1JE4A

Solution structure of the monomeric variant of the chemokine mip-1beta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
b'APMGSDPPTACCASYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords macrophage inflammatory protein 1-beta
publication title Structural comparison of monomeric variants of the chemokine MIP-1beta having differing ability to bind the receptor CCR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1je4A00
1NR2A 1WTWA 1O7YA 3I91A 1E0BA 4IUVA 2L11A 5T1GA 4QUCA 5CBAE 1B50A 2FMMA 1WTRA 2XIWA 5CBEE 5AFWA 2RSOA 1X32A 3MWYW 1QG7A 5DNFA 1HUNA 2B2VC 4ZAIA 4CJ2C 1WD1A 5EPJA 2HDMA 5D14A 2L1BA 1BF4A 1WTVA 4XDXA 1DOKA 4X3KA 2JYOA 2K28A 1MI2A 2HCCA 2RA4A 1HFNA 1DOLA 4IUUA 3H91A 1O7ZA 2FINB 2CVRA 1PLFA 2K04A 2X6LA 1SDFA 4RAUC 3TN2A 4X3SA 4XT3B 5EPKA 1G2TA 4ZKCB 1EIGA 2SDFA 1U4LA 5EPLA 1EOTA 3I3CA 2RSNA 1RTNA 2B2TA 1WVLA 1F9QA 1WTXA 2FHTA 1BO0A 4XT1B 4IUPA 1JE4A 4X3TA 1A15A 1F2LA 2D9UA 4NW2A 1J8IA 1M8AA 3D6WA 1AZQA 2RVLA 1EIHA 1G2SA 2DY7A 3HP3A 1MSHA 1RTOA 4IURA 1KNEA 1U4PA 3F2UA 5EQ0A 1QE6A 5T1IA 2B2UC 1X3QA 4IUQA 1HA6A 1DOMA 1ML0D 1PDQA 4RWSC 2MPMA 3R93A 3QO2A 4ZLTF 1AP0A 1LV9A 2B2TC 1RJTA 3GV6A 1GUWA 5D65A 1B3AA 4OIKA 1BNZA 2B2UA 2L4NA 1NAPA 1NCVA 1PFNA 3MTSA 2MJ8A 2J7ZA 2Q8RE 2N88A 4IUTA 1B53A 4MN3A 1ICWA 1S4ZA 2KECA 2KOLA 3N52A 1HRJA 1J9OA 3KBXA 5JJZA 1JICA 3ONAB 1O80A 3DM1A 2NWGA 1MGSA 3I8ZA 4QUFA 4MHEA 3SVMA 1NR4A 3IL8A 4U68A 1EL0A 2R3ZA 4HEDA 1XX8A 2HUGA 3FPUB 2HDLA 2H1EA 1IL8A 1DONA 1RHPA 1B4OA 3KUPA 2EPBA 1IKMA 1G91A 1F9PA 1WTQA 4O42A 1BBXC 1DZ1A 3IFDA 2EOTA 1XYIA 1WTPA 3UI2A 4R9WA 2EE1A 4HAEA 1ESRA 1MSGA 2B2YA 1PFBA 3FDTA 2BDNA 3P7JA 4CJ1B 4ZK9B 4CJ0B 2JP1A 2X6GA 2HCIA 5E4WC 2KVMA 4UAIA 1G6ZA 4HSVA 3DEPA 1CA5A 2K01A 3I90A 5EKIA 1VMCA 1B2TA 1QNKA 5CORA 4LMQD 4ZKBB 2KUMA 5COYA 2KEDA 4DN4M 2B2WA 1PFMA 2X69A 1WD0A 1C8CA 1SSOA 1ZXTA 2L9HA 2FFKB 1U4RA 4OIJA 1Q3LA 4R8IA 2MGSA 1X3PA 2B2YC 2DY8A 4RA8A 2Q8TA 4HCSA 1AZPA 1F9RA 5E4XA 3DEOA 2NZ1D 2FJ2A 2K03A 1EQTA 2M2LA 2VXWA 3GV3A 5CMDA 2MP1A 2IL8A 3TZDA 2B2VA 2L12A 1HHVA 1U4MA 3LWEA 1ILQA 2KEEA 5EJWA 2K05A 1ILPA 2K1BA 1CA6A 4X3UA 1F9SA 1SAPA 1VMPA 2NYZD 3G7LA 1KNAA 1TVXA 1RODA 2B2WC 1CM9A 1WTOA 1HFGA 3Q6SA 1HUMA 2N55A 1IKLA
chains in the Genus database with same CATH superfamily
5CV4A 2OT2A 4JBJA 3G6EA 2CQOA 1CK1A 3UE1A 2ENBA 2F0WA 2NN6G 2L1BA 4FO2A 3TRZA 2RA4A 2JEAI 1NY4A 1TT2A 1CQFA 1N33L 2EYHA 4QMGA 1M4VA 4X6AH 4HIKA 4CKCA 4BBSH 4PMCA 1EOTA 2CQAA 2O2LD 4O1NA 3TP7A 2UXBQ 1F2LA 2Z4HA 1K83H 4MNOA 4JI4Q 3RN5A 1GM5A 1UE6A 2JA6H 3G71A 4DAPA 4LF9Q 3PO3B 5JPNC 5EQ0A 3S14B 1CZGA 2B2UC 2JA5B 1EWCA 3E0JA 3LGJA 1RDPD 1SNMA 1IW7D 2I5HA 1KDAA 1XPRA 1T5XD 3J80E 3AQQA 4FF2A 2DGYA 1WFQA 3KDFB 4ULLA 4EX5A 3QJYA 4AYBG 3S1MH 1D8LA 3GTJH 5C44H 2MFIA 2WINB 1B9NA 1NR4A 2JJQA 1Y14B 4PV1C 2WFWA 3LX0A 2HUGA 1SRUA 1VQMA 3E9IA 1JE5A 3HKZB 4HJ9A 3CC7A 2VB3X 4BWGB 2EYMA 4A3IH 4YHHL 1S40A 2RHSB 3ULJA 4PZ6A 1PRTD 4C3HG 1X3FA 2K33A 2GVBA 1A3VA 4Q5VA 1W3SA 1I4PA 3KJOA 3UDGA 2QCPX 4ZKBB 3T13A 1QCBD 2KEDA 4OGQC 4DN4M 1LT4D 1PFMA 2Z6KC 4FDBA 4WJ4A 2Z4IA 3WWVA 4F7XA 1X9NA 2FFKB 1EY0A 1N33Q 4J1MA 2WP8J 1EQQA 2LXKA 2JQOA 1C48A 2IHFA 5E4XA 2I0QA 4IFDJ 1D5ZC 2EXZA 2K5DA 1VQEA 2K05A 2N3SA 2CWAA 4FF1A 1XTCD 1EQVA 3S2HB 3L3OC 3HOUH 3C46A 3L9AX 1L1OB 3I72A 4DV3Q 4YCUA 1B50A 1PH6A 3CRLC 3PO3G 4POFA 1SN8A 1HZAA 3A0JA 4KN4C 2CVRA 1TWGH 3NK9A 1E3PA 3I2ZA 4JI0L 5GAEC 1Q8IA 3NBIA 2FHTA 1UUPA 3KF8A 4JYAL 1JE4A 3EJIA 4QL5A 2NUCA 2F0TA 2YTXA 3STBC 3UDXA 4IN3A 3BDOA 4DUZQ 2VUMH 2A19A 1DOMA 1ESFA 3HKZG 3R93A 3RLFA 3RZOB 4AH6A 1SEBD 4HJ5A 3TS0A 1B3AA 3PUXA 2PYKA 3CCEA 1AE2A 3S1NH 4LF6L 4R4QA 5C4HA 1YBYA 3D3RA 3ONAB 3BDLA 3CCMA 4MHEA 5LMNL 1EY8A 1GHKA 1ENAA 2XTIA 1IL8A 1DONA 4NXML 2TMPA 2R92B 5ELDA 5M3FB 4IALA 5KIXA 1DD2A 3S2DH 4A3DB 1KHIA 1KLUD 4DK0A 4HAEA 4EQOA 3M4PA 3NP8A 1ENFA 4MTNA 1CTMA 3DUZA 2ES2A 1VQ6A 2K50A 1MJEA 1E22A 3H3VC 2AQ3B 4HCEA 4CGYB 4DV6Q 5COYA 2B63G 4ME5A 2EYOA 4DNIA 1EIFA 2DJGC 3DEOA 4JI7L 5CC4A 2AWNA 4IO9A 4JYAQ 1U4MA 1LM0A 3W1BA 1Q1EA 1EWHA 5EJWA 3OTOL 3URYA 4N9PA 1DGSA 2O4XA 2Q2TA 3BVZA 5I9PA 5C3EH 1I6HB 4DNTB 3H09A 4XQQA 1HFGA 3J81i 1X56A 2KHJA 4HTHA 3CF5A 2F03A 5IGFA 2F52A 1OO9B 4RHRA 3HOVH 2JSOA 4JVZA 3ERQA 4GKKL 4ZAIA 3QR8A 1WD1A 4GNXC 3W3AA 4A75A 4KLKA 4PMWA 2PPBC 4LF6Q 3K8AA 4M8AA 1PLFA 2A68D 1DYQA 1CZWA 4FXGC 1E1TA 4BY7B 2WAQG 1F9QA 1C9OA 1QNUA 3C1FA 3OMCA 1QUQB 4NXMQ 4C3JG 4DAYA 4LF5Q 4LAAA 1VQCA 1CSQA 4JK1C 3JAMc 4DPGA 2IX1A 3H3VH 4A3CG 5CR3A 5GROA 2JA7H 4X62L 5KNDA 2AUJD 1HA6A 2IJ0A 1PHJA 3HOWH 3GTMH 4NKLA 2R92G 4K2LA 1TWFB 5M3FG 2BA1A 3BZKA 4C2MH 2EVBA 2Z6BA 4DR4L 3VR2A 3MA2B 1E2WA 4XTCS 5C4JH 1JOOA 1STYA 2AWOA 3ULLA 4G7HC 1XX8A 2J4XA 1HR0L 3PUWA 5LHY1 3OTOQ 2QGQA 1WTQA 3IFDA 2EOTA 2UUBL 2Z6KA 1IBKL 4R9WA 5EKKA 2EE1A 2ZJQA 4DXGA 3I4LA 4DV7L 4XQJA 3M3YB 4L5SA 4LWCA 2BDNA 3DWAA 4CJ1B 3OOCA 3RMHA 5IT9c 1CA5A 1KABA 1I94Q 2UUCL 4GKKQ 3CPFA 3MHBA 2BH8A 1CUKA 5L37A 1XNQL 2C9OA 1X3EA 1WOCA 2NN6H 2RCNA 1ZXTA 4DR5L 1SYFA 5BN4A 2BOSA 1YZ6A 3PO2B 1I5FA 2IL8A 3SDZA 4R4TA 2L12A 3CW2C 2LXJA 3GTQH 3RN2A 1EFID 5KRUA 4QB4A 4X65L 1K3RA 1DCZA 1H95A 4LF7L 1XNRL 2ICEC 1FJGL 1Y8OB 1PFSA 2JE6I 4X62Q 4BY7G 1LLRD 5IP9G 5C0XJ 3I55A 1R9TH 1O7YA 3I91A 1H9SB 2L11A 2DN8A 2EZVA 3M4OH 3S17B 4CJ2C 3CAMA 1NMGA 1EY9A 1Q46A 3IFTA 4DR4Q 3NELA 4A76A 3TMEA 3JAME 4EQNA 3J81j 3M4YA 1TWCH 1ZYRC 4A93H 1H9MA 2EYJA 3KF6B 4G4KA 4DAVA 1XXGA 1FR3A 5JAVA 1IYJB 1LT6D 1HR0Q 3P20A 4XT1B 4X3TA 1EUJA 1TR5A 1PA6A 1ICFB 5JPMC 3MXGA 5TSSA 4DV5L 1IBKQ 3MXNA 1U4PA 3GTLH 3F1ZA 1VQFA 5JEAH 1K8OA 3R8BA 2UUCQ 3C3LA 5D65A 2MQHA 4OIKA 3J7ZC 1BNZA 2E2HB 1NAPA 1NCVA 2GA4B 4B3SL 1XNQQ 2ID0A 3PF4A 4UP9A 3EIVA 5GAHC 2ATWA 2A1AA 4G57A 3QB3A 4GOPB 1JWMD 1A2UA 5IP7H 5IT9E 2ICIA 3S1RH 3M85A 4HEDA 4DV4L 1YI2A 3S16B 1LTSD 2HDLA 3SK5A 4G7ZC 3KUPA 1F9PA 3PIP3 1SFOH 2EY2A 4LF7Q 1FJGQ 1HZ9A 1G6PA 3R3OA 5FJ8G 3PO2G 1GXDC 1SNCA 1KLGD 3FDTA 3P7JA 4DKAC 3A8JE 1B8AA 1Y1VB 4KD3A 4CJ0B 3A56A 1OXSC 4JI2Q 4A3LG 5M5XB 3S1QH 1JB7A 3NBHB 2EYPA 3HOZG 3E5SA 2YYZA 4HSPA 1GUGA 5K36G 3I4NH 3CD6A 1PTOF 3PSIA 4RKLA 5CV5A 3K7AB 2RQXA 4QIWE 5C4ZA 2E5LL 1BVSA 1ILQA 2PQAA 4M1UB 2CHBD 4A3JG 2K1BA 1CA6A 4A3MG 3P1HA 4DV5Q 1N34L 1ZKOA 2CH4A 3KYHC 2ZT9C 4DGZA 2OF1A 4FYDA 3M7NA 3NSWA 4FF4A 1SLJA 1NR2A 4RMFA 1YVCA 3HRZC 1EZ6A 4XYQA 2AMCB 4R8NA 3EBEA 1Y1WH 1PYSB 4B08A 2ZXPA 4B3SQ 1UE1A 5D14A 5J3BA 2G9DA 4ILWA 2JYOA 2JK8A 5IYDG 1EU3A 2CKZB 4HMIA 3X3NA 2OTLA 3NHHA 4KJNA 1DJRD 3EA6A 3CPWA 4HIMA 4XQNA 4ALPA 4OX9L 4OO1G 4OEMB 5ELOA 4R4IA 4A3FB 4IPHA 5C3WA 3VA7A 4DV4Q 1LYLA 2KCCA 2JA8B 1QJOA 5M5WB 1D2BA 1AH9A 2OQKA 4JW0A 5HGQA 1NBWA 2QEJC 2NB0A 2XVSA 2HT1A 4K8JA 4IQZA 3U4ZA 1I3QH 1TWHH 4KJOA 4JI1L 1Q86C 1KRSA 2NVQH 5M5YB 1PVOA 1PZJD 1EQRA 1PH9A 3SHLA 1Q90A 3VA5A 1YJNA 4P72A 2RF4A 1Y1VG 1YJ9A 2F1MA 5M3MH 1J6QA 3HGBA 4A3GB 2OCEA 5M9OA 2B63H 4DR2L 3E3XA 2K52A 1YITA 3TZUA 1AEXA 2E5LQ 2A6HC 4DXFA 4DV1L 4A3EH 1B4OA 1GD7A 2WB1B 3PMFA 1A3UA 3HZXA 3D0FA 4Q0FA 4JI8L 4FNFA 1D1IA 4C3IG 1NE3A 1ESRA 1UAPA 2L5TA 1CKNB 4XXEA 1HJPA 1VQ8A 1G6ZA 1SXTA 1S5FD 5IGDA 1XWEA 1I4QA 1YHQA 2D0OA 3K5MA 4B3MQ 1C0AA 1STGA 3PF5A 1NNXA 4OX9Q 3HOYB 3LWUA 3OPOA 4K5VA 2RDGA 3G6JB 1K8AC 2NZ1D 1Y8PB 2VXWA 2HIXA 1FYCA 2MP1A 4HIDA 4LF9L 5CV7A 1QZGA 2JXMB 2K5NA 3PCOB 5DLQE 2R7ZH 3ERSX 1WCMB 4A3BH 4DR1Q 4C3JH 4X66L 3QOLA 1JQYD 2OEOA 4A3FG 1WTWA 3WOEA 5IYCH 4K6DA 1EYAA 4WORA 3D4WA 4QJFA 1VF5C 1STAA 1HUNA 2QW7A 4F87A 2HDMA 2XRSD 4BA1I 1OXXK 1QZHA 1EEFD 2SNMA 1O7ZA 2EDGA 3J7A5 1SMXA 2F0UA 1YHAA 1SE3A 4GS3A 4QGUA 5FLXc 1G291 3S15B 5G3LF 1UEBA 1TWAB 3MXPA 2F0OA 1XJVA 1AE3A 1HCZA 4A3GG 2KHIA 4JI8Q 2K14A 1A63A 1IW7C 1AFPA 1HA5A 2A69D 1S5BD 3OWEB 2G9HD 4KN7C 5KNCA 3GTKH 2MPMA 3Q23A 2VQFQ 1OXTA 3QO2A 1ASYA 1K0RA 2WB1G 1GJXA 2B2TC 4QF4A 1VQ5A 3A5ZB 2NVYB 5DAUA 3U9OA 1TKWB 2J7ZA 4AIMA 3GTOB 4DFAA 5BN3A 1L2FA 5FKAC 2EQSA 5JJZA 1L0WA 5IYBG 3NWTA 2I5MX 4QY7A 3FPUB 4AYBE 1N8RC 2IPKD 4YWMA 4JCVE 3VYTA 5C4XH 3BJUA 3TP6A 1XYIA 3HOYG 1PRTC 1HQMC 2M9VA 4X66Q 4DV3L 4A3KB 1PV4A 1MSGA 2R93G 5IGBA 1XMQL 4GKJL 2F0GA 3H94A 4UAIA 3I4MB 3SK8A 1SROA 3I73A 1IBLL 3GD7A 3A7LA 3J80L 3H0GH 3CMEA 1R4PB 3UDFA 1ONLA 4IOAA 1SYCA 2KUMA 4KMUC 1SSOA 4QCLA 5J39A 4IFDH 3SR1A 1Q3LA 5LMUL 3NQTA 1EQTA 1OXUA 4N8FA 4DUZL 3CRKC 4Y7NH 5KEEA 3NTKA 1GUNA 4UPAA 2LY7A 1KC8C 5KNBA 1SJHD 3KLRA 1RODA 4EGVA 2N55A 2D5DA 1BXTA 2NVXB 4JI6Q 1X55A 4CKEA 5AFWA 5FLXE 1ASZA 5DNFA 1S5CD 3KK7A 3VYRA 2DNCA 3RR5A 1Z9FA 1QVGA 4BA2I 1CFMA 1FNUA 4DUYL 