4F2WA 5CYFA 3OZCA 4L5AA 2HWUA 4M7WA 1PKEA 4DARA 4BMXA 5K1ZA 1TD1A 1V45E 4MCHA 4QFBA 3SCZA 1RSZA 4GMHA 4OGKA 2OECA 1B8OA 5CYGA 1V3QE 1T8WA 3BSFA 5IFKA 4PNPA 4X24A 4TTAA 4F3KA 4R2XA 4D8YA 1T8RA 3LA8A 3UAXA 4DA7A 1PF7E 3T94A 1YR3A 1Q1GA 4YO8A 1TCUA 1YBFA 3OCCA 2QTTA 3PHCA 1G2OA 2Q7OE 3ONVA 5FAKA 1ZOSA 3EUFA 1JDSA 1Y1QA 4GLFA 3DF9A 4JP5A 3FWPA 2ON6A 1I80A 3ODGA 4QAQA 3FAZA 1U1FA 1JP7A 1LX7A 2HSWA 4E1VA 5CXSA 1U1EA 4DA0A 1ZL2A 1A9PA 3TL6A
chains in the Genus database with same CATH superfamily
5JO9A 1MV5A 1GFZA 1M6EX 1COZA 1YASA 3D7NA 2ORED 4OHRA 3DE6X 4R05A 4WOPA 3HCCA 5T5QA 1SBHA 2AJLI 3ECCA 2PLWA 2X58A 1FXWF 3A3PA 3ELUA 5GV7A 2DMRA 5ALKA 2COUA 4BASA 4BNKA 1KHHA 1O95A 3N0RA 3P4YA 1QE3A 4OATA 2AQIA 3DVLA 4WFJA 1KH1A 5E4TA 3N1UA 2AD1A 4ZCSA 3LE8A 4ZO9A 5D86A 3OEHD 1ZU4A 2BKLA 2HMUA 4JI7B 1H3FA 4MVWA 5CFOA 3VA7A 4YHBA 1PGOA 1PNOA 1SD5A 1PS0A 2ZVJA 1HT1E 4OF4A 2IEYA 2KW5A 3N0VA 4Q21A 1UK8A 4QICA 5K51A 1YB5A 1AV6A 3BA1A 1VKRA 1A69A 1D04A 3AFGA 2W43A 3S8MA 4C7MA 4EELA 1K5HA 1FFWA 1DOHA 1T6NA 4EZEA 1HE4A 4QUJA 2LV8A 3AWIA 4CV2A 1RPTA 3DPUA 4FFPA 2OVFA 1BXGA 3PEFA 5JAPA 1YI8A 5KYXA 5ENZA 1DC8A 1OV6A 3H5RA 5JIBA 2ATCA 1F0KA 1XAHA 2XWPA 1HLDA 1PTJA 4TGLA 4B2IA 2QYOA 4FYPA 4CCAA 2B5WA 2DOKA 2HEIA 4XM1A 3K9BA 2WAXA 1J7JA 3HTXA 3V4ZA 1WZCA 3TW0A 1RHQA 2OZPA 3FBWA 3S99A 2QMHA 4J3FA 3BZBA 4DJDC 4ESHA 4ZK2A 5T41A 8ABPA 1ZW1A 3I6MA 4A92A 1Y7PA 4PG7A 3B89A 5AJHA 2VC2B 2H57A 2NYAA 4BEJA 4Z5XA 4TS3A 2Q0QA 2MMCA 3UOWA 3LHSA 3FTFA 1EDDA 2B4YA 3CTPA 2AJBA 1VJTA 4NICA 4XA8A 4KXFB 4L6CA 4U2GA 3CRW1 5K0BA 3CURA 4QDJA 2J0VA 1NT4A 2ACWA 1OLSA 3GFVA 3RHZA 1IZ0A 3CLSD 5A4JA 5KJCA 2QD1A 3IJPA 3NWOA 3K73O 5CP8A 1LPBB 3WFZA 4L9AA 5B37A 1UZNA 3UCFA 2OGWA 2C3UA 1K08A 4V0QA 4CQNA 3H5NA 4GNKA 1E2LA 3SBOA 4CGYA 2UXBB 2IP1A 3U31A 4LGVA 1LLUA 5AKZA 5MGNA 1U2GA 4KQGA 4MQEB 3AYZB 3EYAA 3EDMA 1XR3A 1WIWA 4BMCA 1Z0ZA 2JGKA 5TQ0B 3VJRA 1XRQA 2B25A 3AF3A 3E70C 1WPRA 5F5XA 3CKYA 3OBIA 5EHGA 2PG3A 4J43A 5LB4A 4GSKA 5IT0A 2RH4A 4FWTA 3EXHB 1B93A 1IN6A 3BMQB 4J1TA 1ODFA 3IBFA 3L1UA 2QP9X 1SG0A 3PA6A 3K0CA 5CFRA 5K6RA 2AC4A 4HS9A 3U1TA 3HFRA 2C4WA 4FIZA 4WSOA 5IJWA 4MP8A 1JHRA 1CT9A 3VVCA 4A2CA 1C9JA 3S4YA 2Z9CA 1TJ4A 1UC4B 1DRKA 2CVQA 3FUUA 3R0XA 1LPNA 3DEYX 2B94A 2I1QA 4EA6A 4RJTA 2CL0X 5FH9A 1B2RA 2Z83A 3ILSA 5E7JA 1WCIB 1QIJA 1B8UA 2DPHA 5F73A 3ASVA 3EW9A 4LXXA 5EI5A 3UH0A 2C96A 1INLA 1UBMS 4E22A 4RA9A 4AFNA 1JKFA 2JLUA 3RTCA 4TRRA 2H85A 3ZW7A 4B40A 4EGSA 2X22A 1U5BB 1CZHA 4Q1CA 4PHHA 3GJZA 4I3HA 2QV0A 2GLXA 1PQ4A 1AHHA 1TL7C 3B9QA 4N0QA 2CLEB 4G37A 2GS9A 1DEAA 2FF5A 3NETA 3RV4A 4LPKA 4LGMA 4GPZA 2C7RA 5CDTA 1XK7A 1NUHA 2WK1A 1NVBA 3PUIA 5BSGA 1YT5A 3OOJA 4OLJA 2VDMB 3HH8A 3K9WA 1XNRB 1NI3A 1ZXLA 1HPLA 2Y0EA 1D1TA 1RLMA 1ZPDA 1TJNA 2C92A 1OGJA 2PJDA 2W2KB 3FYUB 3I9MA 3WGHA 5ERGB 1WOYA 1Z18A 2XB8A 5L3QB 1RAFA 1YJQA 3SK0A 4QBTA 1PGNA 3A0RB 4URHA 2AG8A 2JK1A 3X3HA 3W06A 2ZAMA 2O2JA 4EBFA 1KAHA 4EGCB 1EH5A 1OXMA 1I7SB 1BOFA 3V00A 5A4MS 1ZK0A 3F78A 5JJLA 4FU0A 4V2UA 3KWFA 1RYHA 3JQ7A 1J1ZA 2YRWA 3DW1X 3ITKA 3OETA 4HF7A 3S2EA 3FLMA 2YTZA 4AUMA 4D4JA 4DIMA 3KQUA 1GA6A 3N2NA 1L1RA 3ZHTA 1GRNA 3BWDD 2IUFA 4Z8YA 5ECDA 2ZR9A 4YP7A 3NHYA 4RORA 5DHAA 1SOUA 1FFAA 2HV8A 3HZOA 4NYMR 3ET5A 4MUKA 5FQNA 1NQ5A 4XLLA 1XRLA 1NNLA 1WPQA 3H1PA 5KYGA 2A6PA 2GXUA 4CCYA 4US1R 2HYIC 1VLQA 1QDEA 1JECA 1OUMA 4O0MA 1DCFA 5C80A 5G4LA 1BFKA 1SA0B 3DPSA 3FCXA 1RIFA 1ZD9A 4ZFNA 1H6CA 2W2LA 4J4HA 4PU0A 4LVOA 4Z7NB 1XU7A 2BZSA 1GTJ1 4ZHQB 5K03A 2VHEA 3IAS6 3HDHA 3KEMA 4ME6A 3LUFA 5HZGA 5HDQA 1NMXA 1XZLA 3GFTA 5LP6C 1C1YA 4YRDA 3HJGA 4V0NA 2PEYA 2WVJA 4C7OA 3Q85A 2HA2A 5EZYA 4ER5A 2KSQA 4HG2A 2J08A 4DWVA 3L04A 1AUQA 3WMFA 4BVGA 3RTBA 4DILA 2HWYA 3W5AA 2IZZA 4HNRA 3ZWQA 2B8JA 2C00A 4LHXA 4DCPA 5KO2A 3B20A 4LOIA 3WOHA 5H16A 4DAEA 4DBLC 1S9HA 3AUFA 3ZG6A 6ABPA 4V39A 2F9MA 1XT6A 1L0BA 1XD9A 4L07A 4LYHA 4RKQA 4M7PA 2I2DA 1SK9A 4IVNA 4M0KA 4LOJA 3FPKA 4MIKA 1VL0A 2I55A 2RIRA 2WM9B 4Z0TA 5P21A 3BK1A 3PUWA 5DXJA 1SWWA 4XM2A 1P6QA 2JLSA 4YRZA 1TTPB 4RMHA 2BT4A 2Q8QA 1G3RA 2YJTD 4INZA 1CY7A 1X1TA 4CM4A 5KOJB 4GE0A 4U7WA 3W3ZB 2W8BA 1HNXB 1M5RA 1CZLA 4Y6GB 4NKRA 3T15A 1RZUA 1XL0A 1RWQA 2J4FA 3FPGA 3WA6A 3WQRA 2FA9A 1KC1A 4ENPA 3ETNA 3L8FA 1FRZA 1GZ7A 3A3OA 3L0YA 2W6JD 2R8RA 4ZPXA 3VPDA 1NGSA 4Z7JA 1LDNA 2REQA 3X1WA 1JYFA 1KBZA 1PZMA 3AM4A 3DCIA 4M9CA 4BLSA 3OZGA 1XP8A 4HQFA 3N8DA 4C20A 1L8QA 5CLIA 4EA9A 2C4KA 2IU3A 2Z9BA 1VXOA 3IT0A 5LCXA 5DTRA 1TUEA 2JIDA 3H2JA 1QS0A 1VDZA 4HLUA 2CHQA 5G0WA 1R5OA 2QTMA 1OI3A 2ADFA 3HKDB 1TIPA 3LQYA 2WYVA 3T7DA 4U7FA 1ZX1A 5EIHA 1R8JA 3A10A 3R5HA 4WBNA 5CCEA 3AESA 4ZQEA 2JF0A 4I8XA 5SICE 4YLEA 1V4BA 3SYMA 3TTXA 3BX1A 4I50B 4B6FA 1TVEA 5BN3B 4CIBA 5FFMA 3DDHA 1VLMA 2R44A 1CUWA 3HXOA 2EX0A 2EFHB 4R84A 