1JE8A

Two-component response regulator narl/dna complex: dna bending found in a high affinity site
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization allows DNA target site recognition by the NarL response regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*AP*TP*TP*AP*AP*TP*GP*GP*GP*TP*AP*
total genus 21
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1je8A00
1GHCA 1V3FA 2Q8KA 3VFZA 1XD7A 2KIFA 1QPMA 4I98B 3C7JA 4GO1A 1ZH5A 1IRGA 1G4DA 3R4KA 1OYYA 3AAFA 1YW9A 2YSRA 1WKMA 1KGSA 2GA1A 2CG4A 3IWZA 4M6XA 3PFIA 3ZMUA 2FF4A 3DPTA 5FLXZ 1HQCA 4EMSA 5HS9A 1IXRC 4EJWA 2ZO4A 4GCVA 1STZA 4D0PA 4HF2A 3GXOA 3BJOA 1LJ9A 4LLLA 1KYZA 2ELHA 4ZYEA 2D1HA 4LG0B 2EFOA 2QYOA 4CZZA 3HSRA 4CHUA 4Q4ZF 1DPRA 1ZRCA 1GXPA 5E1WA 2CGPA 2Y48A 5CLSA 3WTWC 1L0OC 3L7WA 2ZMEA 1FBUA 5DD8A 1HKTA 2ESHA 2G7UA 4LB6B 5DCMA 1BIAA 2FXAA 1G3YA 4BHCA 2FA5A 4WCGA 3TO6A 4U7BA 1ZARA 5D5UB 3ECOA 4O6JA 1R7JA 1G6NA 2COMA 1S3JA 5KK1A 3WE2A 1RNLA 5E8GA 4OMZA 4M9SA 4N9IA 3OOPA 2M5WA 3H92A 2V9VA 4NB5A 3F3XA 1OYIA 4GGGA 2M45A 1J75A 5LHHA 1TW3A 3WGGA 1PDNC 1IF1A 2EV6A 3WG9A 1USSA 3RYRA 5F1RA 5HS7A 2R7FA 2EK5A 2V1DA 2Z3YA 1XSVA 2P4WA 3IHUA 3T0YA 3TOBA 2HR3A 4I0BA 3T1BA 3CUQA 3E5XA 1O7FA 3G3ZA 3SFZA 3EUHA 1HW1A 2QZ8A 4M74A 1R00A 2Q0OA 2XAJA 2GXBA 2YPRA 3T8RA 2BEOA 2QBYA 2XRNA 4YIIA 1FNNA 4TV7A 3V8JA 2PMHA 1UHWA 4MQVA 5K1YA 2KJCA 4IF4A 5FFXA 2VBYA 3U1DA 1LDJA 1P4XA 1JXSA 3KETA 1ZRDA 2L01A 4BAYA 3J7AO 4BHBA 1P6RA 2OBPA 4QLCU 4EVIA 4RGSA 3CDHA 4EV0A 1XSXA 4PZJA 2MH2A 1LDKB 4HX7A 4U0WA 5JI6A 3P7NA 2XHKA 3I59B 1F1ZA 2UXNA 4IRHA 3WTZA 1XGOA 3BPXA 3SZTA 2GAUA 2QM3A 2K7LA 3BROA 2M8EA 2QQAA 2VBWA 4K2EA 5IT9K 2E7WA 5ICFA 3VODA 1ZHFA 4WXHA 1G3TA 2A3SA 5LEJA 4HX4A 3U9GA 4FT8A 2E7XA 3GW2A 4BQAA 4HQEA 3NEUA 5JVTA 1A04A 2K4JA 4ON0A 3GYHX 4BHPA 2IRFG 1ZG1A 5J8FA 4RB1A 4I0AA 2XUBA 4LLGF 2FSWA 3HUGA 1KU2A 5FD5A 2OZUA 1LEAA 3LA2A 2ACJA 1E2XA 3FWEA 2A61A 4JBAA 1XDUA 3IWFA 1SAXA 4PGGA 5ILVA 2J5OA 4L18B 2FBKA 3IRQA 2FU4A 4RGUA 4HQMA 3NRVA 4DQ2A 3ISPA 3MZYA 4ENMA 5CVRA 2HS5A 3FMQA 3S2WA 5L3GA 3C1DA 2PI0A 3TOAA 5K5OA 1YG2A 3GWZA 1U5TC 4M73A 2A6HF 1YS7A 3ERED 3JSOA 4HX8A 2IPQX 2QENA 4BH9A 1D5VA 4I7HA 1LEBA 2STWA 4I2OA 2NNNA 5ERIA 1W4MA 2RQPA 5CVJA 1DPUA 3GFIA 1O3QA 3CUOA 3WTXC 5JFRA 2LF7A 3RPQA 4ZH4F 3GF2A 1KQ8A 2BE5F 3BZ6A 4RB2C 1FP1D 3RI4A 3JAMZ 2AS5F 1FC3A 1OKRA 1JHHA 5DV5A 1B4AA 4A6DA 4WWCA 3E6MA 3BY6A 2Z9OA 2XASA 4IHTA 1KYWA 2H94A 4LK1F 3QP6A 4XSZF 4HZFA 2NAZA 5L3FA 2VN2A 5L3DA 4A12A 4H0EA 4GXOA 2QWWA 6PAXA 1OYWA 3HRMA 1R5HA 4Y15A 1KU7A 3COAC 2ZFWA 1R58A 1PUEE 2PQ8A 2EV5A 1ONVA 4M6YA 1F9NA 4UHTA 1IN7A 4UV9A 4HOBA 3J80Z 4RS8A 1T0FA 4WK8F 2IP2A 1H9TA 4IRIA 4UNOA 1SFXA 4IPAA 4KA4A 5FO5A 3LA7A 4LJZF 2IA0A 3K1NA 3L2CA 1QQIA 2ESNA 4NQWA 2A5YB 5IT3A 4ESJA 4G94A 3ULQB 5DYMA 4HW0A 1KU3A 4I01A 4AVPA 2F5CA 2VONA 5DUKA 2DQLA 1KQ9A 1DUXC 2Z5UA 1JHFA 2YX7A 3JW4A 2HEOA 2EB7A 3QOPA 4PGHA 3EQLF 1LB2A 2EJRA 1P2FA 4BYYA 3J81K 2QLZA 3GUDA 5TJJA 2LF8A 4CO8A 1CGPA 3M8FA 1G3WA 2HKXA 3HHHA 2HOEA 3MZHA 3EETA 4R8HA 5HDNA 1W7PA 3KP4A 3L09A 3I58A 4CYDA 2PJPA 2R3SA 3U2RA 2HTSA 2P5KA 4OMYA 1R23A 2H09A 5E17F 1F4KA 1TTYA 3HYIA 1BIBA 3IL2A 3D0SA 1IN8A 3QRFF 3P9KA 2OD5A 4U0VA 4MTEA 1BC7C 4OOIA 4AWXB 1SD6A 4KN7X 5F64A 4L9VA 2M30A 5LGTA 1MZBA 4L9NA 3ZMZA 3KEOA 2D1VA 3F6OA 4MHGA 2J5PA 2DTRA 1KA8A 4LD5A 4EJTA 1YS6A 2CO5A 4S04A 4AIHA 3KLOA 2L02A 1SD7A 4RGXA 3F72A 1K6OA 3LA3A 1BI1A 2FNAA 3WTTC 1W5TA 2ZMEB 1IN5A 4CXFA 4HAMA 3HSFA 1ZGJA 3WGHA 4L5JA 2JPCA 3WU1B 3RYPA 1FT9A 4MEXF 1WSUA 3MFKA 2O8XA 1BOAA 4L9JA 1BI2A 3ELKA 3KEQA 5BPDA 2DU9A 2XGXA 2ZNZA 2D2WA 5AONA 2XV4S 4BXUA 5K5QA 3RJPA 5HVQC 5D6FA 3N4MA 4JK1X 3DP7A 1BI0A 1RZ4A 1SMYF 2DK5A 3MQ0A 3VEPA 2DK8A 1I6XA 1I1GA 3W6JB 5FGMA 5DCFA 1UB9A 1XCBA 2PMUA 2OQGA 2HTJA 3KZYA 1REPC 2UWMA 2WC2A 4YIFA 3FX3A 2UXXA 1S8NA 2OAZA 1U5TB 1DDNA 4Q47A 4HLYA 4RGRA 1ZLKA 2GQQA 4KIGA 3M7GA 4HDVA 5FFZA 2FEZA 1S6LA 1TW2A 3KE2A 2FOKA 2A6EF 5D4SA 2MLKA 4YFXF 2DBBA 3O3KA 2R7DA 5K5RA 2XAGA 3F21A 2ZKZA 4G7ZF 1MJ9A 1FP2A 1ZAOA 5D6EA 4Y17A 1FSHA 2MA3A 2IW5A 2D45A 2AXLA 3CTAA 1ZG3A 2IA1A 1X3UA 5D8LB 1RUNA 1SD5A 3G73A 4L0ZB 3GFMA 5BPIA 3ABTA 5DD4A 2QBYB 1Z9CA 2EFWA 4I02A 3FF5A 1XMKA 2ADUA 3CLOA 3RKWA 4A5MA 2HDCA 1HXDA 1HW5A 2C6YA 4EQQA 2P6SA 4G7OF 1UHMA 4MQ9F 1P4AA 5LRSA 1XB4A 2QVOA 3R0AA 2VE8A 1R22A 4HV5A 2OQRA 3HRSA 2G9WA 1IRFA 2ZNYA 3LQQA 1MJAA 3P9IA 1XMAA 1FBQA 1XGNA 3JAMK 1ZRFA 2ZJ2A 4A0XA 4ZZDA 4XLNF 3DKWA 2FE3A 5E20A 1G3SA 3SXYA 4EGYA 3EYIA 2UZKA 4WXCA 4O3MA 2DFIA 1TBXA 2ZCWA 2MLGA 1YLFA 3V8KA 4LFUA 4LGWA 5D5VB 3R61A 1U78A 4XSXF 5ED4A 4HF1A 1LVAA 3K9TA 5LLQA 2X0LA 4HDUA 1OR7A 1WRJA 1XSDA 1F5TA 2WWYA 2EWNA 1T6SA 4KMUX 4JQFA 1BI3A 1SD4A 4Q48A 1J7KA 2YR2A 5LBQA 3BOQA 2G7HA 5E8IA 3WTVC 3H3ZA 3F8FA 3HRUA 4KNYA 4L5IA 1QGPA 3HTUA 4KIFA 5F6FA 1Z1DA 5DUIA 4CDGA 4WF2A 3ECHA 1OMIA 4IRGA 1U6GA 1Y0UA 2K4BA 3M9AA 3Q9VA 3TGNA 3CO7C 2JRTA 3WGIA 2F2EA 4KICA 3GEZA 2RV8A 4AIKA 1IXSB 2HWVA 5BQTA 1MD0A 5ILSA 3BP8A 4M9ZA 1K79A 4QWQA 3IRRA 2VE9A 1ZGAA 1ON1A 4ZYHA 4HBLA 3ZN1A 3L9FA 4KT5C 4UVAA 3RPUA 1C0WA 4HF0A 4PCQA 1O3RA 3MEXA 4ZYGA 3LAPA 2O03A 3QP5A 2QQBA 3FXQA 3V7SA 4XLPF 1ZG5A 1XGMA 2JTVA 2EA2A 4F7ZA 5DDGA 2RC4A 2GA2A 2VC0A 2FBHA 4ENNA 3HHGA 3I4PA 2KIUA 1BM9A 2V6CA 1UCRA 3REOA 4RAYA 5HLIA 4ENKA 5HDKA 1FYKA 4GYIA 3V8LA 2BV6A 3DV8A 3WTYC 4KMFA 2RN7A 2ISYA 3FM5A 5D5WB 3V4GA 3EDPA 4G6DA 1HSTA 5E1XA 4G6QA 2L4AA 4ZYDA 2YX4A 5JHUA 2LDUA 1EV7A 2MH9A 2L3DA 1GVJA 2DPUA 4UVBA 4R79A 3VB2A 2DW4A 5IT9Z 1E17A 1JGSA 4MGRA 4N0BA 1KU9A 3K1PA 3TO9A 4FX4A 4IJAA 3HTSB 4RAZA 4FX0A 4KIBA 1AWCA 5DCMB 1B6AA 2K27A 1B1BA 2P7CB 1S29A 2IJLA 4A2UA 1QZYA 2BGCA 2TDXA 3M1EA 1K7AA 1YW8A 2JSCA 4HV6A 1FLIA 3HIFA 2RDPA 3LQRA 4BNCA 5TRDA 4M9XA 1R36A 3DEUA 3I71A 3E6DA 2DO7A 2XKOA 5D8KB 1TQMA 1MGTA 5FB2A 3F22A 1O57A 3ROUA 2OU2A 2A07F 3QPHA 1WQ2A 3ZMSA 5J6XA 4OIRF 3RDIA 1TNTA 3LWFA 2DAOA 2V1UA 4M71A 2WTEA 4XBFA 4CGZA 2XVCA 1Z05A 2BBYA 1B9NA 4M72A 5D5XB 1PP8F 3F8BA 2GZWA 1W5SA 