4XT3B 4ZUJA 2VS1A 5EPLA 1U5KA 4HJ7A 2RSNA 1EIYB 3L7ZC 1OXVA 5ELFA 1B1ZA 4NW2A 2B39A 4O2DA 4V0BA 3SGIA 2DY7A 3NPPA 5G3LD 2RDFA 1MSHA 2XWBB 4L5RC 3PV0A 1XMQQ 2FMCA 4GKJQ 1Q81C 1PDQA 3FKIH 2ZXRA 1H9RA 5FOBB 4DV6L 2JA5G 3GV6A 1RJTA 2KCNA 2YV5A 1IBLQ 1PXUA 3K7UC 4A3KG 1NUCA 4GOPC 1VQAA 3BU2A 1WI5A 1EY4A 1SYGA 3I4MG 5LMUQ 1GHJA 2GN5A 3JC66 1S72A 5NUCA 4IUNA 2L0CA 1SR3A 1KAWA 2VY3A 1BBXC 4L5QA 3DWQA 4IZ8A 4A3JH 2IX3A 4A3MH 3EROA 2AHOB 1O7LA 4KD4A 4BXXG 4IJHA 3KLSX 2QDBA 4ZK9B 2NVTB 2VNUD 4BBRB 5IIFA 4YWKA 4RGMA 5GADC 1LTGD 2Z8LA 1FNVA 3BDCA 1E1OA 1K3BC 3J7YW 2PNHA 2AQ2B 5GQOA 1SYBA 3RLNA 1HH2P 3GTPH 3D4RA 2KQ3A 1F2ZA 4DUYQ 3NWSA 1U4RA 2NZHA 4LF5L 2G5DA 3D8GA 1W6JA 5DEHA 4DAMA 1PTOB 4OO1H 4MZ9A 2IWHA 2UXCL 1LTLA 3TZDA 3SEBA 5FLMH 1ILPA 2E2IH 1GUTA 2EXDA 3GTGH 2PMZB 1S5ED 2VL6A 2ZXOA 3VR4A 1U0LA 1SE4A 5C3XA 5EKLA 4ABNA 2XIWA 3V05A 4LUZA 2A68C 2NZOA 1MI2A 5DM63 1TS2A 5I6YA 1VQ7A 3HOXB 4RAUC 3U50C 2F0DA 5I9OA 2F3VA 2JN4A 4ZKCB 4DR3L 2YU9H 1LT3D 3KF8B 4O0AA 2B2TA 4K6LA 1PYBA 3KJPA 1YJWA 2E2JH 1V1PA 2PI2A 2D9UA 1J8IA 3NTHA 3K58A 1YNND 2WAQE 1X6OA 1JJ2A 1PH4A 3BZCA 1I94L 2E75C 4PNYA 4JBKA 3NQIA 4C3IH 3DM3A 4ZLTF 3W2DA 4L6TB 2B2UA 4BBSB 1PFNA 2TSSA 4I7AA 2Q8RE 1B53A 1MJCA 3N52A 1S4ZA 2LS01 3CQZH 4HMJA 4BBRG 3J7AV 2F0HA 1K83B 3E9HA 5I2YA 2JA6B 4ZRZA 4QUFA 3SXHA 2D0PA 1I6VC 2UXCQ 1G91A 1EZ8A 2PQEA 3MC0B 2F0VA 4K2KA 3CCSA 2MO1A 1BR9A 3FVQA 1STNA 4A3DG 4N9TA 2HCIA 2L15A 2XGTA 2VQEL 3MZ5A 3EQLC 3S1MB 3GTJB 5C44B 2I46A 1I4XA 1SE8A 2WACA 3FPPA 3U4VA 1F2MA 2QF7A 2L9HA 1E7ZA 1VQDA 5CV9A 1X3PA 1ZEQX 2KENA 4RA8A 4DR3Q 4A3IB 1Q7YC 5D3DA 1AZPA 3K59A 1BCPF 4NB3A 1GVPA 3LWEA 3Q8DA 2KEEA 1Z6HA 4MTKA 1CQVA 4H13C 4X3UA 4BY1H 2SEBD 2Q2IA 1D5MC 2PZTA 1BDOA 1C4QA 2NYZD 1KNAA 5C0XH 3FEWX 4ZQ3A 2WKCA 3V2TA 2KHSA 5LMNW 1VQKA 1XTDA 5H1SE 5JVG3 1G8ZD 1XMOL 2F0EA 4QUCA 4HR7B 2FMMA 1TS4A 1X32A 1QG7A 2A6EC 4CDCC 3D4DA 3RZDH 1WTVA 1C7YA 2K28A 4JI3L 3AYHB 2K04A 4I7ZC 1SDFA 4RFBA 3TN2A 1VF7A 2BCOA 2K32A 2LSSA 4LJZC 4BBSG 3F2BA 1Q12A 4DAYB 1HNWQ 2K7VA 4GOPA 3HOUB 1GKHA 3D6WA 4ODGA 1CHPD 2OQ0A 1RTOA 1KNEA 2JA6G 4JI2L 4XYOA 2V1CC 3PIO3 1VQIA 2KBNA 1X3QA 3ULPA 1P8LA 3G48A 1IXRA 2PI2E 2R93H 2VQEQ 1QILA 1SYDA 2A6ED 4AQYL 1TWGB 1GUWA 4TVAB 3NENA 4POGA 1Y69U 4IFDI 1UWVA 1NJIC 1V43A 3JAML 4K8IA 4KTAA 1WJJA 3ICEA 1O80A 3K5LA 5C44G 3J80i 1NTGA 2XWJB 2VUMB 3W1GA 5I4DA 2QDLA 1X65A 1VQNA 3D31A 1WTPA 1ENCA 3T56B 1STHA 4C3HH 1N9WA 3E0EA 4OONA 1UE7A 3S1NB 4WJWA 1HTPA 2BH2A 1BOSA 3HFZB 1XMOQ 5HY6A 2F0QA 4HSVA 2PW5A 4B3RQ 1B44D 1RKNA 4QIWB 3I90A 1I50H 5EKIA 1VMCA 2D2CC 3K6OA 3J7AF 1WD0A 2Y0SE 1CKOA 4EQPA 4JI3Q 2K5HA 1T9HA 3K5OA 2UXDL 2DY8A 4MIUA 2NBFA 3S2DB 5IT9L 2ZM6L 3VYSA 1E2ZA 1PYWD 4DA2A 4JC0A 4DU9A 5IOCA 2O5JC 1EYCA 2E76C 1KXLA 3A54A 5IODA 1L0YB 1CM9A 1WTOA 2QA4A 1VQBA 2DNEA 1FL0A 1E0BA 1V1QA 1HR0W 3HOUG 4AQYQ 2UU9Q 3PO3H 3DWPA 3S14H 2B2VC 5A2QE 5BN5A 2JA5H 1BF4A 4RG1A 4XDXA 1KDBA 1FNWA 1VQ9A 2HCCA 1II3A 4HJ8A 3H91A 2FINB 1JB3A 4X3SA 3A5UA 1U9RA 2OXPA 4GNXA 3PGZA 5C3EB 4NXNQ 1IYVA 1RCVD 1KRTA 1L1OC 2MO0A 4IUPA 1A15A 3OIPA 3HOVB 4IURA 4B9XA 2D62A 4K14A 2N78A 3H15A 2VUMG 1JMCA 4RWSC 1HNZL 1KD1C 1STBA 4B3ML 3K0XA 1IL2A 3I4OA 2PNRC 1CKNA 4OWTB 2F0MA 4X64L 2PZWA 2SNSA 3A8IE 2UXDQ 1SYEA 2XSCA 3SE0A 1MGSA 1EY7A 1CT1D 3ER0A 3CCLA 4DR1L 1IBML 4LFAL 3AMUA 2JA7B 2DUDA 2ZM6Q 5IY0A 1KL9A 3DLLA 2EPBA 3L2PA 3HOWB 3GTMB 4OHJA 3CCQA 5JJLA 4IJLA 5ELEA 3NE5B 3RUZA 4DR6Q 1VQHA 2FXQA 4C2MB 3CKIB 2UUAL 2K5VA 1Q1BA 2A8VA 4EVOA 2N8NA 3DEPA 3NXWA 5C4JB 4OXPA 1HXYD 3S2HH 5JJKA 4DK1A 1TIID 2DJFC 1PTOC 4OWXB 1VQ4A 4R8IA 2EIFA 1BQQT 3KOJA 4P71A 1FGBD 1GUSA 2FJ2A 1N32Q 3PIOA 2PQAB 2F4IA 1CSPA 3A55A 1VCIA 1K8MA 1LUZA 2VQFL 3FMCA 4JI5L 3HKSA 3EN2A 2RBMA 1JJGA 3FRPB 3QG1A 4RGOS 2ZJPA 1HNZQ 2IW3A 3N6RA 2RSOA 4RCNA 3T4AC 3AB9A 4J15A 2OTJA 3VR6A 3TQYA 4YCVA 4L63B 1DOLA 1PTOD 2B29A 2XN9C 4X64Q 3RZOH 1MIUA 3H3VI 3GTQB 1W6KA 5EPKA 4B9WA 5FK9C 3BVMA 5LL6X 1F77A 1W2BA 4GLAC 1IBMQ 4LFAQ 1NSNS 1BO0A 4P73A 4KHPL 3HEJA 1M8AA 1R9TB 2JA8G 4A3CH 2LFNA 2A69C 3T1HQ 3U58A 3M4OB 3F2UA 4DF7A 2YTVA 1EU4A 2UUAQ 2JA7G 1D5XC 2R92H 5M3FH 3IKJA 1VQGA 4IOCA 4LK1C 1LV9A 1TWCB 3TP8A 4DR7Q 3HOWG 3CP0A 2EJGC 2RCFA 4A93B 4CDEC 2YTYA 4ZCKA 4AYBB 2F4VL 3F8TA 3KDFA 1TS5A 3OIQA 1ET6A 1FD7D 4GN3B 3EFXD 3TBIB 4RHSA 4A4IA 3FHWA 2NWGA 1LTBD 3O13A 1PH5A 2R3ZA 4JBWA 5C0XI 3GTLB 2MHVA 1EOVA 3Q22A 2IHEA 4JI6L 2I5LX 4JI5Q 4R4OA 1OTCA 3TS2A 1O7IA 2WIIB 4GZYC 2NN6I 1YNJC 1I6HH 4V190 1B70B 2L55A 4BS9A 2C5CA 3TSSA 3S1RB 3PUZA 4LFBQ 1TU2B 2HQLA 3RLOA 3MFYA 1M1KC 4LUVA 1D7QA 1K8GA 4KY5A 2B2YC 4P75A 4F88A 2HHHQ 1X3GA 2Q8TA 5IGGA 1SFOB 4HCSA 1Q8KA 1F9RA 3OSOA 4K5XA 3TP5A 4CHTB 1B7YB 3M4QA 2IT1A 5IWAQ 4K0KQ 1RL2A 2B2VA 4KHPQ 2WKDA 1BCPB 1F9SA 3I70A 4BY7H 4KKUA 1YNXA 1WCMG 5IP9H 3S1QB 1X54A 3CXCA 4ID6A 1N36Q 1YNJD 1RIPA 3RNUA 1K28A 5T1GA 1L1OA 3I4NB 1XPOA 3PQIA 5CBEE 4C1NI 1RF2D 2Q8IB 4JV5Q 4PQXA 1QVFA 2F4VQ 2QKIC 4H02A 2EYLA 1DOKA 1HNXL 1TWFH 2X6LA 1ET9A 1LTID 4HJAA 4A93G 5I6WA 2E8GA 3I3CA 4OELB 2K75A 2F3WA 1WVLA 4NP5A 1O78A 4KHVA 1YHBA 4IPCA 4J8QA 1AZQA 3JAMi 2J0TD 1VQOA 2EY6A 5K5PA 2JA9A 1Y1WB 4JOIC 2BDOA 3OW7A 5JEAG 1HTLD 4LF4L 1JOQA 1V9PA 1A6XA 5FLXL 5D3IB 3T1YL 3M3YH 3AFPA 4TQUS 2N88A 3M7GA 2KOLA 1SNDA 3CC2A 3AU7A 4JBMA 1J9OA 3TDQA 3MXUA 2XNAC 1BKBA 4KK7A 4I65A 3IL8A 3OYYA 3QOJA 5IP7G 1I3QB 2B8FA 1TWHB 2HQEA 3T53B 4TRDA 1IKMA 2F0KA 1PH7A 2OWOA 2NVQB 1KAAA 5FJ8H 2CH4W 3PO2H 3OWFA 4H44C 5A35A 3Q0AA 3CMAA 2KA7A 4A3LH 3HKZE 3MFGA 4LF8L 5M3MB 3HOZH 2Z0SA 4GN4B 2B63B 1CI3M 3UDIA 2ZTCA 3NTIA 1EEID 5K36H 2R7FA 2VW9A 1HNXQ 2X69A 5HURA 4A3EB 1PH1A 1C8CA 1KTKA 2F0JA 2I07B 5CV8A 3I4NG 3S17H 3M9BA 4LNQA 3TEHB 2NTSA 1BBWA 1HZBA 3OHXC 3OMGA 1JOKA 3L0OA 3ND9A 3X3MA 1A0IA 1EYDA 5CYUA 3T51B 2R6GA 4UY8C 2GVAA 2JEBI 4GLXA 2WV6D 4YHHQ 3A8KE 3BVGA 3VR5A 4LF4Q 1WTRA 2EJFC 3T1YQ 5IYDH 3F2DA 1GUOA 2CFMA 1Y1WG 4X3KA 1MBYA 1CHQD 2BE5C 1QWYA 5HGTA 2Q2HA 4DV0L 2WAQB 2AUKA 1S5DD 2R7ZB 2E2HH 2PZUA 4A3BB 3CU7A 2CW0C 4C3JB 3FP9A 1YNNC 1QOHA 1WYDA 4GN5A 4XIGS 1R4QB 1VQLA 1QUQA 5J22A 1G2SA 3K0YA 4G7OC 1JT8A 3D6CA 5T1IA 3S16H 1HQRD 1LT5D 4ME3A 4ZYSA 3STBD 4KY6A 4YY3L 2B3GA 4FP5D 4LF8Q 3LNNA 1E2VA 4F8MA 5ISRA 3P75A 2ZTEA 3A7AB 2BE5D 1JWSD 2PCFB 4L8JA 2MJ8A 1Y1VH 1B3QA 4MN3A 2E74C 2KECA 1YEZA 3T16A 4B3TL 1HRJA 3HS0C 5M5XH 1JICA 3I7FA 2CW0D 5M3MG 2H4OA 3I8ZA 1P16A 3MVVA 1A3TA 2F0PA 3ND8A 2PW7A 4JI0Q 4LUOA 4A3EG 3GTKB 3K7AH 1LACA 3E6ZX 2K4KA 2B2YA 2O5IC 2CCZA 3CC4A 4IPDA 5EBCA 3TREA 4DNRB 2KVMA 3K57A 5BR8L 1TXYA 2ZTDA 4QQBX 2XRQD 4LFCL 3CCRA 3BS1A 4LMQD 3V96A 1B9MA 1PZID 4JPBW 4DV0Q 5C4XB 3R2IA 1HNWL 4K5WA 1L0XB 2PMZE 1E24A 2M2LA 3CHBD 1JWUD 3Q24A 4Y52H 1XPUA 1K9MC 3DHQA 5ELNA 1Q82C 5LMNQ 5IE8A 2M00A 4FXDA 2CWPA 1EYGA 2R7ZG 4EQ5A 5C5LA 3GO5A 4A3FH 4A3BG 1TVXA 2JA8H 1QB5D 3H0GB 1M90C 4DV2L 5M5WH 3KLSA 4YCWA 3S24A 4YY3Q 4NDXA 4RH6A 4IUVA 3VR3A 2K6AA 4PZ8A 2C35B 1H9SA 5IYCG 3MWYW 1STEA 1IYUA 4IUUA 4B3TQ 2PO4A 5M5YH 4Y7NB 3OW2A 4JOIA 2QEXA 2SDFA 1U4LA 3HOXG 4KV6A 3C2PA 3KF6A 1V1PB 1LABA 4PZ7A 3WOFA 4A3GH 1SNOA 2K5QA 2RVLA 5ELBA 4JI7Q 3HP3A 1S3OA 4FF3A 5JJIA 2LKVA 3K81C 1JORA 4B3RL 4IUQA 1A2TA 1TY0A 2F0IA 5EGTA 1I4HA 5CGKA 1YIJA 5BR8Q 2H5XA 3SK4A 3IRBA 1Z47A 1G51A 1HPCA 3KLWA 1GO3E 2L4NA 4LFCQ 1PRTB 2BA0A 4UHVA 1EY5A 4IUTA 1KIXA 5IYBH 2IX0A 3VYUA 4KY7A 1LTAD 4RCOA 4OWWB 4U68A 1RD9D 3CCUA 2B8GA 2MNAA 1RHPA 3HOYH 3ITPA 4RGTA 1AN8A 2EYFA 3FKIB 5C4XG 2E2DC 3S9WA 2UU9L 1PFBA 4DV2Q 2Y0SB 1WTHA 2LMCB 1WCMH 2Z1CA 3HOZB 5J1ZA 4RKBA 1DXMA 1CKMA 3QWNA 1FGUA 1H9JA 1B2TA 3H0GG 3NBHA 1SMYC 2R7DA 4NXNL 4OIJA 5IGCA 2MGSA 1A8VA 4IFDG 4IPGA 1TY2A 3GV3A 4CDDC 4A3JB 1BCPC 5EAYA 2Q2UA 4A3MB 5ELCA 4A3IG 1HHVA 4NPSA 1IHZA 4R4CA 4PG3A 5C5MA 1VMPA 3BG3A 1MKHA 2HIVA 5KGUA 1BUVT 2A5HA 2B2WC 3S15H 5FO7B 5KYIA 1IKLA 1PZKD 1TWAH 3SK6A 5JVH3 2UUBQ 1I4GA 1SNPA 5LL6S 3GTPB 1JC7A 1VQPA 5CBAE 2NTTA 4DV7Q 1SMYD 4CKBA 3AFQA 3VDYA 1HFNA 4FVMA 4KKTA 3I56A 3UE0A 4UDUC 2NVYH 3RD4A 3NEMA 1BCPD 1EIGA 5C6AA 2E2IB 2RKSA 1V1OA 1ZYRD 4KHZA 3GTOH 3GTGB 4DR5Q 1WTXA 2K5WA 3W5OA 3J81c 1KQSA 4DR6L 1NMFA 2KCTA 1D1KA 4OL7A 3NUCA 4X65Q 3ZJYC 1XNRQ 4UP7A 1PH2A 1SNQA 3FKIG 4A3KH 5E1FA 5JEAJ 3H6MA 3K80C 5A2QL 3MTSA 2V4DA 2YU9B 1EFWA 2Y0SG 1GOZA 1ICWA 1LO5D 3I4MH 2E2JB 4H0LC 1N32L 3KBXA 5I2XA 3DXJC 4ZUIA 4J6HA 4CDFC 2QILA 4GLVB 4HIOA 4C1NK 1EL0A 3MXNB 2SOBA 1EWIA 1VQJA 2F3IA 2H1EA 4C3IB 2EJMA 4O42A 2VZAA 3UI2A 4BXXH 3BYTB 5GAGC 1HZCA 5F2DA 1H9KA 2JP1A 5EBDA 5FO9B 5E4WC 3CQZB 2K01A 2F0FA 2ASBA 2AKWB 4OO1I 1QNKA 3A74A 5KYLA 2Z9HA 3BZDB 4YWLA 2NVXH 1IZ6A 1AW7A 1JJCB 1VDZA 4WRDA 4KI0A 1J5EL 3AEVA 2KJXA 4JG2A 4KKSA 3HG9A 5E3FA 5CMDA 2P5ZX 3T1HL 5AJ3L 3PUYA 1PH3A 4FXKC 1MHWC 1SE2A 1SBBB 5FLMG 4E6IA 4CBVA 1SAPA 2R61A 3G7LA 1UEAB 1DM0B 2KCMA 4DR7L 4L5TA 1HUMA 1PMRA 2ALYB 4P2CB 4TSSA 4Z9CB 2RHQB 4HN7A 3CCJA 1LTTD 1PH8A 5EPJA 4R1JA 3J81E 1JR0D 3MEFA 4H7BA 4U673 2EY1A 3DMUA 4GNXB 4BY1B 1G2TA 5E7NA 3J81L 4N8X1 4TKOB 1RTNA 2A73B 1LTRD 1D6EC 3IAYA 4P74A 5C3EG 5JOBA 3MAQA 1EIHA 2A74C 2F0LA 1QE6A 3G4SA 3PUVA 3HOVG 2AQ1B 3RZDB 1N34Q 1ML0D 1AP0A 1T5EA 1EY6A 4LFBL 5CV6A 4PMBA 4APVA 3QIAA 2HHHL 1BBUA 3GQBA 2NVTH 1Y8NB 3EVQA 3R2TA 4WFN3 4BBRH 1J5EQ 1TS3A 1FVIA 3GP7A 4NMZA 3CCVA 5IWAL 4K0KL 1QVCA 3DM1A 3KBGA 2MUYA 3SVMA 2RDHA 3J80c 1TQOA 2UXBL 2F0SA 5AJ3Q 1DZ1A 4JI4L 2A6HD 2R93B 3B6YA 1N36L 4LW1A 1PRTF 1A62A 2HD3A 1F2YA 1PTOH 2F0NA 4A3DH 1Z7TA 5DM73 3F2CA 4JV5L 4S3SA 2X6GA 3K5NA 2WB1E 1I4RA 1KDCA 4JI1Q 1MD2D 3U9SA 4WJ3M 5CORA 1JCKB 2VB2X 3KFUA 2IY5B 2B2WA 3C1EA 1K73C 2N49A 4RGNA 3WDNA 2EY5A 2K03A 3PIPA 3ZYYX 4C3HB 1K0SA 4DK6C 1SJED 3HOXH 4DR2Q 4DK3C 1UNSA 1V8QA 4YIJA 3GDEA 5IGEA 2ZJRA 4DV1Q 4BY1G 1VS0A 5FO8B 3BYYB 3MEHA 4UP8A 4C56C 1UE5A 1I50B 3Q6SA 5C0XG
