1JE4A

Solution structure of the monomeric variant of the chemokine mip-1beta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCASYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords macrophage inflammatory protein 1-beta
publication title Structural comparison of monomeric variants of the chemokine MIP-1beta having differing ability to bind the receptor CCR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1je4A00
4ZKBB 2KVMA 4R8IA 3QO2A 1HFNA 1BO0A 4OIJA 1WTOA 2L11A 1DOKA 1HFGA 3IL8A 1X3PA 3KBXA 1RODA 2CVRA 3HP3A 2B2VC 1RJTA 1AZQA 4LMQD 2MP1A 2NZ1D 5AFWA 1DZ1A 1A15A 3GV6A 1U4MA 4OIKA 2KECA 1U4LA 1ICWA 1MSGA 1BBXC 2K1BA 5CBAE 5T1GA 1WTPA 2NWGA 4UAIA 1KNAA 5EPLA 2B2VA 3F2UA 5EKIA 3TN2A 1ESRA 1SAPA 3LWEA 3DEPA 4IUQA 2KEDA 4XDXA 4QUFA 5E4XA 4RAUC 1GUWA 1RHPA 2J7ZA 1O80A 3MWYW 5DNFA 1BF4A 1PLFA 3I91A 1RTOA 2HCIA 4IUPA 2EPBA 3UI2A 1CA5A 1HA6A 4O42A 3D6WA 3SVMA 1XYIA 2DY8A 3DM1A 2D9UA 2N55A 2X6LA 1J9OA 4ZKCB 1B3AA 1CM9A 1M8AA 1MSHA 5CBEE 1O7ZA 1WTQA 1PFBA 3I90A 1AP0A 1B53A 2JP1A 3DEOA 3I8ZA 5T1IA 1G91A 1ILQA 2XIWA 1VMCA 2L9HA 1F2LA 1C8CA 2EOTA 3P7JA 2B2UC 2SDFA 5COYA 1ILPA 1JICA 2KEEA 2FHTA 3KUPA 4DN4M 1F9SA 1HUNA 1HUMA 2B2TA 2KUMA 3FDTA 3TZDA 1B50A 2L1BA 4NW2A 4HAEA 2Q8TA 4X3TA 5EQ0A 1NCVA 1E0BA 2MGSA 4MN3A 2K01A 2VXWA 2K03A 1U4RA 3MTSA 1LV9A 1Q3LA 2B2UA 2BDNA 4IUVA 1NAPA 2RSNA 2X6GA 1PDQA 2HDMA 2FFKB 4X3UA 4CJ1B 4XT1B 2RA4A 3H91A 2B2WC 1HRJA 2DY7A 4XT3B 2JYOA 2RVLA 1SSOA 1NR2A 2FINB 4IUTA 1ML0D 1HHVA 1EQTA 1EIHA 2B2TC 1WD1A 1EL0A 1QNKA 1TVXA 4R9WA 1WTRA 1EOTA 4CJ2C 1RTNA 2RSOA 1IL8A 2L4NA 4HEDA 5EJWA 4RWSC 1WTXA 5EPJA 1CA6A 2HDLA 2B2WA 2R3ZA 1O7YA 4X3KA 1VMPA 3IFDA 2KOLA 1PFMA 1SDFA 2H1EA 1G2TA 2HCCA 1WTWA 3Q6SA 4MHEA 2N88A 1S4ZA 1EIGA 2IL8A 2K04A 2MJ8A 3I3CA 1B4OA 4X3SA 5E4WC 4ZAIA 3R93A 1WD0A 1BNZA 4HSVA 2B2YC 1XX8A 1F9QA 3FPUB 1QG7A 1G6ZA 1MI2A 1F9PA 1AZPA 2EE1A 4CJ0B 5D14A 1DONA 4HCSA 2L12A 4RA8A 5D65A 1QE6A 1IKMA 1IKLA 1WVLA 1U4PA 2FMMA 1PFNA 5CORA 1JE4A 1DOMA 2MPMA 1DOLA 2B2YA 2Q8RE 2X69A 4IUUA 1X32A 4U68A 4ZK9B 5CMDA 2K28A 1MGSA 4IURA 1J8IA 1F9RA 1X3QA 2NYZD 1KNEA 2HUGA 1ZXTA 2FJ2A 2M2LA 5EPKA 1B2TA 4ZLTF 3ONAB 1NR4A 3G7LA 3GV3A 1G2SA 1WTVA 4QUCA 2K05A 5JJZA 3N52A
chains in the Genus database with same CATH superfamily
2HQEA 2B63B 3OHXC 2L11A 2OXPA 3TMEA 2WIIB 3IKJA 4B3RL 1IBLQ 1JOQA 4FF3A 2MO1A 3NTHA 4BA1I 1EY9A 4CKEA 1Q81C 4ALPA 1TY0A 1N33L 3VDYA 5D3IB 2F0EA 1PTOC 3PSIA 3EA6A 2AWNA 1LTGD 2A6ED 1Q46A 5AJ3Q 1XMQL 3HG9A 2F0QA 3LWEA 4PNYA 1E2WA 4P73A 4ID6A 1A2UA 3GTMB 2RHSB 4GN5A 1E2ZA 2F0NA 3OYYA 4LFCQ 2A5HA 1EZ8A 1SJED 1IBMQ 1CSQA 2KA7A 4BBRH 5ELEA 2VS1A 4E6IA 4PQXA 3EFXD 4CHTB 1G6PA 5IGDA 4DA2A 1S5BD 2E2JH 3J81i 1STEA 2Z6BA 2JA9A 3D6CA 3PIOA 3GTPH 3HOUG 3S1QH 1TWHH 2D0PA 3TDQA 1WFQA 3HEJA 3U4ZA 3I72A 1HR0L 3D31A 2HDMA 2LKVA 5K36H 4ZCKA 1Q86C 3A8JE 3QOJA 3S15B 1F2ZA 3CQZB 2FINB 4A3MG 4J1MA 4LFBQ 2E5LL 2GA4B 2KBNA 1IBKQ 5IP9G 2K4KA 3TP6A 1KDBA 4OWXB 4N9PA 1O7YA 2JSOA 3H09A 4DV1L 3MEFA 2HHHQ 2PNHA 2F3WA 3OTOL 2IX1A 3FHWA 1PH3A 4S3SA 3NQTA 2ASBA 1N8RC 1DXMA 1CHPD 1Q1EA 1PRTF 5JAVA 1I50H 2K75A 5C3EG 1C9OA 1KAAA 2A68D 1I4RA 4QIWB 4OELB 5D14A 3ULLA 3I4MH 2F0OA 1U4PA 3MXNA 3D0FA 4ZK9B 4OWTB 4U68A 2F0IA 1CHQD 4GS3A 3GTLH 5CV7A 5EBDA 3SXHA 3CCMA 2E2IH 5M3MH 2AMCB 3K58A 4A3DG 3GV3A 3BU2A 4MTNA 2R6GA 5KYIA 5DM63 2CQAA 3K8AA 1WTOA 1QJOA 1DOKA 5HURA 3GTJB 2OEOA 2BE5C 4POFA 2G9HD 2Q2IA 5CR3A 2L5TA 4LUOA 1SFOB 2ZTDA 1CI3M 4DNTB 1QZHA 1K0SA 2NVYH 4B3TQ 1HNWQ 5KYLA 3F2DA 1D1IA 4IUQA 4BY1H 4TQUS 3VR3A 5IP7H 3E3XA 1YHBA 4RHRA 5GAGC 1YVCA 1C4QA 3MXGA 5LMUL 1II3A 3EVQA 1JE5A 3PO3H 2NVQB 1PVOA 3HOVG 5M5XH 2R93G 1FNWA 3H3VI 2VY3A 2SDFA 3HKZG 4EQNA 3BZKA 1I4PA 2ZTEA 4ZUJA 4AYBB 1PYBA 2EYOA 4F88A 5I9PA 1Q7YC 1HH2P 2YV5A 1PA6A 4LJZC 4IPHA 2MFIA 3D3RA 3X3NA 5A2QL 4LWCA 4IUTA 1ML0D 3KF8B 1EIHA 4XYQA 5IGCA 3NPPA 1E2VA 2L4NA 5K5PA 1WTXA 1VQAA 2B2WA 3CAMA 4IQZA 4HJ9A 1V1QA 4EQOA 1Q1BA 3FKIB 3BG3A 3PF5A 1SROA 2KQ3A 3V2TA 3PMFA 3M4PA 3OSOA 4X65L 3R93A 3GDEA 4X62L 3H3VC 2F0UA 2PYKA 1U0LA 3A55A 4EX5A 1H9MA 2PQAB 2XWBB 1N36L 2EYHA 3HGBA 5ELDA 2EYJA 4CKBA 3VA5A 1Q82C 4JVZA 3RLOA 2B2YA 1C7YA 1EEFD 1MGSA 5C6AA 3A8KE 4YHHL 1XJVA 1EQVA 4IN3A 1VF5C 2JA6G 3JAMi 3M4YA 4DAMA 4ZLTF 1M90C 2ZT9C 2EJMA 1STBA 4KTAA 2YU9H 1K9MC 3IL8A 4DXGA 2B29A 4YY3L 3UDIA 4LF9L 1OXUA 4P72A 2E2IB 2F0FA 2PW5A 2CWPA 3GV6A 4F8MA 5JEAG 1HZAA 3KFUA 1ICWA 1K83H 1WTPA 3PUZA 5HGTA 1LABA 1TR5A 2B2VA 5EKIA 3TN2A 4EQPA 4JG2A 3F8TA 1I3QB 3UDFA 4QUFA 1OXSC 4TVAB 5IGGA 1BOSA 2B3GA 1VF7A 1RTOA 1VQ9A 2Z6KA 3SVMA 3GTQH 4OX9Q 1U5KA 3EJIA 1LT4D 2F0MA 4WFN3 3FMCA 2QF7A 4K8IA 3BDOA 3MXUA 1XNRQ 1G91A 4G7ZC 3K57A 1PTOB 4A3KG 1Y1WH 2ICEC 1TWCH 5COYA 2QW7A 1XPUA 3KF8A 1VCIA 4MNOA 1B50A 3LGJA 3H6MA 5GQOA 5EQ0A 1K8OA 2VQEL 2JA8B 3MVVA 5CV9A 4ABNA 4K5VA 1JWMD 5BN3A 4JI1L 2RVLA 3OWFA 4R4OA 1TVXA 2NTTA 5CV5A 3UDGA 4IFDG 1QB5D 4HEDA 2PQAA 3OIPA 5FLMG 1Z9FA 4JI2Q 2H1EA 4DK0A 2HCCA 1AN8A 3PUXA 3DUZA 3MZ5A 2IL8A 4JI8L 1I6HB 2RF4A 4Q0FA 5ISRA 1RF2D 1SBBB 1R9TH 4LF4L 4YIJA 3ICEA 4K6DA 1BBUA 2ZXOA 3OOCA 3BZCA 4C3HB 2JXMB 4JK1C 5LHY1 2AWOA 4IUUA 1WCMH 4YWKA 1PH9A 3AYHB 5DM73 1SE2A 1YJNA 4DR3Q 2K32A 4A3JB 1HNZL 3CMAA 5BR8Q 1WTVA 3CCJA 3B6YA 2KVMA 5IYCH 4R8IA 4DK6C 3H15A 1QCBD 4AYBE 1KLUD 4C3JH 3I73A 5C4XH 1YJWA 3G6EA 2AQ2B 2SNSA 1M1KC 5E1FA 3SK8A 4MIUA 3U50C 3BDLA 1ZYRD 3D8GA 4A93B 1SYDA 3S1MB 2RHQB 2PW7A 1KIXA 4OL7A 3CRKC 3DMUA 1IW7D 2VQFL 2UUAQ 2HCIA 3UI2A 1I4QA 4KLKA 4B3SQ 4LF5L 1PXUA 5EGTA 2N55A 4IJHA 3NK9A 4ZKCB 1CM9A 5GADC 4JC0A 3I90A 4O1NA 2CKZB 5T1IA 2XRQD 5M3FB 1E3PA 2ICIA 3D4RA 3PCOB 5KNBA 2F0GA 4AYBG 4IOCA 4GN3B 4LFBL 1STHA 4NW2A 4XXEA 2HIXA 4DAVA 1O78A 2FMCA 4FF1A 4QMGA 3KDFB 4BBRG 1B9MA 3MTSA 1LV9A 4DKAC 2JQOA 1PDQA 4A3FH 5J3BA 1VDZA 2DY7A 3UE1A 1JB7A 4A76A 1EUJA 4DV0L 4CDFC 2JK8A 3HOXH 4IPDA 1ASYA 1VQ5A 2E75C 3PGZA 4LF8Q 2RSOA 1KDCA 4GKKL 4X66L 3J81L 4B3ML 3K80C 4G4KA 4A4IA 2NB0A 3NTIA 3KF6B 5FLXL 1EFWA 2UU9Q 2WP8J 5K36G 4L5SA 1PRTC 4LFAQ 3C2PA 3E9HA 3CMEA 5LMNL 4YWLA 1L1OA 4RG1A 2L12A 2HD3A 4N8FA 3CCSA 4A3MB 2A1AA 2EY5A 1YZ6A 5IT9L 1JE4A 3NHHA 2X69A 3K7AH 1CKNA 5M5WH 5I4DA 1X3FA 2HIVA 3M4QA 1Y8NB 1KNEA 2M9VA 1FGBD 2A73B 4C56C 2ES2A 1NR4A 1X65A 3GTGB 4HMJA 1SYGA 3S16B 1TWAB 1YNND 3I4MG 4OIJA 2KCNA 4KV6A 2O5JC 5C3EB 4BXXH 4TRDA 4QF4A 3J7ZC 1OO9B 1AZQA 2ZXRA 4DGZA 3A56A 5M3MG 1EQQA 2LY7A 2KECA 3S2HB 1I4XA 1EY8A 1X3EA 5T1GA 1PH7A 3F2UA 2TMPA 1NMFA 2I5HA 3H0GH 1JWSD 4A3DB 5IGFA 3K0XA 1AE3A 4DUZQ 2A74C 1HTLD 2HT1A 1KRTA 3QJYA 3PIPA 3BJUA 1GJXA 2VB3X 2H5XA 4BBSH 1PMRA 3STBD 5KRUA 4KK7A 1E22A 3KDFA 5I2YA 1SMYC 3ULJA 1LM0A 3M4OH 2KHIA 3RZDH 3C3LA 1KC8C 2ZXPA 2B8FA 1ILPA 3F2CA 5IP7G 1SYFA 2Z6KC 5LL6X 3AB9A 3Q23A 1VQ7A 4FYDA 1VQNA 2GVBA 3PO3G 1GHKA 4XT3B 3GQBA 2OCEA 4DV3Q 3BDCA 3HOVB 2L0CA 2WV6D 2F0LA 2R93B 2XWJB 1I4GA 1HPCA 2RDGA 4PMCA 5IODA 2EVBA 1VQPA 4POGA 3HOYB 4L63B 3HKZB 3SK6A 4LF6L 3K7UC 3TSSA 1PTOD 1BKBA 3QIAA 2CQOA 1UE5A 3TZUA 3J7AF 1JB3A 4Y52H 1QG7A 3T1HL 3GTOH 1H95A 3VYRA 1IXRA 4KHPQ 1S5ED 2JA5H 2F4IA 1SE8A 4JI4Q 1WVLA 1B1ZA 3NE5B 1M4VA 1SNCA 3OWEB 4UP8A 2K7VA 3MXPA 1F9RA 1SRUA 1IL2A 5I2XA 4N8X1 4WJ4A 1SR3A 3K5MA 3V05A 4L5TA 2RCFA 1SNMA 1I6VC 3BVGA 3HFZB 2UUBQ 4CKCA 1PV4A 1RD9D 3CW2C 1XNQQ 4DAPA 2MP1A 4RKBA 5JJIA 3L9AX 5IYBH 2WFWA 3LWUA 3CC4A 4ZRZA 3JAML 2UXCL 4OX9L 5GROA 2F3VA 2JA6B 1XTCD 1A62A 4K14A 2NVXH 4EQ5A 3C1EA 4XQQA 5IGEA 2J7ZA 3MWYW 3DLLA 1BF4A 1HZBA 4KKSA 3I91A 1CKMA 2UXBQ 3MXNB 2ID0A 2MNAA 3ULPA 2X6LA 2CWAA 1SNPA 1AEXA 1XXGA 2PMZB 4IOAA 2D2CC 2ZM6Q 3KLWA 2Z9HA 2UUCL 1PFBA 4H7BA 3PIO3 3DXJC 2QEJC 5M3FG 1EZ6A 1Y14B 1YEZA 2EOTA 4A3IH 1PH1A 3NTKA 4ZYSA 5EBCA 4JBJA 3FDTA 2SOBA 1O7IA 1TIID 3S17B 1TS5A 2PO4A 2IJ0A 2G9DA 1A2TA 4MN3A 5M5YH 4A3EB 3S14H 2K03A 1Y1VH 3SGIA 3GO5A 4JI2L 3AFPA 2PNRC 1EQTA 4LUZA 3S24A 4HIDA 3NUCA 1WD1A 4C3IH 1WTRA 2BE5D 2AQ3B 3J81c 2IT1A 2DNEA 4A3KB 4RFBA 1EOVA 4NXMQ 3CPWA 5FLXc 2NUCA 4O2DA 2MJ8A 2GN5A 5E4WC 2Z1CA 1NMGA 5C5MA 2CHBD 1LTID 2F03A 2CH4A 1F9QA 5C0XJ 3A54A 1S5CD 5D3DA 3VR2A 4DR1L 4BY7B 1VQKA 4HCSA 4I7AA 3FEWX 2EY6A 1OXXK 3MHBA 5IT9c 4HSPA 4X64L 2MPMA 1TWFH 3J80i 4RGMA 5CMDA 3BZDB 5I6YA 3G4SA 1ZXTA 5CV8A 2N78A 1I94Q 3QOLA 3W3AA 4IPCA 3BVZA 3ONAB 4OWWB 1HJPA 1L1OC 4JOIA 1PRTB 4DR6Q 1BO0A 2AKWB 1HFGA 1HQMC 2UXDL 1SMXA 4DV2Q 1WCMG 1W2BA 5C4HA 1BCPF 4HJ7A 5C44H 1IZ6A 1MIUA 3TP7A 4B08A 5F2DA 2LFNA 4HTHA 5CV6A 2JA7H 1SEBD 3HOZH 2NWGA 2XNAC 3K5NA 3S1RB 4JI6Q 3TRZA 4C1NK 5IYCG 4KN7C 1SNDA 2AQ1B 2E76C 5DNFA 2R92H 