5JR3A 5H6RA 4L0YB 3MAJA 2LNBA 1YFHA 4S05A 4IXAA 4O5VA 1I27A 2CYYA 4L9TA 3ZQ7A 3WU0A 2DQRA 2KKOA 1QNTA 3F8MA 3FMSA 2H6CA 3Q5FA 1Z6TA 5HLGA 2VBZA 5BMZA 3FM3A 1T98A 1MDMB 2E1CA 1IW7F 2VC1A 3LFKA 1BJAA 3I0TA 3I5UA 1DP7P 4EM2A 3IC7A 3F8CA 5LEKA 1Z6RA 1O3TA 4P5OA 4Z2YA 1LNWA 1D8JA 3R6SA 5HOOA 3GO5A 1H0MA 3KFWX 2M1BA 4MNUA 4A5NA 1T2KA 1WI9A 2CW0F 5HDGA 1WWXA 2OZ6A 4EM1A 2Q2EA 4LK0F 1YYVA 2HYFA 3DXJF 3TO7A 1P4WA 1AOYA 1FX7A 1OPCA 1RI7A 3I54A 4KDPA 1D3YA 1Z91A 3GFLA 3SZPA 1XN7A 1GXQA 2YU3A 5FD6A 1J0RA 2P8TA 2HQNA 1ON2A 3GFJA 4LLNA 4KN4X 3BDDA 1YW7A 2MC3A 2H6BA 4LG0A 3B02A 5H6QA 3R60A 2P6TA 3DQVC 1HKQA 3RKXA 1CF7B 1QZZA 2VXZA 1EH8A 2EFNA 2Y75A 3O6BB 1K78A 3DFGA 2O61A 1T39A 5LRRA 1YIOA 5EEHA 5CJ9A 2A69F 3MWMA 1HBXG 4XRFA 3FXUA 2DI3A 3V7RA 1FYLA 3OV8A 2V1XA 2B0LA 3I53A 5CVUA 4UUVA 1BBYA 1T38A 1B9MA 1CF7A 3ZPLA 5A2QZ 3E5QA 4DNCA 2QUFA 2DPDA 3KP3A 3W6KB 1XGSA 2L4MA 1S7AA 3FMRA 2O3FA 2V79A 3KP5A 1FY7A 3P9CA 4ESFA 3F8NA 2IA2A 5EEGA 2XAHA 4EM0B 2LSOA 4P9UA 1YTYA 4I09A 4EJUA 4AD9A 3CUQC 1XCVA 4U88A 1EH6A 2P7VB 4EJOA 2RGVA 2MBFA 1QO0D 4OU0A 2O6GE 1HW2A 3QU3A 2XROA 4CICA 3GX4X 4YFNF 3F6VA 2PFBA 1LDDA 2HKOA 5L3EA 3O2PE 3BWGA 1TQIA 5E1ZB 5E18F 4EJVA 3IKVA 2MD5A 2Y0MA 3KP2A 4OIOF 2KIMA 1I1SA 1U8RA 3NQOA 4UV8A 2WV0A 3ZMVA 1SMTA 3ZMDA 4AIJA 4FHTA 2F5DA 3LSTA 4R1HA 1U3EM 5D4RA 1J5YA 3HOTA 2FNPA 4UVCA 1J2XA 2L54A 4OIQF 3V7CA 3DPLC 2IT0A 5DEQA 1MDMA 1QBJA 4GYGA 3I59A 1BN5A 1ODDA 4G8XA 2A68F 2JZYA 3FXRA 1J59A 3CO6C 1LQ1A 3JTGA 1RUOA 3QPTA 3WTUC 4ZZLA 2Z99A 2W25A 1JE8A 2CSOA 2NYXA 3T8TA 3E5UA 1R1TA 1HKSA 5L3CA 5LHGA 3C3WA 3J81Z 2VT2A 3FHZA 2K02A 1YO5C 4OINF 5J8CA 4YFKF 1R1VA 2VT3A 3GZ6A 2LKPA 2JPBA 5A2QK 1IUYA 4RB3C 3BJ6A 5LGNA 5AIQA 2PLYA 2FMYA 2EV0A 3QU6A 3RTRA 1ZREA 2XAQA 2VBXA 5L3BA 3K1MA 1R5GA 2W85A 3BJAA 1ZLJA 1UFMA 2XKPA 2CWEA 1TNSA 1W7PD 4E70A 3F23A 3PQKA 4HA8A 1V4RA 3SQNA 2RKHA 2NRAC 3LAJA 2VOPA 1S7OA 3ZP5A 5H20A 4HYEA 2FMLA 1TLHB 4WXDA 1FPQA 4YG2F 1B59A 5ILUA 3WTSC 4UXNA 2P5LC 1P92A 2NNYA 3Q9SA 3C18A 3T5XA 2W84A 2HQRA 1ZYRF 1ZN2A 2KRFA 2XIGA 2Z33A 4IHSA 3ABUA 4LB5A 2ZBKA 1FOKA 2HYGD 2EA4A 4ESBA 2X4HA 5ICEA 1YQAA 1KQ0A 4U7DA 4MEYF 3B73A 3E6BA 1FYMA 1BC8C 4P9FA 1FWZA 3RKYA 3L00A 4P96A 1D8KA 3QAHA 1Z7UA 1FSEA 3SHFA 5FLXK 3H3UA 4EGZA 4PDKA 3K2ZA 2P5VA 1NHAA 2PN6A 1W7PB 5HLHA 2M87A 4B09A 2VODA 5KVRA 3JSPA 2FQ3A 3RIRA 2EFQA 2NS0A 3HOSA 5LHIA 4LMYA 2DT5A 1J9IA 3HSEA 2QQ9A 4G9YA 3TDZC 3DF8A 4IVNA 3GLXA 5CVIA 4WX9A 2XAFA 3HRTA 1IN6A 3KP7A 5CYVA 2RVCA 3MCZA 2GIVA 4Q5SF 2F5FA 5CVVA 4ENJA 4A0YA 1K78B 1IZ1A 2E1NA 2PG4A 4B8XA 2BYVE 2EFPA 1EH7A 1H9GA 2JT1A 2K86A 3K0LA 4KUMA 3IKTA 1RIOH 4KFCA 1O7LA 4ETSA 2F5EA 2W24A 2KJBA 1L3LA 3KCCA 1Q1HA 3JTHA 3KP6A 2VOOA 2GWRA 4HLXA 3GZ5A 1USTA 4A6EA 1R1UA 3N97A 1VTNC 4N9HA 3I64A 2DLLA 2ZXJA 3CUQB 4OIPF 2ETHA 2STTA 2FRHA 2W57A 3EYYA 3M8EA 3GVAA 4KYWA 3FZVA 2HGCA 2RNJA 1I5ZA 3WE3A 3E97A 3WODF 1TQPA 2O0YA 3E6CC 3PQJA 5BS6A 3BPVA 1IN4A 2FBIA 4A0ZA 1ULYA 1FZPB 3J80K 2PEXA 3VOEA 1U5TA 4P55A 3ZN0A 3E3VA 2GXGA 1PP7U 4U0YA 5ICGA 3CJNA 4Y13A 4G7HF 2PBIA 2CQKA 3TDUC 3R0JA 5LGUA 2IVMA 2HZTA 2HFHA 1MJBA 1SFEA 5HS8A 1U2WA 4ASNA 4MTDA 3ML6A 1FBSA 1MKMA 3KLNA 1IAWA 1SFUA 2ISZA 3ZMTA 5AIPA 3TKYA 4RB0A 5ICCA 3TQNA 2CFXA 3D5LA 3K69A 2OA4A 3KZZA 5BOXA 4NHJA 1IXCA 2H27A 1XDSA 1O3SA 1HSJA
chains in the Genus database with same CATH superfamily
1BOBA 3H9GA 1GHCA 1V3FA 3SFIA 2Q8KA 2RAEA 3VFZA 1XD7A 2KIFA 3L2UA 1EA3A 1QPMA 2K9QA 4I98B 4BEHA 2GOMA 2ZSIB 3C7JA 4GO1A 1QPIA 1ZH5A 1IRGA 1G4DA 2MGQA 2WAFA 1H88C 2VKHA 3CC4I 3CP8A 3M4OJ 3R4KA 3ONQA 5LFAA 1OYYA 4F92B 3AAFA 2X1EA 1SVLA 1YW9A 2YSRA 1WKMA 2QGUA 1B72A 1KGSA 1YHQI 2GA1A 2CG4A 3GLLA 3IWZA 2FD5A 4M6XA 3PFIA 5B3SH 2ZJPF 1OCTC 3HEFA 3ZMUA 2FF4A 3I56I 3DPTA 4HNVA 5FLXZ 1HQCA 2E36A 3M07A 4EMSA 2XPUA 3PM1A 5HS9A 2LVSA 1IXRC 4EJWA 2NOGA 1TT5B 2ZO4A 2HVRA 4GCVA 2BOLA 3OSGA 1STZA 1V5EA 2WY8Q 4D0PA 3OYJA 1D0YA 4HF2A 3GXOA 2BHYA 3BJOA 1LJ9A 4LLLA 1KYZA 1R9TJ 4IZZA 4XLCA 2ELHA 4ZYEA 1JUSA 3LL7A 2D1HA 2JVGA 2OV7A 4LG0B 2EFOA 3IAS2 2QYOA 4E4HA 4CZZA 3HSRA 4CHUA 3HXLA 4Q4ZF 1DPRA 1ZRCA 1GXPA 5E1WA 2CGPA 1EKEA 3S1QJ 1RRJA 1ETYA 2HZDA 2Y48A 2LYCA 3CLQA 1TWGJ 5CLSA 3WTWC 1L0OC 3L7WA 3I4MJ 2VJIA 2ZMEA 5J3LA 5GPAA 1FBUA 2ZC2A 5DD8A 2X6OA 2IGMA 2IAIA 1HKTA 2ESHA 3MMYB 1DU6A 2G7UA 5F0CA 1XS9A 5DM6F 4LB6B 1RESA 4BXXJ 4II3A 5DCMA 2QEXI 1BIAA 3S1MJ 2FXAA 1G3YA 1PUFB 3VPRA 4D5CA 4BHCA 2FA5A 1FMVA 1MW7A 4CCJA 4WCGA 3TO6A 3PO2J 4U7BA 3FKIJ 5M5WJ 1ZARA 1HDPA 2FX0A 2XGCA 2EIKH 5D5UB 3ECOA 1T08B 3W2AA 4O6JA 5B1BH 1R7JA 2AQEA 1G6NA 2COMA 1S3JA 5KK1A 3S8PA 3WE2A 5IOZA 1FIPA 1RNLA 3S14J 4IOAF 2WY7Q 1VQKI 5E8GA 1Z3XA 4OMZA 2FQ4A 2K3PA 3J7YJ 4M9SA 2DDAA 4N9IA 3RPUD 2MD0A 3OYCA 3OOPA 2M5WA 1RR8C 4BXFA 4CH7A 3H92A 2V9VA 4NB5A 3F3XA 1RKWA 2Q1ZB 3E1SA 2Z16A 1Y39A 1OYIA 1IV6A 3CJTB 4ZTJA 4GGGA 3BG5A 2M45A 1VQNI 1J75A 3KX2A 5LHHA 1TW3A 3WGGA 1PDNC 5GTHC 2EV6A 3WG9A 1USSA 3RYRA 5F1RA 2R0QC 4CSWA 5HS7A 1ZKGA 2R7FA 2EBIA 2EK5A 2V1DA 2Z3YA 1VZ0A 4XICA 1XSVA 2P4WA 2FOWA 3IHUA 3T0YA 1BA5A 3TOBA 2HR3A 4ZDLA 3FXLA 4HSRA 5EEAA 1W1WE 4I0BA 3T1BA 3CUQA 3E5XA 5JHFA 1O7FA 2LK2A 3G3ZA 3FBIB 1TWCJ 3IH2A 3SFZA 2LD5A 3EUHA 2ECBA 1MSEC 4GDFA 1HW1A 4PK4A 2QZ8A 2VUMJ 4X6AJ 4M74A 1R00A 5H2FC 1TL8A 3ZQLA 1D0XA 1QA6A 4LIVA 2Q0OA 2XAJA 2GXBA 4C3HJ 2YPRA 3T8RA 2BEOA 2QBYA 3OL3A 2XRNA 1TC3C 2L2OA 4YIIA 3UNGC 3H5NA 1FNNA 4TV7A 4BE1A 3V8JA 2PMHA 1WJEA 1UHWA 3GCMA 3HGGA 4HSTA 4MQVA 2HPMA 5K1YA 2KJCA 4IF4A 5FFXA 3OMYA 2YS9A 4BY7J 2VQLA 2VBYA 3U1DA 1LDJA 4MFDA 1P4XA 3HM5A 1JXSA 3QYBA 4QTRA 3KETA 2K5CA 3M1CA 4AIDA 3H9JA 3G2BA 1ZRDA 2DJIA 3I9V2 3FDYA 1NG6A 2L01A 4BAYA 3J7AO 4BHBA 3CCSI 4KJZA 4IEJA 1P6RA 4NNJA 4E7ZA 2OBPA 1ZGWA 3UKGA 3H5AA 3MVPA 4QLCU 3F0CA 4EVIA 2DA2A 5IP6A 4GFBA 2FJ1A 3AG4H 4RGSA 3CDHA 1B8IA 2R7XA 3CC2I 4XOTA 4EV0A 1XSXA 2L5QA 4PZJA 2MH2A 1LDKB 4OAZA 1IF1A 4HX7A 4U0WA 5JI6A 5TISC 3P7NA 2CQQA 3HKZN 3HOYJ 2XHKA 2F4MB 3I59B 1F1ZA 2UXNA 4IRHA 3WTZA 1XGOA 2CUJA 3BPXA 3SZTA 4M3GA 