4A03A 2BBTA 1BEEA 1QVZA 1GSAA 2HO4A 5EIBC 1C8BA 1RC1A 3I2GA 1W34A 1T2EA 5G0TA 4F1WA 3I8XA 2YUTA 3DHEA 4LMBA 1NUSA 3Q5DA 2Q5OA 5G02A 4C6RA 2M6KA 1IOVA 1N5LA 3DVAA 1T5BA 3E3AA 2Q1XA 4PGHA 1GGHA 2G8LA 3ZOKA 1UBCA 2A1TR 2OBMA 4EG6A 3RI3A 3TBHA 5H82A 1NURA 1QYCA 3D6MA 4NPCA 3JQ8B 1MW9X 2C2KA 4X6YA 2EJBA 1SUCA 4TQUS 1M1UA 4C2UA 4Z4HA 3F98A 1QVRA 5G1PA 1FJGB 3FH0A 1VE1A 4JOSA 1UQTA 1JAIA 3FB4A 1S0UA 3Q2OA 4ZVKA 2GF2A 4Y3UA 3MXOA 3ZCUA 4CI9A 1G8HA 4OQFA 4D0GA 1BZYA 1DJLA 1PUXA 3WL5A 2A78A 4IOKA 2MTBA 1IK6A 2F3PA 3FVRA 3E7DA 2HQ1A 2Y27A 2R96A 2IYYA 3UJNA 1U2QA 1ZBQA 2E4ZA 1I10A 4MAFA 3STHA 3P7MA 1G3UA 2HJHA 1OPRA 5IDYA 2HPAA 3DZBA 2FV8A 3I5YA 2OPBA 2PNFA 3IDFA 2D62A 5I5GA 1B8PA 3W2HA 4JBXA 3GUUA 5AJWA 2RHOA 2R8XA 4MYDA 3TR6A 5A4FS 2AX4A 2F4NA 2WRZA 3AM1A 1N8SA 2F1OA 1NUUA 1TJ3A 2EX4A 2YWFA 3FKSD 1JDNA 4R7TA 3OOHA 4RZSA 3SMVA 4D0NA 3ERCA 1U7WA 1USWA 4IPTA 4NCXA 4LGYA 5E6SB 1N2CA 1U3WA 3I28A 4MUYA 3ZR4B 5ALJA 4DUGD 4E88A 1BXGB 5DW3A 4W5TA 1VL5A 4B6QA 1NV9A 3L8EA 2WWGA 1E9RA 2FPLA 7ABPA 3N3AC 1CDDA 3L8ZA 1JJAA 4HDNA 2G4CA 1DWQA 1H5UA 2ZYDA 4YAFA 5FOUA 5BOSA 3L8CA 1M5UA 4EKGA 2Q3LA 1QGAA 3BZWA 3DM5A 3W5VA 4NZMA 1BX3A 3CNNA 2JIQA 2PL5A 3C6QA 3PK0A 2XRFA 5ITWA 1TYDE 4LZNA 3W3AD 1ETHA 1QLWA 2ZM5A 4FW9A 1UBEA 3I3SR 4OB8A 1AZWA 2P3LA 2XAUA 3TD9A 4ZO7A 5AWFC 3T7EA 5CB4F 1CW2B 4L4ZA 4GH5A 2WJAA 5DYWA 3T9EA 2FX2A 3KDAA 3PIDA 1MQAA 1Z5WA 2Z6UA 1MVNA 4G26A 4G4SP 3E7XA 5TPZD 5KNBH 1XQ9A 4MUGA 2ALJA 1ZOLA 3M1LA 4F38A 1TM4E 1XVIA 3CX3A 3NONA 2QZ4A 1YHZA 1E18A 1P8JA 5LXTF 4UD6A 2C1EA 3MGBA 2Y1XA 1DIGA 3M6VA 1ES9A 3BYZA 1F5SA 3NGXA 3BIFA 4HRXA 3E5NA 1H42A 3PSHA 4I9HA 3FFTA 2A14A 5EHIA 4MDEA 2XCSB 2ZCUA 1EFRA 3N53A 5HR5A 1JYEA 4EY5A 1S1MA 1FW6A 5H7XA 3UPTA 2Z6VA 5JXWA 2R8BA 5FLXA 1M6NA 2OVBA 4IMRA 1F8UA 1NBMD 2WM8A 1H2BA 5DHPA 4H0NA 5JHGB 1CF4A 1Q3HA 4LQ4A 3VGJA 3N6XA 3MZ0A 2Q0SA 4NJOA 4PONA 5AO9A 4M89A 2FR8A 3RF7A 1A88A 3K6SB 2ORYA 2EF1A 4QDTA 1TRHA 1Z5UA 3SM9A 1KMNA 2HWUA 1QYXA 1EFAA 2QN1A 1WTCA 5JSFA 1N6RA 3OESA 4MMYB 2VJAA 4QFBA 3TTUA 1JLSA 1T4DA 3UV7A 1VTKA 1E2PA 2CJYA 1KA9H 3PNYA 3C5HA 5DN9A 5EL0A 2D59A 4OGKA 2CMFA 2CSUA 2WUEA 4WACA 1W5EA 2PA3A 2W6JA 2VCEA 1BU5A 1Z6QA 4RA9B 4D8WA 4EF4A 3CBGA 1EK2A 2YJNA 1HLPA 3BSFA 4FYXA 3O92A 4C76A 2E5WA 1H0SA 5KTSA 4KDEA 4BUCA 4FOTA 3V1TC 3FPFA 2B98A 5A3QA 1AO0A 1SWVA 1S4MA 4KQIA 5C81A 3JWHA 1Z0JA 5JI2E 3I92A 2ZT7A 3TTTA 1WPXA 5ECYA 4MW7A 4PX2A 3VZSA 1ZO8A 4NYIR 4ZU1X 4ETNA 1ETUA 3BE6A 1DBWA 2GF9A 3QUCA 2BCEA 1KY3A 2B8NA 2H1SA 4MUXA 4PRYA 4GZ6A 5EXPA 1XTPA 2Z4TA 1GGFA 5PNTA 3GA5A 3MQ4A 4FGZA 4B7ZA 3RVLA 1L5HA 4YV0A 5JWHA 2B36A 3RVRA 3PC6A 3UW1A 5FAKA 2Y99A 2O2XA 1JLMA 5J5VA 4AMZA 2BF4A 1OC2A 3RK0A 4FX2A 4MJLA 5BVGA 4LN1A 4XGRA 3AERA 2WG1A 4WNAA 4KQKA 5T4BA 2UYCA 1FW8A 4KFSA 2HSWA 3JQ7B 1E9CA 4II2A 1U7XA 2O8VA 2FPWA 4HFNA 1U1EA 5ICSA 4TYPA 3CRZA 1QVWA 4W6ZA 5JXJA 1HE1C 3SHOA 3RSHA 4A0RA 4V03A 4Y7CA 4QQRA 1YVDA 1NVVQ 2DECA 4CEHA 4LHVA 3SS7X 1GZ6A 2X7HA 13PKA 3CUKA 3DT6A 4W1QA 2CVOA 4YJFB 3KKKA 4BMNA 1QM5A 1Z8HA 3N8GA 2ZS9A 1QVAA 3Q6MA 4UVDA 2JBWA 1NFRA 4ARAA 2NIPA 4CCYB 3F6EX 5A0FA 5J2UA 2DULA 3BBLA 1UM8A 1KDYA 1JDUA 3JYQA 5JRJA 1T15A 1U28C 1EX6A 3MGKA 1YGPA 2Y67A 2Y76A 3U39A 3U16A 3AINA 2ZRLA 2C31A 3KVNA 3ESCA 2GA9A 1QZXA 4HH0A 2R751 3CZCA 4J7CA 4IIXA 4R2HA 2ECQA 4OBWA 4RS4A 1Y98A 3M1IA 4W4TA 4NJEB 2FVXA 1TK9A 3KJFA 4UU1A 5JQGF 2VP4A 3JCZA 2Q3DA 3TPZA 3V8RA 4O5AA 2ZAIA 4BVKA 4ID9A 4PN7A 2ARKA 2TMDA 3B6JA 4UDXX 3VPXA 3TEMA 4C7OB 4L57A 1LVHA 5KYKA 2WAYA 3OD1A 3WMWA 5B3KA 4AI6A 2GTHA 3OZSA 1GCOA 4WRRA 1M2OA 4DM7A 1QG0A 1V7CA 4B46A 1A76A 2FWIA 1NYTA 5AW6A 3UWKA 1JPJA 1YQTA 2HIGA 5AI8A 1HDYA 5G4KA 4P0QB 4TV9A 1ZIYA 4L5IA 2GLTA 3HGMA 4MIYA 4F8EA 2DBQA 5ICCA 2Q2OA 2F67A 3D3WA 4I9GA 5TPWA 2JKYA 3DBIA 2O8CB 4HGQA 4RW0A 2XCUA 3RS5A 3O3NB 1PIWA 1WO8A 2RG7A 4BU1A 3O2JA 4OLHA 5I9MA 3U62A 3KUCA 1J99A 5THQA 3TX2A 2HK9A 1FU4A 4DUGA 3EVEA 2HA5A 1Q92A 221PA 5KWEA 2IOFK 3GFRA 3JD3A 4CM4B 3OCVA 3EVAA 4M88A 5EXSA 4JSYA 3T3PB 1UM9B 1Z2AA 1MA0A 3FNHA 3VKFA 3UN1A 3AH8A 4R69A 4ZVOA 3O9ZA 5CEJA 1AKRA 1JKIA 1TC1A 3R5TA 1G3IA 3FCUB 4PPQA 1NUPA 3TXXA 4FGSA 3R5FA 2VRNA 3L1HA 4LK2A 2A3NA 1XYVA 1ZJ6A 2WYWA 3N74A 3BTUA 3ND6A 3OVMA 3W3AA 5I9NA 4BX3A 1S1CA 3ILXA 3P4XA 1RACA 2A5FA 1ZMXA 4N6NA 3S40A 1Y3HA 4HVAA 1V5FA 5D5HA 3SU8A 1AZLA 3DP9A 2WSSD 5LZ5A 5C34B 5C1DA 5LNK6 3I8SA 1P9NA 3NI2A 4HY3A 4OA8A 3VH4A 5HPYB 2NVOA 2GERA 5TPZA 4YPVA 5BSVA 3RUIA 5KDOA 3A2KA 4L8VA 2X7JA 2HD4A 1Z4PX 1WZUA 3HVHA 4RJIA 4Q19A 4Y9DA 4HMPA 3GYGA 3CVVA 4CM6A 4OUKX 4G2TA 1AQNA 1QS0B 3KRTA 1B16A 4K40A 3Q0TA 3N7TA 3D2BA 4GPAA 4F5WA 4MJ3A 3U4GA 1YZ3A 4WBXC 1YNOA 3EN0A 1CERA 2WMNB 2GZRA 3KXKA 4KFUA 1AK9A 5EWJA 3G2JA 2FXIA 1OWOA 3AESB 3GFPA 3EULA 3Q3GE 3EFHA 1T0IA 1KK1A 1T3LA 1XJWA 1NBMA 