1JT8A 4C3JG 1PLFA 3K81C 5JVG3 1G291 1EYCA 4EVOA 3RNUA 1F2MA 3HKZE 2EY2A 4DV5L 2K5HA 4ZQ3A 1WTHA 1E7ZA 4BA2I 3F2BA 2J4XA 2NVTB 1B53A 2MUYA 2YTVA 4KY5A 1N32Q 4UP7A 4DV4L 4B9XA 2C35B 3VR4A 1LUZA 2K5NA 3BYYB 4GKJL 1P16A 1PHJA 3KJPA 1STAA 1TT2A 5G3LD 2Z4IA 2QA4A 3IRBA 4LF8L 1TY2A 3TBIB 2WAQG 4HJ8A 4OHJA 1J5EQ 1B8AA 1DJRD 4XT1B 3T16A 2YTXA 2KCCA 2JYOA 4WRDA 4JI7L 1UUPA 3M3YH 1XMOL 4M8AA 2K52A 4CJ2C 4GOPC 1TXYA 1JR0D 5J39A 3HOYG 3IFDA 4JI3L 3CHBD 3D4DA 5CV4A 1E1OA 1HNXQ 2N88A 2OT2A 2DNCA 1FD7D 1B4OA 1QILA 3A8IE 2I46A 4HSVA 2Q8IB 4BBRB 1NTGA 1S40A 4OO1H 3HOXG 2K5QA 1L0XB 3W1BA 4XTCS 2IPKD 1IKLA 2E2JB 3T56B 3CCRA 4ODGA 3U58A 2IX0A 2B39A 2K50A 2KHSA 3P20A 3OMCA 4LF7Q 3GTPB 4AQYQ 1X3QA 5IWAL 3S1QB 1TWHB 2PMZE 1QVGA 4CBVA 2L55A 3MFGA 1JWUD 5JJKA 4XQNA 1NUCA 3E5SA 1VQFA 4QUCA 2IWHA 2OQKA 1OXVA 1HFNA 1L0WA 1KD1C 3KBGA 4WJWA 1IHZA 2VL6A 2ENBA 2EXZA 1XPOA 3H94A 3SDZA 2CH4W 2CVRA 2K6AA 3WDNA 1K0RA 1Z47A 4OIKA 1B44D 3JAMc 4ZUIA 2AUKA 5C4JH 3Q24A 4JI5Q 4IALA 4HR7B 4XDXA 4NKLA 1KAWA 4K2LA 1GUWA 1I50B 4GNXC 2VUMH 4BXXG 2BOSA 1HHVA 3I4MB 1CA5A 4PZ7A 2DY8A 4M1UB 2CW0C 4DR5Q 1UWVA 4DR4L 1UE1A 1JQYD 1V8QA 2A69C 3ITPA 3GTLB 3I8ZA 2LSSA 5A35A 5M3MB 4BS9A 2I0QA 2H4OA 4PMBA 2F3IA 1DGSA 3P7JA 3H0GG 1VQGA 3BVMA 2DJGC 1LO5D 4KI0A 4DV3L 1D1KA 4JV5L 2L1BA 2E2HH 4A3EG 2BH2A 4DF7A 3W2DA 4RHSA 4ULLA 4H02A 2F4VQ 1G51A 3JC66 3L2PA 2RA4A 3RN5A 1SN8A 1EYAA 2KCMA 3PQIA 2NVYB 1RDPD 2WKCA 4JYAQ 2KHJA 3E0EA 4UPAA 4BY1B 4KHPL 1SDFA 1VQIA 2DN8A 2KCTA 1QZGA 3UE0A 1N9WA 1WTWA 4A3BH 4JI4L 4CGYB 4DV7L 1MD2D 2SNMA 1EIFA 1X6OA 3QB3A 1D5XC 3HOWH 3PO3B 3GD7A 3KK7A 1D8LA 5M5XB 4QJFA 1VQ6A 4BY7G 3HRZC 1LACA 4RGNA 5KNDA 2IX3A 5IYDH 3EQLC 5J22A 1H9RA 3AQQA 1T9HA 4LAAA 1JMCA 4B3RQ 1GVPA 2UUBL 4C2MH 1TQOA 4FP5D 1LLRD 3Q22A 1XPRA 1A6XA 1GD7A 4P74A 1XNQL 4KKTA 2EYPA 1N33Q 2I07B 5I6WA 3SE0A 3HOUH 2K05A 3WOFA 3N52A 4KJNA 2JA5G 2XRSD 2Z8LA 4ILWA 3A7AB 1YI2A 3NSWA 4DR7L 1XMQQ 4GZYC 5BN5A 1PZKD 1H9KA 2JJQA 4A3LH 3AMUA 2EQSA 4JI0L 1RJTA 4LMQD 2ALYB 1U4MA 5FO7B 2R7ZH 2UXBL 4G7OC 3S1NH 4JOIC 3PUWA 1U9RA 2RCNA 4YCVA 3F1ZA 3T1YQ 2LXJA 1IBLL 4UY8C 1L1OB 4UHVA 1VQ8A 1X3GA 1HXYD 2E74C 3J7A5 2EPBA 2YTYA 2E2DC 4Q5VA 4NP5A 1PRTD 1CKNB 2BA1A 1MJEA 4IPGA 5IYBG 5AJ3L 1TU2B 4JW0A 1DD2A 4KJOA 4IZ8A 2OTJA 5C0XH 2XIWA 5GAHC 2L9HA 4LFCL 1EEID 3FRPB 4DN4M 1IBML 3Q0AA 2E5LQ 4Y7NH 1SLJA 1K8GA 2YU9B 1D6EC 1UEAB 4LW1A 1CKOA 3L7ZC 1LTRD 2AUJD 2QDBA 2RSNA 4X3UA 4IFDI 3S2DH 4DV1Q 3H91A 4NXML 4RGOS 3OTOQ 2M00A 2GVAA 1KLGD 4YCUA 1K83B 4R4IA 1NY4A 1IYUA 4FXDA 3RUZA 3DWAA 1G2TA 2WB1G 3D4WA 3SR1A 1GKHA 3I4NH 1LT6D 4FF4A 1Y1VG 2K5DA 3X3MA 1Y69U 4U673 5EAYA 1IBKL 3GTQB 4FXGC 1GO3E 1SJHD 5I9OA 1F9PA 2N3SA 4C3IG 1I94L 2EE1A 3J81E 4OEMB 2HHHL 1QUQA 1Y1WB 1TWCB 1X32A 1L2FA 2K28A 1VQJA 1MBYA 1WJJA 3K5LA 1SMYD 4FO2A 5EPKA 5ELBA 2RQXA 3PUYA 1BVSA 1TWGH 1VQ4A 4QY7A 2Y0SG 3LX0A 4YCWA 2DUDA 2EJFC 2WKDA 1SYBA 1BCPC 4PV1C 5IT9E 1CT1D 1B7YB 1FR3A 3GTKH 1HZ9A 1CQVA 3J80L 3WWVA 2NZ1D 4NB3A 2F0PA 1JJGA 1A3UA 2ZJRA 5LMUQ 3R3OA 1SYCA 4UAIA 3DEPA 4A3GH 2KEDA 1R9TB 1X55A 1JJCB 3PIP3 1STYA 4G7HC 2IY5B 2ZJPA 5EKKA 1QWYA 4H0LC 2D9UA 4B3TL 5C44G 1HNWL 3MFYA 1J9OA 4I65A 4J8QA 4R4CA 1WCMB 2NBFA 1YIJA 2VNUD 2ATWA 1UEBA 1EY0A 4DV6Q 1VMCA 1SE3A 2DGYA 1SNOA 2F52A 2B2UC 1TS2A 2Q2UA 3PO2H 2KEEA 2R92G 1FVIA 1RCVD 4GN4B 2A6HC 1B9NA 1E0BA 3WOEA 5LMNW 3VR6A 1A8VA 4C3JB 4PMWA 5C4XB 2V4DA 2B63H 3BS1A 1FNUA 2JEAI 1HNXL 3ZJYC 4QGUA 1NBWA 2G5DA 4X62Q 1EL0A 1PH5A 1GUTA 2PI2A 4RWSC 4DUYQ 4BY1G 1K8MA 1NNXA 1P8LA 2XTIA 1EWCA 1N36Q 3W5OA 5NUCA 4GOPA 1R4QB 1ENCA 3FPUB 1XX8A 2EY1A 2IW3A 1T5EA 2WAQB 4YHHQ 3L3OC 1MI2A 4AQYL 5J1ZA 3GTMH 1G6ZA 3AU7A 4RA8A 1A3TA 1GUSA 1CZWA 2F0TA 2Z0SA 1KDAA 2CCZA 3G48A 3ND9A 3NENA 4KY7A 4CDCC 4YY3Q 4O0AA 3AFQA 1CZGA 2LXKA 1KRSA 2OQ0A 3T13A 4OO1G 3EROA 4A3FB 1QVFA 1DM0B 2F0JA 4FVMA 1OTCA 2NZOA 3KJOA 3HOXB 1G8ZD 2IHFA 2HQLA 3HP3A 1Q8KA 1O7LA 2JEBI 5JOBA 1VQBA 1GHJA 2CFMA 4R4QA 1DZ1A 3S15H 3CQZH 1U4LA 3R2TA 4EGVA 3HZXA 3TS2A 3I55A 1LTBD 1Y8PB 2QEXA 4RAUC 1RHPA 3K6OA 2ZTCA 4K5WA 3I4OA 1ENFA 3CPFA 2NTSA 4QCLA 3D6WA 2O4XA 4KY6A 5C5LA 1VQCA 3K7AB 3U9OA 5M5WB 1WYDA 1AH9A 4C1NI 1PH2A 1KABA 4CDEC 4GNXA 4CDDC 3TREA 5FO8B 1NJIC 1EIYB 2JP1A 3E0JA 4FXKC 2D62A 5CC4A 2PI2E 1I4HA 1Q12A 1X54A 3NEMA 4WORA 4JI1Q 2RKSA 2XGTA 2PPBC 1VQEA 4V0BA 4R8NA 2MGSA 3KLSX 4NPSA 3CCUA 1XNRL 2YYZA 4JYAL 1Q3LA 1S3OA 1N34Q 2QILA 4A3CH 3URYA 3QWNA 3CC7A 1ESFA 4JI8Q 3GTJH 1QNKA 4APVA 3T51B 3OW7A 3MAQA 4OO1I 4GLVB 1RTNA 4LF4Q 1IL8A 1SFOH 3DWPA 4PG3A 5EJWA 1YNJD 3CC2A 3H0GB 3MC0B 1ASZA 1TS3A 3IAYA 4OGQC 4H13C 1EY5A 3S9WA 2BDOA 4Z9CB 1RL2A 1V1PA 4TKOB 3KOJA 1AFPA 4A75A 2Q2HA 3CCVA 1EY6A 2F0HA 1EWHA 4BBSB 1HNZQ 1RKNA 3M4OB 1ET9A 5D65A 1D5ZC 1QE6A 3UDXA 3RZDB 1Y1WG 1DOLA 2NVQH 4V190 1BDOA 2BCOA 4IURA 4A3BG 3PV0A 3OPOA 1BQQT 3IFTA 3HOWG 1STNA 3G7LA 1G2SA 3NBHA 3R2IA 4BWGB 1B3QA 4TSSA 3Q8DA 1F2YA 3OW2A 3FP9A 1R4PB 4F87A 1JORA 4DR3L 3T1YL 5IYDG 4L8JA 3J80c 5IY0A 5BR8L 5HGQA 1JCKB 3VYSA 2VQFQ 1VQLA 2VW9A 1BBXC 4LF5Q 4N9TA 5CBAE 2K33A 5FO9B 1F77A 3U9SA 3I56A 4JPBW 2LS01 2F0KA 3GTOB 5E4XA 1BBWA 1A3VA 4XYOA 3FKIH 2LMCB 1GM5A 4A3LG 4MTKA 2Q2TA 2JA5B 2O2LD 3CF5A 4O42A 1K8AC 4KD4A 1BCPB 1XWEA 2R7ZG 4G57A 4JBKA 5M9OA 1O7ZA 1SYEA 3G6JB 1GXDC 1YNJC 1Z6HA 3DEOA 1ILQA 1K3RA 2WAQE 5ELOA 1VQMA 5IGBA 3CRLC 1HZCA 3A5UA 1C48A 1DYQA 2UUAL 1A0IA 4FDBA 4B3SL 3AEVA 1JICA 3KUPA 2L15A 2QDLA 2B2TA 4DV0Q 3ND8A 4K6LA 1YBYA 3QG1A 4B9WA 4GKKQ 4X66Q 1HR0W 4B3MQ 4HMIA 3BYTB 2BDNA 1W6KA 2X6GA 5C4XG 4OONA 3RZOH 3OMGA 4DNRB 5DLQE 1HQRD 2D0OA 5C0XG 1WOCA 1SSOA 1NR2A 2EXDA 3VYUA 2NN6H 4R9WA 2A6EC 5LMNQ 4HN7A 2BA0A 2RDFA 4L6TB 5ELFA 4X6AH 3TP5A 2MO0A 5DAUA 2NVXB 1STGA 4MHEA 3MA2B 3NELA 2K04A 1PZID 3T4AC 1I3QH 1NE3A 5FJ8H 1YNXA 2I5MX 5ELCA 4QB4A 1DCZA 3A7LA 1HTPA 1XTDA 3E9IA 5GAEC 3M85A 2FMMA 4A3IB 2UU9L 1DOMA 1SXTA 2CW0D 4FF2A 3G71A 2MHVA 1FJGQ 3I4NG 4LFAL 1J8IA 1W3SA 2A69D 2HUGA 3RN2A 4NMZA 2M2LA 3S14B 5M5YB 1PTOH 2EIFA 2WB1B 2EJGC 1Y1VB 1V9PA 1C0AA 3T53B 3RMHA 4A3FG 1EY4A 3NWTA 4JBWA 1FGUA 4HIOA 1EQRA 5A2QE 2JA8H 3CCEA 3ZYYX 2R7DA 4C3IB 1X3PA 2K5WA 1JOOA 4GLAC 3K0YA 3NP8A 1YITA 1A15A 3K59A 3NXWA 3V96A 4P2CB 1KNAA 2I5LX 2F0WA 2VB2X 5C0XI 2K5VA 2A68C 4LUVA 1O80A 1FYCA 2Y0SB 4DV6L 1GUGA 1I6HH 1KL9A 1H9SB 1KXLA 1TWFB 4R1JA 4RCNA 4K0KQ 1CUKA 5CBEE 5JEAJ 1MKHA 4C3HH 4DUZL 2K14A 4DNIA 3C1FA 4DR2Q 4HIKA 4WJ3M 4A3GG 1GOZA 3TQYA 5DEHA 2F1MA 3HS0C 1YHAA 1HUNA 1EYDA 3SK4A 4X3TA 4A3JH 4H44C 2VXWA 5FK9C 1U4RA 4ME5A 3NQIA 2B2UA 4HJAA 4IUVA 2EYMA 4CJ1B 4DUYL 4LF6Q 1HRJA 5C44B 3CU7A 1JC7A 3HOZB 4P75A 3PO2G 4PZ8A 1IYJB 2JA7B 2XSCA 1PZJD 3M7GA 3T1HQ 2HDLA 4X3KA 5CYUA 1L0YB 2KOLA 1PFMA 4GLXA 1E1TA 4QQBX 2R92B 2QGQA 5HY6A 3OIQA 1CSPA 2RDHA 3CCQA 3DWQA 2B8GA 4X3SA 5JPNC 3SEBA 3RZOB 1D2BA 4A93H 2B63G 3S1MH 4BBSG 4UP9A 3CCLA 1AZPA 1KHIA 4CJ0B 3RD4A 1EFID 4IFDJ 2EYFA 1RIPA 5M3FH 1B2TA 1FL0A 1LT3D 3CP0A 5FKAC 4AH6A 4NXNQ 1C8CA 1V43A 3QO2A 2UXCQ 3M3YB 3KBXA 3FPPA 3J7YW 1W6JA 1B70B 4FNFA 3RR5A 3DHQA 1LYLA 4QIWE 1H9SA 4LNQA 1PTOF 1VQOA 1ESRA 1SAPA 2UUCQ 5IIFA 1QUQB 1LTLA 3DM1A 3KYHC 4NDXA 4RMFA 1WI5A 1ENAA 3L0OA 1B3AA 1MSHA 5IE8A 3A5ZB 4DU9A 1YJ9A 1AP0A 1GUNA 1YHQA 1HCZA 4A3MH 1F2LA 1N34L 2FXQA 5IP9H 5C3WA 2EZVA 1BUVT 3SHLA 3E6ZX 4F7XA 1F9SA 2KUMA 1ICFB 1UE7A 3TZDA 1Q8IA 4XQJA 2Q8TA 5C4ZA 2ZM6L 5FOBB 3VA7A 3GTGH 2PZUA 1NAPA 3S16H 1TWAH 1MJCA 4XIGS 5JPMC 1H9JA 2F0VA 2WB1E 3H3VH 1QOHA 2RBMA 1T5XD 1EWIA 2KJXA 5C3EH 2B2TC 1BCPD 2R61A 4L5QA 1TS4A 5C4JB 2JN4A 1HR0Q 1CA6A 1EU4A 2R3ZA 3VR5A 4DR1Q 3S2HH 1MHWC 1S5DD 2VUMB 4IO9A 3J81j 3ERQA 4A3CG 3PF4A 4X64Q 1WD0A 3FVQA 4OXPA 1I5FA 1PH4A 2V1CC 3QR8A 2F0SA 1S72A 4A3DH 2A8VA 5ELNA 4K8JA 1K73C 5EKLA 1IKMA 3TEHB 3CXCA 2N49A 2Y0SE 4A3IG 4IUNA 3ERSX 2PCFB 2UXDQ 1PFSA 1SE4A 4HCEA 3EIVA 2E2HB 2IHEA 3HKSA 3TS0A 3CKIB 4QL5A 1K28A 2A6HD 4ZKBB 3P1HA 1LTTD 3P75A 4JBMA 1AW7A 5JVH3 1ET6A 1RODA 3M7NA 3KLSA 1PH8A 1GUOA 1HA5A 2QCPX 2ZJQA 1MSGA 3HOVH 4DR6L 4DV5Q 4K5XA 4KMUC 4GOPB 4A3BB 5FLXE 2R93H 1S5FD 5EPLA 4DV2L 3K5OA 2PZTA 1EYGA 3HOWB 3HOYH 2C5CA 4K2KA 1LTAD 1PYWD 4DV4Q 3J80E 1XYIA 2WACA 4P71A 4GKJQ 4JI6L 3MEHA 2Z4HA 1WTQA 2OF1A 4KN4C 3A0JA 4C2MB 2XN9C 2JE6I 5E7NA 4HIMA 1UE6A 5E3FA 2EDGA 2FHTA 3FKIG 3VYTA 4KHVA 4JI7Q 3HOUB 1BXTA 1XMOQ 1KTKA 4KKUA 4ME3A 1NCVA 1ZEQX 3EBEA 2A19A 1TKWB 1N32L 2FFKB 4JI3Q 2B2WC 3PUVA 1LTSD 2R7ZB 1EY7A 5KGUA 3S1NB 1K3BC 3HOZG 1ZYRC 1EU3A 2JA7G 1EOTA 4RH6A 1QNUA 3I4LA 3C46A 1J5EL 2NZHA 2VZAA 3O13A 1VMPA 1PYSB 1QVCA 2N8NA 3I7FA 3A74A 1AE2A 1IW7C 1S4ZA 3I2ZA 4PZ6A 4ZAIA 4DXFA 1FNVA 2JA6H 4R4TA 1FJGL 4RCOA 2B2YC 4GNXB 5KIXA 5IWAQ 1E24A 1ONLA 2NN6G 4DFAA 1NSNS 2J0TD 4J6HA 5H1SE 1CTMA 1D5MC 2PZWA 2AHOB 3R8BA 2OTLA 2O5IC 4X65Q 1PFNA 5CORA 2Q8RE 1CFMA 1PH6A 4KD3A 1UAPA 1X9NA 4Y7NB 3CD6A 2TSSA 4IJLA 1CK1A 4J15A 4DK3C 2OWOA 5JEAH 1Y8OB 5LL6S 3RLNA 5FJ8G 5G3LF 1ZKOA 3S2DB 4HAEA 3S17H 3KLRA 2KENA 4A3EH 2DJFC 4LF7L 4RKLA 4L5RC 2B2VC 4HJ5A 5KNCA 1Q90A 4DAYB 5AFWA 1D7QA 3I4NB 2K1BA 1LT5D 1V1PB 4I7ZC 2R7FA 4JCVE 4MZ9A 4LF9Q 4DR4Q 4K0KL 4A3KH 4UDUC 2BH8A 2JA8G 1BR9A 1SNQA 2EYLA 4DR2L 3M9BA 4IUPA 5TSSA 1HA6A 3DM3A 3KF6A 5C3XA 3TP8A 3ER0A 5IOCA 4JV5Q 5CGKA 1X56A 4JI5L 1M8AA 4KHZA 4BY7H 3J7AV 3N6RA 2QKIC 4DK1A 2SEBD 3NBHB 1TWGB 1YNNC 4IFDH 2MQHA 2C9OA 1HUMA 2NN6I 4DR5L 1VS0A 2P5ZX 5FLMH 3NBIA 4LK1C 1J6QA 5JJLA 2K01A 2D5DA 1UNSA 3SK5A 3GTKB 1VQHA 4C3HG 4DV7Q 3LNNA 3EN2A 3U4VA 3JAME 3GP7A 4RGTA 2VQEQ 5EPJA 3RLFA 4A3GB 2F4VL 4A3JG 1IYVA 1JOKA 4AIMA 3Q6SA 2VUMG 1EIGA 3I3CA 1Z7TA 3S1RH 1BNZA 4DPGA 2E8GA 3W1GA 3STBC 1A63A 1DONA 2F0DA 2XVSA 1CQFA 4NXNL 1KQSA 3PO2B 3I70A 1OXTA 2NVTH 5KEEA 2NYZD 1V1OA 4DR7Q 2FJ2A 5BN4A 4A93G 2WINB 2PQEA 4DAYA 1JJ2A 5L37A 4JI0Q 4YWMA 1VQDA 5JJZA 3NWSA