1QVUA 1MIJA 2GAUA 2QM3A 2K7LA 4YELA 3BROA 2Q2EB 2M8EA 2QQAA 2VBWA 3A02A 4K2EA 5IT9K 2E7WA 3A1YA 5ICFA 4D7MA 4JOMA 3OYKA 1V5GA 2ELJA 1D1BA 3GBGA 3VODA 1ZHFA 1BL0A 2AXTC 3LSRA 1NH3A 4WXHA 1G3TA 3D5SC 2A3SA 4I99C 5LEJA 1I39A 4HX4A 3U9GA 3G6EI 4A93J 1ETKA 4FT8A 2E7XA 1W36D 5F04A 3GW2A 1A36A 4BQAA 2HXOA 4ZJZA 4HQEA 2F5VA 3NEUA 5JVTA 2JA7J 1A04A 2K4JA 4ON0A 3DU5A 1N78A 2ZXHA 3GYHX 4RA2A 4BHPA 2IRFG 2CFOA 2L7KA 3MKWB 1ZG1A 5J8FA 4RB1A 1AKHA 4I0AA 2XUBA 4LLGF 5J1RA 2FSWA 3OS0A 2JA5J 3HUGA 1KU2A 5FD5A 1S72I 2OZUA 3VYTB 2HQAA 3CCQI 1LEAA 2KIQA 3LA2A 3GTMJ 2DODA 2ACJA 3CMYA 2BY3A 3ZQFA 1E2XA 1R4MB 3FWEA 3NAUA 2A61A 4JBAA 1XDUA 3ZQQA 1SANA 3IWFA 3FXJA 5FKKA 1SAXA 2CV0A 3GTOJ 4PGGA 5ILVA 3RZOJ 3ZRGA 2VQGA 5HNFA 2J5OA 4B1RA 4L18B 2FBKA 3IRQA 2DOAA 2FU4A 2NVYJ 4RGUA 4HQMA 3NRVA 4DQ2A 3S2DJ 2VQHA 3ISPA 3MZYA 2V9PA 4ENMA 3CCJI 5CVRA 2E60A 2HS5A 3FMQA 3S2WA 5L3GA 1E3OC 1S5LC 3C1DA 2PI0A 3TOAA 4HEA2 4CCMA 1YG2A 3GWZA 3LMMA 3TW7A 5K5OA 3JRGA 3ZOBA 2DMQA 1U5TC 3CQZJ 4UB6C 4M73A 2A6HF 4IHYA 1YS7A 3OYEA 3OYLA 1ZELA 3ERED 4J01A 3JSOA 4HX8A 2IPQX 2QENA 4BH9A 1U9OA 4A69C 1D5VA 4I7HA 4DIQA 3CCVI 1LEBA 2CUFA 3HDDA 2NVTJ 2STWA 4I2OA 2NNNA 5ERIA 1W4MA 2KRCA 1DU0A 2RQPA 2IXSA 5CVJA 2ZB9A 1DPUA 3GFIA 1R49A 1O3QA 3CUOA 3WTXC 1XX5A 2JA6J 2KT0A 2LBFB 2E19A 4F91B 5JFRA 2LF7A 3RPQA 4A3KJ 4ZH4F 3GF2A 3IH3A 1KQ8A 2BE5F 3BZ6A 4RB2C 4B4CA 1FP1D 1QVTA 3RI4A 2JA2A 3O8GA 3JAMZ 4U87A 2AS5F 2OC6A 2ZXIA 1FC3A 3K4LA 4H4KC 1OKRA 4XN0A 1JHHA 1H89C 5DV5A 5F08A 4XQFA 3JRIA 1B4AA 3HG9A 2BY1A 4A6DA 3DTEA 4WWCA 2LTPA 3E6MA 3HC7A 3BY6A 1IDYA 3DEEA 3K4CA 3E0JB 2NVXJ 3TW6A 3BC8A 3PIOF 2Z9OA 3LSIA 2XASA 3LSMA 2VPRA 4IHTA 1KYWA 2H94A 5IYCJ 4LK1F 3QP6A 4XSZF 4IHXA 4RLQA 4HZFA 1GVDA 2NAZA 5L3FA 4A3FJ 2KISA 2VN2A 1MBHA 5L3DA 2ID3A 4IOCF 4IKFA 4A12A 3A4CA 4V2FA 1W0TA 4H0EA 4GXOA 2QWWA 6PAXA 1OYWA 4CA0A 5B66C 3HRMA 1ENHA 4C9YA 3PSIA 1HA8A 3OWTA 1R5HA 4JX5A 4Y15A 2VASA 3BCBA 5E79C 1KU7A 3COAC 1VQ4I 2ZFWA 1R58A 1PUEE 2PQ8A 3GTQJ 2EV5A 1JUMA 1ONVA 4M6YA 1FMWA 1F9NA 2DMUA 2O5RA 4UHTA 1IN7A 4UV9A 4XMYA 2W00A 4N4OB 3HZJA 4HOBA 2MSYA 3WG7H 3RKQA 1IUFA 1V55H 3J80Z 4DYRA 4RS8A 1JI8A 1T0FA 4WK8F 2IP2A 2EZIA 3CP2A 1H9TA 4IRIA 4UNOA 1SFXA 3IUOA 2V9KA 4IPAA 1UMQA 4B43A 1JKRC 1I50J 3DTKA 4F93B 1XG1A 4KA4A 5FO5A 2R5ZB 4XM3A 3BG7A 3F9KA 3LA7A 2FUG2 4LJZF 2E5ZA 2IA0A 1PJRA 1JJ8C 3K1NA 3L2CA 1QQIA 2HOSA 1OISA 2ESNA 1X4OA 4NQWA 2A5YB 3V42A 5IT3A 2LOOA 4ESJA 4G94A 3TBIA 3CCLI 3VYRB 3ULQB 2LY9A 5DYMA 4HW0A 4BE2A 1KU3A 1AKHB 4I01A 2KHMA 4AVPA 2F5CA 2VONA 5DUKA 2DQLA 2RNGA 3QPLA 1FOXA 1KQ9A 3Q0UA 1OCRH 1R71A 1DUXC 2Z5UA 1JHFA 1Z7LA 2YX7A 1MBKA 3JW4A 1MH4A 4XNFA 5GTIC 2HEOA 2EB7A 1VF9A 4PSXA 5F27A 3QOPA 1RR7A 5C4XJ 1SVMA 2VLAA 2DN0A 4PGHA 3EQLF 1POGA 1LB2A 2EJRA 3ZGKA 2XPVA 2NS8A 1P2FA 1LFPA 4BYYA 5IY5H 3G1OA 3J81K 1QZEA 2QLZA 4BL0B 3GUDA 5TJJA 2LF8A 4CO8A 1CGPA 3M8FA 3ABKH 1G3WA 4RBOA 2QA4I 1VQLI 2HKXA 2KL4A 2R7WA 3HHHA 2HOEA 3MZHA 2K9NA 3EETA 3W2VA 5KCMA 3CZ6A 3DBHB 4R8HA 5HDNA 1W7PA 1Y56A 3KP4A 3L09A 3I58A 3Q3SA 4CYDA 1F36A 1U0JA 2PJPA 2IS1A 3KYLA 2R3SA 3U2RA 2HTSA 1GLNA 2P5KA 4LOCA 4OMYA 1OJLA 1R23A 2L7MP 4ZDOA 2RREA 3TL4X 2CJJA 2EZHA 2H09A 5E17F 4KT6A 1OFCX 1TTYA 2M4GA 4XKVA 1F4KA 2F4IA 1X1AA 2H1LA 3HYIA 1BIBA 3IL2A 2W1OA 3D0SA 3VYUB 1IN8A 5FLMJ 3JRDA 3JRAA 3QRFF 2CQXA 1J09A 3KYDB 3P9KA 2OD5A 4U0VA 2XSJC 4MTEA 2ZSHB 1BC7C 4RM3A 3BTJA 4OOIA 2NOJB 1IRZA 4AWXB 1SD6A 4KN7X 1R4NB 2X9DA 5F64A 4E7LA 3LFUA 4L9VA 2M30A 5M5YJ 3CD6I 3FK7A 3HL2A 5LGTA 5C3EJ 5EYRA 1MZBA 2R7OA 1HLVA 3ASOH 4L9NA 3ZMZA 4C3JJ 3KEOA 3PL8A 2E2JJ 2D1VA 3F6OA 4GRIA 4MHGA 2J5PA 1D1CA 1VQOI 2DTRA 3G1LA 1KA8A 4LD5A 4EJTA 1YS6A 2CO5A 1WJ5A 5FROA 3L2WA 2IS4A 4S04A 4AIHA 4C3IJ 3KLOA 3S93A 2BHZA 1X1PA 4AUXA 2L02A 1SD7A 4RGXA 3SZGA 3VSKA 2LKSA 3F72A 3OS1A 1K6OA 3JREA 3LA3A 1BI1A 3S17J 2FNAA 2X6YA 2XF7A 3WTTC 3RQ4A 4DZPA 2WAQA 3WHBA 3H5RA 4JX4A 2VQCA 2CU7A 1OCPA 3RSNA 1JUPA 1MNMC 1W5TA 2QF7A 3GZNB 1UG2A 2OTLI 2ZMEB 4W1UA 4HG2A 1IN5A 4CXFA 4HAMA 4Y7NJ 2B63J 3GTPJ 3DTIA 2JMWA 3HSFA 1ZGJA 3WGHA 3PNVA 4ZC3A 4L5JA 2HYJA 2JPCA 5M3FJ 5FKMA 3WU1B 4XKCA 1FT9A 1MMGA 3RYPA 2LRDA 1FOYA 1WSUA 4MEXF 3RCOA 2DA7A 3M3YJ 2QCOA 1YJNI 3MFKA 1I3QJ 1IRXA 2O8XA 4JP0A 2H8RA 4A3DJ 1BOAA 4DZJA 4L9JA 1BI2A 1RETA 3ELKA 1MBJA 3AG1H 1Y1WJ 2COBA 3KEQA 5BPDA 3A0HC 5C44J 1B8IB 2DU9A 2XGXA 2ZNZA 3MD2A 5B1AH 2D2WA 5AONA 2XV4S 2KDZA 3PJRA 2V26A 4BXUA 5K5QA 2DCEA 3RJPA 1E0EA 5HVQC 3HUGB 5D6FA 5J1UA 4JK1X 3DP7A 3BG3A 1BI0A 1RZ4A 1SMYF 3K10A 3N4MA 1K61A 1OR7C 2DK5A 3MQ0A 1RKTA 3K4MA 2BY0A 2M0CA 2KLOA 4M3BA 1X2NA 3VEPA 2DK8A 1I6XA 3WU2C 1UG0A 1I1GA 3W6JB 5FGMA 5DCFA 3QODA 1I6HJ 1QU3A 1UB9A 1XCBA 2PMUA 5IYDJ 2OQGA 2HTJA 2VJ4A 3S3NA 3KZYA 1REPC 2CW8A 1YE9A 2KPMA 2UWMA 4BUPA 4PUSA 2WC2A 2EIJH 3LSHA 4E7KA 3J7ZI 4YIFA 2JK3A 3FX3A 1G2HA 2UXXA 1S8NA 2OAZA 1QRYA 1U5TB 3TMOA 1IC8A 1GT0C 1DDNA 4Q47A 4HLYA 4RGRA 4BBSJ 2M2EA 2I8DA 1ZLKA 2R5YA 2GQQA 1HOMA 4KIGA 3M7GA 4HDVA 5FFZA 2FEZA 1S6LA 1TW2A 3K4BA 3KE2A 1JJ6C 2FOKA 2QSHX 2A6EF 5GADJ 5D4SA 1LE8B 2MLKA 4YFXF 4BS9A 2DBBA 3FKJA 3O3KA 4V19K 2R7DA 5K5RA 1Y6IA 2BXYA 4II2A 2XAGA 3F21A 2ZKZA 4G7ZF 1LKXA 1FP2A 1MJ9A 2DFHA 2VB6A 2Y9YA 4E6KG 1ZAOA 5D6EA 2KZGA 4Y17A 2MABA 3G1MA 1FSHA 2ZFUA 2MA3A 1OLTA 3JRHA 1WJAA 4XK4A 1X3ZB 2IW5A 2D45A 2HPIA 1X1CA 2AXLA 3CTAA 4HNUA 4I6ZA 4BQQA 3BT9A 1ZG3A 2CQ7A 4DGWB 2IA1A 1ACIA 2OCEA 1WH7A 2DJNA 1X3UA 2VKDA 5D8LB 1RUNA 5M5XJ 5HLTA 1SD5A 1SC7A 2MFZA 3G73A 4L0ZB 3GFMA 2Y69H 1R6RA 3JCUC 2OPTA 5BPIA 3ABTA 5DD4A 4D7NA 3G4SI 1MNEA 2QBYB 1Z9CA 3BG6A 2EFWA 2EZLA 4IX7A 3MN2A 3CCEI 4I02A 3FF5A 1XMKA 2ADUA 4LIUA 3CJQB 3CLOA 3RKWA 4A5MA 2ID6A 1HXDA 5E3LA 5BNGA 2HDCA 1HW5A 2BVLA 2M0MA 2F4OB 5M3MJ 2C6YA 4AM3A 4EQQA 2P6SA 1UZCA 3PFYA 2HVSA 2DDBA 4P1WA 1A35A 4G7OF 4M3FA 2IEKA 3M8JA 4L5EA 4S0HB 1UHMA 4MQ9F 3H9QA 3SJMA 5EZGA 1P4AA 2VPLA 1VI0A 5LRSA 1XB4A 5J47A 5FKNA 2QVOA 2W4SA 3B6CA 3R0AA 2VE8A 1R22A 4HV5A 2QSFX 1YJ9I 1ERDA 2OQRA 3HOZJ 3H36A 3HRSA 3OYBA 1I3AA 4G12A 2G9WA 