3K5HA 2Y9PB 1NQOA 4G1VA 4XIIA 3A9RA 2BDUA 4E5KA 5G53C 3FCYA 4OM8A 1XEWY 3EF0A 2FPIB 3T3NA 2X0IA 1XCJA 1ZHHA 4MJ7A 2B9EA 2XBUA 1UXJA 2J0UA 1TA9A 3VBEA 4CQLA 1CR6A 2Z09A 1U3DA 4G5SA 1X1RA 5LQDA 2I6UA 2W98A 1A5TA 4B5KA 1W1UA 1T1RA 4PR0A 3LQKA 2QA5A 4N3CA 3OM0A 4O2BA 3DLCA 1EZ1A 4WT7A 1SXGA 2WT9A 2W70A 2YBEA 3RFUA 2YR0A 2VT7A 1T0UA 3EMDA 3T41A 1OXVA 3HNRA 3ETHA 3H5AA 1MVLA 3IP3A 3LS2A 3MTIA 4BBAA 1QMPA 2BGUA 3H42B 3AW9A 1IY2A 3DE0X 3FNQA 3OZBA 3FWKA 4R7ZA 1UEIA 3O38A 2TMYA 4JHLA 2AV6A 2GEUA 1MORA 2C5GA 4FE3A 1AY0A 1PJ4A 1YMVA 2PLRA 4RABA 1TMGE 2AI2A 4UZEA 4LXTA 4HVCA 2P3OA 1OI7A 4HXYA 2J5XA 5C9ZA 5EWLA 1YQGA 3DMDA 5DDIP 4QEZA 4BP3A 1EBFA 1E1NA 3S2FA 2JH8A 3FBTA 1E6LA 4AZTA 2AZ4A 3A26A 2EFGA 4LBVA 1KOLA 2DVMA 3BXGA 1L9KA 1ORDA 2WZCA 4LWZA 5K4AA 2CF6A 1ZIOA 4PHFA 4U9UA 4D3SA 5JD4A 2M98A 4G5HA 1FUYB 3UKJA 2QW8A 1QBKC 2RKBA 3TCNA 3U7EB 3QBTA 4QXPA 5EE5B 4AROA 4BFZA 3KYCA 2WQ7A 2CXNA 1O6BA 1KO4A 1D5WA 1E63A 1XCOA 5FL7D 5DNCA 1MGOA 2YH2A 4X65B 5CAEA 5AVWA 4TUYA 3U7GA 3VNQA 2P0YA 2PX8A 5LC1A 3ITDA 2FFRA 3LHKA 5FI1B 5DGCA 4AWXA 2PJZA 1G5HA 3UAZA 1UBLS 3KO8A 5DP1A 3KUDA 3OUUA 2G40A 3H75A 4RSHA 1DLIA 2ZAYA 5JATA 3DPIA 2L69A 1JMYA 2FPGA 2FZ5A 2FWNA 2I7VA 4POAA 1B26A 2OV3A 3BWEA 3WIUA 5BOSB 5K20A 1DV2A 3LXMA 4HAIA 2QSZA 1ZNWA 3COJA 3ZCVA 2P75A 1A5BB 3I1IA 1RR6A 3IDZA 5BWLA 2F8SA 3OIYA 3TW6A 1XLTC 1XZKA 3OTIA 2B0JA 4R8SA 2RGYA 4TT8A 1DUSA 3DXXA 4E07A 2QQ0A 2GBFA 3WISA 1GZDA 3D6JA 3HLKA 3JQFA 1XTRA 3CNOA 1FFDA 3OZEA 2VDJA 1QAMA 3ZHQA 1N2CE 4U7DA 2ZSHA 4UNRA 2XQGA 3K70C 4CNBA 1EUCA 2AN4A 2ID9A 4NMWA 1RXSA 4QYMA 1PFGA 5BSHA 2J3HA 3HZZA 2ESRA 1Q7TA 2BI7A 3NRCA 2IF2A 5IJ9A 3PPIA 4JUIA 3RQSA 3WQHA 3DBOB 5BWNA 4RULA 1FOEB 1ADJA 2Z1NA 1CJTC 1CRPA 3GMTA 1E6KA 3L06A 4WE3A 4X84A 5D6NA 4C0XA 2I1VB 4LISA 2YDXA 3RKSA 5FBWB 2WU3A 1P3Y1 3DDOA 1DAPA 3R0IA 1S96A 2AF4C 2JH3A 2DKNA 3T7CA 4W8HA 3TBKA 2L0XA 3F7NA 2J59A 3EZ9A 2VJYA 2VK2A 1Y8RA 1PP4A 3QX7A 4KYIB 3ONWA 3PKIA 4IIGA 3TB4A 4I9UA 1K75A 4OHYA 1D9XA 1ONSA 3BAZA 5T57A 2B4KA 2ECPA 2WKSA 4NONA 5A04A 2RHTA 3AILA 3SVZA 1P5FA 4DLTA 1MB2A 1T1GA 2JHPA 1CS0A 1XD8A 4OJMX 5EGSA 3A14A 1JBEA 1KWKA 3CONA 3FOAA 4Q9KA 3OZAA 4GZ5A 4FVTA 1PL7A 2JD2A 4BFYA 4EB6A 4PS0A 3PITA 2W2PA 4C87A 3IRUA 1JEYA 1D3AA 4LCEA 2RHGB 3KSMA 3IMCA 4P08A 4O2AF 3RTEA 3SZMA 2PM8A 3V8VA 4BP8A 3W3AH 3TQHA 3V3TA 1BMTA 1X1BA 4QDKA 4XOIA 4U39A 1XZNA 3RT1A 2RK4A 1JB1A 2H6EA 2X4DA 5HF6A 5C18A 3MVEA 4C9BA 3F8SA 4JR2A 3T9BA 4AJ2A 3GA7A 1P17A 2GD6A 3VOAA 3NHAA 1LNSA 4MS1A 5GGXA 4LG1A 1BRTA 1UP6A 4FHDA 2WSSA 3HB0A 5HRAA 2M6RA 1GG8A 3QXXA 4YFYA 4ZVRA 3LLMA 4XFKA 5F7JA 4FKBA 5LMZA 5EE0A 3U37A 4BZPA 2WYOA 3LUHA 4QVIA 1V5WA 5SYNA 3R7WA 2C3PA 1CJSA 5LD2B 4L27A 3HACA 1E96A 1EFKA 1RADA 3C3BA 3OIWA 5DNWA 3VC2A 1WSDA 4W6QA 4NDAA 1N0WA 2V58A 3WJ7A 1N92A 2PJUA 5AM4A 1YR7A 2CHVA 3F74A 2CD7A 4P34A 4M1SA 1L5HB 1QTRA 1R0LA 2PS0A 4D0LB 1Q22A 4PAOA 2I7XA 4B6GA 2WWTA 3S8EA 4PLTA 1QP7A 2NU7A 5FTKA 2WABA 4QU5A 3OQIA 4A0GA 4AN1A 2DFLA 3O1JC 2SKDA 1CPYA 2A9FA 2PV7A 3FTQA 3ZDCA 5DLPA 3J80A 3VTZA 2FW7A 3KJEA 4QBHA 4A5SA 3GCZA 3ZNQA 4GPD1 4CL0A 1ARZA 1LI4A 2FZWA 1CF2O 1P73A 3ZDDA 1UZMA 2HDWA 5C5CA 1O2DA 1QK4A 1BSVA 4Z3DA 4AS1A 3H9UA 1CRLA 1D2AA 4ZDJA 4MO9A 3QG1A 2NSDA 2AOWA 4HH3C 4X60A 3SC3A 4ZU6X 2OD7A 2IZ7A 1PGQA 2XE6A 2ZJ6A 1E5XA 3QMVA 2X40A 4GRIA 2ZT6A 1GTL1 1PG2A 1ZUHA 1MC5A 1X14A 2W71A 4OHKA 5CVVA 4ERNA 1K8YB 1OXXK 1PFKA 5EC8A 3SJUA 2PGIA 3W1VA 5BYKA 3M3PA 3OU6A 1UXOA 2PFGA 2I65A 1IBMB 1FSZA 5J2UB 3CJQA 3ZNNA 2O0HA 1EDBA 1Z63A 4ALIA 4AT1A 5LUAA 4L4YA 3NANA 2ZW9A 3IQEA 5B3JC 1K98A 3PRYA 1GCAA 1JDVA 4DN6A 3BDVA 5LQJA 1JG3A 1T3HA 2X6QA 1U2PA 3C4JA 3G13A 3OF5A 4IFEA 3COVA 1KAEA 1GKUB 3BKWA 4FSHA 1YZHA 1BJRE 5AM0A 3SZ3A 4P35A 4FILA 1W52X 4F5ZA 1NE7A 4MA5A 4XQEA 2PUEA 4XQGA 3UEOA 2LCFA 3UGTA 1RI3A 4DRYA 1WQ3A 2FCAA 4F5YA 2AG1A 1TW2A 1JKXA 1M2OB 4N6OA 1NLFA 1R6AA 4UD2A 1X3LA 2BFFA 4HVLA 2DTDA 4O4HF 3ZXXA 5G4KB 2CLDX 4TV9B 1RHJA 4OLFA 3WMXA 4GM1A 5C3MA 5FL7A 3UICA 1AB6A 3D3WB 3KHTA 3SPXA 1PR5A 3LBNA 4MWOA 1CFJA 1LV8A 4MGIR 5IKXA 3E23A 1K6JA 2W6QA 1M1XB 1G5RA 3R6WA 4G4JA 4F4HA 3Q9LA 2G83A 1EXWA 1EMDA 1ZNQO 3IQZA 1TLFA 5JVDF 2ORIA 2XUPA 1E5LA 2RC6A 5DW0A 1YI0A 2YV1A 4OQPA 2FWMX 1KL7A 3GLRA 4YALA 4MV4A 1N7HA 4G65A 2EEPA 3DVSX 4ZVQA 3OQ1A 4AJIA 4LHEA 2RGDA 3O8DA 3TD6A 1X94A 1COWD 3C4VA 5DNAA 5G2OA 3O9MA 1U0NA 1P4GA 3MJCA 3AQ4A 1Z88A 3ABZA 4FMDB 3IO3A 4K46A 4LHWA 4TVBA 5B57C 2BR5A 3TWOA 2C5BA 1YFZA 2Z2YA 1LJUA 3QWIA 4B48A 1FSGA 3C16C 1NW4A 2I6SA 5KVSA 4KR9A 5KX5F 1JHDA 1WXXA 2HB6A 1KTIA 4XD2A 4AK9A 4YAOA 3C87A 4P9NA 1FL9A 4BX9A 1BW9A 2YFQA 3VZDA 5AIAA 3MGCA 1X2BA 2D1FA 2YJ3A 3D6TB 3TE6A 4RPGA 1P1HA 1E9BA 2OBXA 1MJGM 1L8AA 2CXRA 2R7KA 2ZRGA 4Q6WA 1SZPA 4IDOA 3PXGA 4HSEA 1K89A 1FJXA 1AA6A 1A7AA 5EWJB 2TRSB 