chains in the Genus database with same CATH topology
2HQEA 2B63B 3OHXC 2L11A 2OXPA 3TMEA 2WIIB 3IKJA 1JOQA 4FF3A 3NTHA 4BA1I 1EY9A 4CKEA 1TY0A 5D3IB 2F0EA 1PTOC 3EA6A 2AWNA 1LTGD 2A6ED 3HG9A 2F0QA 3LWEA 4PNYA 1E2WA 4ID6A 1A2UA 3GTMB 1E2ZA 2F0NA 2A5HA 1EZ8A 1SJED 2KA7A 5ELEA 4E6IA 4PQXA 3EFXD 4CHTB 5IGDA 4DA2A 1S5BD 1STEA 3D6CA 3TDQA 3HEJA 3I72A 3D31A 2HDMA 2LKVA 5K36H 3A8JE 3QOJA 3S15B 1F2ZA 3CQZB 2FINB 4J1MA 2GA4B 3TP6A 1KDBA 4N9PA 1O7YA 2JSOA 3H09A 2F3WA 2IX1A 4S3SA 3NQTA 1DXMA 1CHPD 1Q1EA 1PRTF 5JAVA 2A68D 1KAAA 1I4RA 4QIWB 5D14A 2F0OA 1U4PA 3MXNA 4ZK9B 4U68A 2F0IA 1CHQD 5CV7A 5EBDA 3SXHA 3K58A 3GV3A 2R6GA 5KYIA 5DM63 2CQAA 1WTOA 1QJOA 1DOKA 5HURA 3GTJB 2OEOA 2BE5C 2G9HD 5CR3A 2L5TA 1SFOB 1CI3M 4DNTB 5KYLA 1D1IA 4IUQA 4TQUS 3VR3A 4RHRA 1C4QA 3MXGA 1II3A 3EVQA 2NVQB 1FNWA 2SDFA 4EQNA 1I4PA 4AYBB 4ZUJA 2EYOA 4F88A 5I9PA 4LJZC 3D3RA 3X3NA 5A2QL 4IUTA 1ML0D 1EIHA 4XYQA 5IGCA 3NPPA 1E2VA 2L4NA 5K5PA 1WTXA 2B2WA 4IQZA 4EQOA 1Q1BA 3FKIB 3BG3A 2KQ3A 3V2TA 3PMFA 3OSOA 3R93A 3H3VC 2F0UA 2PYKA 3A55A 1H9MA 2XWBB 2EYHA 3HGBA 5ELDA 2EYJA 4CKBA 3VA5A 2B2YA 1EEFD 1MGSA 5C6AA 3A8KE 1EQVA 4IN3A 1VF5C 3M4YA 4ZLTF 2ZT9C 2EJMA 1STBA 4KTAA 3IL8A 4DXGA 1OXUA 2E2IB 2F0FA 2PW5A 3GV6A 5JEAG 4F8MA 1ICWA 1WTPA 3PUZA 5HGTA 1LABA 1TR5A 2B2VA 5EKIA 3TN2A 4EQPA 1I3QB 4QUFA 1OXSC 5IGGA 1BOSA 1VF7A 1RTOA 3SVMA 3EJIA 1LT4D 2F0MA 4WFN3 3FMCA 2QF7A 4K8IA 3BDOA 3MXUA 1G91A 4G7ZC 3K57A 1PTOB 2ICEC 5COYA 3KF8A 1VCIA 1B50A 3H6MA 5EQ0A 1K8OA 2JA8B 3MVVA 5CV9A 4ABNA 4K5VA 1JWMD 5BN3A 2RVLA 3OWFA 1TVXA 2NTTA 5CV5A 4IFDG 1QB5D 4HEDA 3OIPA 2H1EA 4DK0A 2HCCA 1AN8A 3PUXA 3DUZA 3MZ5A 2IL8A 1I6HB 4Q0FA 5ISRA 1RF2D 1SBBB 4YIJA 4K6DA 2ZXOA 3OOCA 4C3HB 2JXMB 4JK1C 5LHY1 2AWOA 4IUUA 5DM73 1SE2A 2K32A 4A3JB 1WTVA 2KVMA 4R8IA 1QCBD 1KLUD 3I73A 2AQ2B 2SNSA 5E1FA 3SK8A 4MIUA 3BDLA 1ZYRD 3D8GA 4A93B 1SYDA 3S1MB 2PW7A 4OL7A 3CRKC 3DMUA 1IW7D 2HCIA 3UI2A 1I4QA 1PXUA 5EGTA 2N55A 3NK9A 4ZKCB 1CM9A 3I90A 4O1NA 5T1IA 5M3FB 2XRQD 2ICIA 3D4RA 5KNBA 2F0GA 1STHA 4NW2A 4XXEA 4DAVA 1O78A 2FMCA 4FF1A 4QMGA 1B9MA 3MTSA 1LV9A 1PDQA 1VDZA 2DY7A 2E75C 2RSOA 1KDCA 3J81L 4G4KA 2NB0A 3NTIA 5FLXL 2WP8J 5K36G 1PRTC 3C2PA 2L12A 4A3MB 2EY5A 5IT9L 1JE4A 3NHHA 2X69A 5I4DA 1Y8NB 1KNEA 2M9VA 1FGBD 2A73B 4C56C 1NR4A 3GTGB 4HMJA 1SYGA 3S16B 1TWAB 1YNND 4OIJA 2KCNA 4KV6A 2O5JC 5C3EB 4TRDA 4QF4A 1OO9B 1AZQA 2ZXRA 4DGZA 3A56A 2LY7A 2KECA 3S2HB 1I4XA 1EY8A 5T1GA 3F2UA 2TMPA 1JWSD 4A3DB 5IGFA 2A74C 1HTLD 3QJYA 1GJXA 2VB3X 1PMRA 5KRUA 4KK7A 5I2YA 1SMYC 3C3LA 2ZXPA 2B8FA 1ILPA 1SYFA 5LL6X 3AB9A 3Q23A 4FYDA 1GHKA 4XT3B 3GQBA 3BDCA 3HOVB 2L0CA 2WV6D 2F0LA 2R93B 2XWJB 1I4GA 1HPCA 2RDGA 4PMCA 5IODA 2EVBA 3HOYB 4L63B 3HKZB 3SK6A 3TSSA 1PTOD 3QIAA 3TZUA 3J7AF 1JB3A 1QG7A 3VYRA 1S5ED 2F4IA 1WVLA 1B1ZA 3NE5B 1M4VA 1SNCA 3OWEB 2K7VA 3MXPA 1F9RA 5I2XA 3K5MA 3V05A 1SNMA 1I6VC 3BVGA 4CKCA 1RD9D 4DAPA 2MP1A 4RKBA 3L9AX 3LWUA 4ZRZA 3JAML 2F3VA 2JA6B 1XTCD 4K14A 3C1EA 4XQQA 5IGEA 2J7ZA 3MWYW 1BF4A 4KKSA 3I91A 2ID0A 2X6LA 1SNPA 1AEXA 1XXGA 2PMZB 2D2CC 1PFBA 4H7BA 3PIO3 3DXJC 2QEJC 1EZ6A 2EOTA 3NTKA 4ZYSA 5EBCA 3FDTA 2SOBA 1TIID 3S17B 1TS5A 2PO4A 2IJ0A 2G9DA 1A2TA 4MN3A 4A3EB 2K03A 3GO5A 2PNRC 1EQTA 3NUCA 1WD1A 1WTRA 2BE5D 2AQ3B 2IT1A 2DNEA 4A3KB 4RFBA 2NUCA 2MJ8A 5E4WC 2Z1CA 5C5MA 2CHBD 1LTID 2F03A 1F9QA 5C0XJ 3A54A 1S5CD 5D3DA 3VR2A 4BY7B 4HCSA 3FEWX 2EY6A 1OXXK 3MHBA 4HSPA 2MPMA 4RGMA 5CMDA 3BZDB 5I6YA 1ZXTA 5CV8A 3QOLA 3W3AA 3BVZA 3ONAB 1PRTB 1BO0A 1HFGA 1HQMC 5C4HA 1BCPF 3TP7A 4B08A 5F2DA 2LFNA 4HTHA 5CV6A 1SEBD 2NWGA 2XNAC 3K5NA 3S1RB 4C1NK 4KN7C 1SNDA 2AQ1B 2E76C 5DNFA 4C3JG 1PLFA 5JVG3 1G291 1EYCA 4EVOA 1F2MA 2EY2A 4ZQ3A 4BA2I 2J4XA 2NVTB 1B53A 2MUYA 4KY5A 4B9XA 3VR4A 3BYYB 1STAA 1TT2A 5G3LD 2Z4IA 1TY2A 3TBIB 4OHJA 1DJRD 4XT1B 3T16A 2KCCA 2JYOA 4WRDA 1UUPA 4M8AA 4CJ2C 1JR0D 5J39A 3IFDA 3CHBD 3D4DA 5CV4A 2N88A 2OT2A 2DNCA 1FD7D 1B4OA 1QILA 3A8IE 2I46A 4HSVA 2Q8IB 4BBRB 4OO1H 2K5QA 1L0XB 4XTCS 2IPKD 1IKLA 2E2JB 3T56B 4ODGA 2IX0A 2B39A 2KHSA 3P20A 3OMCA 3GTPB 1X3QA 3S1QB 1TWHB 4CBVA 2L55A 3MFGA 1JWUD 4XQNA 1NUCA 3E5SA 4QUCA 2IWHA 1OXVA 1HFNA 3KBGA 4WJWA 1IHZA 2ENBA 2EXZA 3H94A 3SDZA 2CVRA 2K6AA 3WDNA 1Z47A 4OIKA 1B44D 4ZUIA 2AUKA 3Q24A 4IALA 4HR7B 4XDXA 4NKLA 4K2LA 1GUWA 1I50B 2BOSA 1HHVA 3I4MB 1CA5A 2DY8A 4M1UB 2CW0C 1JQYD 1V8QA 2A69C 3ITPA 3GTLB 3I8ZA 5A35A 5M3MB 4BS9A 2H4OA 4PMBA 3P7JA 3BVMA 1LO5D 4KI0A 1D1KA 2L1BA 4DF7A 3W2DA 4RHSA 4ULLA 2RA4A 1EYAA 2NVYB 1RDPD 2WKCA 4BY1B 1SDFA 2DN8A 1WTWA 4CGYB 1MD2D 2SNMA 3QB3A 1D5XC 3PO3B 3GD7A 3KK7A 5M5XB 3HRZC 1LACA 4RGNA 5KNDA 2IX3A 3EQLC 5J22A 1H9RA 4LAAA 1TQOA 4FP5D 1LLRD 3Q22A 1A6XA 4KKTA 2EYPA 5I6WA 2I07B 3SE0A 2K05A 3WOFA 3N52A 4KJNA 2XRSD 2Z8LA 4ILWA 3A7AB 3NSWA 4GZYC 5BN5A 1PZKD 1H9KA 3AMUA 1RJTA 4LMQD 1U4MA 5FO7B 4G7OC 3PUWA 1U9RA 1HXYD 2E74C 2EPBA 2E2DC 4Q5VA 4NP5A 1PRTD 2BA1A 1TU2B 1DD2A 4KJOA 4IZ8A 5C0XH 2XIWA 2L9HA 1EEID 3FRPB 4DN4M 3Q0AA 2YU9B 1D6EC 1UEAB 3L7ZC 1LTRD 2AUJD 2QDBA 2RSNA 4X3UA 4IFDI 3H91A 4RGOS 2M00A 1KLGD 1K83B 1IYUA 4FXDA 3RUZA 3DWAA 1G2TA 3D4WA 3SR1A 1LT6D 4FF4A 2K5DA 3X3MA 1Y69U 4U673 3GTQB 4FXGC 1SJHD 5I9OA 1F9PA 4C3IG 2EE1A 3J81E 1Y1WB 1TWCB 1X32A 2K28A 1MBYA 3K5LA 1SMYD 4FO2A 5EPKA 2RQXA 3PUYA 3LX0A 2EJFC 2WKDA 1SYBA 1BCPC 4PV1C 5IT9E 1CT1D 1FR3A 1CQVA 3J80L 2NZ1D 2F0PA 1A3UA 3R3OA 1SYCA 4UAIA 3DEPA 2KEDA 1R9TB 3PIP3 1STYA 4G7HC 5EKKA 1QWYA 4H0LC 2D9UA 3MFYA 1J9OA 4I65A 4J8QA 1WCMB 2NBFA 2VNUD 1EY0A 1VMCA 1SE3A 1SNOA 2B2UC 1TS2A 2KEEA 1RCVD 2A6HC 1B9NA 1E0BA 3WOEA 3VR6A 4C3JB 4PMWA 5C4XB 2V4DA 3BS1A 1FNUA 2JEAI 1EL0A 1GUTA 4RWSC 1K8MA 1EWCA 5NUCA 1R4QB 1ENCA 3FPUB 1XX8A 2EY1A 2IW3A 1T5EA 2WAQB 1G6ZA 3L3OC 1MI2A 5J1ZA 3AU7A 4RA8A 1A3TA 1GUSA 1CZWA 2F0TA 1KDAA 3ND9A 4KY7A 1CZGA 3T13A 4OO1G 3EROA 4A3FB 1DM0B 2F0JA 4FVMA 3HOXB 1G8ZD 3HP3A 1O7LA 2JEBI 5JOBA 1GHJA 1DZ1A 1U4LA 3R2TA 4EGVA 3HZXA 1LTBD 1Y8PB 4RAUC 1RHPA 3K6OA 4K5WA 1ENFA 2NTSA 4QCLA 3D6WA 2O4XA 4KY6A 5C5LA 3K7AB 3U9OA 5M5WB 4C1NI 1KABA 5FO8B 2JP1A 3E0JA 4FXKC 2D62A 5CC4A 1I4HA 1Q12A 4WORA 2RKSA 2PPBC 4V0BA 4R8NA 2MGSA 3KLSX 2YYZA 1Q3LA 2QILA 3URYA 3QWNA 1ESFA 1QNKA 3MAQA 3T51B 3OW7A 4OO1I 1RTNA 1IL8A 3DWPA 5EJWA 1YNJD 3H0GB 3MC0B 1TS3A 3IAYA 4OGQC 4H13C 1EY5A 3S9WA 2BDOA 4Z9CB 1V1PA 4TKOB 1AFPA 4BBSB 1EY6A 2F0HA 1EWHA 1RKNA 3M4OB 1ET9A 5D65A 1D5ZC 1QE6A 3RZDB 1DOLA 4V190 1BDOA 2BCOA 4IURA 3PV0A 3OPOA 1BQQT 3IFTA 1STNA 3G7LA 1G2SA 3NBHA 3R2IA 4BWGB 4TSSA 1F2YA 1R4PB 4F87A 1JORA 4L8JA 1JCKB 3VYSA 1BBXC 4N9TA 5CBAE 2K33A 5FO9B 1F77A 3U9SA 2LS01 2F0KA 3GTOB 5E4XA 1A3VA 4XYOA 2LMCB 2JA5B 2O2LD 4O42A 4KD4A 1BCPB 1XWEA 4G57A 5M9OA 1O7ZA 1SYEA 3G6JB 1GXDC 1YNJC 1Z6HA 3DEOA 1ILQA 5IGBA 3CRLC 1C48A 1DYQA 1JICA 3KUPA 2B2TA 3ND8A 4K6LA 3QG1A 4B9WA 4HMIA 3BYTB 2BDNA 1W6KA 2X6GA 3OMGA 4DNRB 1HQRD 5C0XG 1SSOA 1NR2A 3VYUA 2NN6H 4R9WA 2A6EC 4HN7A 2BA0A 2RDFA 4L6TB 5ELFA 3TP5A 5DAUA 2NVXB 1STGA 4MHEA 3MA2B 2K04A 1PZID 3T4AC 5ELCA 4QB4A 1DCZA 3A7LA 1HTPA 3M85A 2FMMA 4A3IB 1DOMA 1SXTA 2CW0D 4FF2A 2MHVA 1J8IA 2A69D 2HUGA 4NMZA 2M2LA 3S14B 5M5YB 1PTOH 2WB1B 2EJGC 1Y1VB 3T53B 3RMHA 1EY4A 3NWTA 4JBWA 5A2QE 3ZYYX 4C3IB 1X3PA 2K5WA 1JOOA 3K0YA 3NP8A 1A15A 3K59A 3NXWA 3V96A 4P2CB 1KNAA 2F0WA 2VB2X 5C0XI 2A68C 1O80A 1FYCA 2Y0SB 1GUGA 1H9SB 1TWFB 