1IRFA 3SDGA 2GLOA 2ZNYA 3LQQA 1MJAA 4AYBA 3P9IA 1P7JA 1XMAA 1M1EB 1ETOA 1FBQA 5K7HA 2VL8A 1K4TA 1XGNA 3S16J 3HB9A 3JAMK 1ZRFA 2ZJ2A 2WAQN 3WHCA 4A0XA 4ZZDA 1WJBA 1E3HA 4XLNF 3DKWA 4Y4RA 2FE3A 5E20A 3PSFA 1G3SA 4NUBA 5GP9A 1BR1A 3HOXJ 5FLVA 3SXYA 2M3AA 4EGYA 3EYIA 1N77A 2UZKA 4E7JA 4WXCA 4O3MA 2DFIA 2X1CA 2XF6A 1TBXA 2AHQA 4LG3A 2ZCWA 4F55A 1NK2P 3DCFA 4KISA 2MLGA 1YLFA 3V8KA 4G6TB 4ZTFA 4LFUA 1WI3A 4XLFA 1YITI 2CW7A 2I10A 4PJNA 4LGWA 5D5VB 3R61A 1U78A 4XSXF 5ED4A 3OR1C 5GPCA 5CPRB 1LVAA 4HF1A 3K9TA 2O7OA 2D5VA 5F1JA 5LLQA 2X0LA 4HDUA 4M3EA 3N05A 2ECCA 3IV5A 1OR7A 2AQFA 1WRJA 1XSDA 2DFEA 1F5TA 4X0GA 2WWYA 2VIXA 1ZR4A 2EWNA 1T6SA 4KMUX 2R5ZA 1N25A 4JQFA 4BE0A 2JUCA 1BI3A 1SD4A 4Q48A 3SEZA 1J7KA 2W48A 3DLAA 2YR2A 5LBQA 5J1YA 2VJJA 2IGOA 3BOQA 1RPWA 2LBFA 5IYBJ 1IG7A 3OL4A 1VFCA 2G7HA 2VKEA 5E8IA 2CV1A 1Y1VJ 3BZCA 3WTVC 3H3ZA 4RAFA 3CCMI 2L9VA 3F8FA 2ELKA 3CMAI 2IS2A 2LY1A 3HRUA 3PUBA 4L5IA 4KNYA 1QGPA 4A3MJ 1JKPC 3HTUA 4KIFA 4B47A 5JVGF 5F6FA 1Z1DA 1MBGA 3O8HA 5DUIA 1ZK8A 1Z3YA 1IDZA 4CDGA 5E3NA 4WF2A 1D1AA 4IO9F 3ECHA 1OMIA 2K9SA 2WAEA 4NC6A 4X1EA 5KAIC 2L7FP 4IRGA 3GTGJ 1U6GA 4IQJA 1Y0UA 2K4BA 1H8AC 4A3GJ 3M9AA 3Q9VA 4XR6A 2XDVA 3TGNA 3CO7C 5DM7F 2JRTA 4A3BJ 3CC7I 3A0BC 3WGIA 3VWBA 2F2EA 4KICA 3GEZA 1WPKA 3UR3C 2M4KA 2EQRA 2A6TA 2P0WA 2QKMB 2R7RA 3CCUI 3VDXA 4B3AA 2RV8A 2NVQJ 4AIKA 1IXSB 4XKBA 2HWVA 5E3OA 3DKXA 5BQTA 1MD0A 5ILSA 3BP8A 2GIZA 4M9ZA 2HVQA 1Z77A 2OTJI 2DA5A 4QWQA 3IRRA 1U8BA 2PMZA 1K79A 2UUZA 3ZQIA 1PYVA 2MG4A 2VE9A 1ZGAA 1ON1A 4ZYHA 4Y3OA 4HBLA 4C2TA 4A3LJ 3ZN1A 2Z2SB 3L9FA 4KT5C 3K4JA 4ANJA 2B9SA 4UVAA 2KMUA 3RPUA 1Z21A 1C0WA 1WJDA 2LR8A 4HF0A 4PCQA 1O3RA 1HDDC 3MEXA 4ZYGA 3LAPA 1SVOA 2R7VA 2O03A 3QP5A 2QQBA 1ORKA 3JRBA 2OF7A 3FXQA 4NBQA 3V7SA 4XLPF 2HDDA 1ZG5A 1XGMA 2JTVA 2EA2A 1NK3P 3QQAA 3C2BA 4F7ZA 3SEQA 5DDGA 2RC4A 5EDNA 2NXNB 2GA2A 3ZCOA 1A6IA 2VJ5A 2HI3A 5DS9A 2VC0A 5B5EC 2FBHA 4ENNA 5HODA 1Y8RB 1HF0A 3OYNA 3HHGA 3HJEA 3I4PA 1LVKA 4UUSB 2KIUA 2EIMH 1BM9A 4A3EJ 4BBRJ 3FXOA 1JTXA 4NQWB 2F6CA 2KRHA 2V6CA 3FHNA 3BZKA 1W0UA 3GTKJ 1LUJB 1UCRA 3REOA 1MSFC 4RAYA 5HLIA 3ABLH 2CH0A 4ENKA 4ZDPA 5HDKA 3RZDJ 2K3FA 4BQNA 1G59A 1FYKA 4GYIA 3V8LA 3CMMA 2JVHA 3BQYA 3K2AA 2BV6A 3DV8A 3WTYC 5K7FA 1DQUA 4KMFA 3QWLA 2MW8A 2RN7A 2ISYA 3FM5A 5KNLA 4N4NB 3X2QH 5D5WB 3V4GA 3EDPA 4G6DA 1HSTA 2BY2A 1XMXA 2M8GX 4PJ0C 5E1XA 4G6QA 4B3XA 2L4AA 4ZYDA 2YX4A 1T95A 5JHUA 2LDUA 1EV7A 5F0HA 2E2HJ 2MH9A 2CUZA 2L3DA 1NG7A 3KEYA 1GVJA 3DLLF 1BR4A 3FXKA 1X58A 4XONA 4AU7A 2V6EA 2DPUA 2VXDA 4C2MJ 2MYSA 1Y0NA 4UVBA 4R79A 3VB2A 2DW4A 2NS7A 4MIMA 2R7QA 3DPUA 2Y31A 5IT9Z 3QOEA 3ASNH 1E17A 1TWAJ 3AL0B 1QHGA 1JGSA 4MGRA 1IGNA 1TZLA 4N0BA 1EJ9A 5EG0A 1KU9A 3K1PA 3TO9A 3PNTA 3IP4B 1LE8A 2H8WA 4FX4A 1XPXA 1MBEA 4KITB 4J19A 4IJAA 3HTSB 3HOUJ 1SFOJ 4RAZA 4FX0A 4KIBA 4E7IA 1AWCA 2X6XA 4FETA 5DCMB 1B6AA 1UJ8A 1T0FC 3CESA 1B1BA 2K27A 2P7CB 4IQ4A 1N75A 1S29A 2IJLA 3ZQHA 4A2UA 1QZYA 1OQYA 4NC8A 2BGCA 1AHDP 2BW3B 2TDXA 2O9LA 3M1EA 1K7AA 1YW8A 5FRMA 2JSCA 4HV6A 3U21A 3HIFA 1FLIA 2RDPA 3LQRA 4XLEA 2GM4A 4BNCA 4PFPA 3SYTA 1VQPI 5TRDA 1WH5A 3PO3J 4M9XA 1R36A 1TWFJ 1Z0XA 5EJCA 3DEUA 3I71A 3E6DA 2DO7A 2XKOA 3OY9A 5D8KB 1TQMA 1MGTA 5FB2A 3F22A 4JX6A 1O57A 2V4JC 3ROUA 4DYCA 2XGDA 3PIPF 2JQ7A 2K9MA 2OU2A 4RLFA 2A07F 1WVRA 3QPHA 3KPHA 1WQ2A 1T33A 3Q0WA 3ZMSA 1BW5A 2LLKA 5J6XA 1WCMJ 5FRNA 4OIRF 2LP0A 3RDIA 1TNTA 3LWFA 2DAOA 2V1UA 4M71A 2DOFA 2WB1A 2WTEA 4XBFA 1GV5A 4BY1J 4BQOA 1JKQC 4CGZA 3BTCA 2XVCA 5EF6A 3NARA 1Z05A 1A31A 1MMAA 2GOXB 4BACA 1MMSA 2BBYA 2LG4A 1B9NA 4M72A 4FCYA 5D5XB 3S1NJ 2R92J 3FIWA 3LSKA 1PP8F 1WZ2A 2IS6A 3F8BA 2GZWA 1KONA 1W5SA 3VSLA 3BR1A 5JR3A 2B7EA 5H6RA 1MH3A 4L0YB 2I5UA 3LSJA 3MAJA 2LNBA 1YFHA 4S05A 4IXAA 2IGKA 4B48A 4O5VA 1I27A 5CQEA 2CYYA 4DYQA 4L9TA 3ZQ7A 3BR2A 3S3MA 3WU0A 2DQRA 2WBMA 4C30A 2K40A 4A3IJ 2KKOA 3KZIC 1QNTA 5J40A 2WV1A 3F8MA 3FMSA 2W7NA 5JLXA 2H6CA 3Q5FA 3I55I 1Z6TA 5HLGA 2VBZA 3W2WA 5BMZA 3FM3A 1T98A 4DBQA 3P5JA 3L2QA 2NVUB 2X48A 1MDMB 2DYSH 2OJED 2E1CA 1IW7F 2VC1A 3LFKA 4Y52J 1BJAA 4NDLA 4E7SA 4CCKA 3NWSA 1WJFA 4XRSA 2VKVA 3I0TA 3I5UA 1DP7P 4EM2A 3IC7A 4AC0A 3A2KA 3F8CA 3ESWB 3AG3H 5LEKA 1Z6RA 1O3TA 1V54H 4Y33A 4P5OA 4Z2YA 1LNWA 3CCYA 4A3CJ 1D8JA 3W3CA 1YIJI 3R6SA 2VI6A 5HOOA 1XTAA 3GO5A 1H0MA 5C4JJ 3S15J 3KFWX 2M1BA 4MNUA 5F0FA 2L0KA 1S9HA 3LOCA 3CCRI 2DA1A 4A5NA 2W82A 1T2KA 1WI9A 2CW0F 5HDGA 1WWXA 2EILH 1YI2I 1JKOC 3LSPA 3BLYA 2OZ6A 4EM1A 2Q2EA 4LK0F 3AG2H 1YYVA 1AA7A 3A01B 2HYFA 2DMTA 1DGRM 3DXJF 3TO7A 2L7ZA 1P4WA 1AOYA 4XIDA 4DOZA 4AYBN 3BR5A 1FX7A 4D9JA 1JT6A 1X1DA 1OPCA 2Y30A 1CQTA 5EZHA 3BR0A 2CS3A 1RI7A 3TP3A 3OYAA 3I54A 1A6QA 4PJJA 4KDPA 1D3YA 1X4PA 3ZR8X 4FE7A 4BJTA 1Z91A 3S3OA 3CJRB 3GFLA 4UUTA 3SZPA 1XN7A 1GXQA 2XAUA 4F3QA 2YU3A 5FD6A 1J0RA 2P8TA 2HQNA 1ON2A 3GFJA 4LLNA 4QPOA 4KN4X 1BJZA 3U1KA 3BDDA 2JSPA 4BJ5C 1YW7A 1UHSA 2V7FA 2MC3A 2H6BA 1BR2A 4LG0A 3B02A 5H6QA 2HQ5A 1HCRA 1OCCH 2AO9A 3R60A 2UV1A 3AKZA 3A03A 2IBDA 3L2RA 2JN6A 3LSGA 2P6TA 3DQVC 1HKQA 4QIWN 3RKXA 1CF7B 1QZZA 2VXZA 4MLOA 4C2UA 5KHDA 1EH8A 2OCCH 2EFNA 3H0DA 2Y75A 3O6BB 2HOTA 1K78A 3DFGA 3EUAA 2XB5A 4UUSA 2O61A 1T39A 5LRRA 1X2MA 4CCOA 4RM2A 1YIOA 5EEHA 5CJ9A 3MZ8A 2A69F 3MWMA 4DW6A 1JGGA 1HBXG 2E1MC 2X1DA 3QYEA 4XRFA 3FXUA 2DI3A 3V7RA 1FYLA 3OV8A 1P7IA 2V1XA 2DTZA 2PX9A 2B0LA 3I53A 2O8KA 5CVUA 1VQ9I 4IHVA 4UUVA 1BBYA 2JJ7A 1T38A 1B9MA 1CF7A 3ZPLA 2R93J 4UY8I 1JTYA 4RMNA 5FKLA 3FISA 2LREA 5A2QZ 3E5QA 4CYCB 2E35A 4DNCA 1VNDA 1YX3A 5IP9J 5E3MA 2QUFA 2DPDA 3HGYA 2EPFA 3S32A 5LD2C 4QPQA 3QPSA 3L1PA 2KDOA 3KP3A 2QSGX 3W6KB 4JYKA 1XGSA 2YUSA 3EUHC 2L4MA 1ZTRA 4DBRA 1S7AA 4M6VA 4YIRX 3FMRA 5K7ZA 2O3FA 2V79A 1IV8A 3KP5A 3S1RJ 1FY7A 3P9CA 4BDZA 3I4NJ 3OS2A 4ESFA 2JUGA 3F8NA 2IA2A 5EEGA 1SFKA 2XAHA 4EM0B 4XOPA 1FOWA 4RDUA 1W36C 3H0GJ 4PFOA 3PNYA 1T8IA 2LSOA 4P9UA 2RQQA 1YTYA 4I09A 4EJUA 4AD9A 2XPWA 3C2HA 3CUQC 4FE4A 1XCVA 4U88A 1EH6A 2BXZA 2P7VB 2H1KA 3ERMA 4EJOA 1DGWY 2RGVA 2MBFA 3D1NI 