chains in the Genus database with same CATH topology
5CV4A 2OT2A 1CK1A 2ENBA 2F0WA 2NN6G 2L1BA 4FO2A 2RA4A 2JEAI 1TT2A 1CQFA 2EYHA 4QMGA 1M4VA 4CKCA 4PMCA 1EOTA 2CQAA 2O2LD 4O1NA 3TP7A 1F2LA 2Z4HA 4DAPA 3PO3B 5JPNC 5EQ0A 3S14B 1CZGA 2B2UC 2JA5B 1EWCA 3E0JA 1RDPD 1SNMA 1IW7D 1KDAA 1T5XD 3J80E 4FF2A 4ULLA 3QJYA 2WINB 1B9NA 1NR4A 4PV1C 3LX0A 2HUGA 3HKZB 2VB3X 4BWGB 2EYMA 1PRTD 4C3HG 2K33A 1A3VA 4Q5VA 1I4PA 2QCPX 4ZKBB 3T13A 1QCBD 2KEDA 4OGQC 4DN4M 1LT4D 1PFMA 2Z4IA 4F7XA 2FFKB 1EY0A 4J1MA 2WP8J 1C48A 5E4XA 4IFDJ 1D5ZC 2EXZA 2K5DA 2K05A 4FF1A 1XTCD 1EQVA 3S2HB 3L3OC 3C46A 3L9AX 3I72A 1B50A 3CRLC 4KN4C 2CVRA 3NK9A 1Q8IA 3NBIA 2FHTA 1UUPA 3KF8A 1JE4A 3EJIA 2NUCA 2F0TA 4IN3A 3BDOA 1DOMA 1ESFA 3R93A 3RLFA 3RZOB 1SEBD 1B3AA 3PUXA 2PYKA 5C4HA 3D3RA 3ONAB 3BDLA 4MHEA 1EY8A 1GHKA 1ENAA 1IL8A 1DONA 2TMPA 2R92B 5ELDA 5M3FB 4IALA 5KIXA 1DD2A 4A3DB 1KLUD 4DK0A 4EQOA 4HAEA 3NP8A 1ENFA 1CTMA 3DUZA 3H3VC 2AQ3B 4HCEA 4CGYB 5COYA 4ME5A 2EYOA 3DEOA 5CC4A 2AWNA 1U4MA 1Q1EA 1EWHA 5EJWA 3URYA 4N9PA 2O4XA 3BVZA 5I9PA 1I6HB 4DNTB 3H09A 4XQQA 1HFGA 4HTHA 2F03A 5IGFA 1OO9B 4RHRA 2JSOA 3ERQA 4ZAIA 1WD1A 3W3AA 2PPBC 4PMWA 4M8AA 1PLFA 2A68D 1DYQA 1CZWA 4FXGC 4BY7B 1F9QA 1QNUA 3C1FA 3OMCA 4C3JG 4DAYA 4LAAA 4JK1C 2IX1A 5CR3A 5KNDA 2AUJD 1HA6A 2IJ0A 4NKLA 4K2LA 1TWFB 2BA1A 2EVBA 3VR2A 3MA2B 1E2WA 4XTCS 1JOOA 1STYA 2AWOA 4G7HC 1XX8A 2J4XA 3PUWA 5LHY1 1WTQA 3IFDA 2EOTA 4R9WA 5EKKA 2EE1A 4DXGA 3I4LA 4XQJA 3M3YB 2BDNA 3DWAA 4CJ1B 3OOCA 3RMHA 1CA5A 1KABA 3MHBA 2C9OA 2NN6H 1ZXTA 1SYFA 5BN4A 2BOSA 3PO2B 3SDZA 2IL8A 2L12A 1EFID 5KRUA 4QB4A 1DCZA 2ICEC 1Y8OB 2JE6I 1LLRD 5C0XJ 1O7YA 3I91A 1H9SB 2L11A 2DN8A 2EZVA 3S17B 4CJ2C 1EY9A 3IFTA 3TMEA 3JAME 4EQNA 3M4YA 1ZYRC 1H9MA 2EYJA 4DAVA 4G4KA 1XXGA 1FR3A 5JAVA 1LT6D 3P20A 4XT1B 4X3TA 1TR5A 5JPMC 3MXGA 5TSSA 3MXNA 1U4PA 5JEAH 1K8OA 3R8BA 3C3LA 5D65A 4OIKA 1BNZA 2E2HB 1NAPA 1NCVA 2GA4B 2ID0A 4G57A 3QB3A 1JWMD 1A2UA 5IT9E 2ICIA 3M85A 4HEDA 3S16B 1LTSD 2HDLA 3SK5A 4G7ZC 3KUPA 1F9PA 3PIP3 2EY2A 3R3OA 1GXDC 1SNCA 1KLGD 3FDTA 3P7JA 3A8JE 1Y1VB 4KD3A 4CJ0B 3A56A 1OXSC 5M5XB 2EYPA 3E5SA 2YYZA 4HSPA 1GUGA 5K36G 1PTOF 4RKLA 5CV5A 3K7AB 2RQXA 5C4ZA 1ILQA 4M1UB 2CHBD 2K1BA 1CA6A 3P1HA 1ZKOA 2ZT9C 4DGZA 2OF1A 4FYDA 3M7NA 3NSWA 4FF4A 1NR2A 3HRZC 1EZ6A 4XYQA 4R8NA 4B08A 2ZXPA 5D14A 2G9DA 4ILWA 2JYOA 1EU3A 4HMIA 3X3NA 3NHHA 4KJNA 1DJRD 3EA6A 4XQNA 4OO1G 4A3FB 5C3WA 3VA7A 2JA8B 2KCCA 1QJOA 5M5WB 1D2BA 2QEJC 2NB0A 2XVSA 4K8JA 4IQZA 4KJOA 5M5YB 1PZJD 3SHLA 1Q90A 3VA5A 2F1MA 3HGBA 4A3GB 5M9OA 3TZUA 1AEXA 2A6HC 4DXFA 1B4OA 2WB1B 3PMFA 1A3UA 3HZXA 4Q0FA 4FNFA 1D1IA 4C3IG 1ESRA 1UAPA 2L5TA 4XXEA 1G6ZA 1SXTA 1S5FD 5IGDA 1XWEA 1I4QA 3K5MA 1STGA 3HOYB 3LWUA 3OPOA 4K5VA 2RDGA 3G6JB 2NZ1D 1Y8PB 2VXWA 1FYCA 2MP1A 5CV7A 2JXMB 1WCMB 3QOLA 1JQYD 2OEOA 1WTWA 3WOEA 4K6DA 1EYAA 4WORA 3D4WA 1VF5C 1STAA 1HUNA 4F87A 2HDMA 2XRSD 4BA1I 1OXXK 1EEFD 2SNMA 1O7ZA 2EDGA 2F0UA 1SE3A 1G291 3S15B 5G3LF 1TWAB 3MXPA 2F0OA 1HCZA 1IW7C 1AFPA 1HA5A 2A69D 1S5BD 3OWEB 2G9HD 4KN7C 5KNCA 2MPMA 3Q23A 1OXTA 3QO2A 1GJXA 2B2TC 4QF4A 3U9OA 2NVYB 5DAUA 1TKWB 2J7ZA 3GTOB 4DFAA 5BN3A 5FKAC 5JJZA 3NWTA 3FPUB 2IPKD 3VYTA 3TP6A 1XYIA 1PRTC 1HQMC 2M9VA 4A3KB 1MSGA 5IGBA 2F0GA 3H94A 4UAIA 3I4MB 3SK8A 3I73A 3GD7A 3A7LA 3J80L 1R4PB 1ONLA 1SYCA 2KUMA 4KMUC 1SSOA 4QCLA 5J39A 4IFDH 3SR1A 1Q3LA 3NQTA 1EQTA 1OXUA 3CRKC 5KEEA 3NTKA 1GUNA 2LY7A 5KNBA 1SJHD 3KLRA 1RODA 4EGVA 2N55A 2D5DA 1BXTA 2NVXB 4CKEA 5AFWA 5FLXE 5DNFA 1S5CD 3KK7A 3VYRA 2DNCA 4BA2I 1CFMA 1FNUA 4XT3B 4ZUJA 5EPLA 2RSNA 3L7ZC 1OXVA 5ELFA 1B1ZA 4NW2A 2B39A 4V0BA 2DY7A 3NPPA 5G3LD 2RDFA 1MSHA 2XWBB 3PV0A 2FMCA 1PDQA 2ZXRA 1H9RA 5FOBB 3GV6A 1RJTA 2KCNA 1PXUA 1NUCA 1EY4A 1SYGA 1GHJA 5NUCA 4IUNA 2L0CA 1BBXC 3DWQA 4IZ8A 2IX3A 3EROA 1O7LA 4KD4A 3KLSX 2QDBA 4ZK9B 2NVTB 2VNUD 4BBRB 5IIFA 4RGMA 1LTGD 2Z8LA 1FNVA 3BDCA 3J7YW 2AQ2B 1SYBA 3D4RA 2KQ3A 1F2ZA 3NWSA 1U4RA 3D8GA 1W6JA 5DEHA 1PTOB 4OO1H 2IWHA 3TZDA 3SEBA 1ILPA 1GUTA 2PMZB 1S5ED 2ZXOA 3VR4A 1SE4A 5C3XA 5EKLA 4ABNA 2XIWA 3V05A 2A68C 1MI2A 5DM63 1TS2A 5I6YA 3HOXB 4RAUC 2F0DA 5I9OA 2F3VA 4ZKCB 1LT3D 2B2TA 4K6LA 1V1PA 2D9UA 1J8IA 3NTHA 3K58A 1YNND 2E75C 4PNYA 3NQIA 4ZLTF 3W2DA 4L6TB 2B2UA 4BBSB 1PFNA 2TSSA 2Q8RE 1B53A 1S4ZA 2LS01 3N52A 4HMJA 3J7AV 2F0HA 1K83B 5I2YA 2JA6B 4ZRZA 4QUFA 3SXHA 1I6VC 1G91A 1EZ8A 2PQEA 3MC0B 2F0VA 4K2KA 1BR9A 3FVQA 1STNA 4N9TA 2HCIA 3MZ5A 3EQLC 3S1MB 3GTJB 5C44B 2I46A 1I4XA 2WACA 3FPPA 1F2MA 2QF7A 2L9HA 5CV9A 1X3PA 1ZEQX 4RA8A 4A3IB 5D3DA 1AZPA 3K59A 1BCPF 3LWEA 2KEEA 1Z6HA 1CQVA 4H13C 4X3UA 2SEBD 1D5MC 2PZTA 1BDOA 1C4QA 2NYZD 1KNAA 5C0XH 3FEWX 4ZQ3A 2WKCA 3V2TA 2KHSA 5JVG3 1G8ZD 2F0EA 4QUCA 4HR7B 2FMMA 1TS4A 1X32A 1QG7A 2A6EC 3D4DA 1WTVA 2K28A 2K04A 4I7ZC 1SDFA 4RFBA 3TN2A 1VF7A 2BCOA 2K32A 4LJZC 1Q12A 2K7VA 3HOUB 3D6WA 4ODGA 1CHPD 1RTOA 1KNEA 4XYOA 3PIO3 1X3QA 1QILA 1SYDA 2A6ED 1TWGB 1GUWA 1Y69U 4IFDI 1V43A 3JAML 4K8IA 4KTAA 1O80A 3K5LA 2XWJB 2VUMB 5I4DA 3D31A 1WTPA 1ENCA 3T56B 1STHA 3S1NB 4WJWA 1HTPA 1BOSA 2F0QA 4HSVA 2PW5A 1B44D 1RKNA 4QIWB 3I90A 5EKIA 1VMCA 2D2CC 3K6OA 3J7AF 1WD0A 4EQPA 3K5OA 2DY8A 4MIUA 2NBFA 3S2DB 5IT9L 3VYSA 1E2ZA 1PYWD 4DA2A 4DU9A 5IOCA 2O5JC 1EYCA 2E76C 3A54A 5IODA 1L0YB 1CM9A 1WTOA 2DNEA 1E0BA 3DWPA 2B2VC 5A2QE 5BN5A 1BF4A 4XDXA 1KDBA 1FNWA 2HCCA 1II3A 3H91A 2FINB 1JB3A 4X3SA 1U9RA 2OXPA 5C3EB 1IYVA 1RCVD 4IUPA 1A15A 3OIPA 3HOVB 4IURA 4B9XA 2D62A 4K14A 4RWSC 1STBA 2PNRC 2F0MA 2PZWA 2SNSA 3A8IE 1SYEA 2XSCA 3SE0A 1MGSA 1EY7A 1CT1D 3AMUA 2JA7B 2EPBA 3HOWB 3GTMB 4OHJA 5ELEA 3NE5B 3RUZA 4C2MB 3CKIB 1Q1BA 4EVOA 3DEPA 3NXWA 5C4JB 1HXYD 4DK1A 1TIID 1PTOC 4R8IA 1BQQT 1FGBD 1GUSA 2FJ2A 2F4IA 3A55A 1VCIA 1K8MA 3FMCA 2RBMA 3FRPB 3QG1A 4RGOS 2IW3A 3N6RA 2RSOA 4RCNA 3T4AC 3AB9A 3VR6A 4L63B 1DOLA 1PTOD 2XN9C 3GTQB 1W6KA 5EPKA 4B9WA 5FK9C 3BVMA 5LL6X 1F77A 1NSNS 1BO0A 3HEJA 1M8AA 1R9TB 2LFNA 2A69C 3M4OB 3F2UA 4DF7A 1EU4A 1D5XC 3IKJA 4LK1C 1LV9A 1TWCB 3TP8A 2EJGC 4A93B 4AYBB 1TS5A 3OIQA 1ET6A 1FD7D 3EFXD 3TBIB 4RHSA 2NWGA 1LTBD 3O13A 2R3ZA 4JBWA 5C0XI 3GTLB 2MHVA 3Q22A 2WIIB 4GZYC 2NN6I 1YNJC 4V190 2L55A 4BS9A 2C5CA 3TSSA 3S1RB 3PUZA 1TU2B 3MFYA 4KY5A 2B2YC 4F88A 1SFOB 2Q8TA 5IGGA 4HCSA 4K5XA 1F9RA 3OSOA 3TP5A 4CHTB 2IT1A 2B2VA 2WKDA 1BCPB 1F9SA 3I70A 4KKUA 3S1QB 4ID6A 1YNJD 5T1GA 3I4NB 5CBEE 4C1NI 1RF2D 2Q8IB 4PQXA 2QKIC 2EYLA 1DOKA 2X6LA 1ET9A 1LTID 5I6WA 3I3CA 2F3WA 1WVLA 4NP5A 1O78A 4KHVA 4J8QA 1AZQA 2J0TD 2EY6A 5K5PA 1Y1WB 2BDOA 3OW7A 5JEAG 1HTLD 1JOQA 1A6XA 5FLXL 5D3IB 4TQUS 2N88A 3M7GA 2KOLA 1SNDA 3AU7A 1J9OA 3TDQA 3MXUA 2XNAC 4KK7A 4I65A 3IL8A 3QOJA 1I3QB 2B8FA 1TWHB 2HQEA 3T53B 4TRDA 1IKMA 2F0KA 2NVQB 1KAAA 3OWFA 4H44C 5A35A 3Q0AA 2KA7A 3MFGA 5M3MB 2B63B 1CI3M 3NTIA 1EEID 5K36H 2X69A 5HURA 4A3EB 1C8CA 1KTKA 2F0JA 2I07B 5CV8A 2NTSA 3OHXC 3OMGA 1JOKA 3ND9A 3X3MA 1EYDA 5CYUA 3T51B 2R6GA 2JEBI 2WV6D 3A8KE 3BVGA 3VR5A 1WTRA 2EJFC 1GUOA 4X3KA 1MBYA 1CHQD 2BE5C 1QWYA 5HGTA 2WAQB 2AUKA 1S5DD 2R7ZB 2PZUA 4A3BB 3CU7A 2CW0C 4C3JB 1YNNC 1QOHA 4XIGS 1R4QB 5J22A 1G2SA 3K0YA 4G7OC 3D6CA 5T1IA 1HQRD 1LT5D 4ZYSA 4KY6A 4FP5D 3LNNA 1E2VA 4F8MA 5ISRA 3P75A 3A7AB 2BE5D 1JWSD 2PCFB 4L8JA 2MJ8A 4MN3A 2E74C 2KECA 3T16A 1HRJA 3HS0C 1JICA 2CW0D 2H4OA 3I8ZA 3MVVA 1A3TA 2F0PA 3ND8A 2PW7A 3GTKB 