4RCNA 5CBEE 5JEAJ 3C1FA 1GOZA 5DEHA 2F1MA 3HS0C 1HUNA 1EYDA 3SK4A 4X3TA 4H44C 2VXWA 5FK9C 1U4RA 4ME5A 3NQIA 2B2UA 4IUVA 2EYMA 4CJ1B 1HRJA 5C44B 3CU7A 1JC7A 3HOZB 2JA7B 2XSCA 1PZJD 3M7GA 2HDLA 4X3KA 5CYUA 1L0YB 2KOLA 1PFMA 2R92B 3OIQA 2RDHA 3DWQA 2B8GA 4X3SA 5JPNC 3SEBA 3RZOB 1D2BA 1AZPA 4CJ0B 3RD4A 1EFID 4IFDJ 2EYFA 1B2TA 1LT3D 5FKAC 1C8CA 1V43A 3QO2A 3M3YB 3KBXA 3FPPA 3J7YW 1W6JA 4FNFA 3DHQA 1H9SA 1PTOF 1ESRA 1SAPA 5IIFA 3DM1A 4NDXA 1ENAA 1B3AA 1MSHA 4DU9A 1AP0A 1GUNA 1HCZA 1F2LA 5C3WA 2EZVA 1BUVT 3SHLA 3E6ZX 4F7XA 1F9SA 2KUMA 3TZDA 1Q8IA 4XQJA 2Q8TA 5C4ZA 5FOBB 3VA7A 2PZUA 1NAPA 4XIGS 5JPMC 1H9JA 2F0VA 1QOHA 2RBMA 1T5XD 2KJXA 2B2TC 1BCPD 2R61A 1TS4A 5C4JB 1CA6A 1EU4A 2R3ZA 3VR5A 1S5DD 2VUMB 3ERQA 1WD0A 3FVQA 2F0SA 4K8JA 5EKLA 1IKMA 4IUNA 2PCFB 1SE4A 4HCEA 2E2HB 3CKIB 2A6HD 4ZKBB 3P1HA 1LTTD 3P75A 1AW7A 5JVH3 1ET6A 1RODA 3M7NA 3KLSA 1GUOA 1HA5A 2QCPX 1MSGA 4A3BB 4K5XA 4KMUC 5FLXE 1S5FD 5EPLA 3K5OA 2PZTA 3HOWB 2C5CA 4K2KA 1LTAD 1PYWD 3J80E 1XYIA 2WACA 3MEHA 2Z4HA 1WTQA 2OF1A 4KN4C 4C2MB 2XN9C 2JE6I 5E3FA 2EDGA 2FHTA 3VYTA 4KHVA 3HOUB 1BXTA 1KTKA 4KKUA 1NCVA 1ZEQX 1TKWB 2FFKB 2B2WC 3PUVA 1LTSD 2R7ZB 1EY7A 5KGUA 3S1NB 1ZYRC 1EU3A 1EOTA 4RH6A 1QNUA 3I4LA 3C46A 1VMPA 3O13A 1IW7C 1S4ZA 4ZAIA 4DXFA 1FNVA 4RCOA 2B2YC 5KIXA 1ONLA 2NN6G 4DFAA 1NSNS 2J0TD 4J6HA 1CTMA 1D5MC 2PZWA 3R8BA 2O5IC 1PFNA 5CORA 2Q8RE 1CFMA 4KD3A 1UAPA 4Y7NB 2TSSA 1CK1A 5JEAH 1Y8OB 5LL6S 5G3LF 1ZKOA 3S2DB 4HAEA 3KLRA 4RKLA 2B2VC 5KNCA 1Q90A 5AFWA 3I4NB 2K1BA 1LT5D 1V1PB 4I7ZC 4UDUC 1BR9A 1SNQA 2EYLA 4IUPA 5TSSA 1HA6A 5C3XA 3TP8A 5IOCA 5CGKA 1M8AA 4KHZA 3J7AV 3N6RA 2QKIC 4DK1A 2SEBD 1TWGB 1YNNC 4IFDH 2C9OA 1HUMA 2NN6I 3NBIA 4LK1C 2K01A 2D5DA 1UNSA 3SK5A 3GTKB 4C3HG 3LNNA 3JAME 3GP7A 4RGTA 5EPJA 3RLFA 4A3GB 1IYVA 1JOKA 3Q6SA 1EIGA 3I3CA 1Z7TA 1BNZA 1DONA 2F0DA 2XVSA 1CQFA 3PO2B 3I70A 1OXTA 5KEEA 2NYZD 1V1OA 2FJ2A 5BN4A 2WINB 2PQEA 4DAYA 5ELBA 5JJZA 3NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKB B;  2KVM A;  4R8I A;  3QO2 A;  1HFN A;  1BO0 A;  4OIJ A;  1WTO A;  2L11 A;  1DOK A;  1HFG A;  3IL8 A;  1X3P A;  3KBX A;  1ROD A;  2CVR A;  3HP3 A;  2B2V C;  1RJT A;  1AZQ A;  4LMQ D;  2MP1 A;  2NZ1 D;  5AFW A;  1DZ1 A;  1A15 A;  3GV6 A;  1U4M A;  4OIK A;  2KEC A;  1U4L A;  1ICW A;  1MSG A;  1BBX C;  2K1B A;  5CBA E;  5T1G A;  1WTP A;  2NWG A;  4UAI A;  1KNA A;  5EPL A;  2B2V A;  3F2U A;  5EKI A;  3TN2 A;  1ESR A;  1SAP A;  3LWE A;  3DEP A;  4IUQ A;  2KED A;  4XDX A;  4QUF A;  5E4X A;  4RAU C;  1GUW A;  1RHP A;  2J7Z A;  1O80 A;  3MWY W;  5DNF A;  1BF4 A;  1PLF A;  3I91 A;  1RTO A;  2HCI A;  4IUP A;  2EPB A;  3UI2 A;  1CA5 A;  1HA6 A;  4O42 A;  3D6W A;  3SVM A;  1XYI A;  2DY8 A;  3DM1 A;  2D9U A;  2N55 A;  2X6L A;  1J9O A;  4ZKC B;  1B3A A;  1CM9 A;  1M8A A;  1MSH A;  5CBE E;  1O7Z A;  1WTQ A;  1PFB A;  3I90 A;  1AP0 A;  1B53 A;  2JP1 A;  3DEO A;  3I8Z A;  5T1I A;  1G91 A;  1ILQ A;  2XIW A;  1VMC A;  2L9H A;  1F2L A;  1C8C A;  2EOT A;  3P7J A;  2B2U C;  2SDF A;  5COY A;  1ILP A;  1JIC A;  2KEE A;  2FHT A;  3KUP A;  4DN4 M;  1F9S A;  1HUN A;  1HUM A;  2B2T A;  2KUM A;  3FDT A;  3TZD A;  1B50 A;  2L1B A;  4NW2 A;  4HAE A;  2Q8T A;  4X3T A;  5EQ0 A;  1NCV A;  1E0B A;  2MGS A;  4MN3 A;  2K01 A;  2VXW A;  2K03 A;  1U4R A;  3MTS A;  1LV9 A;  1Q3L A;  2B2U A;  2BDN A;  4IUV A;  1NAP A;  2RSN A;  2X6G A;  1PDQ A;  2HDM A;  2FFK B;  4X3U A;  4CJ1 B;  4XT1 B;  2RA4 A;  3H91 A;  2B2W C;  1HRJ A;  2DY7 A;  4XT3 B;  2JYO A;  2RVL A;  1SSO A;  1NR2 A;  2FIN B;  4IUT A;  1ML0 D;  1HHV A;  1EQT A;  1EIH A;  2B2T C;  1WD1 A;  1EL0 A;  1QNK A;  1TVX A;  4R9W A;  1WTR A;  1EOT A;  4CJ2 C;  1RTN A;  2RSO A;  1IL8 A;  2L4N A;  4HED A;  5EJW A;  4RWS C;  1WTX A;  5EPJ A;  1CA6 A;  2HDL A;  2B2W A;  2R3Z A;  1O7Y A;  4X3K A;  1VMP A;  3IFD A;  2KOL A;  1PFM A;  1SDF A;  2H1E A;  1G2T A;  2HCC A;  1WTW A;  3Q6S A;  4MHE A;  2N88 A;  1S4Z A;  1EIG A;  2IL8 A;  2K04 A;  2MJ8 A;  3I3C A;  1B4O A;  4X3S A;  5E4W C;  4ZAI A;  3R93 A;  1WD0 A;  1BNZ A;  4HSV A;  2B2Y C;  1XX8 A;  1F9Q A;  3FPU B;  1QG7 A;  1G6Z A;  1MI2 A;  1F9P A;  1AZP A;  2EE1 A;  4CJ0 B;  5D14 A;  1DON A;  4HCS A;  2L12 A;  4RA8 A;  5D65 A;  1QE6 A;  1IKM A;  1IKL A;  1WVL A;  1U4P A;  2FMM A;  1PFN A;  5COR A;  1JE4 A;  1DOM A;  2MPM A;  1DOL A;  2B2Y A;  2Q8R E;  2X69 A;  4IUU A;  1X32 A;  4U68 A;  4ZK9 B;  5CMD A;  2K28 A;  1MGS A;  4IUR A;  1J8I A;  1F9R A;  1X3Q A;  2NYZ D;  1KNE A;  2HUG A;  1ZXT A;  2FJ2 A;  2M2L A;  5EPK A;  1B2T A;  4ZLT F;  3ONA B;  1NR4 A;  3G7L A;  3GV3 A;  1G2S A;  1WTV A;  4QUC A;  2K05 A;  5JJZ A;  3N52 A; 
#chains in the Genus database with same CATH topology
 2HQE A;  2B63 B;  3OHX C;  2L11 A;  2OXP A;  3TME A;  2WII B;  3IKJ A;  4B3R L;  1IBL Q;  1JOQ A;  4FF3 A;  2MO1 A;  3NTH A;  4BA1 I;  1EY9 A;  4CKE A;  1Q81 C;  4ALP A;  1TY0 A;  1N33 L;  3VDY A;  5D3I B;  2F0E A;  1PTO C;  3PSI A;  3EA6 A;  2AWN A;  1LTG D;  2A6E D;  1Q46 A;  5AJ3 Q;  1XMQ L;  3HG9 A;  2F0Q A;  3LWE A;  4PNY A;  1E2W A;  4P73 A;  4ID6 A;  1A2U A;  3GTM B;  2RHS B;  4GN5 A;  1E2Z A;  2F0N A;  3OYY A;  4LFC Q;  2A5H A;  1EZ8 A;  1SJE D;  1IBM Q;  1CSQ A;  2KA7 A;  4BBR H;  5ELE A;  2VS1 A;  4E6I A;  4PQX A;  3EFX D;  4CHT B;  1G6P A;  5IGD A;  4DA2 A;  1S5B D;  2E2J H;  3J81 i;  1STE A;  2Z6B A;  2JA9 A;  3D6C A;  3PIO A;  3GTP H;  3HOU G;  3S1Q H;  1TWH H;  2D0P A;  3TDQ A;  1WFQ A;  3HEJ A;  3U4Z A;  3I72 A;  1HR0 L;  3D31 A;  2HDM A;  2LKV A;  5K36 H;  4ZCK A;  1Q86 C;  3A8J E;  3QOJ A;  3S15 B;  1F2Z A;  3CQZ B;  2FIN B;  4A3M G;  4J1M A;  4LFB Q;  2E5L L;  2GA4 B;  2KBN A;  1IBK Q;  5IP9 G;  2K4K A;  3TP6 A;  1KDB A;  4OWX B;  4N9P A;  1O7Y A;  2JSO A;  3H09 A;  4DV1 L;  3MEF A;  2HHH Q;  2PNH A;  2F3W A;  3OTO L;  2IX1 A;  3FHW A;  1PH3 A;  4S3S A;  3NQT A;  2ASB A;  1N8R C;  1DXM A;  1CHP D;  1Q1E A;  1PRT F;  5JAV A;  1I50 H;  2K75 A;  5C3E G;  1C9O A;  1KAA A;  2A68 D;  1I4R A;  4QIW B;  4OEL B;  5D14 A;  3ULL A;  3I4M H;  2F0O A;  1U4P A;  3MXN A;  3D0F A;  4ZK9 B;  4OWT B;  4U68 A;  2F0I A;  1CHQ D;  4GS3 A;  3GTL H;  5CV7 A;  5EBD A;  3SXH A;  3CCM A;  2E2I H;  5M3M H;  2AMC B;  3K58 A;  4A3D G;  3GV3 A;  3BU2 A;  4MTN A;  2R6G A;  5KYI A;  5DM6 3;  2CQA A;  3K8A A;  1WTO A;  1QJO A;  1DOK A;  5HUR A;  3GTJ B;  2OEO A;  2BE5 C;  4POF A;  2G9H D;  2Q2I A;  5CR3 A;  2L5T A;  4LUO A;  1SFO B;  2ZTD A;  1CI3 M;  4DNT B;  1QZH A;  1K0S A;  2NVY H;  4B3T Q;  1HNW Q;  5KYL A;  3F2D A;  1D1I A;  4IUQ A;  4BY1 H;  4TQU S;  3VR3 A;  5IP7 H;  3E3X A;  1YHB A;  4RHR A;  5GAG C;  1YVC A;  1C4Q A;  3MXG A;  5LMU L;  1II3 A;  3EVQ A;  1JE5 A;  3PO3 H;  2NVQ B;  1PVO A;  3HOV G;  5M5X H;  2R93 G;  1FNW A;  3H3V I;  2VY3 A;  2SDF A;  3HKZ G;  4EQN A;  3BZK A;  1I4P A;  2ZTE A;  4ZUJ A;  4AYB B;  1PYB A;  2EYO A;  4F88 A;  5I9P A;  1Q7Y C;  1HH2 P;  2YV5 A;  1PA6 A;  4LJZ C;  4IPH A;  2MFI A;  3D3R A;  3X3N A;  5A2Q L;  4LWC A;  4IUT A;  1ML0 D;  3KF8 B;  1EIH A;  4XYQ A;  5IGC A;  3NPP A;  1E2V A;  2L4N A;  5K5P A;  1WTX A;  1VQA A;  2B2W A;  3CAM A;  4IQZ A;  4HJ9 A;  1V1Q A;  4EQO A;  1Q1B A;  3FKI B;  3BG3 A;  3PF5 A;  1SRO A;  2KQ3 A;  3V2T A;  3PMF A;  3M4P A;  3OSO A;  4X65 L;  3R93 A;  3GDE A;  4X62 L;  3H3V C;  2F0U A;  2PYK A;  1U0L A;  3A55 A;  4EX5 A;  1H9M A;  2PQA B;  2XWB B;  1N36 L;  2EYH A;  3HGB A;  5ELD A;  2EYJ A;  4CKB A;  3VA5 A;  1Q82 C;  4JVZ A;  3RLO A;  2B2Y A;  1C7Y A;  1EEF D;  1MGS A;  5C6A A;  3A8K E;  4YHH L;  1XJV A;  1EQV A;  4IN3 A;  1VF5 C;  2JA6 G;  3JAM i;  3M4Y A;  4DAM A;  4ZLT F;  1M90 C;  2ZT9 C;  2EJM A;  1STB A;  4KTA A;  2YU9 H;  1K9M C;  3IL8 A;  4DXG A;  2B29 A;  4YY3 L;  3UDI A;  4LF9 L;  1OXU A;  4P72 A;  2E2I B;  2F0F A;  2PW5 A;  2CWP A;  3GV6 A;  4F8M A;  5JEA G;  1HZA A;  3KFU A;  1ICW A;  1K83 H;  1WTP A;  3PUZ A;  5HGT A;  1LAB A;  1TR5 A;  2B2V A;  5EKI A;  3TN2 A;  4EQP A;  4JG2 A;  3F8T A;  1I3Q B;  3UDF A;  4QUF A;  1OXS C;  4TVA B;  5IGG A;  1BOS A;  2B3G A;  1VF7 A;  1RTO A;  1VQ9 A;  2Z6K A;  3SVM A;  3GTQ H;  4OX9 Q;  1U5K A;  3EJI A;  1LT4 D;  2F0M A;  4WFN 3;  3FMC A;  2QF7 A;  4K8I A;  3BDO A;  3MXU A;  1XNR Q;  1G91 A;  4G7Z C;  3K57 A;  1PTO B;  4A3K G;  1Y1W H;  2ICE C;  1TWC H;  5COY A;  2QW7 A;  1XPU A;  3KF8 A;  1VCI A;  4MNO A;  1B50 A;  3LGJ A;  3H6M A;  5GQO A;  5EQ0 A;  1K8O A;  2VQE L;  2JA8 B;  