1QO0D 2WADA 3K6GA 4OU0A 2O6GE 1HW2A 1MBFA 3QU3A 2XROA 1FJLA 3MKZA 5GAHJ 1WHUA 2KFDA 4CICA 3GX4X 4YFNF 3F6VA 2PFBA 1A5JA 1LDDA 2HKOA 5L3EA 3O2PE 4CCLA 3BWGA 3OYIA 1TQIA 5E1ZB 5E18F 2E5NA 2DT6A 4EJVA 3IKVA 2MD5A 3OR2C 5GAGJ 1DP3A 2QQ8A 2Y0MA 3KP2A 4OIOF 2KIMA 4NC7A 1I1SA 1O4XA 2BVMA 1U8RA 3NQOA 2EH3A 2KQRA 2Y0SA 1VQ7I 4UV8A 2ZXWH 2WA0A 2WV0A 4EEFG 1KZHA 3ZMVA 1SMTA 2A5WA 1YX5A 1VQ8I 3ZMDA 4AIJA 4V2GA 4FHTA 2F5DA 3LSTA 4R1HA 5HNHA 1U3EM 5D4RA 1J5YA 3HOTA 1FIAA 2FNPA 4AVZA 4UVCA 1J2XA 5IOYA 1ETWA 2L54A 4OIQF 3OIOA 3S2HJ 3V7CA 3DPLC 2IT0A 1GDTA 4FISA 4FTHA 5DEQA 1MDMA 2R4GA 2E34A 2E2IJ 1QBJA 3A01A 3OIPA 3CDIA 1X1BA 4I76A 4GYGA 5KAFC 4PJMA 3I59A 4RAGA 4YRVA 1BN5A 1ODDA 4G8XA 4CZCA 1LFBA 2A68F 2R5YB 2L9SA 2CUEA 2JZYA 4D5FA 3H3VK 2PMZN 1VQ5I 1BW6A 2K85A 3FXRA 5FKOA 1J59A 2X6WA 3FXMA 4IHWA 3CO6C 1LQ1A 3JTGA 3MKLA 4BEHB 1RUOA 4BDYA 3QPTA 3WTUC 4ZZLA 2Z99A 2W25A 1JE8A 2CSOA 2NYXA 3T8TA 3E5UA 1R1TA 4YEJA 2L9RA 1HKSA 1XC5A 5L3CA 5LHGA 2EZKA 3C3WA 3OYGA 3J81Z 2VT2A 3FHZA 2K02A 2X85A 1YO5C 4OINF 3VYSB 3OOUA 3ZQGA 4BGDA 5J8CA 1ZR2A 1SEUA 4YFKF 3DWLE 2DOEA 1R1VA 3K4NA 2V1NA 5IP7J 2DA6A 2LC2A 2P81A 2VT3A 3GZ6A 2LKPA 3EUKL 3H1CA 2JPBA 2DMNA 2JA8J 5A2QK 3PUFA 4BJ6C 1IUYA 1X3WB 4RB3C 2R7SA 2OUMA 3BJ6A 1NTCA 1D5YA 5LGNA 2LY2A 5AIQA 3OYHA 3K70C 2PLYA 5JLWA 2FMYA 1G8XA 2KP6A 2EV0A 3OYDA 1IO2A 3QU6A 3RTRA 1ZREA 2XAQA 3OIQA 4B44A 1FTZA 2VBXA 4OAYA 2DMPA 2TRTA 5L3BA 1B72B 3K1MA 3QYFA 4UB8C 1R5GA 2LFBA 2W85A 3BJAA 2GXAA 4XORA 3Q0VA 1ZLJA 1UFMA 3K7AJ 2E1MB 2XKPA 2CWEA 3DBRB 1TNSA 3FBNB 1W7PD 1Q1VA 4E70A 3F23A 3PQKA 4HA8A 1V4RA 2M34A 3K70D 2XC7A 2CRGA 3SQNA 2RKHA 4ITVA 2NRAC 3LAJA 2VOPA 1S7OA 1P9QC 3ZP5A 5H20A 4HYEA 4Z6YA 3BTIA 1UAAA 2FMLA 2XGEA 3SDBA 1TLHB 3HKZA 4WXDA 1QHHD 2Y0SN 1FPQA 2E71A 4YG2F 1B59A 3JRCA 2XB0X 4MFEA 1GUUA 2ME6A 5ILUA 3WTSC 1K6YA 3HPHA 4UXNA 2P5LC 3ZXSA 4FASD 1P92A 2NNYA 1K4SA 2F48A 3Q9SA 1K83J 3C18A 2HNHA 3BCAA 2W84A 2HQRA 3T5XA 5EGOA 1ZYRF 1ZN2A 1OCOH 2KRFA 2YU9J 2XIGA 2Z33A 4IHSA 3ABUA 3H35A 4LB5A 2ZBKA 1FOKA 3FK6A 2HU9A 2HYGD 2EA4A 4ESBA 2X4HA 5ICEA 3G71I 1YQAA 2DXIA 4MO7A 2XF5A 4FQGA 1KQ0A 1HC8A 4U7DA 4MEYF 4M3DA 9ANTA 1Y8QB 2EINH 4OWRB 3B73A 1U9NA 3BTLA 3E6BA 1FYMA 1BC8C 4P9FA 1FWZA 3RKYA 3L00A 4P96A 3HPGA 2CQNA 1D8KA 2LH9A 3QAHA 1Z7UA 1FSEA 3SHFA 5FLXK 3GMEA 2GBYA 4XLAA 3H3UA 2X51A 1EF4A 2Y2ZA 1W5CC 2IGNA 4EGZA 4PDKA 3K2ZA 1GV2A 4A3JJ 2P5VA 2LMDA 1NHAA 3ZQCA 2PN6A 1AU7A 5TGTA 1W7PB 4IL6C 1MNDA 5HLHA 2DYRH 2M87A 3BR3A 4B09A 2VODA 5KVRA 3JSPA 5FJ8J 2PJRB 2FQ3A 3RIRA 2EFQA 2DFFA 2NS0A 4CYCA 3HOSA 3CMEI 5LHIA 4LMYA 2DT5A 1J9IA 3HSEA 2QQ9A 2N8GA 1VQMI 4G9YA 4QSHA 3TDZC 2HOAA 1V5FA 3DF8A 2ME0A 2G0EA 4IVNA 3GLXA 4HPQA 5CVIA 3K4KA 5GAEJ 1SAUA 5J4VA 2DT7B 1LPQA 4WX9A 2XAFA 3DU6A 3HRTA 1E3PA 1IN6A 1YRNA 3KP7A 3ABMH 4LITA 5CYVA 2RVCA 2WB1N 4XL9A 4CCNA 3MCZA 2A05A 2GIVA 2M9HA 1MMNA 3C2GA 2F5FA 4Q5SF 5CVVA 4XN3A 2K9LA 4ENJA 4A0YA 1K78B 4HNTA 1IZ1A 1RC9A 3IH4A 2E1NA 2PG4A 4B8XA 3MKYB 2BYVE 2EFPA 2R7TA 1YOVB 2BW3A 1EH7A 1H9GA 2JT1A 2K86A 3K0LA 4KUMA 1ITYA 1FEXA 3HOWJ 3IKTA 1RIOH 1O7LA 4KFCA 4XRMA 4ETSA 2F5EA 2W24A 2KJBA 3EPZA 2L9NA 3BR6A 1L3LA 3HBLA 1ETQA 3KCCA 4ZYAA 1Q1HA 1TWHJ 3JTHA 5DTDA 4W97A 4DJAA 2KZVA 1YRNB 3KP6A 2VOOA 2XSDC 2GWRA 4HLXA 3GZ5A 1USTA 4E7HA 4J00A 2HXIA 2Z1DA 4A6EA 2JWTA 1R1UA 3DKYA 4BKXA 3N97A 3J7AY 1VTNC 2XRLA 4N9HA 3I64A 2DLLA 3JRFA 2ZXJA 3CUQB 4HRIA 2ETHA 4OIPF 2STTA 5J4YA 2FRHA 3JR9A 2W57A 3EYYA 3LNQA 3M8EA 5EGOB 1FTTA 3GVAA 3BQZA 4PSWA 4KYWA 1YJWI 3KIOA 3BG9A 4XRSG 3FZVA 1JT0A 2HGCA 3GTLJ 1F43A 2RNJA 1I5ZA 3I3LA 3WE3A 3E97A 3WODF 1TQPA 1WFXA 3TEDA 5CQGA 2O0YA 2ZJRF 2LKXA 2HDWA 3OYMA 3GTJJ 1ETXA 3OYFA 1LFUP 3E6CC 2CV2A 3PQJA 5BS6A 1S7EA 3BPVA 1IN4A 2FBIA 4A0ZA 1X19A 1D0ZA 1ULYA 1ZQ3P 1PVEA 1FZPB 1T56A 3CDLA 3J80K 2PEXA 3VOEA 2QKLB 1U5TA 3DEWA 4P55A 5CKTA 3ZN0A 3DBLB 4EATA 4D1QA 3E3VA 2GXGA 1PP7U 1TP4A 4U0YA 5ICGA 1UELB 2CMPA 1TT0A 3CJNA 2Y9ZA 4Y13A 4G7HF 2PBIA 1MMDA 5IPAA 2CQKA 3TDUC 3CF5F 4XLHA 3RQIA 3R0JA 3NWTA 5LGUA 1PUFA 2IVMA 2HZTA 2DA4A 2HFHA 2ZMEC 5EG0B 3W6VA 1MJBA 1SFEA 5HS8A 3AFHA 3IAM2 3L2VA 1U2WA 1R5ID 3KYCB 4ASNA 4MTDA 2PJRA 2R7UA 3ML6A 1FBSA 1MKMA 2E1OA 3KLNA 3OSFA 1IAWA 2JRMA 1SFUA 2M7BA 2ISZA 3ZMTA 3CF2A 5AIPA 3AL0C 2R7ZJ 3D5RC 4XKWA 2DA3A 3TKYA 3TP0A 1VQ6I 4RB0A 3B6AA 5ICCA 2TCTA 2ZJQF 3TQNA 2CFXA 3D5LA 3K69A 4CUGA 4ABZA 2OA4A 3KZZA 5BOXA 1Z67A 3HOVJ 4NHJA 1IXCA 1OCZH 2BZTA 2ICWG 1APLC 4F52A 4BU2A 1WGXA 1ETVA 2H27A 1IJWC 2M7AA 4PJLA 1XDSA 1O3SA 2MC4A 1HSJA 1WJCA 3E7LA
chains in the Genus database with same CATH topology
1GHCA 1V3FA 2Q8KA 3VFZA 1XD7A 2KIFA 1QPMA 4I98B 3C7JA 4GO1A 1ZH5A 1IRGA 1G4DA 3R4KA 1OYYA 3AAFA 1YW9A 2YSRA 1WKMA 1KGSA 2GA1A 2CG4A 3IWZA 4M6XA 3PFIA 3ZMUA 2FF4A 3DPTA 5FLXZ 1HQCA 4EMSA 5HS9A 1IXRC 4EJWA 2ZO4A 4GCVA 1STZA 4D0PA 4HF2A 3GXOA 3BJOA 1LJ9A 4LLLA 1KYZA 2ELHA 4ZYEA 2D1HA 4LG0B 2EFOA 2QYOA 4CZZA 3HSRA 4CHUA 4Q4ZF 1DPRA 1ZRCA 1GXPA 5E1WA 2CGPA 2Y48A 5CLSA 3WTWC 1L0OC 3L7WA 2ZMEA 1FBUA 5DD8A 1HKTA 2ESHA 2G7UA 4LB6B 5DCMA 1BIAA 2FXAA 1G3YA 4BHCA 2FA5A 4WCGA 3TO6A 4U7BA 1ZARA 5D5UB 3ECOA 4O6JA 1R7JA 1G6NA 2COMA 1S3JA 5KK1A 3WE2A 1RNLA 5E8GA 4OMZA 4M9SA 4N9IA 3OOPA 2M5WA 3H92A 2V9VA 4NB5A 3F3XA 1OYIA 4GGGA 2M45A 1J75A 5LHHA 1TW3A 3WGGA 1PDNC 1IF1A 2EV6A 3WG9A 1USSA 3RYRA 5F1RA 5HS7A 2R7FA 2EK5A 2V1DA 2Z3YA 1XSVA 2P4WA 3IHUA 3T0YA 3TOBA 2HR3A 4I0BA 3T1BA 3CUQA 3E5XA 1O7FA 3G3ZA 3SFZA 3EUHA 1HW1A 2QZ8A 4M74A 1R00A 2Q0OA 2XAJA 2GXBA 2YPRA 3T8RA 2BEOA 2QBYA 2XRNA 4YIIA 1FNNA 4TV7A 3V8JA 2PMHA 1UHWA 4MQVA 5K1YA 2KJCA 4IF4A 5FFXA 2VBYA 3U1DA 1LDJA 1P4XA 1JXSA 3KETA 1ZRDA 2L01A 4BAYA 3J7AO 4BHBA 1P6RA 2OBPA 4QLCU 4EVIA 4RGSA 3CDHA 4EV0A 1XSXA 4PZJA 2MH2A 1LDKB 4HX7A 4U0WA 5JI6A 3P7NA 2XHKA 3I59B 1F1ZA 2UXNA 4IRHA 3WTZA 1XGOA 3BPXA 3SZTA 2GAUA 2QM3A 2K7LA 3BROA 2M8EA 2QQAA 2VBWA 4K2EA 5IT9K 2E7WA 5ICFA 3VODA 1ZHFA 4WXHA 1G3TA 2A3SA 5LEJA 4HX4A 3U9GA 4FT8A 2E7XA 3GW2A 4BQAA 4HQEA 3NEUA 5JVTA 1A04A 2K4JA 4ON0A 3GYHX 