3QELA 1USUA 3G0GA 2XUGA 4OOEA 5J47A 2A5GA 4MKGA 5BOVA 1Q0SA 3FY4A 2EKPA 3WB9A 4BLQA 3HJFA 1WXIA 1NJ2A 2ZSFA 4N41A 1GNLA 1EBBA 3CCFA 1YDHA 1E9DA 3L7CA 4ENUA 1OIWA 1HOTA 3I45A 4RA6A 5EXDA 2J0UB 1TIBA 4HN2A 3PQ3A 1X1SA 5EJEA 1T5OA 4LYAA 4D9MA 2P6NA 3AIOA 3FYHA 1RI2A 3OJWA 4H7DA 3MINA 5IAJA 1WW2A 3LVRE 1UODA 1CZOA 4JI5B 3I76A 1K68A 1P4HA 4O2BB 1WXFA 4FR2A 5E9QA 3QVWA 2ZI3A 4JB2A 2MSLA 3ZCXA 4F3KA 2IGTA 3E9MA 4MVJP 3GQBA 1NBME 3GW8A 3K1ZA 2JD0A 1ESEA 2NV2B 2FFQA 4CF5A 1TFRA 1JR2A 3VI4B 2EKDA 4D4LA 4JUCA 5ADUS 9LDTA 4ARCA 2CLSA 2C94A 3CX4A 2M6SA 4EHDA 2XWQA 3ANSA 4YLYA 5BWOA 3C2QA 3K2BA 3I05A 3IALA 2G9QA 1GQSA 2AVNA 1BU8A 5BSUA 3V7WA 4A1FA 4BJHB 4EY6A 1NXXA 1GNQA 2PWZA 3UUWA 4UBKA 5EJFA 1CQXA 3C8HA 4RV9A 1V3TA 3X43A 4Z9XA 4CUJA 4I81A 1ZRMA 3UCXA 3GJ7A 1Y1QA 4YT2A 5EWLB 5B30A 1EEXB 1P1FA 5K2MA 4CM9D 1U81A 2CBZA 2XUJA 4GVPA 2AUNA 3ZWOA 2H2HA 5AOVA 1R0BA 3KXDA 2PYIA 2J85A 1GUYA 1VKOA 2K5UA 4OAQA 5CA0F 5CCBA 1RWOA 4PSCA 2IOQA 2ZXEA 1CRZA 2Z8ZA 3CVWA 2I1LA 3RQIA 2V96A 2XBLA 4KLRA 2IDMA 3A27A 1GSIA 1T5TA 3KYCB 5DZSA 5IJZA 4BKPA 5JLAA 4BEWA 3OM1A 4O2LA 4EYSA 3ANNA 1NF8A 1Q2XA 4WGGA 2DM6A 3AGQA 1RFLA 2QMZA 3OHMA 3L4SO 1O1YA 2Z0MA 2FEWB 2R1VA 3WRYC 1WHSA 1KI8A 2PIAA 4RHTA 2OYRA 4NU6A 4WNCA 3IOEA 5CMLA 1ADBA 1OI4A 3QFCA 5IYZB 5DCYA 5F3RA 1R37A 2A30A 2WAOA 2WVGA 2EJTA 3NP9A 4IIDA 1XCMA 2FPGB 3NJRA 4YJ2B 3I2YX 4D97A 1ZK2A 3EGDA 3RAGA 3DS8A 1BDMA 4MRSA 4J0KA 1V25A 4AL4A 1DAEA 3MF4A 1NPTO 2C78A 4JNCA 1C80A 3WP0A 3PFNA 1Q74A 1C81A 5IVIA 5HGJA 4TVSA 2ZE7A 3B6EA 3H4TA 5KJEA 4QDUA 2W42A 4LXQA 3RF6A 3CR7A 4IGFA 4G0XA 1FFEA 4MPPA 3FRJA 4UUPA 4XH9B 4JC8A 3BWMA 5KC8A 1L7RA 3MS7A 3KJZA 1KYWA 1EUCB 3I5XA 2DB3A 3L79A 3O4FA 2FSVC 3D7KA 4KNYA 1F0PA 2MMGA 1XTUA 4QOFA 2HT1A 5IJ9B 4Q9DA 4PQYA 4B47A 1QO0D 3IX7A 1V48A 3IHTA 4RPCA 1MJHA 2C4UA 4HYYA 1A4RA 4RK6A 3EUEA 4BNIA 1NXPA 1RYFA 2ZSDA 4JR0A 3OE7A 3MD0A 4C43A 4EJSC 4AJ1A 4ZREA 2PMBA 4Q7MB 1TIKA 4C01A 1IZZA 3FHCB 3HA5A 4DOMA 1M83A 5FT9A 3HWWA 3KELA 1GV0A 1Y8RB 2YY5A 1KERA 1NNUA 1NHWA 4KXQA 1TUBA 2RSLA 5JAHA 3VOSA 2AC7A 2QX8A 1L8XA 2FWRA 1FX0B 2H9IA 3Q2IA 4B32A 1OLXA 4WK6A 1AXRA 3C1AA 2O0LA 3OO1A 3GFGA 4MKXA 2GNAA 4BO2A 2V3WA 2ZLBA 3A06A 4JUBA 3TSAA 1CS0B 1H8HD 4KLAA 2X0EA 1EWKA 4ZV4A 2XUQA 4XYLA 2NV6A 5KYUA 1WRBA 3B1ZA 2QX4A 3MJRA 3ZGOA 1EKXA 3FTNA 4EB6B 1DQYA 2C0PA 3I9OA 3EVZA 3HSYA 1JEYB 4MLCA 4L4RA 3D2AA 4J2TA 4E15A 1SZCA 3JWIA 3IEPA 3C1UA 4PZYA 3I1FA 5F98A 1T0HB 3N58A 4BLPA 2XZDA 2G63A 2V7BA 1KOFA 3PJEA 1YZYA 3E9RA 4AF7A 3B5IA 2JEOA 3AK4A 4ZQFA 4RVCA 5ULLA 2XQVA 1O0SA 3BIXA 1COWA 3DOHA 2VDLB 3ORQA 4RCZA 4UVEA 4NS1A 3DL7A 2BKVA 2NOAA 4MS1B 2Q2NA 3CSSA 1GAQA 3M9WA 4G0WA 1IUPA 4OB7A 1AXGA 1DFGA 4P7FA 4PGGA 3D5EA 2H07A 2F7SA 4QLBA 1V71A 3QPBA 3P20A 1PDWA 1NVTA 5C2JB 3R7WB 3UHPA 4K9QA 1EJBA 4CM7A 1D2NA 1RYBA 3I2IA 1MX9A 2XXJA 3WK7A 3FHTA 3SIWA 2IE0A 5IJXA 4G5FA 1I51A 4D0SA 1CUJA 5JDIA 2OWEA 1N5JA 1W0JA 2VT2A 1P45A 3TX6A 5HQ3B 2AQKA 4PCVA 4YJKA 1A9YA 3M6FA 3QU9A 4XYGA 5DX0A 3W90A 4RTPA 1NULA 1A0OA 3AW8A 5K0ZA 3D6UA 3HQ4O 5M2QA 1K9SA 3OH8A 1SQSA 1WNTA 1SXPA 1ISIA 3OQIB 1UC5B 2C9DA 1W6UA 5CR9A 4UUOA 2ZRDA 1I24A 1XN1A 2ADMA 1YV9A 1MVOA 5ADHA 3DDSA 3STYA 5J5CA 2XJ9A 2VPZA 2DC1A 3F3YA 3RVQA 4E09A 4UUBA 3WL4A 1M54A 3H6KA 4OY3A 4MYHA 3SLRA 4B81A 4GBMA 1Z25A 4MLPA 3TJMA 1WBBA 3MUOA 2MSDB 3DP7A 3PFHA 3AF6A 3H0EA 4FXPA 2ZK7A 3N2ZB 3CLHA 3VU8A 4IDCA 1GPDG 3DXZA 3ACCA 4OXKA 4HTAA 3T7AA 1D4ZA 4B3IA 3C15C 3ZI7A 2OP0A 3COZA 2ZZMA 4IHJB 5KZMB 4H4CA 3STWA 2Q4EA 4PCLA 3PP8A 4MYSA 1CKEA 1N25A 1QANA 1VE5A 4DLBA 4ENVA 3RK4A 2WJWA 1QFMA 3HSSA 1P1CA 4BQOA 3FGNA 1WEKA 2CL7X 4KO8A 3IEIA 2BD0A 1D4OA 1ZW6A 3OOEA 5CA1A 1N7JA 1GFIA 2WHQA 4Q00A 4NPAA 2DQ4A 2FEMA 1ZIPA 4TROA 5FKJA 3G85A 3BILA 4NV0A 1F8FA 3FB1A 1O5TA 1MC1A 2C5LA 2GJ9A 2CLMB 4ND6A 4TT3D 5CLHA 3U80A 4LECA 1J56A 1JI3A 1NNSA 2AL7A 3ZY2A 3A6DA 5IRCD 2ZE5A 1CE8B 5LR6A 1DP4A 2QAGC 2XNDD 2JI4A 5LZ2A 4G09A 1UC8A 4FN4A 2B5VA 2HZBA 5F3WB 4ZQBA 1O6ZA 2XTAA 1CUCA 2DR3A 4ZA2A 2VAVA 4M2LA 2YJGA 3O90A 2I03A 3SYLA 1KZ1A 3T5GA 3VAAA 1S2IA 1ECFA 4H1TA 1DTWA 4O0LA 3K0FA 4MVJG 1LPAB 4BJ3A 4DV5B 3D7SA 3GPCA 4OPMA 1AM4D 1VE7A 2NSJA 5CNMA 1HQCA 3VR1A 5B1YA 2ECOA 4IH9A 1KEWA 1EHIA 3O8QA 3F2VA 3Q12A 4NE7A 2VSQA 2OZVA 4KH1A 5D6OA 4DNXA 3RANA 5I7FA 3OQOA 4QLOA 3IODA 4CMHA 1JWLA 2XNCA 3I1YA 4AF6A 5ALIA 4QDXA 3MWDA 4AS3A 3AR3A 1GAXA 5JMOA 4OJYA 4QPPA 2EJCA 3GEDA 4BNNA 1KFBB 4UBLA 1WY7A 2ODNA 4JB0A 4LJ8A 4LKRA 2R5FA 5COAA 3WLRA 3MJTA 2ZQ5A 4MVCA 1W9MA 3IURA 3T1QA 2Q2WA 1GZ5A 1BWSA 3DL2A 3GT4A 3I6BA 5A62A 1M6HA 2ZEJA 3UGJA 5JFTA 2P1ZA 2BL4A 1GLNA 2A59A 3WQBA 4KREA 1VSVA 3D3KA 1YULA 1V8DA 3JAWA 4ED9A 2UU9B 3C7KA 3TXAA 2CMDA 2VZEA 3DMYA 1NE2A 1SG9A 2J1LA 4W1RA 5EKDA 1ICEA 1H93A 3OQHA 1B43A 3M9LA 2RHDA 4E4TA 2G0NA 5THKA 