3MVV A;  5CV9 A;  4ABN A;  4K5V A;  1JWM D;  5BN3 A;  4JI1 L;  2RVL A;  3OWF A;  4R4O A;  1TVX A;  2NTT A;  5CV5 A;  3UDG A;  4IFD G;  1QB5 D;  4HED A;  2PQA A;  3OIP A;  5FLM G;  1Z9F A;  4JI2 Q;  2H1E A;  4DK0 A;  2HCC A;  1AN8 A;  3PUX A;  3DUZ A;  3MZ5 A;  2IL8 A;  4JI8 L;  1I6H B;  2RF4 A;  4Q0F A;  5ISR A;  1RF2 D;  1SBB B;  1R9T H;  4LF4 L;  4YIJ A;  3ICE A;  4K6D A;  1BBU A;  2ZXO A;  3OOC A;  3BZC A;  4C3H B;  2JXM B;  4JK1 C;  5LHY 1;  2AWO A;  4IUU A;  1WCM H;  4YWK A;  1PH9 A;  3AYH B;  5DM7 3;  1SE2 A;  1YJN A;  4DR3 Q;  2K32 A;  4A3J B;  1HNZ L;  3CMA A;  5BR8 Q;  1WTV A;  3CCJ A;  3B6Y A;  2KVM A;  5IYC H;  4R8I A;  4DK6 C;  3H15 A;  1QCB D;  4AYB E;  1KLU D;  4C3J H;  3I73 A;  5C4X H;  1YJW A;  3G6E A;  2AQ2 B;  2SNS A;  1M1K C;  5E1F A;  3SK8 A;  4MIU A;  3U50 C;  3BDL A;  1ZYR D;  3D8G A;  4A93 B;  1SYD A;  3S1M B;  2RHQ B;  2PW7 A;  1KIX A;  4OL7 A;  3CRK C;  3DMU A;  1IW7 D;  2VQF L;  2UUA Q;  2HCI A;  3UI2 A;  1I4Q A;  4KLK A;  4B3S Q;  4LF5 L;  1PXU A;  5EGT A;  2N55 A;  4IJH A;  3NK9 A;  4ZKC B;  1CM9 A;  5GAD C;  4JC0 A;  3I90 A;  4O1N A;  2CKZ B;  5T1I A;  2XRQ D;  5M3F B;  1E3P A;  2ICI A;  3D4R A;  3PCO B;  5KNB A;  2F0G A;  4AYB G;  4IOC A;  4GN3 B;  4LFB L;  1STH A;  4NW2 A;  4XXE A;  2HIX A;  4DAV A;  1O78 A;  2FMC A;  4FF1 A;  4QMG A;  3KDF B;  4BBR G;  1B9M A;  3MTS A;  1LV9 A;  4DKA C;  2JQO A;  1PDQ A;  4A3F H;  5J3B A;  1VDZ A;  2DY7 A;  3UE1 A;  1JB7 A;  4A76 A;  1EUJ A;  4DV0 L;  4CDF C;  2JK8 A;  3HOX H;  4IPD A;  1ASY A;  1VQ5 A;  2E75 C;  3PGZ A;  4LF8 Q;  2RSO A;  1KDC A;  4GKK L;  4X66 L;  3J81 L;  4B3M L;  3K80 C;  4G4K A;  4A4I A;  2NB0 A;  3NTI A;  3KF6 B;  5FLX L;  1EFW A;  2UU9 Q;  2WP8 J;  5K36 G;  4L5S A;  1PRT C;  4LFA Q;  3C2P A;  3E9H A;  3CME A;  5LMN L;  4YWL A;  1L1O A;  4RG1 A;  2L12 A;  2HD3 A;  4N8F A;  3CCS A;  4A3M B;  2A1A A;  2EY5 A;  1YZ6 A;  5IT9 L;  1JE4 A;  3NHH A;  2X69 A;  3K7A H;  1CKN A;  5M5W H;  5I4D A;  1X3F A;  2HIV A;  3M4Q A;  1Y8N B;  1KNE A;  2M9V A;  1FGB D;  2A73 B;  4C56 C;  2ES2 A;  1NR4 A;  1X65 A;  3GTG B;  4HMJ A;  1SYG A;  3S16 B;  1TWA B;  1YNN D;  3I4M G;  4OIJ A;  2KCN A;  4KV6 A;  2O5J C;  5C3E B;  4BXX H;  4TRD A;  4QF4 A;  3J7Z C;  1OO9 B;  1AZQ A;  2ZXR A;  4DGZ A;  3A56 A;  5M3M G;  1EQQ A;  2LY7 A;  2KEC A;  3S2H B;  1I4X A;  1EY8 A;  1X3E A;  5T1G A;  1PH7 A;  3F2U A;  2TMP A;  1NMF A;  2I5H A;  3H0G H;  1JWS D;  4A3D B;  5IGF A;  3K0X A;  1AE3 A;  4DUZ Q;  2A74 C;  1HTL D;  2HT1 A;  1KRT A;  3QJY A;  3PIP A;  3BJU A;  1GJX A;  2VB3 X;  2H5X A;  4BBS H;  1PMR A;  3STB D;  5KRU A;  4KK7 A;  1E22 A;  3KDF A;  5I2Y A;  1SMY C;  3ULJ A;  1LM0 A;  3M4O H;  2KHI A;  3RZD H;  3C3L A;  1KC8 C;  2ZXP A;  2B8F A;  1ILP A;  3F2C A;  5IP7 G;  1SYF A;  2Z6K C;  5LL6 X;  3AB9 A;  3Q23 A;  1VQ7 A;  4FYD A;  1VQN A;  2GVB A;  3PO3 G;  1GHK A;  4XT3 B;  3GQB A;  2OCE A;  4DV3 Q;  3BDC A;  3HOV B;  2L0C A;  2WV6 D;  2F0L A;  2R93 B;  2XWJ B;  1I4G A;  1HPC A;  2RDG A;  4PMC A;  5IOD A;  2EVB A;  1VQP A;  4POG A;  3HOY B;  4L63 B;  3HKZ B;  3SK6 A;  4LF6 L;  3K7U C;  3TSS A;  1PTO D;  1BKB A;  3QIA A;  2CQO A;  1UE5 A;  3TZU A;  3J7A F;  1JB3 A;  4Y52 H;  1QG7 A;  3T1H L;  3GTO H;  1H95 A;  3VYR A;  1IXR A;  4KHP Q;  1S5E D;  2JA5 H;  2F4I A;  1SE8 A;  4JI4 Q;  1WVL A;  1B1Z A;  3NE5 B;  1M4V A;  1SNC A;  3OWE B;  4UP8 A;  2K7V A;  3MXP A;  1F9R A;  1SRU A;  1IL2 A;  5I2X A;  4N8X 1;  4WJ4 A;  1SR3 A;  3K5M A;  3V05 A;  4L5T A;  2RCF A;  1SNM A;  1I6V C;  3BVG A;  3HFZ B;  2UUB Q;  4CKC A;  1PV4 A;  1RD9 D;  3CW2 C;  1XNQ Q;  4DAP A;  2MP1 A;  4RKB A;  5JJI A;  3L9A X;  5IYB H;  2WFW A;  3LWU A;  3CC4 A;  4ZRZ A;  3JAM L;  2UXC L;  4OX9 L;  5GRO A;  2F3V A;  2JA6 B;  1XTC D;  1A62 A;  4K14 A;  2NVX H;  4EQ5 A;  3C1E A;  4XQQ A;  5IGE A;  2J7Z A;  3MWY W;  3DLL A;  1BF4 A;  1HZB A;  4KKS A;  3I91 A;  1CKM A;  2UXB Q;  3MXN B;  2ID0 A;  2MNA A;  3ULP A;  2X6L A;  2CWA A;  1SNP A;  1AEX A;  1XXG A;  2PMZ B;  4IOA A;  2D2C C;  2ZM6 Q;  3KLW A;  2Z9H A;  2UUC L;  1PFB A;  4H7B A;  3PIO 3;  3DXJ C;  2QEJ C;  5M3F G;  1EZ6 A;  1Y14 B;  1YEZ A;  2EOT A;  4A3I H;  1PH1 A;  3NTK A;  4ZYS A;  5EBC A;  4JBJ A;  3FDT A;  2SOB A;  1O7I A;  1TII D;  3S17 B;  1TS5 A;  2PO4 A;  2IJ0 A;  2G9D A;  1A2T A;  4MN3 A;  5M5Y H;  4A3E B;  3S14 H;  2K03 A;  1Y1V H;  3SGI A;  3GO5 A;  4JI2 L;  3AFP A;  2PNR C;  1EQT A;  4LUZ A;  3S24 A;  4HID A;  3NUC A;  1WD1 A;  4C3I H;  1WTR A;  2BE5 D;  2AQ3 B;  3J81 c;  2IT1 A;  2DNE A;  4A3K B;  4RFB A;  1EOV A;  4NXM Q;  3CPW A;  5FLX c;  2NUC A;  4O2D A;  2MJ8 A;  2GN5 A;  5E4W C;  2Z1C A;  1NMG A;  5C5M A;  2CHB D;  1LTI D;  2F03 A;  2CH4 A;  1F9Q A;  5C0X J;  3A54 A;  1S5C D;  5D3D A;  3VR2 A;  4DR1 L;  4BY7 B;  1VQK A;  4HCS A;  4I7A A;  3FEW X;  2EY6 A;  1OXX K;  3MHB A;  5IT9 c;  4HSP A;  4X64 L;  2MPM A;  1TWF H;  3J80 i;  4RGM A;  5CMD A;  3BZD B;  5I6Y A;  3G4S A;  1ZXT A;  5CV8 A;  2N78 A;  1I94 Q;  3QOL A;  3W3A A;  4IPC A;  3BVZ A;  3ONA B;  4OWW B;  1HJP A;  1L1O C;  4JOI A;  1PRT B;  4DR6 Q;  1BO0 A;  2AKW B;  1HFG A;  1HQM C;  2UXD L;  1SMX A;  4DV2 Q;  1WCM G;  1W2B A;  5C4H A;  1BCP F;  4HJ7 A;  5C44 H;  1IZ6 A;  1MIU A;  3TP7 A;  4B08 A;  5F2D A;  2LFN A;  4HTH A;  5CV6 A;  2JA7 H;  1SEB D;  3HOZ H;  2NWG A;  2XNA C;  3K5N A;  3S1R B;  4JI6 Q;  3TRZ A;  4C1N K;  5IYC G;  4KN7 C;  1SND A;  2AQ1 B;  2E76 C;  5DNF A;  2R92 H;  1JT8 A;  4C3J G;  1PLF A;  3K81 C;  5JVG 3;  1G29 1;  1EYC A;  4EVO A;  3RNU A;  1F2M A;  3HKZ E;  2EY2 A;  4DV5 L;  2K5H A;  4ZQ3 A;  1WTH A;  1E7Z A;  4BA2 I;  3F2B A;  2J4X A;  2NVT B;  1B53 A;  2MUY A;  2YTV A;  4KY5 A;  1N32 Q;  4UP7 A;  4DV4 L;  4B9X A;  2C35 B;  3VR4 A;  1LUZ A;  2K5N A;  3BYY B;  4GKJ L;  1P16 A;  1PHJ A;  3KJP A;  1STA A;  1TT2 A;  5G3L D;  2Z4I A;  2QA4 A;  3IRB A;  4LF8 L;  1TY2 A;  3TBI B;  2WAQ G;  4HJ8 A;  4OHJ A;  1J5E Q;  1B8A A;  1DJR D;  4XT1 B;  3T16 A;  2YTX A;  2KCC A;  2JYO A;  4WRD A;  4JI7 L;  1UUP A;  3M3Y H;  1XMO L;  4M8A A;  2K52 A;  4CJ2 C;  4GOP C;  1TXY A;  1JR0 D;  5J39 A;  3HOY G;  3IFD A;  4JI3 L;  3CHB D;  3D4D A;  5CV4 A;  1E1O A;  1HNX Q;  2N88 A;  2OT2 A;  2DNC A;  1FD7 D;  1B4O A;  1QIL A;  3A8I E;  2I46 A;  4HSV A;  2Q8I B;  4BBR B;  1NTG A;  1S40 A;  4OO1 H;  3HOX G;  2K5Q A;  1L0X B;  3W1B A;  4XTC S;  2IPK D;  1IKL A;  2E2J B;  3T56 B;  3CCR A;  4ODG A;  3U58 A;  2IX0 A;  2B39 A;  2K50 A;  2KHS A;  3P20 A;  3OMC A;  4LF7 Q;  3GTP B;  4AQY Q;  1X3Q A;  5IWA L;  3S1Q B;  1TWH B;  2PMZ E;  1QVG A;  4CBV A;  2L55 A;  3MFG A;  1JWU D;  5JJK A;  4XQN A;  1NUC A;  3E5S A;  1VQF A;  4QUC A;  2IWH A;  2OQK A;  1OXV A;  1HFN A;  1L0W A;  1KD1 C;  3KBG A;  4WJW A;  1IHZ A;  2VL6 A;  2ENB A;  2EXZ A;  1XPO A;  3H94 A;  3SDZ A;  2CH4 W;  2CVR A;  2K6A A;  3WDN A;  1K0R A;  1Z47 A;  4OIK A;  1B44 D;  3JAM c;  4ZUI A;  2AUK A;  5C4J H;  3Q24 A;  4JI5 Q;  4IAL A;  4HR7 B;  4XDX A;  4NKL A;  1KAW A;  4K2L A;  1GUW A;  1I50 B;  4GNX C;  2VUM H;  4BXX G;  2BOS A;  1HHV A;  3I4M B;  1CA5 A;  4PZ7 A;  2DY8 A;  4M1U B;  2CW0 C;  4DR5 Q;  1UWV A;  4DR4 L;  1UE1 A;  1JQY D;  1V8Q A;  2A69 C;  3ITP A;  3GTL B;  3I8Z A;  2LSS A;  5A35 A;  5M3M B;  4BS9 A;  2I0Q A;  2H4O A;  4PMB A;  2F3I A;  1DGS A;  3P7J A;  3H0G G;  1VQG A;  3BVM A;  2DJG C;  1LO5 D;  4KI0 A;  4DV3 L;  1D1K A;  4JV5 L;  2L1B A;  2E2H H;  4A3E G;  2BH2 A;  4DF7 A;  3W2D A;  4RHS A;  4ULL A;  4H02 A;  2F4V Q;  1G51 A;  3JC6 6;  3L2P A;  2RA4 A;  3RN5 A;  1SN8 A;  1EYA A;  2KCM A;  3PQI A;  2NVY B;  1RDP D;  2WKC A;  4JYA Q;  2KHJ A;  3E0E A;  4UPA A;  4BY1 B;  4KHP L;  1SDF A;  1VQI A;  2DN8 A;  2KCT A;  1QZG A;  3UE0 A;  1N9W A;  1WTW A;  4A3B H;  4JI4 L;  4CGY B;  4DV7 L;  1MD2 D;  2SNM A;  1EIF A;  1X6O A;  3QB3 A;  1D5X C;  3HOW H;  3PO3 B;  3GD7 A;  3KK7 A;  1D8L A;  5M5X B;  4QJF A;  1VQ6 A;  4BY7 G;  3HRZ C;  1LAC A;  4RGN A;  5KND A;  2IX3 A;  5IYD H;  3EQL C;  5J22 A;  1H9R A;  3AQQ A;  1T9H A;  4LAA A;  1JMC A;  4B3R Q;  1GVP A;  2UUB L;  4C2M H;  1TQO A;  4FP5 D;  1LLR D;  3Q22 A;  1XPR A;  1A6X A;  1GD7 A;  4P74 A;  1XNQ L;  4KKT A;  2EYP A;  1N33 Q;  2I07 B;  5I6W A;  3SE0 A;  3HOU H;  2K05 A;  3WOF A;  3N52 A;  4KJN A;  2JA5 G;  2XRS D;  2Z8L A;  4ILW A;  3A7A B;  1YI2 A;  3NSW A;  4DR7 L;  1XMQ Q;  4GZY C;  5BN5 A;  1PZK D;  