4BHPA 2IRFG 1ZG1A 5J8FA 4RB1A 4I0AA 2XUBA 4LLGF 2FSWA 3HUGA 1KU2A 5FD5A 2OZUA 1LEAA 3LA2A 2ACJA 1E2XA 3FWEA 2A61A 4JBAA 1XDUA 3IWFA 1SAXA 4PGGA 5ILVA 2J5OA 4L18B 2FBKA 3IRQA 2FU4A 4RGUA 4HQMA 3NRVA 4DQ2A 3ISPA 3MZYA 4ENMA 5CVRA 2HS5A 3FMQA 3S2WA 5L3GA 3C1DA 2PI0A 3TOAA 5K5OA 1YG2A 3GWZA 1U5TC 4M73A 2A6HF 1YS7A 3ERED 3JSOA 4HX8A 2IPQX 2QENA 4BH9A 1D5VA 4I7HA 1LEBA 2STWA 4I2OA 2NNNA 5ERIA 1W4MA 2RQPA 5CVJA 1DPUA 3GFIA 1O3QA 3CUOA 3WTXC 5JFRA 2LF7A 3RPQA 4ZH4F 3GF2A 1KQ8A 2BE5F 3BZ6A 4RB2C 1FP1D 3RI4A 3JAMZ 2AS5F 1FC3A 1OKRA 1JHHA 5DV5A 1B4AA 4A6DA 4WWCA 3E6MA 3BY6A 2Z9OA 2XASA 4IHTA 1KYWA 2H94A 4LK1F 3QP6A 4XSZF 4HZFA 2NAZA 5L3FA 2VN2A 5L3DA 4A12A 4H0EA 4GXOA 2QWWA 6PAXA 1OYWA 3HRMA 1R5HA 4Y15A 1KU7A 3COAC 2ZFWA 1R58A 1PUEE 2PQ8A 2EV5A 1ONVA 4M6YA 1F9NA 4UHTA 1IN7A 4UV9A 4HOBA 3J80Z 4RS8A 1T0FA 4WK8F 2IP2A 1H9TA 4IRIA 4UNOA 1SFXA 4IPAA 4KA4A 5FO5A 3LA7A 4LJZF 2IA0A 3K1NA 3L2CA 1QQIA 2ESNA 4NQWA 2A5YB 5IT3A 4ESJA 4G94A 3ULQB 5DYMA 4HW0A 1KU3A 4I01A 4AVPA 2F5CA 2VONA 5DUKA 2DQLA 1KQ9A 1DUXC 2Z5UA 1JHFA 2YX7A 3JW4A 2HEOA 2EB7A 3QOPA 4PGHA 3EQLF 1LB2A 2EJRA 1P2FA 4BYYA 3J81K 2QLZA 3GUDA 5TJJA 2LF8A 4CO8A 1CGPA 3M8FA 1G3WA 2HKXA 3HHHA 2HOEA 3MZHA 3EETA 4R8HA 5HDNA 1W7PA 3KP4A 3L09A 3I58A 4CYDA 2PJPA 2R3SA 3U2RA 2HTSA 2P5KA 4OMYA 1R23A 2H09A 5E17F 1F4KA 1TTYA 3HYIA 1BIBA 3IL2A 3D0SA 1IN8A 3QRFF 3P9KA 2OD5A 4U0VA 4MTEA 1BC7C 4OOIA 4AWXB 1SD6A 4KN7X 5F64A 4L9VA 2M30A 5LGTA 1MZBA 4L9NA 3ZMZA 3KEOA 2D1VA 3F6OA 4MHGA 2J5PA 2DTRA 1KA8A 4LD5A 4EJTA 1YS6A 2CO5A 4S04A 4AIHA 3KLOA 2L02A 1SD7A 4RGXA 3F72A 1K6OA 3LA3A 1BI1A 2FNAA 3WTTC 1W5TA 2ZMEB 1IN5A 4CXFA 4HAMA 3HSFA 1ZGJA 3WGHA 4L5JA 2JPCA 3WU1B 3RYPA 1FT9A 4MEXF 1WSUA 3MFKA 2O8XA 1BOAA 4L9JA 1BI2A 3ELKA 3KEQA 5BPDA 2DU9A 2XGXA 2ZNZA 2D2WA 5AONA 2XV4S 4BXUA 5K5QA 3RJPA 5HVQC 5D6FA 3N4MA 4JK1X 3DP7A 1BI0A 1RZ4A 1SMYF 2DK5A 3MQ0A 3VEPA 2DK8A 1I6XA 1I1GA 3W6JB 5FGMA 5DCFA 1UB9A 1XCBA 2PMUA 2OQGA 2HTJA 3KZYA 1REPC 2UWMA 2WC2A 4YIFA 3FX3A 2UXXA 1S8NA 2OAZA 1U5TB 1DDNA 4Q47A 4HLYA 4RGRA 1ZLKA 2GQQA 4KIGA 3M7GA 4HDVA 5FFZA 2FEZA 1S6LA 1TW2A 3KE2A 2FOKA 2A6EF 5D4SA 2MLKA 4YFXF 2DBBA 3O3KA 2R7DA 5K5RA 2XAGA 3F21A 2ZKZA 4G7ZF 1MJ9A 1FP2A 1ZAOA 5D6EA 4Y17A 1FSHA 2MA3A 2IW5A 2D45A 2AXLA 3CTAA 1ZG3A 2IA1A 1X3UA 5D8LB 1RUNA 1SD5A 3G73A 4L0ZB 3GFMA 5BPIA 3ABTA 5DD4A 2QBYB 1Z9CA 2EFWA 4I02A 3FF5A 1XMKA 2ADUA 3CLOA 3RKWA 4A5MA 2HDCA 1HXDA 1HW5A 2C6YA 4EQQA 2P6SA 4G7OF 1UHMA 4MQ9F 1P4AA 5LRSA 1XB4A 2QVOA 3R0AA 2VE8A 1R22A 4HV5A 2OQRA 3HRSA 2G9WA 1IRFA 2ZNYA 3LQQA 1MJAA 3P9IA 1XMAA 1FBQA 1XGNA 3JAMK 1ZRFA 2ZJ2A 4A0XA 4ZZDA 4XLNF 3DKWA 2FE3A 5E20A 1G3SA 3SXYA 4EGYA 3EYIA 2UZKA 4WXCA 4O3MA 2DFIA 1TBXA 2ZCWA 2MLGA 1YLFA 3V8KA 4LFUA 4LGWA 5D5VB 3R61A 1U78A 4XSXF 5ED4A 4HF1A 1LVAA 3K9TA 5LLQA 2X0LA 4HDUA 1OR7A 1WRJA 1XSDA 1F5TA 2WWYA 2EWNA 1T6SA 4KMUX 4JQFA 1BI3A 1SD4A 4Q48A 1J7KA 2YR2A 5LBQA 3BOQA 2G7HA 5E8IA 3WTVC 3H3ZA 3F8FA 3HRUA 4KNYA 4L5IA 1QGPA 3HTUA 4KIFA 5F6FA 1Z1DA 5DUIA 4CDGA 4WF2A 3ECHA 1OMIA 4IRGA 1U6GA 1Y0UA 2K4BA 3M9AA 3Q9VA 3TGNA 3CO7C 2JRTA 3WGIA 2F2EA 4KICA 3GEZA 2RV8A 4AIKA 1IXSB 2HWVA 5BQTA 1MD0A 5ILSA 3BP8A 4M9ZA 1K79A 4QWQA 3IRRA 2VE9A 1ZGAA 1ON1A 4ZYHA 4HBLA 3ZN1A 3L9FA 4KT5C 4UVAA 3RPUA 1C0WA 4HF0A 4PCQA 1O3RA 3MEXA 4ZYGA 3LAPA 2O03A 3QP5A 2QQBA 3FXQA 3V7SA 4XLPF 1ZG5A 1XGMA 2JTVA 2EA2A 4F7ZA 5DDGA 2RC4A 2GA2A 2VC0A 2FBHA 4ENNA 3HHGA 3I4PA 2KIUA 1BM9A 2V6CA 1UCRA 3REOA 4RAYA 5HLIA 4ENKA 5HDKA 1FYKA 4GYIA 3V8LA 2BV6A 3DV8A 3WTYC 4KMFA 2RN7A 2ISYA 3FM5A 5D5WB 3V4GA 3EDPA 4G6DA 1HSTA 5E1XA 4G6QA 2L4AA 4ZYDA 2YX4A 5JHUA 2LDUA 1EV7A 2MH9A 2L3DA 1GVJA 2DPUA 4UVBA 4R79A 3VB2A 2DW4A 5IT9Z 1E17A 1JGSA 4MGRA 4N0BA 1KU9A 3K1PA 3TO9A 4FX4A 4IJAA 3HTSB 4RAZA 4FX0A 4KIBA 1AWCA 5DCMB 1B6AA 2K27A 1B1BA 2P7CB 1S29A 2IJLA 4A2UA 1QZYA 2BGCA 2TDXA 3M1EA 1K7AA 1YW8A 2JSCA 4HV6A 1FLIA 3HIFA 2RDPA 3LQRA 4BNCA 5TRDA 4M9XA 1R36A 3DEUA 3I71A 3E6DA 2DO7A 2XKOA 5D8KB 1TQMA 1MGTA 5FB2A 3F22A 1O57A 3ROUA 2OU2A 2A07F 3QPHA 1WQ2A 3ZMSA 5J6XA 4OIRF 3RDIA 1TNTA 3LWFA 2DAOA 2V1UA 4M71A 2WTEA 4XBFA 4CGZA 2XVCA 1Z05A 2BBYA 1B9NA 4M72A 5D5XB 1PP8F 3F8BA 2GZWA 1W5SA 5JR3A 5H6RA 4L0YB 3MAJA 2LNBA 1YFHA 4S05A 4IXAA 4O5VA 1I27A 2CYYA 4L9TA 3ZQ7A 3WU0A 2DQRA 2KKOA 1QNTA 3F8MA 3FMSA 2H6CA 3Q5FA 1Z6TA 5HLGA 2VBZA 5BMZA 3FM3A 1T98A 1MDMB 2E1CA 1IW7F 2VC1A 3LFKA 1BJAA 3I0TA 3I5UA 1DP7P 4EM2A 3IC7A 3F8CA 5LEKA 1Z6RA 1O3TA 4P5OA 4Z2YA 1LNWA 1D8JA 3R6SA 5HOOA 3GO5A 1H0MA 3KFWX 2M1BA 4MNUA 4A5NA 1T2KA 1WI9A 2CW0F 5HDGA 1WWXA 2OZ6A 4EM1A 2Q2EA 4LK0F 1YYVA 2HYFA 3DXJF 3TO7A 1P4WA 1AOYA 1FX7A 1OPCA 1RI7A 3I54A 4KDPA 1D3YA 1Z91A 3GFLA 3SZPA 1XN7A 1GXQA 2YU3A 5FD6A 1J0RA 2P8TA 2HQNA 1ON2A 3GFJA 4LLNA 4KN4X 3BDDA 1YW7A 2MC3A 2H6BA 4LG0A 3B02A 5H6QA 3R60A 2P6TA 3DQVC 1HKQA 3RKXA 1CF7B 1QZZA 2VXZA 1EH8A 2EFNA 2Y75A 3O6BB 1K78A 3DFGA 2O61A 1T39A 5LRRA 1YIOA 5EEHA 5CJ9A 2A69F 3MWMA 1HBXG 4XRFA 3FXUA 2DI3A 3V7RA 1FYLA 3OV8A 2V1XA 2B0LA 3I53A 5CVUA 4UUVA 1BBYA 1T38A 1B9MA 1CF7A 3ZPLA 5A2QZ 3E5QA 4DNCA 2QUFA 2DPDA 3KP3A 3W6KB 1XGSA 2L4MA 1S7AA 3FMRA 2O3FA 2V79A 3KP5A 1FY7A 3P9CA 4ESFA 3F8NA 2IA2A 5EEGA 2XAHA 4EM0B 2LSOA 4P9UA 1YTYA 4I09A 4EJUA 4AD9A 3CUQC 1XCVA 4U88A 1EH6A 2P7VB 4EJOA 2RGVA 2MBFA 1QO0D 4OU0A 2O6GE 1HW2A 3QU3A 2XROA 4CICA 3GX4X 4YFNF 3F6VA 2PFBA 1LDDA 2HKOA 5L3EA 3O2PE 3BWGA 1TQIA 5E1ZB 5E18F 4EJVA 3IKVA 2MD5A 2Y0MA 3KP2A 4OIOF 2KIMA 1I1SA 1U8RA 3NQOA 4UV8A 2WV0A 3ZMVA 1SMTA 3ZMDA 4AIJA 4FHTA 2F5DA 3LSTA 4R1HA 1U3EM 5D4RA 1J5YA 3HOTA 2FNPA 4UVCA 1J2XA 2L54A 4OIQF 3V7CA 3DPLC 2IT0A 5DEQA 1MDMA 1QBJA 4GYGA 3I59A 1BN5A 1ODDA 4G8XA 2A68F 2JZYA 3FXRA 1J59A 3CO6C 1LQ1A 3JTGA 1RUOA 3QPTA 3WTUC 4ZZLA 2Z99A 2W25A 1JE8A 2CSOA 2NYXA 3T8TA 3E5UA 1R1TA 1HKSA 5L3CA 5LHGA 3C3WA 3J81Z 2VT2A 3FHZA 2K02A 1YO5C 4OINF 5J8CA 4YFKF 1R1VA 2VT3A 3GZ6A 2LKPA 2JPBA 5A2QK 1IUYA 4RB3C 3BJ6A 5LGNA 5AIQA 2PLYA 2FMYA 2EV0A 3QU6A 3RTRA 1ZREA 2XAQA 2VBXA 5L3BA 3K1MA 1R5GA 2W85A 3BJAA 1ZLJA 