5J4HA 1VA4A 3OLYA 4NX2A 5IF3A 3OIVA 1FDTA 4XYMA 1VMEA 2EDAA 4A9AA 4N6GA 4QWMA 3GAFA 1QO0A 1BW9B 4N7RA 1XZCA 1ZMBA 1P33A 3FZGA 3DM9B 3IQFA 1WU8A 4R8RA 4BBZA 2OGUA 2JHGA 4P7BA 2ZUBA 3CUWA 1ZVKA 1CB7A 3HU3A 1QRTA 3NBFA 2VPQA 3M89A 4BMSA 4BMVA 3ON5A 3QEMA 3H0CA 2ZAOA 3MCVA 3AKZA 1GLGA 2QP3A 3LZDA 3L9WA 1WLYA 2RH9B 3GVPA 3QELB 2VNAA 3FLBA 3KALA 4PANA 3TQQA 5FUYA 3BRWD 1EINA 1QCCA 4B33A 2PX3A 2F6RA 3F9IA 5BUQA 1IAVA 1ODJA 1YCDA 1R4NA 3Q7RA 3QMWA 3TEJA 4CM8A 4QO7A 3A32A 3C5EA 1YB4A 3DCYA 4UOQA 4KH0A 2FKAA 2Q5HA 2HSGA 4M0CA 4WN3A 5HZKA 3GEEA 2A1UA 3RW9A 2VJBA 4Q1FA 2D1SA 3FMPB 3E27A 4RA6B 3P9XA 4TMFA 1H8HA 4PLYA 4LNHA 4ZYZA 1Z38A 1LBIA 4UHJA 4RETA 2PE5A 1UJBA 1FRQA 2PHZA 3INRA 2V3VA 3R24A 1GG2A 4PZUA 5KSOA 1E3LA 2IXEA 2R8YA 1F2UA 3K6JA 2Q5IA 1PRYA 3LCCA 3MINB 4QREA 5ENDA 2IV3A 5CB4A 3MJSA 1EVIA 1FTWA 1QPBA 4G5OA 1I5RA 2QZSA 1KDVA 2G4VA 2YOGA 1U0GA 3IJRA 4P58A 5AVXA 1DC4A 4UAVA 3GQBB 5IJ0A 1E3MA 4ZYVA 2HM7A 2WSIA 2WYIA 3OLWA 4MR9A 2GKSA 4ND8A 4JJ4A 5EQTA 6GPBA 2ACEA 2NXWA 4KGVA 4BGDA 3EVNA 5HIAA 4QARA 1PYOA 1Q14A 5LXTA 4FBGA 3F7MA 2R6AA 2A0UA 3VSEA 4CRWB 4UCWA 5I9LA 2ZT5A 2XMPA 4Z9AA 2PSDA 5KTNA 2ZJZA 1H0HA 3FNFA 3HU2A 4OYRA 3SQXA 3NPAA 1OYOA 3TNJA 4Y2RA 1QIHA 2WNSA 1N2IA 3L7NA 4A8HA 4YFVA 3NJ8A 4M53A 2BHRA 2BM0A 2SICE 3U0BA 3DKVA 3QQPA 4WLVA 1ISPA 1W35A 3VKUA 2XUKA 3B82A 2ZIZA 3DTNA 3G5AA 2BN4A 3LT1A 3TK1A 3VC3A 3WSTA 4RTLA 5JBQA 1HT2E 4RGQA 2BSQA 2X5JO 1PD1A 2O1WA 1OX6A 2H4YA 2XWBF 3FX2A 3OQVA 2B2NA 4IBOA 2XDQA 3RFVA 2IQIA 2DWOA 2OLEA 5TQVA 4RH0A 4I1OA 2PMKA 1N3BA 4PR3A 4DLAA 1YONA 4AP9A 2F1IA 5HQJA 2Q6KA 4E4RA 3G1TA 2HTEA 2H4FA 3BHMA 4LJKA 4U2DA 4KGDA 4H7KA 4RPKA 2ACVA 2GCEA 3E9NA 4YMIA 3S2IA 2QUBA 3A6EA 3QVLA 4LJRA 2AMFA 5K6TA 5ALSA 3WADA 4EEZA 5DM70 2R1VB 1RXEA 3AM5A 3CN7A 4LGCA 1A2KC 2WU4A 1KDZA 3K0EA 4ZHQA 2OP1A 3HO1A 1JSZA 2FQQA 2YIJA 4HLCA 1VPVA 2A2ZA 4BAZA 1PJ2A 4OHCA 2QLLA 2ZE8A 3COSA 4TS9A 5DNVA 4CVNA 3ZLJA 1LDMA 2BCJQ 2H54A 3RGWS 3EGDB 1GHTA 4YAWA 2ZTMA 3NHZA 1RCFA 1XD2A 2JASA 1S2LA 2JZCA 5F33A 3GMSA 4RZQA 2GK6A 2GEFA 4BBJA 1TJ5A 4CBVA 3RASA 3SEAA 4DT1A 2BTEA 1PQWA 4L3WA 1OGYA 1DDIA 1N8KA 3AG5A 5TRTA 3EFOA 1SQGA 2RH5A 3BXHA 3I30X 4MUEA 1E94E 1SCJA 3L0DA 5L7WA 4GZ3A 3N8KA 1UOPA 2BR3A 2CFOA 3FDXA 1EGVB 4W8OA 1AKMA 1K9VF 3CX8A 2VZLA 3OKAA 3RPEA 3ZV6A 4B7CA 1KQPA 4UOZA 1RXVA 3QVTA 1U28A 2OC4A 4BC0A 3L8MA 4PZ0A 2CXTA 3SY8A 1AKWA 2XTMA 4GLJA 4TT3A 4DF3A 3W79A 3KR0A 5KB3A 4BLOA 4YCLA 5EUBA 2ZYVX 2WKRA 5HTOA 2FPPA 2FQYA 4TQGA 2XNDA 3S5UA 3C5VA 2XT9A 1O97C 1O94C 2W2XA 2VYVA 2ZRAA 2NUAB 4NAUA 3MOGA 2C2ZA 4KCGA 3C7CB 5H9VA 3V48A 5AKGA 3RDPA 4ID3A 3DMPA 4B31A 2WKQA 1MP0A 1PK8A 1GLVA 3JWGA 4K9PA 1JR3D 1VPDA 3TECE 1TUBB 5I7AA 4D74A 4S05A 2V8OA 3D4PA 3M1AA 2OLKA 5LVAA 5D5QA 4QEDA 1QGDA 2HTFA 1R6DA 1XV5A 1ZINA 2Q3CA 2O14A 3JQ6A 2Y3IA 3M6UA 1BWRA 1ZJZA 2DQZA 2PCJA 2ZR7A 2FMFA 4D92A 2CY0A 2I2XB 4PSAA 5KYUB 1BHQ1 4MWGA 5AJZA 4ZTZB 1RJ9A 1VG9B 2OCGA 3DMFA 1CDZA 3PX7A 1K5DA 4Q16A 2O19A 1T2UA 1LVGA 4LMPA 4YI3A 1KK2A 2JEZA 3GVIA 3T5BA 1JJBA 3FSRA 4NF2A 4O29A 4IILA 2GF0A 1DXQA 1NHGA 5JQGA 2C2XA 2QQ5A 2QBYB 5BYJA 4YTEA 2XUDA 4QD3A 1AUPA 3THWB 4DBLE 4LZOA 2HLDD 3EHEA 4GX1A 4YRIA 3B52X 4C0JA 2EGHA 2J3LA 1T5IA 2PKWA 4NENA 1RSZA 4WECA 2O2IA 3FUXA 5BV7A 1K2VN 4BRUA 2FUG1 3AVYA 3AUUA 1UQUA 4B44A 2R47A 4JNKA 3HKCA 1G9SA 1C1HA 2YN4A 1W73A 2WEKA 5I7HA 3T7SA 4HJRA 1CJMA 1RM0A 3RFTA 3VU9B 4ZN6A 3HI4A 1VGQA 1T8WA 1WUIS 3ZNPA 1Z0IA 2JARA 3LPNA 3TS1A 2YOHA 1FYEA 3GLVA 4MW4A 1NN0A 1I6WA 1SKAA 1QE0A 3T5TA 3TM4A 1MT3A 3Q2KA 1NVXQ 3TLJA 4X94A 2VQ6A 4LYDA 1OY1A 4RZHA 2B99A 3FTCA 3D2CA 1CSEE 3FWHA 1ZLYA 1I1QB 4R2XA 5LBUA 4D8YA 4ZMBA 5F3DA 1G20A 1UDAA 4HB2A 3UAXA 2PGNA 1ZJ4A 2YC4C 3OIDA 5IWAB 1T4BA 3E5MA 1FYFA 3QI7A 3H1EA 4PZLA 4R5HA 3IPLA 5JPDA 2R11A 4GI5A 5F5LA 1FQWA 3EPKA 1CU1A 2ASVA 2AFIB 2Y2VA 5ECWA 3UT5A 3WNDA 4H0FA 1GKIA 4RAOA 1SC3A 2QNIA 6ADHA 3QOFA 1FB5A 3FWPA 3GJQA 3URMA 4WZBA 1BE6A 1R9NA 621PA 5B4UA 1XQVA 4YXFA 2QENA 4P4TA 3EBOA 5DRYA 4BTLA 3TG2A 3WP1B 4CDRA 2MR6A 4PFQA 3GJYA 2Q28A 2VUIB 4RVFA 4TWBA 1GZVA 3RJTA 5FWYA 3LY5A 5JNTA 1DBIA 1QHNA 4IOMA 2AGVA 3IAM1 5ILQA 1MNQA 4UE6A 1R9GA 2C0CA 4JP8A 4X7BA 4Y2JA 4I4LA 5KHOC 4GYYA 4IL5A 3FFAA 4O4IA 1VHTA 1SCIA 4YP1A 4H6WA 5BPFA 3DTTA 4FQ5A 5GM1A 5FXMA 2FPOA 3SBXA 3ZGYA 5I7OA 5G3ZA 4YPFA 5CITA 5LN1A 2BMDA 3Q10A 3F6PA 1UBHS 4JS0A 4C78A 3W5CA 4IF4A 4ABTA 2C77A 1XJQA 3V5NA 4F6RA 3HO8A 3F8WA 2AWNA 3KT8A 5AVOA 4XE5A 1X8JA 4W5HA 1AUVA 4WUTA 4FKMA 4TMZA 3GFQA 4OJTA 4YEDA 1DTWB 5F5NA 3K0FB 5ERYA 4ER6A 3KKLA 3R2JA 3P2JA 2IKQA 1P2TA 2N1BA 2GK3A 4TWIA 1CRWG 3T9DA 4XIYA 3VTFA 5B12A 3TFOA 1E92A 2XA9A 3QSGA 3TAHA 2ZSKA 2FI1A 3ZWDA 3SC6A 3QH4A 5FPTA 4K6GA 1DKUA 1P2VA 2EATA 2QGNA 2IUUA 1RE0A 2JCXA 4GE3A 2C97A 4R7GA 3OF3A 3TAUA 5B58C 1WZ2A 1VLVA 