1H9K A;  2JJQ A;  4A3L H;  3AMU A;  2EQS A;  4JI0 L;  1RJT A;  4LMQ D;  2ALY B;  1U4M A;  5FO7 B;  2R7Z H;  2UXB L;  4G7O C;  3S1N H;  4JOI C;  3PUW A;  1U9R A;  2RCN A;  4YCV A;  3F1Z A;  3T1Y Q;  2LXJ A;  1IBL L;  4UY8 C;  1L1O B;  4UHV A;  1VQ8 A;  1X3G A;  1HXY D;  2E74 C;  3J7A 5;  2EPB A;  2YTY A;  2E2D C;  4Q5V A;  4NP5 A;  1PRT D;  1CKN B;  2BA1 A;  1MJE A;  4IPG A;  5IYB G;  5AJ3 L;  1TU2 B;  4JW0 A;  1DD2 A;  4KJO A;  4IZ8 A;  2OTJ A;  5C0X H;  2XIW A;  5GAH C;  2L9H A;  4LFC L;  1EEI D;  3FRP B;  4DN4 M;  1IBM L;  3Q0A A;  2E5L Q;  4Y7N H;  1SLJ A;  1K8G A;  2YU9 B;  1D6E C;  1UEA B;  4LW1 A;  1CKO A;  3L7Z C;  1LTR D;  2AUJ D;  2QDB A;  2RSN A;  4X3U A;  4IFD I;  3S2D H;  4DV1 Q;  3H91 A;  4NXM L;  4RGO S;  3OTO Q;  2M00 A;  2GVA A;  1KLG D;  4YCU A;  1K83 B;  4R4I A;  1NY4 A;  1IYU A;  4FXD A;  3RUZ A;  3DWA A;  1G2T A;  2WB1 G;  3D4W A;  3SR1 A;  1GKH A;  3I4N H;  1LT6 D;  4FF4 A;  1Y1V G;  2K5D A;  3X3M A;  1Y69 U;  4U67 3;  5EAY A;  1IBK L;  3GTQ B;  4FXG C;  1GO3 E;  1SJH D;  5I9O A;  1F9P A;  2N3S A;  4C3I G;  1I94 L;  2EE1 A;  3J81 E;  4OEM B;  2HHH L;  1QUQ A;  1Y1W B;  1TWC B;  1X32 A;  1L2F A;  2K28 A;  1VQJ A;  1MBY A;  1WJJ A;  3K5L A;  1SMY D;  4FO2 A;  5EPK A;  5ELB A;  2RQX A;  3PUY A;  1BVS A;  1TWG H;  1VQ4 A;  4QY7 A;  2Y0S G;  3LX0 A;  4YCW A;  2DUD A;  2EJF C;  2WKD A;  1SYB A;  1BCP C;  4PV1 C;  5IT9 E;  1CT1 D;  1B7Y B;  1FR3 A;  3GTK H;  1HZ9 A;  1CQV A;  3J80 L;  3WWV A;  2NZ1 D;  4NB3 A;  2F0P A;  1JJG A;  1A3U A;  2ZJR A;  5LMU Q;  3R3O A;  1SYC A;  4UAI A;  3DEP A;  4A3G H;  2KED A;  1R9T B;  1X55 A;  1JJC B;  3PIP 3;  1STY A;  4G7H C;  2IY5 B;  2ZJP A;  5EKK A;  1QWY A;  4H0L C;  2D9U A;  4B3T L;  5C44 G;  1HNW L;  3MFY A;  1J9O A;  4I65 A;  4J8Q A;  4R4C A;  1WCM B;  2NBF A;  1YIJ A;  2VNU D;  2ATW A;  1UEB A;  1EY0 A;  4DV6 Q;  1VMC A;  1SE3 A;  2DGY A;  1SNO A;  2F52 A;  2B2U C;  1TS2 A;  2Q2U A;  3PO2 H;  2KEE A;  2R92 G;  1FVI A;  1RCV D;  4GN4 B;  2A6H C;  1B9N A;  1E0B A;  3WOE A;  5LMN W;  3VR6 A;  1A8V A;  4C3J B;  4PMW A;  5C4X B;  2V4D A;  2B63 H;  3BS1 A;  1FNU A;  2JEA I;  1HNX L;  3ZJY C;  4QGU A;  1NBW A;  2G5D A;  4X62 Q;  1EL0 A;  1PH5 A;  1GUT A;  2PI2 A;  4RWS C;  4DUY Q;  4BY1 G;  1K8M A;  1NNX A;  1P8L A;  2XTI A;  1EWC A;  1N36 Q;  3W5O A;  5NUC A;  4GOP A;  1R4Q B;  1ENC A;  3FPU B;  1XX8 A;  2EY1 A;  2IW3 A;  1T5E A;  2WAQ B;  4YHH Q;  3L3O C;  1MI2 A;  4AQY L;  5J1Z A;  3GTM H;  1G6Z A;  3AU7 A;  4RA8 A;  1A3T A;  1GUS A;  1CZW A;  2F0T A;  2Z0S A;  1KDA A;  2CCZ A;  3G48 A;  3ND9 A;  3NEN A;  4KY7 A;  4CDC C;  4YY3 Q;  4O0A A;  3AFQ A;  1CZG A;  2LXK A;  1KRS A;  2OQ0 A;  3T13 A;  4OO1 G;  3ERO A;  4A3F B;  1QVF A;  1DM0 B;  2F0J A;  4FVM A;  1OTC A;  2NZO A;  3KJO A;  3HOX B;  1G8Z D;  2IHF A;  2HQL A;  3HP3 A;  1Q8K A;  1O7L A;  2JEB I;  5JOB A;  1VQB A;  1GHJ A;  2CFM A;  4R4Q A;  1DZ1 A;  3S15 H;  3CQZ H;  1U4L A;  3R2T A;  4EGV A;  3HZX A;  3TS2 A;  3I55 A;  1LTB D;  1Y8P B;  2QEX A;  4RAU C;  1RHP A;  3K6O A;  2ZTC A;  4K5W A;  3I4O A;  1ENF A;  3CPF A;  2NTS A;  4QCL A;  3D6W A;  2O4X A;  4KY6 A;  5C5L A;  1VQC A;  3K7A B;  3U9O A;  5M5W B;  1WYD A;  1AH9 A;  4C1N I;  1PH2 A;  1KAB A;  4CDE C;  4GNX A;  4CDD C;  3TRE A;  5FO8 B;  1NJI C;  1EIY B;  2JP1 A;  3E0J A;  4FXK C;  2D62 A;  5CC4 A;  2PI2 E;  1I4H A;  1Q12 A;  1X54 A;  3NEM A;  4WOR A;  4JI1 Q;  2RKS A;  2XGT A;  2PPB C;  1VQE A;  4V0B A;  4R8N A;  2MGS A;  3KLS X;  4NPS A;  3CCU A;  1XNR L;  2YYZ A;  4JYA L;  1Q3L A;  1S3O A;  1N34 Q;  2QIL A;  4A3C H;  3URY A;  3QWN A;  3CC7 A;  1ESF A;  4JI8 Q;  3GTJ H;  1QNK A;  4APV A;  3T51 B;  3OW7 A;  3MAQ A;  4OO1 I;  4GLV B;  1RTN A;  4LF4 Q;  1IL8 A;  1SFO H;  3DWP A;  4PG3 A;  5EJW A;  1YNJ D;  3CC2 A;  3H0G B;  3MC0 B;  1ASZ A;  1TS3 A;  3IAY A;  4OGQ C;  4H13 C;  1EY5 A;  3S9W A;  2BDO A;  4Z9C B;  1RL2 A;  1V1P A;  4TKO B;  3KOJ A;  1AFP A;  4A75 A;  2Q2H A;  3CCV A;  1EY6 A;  2F0H A;  1EWH A;  4BBS B;  1HNZ Q;  1RKN A;  3M4O B;  1ET9 A;  5D65 A;  1D5Z C;  1QE6 A;  3UDX A;  3RZD B;  1Y1W G;  1DOL A;  2NVQ H;  4V19 0;  1BDO A;  2BCO A;  4IUR A;  4A3B G;  3PV0 A;  3OPO A;  1BQQ T;  3IFT A;  3HOW G;  1STN A;  3G7L A;  1G2S A;  3NBH A;  3R2I A;  4BWG B;  1B3Q A;  4TSS A;  3Q8D A;  1F2Y A;  3OW2 A;  3FP9 A;  1R4P B;  4F87 A;  1JOR A;  4DR3 L;  3T1Y L;  5IYD G;  4L8J A;  3J80 c;  5IY0 A;  5BR8 L;  5HGQ A;  1JCK B;  3VYS A;  2VQF Q;  1VQL A;  2VW9 A;  1BBX C;  4LF5 Q;  4N9T A;  5CBA E;  2K33 A;  5FO9 B;  1F77 A;  3U9S A;  3I56 A;  4JPB W;  2LS0 1;  2F0K A;  3GTO B;  5E4X A;  1BBW A;  1A3V A;  4XYO A;  3FKI H;  2LMC B;  1GM5 A;  4A3L G;  4MTK A;  2Q2T A;  2JA5 B;  2O2L D;  3CF5 A;  4O42 A;  1K8A C;  4KD4 A;  1BCP B;  1XWE A;  2R7Z G;  4G57 A;  4JBK A;  5M9O A;  1O7Z A;  1SYE A;  3G6J B;  1GXD C;  1YNJ C;  1Z6H A;  3DEO A;  1ILQ A;  1K3R A;  2WAQ E;  5ELO A;  1VQM A;  5IGB A;  3CRL C;  1HZC A;  3A5U A;  1C48 A;  1DYQ A;  2UUA L;  1A0I A;  4FDB A;  4B3S L;  3AEV A;  1JIC A;  3KUP A;  2L15 A;  2QDL A;  2B2T A;  4DV0 Q;  3ND8 A;  4K6L A;  1YBY A;  3QG1 A;  4B9W A;  4GKK Q;  4X66 Q;  1HR0 W;  4B3M Q;  4HMI A;  3BYT B;  2BDN A;  1W6K A;  2X6G A;  5C4X G;  4OON A;  3RZO H;  3OMG A;  4DNR B;  5DLQ E;  1HQR D;  2D0O A;  5C0X G;  1WOC A;  1SSO A;  1NR2 A;  2EXD A;  3VYU A;  2NN6 H;  4R9W A;  2A6E C;  5LMN Q;  4HN7 A;  2BA0 A;  2RDF A;  4L6T B;  5ELF A;  4X6A H;  3TP5 A;  2MO0 A;  5DAU A;  2NVX B;  1STG A;  4MHE A;  3MA2 B;  3NEL A;  2K04 A;  1PZI D;  3T4A C;  1I3Q H;  1NE3 A;  5FJ8 H;  1YNX A;  2I5M X;  5ELC A;  4QB4 A;  1DCZ A;  3A7L A;  1HTP A;  1XTD A;  3E9I A;  5GAE C;  3M85 A;  2FMM A;  4A3I B;  2UU9 L;  1DOM A;  1SXT A;  2CW0 D;  4FF2 A;  3G71 A;  2MHV A;  1FJG Q;  3I4N G;  4LFA L;  1J8I A;  1W3S A;  2A69 D;  2HUG A;  3RN2 A;  4NMZ A;  2M2L A;  3S14 B;  5M5Y B;  1PTO H;  2EIF A;  2WB1 B;  2EJG C;  1Y1V B;  1V9P A;  1C0A A;  3T53 B;  3RMH A;  4A3F G;  1EY4 A;  3NWT A;  4JBW A;  1FGU A;  4HIO A;  1EQR A;  5A2Q E;  2JA8 H;  3CCE A;  3ZYY X;  2R7D A;  4C3I B;  1X3P A;  2K5W A;  1JOO A;  4GLA C;  3K0Y A;  3NP8 A;  1YIT A;  1A15 A;  3K59 A;  3NXW A;  3V96 A;  4P2C B;  1KNA A;  2I5L X;  2F0W A;  2VB2 X;  5C0X I;  2K5V A;  2A68 C;  4LUV A;  1O80 A;  1FYC A;  2Y0S B;  4DV6 L;  1GUG A;  1I6H H;  1KL9 A;  1H9S B;  1KXL A;  1TWF B;  4R1J A;  4RCN A;  4K0K Q;  1CUK A;  5CBE E;  5JEA J;  1MKH A;  4C3H H;  4DUZ L;  2K14 A;  4DNI A;  3C1F A;  4DR2 Q;  4HIK A;  4WJ3 M;  4A3G G;  1GOZ A;  3TQY A;  5DEH A;  2F1M A;  3HS0 C;  1YHA A;  1HUN A;  1EYD A;  3SK4 A;  4X3T A;  4A3J H;  4H44 C;  2VXW A;  5FK9 C;  1U4R A;  4ME5 A;  3NQI A;  2B2U A;  4HJA A;  4IUV A;  2EYM A;  4CJ1 B;  4DUY L;  4LF6 Q;  1HRJ A;  5C44 B;  3CU7 A;  1JC7 A;  3HOZ B;  4P75 A;  3PO2 G;  4PZ8 A;  1IYJ B;  2JA7 B;  2XSC A;  1PZJ D;  3M7G A;  3T1H Q;  2HDL A;  4X3K A;  5CYU A;  1L0Y B;  2KOL A;  1PFM A;  4GLX A;  1E1T A;  4QQB X;  2R92 B;  2QGQ A;  5HY6 A;  3OIQ A;  1CSP A;  2RDH A;  3CCQ A;  3DWQ A;  2B8G A;  4X3S A;  5JPN C;  3SEB A;  3RZO B;  1D2B A;  4A93 H;  2B63 G;  3S1M H;  4BBS G;  4UP9 A;  3CCL A;  1AZP A;  1KHI A;  4CJ0 B;  3RD4 A;  1EFI D;  4IFD J;  2EYF A;  1RIP A;  5M3F H;  1B2T A;  1FL0 A;  1LT3 D;  3CP0 A;  5FKA C;  4AH6 A;  4NXN Q;  1C8C A;  1V43 A;  3QO2 A;  2UXC Q;  3M3Y B;  3KBX A;  3FPP A;  3J7Y W;  1W6J A;  1B70 B;  4FNF A;  3RR5 A;  3DHQ A;  1LYL A;  4QIW E;  1H9S A;  4LNQ A;  1PTO F;  1VQO A;  1ESR A;  1SAP A;  2UUC Q;  5IIF A;  1QUQ B;  1LTL A;  3DM1 A;  3KYH C;  4NDX A;  4RMF A;  1WI5 A;  1ENA A;  3L0O A;  1B3A A;  1MSH A;  5IE8 A;  3A5Z B;  4DU9 A;  1YJ9 A;  1AP0 A;  1GUN A;  1YHQ A;  1HCZ A;  4A3M H;  1F2L A;  1N34 L;  2FXQ A;  5IP9 H;  5C3W A;  2EZV A;  1BUV T;  3SHL A;  3E6Z X;  4F7X A;  1F9S A;  2KUM A;  1ICF B;  1UE7 A;  3TZD A;  1Q8I A;  4XQJ A;  2Q8T A;  5C4Z A;  2ZM6 L;  5FOB B;  3VA7 A;  3GTG H;  2PZU A;  1NAP A;  3S16 H;  1TWA H;  1MJC A;  4XIG S;  5JPM C;  1H9J A;  2F0V A;  2WB1 E;  3H3V H;  1QOH A;  2RBM A;  1T5X D;  1EWI A;  2KJX A;  5C3E H;  2B2T C;  1BCP D;  2R61 A;  4L5Q A;  1TS4 A;  5C4J B;  2JN4 A;  1HR0 Q;  1CA6 A;  1EU4 A;  2R3Z A;  3VR5 A;  4DR1 Q;  3S2H H;  1MHW C;  1S5D D;  2VUM B;  4IO9 A;  3J81 j;  3ERQ A;  4A3C G;  3PF4 A;  4X64 Q;  1WD0 A;  3FVQ A;  4OXP A;  1I5F A;  1PH4 A;  2V1C C;  3QR8 A;  2F0S A;  