1LACA 3E6ZX 2B2YA 2O5IC 5EBCA 4DNRB 2KVMA 3K57A 2XRQD 3BS1A 4LMQD 3V96A 1B9MA 1PZID 5C4XB 3R2IA 4K5WA 1L0XB 2M2LA 3CHBD 1JWUD 3Q24A 3DHQA 4FXDA 2M00A 5C5LA 3GO5A 1TVXA 1QB5D 3H0GB 3KLSA 4NDXA 4RH6A 4IUVA 3VR3A 2K6AA 1H9SA 3MWYW 1STEA 1IYUA 4IUUA 2PO4A 4Y7NB 2SDFA 1U4LA 4KV6A 3C2PA 1V1PB 1LABA 3WOFA 1SNOA 2K5QA 2RVLA 5ELBA 3HP3A 4FF3A 2LKVA 1JORA 4IUQA 1A2TA 1TY0A 2F0IA 5EGTA 1I4HA 5CGKA 3SK4A 1Z47A 1HPCA 2L4NA 1PRTB 2BA0A 1EY5A 4IUTA 2IX0A 3VYUA 4KY7A 1LTAD 4RCOA 4U68A 1RD9D 2B8GA 1RHPA 3ITPA 4RGTA 1AN8A 2EYFA 3FKIB 2E2DC 3S9WA 1PFBA 2Y0SB 2LMCB 2Z1CA 3HOZB 5J1ZA 4RKBA 1DXMA 3QWNA 1H9JA 1B2TA 3NBHA 1SMYC 4OIJA 5IGCA 2MGSA 4IFDG 1TY2A 3GV3A 4A3JB 1BCPC 4A3MB 5ELCA 1HHVA 1IHZA 5C5MA 1VMPA 3BG3A 5KGUA 1BUVT 2A5HA 2B2WC 5FO7B 5KYIA 1PZKD 1IKLA 5JVH3 3SK6A 1I4GA 1SNPA 5LL6S 3GTPB 1JC7A 5CBAE 2NTTA 1SMYD 4CKBA 1HFNA 4FVMA 4KKTA 4UDUC 3RD4A 1BCPD 1EIGA 5C6AA 2E2IB 2RKSA 1V1OA 1ZYRD 4KHZA 3GTGB 1WTXA 2K5WA 1D1KA 4OL7A 3NUCA 1SNQA 5E1FA 5JEAJ 3H6MA 5A2QL 3MTSA 2V4DA 2YU9B 1GOZA 1ICWA 1LO5D 2E2JB 4H0LC 3KBXA 5I2XA 3DXJC 4ZUIA 4J6HA 2QILA 4C1NK 1EL0A 2SOBA 2H1EA 4C3IB 2EJMA 4O42A 3UI2A 3BYTB 5F2DA 1H9KA 2JP1A 5EBDA 5FO9B 5E4WC 3CQZB 2K01A 2F0FA 4OO1I 1QNKA 5KYLA 3BZDB 1AW7A 1VDZA 4WRDA 4KI0A 2KJXA 4KKSA 3HG9A 5E3FA 5CMDA 3PUYA 4FXKC 1SE2A 1SBBB 4E6IA 4CBVA 1SAPA 1UEAB 2R61A 1DM0B 3G7LA 1HUMA 1PMRA 4P2CB 4TSSA 4Z9CB 4HN7A 1LTTD 5EPJA 3J81E 1JR0D 4H7BA 4U673 2EY1A 3DMUA 4BY1B 1G2TA 3J81L 4TKOB 1RTNA 2A73B 1LTRD 1D6EC 3IAYA 5JOBA 3MAQA 1EIHA 2A74C 2F0LA 1QE6A 3PUVA 2AQ1B 3RZDB 1ML0D 1AP0A 1T5EA 1EY6A 5CV6A 4PMBA 3QIAA 3GQBA 1Y8NB 3EVQA 3R2TA 4WFN3 1TS3A 3GP7A 4NMZA 3DM1A 3KBGA 2MUYA 3SVMA 2RDHA 1TQOA 2F0SA 1DZ1A 2A6HD 2R93B 1PRTF 1F2YA 1PTOH 2F0NA 1Z7TA 5DM73 4S3SA 2X6GA 3K5NA 1I4RA 1KDCA 3U9SA 1MD2D 5CORA 1JCKB 2VB2X 2B2WA 3C1EA 4RGNA 3WDNA 2EY5A 2K03A 3ZYYX 4C3HB 1SJED 1UNSA 1V8QA 4YIJA 5IGEA 5FO8B 3BYYB 3MEHA 4C56C 1I50B 3Q6SA 5C0XG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  1WTW A;  1O7Y A;  3I91 A;  1E0B A;  4IUV A;  2L11 A;  5T1G A;  4QUC A;  5CBA E;  1B50 A;  2FMM A;  1WTR A;  2XIW A;  5CBE E;  5AFW A;  2RSO A;  1X32 A;  3MWY W;  1QG7 A;  5DNF A;  1HUN A;  2B2V C;  4ZAI A;  4CJ2 C;  1WD1 A;  5EPJ A;  2HDM A;  5D14 A;  2L1B A;  1BF4 A;  1WTV A;  4XDX A;  1DOK A;  4X3K A;  2JYO A;  2K28 A;  1MI2 A;  2HCC A;  2RA4 A;  1HFN A;  1DOL A;  4IUU A;  3H91 A;  1O7Z A;  2FIN B;  2CVR A;  1PLF A;  2K04 A;  2X6L A;  1SDF A;  4RAU C;  3TN2 A;  4X3S A;  4XT3 B;  5EPK A;  1G2T A;  4ZKC B;  1EIG A;  2SDF A;  1U4L A;  5EPL A;  1EOT A;  3I3C A;  2RSN A;  1RTN A;  2B2T A;  1WVL A;  1F9Q A;  1WTX A;  2FHT A;  1BO0 A;  4XT1 B;  4IUP A;  1JE4 A;  4X3T A;  1A15 A;  1F2L A;  2D9U A;  4NW2 A;  1J8I A;  1M8A A;  3D6W A;  1AZQ A;  2RVL A;  1EIH A;  1G2S A;  2DY7 A;  3HP3 A;  1MSH A;  1RTO A;  4IUR A;  1KNE A;  1U4P A;  3F2U A;  5EQ0 A;  1QE6 A;  5T1I A;  2B2U C;  1X3Q A;  4IUQ A;  1HA6 A;  1DOM A;  1ML0 D;  1PDQ A;  4RWS C;  2MPM A;  3R93 A;  3QO2 A;  4ZLT F;  1AP0 A;  1LV9 A;  2B2T C;  1RJT A;  3GV6 A;  1GUW A;  5D65 A;  1B3A A;  4OIK A;  1BNZ A;  2B2U A;  2L4N A;  1NAP A;  1NCV A;  1PFN A;  3MTS A;  2MJ8 A;  2J7Z A;  2Q8R E;  2N88 A;  4IUT A;  1B53 A;  4MN3 A;  1ICW A;  1S4Z A;  2KEC A;  2KOL A;  3N52 A;  1HRJ A;  1J9O A;  3KBX A;  5JJZ A;  1JIC A;  3ONA B;  1O80 A;  3DM1 A;  2NWG A;  1MGS A;  3I8Z A;  4QUF A;  4MHE A;  3SVM A;  1NR4 A;  3IL8 A;  4U68 A;  1EL0 A;  2R3Z A;  4HED A;  1XX8 A;  2HUG A;  3FPU B;  2HDL A;  2H1E A;  1IL8 A;  1DON A;  1RHP A;  1B4O A;  3KUP A;  2EPB A;  1IKM A;  1G91 A;  1F9P A;  1WTQ A;  4O42 A;  1BBX C;  1DZ1 A;  3IFD A;  2EOT A;  1XYI A;  1WTP A;  3UI2 A;  4R9W A;  2EE1 A;  4HAE A;  1ESR A;  1MSG A;  2B2Y A;  1PFB A;  3FDT A;  2BDN A;  3P7J A;  4CJ1 B;  4ZK9 B;  4CJ0 B;  2JP1 A;  2X6G A;  2HCI A;  5E4W C;  2KVM A;  4UAI A;  1G6Z A;  4HSV A;  3DEP A;  1CA5 A;  2K01 A;  3I90 A;  5EKI A;  1VMC A;  1B2T A;  1QNK A;  5COR A;  4LMQ D;  4ZKB B;  2KUM A;  5COY A;  2KED A;  4DN4 M;  2B2W A;  1PFM A;  2X69 A;  1WD0 A;  1C8C A;  1SSO A;  1ZXT A;  2L9H A;  2FFK B;  1U4R A;  4OIJ A;  1Q3L A;  4R8I A;  2MGS A;  1X3P A;  2B2Y C;  2DY8 A;  4RA8 A;  2Q8T A;  4HCS A;  1AZP A;  1F9R A;  5E4X A;  3DEO A;  2NZ1 D;  2FJ2 A;  2K03 A;  1EQT A;  2M2L A;  2VXW A;  3GV3 A;  5CMD A;  2MP1 A;  2IL8 A;  3TZD A;  2B2V A;  2L12 A;  1HHV A;  1U4M A;  3LWE A;  1ILQ A;  2KEE A;  5EJW A;  2K05 A;  1ILP A;  2K1B A;  1CA6 A;  4X3U A;  1F9S A;  1SAP A;  1VMP A;  2NYZ D;  3G7L A;  1KNA A;  1TVX A;  1ROD A;  2B2W C;  1CM9 A;  1WTO A;  1HFG A;  3Q6S A;  1HUM A;  2N55 A;  1IKL A; 
#chains in the Genus database with same CATH topology
 5CV4 A;  2OT2 A;  4JBJ A;  3G6E A;  2CQO A;  1CK1 A;  3UE1 A;  2ENB A;  2F0W A;  2NN6 G;  2L1B A;  4FO2 A;  3TRZ A;  2RA4 A;  2JEA I;  1NY4 A;  1TT2 A;  1CQF A;  1N33 L;  2EYH A;  4QMG A;  1M4V A;  4X6A H;  4HIK A;  4CKC A;  4BBS H;  4PMC A;  1EOT A;  2CQA A;  2O2L D;  4O1N A;  3TP7 A;  2UXB Q;  1F2L A;  2Z4H A;  1K83 H;  4MNO A;  4JI4 Q;  3RN5 A;  1GM5 A;  1UE6 A;  2JA6 H;  3G71 A;  4DAP A;  4LF9 Q;  3PO3 B;  5JPN C;  5EQ0 A;  3S14 B;  1CZG A;  2B2U C;  2JA5 B;  1EWC A;  3E0J A;  3LGJ A;  1RDP D;  1SNM A;  1IW7 D;  2I5H A;  1KDA A;  1XPR A;  1T5X D;  3J80 E;  3AQQ A;  4FF2 A;  2DGY A;  1WFQ A;  3KDF B;  4ULL A;  4EX5 A;  3QJY A;  4AYB G;  3S1M H;  1D8L A;  3GTJ H;  5C44 H;  2MFI A;  2WIN B;  1B9N A;  1NR4 A;  2JJQ A;  1Y14 B;  4PV1 C;  2WFW A;  3LX0 A;  2HUG A;  1SRU A;  1VQM A;  3E9I A;  1JE5 A;  3HKZ B;  4HJ9 A;  3CC7 A;  2VB3 X;  4BWG B;  2EYM A;  4A3I H;  4YHH L;  1S40 A;  2RHS B;  3ULJ A;  4PZ6 A;  1PRT D;  4C3H G;  1X3F A;  2K33 A;  2GVB A;  1A3V A;  4Q5V A;  1W3S A;  1I4P A;  3KJO A;  3UDG A;  2QCP X;  4ZKB B;  3T13 A;  1QCB D;  2KED A;  4OGQ C;  4DN4 M;  1LT4 D;  1PFM A;  2Z6K C;  4FDB A;  4WJ4 A;  2Z4I A;  3WWV A;  4F7X A;  1X9N A;  2FFK B;  1EY0 A;  1N33 Q;  4J1M A;  2WP8 J;  1EQQ A;  2LXK A;  2JQO A;  1C48 A;  2IHF A;  5E4X A;  2I0Q A;  4IFD J;  1D5Z C;  2EXZ A;  2K5D A;  1VQE A;  2K05 A;  2N3S A;  2CWA A;  4FF1 A;  1XTC D;  1EQV A;  3S2H B;  3L3O C;  3HOU H;  3C46 A;  3L9A X;  1L1O B;  3I72 A;  4DV3 Q;  4YCU A;  1B50 A;  1PH6 A;  3CRL C;  3PO3 G;  4POF A;  1SN8 A;  1HZA A;  3A0J A;  4KN4 C;  2CVR A;  1TWG H;  3NK9 A;  1E3P A;  3I2Z A;  4JI0 L;  5GAE C;  1Q8I A;  3NBI A;  2FHT A;  1UUP A;  3KF8 A;  4JYA L;  1JE4 A;  3EJI A;  4QL5 A;  2NUC A;  2F0T A;  2YTX A;  3STB C;  3UDX A;  4IN3 A;  3BDO A;  4DUZ Q;  2VUM H;  2A19 A;  1DOM A;  1ESF A;  3HKZ G;  3R93 A;  3RLF A;  3RZO B;  4AH6 A;  1SEB D;  4HJ5 A;  3TS0 A;  1B3A A;  3PUX A;  2PYK A;  3CCE A;  1AE2 A;  3S1N H;  4LF6 L;  4R4Q A;  5C4H A;  1YBY A;  3D3R A;  3ONA B;  3BDL A;  3CCM A;  4MHE A;  5LMN L;  1EY8 A;  1GHK A;  1ENA A;  2XTI A;  1IL8 A;  1DON A;  4NXM L;  2TMP A;  2R92 B;  5ELD A;  5M3F B;  4IAL A;  5KIX A;  1DD2 A;  3S2D H;  4A3D B;  1KHI A;  1KLU D;  4DK0 A;  4HAE A;  4EQO A;  3M4P A;  3NP8 A;  1ENF A;  4MTN A;  1CTM A;  3DUZ A;  2ES2 A;  1VQ6 A;  2K50 A;  1MJE A;  1E22 A;  3H3V C;  2AQ3 B;  4HCE A;  4CGY B;  4DV6 Q;  5COY A;  2B63 G;  4ME5 A;  2EYO A;  4DNI A;  1EIF A;  2DJG C;  3DEO A;  4JI7 L;  5CC4 A;  2AWN A;  4IO9 A;  4JYA Q;  1U4M A;  1LM0 A;  3W1B A;  1Q1E A;  1EWH A;  5EJW A;  3OTO L;  3URY A;  4N9P A;  1DGS A;  2O4X A;  2Q2T A;  3BVZ A;  5I9P A;  5C3E H;  1I6H B;  4DNT B;  3H09 A;  4XQQ A;  1HFG A;  3J81 i;  1X56 A;  2KHJ A;  4HTH A;  3CF5 A;  2F03 A;  5IGF A;  2F52 A;  1OO9 B;  4RHR A;  3HOV H;  2JSO A;  4JVZ A;  3ERQ A;  4GKK L;  4ZAI A;  3QR8 A;  1WD1 A;  4GNX C;  3W3A A;  4A75 A;  4KLK A;  4PMW A;  2PPB C;  4LF6 Q;  3K8A A;  4M8A A;  1PLF A;  2A68 D;  1DYQ A;  1CZW A;  4FXG C;  1E1T A;  4BY7 B;  2WAQ G;  1F9Q A;  1C9O A;  1QNU A;  3C1F A;  3OMC A;  1QUQ B;  4NXM Q;  4C3J G;  4DAY A;  4LF5 Q;  4LAA A;  1VQC A;  1CSQ A;  4JK1 C;  3JAM c;  4DPG A;  2IX1 A;  3H3V H;  4A3C G;  5CR3 A;  5GRO A;  2JA7 H;  4X62 L;  5KND A;  2AUJ D;  1HA6 A;  2IJ0 A;  1PHJ A;  3HOW H;  3GTM H;  4NKL A;  2R92 G;  4K2L A;  1TWF B;  5M3F G;  2BA1 A;  3BZK A;  4C2M H;  2EVB A;  2Z6B A;  4DR4 L;  3VR2 A;  3MA2 B;  1E2W A;  4XTC S;  5C4J H;  1JOO A;  1STY A;  2AWO A;  3ULL A;  4G7H C;  1XX8 A;  2J4X A;  1HR0 L;  3PUW A;  5LHY 1;  3OTO Q;  2QGQ A;  1WTQ A;  3IFD A;  2EOT A;  2UUB L;  2Z6K A;  1IBK L;  4R9W A;  5EKK A;  2EE1 