1UFMA 2XKPA 2CWEA 1TNSA 1W7PD 4E70A 3F23A 3PQKA 4HA8A 1V4RA 3SQNA 2RKHA 2NRAC 3LAJA 2VOPA 1S7OA 3ZP5A 5H20A 4HYEA 2FMLA 1TLHB 4WXDA 1FPQA 4YG2F 1B59A 5ILUA 3WTSC 4UXNA 2P5LC 1P92A 2NNYA 3Q9SA 3C18A 3T5XA 2W84A 2HQRA 1ZYRF 1ZN2A 2KRFA 2XIGA 2Z33A 4IHSA 3ABUA 4LB5A 2ZBKA 1FOKA 2HYGD 2EA4A 4ESBA 2X4HA 5ICEA 1YQAA 1KQ0A 4U7DA 4MEYF 3B73A 3E6BA 1FYMA 1BC8C 4P9FA 1FWZA 3RKYA 3L00A 4P96A 1D8KA 3QAHA 1Z7UA 1FSEA 3SHFA 5FLXK 3H3UA 4EGZA 4PDKA 3K2ZA 2P5VA 1NHAA 2PN6A 1W7PB 5HLHA 2M87A 4B09A 2VODA 5KVRA 3JSPA 2FQ3A 3RIRA 2EFQA 2NS0A 3HOSA 5LHIA 4LMYA 2DT5A 1J9IA 3HSEA 2QQ9A 4G9YA 3TDZC 3DF8A 4IVNA 3GLXA 5CVIA 4WX9A 2XAFA 3HRTA 1IN6A 3KP7A 5CYVA 2RVCA 3MCZA 2GIVA 4Q5SF 2F5FA 5CVVA 4ENJA 4A0YA 1K78B 1IZ1A 2E1NA 2PG4A 4B8XA 2BYVE 2EFPA 1EH7A 1H9GA 2JT1A 2K86A 3K0LA 4KUMA 3IKTA 1RIOH 4KFCA 1O7LA 4ETSA 2F5EA 2W24A 2KJBA 1L3LA 3KCCA 1Q1HA 3JTHA 3KP6A 2VOOA 2GWRA 4HLXA 3GZ5A 1USTA 4A6EA 1R1UA 3N97A 1VTNC 4N9HA 3I64A 2DLLA 2ZXJA 3CUQB 4OIPF 2ETHA 2STTA 2FRHA 2W57A 3EYYA 3M8EA 3GVAA 4KYWA 3FZVA 2HGCA 2RNJA 1I5ZA 3WE3A 3E97A 3WODF 1TQPA 2O0YA 3E6CC 3PQJA 5BS6A 3BPVA 1IN4A 2FBIA 4A0ZA 1ULYA 1FZPB 3J80K 2PEXA 3VOEA 1U5TA 4P55A 3ZN0A 3E3VA 2GXGA 1PP7U 4U0YA 5ICGA 3CJNA 4Y13A 4G7HF 2PBIA 2CQKA 3TDUC 3R0JA 5LGUA 2IVMA 2HZTA 2HFHA 1MJBA 1SFEA 5HS8A 1U2WA 4ASNA 4MTDA 3ML6A 1FBSA 1MKMA 3KLNA 1IAWA 1SFUA 2ISZA 3ZMTA 5AIPA 3TKYA 4RB0A 5ICCA 3TQNA 2CFXA 3D5LA 3K69A 2OA4A 3KZZA 5BOXA 4NHJA 1IXCA 2H27A 1XDSA 1O3SA 1HSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHC A;  1V3F A;  2Q8K A;  3VFZ A;  1XD7 A;  2KIF A;  1QPM A;  4I98 B;  3C7J A;  4GO1 A;  1ZH5 A;  1IRG A;  1G4D A;  3R4K A;  1OYY A;  3AAF A;  1YW9 A;  2YSR A;  1WKM A;  1KGS A;  2GA1 A;  2CG4 A;  3IWZ A;  4M6X A;  3PFI A;  3ZMU A;  2FF4 A;  3DPT A;  5FLX Z;  1HQC A;  4EMS A;  5HS9 A;  1IXR C;  4EJW A;  2ZO4 A;  4GCV A;  1STZ A;  4D0P A;  4HF2 A;  3GXO A;  3BJO A;  1LJ9 A;  4LLL A;  1KYZ A;  2ELH A;  4ZYE A;  2D1H A;  4LG0 B;  2EFO A;  2QYO A;  4CZZ A;  3HSR A;  4CHU A;  4Q4Z F;  1DPR A;  1ZRC A;  1GXP A;  5E1W A;  2CGP A;  2Y48 A;  5CLS A;  3WTW C;  1L0O C;  3L7W A;  2ZME A;  1FBU A;  5DD8 A;  1HKT A;  2ESH A;  2G7U A;  4LB6 B;  5DCM A;  1BIA A;  2FXA A;  1G3Y A;  4BHC A;  2FA5 A;  4WCG A;  3TO6 A;  4U7B A;  1ZAR A;  5D5U B;  3ECO A;  4O6J A;  1R7J A;  1G6N A;  2COM A;  1S3J A;  5KK1 A;  3WE2 A;  1RNL A;  5E8G A;  4OMZ A;  4M9S A;  4N9I A;  3OOP A;  2M5W A;  3H92 A;  2V9V A;  4NB5 A;  3F3X A;  1OYI A;  4GGG A;  2M45 A;  1J75 A;  5LHH A;  1TW3 A;  3WGG A;  1PDN C;  1IF1 A;  2EV6 A;  3WG9 A;  1USS A;  3RYR A;  5F1R A;  5HS7 A;  2R7F A;  2EK5 A;  2V1D A;  2Z3Y A;  1XSV A;  2P4W A;  3IHU A;  3T0Y A;  3TOB A;  2HR3 A;  4I0B A;  3T1B A;  3CUQ A;  3E5X A;  1O7F A;  3G3Z A;  3SFZ A;  3EUH A;  1HW1 A;  2QZ8 A;  4M74 A;  1R00 A;  2Q0O A;  2XAJ A;  2GXB A;  2YPR A;  3T8R A;  2BEO A;  2QBY A;  2XRN A;  4YII A;  1FNN A;  4TV7 A;  3V8J A;  2PMH A;  1UHW A;  4MQV A;  5K1Y A;  2KJC A;  4IF4 A;  5FFX A;  2VBY A;  3U1D A;  1LDJ A;  1P4X A;  1JXS A;  3KET A;  1ZRD A;  2L01 A;  4BAY A;  3J7A O;  4BHB A;  1P6R A;  2OBP A;  4QLC U;  4EVI A;  4RGS A;  3CDH A;  4EV0 A;  1XSX A;  4PZJ A;  2MH2 A;  1LDK B;  4HX7 A;  4U0W A;  5JI6 A;  3P7N A;  2XHK A;  3I59 B;  1F1Z A;  2UXN A;  4IRH A;  3WTZ A;  1XGO A;  3BPX A;  3SZT A;  2GAU A;  2QM3 A;  2K7L A;  3BRO A;  2M8E A;  2QQA A;  2VBW A;  4K2E A;  5IT9 K;  2E7W A;  5ICF A;  3VOD A;  1ZHF A;  4WXH A;  1G3T A;  2A3S A;  5LEJ A;  4HX4 A;  3U9G A;  4FT8 A;  2E7X A;  3GW2 A;  4BQA A;  4HQE A;  3NEU A;  5JVT A;  1A04 A;  2K4J A;  4ON0 A;  3GYH X;  4BHP A;  2IRF G;  1ZG1 A;  5J8F A;  4RB1 A;  4I0A A;  2XUB A;  4LLG F;  2FSW A;  3HUG A;  1KU2 A;  5FD5 A;  2OZU A;  1LEA A;  3LA2 A;  2ACJ A;  1E2X A;  3FWE A;  2A61 A;  4JBA A;  1XDU A;  3IWF A;  1SAX A;  4PGG A;  5ILV A;  2J5O A;  4L18 B;  2FBK A;  3IRQ A;  2FU4 A;  4RGU A;  4HQM A;  3NRV A;  4DQ2 A;  3ISP A;  3MZY A;  4ENM A;  5CVR A;  2HS5 A;  3FMQ A;  3S2W A;  5L3G A;  3C1D A;  2PI0 A;  3TOA A;  5K5O A;  1YG2 A;  3GWZ A;  1U5T C;  4M73 A;  2A6H F;  1YS7 A;  3ERE D;  3JSO A;  4HX8 A;  2IPQ X;  2QEN A;  4BH9 A;  1D5V A;  4I7H A;  1LEB A;  2STW A;  4I2O A;  2NNN A;  5ERI A;  1W4M A;  2RQP A;  5CVJ A;  1DPU A;  3GFI A;  1O3Q A;  3CUO A;  3WTX C;  5JFR A;  2LF7 A;  3RPQ A;  4ZH4 F;  3GF2 A;  1KQ8 A;  2BE5 F;  3BZ6 A;  4RB2 C;  1FP1 D;  3RI4 A;  3JAM Z;  2AS5 F;  1FC3 A;  1OKR A;  1JHH A;  5DV5 A;  1B4A A;  4A6D A;  4WWC A;  3E6M A;  3BY6 A;  2Z9O A;  2XAS A;  4IHT A;  1KYW A;  2H94 A;  4LK1 F;  3QP6 A;  4XSZ F;  4HZF A;  2NAZ A;  5L3F A;  2VN2 A;  5L3D A;  4A12 A;  4H0E A;  4GXO A;  2QWW A;  6PAX A;  1OYW A;  3HRM A;  1R5H A;  4Y15 A;  1KU7 A;  3COA C;  2ZFW A;  1R58 A;  1PUE E;  2PQ8 A;  2EV5 A;  1ONV A;  4M6Y A;  1F9N A;  4UHT A;  1IN7 A;  4UV9 A;  4HOB A;  3J80 Z;  4RS8 A;  1T0F A;  4WK8 F;  2IP2 A;  1H9T A;  4IRI A;  4UNO A;  1SFX A;  4IPA A;  4KA4 A;  5FO5 A;  3LA7 A;  4LJZ F;  2IA0 A;  3K1N A;  3L2C A;  1QQI A;  2ESN A;  4NQW A;  2A5Y B;  5IT3 A;  4ESJ A;  4G94 A;  3ULQ B;  5DYM A;  4HW0 A;  1KU3 A;  4I01 A;  4AVP A;  2F5C A;  2VON A;  5DUK A;  2DQL A;  1KQ9 A;  1DUX C;  2Z5U A;  1JHF A;  2YX7 A;  3JW4 A;  2HEO A;  2EB7 A;  3QOP A;  4PGH A;  3EQL F;  1LB2 A;  2EJR A;  1P2F A;  4BYY A;  3J81 K;  2QLZ A;  3GUD A;  5TJJ A;  2LF8 A;  4CO8 A;  1CGP A;  3M8F A;  1G3W A;  2HKX A;  3HHH A;  2HOE A;  3MZH A;  3EET A;  4R8H A;  5HDN A;  1W7P A;  3KP4 A;  3L09 A;  3I58 A;  4CYD A;  2PJP A;  2R3S A;  3U2R A;  2HTS A;  2P5K A;  4OMY A;  1R23 A;  2H09 A;  5E17 F;  1F4K A;  1TTY A;  3HYI A;  1BIB A;  3IL2 A;  3D0S A;  1IN8 A;  3QRF F;  3P9K A;  2OD5 A;  4U0V A;  4MTE A;  1BC7 C;  4OOI A;  4AWX B;  1SD6 A;  4KN7 X;  5F64 A;  4L9V A;  2M30 A;  5LGT A;  1MZB A;  4L9N A;  3ZMZ A;  3KEO A;  2D1V A;  3F6O A;  4MHG A;  2J5P A;  2DTR A;  1KA8 A;  4LD5 A;  4EJT A;  1YS6 A;  2CO5 