1S72 A;  4A3D H;  2A8V A;  5ELN A;  4K8J A;  1K73 C;  5EKL A;  1IKM A;  3TEH B;  3CXC A;  2N49 A;  2Y0S E;  4A3I G;  4IUN A;  3ERS X;  2PCF B;  2UXD Q;  1PFS A;  1SE4 A;  4HCE A;  3EIV A;  2E2H B;  2IHE A;  3HKS A;  3TS0 A;  3CKI B;  4QL5 A;  1K28 A;  2A6H D;  4ZKB B;  3P1H A;  1LTT D;  3P75 A;  4JBM A;  1AW7 A;  5JVH 3;  1ET6 A;  1ROD A;  3M7N A;  3KLS A;  1PH8 A;  1GUO A;  1HA5 A;  2QCP X;  2ZJQ A;  1MSG A;  3HOV H;  4DR6 L;  4DV5 Q;  4K5X A;  4KMU C;  4GOP B;  4A3B B;  5FLX E;  2R93 H;  1S5F D;  5EPL A;  4DV2 L;  3K5O A;  2PZT A;  1EYG A;  3HOW B;  3HOY H;  2C5C A;  4K2K A;  1LTA D;  1PYW D;  4DV4 Q;  3J80 E;  1XYI A;  2WAC A;  4P71 A;  4GKJ Q;  4JI6 L;  3MEH A;  2Z4H A;  1WTQ A;  2OF1 A;  4KN4 C;  3A0J A;  4C2M B;  2XN9 C;  2JE6 I;  5E7N A;  4HIM A;  1UE6 A;  5E3F A;  2EDG A;  2FHT A;  3FKI G;  3VYT A;  4KHV A;  4JI7 Q;  3HOU B;  1BXT A;  1XMO Q;  1KTK A;  4KKU A;  4ME3 A;  1NCV A;  1ZEQ X;  3EBE A;  2A19 A;  1TKW B;  1N32 L;  2FFK B;  4JI3 Q;  2B2W C;  3PUV A;  1LTS D;  2R7Z B;  1EY7 A;  5KGU A;  3S1N B;  1K3B C;  3HOZ G;  1ZYR C;  1EU3 A;  2JA7 G;  1EOT A;  4RH6 A;  1QNU A;  3I4L A;  3C46 A;  1J5E L;  2NZH A;  2VZA A;  3O13 A;  1VMP A;  1PYS B;  1QVC A;  2N8N A;  3I7F A;  3A74 A;  1AE2 A;  1IW7 C;  1S4Z A;  3I2Z A;  4PZ6 A;  4ZAI A;  4DXF A;  1FNV A;  2JA6 H;  4R4T A;  1FJG L;  4RCO A;  2B2Y C;  4GNX B;  5KIX A;  5IWA Q;  1E24 A;  1ONL A;  2NN6 G;  4DFA A;  1NSN S;  2J0T D;  4J6H A;  5H1S E;  1CTM A;  1D5M C;  2PZW A;  2AHO B;  3R8B A;  2OTL A;  2O5I C;  4X65 Q;  1PFN A;  5COR A;  2Q8R E;  1CFM A;  1PH6 A;  4KD3 A;  1UAP A;  1X9N A;  4Y7N B;  3CD6 A;  2TSS A;  4IJL A;  1CK1 A;  4J15 A;  4DK3 C;  2OWO A;  5JEA H;  1Y8O B;  5LL6 S;  3RLN A;  5FJ8 G;  5G3L F;  1ZKO A;  3S2D B;  4HAE A;  3S17 H;  3KLR A;  2KEN A;  4A3E H;  2DJF C;  4LF7 L;  4RKL A;  4L5R C;  2B2V C;  4HJ5 A;  5KNC A;  1Q90 A;  4DAY B;  5AFW A;  1D7Q A;  3I4N B;  2K1B A;  1LT5 D;  1V1P B;  4I7Z C;  2R7F A;  4JCV E;  4MZ9 A;  4LF9 Q;  4DR4 Q;  4K0K L;  4A3K H;  4UDU C;  2BH8 A;  2JA8 G;  1BR9 A;  1SNQ A;  2EYL A;  4DR2 L;  3M9B A;  4IUP A;  5TSS A;  1HA6 A;  3DM3 A;  3KF6 A;  5C3X A;  3TP8 A;  3ER0 A;  5IOC A;  4JV5 Q;  5CGK A;  1X56 A;  4JI5 L;  1M8A A;  4KHZ A;  4BY7 H;  3J7A V;  3N6R A;  2QKI C;  4DK1 A;  2SEB D;  3NBH B;  1TWG B;  1YNN C;  4IFD H;  2MQH A;  2C9O A;  1HUM A;  2NN6 I;  4DR5 L;  1VS0 A;  2P5Z X;  5FLM H;  3NBI A;  4LK1 C;  1J6Q A;  5JJL A;  2K01 A;  2D5D A;  1UNS A;  3SK5 A;  3GTK B;  1VQH A;  4C3H G;  4DV7 Q;  3LNN A;  3EN2 A;  3U4V A;  3JAM E;  3GP7 A;  4RGT A;  2VQE Q;  5EPJ A;  3RLF A;  4A3G B;  2F4V L;  4A3J G;  1IYV A;  1JOK A;  4AIM A;  3Q6S A;  2VUM G;  1EIG A;  3I3C A;  1Z7T A;  3S1R H;  1BNZ A;  4DPG A;  2E8G A;  3W1G A;  3STB C;  1A63 A;  1DON A;  2F0D A;  2XVS A;  1CQF A;  4NXN L;  1KQS A;  3PO2 B;  3I70 A;  1OXT A;  2NVT H;  5KEE A;  2NYZ D;  1V1O A;  4DR7 Q;  2FJ2 A;  5BN4 A;  4A93 G;  2WIN B;  2PQE A;  4DAY A;  1JJ2 A;  5L37 A;  4JI0 Q;  4YWM A;  1VQD A;  5JJZ A;  3NWS A; 
#chains in the Genus database with same CATH homology
 2HQE A;  2B63 B;  3OHX C;  2L11 A;  2OXP A;  3TME A;  2WII B;  3IKJ A;  1JOQ A;  4FF3 A;  3NTH A;  4BA1 I;  1EY9 A;  4CKE A;  1TY0 A;  5D3I B;  2F0E A;  1PTO C;  3EA6 A;  2AWN A;  1LTG D;  2A6E D;  3HG9 A;  2F0Q A;  3LWE A;  4PNY A;  1E2W A;  4ID6 A;  1A2U A;  3GTM B;  1E2Z A;  2F0N A;  2A5H A;  1EZ8 A;  1SJE D;  2KA7 A;  5ELE A;  4E6I A;  4PQX A;  3EFX D;  4CHT B;  5IGD A;  4DA2 A;  1S5B D;  1STE A;  3D6C A;  3TDQ A;  3HEJ A;  3I72 A;  3D31 A;  2HDM A;  2LKV A;  5K36 H;  3A8J E;  3QOJ A;  3S15 B;  1F2Z A;  3CQZ B;  2FIN B;  4J1M A;  2GA4 B;  3TP6 A;  1KDB A;  4N9P A;  1O7Y A;  2JSO A;  3H09 A;  2F3W A;  2IX1 A;  4S3S A;  3NQT A;  1DXM A;  1CHP D;  1Q1E A;  1PRT F;  5JAV A;  2A68 D;  1KAA A;  1I4R A;  4QIW B;  5D14 A;  2F0O A;  1U4P A;  3MXN A;  4ZK9 B;  4U68 A;  2F0I A;  1CHQ D;  5CV7 A;  5EBD A;  3SXH A;  3K58 A;  3GV3 A;  2R6G A;  5KYI A;  5DM6 3;  2CQA A;  1WTO A;  1QJO A;  1DOK A;  5HUR A;  3GTJ B;  2OEO A;  2BE5 C;  2G9H D;  5CR3 A;  2L5T A;  1SFO B;  1CI3 M;  4DNT B;  5KYL A;  1D1I A;  4IUQ A;  4TQU S;  3VR3 A;  4RHR A;  1C4Q A;  3MXG A;  1II3 A;  3EVQ A;  2NVQ B;  1FNW A;  2SDF A;  4EQN A;  1I4P A;  4AYB B;  4ZUJ A;  2EYO A;  4F88 A;  5I9P A;  4LJZ C;  3D3R A;  3X3N A;  5A2Q L;  4IUT A;  1ML0 D;  1EIH A;  4XYQ A;  5IGC A;  3NPP A;  1E2V A;  2L4N A;  5K5P A;  1WTX A;  2B2W A;  4IQZ A;  4EQO A;  1Q1B A;  3FKI B;  3BG3 A;  2KQ3 A;  3V2T A;  3PMF A;  3OSO A;  3R93 A;  3H3V C;  2F0U A;  2PYK A;  3A55 A;  1H9M A;  2XWB B;  2EYH A;  3HGB A;  5ELD A;  2EYJ A;  4CKB A;  3VA5 A;  2B2Y A;  1EEF D;  1MGS A;  5C6A A;  3A8K E;  1EQV A;  4IN3 A;  1VF5 C;  3M4Y A;  4ZLT F;  2ZT9 C;  2EJM A;  1STB A;  4KTA A;  3IL8 A;  4DXG A;  1OXU A;  2E2I B;  2F0F A;  2PW5 A;  3GV6 A;  5JEA G;  4F8M A;  1ICW A;  1WTP A;  3PUZ A;  5HGT A;  1LAB A;  1TR5 A;  2B2V A;  5EKI A;  3TN2 A;  4EQP A;  1I3Q B;  4QUF A;  1OXS C;  5IGG A;  1BOS A;  1VF7 A;  1RTO A;  3SVM A;  3EJI A;  1LT4 D;  2F0M A;  4WFN 3;  3FMC A;  2QF7 A;  4K8I A;  3BDO A;  3MXU A;  1G91 A;  4G7Z C;  3K57 A;  1PTO B;  2ICE C;  5COY A;  3KF8 A;  1VCI A;  1B50 A;  3H6M A;  5EQ0 A;  1K8O A;  2JA8 B;  3MVV A;  5CV9 A;  4ABN A;  4K5V A;  1JWM D;  5BN3 A;  2RVL A;  3OWF A;  1TVX A;  2NTT A;  5CV5 A;  4IFD G;  1QB5 D;  4HED A;  3OIP A;  2H1E A;  4DK0 A;  2HCC A;  1AN8 A;  3PUX A;  3DUZ A;  3MZ5 A;  2IL8 A;  1I6H B;  4Q0F A;  5ISR A;  1RF2 D;  1SBB B;  4YIJ A;  4K6D A;  2ZXO A;  3OOC A;  4C3H B;  2JXM B;  4JK1 C;  5LHY 1;  2AWO A;  4IUU A;  5DM7 3;  1SE2 A;  2K32 A;  4A3J B;  1WTV A;  2KVM A;  4R8I A;  1QCB D;  1KLU D;  3I73 A;  2AQ2 B;  2SNS A;  5E1F A;  3SK8 A;  4MIU A;  3BDL A;  1ZYR D;  3D8G A;  4A93 B;  1SYD A;  3S1M B;  2PW7 A;  4OL7 A;  3CRK C;  3DMU A;  1IW7 D;  2HCI A;  3UI2 A;  1I4Q A;  1PXU A;  5EGT A;  2N55 A;  3NK9 A;  4ZKC B;  1CM9 A;  3I90 A;  4O1N A;  5T1I A;  5M3F B;  2XRQ D;  2ICI A;  3D4R A;  5KNB A;  2F0G A;  1STH A;  4NW2 A;  4XXE A;  4DAV A;  1O78 A;  2FMC A;  4FF1 A;  4QMG A;  1B9M A;  3MTS A;  1LV9 A;  1PDQ A;  1VDZ A;  2DY7 A;  2E75 C;  2RSO A;  1KDC A;  3J81 L;  4G4K A;  2NB0 A;  3NTI A;  5FLX L;  2WP8 J;  5K36 G;  1PRT C;  3C2P A;  2L12 A;  4A3M B;  2EY5 A;  5IT9 L;  1JE4 A;  3NHH A;  2X69 A;  5I4D A;  1Y8N B;  1KNE A;  2M9V A;  1FGB D;  2A73 B;  4C56 C;  1NR4 A;  3GTG B;  4HMJ A;  1SYG A;  3S16 B;  1TWA B;  1YNN D;  4OIJ A;  2KCN A;  4KV6 A;  2O5J C;  5C3E B;  4TRD A;  4QF4 A;  1OO9 B;  1AZQ A;  2ZXR A;  4DGZ A;  3A56 A;  2LY7 A;  2KEC A;  3S2H B;  1I4X A;  1EY8 A;  5T1G A;  3F2U A;  2TMP A;  1JWS D;  4A3D B;  5IGF A;  2A74 C;  1HTL D;  3QJY A;  1GJX A;  2VB3 X;  1PMR A;  5KRU A;  4KK7 A;  5I2Y A;  1SMY C;  3C3L A;  2ZXP A;  2B8F A;  1ILP A;  1SYF A;  5LL6 X;  3AB9 A;  3Q23 A;  4FYD A;  1GHK A;  4XT3 B;  3GQB A;  3BDC A;  3HOV B;  2L0C A;  2WV6 D;  2F0L A;  2R93 B;  2XWJ B;  1I4G A;  1HPC A;  2RDG A;  4PMC A;  5IOD A;  2EVB A;  3HOY B;  4L63 B;  3HKZ B;  3SK6 A;  3TSS A;  1PTO D;  3QIA A;  3TZU A;  3J7A F;  1JB3 A;  1QG7 A;  3VYR A;  1S5E D;  2F4I A;  1WVL A;  1B1Z A;  3NE5 B;  1M4V A;  1SNC A;  3OWE B;  2K7V A;  3MXP A;  1F9R A;  5I2X A;  3K5M A;  3V05 A;  1SNM A;  1I6V C;  3BVG A;  4CKC A;  1RD9 D;  4DAP A;  2MP1 A;  4RKB A;  3L9A X;  3LWU A;  4ZRZ A;  3JAM L;  2F3V A;  2JA6 B;  1XTC D;  4K14 A;  3C1E A;  4XQQ A;  5IGE A;  2J7Z A;  3MWY W;  1BF4 A;  4KKS A;  3I91 A;  2ID0 A;  2X6L A;  1SNP A;  1AEX A;  1XXG A;  2PMZ B;  2D2C C;  1PFB A;  4H7B A;  3PIO 3;  3DXJ C;  2QEJ C;  1EZ6 A;  2EOT A;  3NTK A;  4ZYS A;  5EBC A;  3FDT A;  2SOB A;  1TII D;  3S17 B;  1TS5 A;  2PO4 A;  2IJ0 A;  2G9D A;  1A2T A;  4MN3 A;  4A3E B;  2K03 A;  3GO5 A;  2PNR C;  1EQT A;  3NUC A;  1WD1 A;  1WTR A;  2BE5 D;  2AQ3 B;  2IT1 A;  2DNE A;  4A3K B;  4RFB A;  2NUC A;  2MJ8 A;  5E4W C;  2Z1C A;  5C5M A;  2CHB D;  1LTI D;  2F03 A;  1F9Q A;  5C0X J;  3A54 A;  1S5C D;  5D3D A;  3VR2 A;  4BY7 B;  4HCS A;  3FEW X;  2EY6 A;  1OXX K;  3MHB A;  4HSP A;  2MPM A;  4RGM A;  5CMD A;  3BZD B;  5I6Y A;  1ZXT A;  5CV8 A;  3QOL A;  3W3A A;  3BVZ A;  3ONA B;  1PRT B;  1BO0 A;  1HFG A;  1HQM C;  5C4H A;  1BCP F;  3TP7 A;  4B08 A;  5F2D A;  2LFN A;  4HTH A;  5CV6 A;  1SEB D;  2NWG A;  2XNA C;  3K5N A;  3S1R B;  4C1N K;  4KN7 C;  1SND A;  