A;  2ZJQ A;  4DXG A;  3I4L A;  4DV7 L;  4XQJ A;  3M3Y B;  4L5S A;  4LWC A;  2BDN A;  3DWA A;  4CJ1 B;  3OOC A;  3RMH A;  5IT9 c;  1CA5 A;  1KAB A;  1I94 Q;  2UUC L;  4GKK Q;  3CPF A;  3MHB A;  2BH8 A;  1CUK A;  5L37 A;  1XNQ L;  2C9O A;  1X3E A;  1WOC A;  2NN6 H;  2RCN A;  1ZXT A;  4DR5 L;  1SYF A;  5BN4 A;  2BOS A;  1YZ6 A;  3PO2 B;  1I5F A;  2IL8 A;  3SDZ A;  4R4T A;  2L12 A;  3CW2 C;  2LXJ A;  3GTQ H;  3RN2 A;  1EFI D;  5KRU A;  4QB4 A;  4X65 L;  1K3R A;  1DCZ A;  1H95 A;  4LF7 L;  1XNR L;  2ICE C;  1FJG L;  1Y8O B;  1PFS A;  2JE6 I;  4X62 Q;  4BY7 G;  1LLR D;  5IP9 G;  5C0X J;  3I55 A;  1R9T H;  1O7Y A;  3I91 A;  1H9S B;  2L11 A;  2DN8 A;  2EZV A;  3M4O H;  3S17 B;  4CJ2 C;  3CAM A;  1NMG A;  1EY9 A;  1Q46 A;  3IFT A;  4DR4 Q;  3NEL A;  4A76 A;  3TME A;  3JAM E;  4EQN A;  3J81 j;  3M4Y A;  1TWC H;  1ZYR C;  4A93 H;  1H9M A;  2EYJ A;  3KF6 B;  4G4K A;  4DAV A;  1XXG A;  1FR3 A;  5JAV A;  1IYJ B;  1LT6 D;  1HR0 Q;  3P20 A;  4XT1 B;  4X3T A;  1EUJ A;  1TR5 A;  1PA6 A;  1ICF B;  5JPM C;  3MXG A;  5TSS A;  4DV5 L;  1IBK Q;  3MXN A;  1U4P A;  3GTL H;  3F1Z A;  1VQF A;  5JEA H;  1K8O A;  3R8B A;  2UUC Q;  3C3L A;  5D65 A;  2MQH A;  4OIK A;  3J7Z C;  1BNZ A;  2E2H B;  1NAP A;  1NCV A;  2GA4 B;  4B3S L;  1XNQ Q;  2ID0 A;  3PF4 A;  4UP9 A;  3EIV A;  5GAH C;  2ATW A;  2A1A A;  4G57 A;  3QB3 A;  4GOP B;  1JWM D;  1A2U A;  5IP7 H;  5IT9 E;  2ICI A;  3S1R H;  3M85 A;  4HED A;  4DV4 L;  1YI2 A;  3S16 B;  1LTS D;  2HDL A;  3SK5 A;  4G7Z C;  3KUP A;  1F9P A;  3PIP 3;  1SFO H;  2EY2 A;  4LF7 Q;  1FJG Q;  1HZ9 A;  1G6P A;  3R3O A;  5FJ8 G;  3PO2 G;  1GXD C;  1SNC A;  1KLG D;  3FDT A;  3P7J A;  4DKA C;  3A8J E;  1B8A A;  1Y1V B;  4KD3 A;  4CJ0 B;  3A56 A;  1OXS C;  4JI2 Q;  4A3L G;  5M5X B;  3S1Q H;  1JB7 A;  3NBH B;  2EYP A;  3HOZ G;  3E5S A;  2YYZ A;  4HSP A;  1GUG A;  5K36 G;  3I4N H;  3CD6 A;  1PTO F;  3PSI A;  4RKL A;  5CV5 A;  3K7A B;  2RQX A;  4QIW E;  5C4Z A;  2E5L L;  1BVS A;  1ILQ A;  2PQA A;  4M1U B;  2CHB D;  4A3J G;  2K1B A;  1CA6 A;  4A3M G;  3P1H A;  4DV5 Q;  1N34 L;  1ZKO A;  2CH4 A;  3KYH C;  2ZT9 C;  4DGZ A;  2OF1 A;  4FYD A;  3M7N A;  3NSW A;  4FF4 A;  1SLJ A;  1NR2 A;  4RMF A;  1YVC A;  3HRZ C;  1EZ6 A;  4XYQ A;  2AMC B;  4R8N A;  3EBE A;  1Y1W H;  1PYS B;  4B08 A;  2ZXP A;  4B3S Q;  1UE1 A;  5D14 A;  5J3B A;  2G9D A;  4ILW A;  2JYO A;  2JK8 A;  5IYD G;  1EU3 A;  2CKZ B;  4HMI A;  3X3N A;  2OTL A;  3NHH A;  4KJN A;  1DJR D;  3EA6 A;  3CPW A;  4HIM A;  4XQN A;  4ALP A;  4OX9 L;  4OO1 G;  4OEM B;  5ELO A;  4R4I A;  4A3F B;  4IPH A;  5C3W A;  3VA7 A;  4DV4 Q;  1LYL A;  2KCC A;  2JA8 B;  1QJO A;  5M5W B;  1D2B A;  1AH9 A;  2OQK A;  4JW0 A;  5HGQ A;  1NBW A;  2QEJ C;  2NB0 A;  2XVS A;  2HT1 A;  4K8J A;  4IQZ A;  3U4Z A;  1I3Q H;  1TWH H;  4KJO A;  4JI1 L;  1Q86 C;  1KRS A;  2NVQ H;  5M5Y B;  1PVO A;  1PZJ D;  1EQR A;  1PH9 A;  3SHL A;  1Q90 A;  3VA5 A;  1YJN A;  4P72 A;  2RF4 A;  1Y1V G;  1YJ9 A;  2F1M A;  5M3M H;  1J6Q A;  3HGB A;  4A3G B;  2OCE A;  5M9O A;  2B63 H;  4DR2 L;  3E3X A;  2K52 A;  1YIT A;  3TZU A;  1AEX A;  2E5L Q;  2A6H C;  4DXF A;  4DV1 L;  4A3E H;  1B4O A;  1GD7 A;  2WB1 B;  3PMF A;  1A3U A;  3HZX A;  3D0F A;  4Q0F A;  4JI8 L;  4FNF A;  1D1I A;  4C3I G;  1NE3 A;  1ESR A;  1UAP A;  2L5T A;  1CKN B;  4XXE A;  1HJP A;  1VQ8 A;  1G6Z A;  1SXT A;  1S5F D;  5IGD A;  1XWE A;  1I4Q A;  1YHQ A;  2D0O A;  3K5M A;  4B3M Q;  1C0A A;  1STG A;  3PF5 A;  1NNX A;  4OX9 Q;  3HOY B;  3LWU A;  3OPO A;  4K5V A;  2RDG A;  3G6J B;  1K8A C;  2NZ1 D;  1Y8P B;  2VXW A;  2HIX A;  1FYC A;  2MP1 A;  4HID A;  4LF9 L;  5CV7 A;  1QZG A;  2JXM B;  2K5N A;  3PCO B;  5DLQ E;  2R7Z H;  3ERS X;  1WCM B;  4A3B H;  4DR1 Q;  4C3J H;  4X66 L;  3QOL A;  1JQY D;  2OEO A;  4A3F G;  1WTW A;  3WOE A;  5IYC H;  4K6D A;  1EYA A;  4WOR A;  3D4W A;  4QJF A;  1VF5 C;  1STA A;  1HUN A;  2QW7 A;  4F87 A;  2HDM A;  2XRS D;  4BA1 I;  1OXX K;  1QZH A;  1EEF D;  2SNM A;  1O7Z A;  2EDG A;  3J7A 5;  1SMX A;  2F0U A;  1YHA A;  1SE3 A;  4GS3 A;  4QGU A;  5FLX c;  1G29 1;  3S15 B;  5G3L F;  1UEB A;  1TWA B;  3MXP A;  2F0O A;  1XJV A;  1AE3 A;  1HCZ A;  4A3G G;  2KHI A;  4JI8 Q;  2K14 A;  1A63 A;  1IW7 C;  1AFP A;  1HA5 A;  2A69 D;  1S5B D;  3OWE B;  2G9H D;  4KN7 C;  5KNC A;  3GTK H;  2MPM A;  3Q23 A;  2VQF Q;  1OXT A;  3QO2 A;  1ASY A;  1K0R A;  2WB1 G;  1GJX A;  2B2T C;  4QF4 A;  1VQ5 A;  3A5Z B;  2NVY B;  5DAU A;  3U9O A;  1TKW B;  2J7Z A;  4AIM A;  3GTO B;  4DFA A;  5BN3 A;  1L2F A;  5FKA C;  2EQS A;  5JJZ A;  1L0W A;  5IYB G;  3NWT A;  2I5M X;  4QY7 A;  3FPU B;  4AYB E;  1N8R C;  2IPK D;  4YWM A;  4JCV E;  3VYT A;  5C4X H;  3BJU A;  3TP6 A;  1XYI A;  3HOY G;  1PRT C;  1HQM C;  2M9V A;  4X66 Q;  4DV3 L;  4A3K B;  1PV4 A;  1MSG A;  2R93 G;  5IGB A;  1XMQ L;  4GKJ L;  2F0G A;  3H94 A;  4UAI A;  3I4M B;  3SK8 A;  1SRO A;  3I73 A;  1IBL L;  3GD7 A;  3A7L A;  3J80 L;  3H0G H;  3CME A;  1R4P B;  3UDF A;  1ONL A;  4IOA A;  1SYC A;  2KUM A;  4KMU C;  1SSO A;  4QCL A;  5J39 A;  4IFD H;  3SR1 A;  1Q3L A;  5LMU L;  3NQT A;  1EQT A;  1OXU A;  4N8F A;  4DUZ L;  3CRK C;  4Y7N H;  5KEE A;  3NTK A;  1GUN A;  4UPA A;  2LY7 A;  1KC8 C;  5KNB A;  1SJH D;  3KLR A;  1ROD A;  4EGV A;  2N55 A;  2D5D A;  1BXT A;  2NVX B;  4JI6 Q;  1X55 A;  4CKE A;  5AFW A;  5FLX E;  1ASZ A;  5DNF A;  1S5C D;  3KK7 A;  3VYR A;  2DNC A;  3RR5 A;  1Z9F A;  1QVG A;  4BA2 I;  1CFM A;  1FNU A;  4DUY L;  4XT3 B;  4ZUJ A;  2VS1 A;  5EPL A;  1U5K A;  4HJ7 A;  2RSN A;  1EIY B;  3L7Z C;  1OXV A;  5ELF A;  1B1Z A;  4NW2 A;  2B39 A;  4O2D A;  4V0B A;  3SGI A;  2DY7 A;  3NPP A;  5G3L D;  2RDF A;  1MSH A;  2XWB B;  4L5R C;  3PV0 A;  1XMQ Q;  2FMC A;  4GKJ Q;  1Q81 C;  1PDQ A;  3FKI H;  2ZXR A;  1H9R A;  5FOB B;  4DV6 L;  2JA5 G;  3GV6 A;  1RJT A;  2KCN A;  2YV5 A;  1IBL Q;  1PXU A;  3K7U C;  4A3K G;  1NUC A;  4GOP C;  1VQA A;  3BU2 A;  1WI5 A;  1EY4 A;  1SYG A;  3I4M G;  5LMU Q;  1GHJ A;  2GN5 A;  3JC6 6;  1S72 A;  5NUC A;  4IUN A;  2L0C A;  1SR3 A;  1KAW A;  2VY3 A;  1BBX C;  4L5Q A;  3DWQ A;  4IZ8 A;  4A3J H;  2IX3 A;  4A3M H;  3ERO A;  2AHO B;  1O7L A;  4KD4 A;  4BXX G;  4IJH A;  3KLS X;  2QDB A;  4ZK9 B;  2NVT B;  2VNU D;  4BBR B;  5IIF A;  4YWK A;  4RGM A;  5GAD C;  1LTG D;  2Z8L A;  1FNV A;  3BDC A;  1E1O A;  1K3B C;  3J7Y W;  2PNH A;  2AQ2 B;  5GQO A;  1SYB A;  3RLN A;  1HH2 P;  3GTP H;  3D4R A;  2KQ3 A;  1F2Z A;  4DUY Q;  3NWS A;  1U4R A;  2NZH A;  4LF5 L;  2G5D A;  3D8G A;  1W6J A;  5DEH A;  4DAM A;  1PTO B;  4OO1 H;  4MZ9 A;  2IWH A;  2UXC L;  1LTL A;  3TZD A;  3SEB A;  5FLM H;  1ILP A;  2E2I H;  1GUT A;  2EXD A;  3GTG H;  2PMZ B;  1S5E D;  2VL6 A;  2ZXO A;  3VR4 A;  1U0L A;  1SE4 A;  5C3X A;  5EKL A;  4ABN A;  2XIW A;  3V05 A;  4LUZ A;  2A68 C;  2NZO A;  1MI2 A;  5DM6 3;  1TS2 A;  5I6Y A;  1VQ7 A;  3HOX B;  4RAU C;  3U50 C;  2F0D A;  5I9O A;  2F3V A;  2JN4 A;  4ZKC B;  4DR3 L;  2YU9 H;  1LT3 D;  3KF8 B;  4O0A A;  2B2T A;  4K6L A;  1PYB A;  3KJP A;  1YJW A;  2E2J H;  1V1P A;  2PI2 A;  2D9U A;  1J8I A;  3NTH A;  3K58 A;  1YNN D;  2WAQ E;  1X6O A;  1JJ2 A;  1PH4 A;  3BZC A;  1I94 L;  2E75 C;  4PNY A;  4JBK A;  3NQI A;  4C3I H;  3DM3 A;  4ZLT F;  3W2D A;  4L6T B;  2B2U A;  4BBS B;  1PFN A;  2TSS A;  4I7A A;  2Q8R E;  1B53 A;  1MJC A;  3N52 A;  1S4Z A;  2LS0 1;  3CQZ H;  4HMJ A;  4BBR G;  3J7A V;  2F0H A;  1K83 B;  3E9H A;  5I2Y A;  2JA6 B;  4ZRZ A;  4QUF A;  3SXH A;  2D0P A;  1I6V C;  2UXC Q;  1G91 A;  1EZ8 A;  2PQE A;  3MC0 B;  2F0V A;  4K2K A;  3CCS A;  2MO1 A;  1BR9 A;  3FVQ A;  1STN A;  4A3D G;  4N9T A;  2HCI A;  2L15 A;  2XGT A;  2VQE L;  3MZ5 A;  3EQL C;  3S1M B;  3GTJ B;  5C44 B;  2I46 A;  1I4X A;  1SE8 A;  2WAC A;  3FPP A;  3U4V A;  1F2M A;  2QF7 A;  2L9H A;  1E7Z A;  1VQD A;  5CV9 A;  1X3P A;  1ZEQ X;  2KEN A;  4RA8 A;  4DR3 Q;  4A3I B;  1Q7Y C;  5D3D A;  1AZP A;  3K59 A;  1BCP F;  4NB3 A;  1GVP A;  3LWE A;  3Q8D A;  2KEE A;  1Z6H A;  4MTK A;  1CQV A;  4H13 C;  4X3U A;  4BY1 H;  2SEB D;  2Q2I A;  1D5M C;  2PZT A;  1BDO A;  1C4Q A;  2NYZ D;  1KNA A;  5C0X H;  3FEW X;  4ZQ3 A;  2WKC A;  3V2T A;  2KHS A;  5LMN W;  1VQK A;  1XTD A;  5H1S E;  5JVG 3;  1G8Z D;  1XMO L;  2F0E A;  4QUC A;  4HR7 B;  2FMM A;  1TS4 A;  1X32 A;  1QG7 A;  2A6E C;  4CDC C;  3D4D A;  3RZD H;  1WTV A;  1C7Y A;  2K28 A;  4JI3 L;  3AYH B;  2K04 A;  4I7Z C;  1SDF A;  4RFB A;  3TN2 A;  