1XJCA 2VHTA 4EJ6A 5HRCA 1QR6A 2IELA 1Z62A 1E2HA 1ZN8A 2Z6AA 2QLNA 3K72B 2BV3A 3DDWA 3JVUA 2PSSA 5D3KA 4MX8A 5DHUA 3ZWKA 4F92B 3INTA 3A7EA 5J4VA 4QA9A 2IF0A 2GEVA 4HHEA 4YMHA 2D6FA 5IBCA 1PGPA 3Q87B 3M9XA 3USCS 2V6MA 4RLFA 4CMBA 4JUDX 4KACA 4MS3A 1IOZA 3MD9A 4E2XA 1B14A 1YD7A 2EP8A 3P9SA 4JYPA 3A3YA 3H6HA 1DT5A 5C4IA 1T43A 3DAHA 4KDRA 1XLTA 3KR1A 1JKMA 1OFVA 2IITA 3EA5A 3G79A 2FDXA 4HQRA 4INOA 4ENWA 2XD4A 4MV9A 3R5KA 1Q0LA 3RJ9A 1TO6A 3UZUA 2I4MA 4DEXA 1EP9A 1YACA 1P39A 1JHVA 1PBNA 1FVOA 4QJBA 5EPEA 4L9RA 3RS3A 3WBFA 2QUJA 3OTWA 3N6VA 3M6AA 2WLSA 5AK0A 2JEYA 2PRIA 1J25A 5DI9A 2DBVO 3OPQA 4FSDA 7GPBA 3TZEA 1F6DA 2MOKA 1ONOA 2VP2A 3OUTA 1Z4OA 4IO1A 1DWOA 4JIMA 3QEMB 4ZHQF 3A25A 2P5UA 1D03A 2EVWX 4G8BA 4CI0B 3HUEA 1ZVJA 3PUXA 1JR3A 4OGLA 3O3OB 4EY8A 1KNQA 3FCAA 4CM8B 2JIZD 3ZUPA 1PNQA 5ALHA 3R9IA 1VBMA 3TOSA 3UMMA 1YUNA 2VYQA 4D4KA 2A1UB 1X7GA 4QYIA 1PR6A 2FSPA 3GJ0A 4KJXA 3WE7A 3OTHA 4W82A 1XN4A 3ASYA 2XKAA 1SD1A 3AMVA 4OKSA 2F48A 4F93B 5ALLA 4JYAB 1ZJYA 1YZLA 1KVTA 2EW2A 1G16A 2OXFA 1BEZA 1IG0A 3E9DA 2UVPA 4KQ1A 3RYFB 2HN9A 2LCIA 5CB4B 4AJ4A 2NZJA 3KU4A 4F4DA 1R27A 4BNDB 4L5CA 4GL4A 3OSZA 5IJ0B 1E6UA 4HXEB 2JGAA 3PNSA 1FDSA 3LHIA 1IE3A 4MR9B 4ND8B 4XYEA 3RBZA 3RSZA 1PO7A 1L5VA 2H0AA 3G0OA 1QG2A 1Z5GA 4LDNA 5LXTB 2PGLA 5LYJF 3BDIA 3W2GA 3SDSA 2OORC 2I6QA 1OWMA 4Z4EA 1ZI9A 3MUNA 2GTPA 5DP2A 5IHPA 1TCBA 4XQ0A 1MXFA 3KLBA 4DIDA 4QPNA 1DINA 2GOYA 2ZROA 3C8UA 1JHMA 4UARA 1V7ZA 3CGGA 1WSAA 4IH1A 2Y1KA 1Q3TA 3U81A 1SQ5A 3ZD8A 1VPWA 3QM1A 1K3TA 4CT5A 4BN5A 2QU7A 4LF9B 1Z4KA 1UJMA 1FS6A 4I14A 3CUEF 3OTGA 4NG4A 4HXGA 1E9SA 3U9LA 1QLJA 3ICOA 1OGIA 2OK8A 4ZVSA 1K06A 2F90A 2G9UA 1SU8A 4E5YA 2FPMA 4DFDA 3G2HA 3U3OA 2PO7A 3WGTA 4WZZA 3KTAB 2AEEA 4UDYX 4L0DA 2GUWA 4IEIA 4CG0A 4ZQHA 1TE2A 1H4SA 3WDMA 2ZJ8A 5C32A 2MCFA 5KPDA 2PFSA 3ASUA 1II8A 5CT4A 4JY7A 3AUXA 1Z5OA 2WTNA 4K1LA 3H6GA 2FF7A 1E7SA 2QD5A 1UXKA 2D1YA 4IVPA 1URPA 3UMCA 2NQ8A 4MW5A 4DWJA 4F5EA 4MXDA 5I9BA 4J4TA 3EMKA 1GM5A 2FUCA 3TTWA 1XJ5A 2QRUA 3NQ41 3PD1A 1CNEA 1B74A 4LFAB 3H5IA 1XD2B 1ORWA 3NT2A 3D8NA 2GXQA 5IT9A 5EHNA 4B8WA 2CKMA 4YJ3F 1WXEA 4NMMA 2QLMA 4AURA 4GMKA 1NN3A 2YWCA 4GC9A 3GB9A 3GF4A 4GNRA 1EAMA 4EYQA 2CFSA 4WMLA 1YA4A 5EN4A 2H1WA 2XCIA 4IQFA 2ATEA 1QNFA 1XB2A 3GPBA 1N0VC 1ISRA 2IFTA 5E8RA 2CNKA 4DJ5X 1R7RA 4K05A 1EFCA 5JSQA 3DZJA 2PWPA 3ND5A 1NRJB 5B3JA 4KOAA 1W36B 4G2NA 3OLXA 1CUGA 4UTZA 4ZVTA 5JSKA 3BPSA 1U31A 1ZOPA 3L0IB 4H3KB 1TM3E 3BFVA 1SBTA 1XQ1A 1DQSA 4NS4A 1OIVA 5AW2A 4WK0B 4Z49A 3BT7A 3QLEA 3GLUA 1JKJA 3USZA 4CMEA 3LX6A 5LDHA 2J3EA 2QMQA 1D4FA 4IJ5A 5KAMA 1Y3FE 2E18A 2PPLA 4LZLA 4ZXFA 1D7OA 4G0NA 4RSMA 4A0FA 3IBGA 4YQYA 3HXMA 2ZJ1A 3M8KA 3FPAA 3YASA 5HUHA 2VNHA 5EINA 4OH1A 1SUPA 2ROQA 4JP1A 5FR1A 1X7WA 1FQKA 3RROA 2Q4TA 1RC0A 2HWWA 4R2WA 4C7BA 2CXSA 2XIJA 3TD2A 4LRSB 5JFOA 2PTHA 3WWYA 1C8KA 2V9ZA 5CIWA 1GFWA 2MYUA 3OP1A 2CK3D 4BN4A 3ZKAA 3RU9A 4AQYB 1O08A 2FDCA 1VKJA 3VHXA 5BR8B 3CO0S 1FPQA 3H4IA 1A95A 3AHGA 3H9JA 3SM3A 4JT2A 3TNDA 2P5TB 4YR9A 5HOEA 4FZ3A 1XTZA 4GVXA 4CTOA 1Q0RA 2HMTA 1MPTA 3ZXUB 4M46A 3ZIDA 3COYA 4R01A 5MFPA 2RI0A 2VATA 1J0CA 3FTPA 3L7OA 3BMNA 4AZ0A 4A3SA 5FA5A 5JAZA 3TZQA 4I9NA 5JQGB 3W9YA 4GG1A 2NPFA 3QXHA 1M2FA 4Q4AA 4FM9A 4PLFA 4AMGA 1O5IA 3R0ZA 3VHRA 1M0EA 2WNHA 3H7IA 1FLDA 4TRMA 8GPBA 3LYLA 2O8EB 5BNTA 4NENB 1RQPA 2GM3A 2VLIA 4O4HA 3URKA 3OEYA 1T2AA 4IO0A 5ESRA 3CHYA 3HKCB 4OA5A 3SLKA 1KI7A 1KVQA 2XYGA 5JCJD 4OYYA 4TS4A 4X1OA 3VVBA 2CHEA 2KLHA 1O7JA 1Z8NA 2NUTA 3ZIAD 3WLTA 3I32A 4R71A 2KS6A 2VKQA 3A28A 3MERA 2ZUEA 3IV6A 2WVHA 4KUHA 1E6EA 1OVGA 3N0TA 5GP1A 3BERA 1NIJA 3ZDEA 4M1TA 3PFWO 4LOLA 4P84A 5J4KA 2R6R1 1DAOA 1DQZA 3E18A 1IN1A 1E0DA 3QPWA 1TPYA 2JIZA 1G20B 1MHPA 2LDBA 1WMAA 3HP4A 4QRDA 1DTSA 2EG9A 4GU5A 1OU0A 1QGUA 4GD3Q 4CIXA 3MJVA 3E1KA 1BWPA 4CU5A 1J07A 1C8VB 1SBQA 3W77A 4OQDA 5I47A 2UUCB 1GN8A 3H1BA 2G71A 1OB5A 1E2KA 1YOVB 3MLBA 4WKGA 4Q1DA 5CFLA 2GBCA 2Q5QA 1TFUA 1DTEA 3NOXA 3UT5B 5IK2D 5ELMA 3ZX4A 5EZ5A 1V6CA 5A2QA 2QGFA 4Y2TA 1HTWA 3RRXA 4ON9A 1P0FA 3OX4A 4NC9A 1VLZA 4YUXA 1JW9B 2JFNA 2GA8A 3FJOA 4G5YA 4RMIA 2H2GA 2QRKA 4WZBB 1UBTS 1OTYA 1YZNA 2FFAA 2FLKA 4PAGA 1OCEA 3HJHA 5DMHA 3AR5A 1G20E 1P1RA 4WNIA 3ZGXA 4BNUA 4LXYA 3G68A 1BYIA 3T9AA 4EEXA 3AOGA 1KGDA 4RADA 5DSZA 5CCXA 4K81B 3QFSA 5FWYB 4QUBA 1EVEA 3G17A 4CT0A 1RCTE 3KHSA 2GPJA 5I48A 1G4AE 4QGSA 4TVOA 2A35A 4OUDB 1N6NA 1J42A 1RLTA 4Y6LA 4Y98A 5K0FA 5EA2A 5LA6F 2WA1A 1IOLA 2EKBA 1QBGA 3FE2A 2IE8A 1Y5MA 1AHIA 1Y33E 1B6TA 2CHGA 3P0FA 3PFIA 4WZBE 4F6RB 4OIMA 4H1HA 5C0OE 3W9BA 3NIGB 1IULA 2LWIA 2ZAGA 3MEQA 4QBKA 1KWGA 2IH5A 3CMCO 1DKRA 1VHJA 5B7GA 5ESDA 1M1NA 5D3MB 4UBNA 2W2MA 4Z4CA 2NW6A 1YRAA 3MWFA 1Z4JA 1SU4A 1HYGA 3LKVA 4U63A 4JVLA 3DQPA 2HJSA 3BE4A 5HZMA 2G04A 2G5GX 3SR3A 4K6CA 