2AQ1 B;  2E76 C;  5DNF A;  4C3J G;  1PLF A;  5JVG 3;  1G29 1;  1EYC A;  4EVO A;  1F2M A;  2EY2 A;  4ZQ3 A;  4BA2 I;  2J4X A;  2NVT B;  1B53 A;  2MUY A;  4KY5 A;  4B9X A;  3VR4 A;  3BYY B;  1STA A;  1TT2 A;  5G3L D;  2Z4I A;  1TY2 A;  3TBI B;  4OHJ A;  1DJR D;  4XT1 B;  3T16 A;  2KCC A;  2JYO A;  4WRD A;  1UUP A;  4M8A A;  4CJ2 C;  1JR0 D;  5J39 A;  3IFD A;  3CHB D;  3D4D A;  5CV4 A;  2N88 A;  2OT2 A;  2DNC A;  1FD7 D;  1B4O A;  1QIL A;  3A8I E;  2I46 A;  4HSV A;  2Q8I B;  4BBR B;  4OO1 H;  2K5Q A;  1L0X B;  4XTC S;  2IPK D;  1IKL A;  2E2J B;  3T56 B;  4ODG A;  2IX0 A;  2B39 A;  2KHS A;  3P20 A;  3OMC A;  3GTP B;  1X3Q A;  3S1Q B;  1TWH B;  4CBV A;  2L55 A;  3MFG A;  1JWU D;  4XQN A;  1NUC A;  3E5S A;  4QUC A;  2IWH A;  1OXV A;  1HFN A;  3KBG A;  4WJW A;  1IHZ A;  2ENB A;  2EXZ A;  3H94 A;  3SDZ A;  2CVR A;  2K6A A;  3WDN A;  1Z47 A;  4OIK A;  1B44 D;  4ZUI A;  2AUK A;  3Q24 A;  4IAL A;  4HR7 B;  4XDX A;  4NKL A;  4K2L A;  1GUW A;  1I50 B;  2BOS A;  1HHV A;  3I4M B;  1CA5 A;  2DY8 A;  4M1U B;  2CW0 C;  1JQY D;  1V8Q A;  2A69 C;  3ITP A;  3GTL B;  3I8Z A;  5A35 A;  5M3M B;  4BS9 A;  2H4O A;  4PMB A;  3P7J A;  3BVM A;  1LO5 D;  4KI0 A;  1D1K A;  2L1B A;  4DF7 A;  3W2D A;  4RHS A;  4ULL A;  2RA4 A;  1EYA A;  2NVY B;  1RDP D;  2WKC A;  4BY1 B;  1SDF A;  2DN8 A;  1WTW A;  4CGY B;  1MD2 D;  2SNM A;  3QB3 A;  1D5X C;  3PO3 B;  3GD7 A;  3KK7 A;  5M5X B;  3HRZ C;  1LAC A;  4RGN A;  5KND A;  2IX3 A;  3EQL C;  5J22 A;  1H9R A;  4LAA A;  1TQO A;  4FP5 D;  1LLR D;  3Q22 A;  1A6X A;  4KKT A;  2EYP A;  5I6W A;  2I07 B;  3SE0 A;  2K05 A;  3WOF A;  3N52 A;  4KJN A;  2XRS D;  2Z8L A;  4ILW A;  3A7A B;  3NSW A;  4GZY C;  5BN5 A;  1PZK D;  1H9K A;  3AMU A;  1RJT A;  4LMQ D;  1U4M A;  5FO7 B;  4G7O C;  3PUW A;  1U9R A;  1HXY D;  2E74 C;  2EPB A;  2E2D C;  4Q5V A;  4NP5 A;  1PRT D;  2BA1 A;  1TU2 B;  1DD2 A;  4KJO A;  4IZ8 A;  5C0X H;  2XIW A;  2L9H A;  1EEI D;  3FRP B;  4DN4 M;  3Q0A A;  2YU9 B;  1D6E C;  1UEA B;  3L7Z C;  1LTR D;  2AUJ D;  2QDB A;  2RSN A;  4X3U A;  4IFD I;  3H91 A;  4RGO S;  2M00 A;  1KLG D;  1K83 B;  1IYU A;  4FXD A;  3RUZ A;  3DWA A;  1G2T A;  3D4W A;  3SR1 A;  1LT6 D;  4FF4 A;  2K5D A;  3X3M A;  1Y69 U;  4U67 3;  3GTQ B;  4FXG C;  1SJH D;  5I9O A;  1F9P A;  4C3I G;  2EE1 A;  3J81 E;  1Y1W B;  1TWC B;  1X32 A;  2K28 A;  1MBY A;  3K5L A;  1SMY D;  4FO2 A;  5EPK A;  2RQX A;  3PUY A;  3LX0 A;  2EJF C;  2WKD A;  1SYB A;  1BCP C;  4PV1 C;  5IT9 E;  1CT1 D;  1FR3 A;  1CQV A;  3J80 L;  2NZ1 D;  2F0P A;  1A3U A;  3R3O A;  1SYC A;  4UAI A;  3DEP A;  2KED A;  1R9T B;  3PIP 3;  1STY A;  4G7H C;  5EKK A;  1QWY A;  4H0L C;  2D9U A;  3MFY A;  1J9O A;  4I65 A;  4J8Q A;  1WCM B;  2NBF A;  2VNU D;  1EY0 A;  1VMC A;  1SE3 A;  1SNO A;  2B2U C;  1TS2 A;  2KEE A;  1RCV D;  2A6H C;  1B9N A;  1E0B A;  3WOE A;  3VR6 A;  4C3J B;  4PMW A;  5C4X B;  2V4D A;  3BS1 A;  1FNU A;  2JEA I;  1EL0 A;  1GUT A;  4RWS C;  1K8M A;  1EWC A;  5NUC A;  1R4Q B;  1ENC A;  3FPU B;  1XX8 A;  2EY1 A;  2IW3 A;  1T5E A;  2WAQ B;  1G6Z A;  3L3O C;  1MI2 A;  5J1Z A;  3AU7 A;  4RA8 A;  1A3T A;  1GUS A;  1CZW A;  2F0T A;  1KDA A;  3ND9 A;  4KY7 A;  1CZG A;  3T13 A;  4OO1 G;  3ERO A;  4A3F B;  1DM0 B;  2F0J A;  4FVM A;  3HOX B;  1G8Z D;  3HP3 A;  1O7L A;  2JEB I;  5JOB A;  1GHJ A;  1DZ1 A;  1U4L A;  3R2T A;  4EGV A;  3HZX A;  1LTB D;  1Y8P B;  4RAU C;  1RHP A;  3K6O A;  4K5W A;  1ENF A;  2NTS A;  4QCL A;  3D6W A;  2O4X A;  4KY6 A;  5C5L A;  3K7A B;  3U9O A;  5M5W B;  4C1N I;  1KAB A;  5FO8 B;  2JP1 A;  3E0J A;  4FXK C;  2D62 A;  5CC4 A;  1I4H A;  1Q12 A;  4WOR A;  2RKS A;  2PPB C;  4V0B A;  4R8N A;  2MGS A;  3KLS X;  2YYZ A;  1Q3L A;  2QIL A;  3URY A;  3QWN A;  1ESF A;  1QNK A;  3MAQ A;  3T51 B;  3OW7 A;  4OO1 I;  1RTN A;  1IL8 A;  3DWP A;  5EJW A;  1YNJ D;  3H0G B;  3MC0 B;  1TS3 A;  3IAY A;  4OGQ C;  4H13 C;  1EY5 A;  3S9W A;  2BDO A;  4Z9C B;  1V1P A;  4TKO B;  1AFP A;  4BBS B;  1EY6 A;  2F0H A;  1EWH A;  1RKN A;  3M4O B;  1ET9 A;  5D65 A;  1D5Z C;  1QE6 A;  3RZD B;  1DOL A;  4V19 0;  1BDO A;  2BCO A;  4IUR A;  3PV0 A;  3OPO A;  1BQQ T;  3IFT A;  1STN A;  3G7L A;  1G2S A;  3NBH A;  3R2I A;  4BWG B;  4TSS A;  1F2Y A;  1R4P B;  4F87 A;  1JOR A;  4L8J A;  1JCK B;  3VYS A;  1BBX C;  4N9T A;  5CBA E;  2K33 A;  5FO9 B;  1F77 A;  3U9S A;  2LS0 1;  2F0K A;  3GTO B;  5E4X A;  1A3V A;  4XYO A;  2LMC B;  2JA5 B;  2O2L D;  4O42 A;  4KD4 A;  1BCP B;  1XWE A;  4G57 A;  5M9O A;  1O7Z A;  1SYE A;  3G6J B;  1GXD C;  1YNJ C;  1Z6H A;  3DEO A;  1ILQ A;  5IGB A;  3CRL C;  1C48 A;  1DYQ A;  1JIC A;  3KUP A;  2B2T A;  3ND8 A;  4K6L A;  3QG1 A;  4B9W A;  4HMI A;  3BYT B;  2BDN A;  1W6K A;  2X6G A;  3OMG A;  4DNR B;  1HQR D;  5C0X G;  1SSO A;  1NR2 A;  3VYU A;  2NN6 H;  4R9W A;  2A6E C;  4HN7 A;  2BA0 A;  2RDF A;  4L6T B;  5ELF A;  3TP5 A;  5DAU A;  2NVX B;  1STG A;  4MHE A;  3MA2 B;  2K04 A;  1PZI D;  3T4A C;  5ELC A;  4QB4 A;  1DCZ A;  3A7L A;  1HTP A;  3M85 A;  2FMM A;  4A3I B;  1DOM A;  1SXT A;  2CW0 D;  4FF2 A;  2MHV A;  1J8I A;  2A69 D;  2HUG A;  4NMZ A;  2M2L A;  3S14 B;  5M5Y B;  1PTO H;  2WB1 B;  2EJG C;  1Y1V B;  3T53 B;  3RMH A;  1EY4 A;  3NWT A;  4JBW A;  5A2Q E;  3ZYY X;  4C3I B;  1X3P A;  2K5W A;  1JOO A;  3K0Y A;  3NP8 A;  1A15 A;  3K59 A;  3NXW A;  3V96 A;  4P2C B;  1KNA A;  2F0W A;  2VB2 X;  5C0X I;  2A68 C;  1O80 A;  1FYC A;  2Y0S B;  1GUG A;  1H9S B;  1TWF B;  4RCN A;  5CBE E;  5JEA J;  3C1F A;  1GOZ A;  5DEH A;  2F1M A;  3HS0 C;  1HUN A;  1EYD A;  3SK4 A;  4X3T A;  4H44 C;  2VXW A;  5FK9 C;  1U4R A;  4ME5 A;  3NQI A;  2B2U A;  4IUV A;  2EYM A;  4CJ1 B;  1HRJ A;  5C44 B;  3CU7 A;  1JC7 A;  3HOZ B;  2JA7 B;  2XSC A;  1PZJ D;  3M7G A;  2HDL A;  4X3K A;  5CYU A;  1L0Y B;  2KOL A;  1PFM A;  2R92 B;  3OIQ A;  2RDH A;  3DWQ A;  2B8G A;  4X3S A;  5JPN C;  3SEB A;  3RZO B;  1D2B A;  1AZP A;  4CJ0 B;  3RD4 A;  1EFI D;  4IFD J;  2EYF A;  1B2T A;  1LT3 D;  5FKA C;  1C8C A;  1V43 A;  3QO2 A;  3M3Y B;  3KBX A;  3FPP A;  3J7Y W;  1W6J A;  4FNF A;  3DHQ A;  1H9S A;  1PTO F;  1ESR A;  1SAP A;  5IIF A;  3DM1 A;  4NDX A;  1ENA A;  1B3A A;  1MSH A;  4DU9 A;  1AP0 A;  1GUN A;  1HCZ A;  1F2L A;  5C3W A;  2EZV A;  1BUV T;  3SHL A;  3E6Z X;  4F7X A;  1F9S A;  2KUM A;  3TZD A;  1Q8I A;  4XQJ A;  2Q8T A;  5C4Z A;  5FOB B;  3VA7 A;  2PZU A;  1NAP A;  4XIG S;  5JPM C;  1H9J A;  2F0V A;  1QOH A;  2RBM A;  1T5X D;  2KJX A;  2B2T C;  1BCP D;  2R61 A;  1TS4 A;  5C4J B;  1CA6 A;  1EU4 A;  2R3Z A;  3VR5 A;  1S5D D;  2VUM B;  3ERQ A;  1WD0 A;  3FVQ A;  2F0S A;  4K8J A;  5EKL A;  1IKM A;  4IUN A;  2PCF B;  1SE4 A;  4HCE A;  2E2H B;  3CKI B;  2A6H D;  4ZKB B;  3P1H A;  1LTT D;  3P75 A;  1AW7 A;  5JVH 3;  1ET6 A;  1ROD A;  3M7N A;  3KLS A;  1GUO A;  1HA5 A;  2QCP X;  1MSG A;  4A3B B;  4K5X A;  4KMU C;  5FLX E;  1S5F D;  5EPL A;  3K5O A;  2PZT A;  3HOW B;  2C5C A;  4K2K A;  1LTA D;  1PYW D;  3J80 E;  1XYI A;  2WAC A;  3MEH A;  2Z4H A;  1WTQ A;  2OF1 A;  4KN4 C;  4C2M B;  2XN9 C;  2JE6 I;  5E3F A;  2EDG A;  2FHT A;  3VYT A;  4KHV A;  3HOU B;  1BXT A;  1KTK A;  4KKU A;  1NCV A;  1ZEQ X;  1TKW B;  2FFK B;  2B2W C;  3PUV A;  1LTS D;  2R7Z B;  1EY7 A;  5KGU A;  3S1N B;  1ZYR C;  1EU3 A;  1EOT A;  4RH6 A;  1QNU A;  3I4L A;  3C46 A;  1VMP A;  3O13 A;  1IW7 C;  1S4Z A;  4ZAI A;  4DXF A;  1FNV A;  4RCO A;  2B2Y C;  5KIX A;  1ONL A;  2NN6 G;  4DFA A;  1NSN S;  2J0T D;  4J6H A;  1CTM A;  1D5M C;  2PZW A;  3R8B A;  2O5I C;  1PFN A;  5COR A;  2Q8R E;  1CFM A;  4KD3 A;  1UAP A;  4Y7N B;  2TSS A;  1CK1 A;  5JEA H;  1Y8O B;  5LL6 S;  5G3L F;  1ZKO A;  3S2D B;  4HAE A;  3KLR A;  4RKL A;  2B2V C;  5KNC A;  1Q90 A;  5AFW A;  3I4N B;  2K1B A;  1LT5 D;  1V1P B;  4I7Z C;  4UDU C;  1BR9 A;  1SNQ A;  2EYL A;  4IUP A;  5TSS A;  1HA6 A;  5C3X A;  3TP8 A;  5IOC A;  5CGK A;  1M8A A;  4KHZ A;  3J7A V;  3N6R A;  2QKI C;  4DK1 A;  2SEB D;  1TWG B;  1YNN C;  4IFD H;  2C9O A;  1HUM A;  2NN6 I;  3NBI A;  4LK1 C;  2K01 A;  2D5D A;  1UNS A;  3SK5 A;  3GTK B;  4C3H G;  3LNN A;  3JAM E;  3GP7 A;  4RGT A;  5EPJ A;  3RLF A;  4A3G B;  1IYV A;  1JOK A;  3Q6S A;  1EIG A;  3I3C A;  1Z7T A;  1BNZ A;  1DON A;  2F0D A;  2XVS A;  1CQF A;  3PO2 B;  3I70 A;  1OXT A;  5KEE A;  2NYZ D;  1V1O A;  2FJ2 A;  5BN4 A;  2WIN B;  2PQE A;  4DAY A;  5ELB A;  5JJZ A;  3NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...