1VF7 A;  2BCO A;  2K32 A;  2LSS A;  4LJZ C;  4BBS G;  3F2B A;  1Q12 A;  4DAY B;  1HNW Q;  2K7V A;  4GOP A;  3HOU B;  1GKH A;  3D6W A;  4ODG A;  1CHP D;  2OQ0 A;  1RTO A;  1KNE A;  2JA6 G;  4JI2 L;  4XYO A;  2V1C C;  3PIO 3;  1VQI A;  2KBN A;  1X3Q A;  3ULP A;  1P8L A;  3G48 A;  1IXR A;  2PI2 E;  2R93 H;  2VQE Q;  1QIL A;  1SYD A;  2A6E D;  4AQY L;  1TWG B;  1GUW A;  4TVA B;  3NEN A;  4POG A;  1Y69 U;  4IFD I;  1UWV A;  1NJI C;  1V43 A;  3JAM L;  4K8I A;  4KTA A;  1WJJ A;  3ICE A;  1O80 A;  3K5L A;  5C44 G;  3J80 i;  1NTG A;  2XWJ B;  2VUM B;  3W1G A;  5I4D A;  2QDL A;  1X65 A;  1VQN A;  3D31 A;  1WTP A;  1ENC A;  3T56 B;  1STH A;  4C3H H;  1N9W A;  3E0E A;  4OON A;  1UE7 A;  3S1N B;  4WJW A;  1HTP A;  2BH2 A;  1BOS A;  3HFZ B;  1XMO Q;  5HY6 A;  2F0Q A;  4HSV A;  2PW5 A;  4B3R Q;  1B44 D;  1RKN A;  4QIW B;  3I90 A;  1I50 H;  5EKI A;  1VMC A;  2D2C C;  3K6O A;  3J7A F;  1WD0 A;  2Y0S E;  1CKO A;  4EQP A;  4JI3 Q;  2K5H A;  1T9H A;  3K5O A;  2UXD L;  2DY8 A;  4MIU A;  2NBF A;  3S2D B;  5IT9 L;  2ZM6 L;  3VYS A;  1E2Z A;  1PYW D;  4DA2 A;  4JC0 A;  4DU9 A;  5IOC A;  2O5J C;  1EYC A;  2E76 C;  1KXL A;  3A54 A;  5IOD A;  1L0Y B;  1CM9 A;  1WTO A;  2QA4 A;  1VQB A;  2DNE A;  1FL0 A;  1E0B A;  1V1Q A;  1HR0 W;  3HOU G;  4AQY Q;  2UU9 Q;  3PO3 H;  3DWP A;  3S14 H;  2B2V C;  5A2Q E;  5BN5 A;  2JA5 H;  1BF4 A;  4RG1 A;  4XDX A;  1KDB A;  1FNW A;  1VQ9 A;  2HCC A;  1II3 A;  4HJ8 A;  3H91 A;  2FIN B;  1JB3 A;  4X3S A;  3A5U A;  1U9R A;  2OXP A;  4GNX A;  3PGZ A;  5C3E B;  4NXN Q;  1IYV A;  1RCV D;  1KRT A;  1L1O C;  2MO0 A;  4IUP A;  1A15 A;  3OIP A;  3HOV B;  4IUR A;  4B9X A;  2D62 A;  4K14 A;  2N78 A;  3H15 A;  2VUM G;  1JMC A;  4RWS C;  1HNZ L;  1KD1 C;  1STB A;  4B3M L;  3K0X A;  1IL2 A;  3I4O A;  2PNR C;  1CKN A;  4OWT B;  2F0M A;  4X64 L;  2PZW A;  2SNS A;  3A8I E;  2UXD Q;  1SYE A;  2XSC A;  3SE0 A;  1MGS A;  1EY7 A;  1CT1 D;  3ER0 A;  3CCL A;  4DR1 L;  1IBM L;  4LFA L;  3AMU A;  2JA7 B;  2DUD A;  2ZM6 Q;  5IY0 A;  1KL9 A;  3DLL A;  2EPB A;  3L2P A;  3HOW B;  3GTM B;  4OHJ A;  3CCQ A;  5JJL A;  4IJL A;  5ELE A;  3NE5 B;  3RUZ A;  4DR6 Q;  1VQH A;  2FXQ A;  4C2M B;  3CKI B;  2UUA L;  2K5V A;  1Q1B A;  2A8V A;  4EVO A;  2N8N A;  3DEP A;  3NXW A;  5C4J B;  4OXP A;  1HXY D;  3S2H H;  5JJK A;  4DK1 A;  1TII D;  2DJF C;  1PTO C;  4OWX B;  1VQ4 A;  4R8I A;  2EIF A;  1BQQ T;  3KOJ A;  4P71 A;  1FGB D;  1GUS A;  2FJ2 A;  1N32 Q;  3PIO A;  2PQA B;  2F4I A;  1CSP A;  3A55 A;  1VCI A;  1K8M A;  1LUZ A;  2VQF L;  3FMC A;  4JI5 L;  3HKS A;  3EN2 A;  2RBM A;  1JJG A;  3FRP B;  3QG1 A;  4RGO S;  2ZJP A;  1HNZ Q;  2IW3 A;  3N6R A;  2RSO A;  4RCN A;  3T4A C;  3AB9 A;  4J15 A;  2OTJ A;  3VR6 A;  3TQY A;  4YCV A;  4L63 B;  1DOL A;  1PTO D;  2B29 A;  2XN9 C;  4X64 Q;  3RZO H;  1MIU A;  3H3V I;  3GTQ B;  1W6K A;  5EPK A;  4B9W A;  5FK9 C;  3BVM A;  5LL6 X;  1F77 A;  1W2B A;  4GLA C;  1IBM Q;  4LFA Q;  1NSN S;  1BO0 A;  4P73 A;  4KHP L;  3HEJ A;  1M8A A;  1R9T B;  2JA8 G;  4A3C H;  2LFN A;  2A69 C;  3T1H Q;  3U58 A;  3M4O B;  3F2U A;  4DF7 A;  2YTV A;  1EU4 A;  2UUA Q;  2JA7 G;  1D5X C;  2R92 H;  5M3F H;  3IKJ A;  1VQG A;  4IOC A;  4LK1 C;  1LV9 A;  1TWC B;  3TP8 A;  4DR7 Q;  3HOW G;  3CP0 A;  2EJG C;  2RCF A;  4A93 B;  4CDE C;  2YTY A;  4ZCK A;  4AYB B;  2F4V L;  3F8T A;  3KDF A;  1TS5 A;  3OIQ A;  1ET6 A;  1FD7 D;  4GN3 B;  3EFX D;  3TBI B;  4RHS A;  4A4I A;  3FHW A;  2NWG A;  1LTB D;  3O13 A;  1PH5 A;  2R3Z A;  4JBW A;  5C0X I;  3GTL B;  2MHV A;  1EOV A;  3Q22 A;  2IHE A;  4JI6 L;  2I5L X;  4JI5 Q;  4R4O A;  1OTC A;  3TS2 A;  1O7I A;  2WII B;  4GZY C;  2NN6 I;  1YNJ C;  1I6H H;  4V19 0;  1B70 B;  2L55 A;  4BS9 A;  2C5C A;  3TSS A;  3S1R B;  3PUZ A;  4LFB Q;  1TU2 B;  2HQL A;  3RLO A;  3MFY A;  1M1K C;  4LUV A;  1D7Q A;  1K8G A;  4KY5 A;  2B2Y C;  4P75 A;  4F88 A;  2HHH Q;  1X3G A;  2Q8T A;  5IGG A;  1SFO B;  4HCS A;  1Q8K A;  1F9R A;  3OSO A;  4K5X A;  3TP5 A;  4CHT B;  1B7Y B;  3M4Q A;  2IT1 A;  5IWA Q;  4K0K Q;  1RL2 A;  2B2V A;  4KHP Q;  2WKD A;  1BCP B;  1F9S A;  3I70 A;  4BY7 H;  4KKU A;  1YNX A;  1WCM G;  5IP9 H;  3S1Q B;  1X54 A;  3CXC A;  4ID6 A;  1N36 Q;  1YNJ D;  1RIP A;  3RNU A;  1K28 A;  5T1G A;  1L1O A;  3I4N B;  1XPO A;  3PQI A;  5CBE E;  4C1N I;  1RF2 D;  2Q8I B;  4JV5 Q;  4PQX A;  1QVF A;  2F4V Q;  2QKI C;  4H02 A;  2EYL A;  1DOK A;  1HNX L;  1TWF H;  2X6L A;  1ET9 A;  1LTI D;  4HJA A;  4A93 G;  5I6W A;  2E8G A;  3I3C A;  4OEL B;  2K75 A;  2F3W A;  1WVL A;  4NP5 A;  1O78 A;  4KHV A;  1YHB A;  4IPC A;  4J8Q A;  1AZQ A;  3JAM i;  2J0T D;  1VQO A;  2EY6 A;  5K5P A;  2JA9 A;  1Y1W B;  4JOI C;  2BDO A;  3OW7 A;  5JEA G;  1HTL D;  4LF4 L;  1JOQ A;  1V9P A;  1A6X A;  5FLX L;  5D3I B;  3T1Y L;  3M3Y H;  3AFP A;  4TQU S;  2N88 A;  3M7G A;  2KOL A;  1SND A;  3CC2 A;  3AU7 A;  4JBM A;  1J9O A;  3TDQ A;  3MXU A;  2XNA C;  1BKB A;  4KK7 A;  4I65 A;  3IL8 A;  3OYY A;  3QOJ A;  5IP7 G;  1I3Q B;  2B8F A;  1TWH B;  2HQE A;  3T53 B;  4TRD A;  1IKM A;  2F0K A;  1PH7 A;  2OWO A;  2NVQ B;  1KAA A;  5FJ8 H;  2CH4 W;  3PO2 H;  3OWF A;  4H44 C;  5A35 A;  3Q0A A;  3CMA A;  2KA7 A;  4A3L H;  3HKZ E;  3MFG A;  4LF8 L;  5M3M B;  3HOZ H;  2Z0S A;  4GN4 B;  2B63 B;  1CI3 M;  3UDI A;  2ZTC A;  3NTI A;  1EEI D;  5K36 H;  2R7F A;  2VW9 A;  1HNX Q;  2X69 A;  5HUR A;  4A3E B;  1PH1 A;  1C8C A;  1KTK A;  2F0J A;  2I07 B;  5CV8 A;  3I4N G;  3S17 H;  3M9B A;  4LNQ A;  3TEH B;  2NTS A;  1BBW A;  1HZB A;  3OHX C;  3OMG A;  1JOK A;  3L0O A;  3ND9 A;  3X3M A;  1A0I A;  1EYD A;  5CYU A;  3T51 B;  2R6G A;  4UY8 C;  2GVA A;  2JEB I;  4GLX A;  2WV6 D;  4YHH Q;  3A8K E;  3BVG A;  3VR5 A;  4LF4 Q;  1WTR A;  2EJF C;  3T1Y Q;  5IYD H;  3F2D A;  1GUO A;  2CFM A;  1Y1W G;  4X3K A;  1MBY A;  1CHQ D;  2BE5 C;  1QWY A;  5HGT A;  2Q2H A;  4DV0 L;  2WAQ B;  2AUK A;  1S5D D;  2R7Z B;  2E2H H;  2PZU A;  4A3B B;  3CU7 A;  2CW0 C;  4C3J B;  3FP9 A;  1YNN C;  1QOH A;  1WYD A;  4GN5 A;  4XIG S;  1R4Q B;  1VQL A;  1QUQ A;  5J22 A;  1G2S A;  3K0Y A;  4G7O C;  1JT8 A;  3D6C A;  5T1I A;  3S16 H;  1HQR D;  1LT5 D;  4ME3 A;  4ZYS A;  3STB D;  4KY6 A;  4YY3 L;  2B3G A;  4FP5 D;  4LF8 Q;  3LNN A;  1E2V A;  4F8M A;  5ISR A;  3P75 A;  2ZTE A;  3A7A B;  2BE5 D;  1JWS D;  2PCF B;  4L8J A;  2MJ8 A;  1Y1V H;  1B3Q A;  4MN3 A;  2E74 C;  2KEC A;  1YEZ A;  3T16 A;  4B3T L;  1HRJ A;  3HS0 C;  5M5X H;  1JIC A;  3I7F A;  2CW0 D;  5M3M G;  2H4O A;  3I8Z A;  1P16 A;  3MVV A;  1A3T A;  2F0P A;  3ND8 A;  2PW7 A;  4JI0 Q;  4LUO A;  4A3E G;  3GTK B;  3K7A H;  1LAC A;  3E6Z X;  2K4K A;  2B2Y A;  2O5I C;  2CCZ A;  3CC4 A;  4IPD A;  5EBC A;  3TRE A;  4DNR B;  2KVM A;  3K57 A;  5BR8 L;  1TXY A;  2ZTD A;  4QQB X;  2XRQ D;  4LFC L;  3CCR A;  3BS1 A;  4LMQ D;  3V96 A;  1B9M A;  1PZI D;  4JPB W;  4DV0 Q;  5C4X B;  3R2I A;  1HNW L;  4K5W A;  1L0X B;  2PMZ E;  1E24 A;  2M2L A;  3CHB D;  1JWU D;  3Q24 A;  4Y52 H;  1XPU A;  1K9M C;  3DHQ A;  5ELN A;  1Q82 C;  5LMN Q;  5IE8 A;  2M00 A;  4FXD A;  2CWP A;  1EYG A;  2R7Z G;  4EQ5 A;  5C5L A;  3GO5 A;  4A3F H;  4A3B G;  1TVX A;  2JA8 H;  1QB5 D;  3H0G B;  1M90 C;  4DV2 L;  5M5W H;  3KLS A;  4YCW A;  3S24 A;  4YY3 Q;  4NDX A;  4RH6 A;  4IUV A;  3VR3 A;  2K6A A;  4PZ8 A;  2C35 B;  1H9S A;  5IYC G;  3MWY W;  1STE A;  1IYU A;  4IUU A;  4B3T Q;  2PO4 A;  5M5Y H;  4Y7N B;  3OW2 A;  4JOI A;  2QEX A;  2SDF A;  1U4L A;  3HOX G;  4KV6 A;  3C2P A;  3KF6 A;  1V1P B;  1LAB A;  4PZ7 A;  3WOF A;  4A3G H;  1SNO A;  2K5Q A;  2RVL A;  5ELB A;  4JI7 Q;  3HP3 A;  1S3O A;  4FF3 A;  5JJI A;  2LKV A;  3K81 C;  1JOR A;  4B3R L;  4IUQ A;  1A2T A;  1TY0 A;  2F0I A;  5EGT A;  1I4H A;  5CGK A;  1YIJ A;  5BR8 Q;  2H5X A;  3SK4 A;  3IRB A;  1Z47 A;  1G51 A;  1HPC A;  3KLW A;  1GO3 E;  2L4N A;  4LFC Q;  1PRT B;  2BA0 A;  4UHV A;  1EY5 A;  4IUT A;  1KIX A;  5IYB H;  2IX0 A;  3VYU A;  4KY7 A;  1LTA D;  4RCO A;  4OWW B;  4U68 A;  1RD9 D;  3CCU A;  2B8G A;  2MNA A;  1RHP A;  3HOY H;  3ITP A;  4RGT A;  1AN8 A;  2EYF A;  3FKI B;  5C4X G;  2E2D C;  3S9W A;  2UU9 L;  1PFB A;  4DV2 Q;  2Y0S B;  1WTH A;  2LMC B;  1WCM H;  2Z1C A;  3HOZ B;  5J1Z A;  4RKB A;  1DXM A;  1CKM A;  3QWN A;  1FGU A;  1H9J A;  1B2T A;  3H0G G;  3NBH A;  1SMY C;  2R7D A;  4NXN L;  4OIJ A;  5IGC A;  2MGS A;  1A8V A;  4IFD G;  4IPG A;  1TY2 A;  3GV3 A;  4CDD C;  4A3J B;  1BCP C;  5EAY A;  2Q2U A;  