4ZIRB 2CXOA 2PXCA 4KHPB 1NI4A 1T3SA 3EOZA 3EJ6A 4JLSA 2XB2A 1EEHA 2XUOA 2MYTA 1L7AA 4H7PA 4DTCA 5H3HA 3ZUGA 3CJTA 4XB2A 4CIWA 2GHQA 1C8LA 4F2HA 2AW3A 4LDQA 3ILYA 1G8PA 3KQOA 4JKOA 5DNEA 5FLYA 1WD5A 4AG5A 3IKLA 5AI5A 3FROA 3H05A 4KQFA 5EZQA 5TSDA 1U3CA 4Z3KA 5TQ2A 3BKXA 2IH4A 4AN0A 5BN5A 1ZESA 4FYIA 1CIVA 1FRFS 2FK8A 1FPMA 2H7XA 4JXXA 3SJAA 4YT4A 3WGIA 2WI8A 3PHJA 1D07A 1ADFA 1HEIA 4LTNA 2QUAA 2G0AA 2B1GA 1X74A 4DSUA 4JOQA 4AULA 5CA0A 3KB8A 3SQLA 3LVQE 4IWNA 3DV0A 2Q8NA 5H0IA 3SJ7A 3WHKA 3FMFA 4M21A 1OFHA 2NV0A 4TN1A 1XZPA 1KMMA 2BP7A 3GEIA 3L84A 4ECAA 1PFUA 1X2EA 3V1NA 4XD7D 4BUZA 3CRQA 1TYAE 3A37A 2A94A 2FSVA 3VO9A 1XDWA 4C3VA 5BRNA 3C8DA 1KZGB 2Z2ZA 2Q2VA 3T95A 3FDJA 4ZP1A 4CXMA 5FYQA 1IWOA 1A7KA 4KGXA 4ZGBA 1DBRA 1R4AA 1ISGA 3O8NA 2H08A 4GZLA 1G4UR 5E3JA 2G1KA 1O5OA 3BD8A 1T8SA 1NC1A 4EJSA 1N9KA 2H63A 4J49A 2IHKA 3L7KA 2BKEA 3UNXA 3Q8MA 3U44A 1JQKA 1DADA 2NZ2A 3BMOA 3ZW8A 1G8AA 1Z16A 4NBVA 5JNUA 1EE9A 1XZQA 2WIDA 3QKUA 4DGQA 1XNQB 4QYIB 5DHSA 4YYZA 4IJKA 5CD9A 2CFCA 4L5AA 1QFXA 2FOLA 2HBQA 2AN1A 5TMPA 4JGGA 3FSEA 2ZI9A 3BD9A 4PE5B 3RVNA 4EAAA 1TD1A 2NGRA 1T5DX 5HM6A 2UVPB 3UQZA 3K32A 3MT8A 1LS6A 2EWMA 1JR3E 2WF5A 2WHPA 3HA2A 4R1TA 3WA7A 3G8BA 4FFMA 4MR8B 4C03A 5BNZA 4MQLA 1LQ2A 1TM7E 2OB1A 4FDMA 5E7QA 4LRYA 5IAEA 3S55A 3WFJA 3MPUA 4DLYA 5MN4A 3A1FA 3E9QA 3FOBA 3ORRA 2JAQA 2P8JA 3QYPA 2OFOA 4LYFA 4FOLA 1ABFA 1L4BA 2JIOA 5L95A 1J70A 1L5ZA 3EAGA 4GPEA 2Q99A 4NZNA 1DBPA 1UMKA 4GOKA 1Z7GA 4X61A 4YGXB 3H19A 1OAAA 4KYUA 3V4PB 5H4GA 2X5NA 3DMRA 1AV7A 2V6BA 5DWDA 4B4WA 2GFQA 5JCJA 1K7EB 4NBUA 1DVRA 4WAUA 5J4YA 4O3MA 4Z9YA 4XRGA 3PPVA 4MVJH 2AE2A 2W6IA 1DQNA 3U3XA 3ZIAA 1J2JA 1FP7A 4JD5A 2G07A 5HP4A 3IIJA 3SX0A 2OFWA 5AVJA 4Q3DA 1TKRA 3HCPA 1BGXT 2XDAA 3FRIA 1L6RA 2YNMD 3JYLA 4U9IS 5EPOA 4F97A 1JDSA 1JFFA 1NTOA 1TA0A 2PGOA 2XIQA 3N3BC 1N77A 1R0RE 4QAQA 2OTCA 2M9MA 2MR5A 2PT7A 2PUWA 3NGMA 1KR2A 2ZIUB 4JC0A 4O2AB 5AW7A 2A1TS 4RTRA 2DHQA 2FEOA 2H1RA 2UYGA 3B3AA 1J0EA 1XPJA 2NO0A 2ANBA 1QIGA 4J3JA 5FBQB 4L4UA 2H2IA 1O8BA 3IA7A 5JJ5A 5EG5A 3KJQA 2HRCA 5DASA 5IK2A 5JPCA 4ZTUB 2IUYA 3B60A 2GPNA 4ZOBA 3PDUA 1WS6A 5A5GA 5KINB 4O5OA 4X54A 3TO5A 1GUFA 4JYBA 1K88A 4MR7A 3H7AA 4QM7A 2HMVA 2PX6A 4X20A 3TVYA 1E1CA 3L1VA 2O8NA 3LCJA 4W1SA 3SYNA 3WYDA 5B3LA 3NC0C 3RM3A 1SURA 4X8OA 1OYWA 4CMJA 2JLAA 4OEHA 4OL0A 1X7ZB 4RWEA 3O8CA 4IDAA 2BGWA 5FL3A 1U4NA 4JQZA 3HN6A 3FA2A 4X92A 4MA0A 3TUZC 3CO5A 2EL7A 3D7MA 4H3VA 4TRJA 2JLBA 4RVOA 2M32A 4PRZA 3K1AA 2O5EA 1TVMA 3DAFA 3NHFA 3ZBQA 5CIYA 1HM5A 1ZBDA 2JH9A 3DOFA 4QODA 3SD7A 2I54A 3F97A 4GL2A 2Y1LA 3G3EA 3ZHZA 1G8MA 1JKJB 1Z83A 3BGVA 3KQQA 2G5TA 3BL8A 3KWJA 5B1DA 4BZZA 1CP3A 1L5YA 3Q8WA 1SO8A 1O94D 2RAFA 1SKQA 2COKA 3HNOA 3NB0A 4I19A 5LIPA 3HMQA 1GYRA 3LXRA 4QX6A 5HMLA 2W93A 4H3HB 4ROTA 2QPOA 4KXXA 5FHRA 1X7WB 3ODPA 5ALWA 2QZZA 1O6GA 1GL9B 2GZAA 2PS9A 2M1XA 3L40A 3L8HA 3KYIB 4HX5A 4I5GA 4UCXA 5D85A 4LFBB 4ZHSA 1R6BX 1SVIA 1U11A 3QBEA 2VF7A 3GUYA 3H8SA 4TV8A 3LA6A 2AIRA 3B12A 5EUQB 1HC7A 4D42A 4WZAA 2QG9A 3F4LA 3K1YA 2I8CA 5EMHA 4EPYA 1KS2A 1N1EA 1EUDB 4JX8A 4JYMA 1ESDA 2IS4A 5FO0A 2Q62A 4JZKA 2RHCA 1Q44A 2H9AA 2I0FA 3H9BA 1SY7A 3JYOA 3EXEB 4CZ2A 3U4DA 3BMNB 1LI7A 2CDNA 4AZ0B 1O0BA 4OIFA 3WWDA 3L8GA 4UM7A 1KMHB 2F3TA 2VYFA 5TNXA 2HDNB 2OGSA 4S2EA 3T0GA 1I7LA 4H31A 5BV1A 4Q4AB 5K7SA 1O0CA 2V1XA 2G8NA 3H9EO 3S70A 4M8NE 2OXEA 1T3GA 2J5KA 2PLAA 1SVSA 2KPOA 2VDVE 3IUBA 4LFCB 4C14A 4WY2A 5YASA 1OZHA 3L6RA 1Z29A 3CXRA 4QXQA 2OO5C 1ZEMA 4X97A 3ONEA 1P74A 3KUXA 4B7AA 2W90A 3NFYA 4JJGA 4O4HB 1B0UA 1ILEA 4C0WA 3HBLA 2ZM6B 4I4TF 4QXMA 5DMXA 1QRUA 3UC9A 3HYCA 5HBGA 3QNWA 4KJZA 1IWBB 4I1SA 3CKKA 4HX2A 2YXNA 3X44A 5B7PA 3ICPA 1Y9JA 1JIUA 2NUTB 2VAMA 4Q3EA 2ZIVB 3IPXA 2H4ZA 2UUOA 1U9JA 1JJFA 2QXUA 4AY3A 4FGLA 4HDAA 5AKEA 2NX2A 5FIUA 6YASA 3EPLA 3LTEA 1I7PA 3EBPA 4J0HA 1QJ4A 2CHFA 3ESBA 3JQGB 4UJ3A 4CM5A 3LQ2A 4DC1A 4ETIA 4PYJA 2ZYWX 3MAAC 2H31A 3ZGNA 1VG1A 2ZBGA 3ZE7A 4X0EA 1E64A 5TLSA 1ZM3A 3JV7A 1Y7HA 3ETJA 3OEED 1QGUB 4BNGA 4LAFA 1VL8A 3AHJA 4ZKEA 2QTRA 1P7WA 1T9ZA 4CM3A 3F73A 1YWGO 4COOA 1Q0UA 3DT8A 4W5QA 4CEIA 1XDBA 2I4TA 4R6WA 2D2EA 5NLLA 5CPFA 1VJRA 5F9HA 2V59A 2XHEA 3ADPA 5CX1A 2X1LA 4UKDA 2BFCA 3GGSA 4JEIA 5JC1A 3HB1A 1NJFA 3EW7A 4J2OA 4I0WB 4FNGA 4QDOA 2GHRA 2GPTA 4W5JA 1GCIA 3N5CA 1BVYF 4XIFA 4OX9Y 3TIVA 1MBZA 3C1TA 3MTEA 1U04A 1NX6A 4K7JA 1C3JA 1TX4B 3WS7A 4F6LA 5HS6A 3T7TA 3TJZA 4TTJA 3CZ4A 1F3OA 3DTVD 4K8RB 4RIGA 3W4JA 2NU9A 3TDMA 4EHIA 1DGQA 2NM0A 2GM9A 4LMRA 1FYDA 1LSJA 4JFRA 2ZKLA 2VT6A 5FOTA 4JLWA 4IDHA 5JCXA 4KPYA 2ISCA 1DEOA 1H4VB 4ER0A 3L4JA 1ZIDA 3CSDA 2XUHA 3A1SA 3QGMA 3WGMA 4YASA 5FULA 3T4PA 4OH7A 4V0SA 4OGFA 1D5CA 5JC8A 1USKA 1P5HA 2COEA 5I7EA 1M2VA 1H8ED 4QC2A 1M1NB 2R9VA 3DHVA 3CLRC 2PGDA 4U7PB 4BX8A 4DLLA 2YNMA 4MSUA 1G41A 1N2JA 2XMBA 2Y4OA 1EE1A 1VBNA 2VJQA 3KYDA 4M0DA 1QLHA 1QRAA 2XBMA 1GAWA 4ZCTA 1L3BA 2CEKA 1SUWA 3OTQA 2WT4A 3P19A 1JAXA 5ALFA 1RHRA 2V9CA 4TYYA 4ZEOA 4JJ7A 1P0CA 2WG2A 3KVOA 4J0QA 4J9UE 4KN6A 3ED5A 4TZTA 4XGIA 5GONF 1YE8A 3TLYA 3MA0A 4L8LA 5E4FA 1U0SY 1NVDA 3LD9A 4EENA 4FB4A 3PEEA 3G8CA 3LCUA 2PNJA 3OJCA 4F4IA 2RHBA 2RJOA 2VPPA 3A4MA 3K0BA 3H17A 2PKEA 3L1IA 1LC3A 3L4BC 2R4TA 3NG1A 5K09A 1VHWA 4DRXA 3IEMA 1DWPA 1TZ2A 5TQ2B 1A04A 1UKYA 5CJPA 4PVCA 4DIKA 4JC4A 2OWDA 2C1XA 1BVHA 1IHYA 2DP4E 1Y1LA 4HWPA 4AY5A 3A58B 1QH0A 6AT1A 1TPZA 1MNAA 1P4SA 3H8JA 2ZKIA 2ZRQA 3G6KA 3DWEX 1IHPA 1YQWA 4KG7A 3UCEA 3VMMA 5CA0B 5INTA 3VKWA 5A6VA 4KPUA 3EODA 1MOQA 4U6SA 4UW9A 1IXYA 3HXPA 5CFPA 5EYPB 1E2UA 1LH0A 4MQFB 4XX0B 4N7BA 4YS6A 1V5GA 3R8XA 3SE0A 4ZQCB 1QZUA 2GAJA 4GKBA 4C0AC 4D9EA 1A27A 1PL8A 5C52B 1V1JA 4Q15A 5IT5A 4PC1A 4K86A 3HEBA 3ZXSA 3I09A 2AB0A 1M76A 4J75A 3WHLA 1EZZA 1VC2A 2VXOA 5EXEA 3WAJA 3DL4A 2FPXA 1RI5A 3S3TA 3ZD6A 5F2KA 3U40A 5L4LA 3ZU6A 2Z5VA 1Q7GA 4MEAA 4DLZA 2EZ4A 1ZSYA 1O94A 4BVFA 4P33A 1P31A 5EJ4A 3P9CA 3VUFA 2WM3A 3TG8A 1Z35A 3MWLA 1H2XA 3BMOB 1QHXA 5F7XA 3BVPA 1NFFA 4LDPA 2FHSA 4HYQA 4M8SA 3PCTA 4ADSG 2IWHA 1JI0A 3GP8A 5HK9A 2QSJA 2QLTA 2AG6A 2MJLA 3EXHC 1YS1X 1RJFA 1GTSA 1R16A 2GRAA 3NV7A 1HSOA 3CRVA 1F06A 2RBEA 4JVMA 2ZBQA 4DY4A 3TR5A 5I3CA 1DFIA 5ALMA 3ENKA 2LP4Y 2Y1OA 3HABA 1REQB 1AK1A 3HYSA 3P2OA 1VL6A 3VZQA 2IXFA 1NVVR 2GEBA 3VXKA 4FZRA 4AY6A 5FBVB 1USGA 3JWPA 1NV8A 2QJOA 3WLMA 1PEKE 1ZD2P 4C0SA 1F51E 2P4HX 1V7PC 5AVSA 4EF6A 1CQJA 2ZBPA 1GDHA 1CUVA 1JWBB 4JZYA 5BYBA 3UHJA 2PCLA 1U0BB 3HK2A 1I7NA 3MTJA 3PTZA 2XMSA 3AI2A 4IM7A 1NSFA 2Q0HA 2VRBA 2AG0A 1PFQA 1UBKS 4A36A 1V11A 1ELOA 1Z4QA 3LW7A 2FOIA 4FBMA 4GAEA 3V2UA 1NNEA 1IQ0A 2IEZA 2ZZNA 1PW7A 2VZ0A 4LZAA 1DLJA 2XTJA 4GWGA 4H7EA 3CN9A 2N0SA 3LX8A 5EERA 5HILA 4QYSA 4F46A 2AZMA 2GFIA 1G21A 4ODIA 3WOVA 3CH5A 3EIEA 3BRSA 4D43A 5CLJA 1L7BA 4WK2B 4YK7A 1QFYA 1A98A 3ONNA 1VYUA 3N87A 4GOND 4JU8A 2J9FA 3ZJVA 3FYUC 2IW3A 2QD2A 1EP3B 1HYEA 1JFFB 3F3SA 3KZXA 2OCBA 4RK0A 4S1VA 4UM9D 1L5LA 3SHWA 3UJ6A 2I9KA 4WFKA 4E5PA 4ZGGA 2H0RA 4DL9A 1C29B 1WV0A 2H06A 4IW3B 3HVUA 3K92A 4X6LA 5E2AA 1SGWA 3B5JA 3OEEA 3U3DA 3Q0EA 3KX2A 4H7FA 4I5EA 4KQ2A 5KJ6A 4BMZA 4AX8A 1NXSA 4URYR 3AB3A 3W78A 4YRFA 2X0RA 3FOCA 2C0QA 4DTIA 1VE3A 2QPTA 4QU0A 3AP2A 1QE5A 1UPAA 2LE0A 3PG5A 2ONCA 3AHEA 3QITA 4X63A 5BW6B 1AMNA 3EEBA 2VTBA 1AF7A 3MNFA 1XKLA 4RHEA 2J3JA 4HPJB 4V0RA 3OCWA 3OT1A 1C0LA 4FCWA 3KT3A 1VYTA 2Q3MA 4M0PA 4U3JA 3R1IA 2QB5A 1UKBA 3KD2A 4HNAA 4HUQA 2YL2A 2NSHA 4UNQA 4X45A 3SHVA 1PEYA 3BXPA 1EFVA 4B73A 3U19A 4YCNA 2JGEA 1FTQA 4H59A 4HTFA 4CKZA 1NJ6A 5KOHB 4H7JA 3O74A 3GJTA 3MFQA 3DTVA 3PQ4A 2IYTA 5JS1A 2FK7A 3PFFA 1NSYA 1N57A 2ZIEA 3JZMA 1F8XA 2R7MA 3HCWA 4UZSA 3QBDA 1OLUA 3I6IA 4RVHA 4UEOA 4WY5A 3WGVA 1OQAA 3JATA 2LRHA 3KM0A 2P4QA 4PS1A 4C1NA 4H60A 1BKYA 4RSGA 3K1AB 2HCTA 2QTVB 1RNLA 1C3OA 2FZVA 3BTVA 2A4KA 3BB4A 1L4HA 2BHNA 3D7RA 3KPWA 4ZMRA 3D1JA 2V4MA 1FFYA 4C3OB 1ULAA 5JDCC 1B1AA 1SBNE 3U3RA 3N39C 1MR3F 1ZK3A 3IDAA 4IRXA 3EQ9A 1Z4NA 4ECEA 3VYSB 2UV8A 2ONKA 5E6RB 3DVQX 1PI3A 4GX2A 4PLZA 1FUUA 3WNZA 1JU3A 1B41A 5U4QA 5A05A 5JZOA 5FJIA 4US2R 3P0RA 2R6ZA 1P1KA 2C2YA 4DMGA 3NWEA 5K4HA 4F96A 5CHEA 3BREA 1Y8CA 2JRCA 2DT8A 1DCMA 2IPMA 2XTNA 3DTYA 1GPBA 2P2LA 4MW6A 4IEFB 4WZAB 5BNFA 3WGJA 1B6GA 5M7EA 3G2MA 1DARA 4FEGA 3ROMA 3QXCA 3EY4A 2JLZA 3PVCA 3BJEA 3LFTA 1Y1RA 4PG5A 4B45A 2QORA 4R2MA 1X70A 1XOIA 1U6KA 3NBAA 1SD2A 5FORA 3T38A 4B3TB 1TM1E 4LQCA 4MDFA 4BP1A 1SHJA 1BXRA 2Z57A 4ZVVA 5TVKA 3FG9A 1YAHA 4B80A 4D3ZA 2VQDA 4DXHA 4AJOA 1P0QA 4MCAA 2P68A 3LT4A 4Q9HA 5D01A 1IB6A 1KIFA 3OZUA 1P0MA 3PC2A 3ZE9A 4Q1EA 2FWBA 4LVUA 4WZAE 3ZQ6A 2HXYA 3PLAE 4IJMA 3WDSA 2YY6A 2J9GA 3RBXA 2B0CA 3BCSA 4S0ZA 1H0RA 5ICMA 3UAOA 5BSRA 1WP4A 5L3RA 4NBKA 1ZMTA 1II9A 1P3DA 3B85A 5FWXA 3GLTA 2JGIA 3OCZA 5KJ1A 1A8SA 2I78A 5C5EA 3NHWA 1PKEA 4L6AA 5MHTA 1VIDA 2FP3A 4A6PA 4K26A 4DARA 2HIAA 3ZS9A 1Z7WA 4LRTB 3DZFA 3IAS1 1G98A 3EIWA 5HKOA 2RI6A 3E7FA 4BO5A 4IIFA 3NO4A 5JR3A 1AVTA 3LY7A 1MEEA 2HK7A 1OH5A 1W85A 3VR6A 4DNPA 3TUIC 1DL5A 3HVRA 4MUMA 1E7QA 3PUVA 2Y1GA 4JKYA 3PUZA 5JADA 5IDVA 4HMOA 2ECFA 4IDBA 4PX3A 2WWIA 2Q6TA 5KSZA 3NMUF 3PSAA 2DFNA 3WTBA 3JWJA 4RTJA 3I04M 2XA2A 3NHPA 4JI6B 4C04A 1ORRA 1YHNA 2ZZKA 3MAJA 4CEIB 4HUTA 2RJNA 4DCCA 3KYJB 4QG3A 3QFRA 4J9VA 5CD1A 4LX0A 3KB2A 3I9NA 5CTJA 3HXKA 5KQRA 1FJHA 2BHTA 1Z6PA 3INGA 4BDSA 1E4VA 3WIEA 2VXYA 3DWIA 5LZ9A 3JZFA 1CR4A 4L78A 1GZHB 1SCAA 3DO6A 1UIRA 1KFCB 2EFJA 1YR3A 3N2GB 4K9DA 4MB6A 2RD2A 1WCXA 2P2YA 5EXXA 2P3SA 1XHFA 3AVPA 1DO8A 1ZK1A 1YVPA 4EMTA 3EFBA 1KDRA 5HFJA 3O5AA 1H2YA 1IHDA 2GPSA 4OP1A 4R6XA 4PV7A 5HZHA 5JYEA 4OQLA 1RM4A 5LDGA 2NU9B 4GUDA 3OWHA 5B4TA 2HPVA 2OORA 4ZEMA