4A3M B;  5ELC A;  4A3I G;  1HHV A;  4NPS A;  1IHZ A;  4R4C A;  4PG3 A;  5C5M A;  1VMP A;  3BG3 A;  1MKH A;  2HIV A;  5KGU A;  1BUV T;  2A5H A;  2B2W C;  3S15 H;  5FO7 B;  5KYI A;  1IKL A;  1PZK D;  1TWA H;  3SK6 A;  5JVH 3;  2UUB Q;  1I4G A;  1SNP A;  5LL6 S;  3GTP B;  1JC7 A;  1VQP A;  5CBA E;  2NTT A;  4DV7 Q;  1SMY D;  4CKB A;  3AFQ A;  3VDY A;  1HFN A;  4FVM A;  4KKT A;  3I56 A;  3UE0 A;  4UDU C;  2NVY H;  3RD4 A;  3NEM A;  1BCP D;  1EIG A;  5C6A A;  2E2I B;  2RKS A;  1V1O A;  1ZYR D;  4KHZ A;  3GTO H;  3GTG B;  4DR5 Q;  1WTX A;  2K5W A;  3W5O A;  3J81 c;  1KQS A;  4DR6 L;  1NMF A;  2KCT A;  1D1K A;  4OL7 A;  3NUC A;  4X65 Q;  3ZJY C;  1XNR Q;  4UP7 A;  1PH2 A;  1SNQ A;  3FKI G;  4A3K H;  5E1F A;  5JEA J;  3H6M A;  3K80 C;  5A2Q L;  3MTS A;  2V4D A;  2YU9 B;  1EFW A;  2Y0S G;  1GOZ A;  1ICW A;  1LO5 D;  3I4M H;  2E2J B;  4H0L C;  1N32 L;  3KBX A;  5I2X A;  3DXJ C;  4ZUI A;  4J6H A;  4CDF C;  2QIL A;  4GLV B;  4HIO A;  4C1N K;  1EL0 A;  3MXN B;  2SOB A;  1EWI A;  1VQJ A;  2F3I A;  2H1E A;  4C3I B;  2EJM A;  4O42 A;  2VZA A;  3UI2 A;  4BXX H;  3BYT B;  5GAG C;  1HZC A;  5F2D A;  1H9K A;  2JP1 A;  5EBD A;  5FO9 B;  5E4W C;  3CQZ B;  2K01 A;  2F0F A;  2ASB A;  2AKW B;  4OO1 I;  1QNK A;  3A74 A;  5KYL A;  2Z9H A;  3BZD B;  4YWL A;  2NVX H;  1IZ6 A;  1AW7 A;  1JJC B;  1VDZ A;  4WRD A;  4KI0 A;  1J5E L;  3AEV A;  2KJX A;  4JG2 A;  4KKS A;  3HG9 A;  5E3F A;  5CMD A;  2P5Z X;  3T1H L;  5AJ3 L;  3PUY A;  1PH3 A;  4FXK C;  1MHW C;  1SE2 A;  1SBB B;  5FLM G;  4E6I A;  4CBV A;  1SAP A;  2R61 A;  3G7L A;  1UEA B;  1DM0 B;  2KCM A;  4DR7 L;  4L5T A;  1HUM A;  1PMR A;  2ALY B;  4P2C B;  4TSS A;  4Z9C B;  2RHQ B;  4HN7 A;  3CCJ A;  1LTT D;  1PH8 A;  5EPJ A;  4R1J A;  3J81 E;  1JR0 D;  3MEF A;  4H7B A;  4U67 3;  2EY1 A;  3DMU A;  4GNX B;  4BY1 B;  1G2T A;  5E7N A;  3J81 L;  4N8X 1;  4TKO B;  1RTN A;  2A73 B;  1LTR D;  1D6E C;  3IAY A;  4P74 A;  5C3E G;  5JOB A;  3MAQ A;  1EIH A;  2A74 C;  2F0L A;  1QE6 A;  3G4S A;  3PUV A;  3HOV G;  2AQ1 B;  3RZD B;  1N34 Q;  1ML0 D;  1AP0 A;  1T5E A;  1EY6 A;  4LFB L;  5CV6 A;  4PMB A;  4APV A;  3QIA A;  2HHH L;  1BBU A;  3GQB A;  2NVT H;  1Y8N B;  3EVQ A;  3R2T A;  4WFN 3;  4BBR H;  1J5E Q;  1TS3 A;  1FVI A;  3GP7 A;  4NMZ A;  3CCV A;  5IWA L;  4K0K L;  1QVC A;  3DM1 A;  3KBG A;  2MUY A;  3SVM A;  2RDH A;  3J80 c;  1TQO A;  2UXB L;  2F0S A;  5AJ3 Q;  1DZ1 A;  4JI4 L;  2A6H D;  2R93 B;  3B6Y A;  1N36 L;  4LW1 A;  1PRT F;  1A62 A;  2HD3 A;  1F2Y A;  1PTO H;  2F0N A;  4A3D H;  1Z7T A;  5DM7 3;  3F2C A;  4JV5 L;  4S3S A;  2X6G A;  3K5N A;  2WB1 E;  1I4R A;  1KDC A;  4JI1 Q;  1MD2 D;  3U9S A;  4WJ3 M;  5COR A;  1JCK B;  2VB2 X;  3KFU A;  2IY5 B;  2B2W A;  3C1E A;  1K73 C;  2N49 A;  4RGN A;  3WDN A;  2EY5 A;  2K03 A;  3PIP A;  3ZYY X;  4C3H B;  1K0S A;  4DK6 C;  1SJE D;  3HOX H;  4DR2 Q;  4DK3 C;  1UNS A;  1V8Q A;  4YIJ A;  3GDE A;  5IGE A;  2ZJR A;  4DV1 Q;  4BY1 G;  1VS0 A;  5FO8 B;  3BYY B;  3MEH A;  4UP8 A;  4C56 C;  1UE5 A;  1I50 B;  3Q6S A;  5C0X G; 
#chains in the Genus database with same CATH homology
 5CV4 A;  2OT2 A;  1CK1 A;  2ENB A;  2F0W A;  2NN6 G;  2L1B A;  4FO2 A;  2RA4 A;  2JEA I;  1TT2 A;  1CQF A;  2EYH A;  4QMG A;  1M4V A;  4CKC A;  4PMC A;  1EOT A;  2CQA A;  2O2L D;  4O1N A;  3TP7 A;  1F2L A;  2Z4H A;  4DAP A;  3PO3 B;  5JPN C;  5EQ0 A;  3S14 B;  1CZG A;  2B2U C;  2JA5 B;  1EWC A;  3E0J A;  1RDP D;  1SNM A;  1IW7 D;  1KDA A;  1T5X D;  3J80 E;  4FF2 A;  4ULL A;  3QJY A;  2WIN B;  1B9N A;  1NR4 A;  4PV1 C;  3LX0 A;  2HUG A;  3HKZ B;  2VB3 X;  4BWG B;  2EYM A;  1PRT D;  4C3H G;  2K33 A;  1A3V A;  4Q5V A;  1I4P A;  2QCP X;  4ZKB B;  3T13 A;  1QCB D;  2KED A;  4OGQ C;  4DN4 M;  1LT4 D;  1PFM A;  2Z4I A;  4F7X A;  2FFK B;  1EY0 A;  4J1M A;  2WP8 J;  1C48 A;  5E4X A;  4IFD J;  1D5Z C;  2EXZ A;  2K5D A;  2K05 A;  4FF1 A;  1XTC D;  1EQV A;  3S2H B;  3L3O C;  3C46 A;  3L9A X;  3I72 A;  1B50 A;  3CRL C;  4KN4 C;  2CVR A;  3NK9 A;  1Q8I A;  3NBI A;  2FHT A;  1UUP A;  3KF8 A;  1JE4 A;  3EJI A;  2NUC A;  2F0T A;  4IN3 A;  3BDO A;  1DOM A;  1ESF A;  3R93 A;  3RLF A;  3RZO B;  1SEB D;  1B3A A;  3PUX A;  2PYK A;  5C4H A;  3D3R A;  3ONA B;  3BDL A;  4MHE A;  1EY8 A;  1GHK A;  1ENA A;  1IL8 A;  1DON A;  2TMP A;  2R92 B;  5ELD A;  5M3F B;  4IAL A;  5KIX A;  1DD2 A;  4A3D B;  1KLU D;  4DK0 A;  4EQO A;  4HAE A;  3NP8 A;  1ENF A;  1CTM A;  3DUZ A;  3H3V C;  2AQ3 B;  4HCE A;  4CGY B;  5COY A;  4ME5 A;  2EYO A;  3DEO A;  5CC4 A;  2AWN A;  1U4M A;  1Q1E A;  1EWH A;  5EJW A;  3URY A;  4N9P A;  2O4X A;  3BVZ A;  5I9P A;  1I6H B;  4DNT B;  3H09 A;  4XQQ A;  1HFG A;  4HTH A;  2F03 A;  5IGF A;  1OO9 B;  4RHR A;  2JSO A;  3ERQ A;  4ZAI A;  1WD1 A;  3W3A A;  2PPB C;  4PMW A;  4M8A A;  1PLF A;  2A68 D;  1DYQ A;  1CZW A;  4FXG C;  4BY7 B;  1F9Q A;  1QNU A;  3C1F A;  3OMC A;  4C3J G;  4DAY A;  4LAA A;  4JK1 C;  2IX1 A;  5CR3 A;  5KND A;  2AUJ D;  1HA6 A;  2IJ0 A;  4NKL A;  4K2L A;  1TWF B;  2BA1 A;  2EVB A;  3VR2 A;  3MA2 B;  1E2W A;  4XTC S;  1JOO A;  1STY A;  2AWO A;  4G7H C;  1XX8 A;  2J4X A;  3PUW A;  5LHY 1;  1WTQ A;  3IFD A;  2EOT A;  4R9W A;  5EKK A;  2EE1 A;  4DXG A;  3I4L A;  4XQJ A;  3M3Y B;  2BDN A;  3DWA A;  4CJ1 B;  3OOC A;  3RMH A;  1CA5 A;  1KAB A;  3MHB A;  2C9O A;  2NN6 H;  1ZXT A;  1SYF A;  5BN4 A;  2BOS A;  3PO2 B;  3SDZ A;  2IL8 A;  2L12 A;  1EFI D;  5KRU A;  4QB4 A;  1DCZ A;  2ICE C;  1Y8O B;  2JE6 I;  1LLR D;  5C0X J;  1O7Y A;  3I91 A;  1H9S B;  2L11 A;  2DN8 A;  2EZV A;  3S17 B;  4CJ2 C;  1EY9 A;  3IFT A;  3TME A;  3JAM E;  4EQN A;  3M4Y A;  1ZYR C;  1H9M A;  2EYJ A;  4DAV A;  4G4K A;  1XXG A;  1FR3 A;  5JAV A;  1LT6 D;  3P20 A;  4XT1 B;  4X3T A;  1TR5 A;  5JPM C;  3MXG A;  5TSS A;  3MXN A;  1U4P A;  5JEA H;  1K8O A;  3R8B A;  3C3L A;  5D65 A;  4OIK A;  1BNZ A;  2E2H B;  1NAP A;  1NCV A;  2GA4 B;  2ID0 A;  4G57 A;  3QB3 A;  1JWM D;  1A2U A;  5IT9 E;  2ICI A;  3M85 A;  4HED A;  3S16 B;  1LTS D;  2HDL A;  3SK5 A;  4G7Z C;  3KUP A;  1F9P A;  3PIP 3;  2EY2 A;  3R3O A;  1GXD C;  1SNC A;  1KLG D;  3FDT A;  3P7J A;  3A8J E;  1Y1V B;  4KD3 A;  4CJ0 B;  3A56 A;  1OXS C;  5M5X B;  2EYP A;  3E5S A;  2YYZ A;  4HSP A;  1GUG A;  5K36 G;  1PTO F;  4RKL A;  5CV5 A;  3K7A B;  2RQX A;  5C4Z A;  1ILQ A;  4M1U B;  2CHB D;  2K1B A;  1CA6 A;  3P1H A;  1ZKO A;  2ZT9 C;  4DGZ A;  2OF1 A;  4FYD A;  3M7N A;  3NSW A;  4FF4 A;  1NR2 A;  3HRZ C;  1EZ6 A;  4XYQ A;  4R8N A;  4B08 A;  2ZXP A;  5D14 A;  2G9D A;  4ILW A;  2JYO A;  1EU3 A;  4HMI A;  3X3N A;  3NHH A;  4KJN A;  1DJR D;  3EA6 A;  4XQN A;  4OO1 G;  4A3F B;  5C3W A;  3VA7 A;  2JA8 B;  2KCC A;  1QJO A;  5M5W B;  1D2B A;  2QEJ C;  2NB0 A;  2XVS A;  4K8J A;  4IQZ A;  4KJO A;  5M5Y B;  1PZJ D;  3SHL A;  1Q90 A;  3VA5 A;  2F1M A;  3HGB A;  4A3G B;  5M9O A;  3TZU A;  1AEX A;  2A6H C;  4DXF A;  1B4O A;  2WB1 B;  3PMF A;  1A3U A;  3HZX A;  4Q0F A;  4FNF A;  1D1I A;  4C3I G;  1ESR A;  1UAP A;  2L5T A;  4XXE A;  1G6Z A;  1SXT A;  1S5F D;  5IGD A;  1XWE A;  1I4Q A;  3K5M A;  1STG A;  3HOY B;  3LWU A;  3OPO A;  4K5V A;  2RDG A;  3G6J B;  2NZ1 D;  1Y8P B;  2VXW A;  1FYC A;  2MP1 A;  5CV7 A;  2JXM B;  1WCM B;  3QOL A;  1JQY D;  2OEO A;  1WTW A;  3WOE A;  4K6D A;  1EYA A;  4WOR A;  3D4W A;  1VF5 C;  1STA A;  1HUN A;  4F87 A;  2HDM A;  2XRS D;  4BA1 I;  1OXX K;  1EEF D;  2SNM A;  1O7Z A;  2EDG A;  2F0U A;  1SE3 A;  1G29 1;  3S15 B;  5G3L F;  1TWA B;  3MXP A;  2F0O A;  1HCZ A;  1IW7 C;  1AFP A;  1HA5 A;  2A69 D;  1S5B D;  3OWE B;  2G9H D;  4KN7 C;  5KNC A;  2MPM A;  3Q23 A;  1OXT A;  3QO2 A;  1GJX A;  2B2T C;  4QF4 A;  3U9O A;  2NVY B;  5DAU A;  1TKW B;  2J7Z A;  3GTO B;  4DFA A;  5BN3 A;  5FKA C;  5JJZ A;  3NWT A;  3FPU B;  2IPK D;  3VYT A;  3TP6 A;  1XYI A;  1PRT C;  1HQM C;  2M9V A;  4A3K B;  1MSG A;  5IGB A;  2F0G A;  3H94 A;  4UAI A;  3I4M B;  3SK8 A;  3I73 A;  3GD7 A;  3A7L A;  3J80 L;  1R4P B;  1ONL A;  1SYC A;  2KUM A;  4KMU C;  1SSO A;  4QCL A;  5J39 A;  4IFD H;  3SR1 A;  1Q3L A;  3NQT A;  1EQT A;  1OXU A;  3CRK C;  5KEE A;  3NTK A;  1GUN A;  2LY7 A;  5KNB A;  1SJH D;  3KLR A;  1ROD A;  4EGV A;  2N55 A;  2D5D A;  1BXT A;  2NVX B;  4CKE A;  5AFW A;  5FLX E;  5DNF A;  1S5C D;  3KK7 A;  3VYR A;  2DNC A;  4BA2 I;  1CFM A;  1FNU A;  4XT3 B;  4ZUJ A;  5EPL A;  2RSN A;  3L7Z C;  1OXV A;  5ELF A;  1B1Z A;  4NW2 A;  2B39 A;  4V0B A;  2DY7 A;  3NPP A;  5G3L D;  2RDF A;  1MSH A;  2XWB B;  3PV0 A;  2FMC A;  1PDQ A;  2ZXR A;  1H9R A;  5FOB B;  3GV6 A;  1RJT A;  2KCN A;  1PXU A;  1NUC A;  1EY4 A;  1SYG A;  1GHJ A;  5NUC A;  4IUN A;  2L0C A;  1BBX C;  3DWQ A;  4IZ8 A;  2IX3 A;  3ERO A;  1O7L A;  4KD4 A;  3KLS X;  2QDB A;  4ZK9 B;  2NVT B;  2VNU D;  4BBR B;  5IIF A;  4RGM A;  1LTG D;  2Z8L A;  1FNV A;  3BDC A;  3J7Y W;  2AQ2 B;  1SYB A;  3D4R A;  2KQ3 A;  1F2Z A;  3NWS A;  1U4R A;  3D8G A;  1W6J A;  5DEH A;  1PTO B;  4OO1 H;  2IWH A;  3TZD A;  3SEB A;  1ILP A;  1GUT A;  2PMZ B;  1S5E D;  2ZXO A;  3VR4 A;  1SE4 A;  5C3X A;  5EKL A;  4ABN A;  2XIW A;  3V05 A;  2A68 C;  1MI2 A;  5DM6 3;  1TS2 A;  5I6Y A;  3HOX B;  4RAU C;  2F0D A;  5I9O A;  2F3V A;  4ZKC B;  1LT3 D;  2B2T A;  4K6L A;  1V1P A;  2D9U A;  1J8I A;  3NTH A;  3K58 A;  1YNN D;  2E75 C;  4PNY A;  3NQI A;  4ZLT F;  3W2D A;  4L6T B;  2B2U A;  4BBS B;  1PFN A;  2TSS A;  2Q8R E;  1B53 A;  1S4Z A;  2LS0 1;  3N52 A;  4HMJ A;  3J7A V;  2F0H A;  1K83 B;  5I2Y A;  2JA6 B;  4ZRZ A;  4QUF A;  3SXH A;  1I6V C;  1G91 A;  1EZ8 A;  2PQE A;  3MC0 B;  2F0V A;  4K2K A;  1BR9 A;  3FVQ A;  1STN A;  4N9T A;  2HCI A;  3MZ5 A;  3EQL C;  3S1M B;  3GTJ B;  5C44 B;  2I46 A;  1I4X A;  2WAC A;  3FPP A;  1F2M A;  2QF7 A;  2L9H A;  5CV9 A;  1X3P A;  1ZEQ X;  4RA8 A;  4A3I B;  5D3D A;  1AZP A;  3K59 A;  1BCP F;  3LWE A;  2KEE A;  1Z6H A;  1CQV A;  4H13 C;  4X3U A;  2SEB D;  1D5M C;  2PZT A;  1BDO A;  1C4Q A;  2NYZ D;  1KNA A;  5C0X H;  3FEW X;  4ZQ3 A;  2WKC A;  3V2T A;  2KHS A;  5JVG 3;  1G8Z D;  2F0E A;  4QUC A;  4HR7 B;  2FMM A;  1TS4 A;  1X32 A;  1QG7 A;  2A6E C;  3D4D A;  1WTV A;  2K28 A;  2K04 A;  4I7Z C;  1SDF A;  4RFB A;  3TN2 A;  1VF7 A;  2BCO A;  2K32 A;  4LJZ C;  1Q12 A;  2K7V A;  3HOU B;  3D6W A;  4ODG A;  1CHP D;  1RTO A;  1KNE A;  4XYO A;  3PIO 3;  1X3Q A;  1QIL A;  1SYD A;  2A6E D;  1TWG B;  1GUW A;  1Y69 U;  4IFD I;  1V43 A;  3JAM L;  4K8I A;  4KTA A;  1O80 A;  3K5L A;  2XWJ B;  2VUM B;  5I4D A;  3D31 A;  1WTP A;  1ENC A;  3T56 B;  1STH A;  3S1N B;  4WJW A;  1HTP A;  1BOS A;  2F0Q A;  4HSV A;  2PW5 A;  1B44 D;  1RKN A;  4QIW B;  3I90 A;  5EKI A;  1VMC A;  2D2C C;  3K6O A;  3J7A F;  1WD0 A;  4EQP A;  3K5O A;  2DY8 A;  4MIU A;  2NBF A;  3S2D B;  5IT9 L;  3VYS A;  1E2Z A;  1PYW D;  4DA2 A;  4DU9 A;  5IOC A;  2O5J C;  1EYC A;  2E76 C;  3A54 A;  5IOD A;  1L0Y B;  1CM9 A;  1WTO A;  2DNE A;  1E0B A;  3DWP A;  2B2V C;  5A2Q E;  5BN5 A;  1BF4 A;  4XDX A;  1KDB A;  1FNW A;  2HCC A;  1II3 A;  3H91 A;  2FIN B;  1JB3 A;  4X3S A;  1U9R A;  2OXP A;  5C3E B;  1IYV A;  1RCV D;  4IUP A;  1A15 A;  3OIP A;  3HOV B;  4IUR A;  4B9X A;  2D62 A;  4K14 A;  4RWS C;  1STB A;  2PNR C;  2F0M A;  2PZW A;  2SNS A;  3A8I E;  1SYE A;  2XSC A;  3SE0 A;  1MGS A;  1EY7 A;  1CT1 D;  3AMU A;  2JA7 B;  2EPB A;  3HOW B;  3GTM B;  4OHJ A;  5ELE A;  3NE5 B;  3RUZ A;  4C2M B;  3CKI B;  1Q1B A;  4EVO A;  3DEP A;  3NXW A;  5C4J B;  1HXY D;  4DK1 A;  1TII D;  1PTO C;  4R8I A;  1BQQ T;  1FGB D;  1GUS A;  2FJ2 A;  2F4I A;  3A55 A;  1VCI A;  1K8M A;  3FMC A;  2RBM A;  3FRP B;  3QG1 A;  4RGO S;  2IW3 A;  3N6R A;  2RSO A;  4RCN A;  3T4A C;  3AB9 A;  3VR6 A;  4L63 B;  1DOL A;  1PTO D;  2XN9 C;  3GTQ B;  1W6K A;  5EPK A;  4B9W A;  5FK9 C;  3BVM A;  5LL6 X;  1F77 A;  1NSN S;  1BO0 A;  3HEJ A;  1M8A A;  1R9T B;  2LFN A;  2A69 C;  3M4O B;  3F2U A;  4DF7 A;  1EU4 A;  1D5X C;  3IKJ A;  4LK1 C;  1LV9 A;  1TWC B;  3TP8 A;  2EJG C;  4A93 B;  4AYB B;  1TS5 A;  3OIQ A;  1ET6 A;  1FD7 D;  3EFX D;  3TBI B;  4RHS A;  2NWG A;  1LTB D;  3O13 A;  2R3Z A;  4JBW A;  5C0X I;  3GTL B;  2MHV A;  3Q22 A;  2WII B;  4GZY C;  2NN6 I;  1YNJ C;  4V19 0;  2L55 A;  4BS9 A;  2C5C A;  3TSS A;  3S1R B;  3PUZ A;  1TU2 B;  3MFY A;  4KY5 A;  2B2Y C;  4F88 A;  1SFO B;  2Q8T A;  5IGG A;  4HCS A;  4K5X A;  1F9R A;  3OSO A;  3TP5 A;  4CHT B;  2IT1 A;  2B2V A;  2WKD A;  1BCP B;  1F9S A;  3I70 A;  4KKU A;  3S1Q B;  4ID6 A;  1YNJ D;  5T1G A;  3I4N B;  5CBE E;  4C1N I;  1RF2 D;  2Q8I B;  4PQX A;  2QKI C;  2EYL A;  1DOK A;  2X6L A;  1ET9 A;  1LTI D;  5I6W A;  3I3C A;  2F3W A;  1WVL A;  4NP5 A;  1O78 A;  4KHV A;  4J8Q A;  1AZQ A;  2J0T D;  2EY6 A;  5K5P A;  1Y1W B;  2BDO A;  3OW7 A;  5JEA G;  1HTL D;  1JOQ A;  1A6X A;  5FLX L;  5D3I B;  4TQU S;  2N88 A;  3M7G A;  2KOL A;  1SND A;  3AU7 A;  1J9O A;  3TDQ A;  3MXU A;  2XNA C;  4KK7 A;  4I65 A;  3IL8 A;  3QOJ A;  1I3Q B;  2B8F A;  1TWH B;  2HQE A;  3T53 B;  4TRD A;  1IKM A;  2F0K A;  2NVQ B;  1KAA A;  3OWF A;  4H44 C;  5A35 A;  3Q0A A;  2KA7 A;  3MFG A;  5M3M B;  2B63 B;  1CI3 M;  3NTI A;  1EEI D;  5K36 H;  2X69 A;  5HUR A;  4A3E B;  1C8C A;  1KTK A;  2F0J A;  2I07 B;  5CV8 A;  2NTS A;  3OHX C;  3OMG A;  1JOK A;  3ND9 A;  3X3M A;  1EYD A;  5CYU A;  3T51 B;  2R6G A;  2JEB I;  2WV6 D;  3A8K E;  3BVG A;  3VR5 A;  1WTR A;  2EJF C;  1GUO A;  4X3K A;  1MBY A;  1CHQ D;  2BE5 C;  1QWY A;  5HGT A;  2WAQ B;  2AUK A;  1S5D D;  2R7Z B;  2PZU A;  4A3B B;  3CU7 A;  2CW0 C;  4C3J B;  1YNN C;  1QOH A;  4XIG S;  1R4Q B;  5J22 A;  1G2S A;  3K0Y A;  4G7O C;  3D6C A;  5T1I A;  1HQR D;  1LT5 D;  4ZYS A;  4KY6 A;  4FP5 D;  3LNN A;  1E2V A;  4F8M A;  5ISR A;  3P75 A;  3A7A B;  2BE5 D;  1JWS D;  2PCF B;  4L8J A;  2MJ8 A;  4MN3 A;  2E74 C;  2KEC A;  3T16 A;  1HRJ A;  3HS0 C;  1JIC A;  2CW0 D;  2H4O A;  3I8Z A;  3MVV A;  1A3T A;  2F0P A;  3ND8 A;  2PW7 A;  3GTK B;  1LAC A;  3E6Z X;  2B2Y A;  2O5I C;  5EBC A;  4DNR B;  2KVM A;  3K57 A;  2XRQ D;  3BS1 A;  4LMQ D;  3V96 A;  1B9M A;  1PZI D;  5C4X B;  3R2I A;  4K5W A;  1L0X B;  2M2L A;  3CHB D;  1JWU D;  3Q24 A;  3DHQ A;  4FXD A;  2M00 A;  5C5L A;  3GO5 A;  1TVX A;  1QB5 D;  3H0G B;  3KLS A;  4NDX A;  4RH6 A;  4IUV A;  3VR3 A;  2K6A A;  1H9S A;  3MWY W;  1STE A;  1IYU A;  4IUU A;  2PO4 A;  4Y7N B;  2SDF A;  1U4L A;  4KV6 A;  3C2P A;  1V1P B;  1LAB A;  3WOF A;  1SNO A;  2K5Q A;  2RVL A;  5ELB A;  3HP3 A;  4FF3 A;  2LKV A;  1JOR A;  4IUQ A;  1A2T A;  1TY0 A;  2F0I A;  5EGT A;  1I4H A;  5CGK A;  3SK4 A;  1Z47 A;  1HPC A;  2L4N A;  1PRT B;  2BA0 A;  1EY5 A;  4IUT A;  2IX0 A;  3VYU A;  4KY7 A;  1LTA D;  4RCO A;  4U68 A;  1RD9 D;  2B8G A;  1RHP A;  3ITP A;  4RGT A;  1AN8 A;  2EYF A;  3FKI B;  2E2D C;  3S9W A;  1PFB A;  2Y0S B;  2LMC B;  2Z1C A;  3HOZ B;  5J1Z A;  4RKB A;  1DXM A;  3QWN A;  1H9J A;  1B2T A;  3NBH A;  1SMY C;  4OIJ A;  5IGC A;  2MGS A;  4IFD G;  1TY2 A;  3GV3 A;  4A3J B;  1BCP C;  4A3M B;  5ELC A;  1HHV A;  1IHZ A;  5C5M A;  1VMP A;  3BG3 A;  5KGU A;  1BUV T;  2A5H A;  2B2W C;  5FO7 B;  5KYI A;  1PZK D;  1IKL A;  5JVH 3;  3SK6 A;  1I4G A;  1SNP A;  5LL6 S;  3GTP B;  1JC7 A;  5CBA E;  2NTT A;  1SMY D;  4CKB A;  1HFN A;  4FVM A;  4KKT A;  4UDU C;  3RD4 A;  1BCP D;  1EIG A;  5C6A A;  2E2I B;  2RKS A;  1V1O A;  1ZYR D;  4KHZ A;  3GTG B;  1WTX A;  2K5W A;  1D1K A;  4OL7 A;  3NUC A;  1SNQ A;  5E1F A;  5JEA J;  3H6M A;  5A2Q L;  3MTS A;  2V4D A;  2YU9 B;  1GOZ A;  1ICW A;  1LO5 D;  2E2J B;  4H0L C;  3KBX A;  5I2X A;  3DXJ C;  4ZUI A;  4J6H A;  2QIL A;  4C1N K;  1EL0 A;  2SOB A;  2H1E A;  4C3I B;  2EJM A;  4O42 A;  3UI2 A;  3BYT B;  5F2D A;  1H9K A;  2JP1 A;  5EBD A;  5FO9 B;  5E4W C;  3CQZ B;  2K01 A;  2F0F A;  4OO1 I;  1QNK A;  5KYL A;  3BZD B;  1AW7 A;  1VDZ A;  4WRD A;  4KI0 A;  2KJX A;  4KKS A;  3HG9 A;  5E3F A;  5CMD A;  3PUY A;  4FXK C;  1SE2 A;  1SBB B;  4E6I A;  4CBV A;  1SAP A;  1UEA B;  2R61 A;  1DM0 B;  3G7L A;  1HUM A;  1PMR A;  4P2C B;  4TSS A;  4Z9C B;  4HN7 A;  1LTT D;  5EPJ A;  3J81 E;  1JR0 D;  4H7B A;  4U67 3;  2EY1 A;  3DMU A;  4BY1 B;  1G2T A;  3J81 L;  4TKO B;  1RTN A;  2A73 B;  1LTR D;  1D6E C;  3IAY A;  5JOB A;  3MAQ A;  1EIH A;  2A74 C;  2F0L A;  1QE6 A;  3PUV A;  2AQ1 B;  3RZD B;  1ML0 D;  1AP0 A;  1T5E A;  1EY6 A;  5CV6 A;  4PMB A;  3QIA A;  3GQB A;  1Y8N B;  3EVQ A;  3R2T A;  4WFN 3;  1TS3 A;  3GP7 A;  4NMZ A;  3DM1 A;  3KBG A;  2MUY A;  3SVM A;  2RDH A;  1TQO A;  2F0S A;  1DZ1 A;  2A6H D;  2R93 B;  1PRT F;  1F2Y A;  1PTO H;  2F0N A;  1Z7T A;  5DM7 3;  4S3S A;  2X6G A;  3K5N A;  1I4R A;  1KDC A;  3U9S A;  1MD2 D;  5COR A;  1JCK B;  2VB2 X;  2B2W A;  3C1E A;  4RGN A;  3WDN A;  2EY5 A;  2K03 A;  3ZYY X;  4C3H B;  1SJE D;  1UNS A;  1V8Q A;  4YIJ A;  5IGE A;  5FO8 B;  3BYY B;  3MEH A;  4C56 C;  1I50 B;  3Q6S A;  5C0X G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...