A;  4S04 A;  4AIH A;  3KLO A;  2L02 A;  1SD7 A;  4RGX A;  3F72 A;  1K6O A;  3LA3 A;  1BI1 A;  2FNA A;  3WTT C;  1W5T A;  2ZME B;  1IN5 A;  4CXF A;  4HAM A;  3HSF A;  1ZGJ A;  3WGH A;  4L5J A;  2JPC A;  3WU1 B;  3RYP A;  1FT9 A;  4MEX F;  1WSU A;  3MFK A;  2O8X A;  1BOA A;  4L9J A;  1BI2 A;  3ELK A;  3KEQ A;  5BPD A;  2DU9 A;  2XGX A;  2ZNZ A;  2D2W A;  5AON A;  2XV4 S;  4BXU A;  5K5Q A;  3RJP A;  5HVQ C;  5D6F A;  3N4M A;  4JK1 X;  3DP7 A;  1BI0 A;  1RZ4 A;  1SMY F;  2DK5 A;  3MQ0 A;  3VEP A;  2DK8 A;  1I6X A;  1I1G A;  3W6J B;  5FGM A;  5DCF A;  1UB9 A;  1XCB A;  2PMU A;  2OQG A;  2HTJ A;  3KZY A;  1REP C;  2UWM A;  2WC2 A;  4YIF A;  3FX3 A;  2UXX A;  1S8N A;  2OAZ A;  1U5T B;  1DDN A;  4Q47 A;  4HLY A;  4RGR A;  1ZLK A;  2GQQ A;  4KIG A;  3M7G A;  4HDV A;  5FFZ A;  2FEZ A;  1S6L A;  1TW2 A;  3KE2 A;  2FOK A;  2A6E F;  5D4S A;  2MLK A;  4YFX F;  2DBB A;  3O3K A;  2R7D A;  5K5R A;  2XAG A;  3F21 A;  2ZKZ A;  4G7Z F;  1MJ9 A;  1FP2 A;  1ZAO A;  5D6E A;  4Y17 A;  1FSH A;  2MA3 A;  2IW5 A;  2D45 A;  2AXL A;  3CTA A;  1ZG3 A;  2IA1 A;  1X3U A;  5D8L B;  1RUN A;  1SD5 A;  3G73 A;  4L0Z B;  3GFM A;  5BPI A;  3ABT A;  5DD4 A;  2QBY B;  1Z9C A;  2EFW A;  4I02 A;  3FF5 A;  1XMK A;  2ADU A;  3CLO A;  3RKW A;  4A5M A;  2HDC A;  1HXD A;  1HW5 A;  2C6Y A;  4EQQ A;  2P6S A;  4G7O F;  1UHM A;  4MQ9 F;  1P4A A;  5LRS A;  1XB4 A;  2QVO A;  3R0A A;  2VE8 A;  1R22 A;  4HV5 A;  2OQR A;  3HRS A;  2G9W A;  1IRF A;  2ZNY A;  3LQQ A;  1MJA A;  3P9I A;  1XMA A;  1FBQ A;  1XGN A;  3JAM K;  1ZRF A;  2ZJ2 A;  4A0X A;  4ZZD A;  4XLN F;  3DKW A;  2FE3 A;  5E20 A;  1G3S A;  3SXY A;  4EGY A;  3EYI A;  2UZK A;  4WXC A;  4O3M A;  2DFI A;  1TBX A;  2ZCW A;  2MLG A;  1YLF A;  3V8K A;  4LFU A;  4LGW A;  5D5V B;  3R61 A;  1U78 A;  4XSX F;  5ED4 A;  4HF1 A;  1LVA A;  3K9T A;  5LLQ A;  2X0L A;  4HDU A;  1OR7 A;  1WRJ A;  1XSD A;  1F5T A;  2WWY A;  2EWN A;  1T6S A;  4KMU X;  4JQF A;  1BI3 A;  1SD4 A;  4Q48 A;  1J7K A;  2YR2 A;  5LBQ A;  3BOQ A;  2G7H A;  5E8I A;  3WTV C;  3H3Z A;  3F8F A;  3HRU A;  4KNY A;  4L5I A;  1QGP A;  3HTU A;  4KIF A;  5F6F A;  1Z1D A;  5DUI A;  4CDG A;  4WF2 A;  3ECH A;  1OMI A;  4IRG A;  1U6G A;  1Y0U A;  2K4B A;  3M9A A;  3Q9V A;  3TGN A;  3CO7 C;  2JRT A;  3WGI A;  2F2E A;  4KIC A;  3GEZ A;  2RV8 A;  4AIK A;  1IXS B;  2HWV A;  5BQT A;  1MD0 A;  5ILS A;  3BP8 A;  4M9Z A;  1K79 A;  4QWQ A;  3IRR A;  2VE9 A;  1ZGA A;  1ON1 A;  4ZYH A;  4HBL A;  3ZN1 A;  3L9F A;  4KT5 C;  4UVA A;  3RPU A;  1C0W A;  4HF0 A;  4PCQ A;  1O3R A;  3MEX A;  4ZYG A;  3LAP A;  2O03 A;  3QP5 A;  2QQB A;  3FXQ A;  3V7S A;  4XLP F;  1ZG5 A;  1XGM A;  2JTV A;  2EA2 A;  4F7Z A;  5DDG A;  2RC4 A;  2GA2 A;  2VC0 A;  2FBH A;  4ENN A;  3HHG A;  3I4P A;  2KIU A;  1BM9 A;  2V6C A;  1UCR A;  3REO A;  4RAY A;  5HLI A;  4ENK A;  5HDK A;  1FYK A;  4GYI A;  3V8L A;  2BV6 A;  3DV8 A;  3WTY C;  4KMF A;  2RN7 A;  2ISY A;  3FM5 A;  5D5W B;  3V4G A;  3EDP A;  4G6D A;  1HST A;  5E1X A;  4G6Q A;  2L4A A;  4ZYD A;  2YX4 A;  5JHU A;  2LDU A;  1EV7 A;  2MH9 A;  2L3D A;  1GVJ A;  2DPU A;  4UVB A;  4R79 A;  3VB2 A;  2DW4 A;  5IT9 Z;  1E17 A;  1JGS A;  4MGR A;  4N0B A;  1KU9 A;  3K1P A;  3TO9 A;  4FX4 A;  4IJA A;  3HTS B;  4RAZ A;  4FX0 A;  4KIB A;  1AWC A;  5DCM B;  1B6A A;  2K27 A;  1B1B A;  2P7C B;  1S29 A;  2IJL A;  4A2U A;  1QZY A;  2BGC A;  2TDX A;  3M1E A;  1K7A A;  1YW8 A;  2JSC A;  4HV6 A;  1FLI A;  3HIF A;  2RDP A;  3LQR A;  4BNC A;  5TRD A;  4M9X A;  1R36 A;  3DEU A;  3I71 A;  3E6D A;  2DO7 A;  2XKO A;  5D8K B;  1TQM A;  1MGT A;  5FB2 A;  3F22 A;  1O57 A;  3ROU A;  2OU2 A;  2A07 F;  3QPH A;  1WQ2 A;  3ZMS A;  5J6X A;  4OIR F;  3RDI A;  1TNT A;  3LWF A;  2DAO A;  2V1U A;  4M71 A;  2WTE A;  4XBF A;  4CGZ A;  2XVC A;  1Z05 A;  2BBY A;  1B9N A;  4M72 A;  5D5X B;  1PP8 F;  3F8B A;  2GZW A;  1W5S A;  5JR3 A;  5H6R A;  4L0Y B;  3MAJ A;  2LNB A;  1YFH A;  4S05 A;  4IXA A;  4O5V A;  1I27 A;  2CYY A;  4L9T A;  3ZQ7 A;  3WU0 A;  2DQR A;  2KKO A;  1QNT A;  3F8M A;  3FMS A;  2H6C A;  3Q5F A;  1Z6T A;  5HLG A;  2VBZ A;  5BMZ A;  3FM3 A;  1T98 A;  1MDM B;  2E1C A;  1IW7 F;  2VC1 A;  3LFK A;  1BJA A;  3I0T A;  3I5U A;  1DP7 P;  4EM2 A;  3IC7 A;  3F8C A;  5LEK A;  1Z6R A;  1O3T A;  4P5O A;  4Z2Y A;  1LNW A;  1D8J A;  3R6S A;  5HOO A;  3GO5 A;  1H0M A;  3KFW X;  2M1B A;  4MNU A;  4A5N A;  1T2K A;  1WI9 A;  2CW0 F;  5HDG A;  1WWX A;  2OZ6 A;  4EM1 A;  2Q2E A;  4LK0 F;  1YYV A;  2HYF A;  3DXJ F;  3TO7 A;  1P4W A;  1AOY A;  1FX7 A;  1OPC A;  1RI7 A;  3I54 A;  4KDP A;  1D3Y A;  1Z91 A;  3GFL A;  3SZP A;  1XN7 A;  1GXQ A;  2YU3 A;  5FD6 A;  1J0R A;  2P8T A;  2HQN A;  1ON2 A;  3GFJ A;  4LLN A;  4KN4 X;  3BDD A;  1YW7 A;  2MC3 A;  2H6B A;  4LG0 A;  3B02 A;  5H6Q A;  3R60 A;  2P6T A;  3DQV C;  1HKQ A;  3RKX A;  1CF7 B;  1QZZ A;  2VXZ A;  1EH8 A;  2EFN A;  2Y75 A;  3O6B B;  1K78 A;  3DFG A;  2O61 A;  1T39 A;  5LRR A;  1YIO A;  5EEH A;  5CJ9 A;  2A69 F;  3MWM A;  1HBX G;  4XRF A;  3FXU A;  2DI3 A;  3V7R A;  1FYL A;  3OV8 A;  2V1X A;  2B0L A;  3I53 A;  5CVU A;  4UUV A;  1BBY A;  1T38 A;  1B9M A;  1CF7 A;  3ZPL A;  5A2Q Z;  3E5Q A;  4DNC A;  2QUF A;  2DPD A;  3KP3 A;  3W6K B;  1XGS A;  2L4M A;  1S7A A;  3FMR A;  2O3F A;  2V79 A;  3KP5 A;  1FY7 A;  3P9C A;  4ESF A;  3F8N A;  2IA2 A;  5EEG A;  2XAH A;  4EM0 B;  2LSO A;  4P9U A;  1YTY A;  4I09 A;  4EJU A;  4AD9 A;  3CUQ C;  1XCV A;  4U88 A;  1EH6 A;  2P7V B;  4EJO A;  2RGV A;  2MBF A;  1QO0 D;  4OU0 A;  2O6G E;  1HW2 A;  3QU3 A;  2XRO A;  4CIC A;  3GX4 X;  4YFN F;  3F6V A;  2PFB A;  1LDD A;  2HKO A;  5L3E A;  3O2P E;  3BWG A;  1TQI A;  5E1Z B;  5E18 F;  4EJV A;  3IKV A;  2MD5 A;  2Y0M A;  3KP2 A;  4OIO F;  2KIM A;  1I1S A;  1U8R A;  3NQO A;  4UV8 A;  2WV0 A;  3ZMV A;  1SMT A;  3ZMD A;  4AIJ A;  4FHT A;  2F5D A;  3LST A;  4R1H A;  1U3E M;  5D4R A;  1J5Y A;  3HOT A;  2FNP A;  4UVC A;  1J2X A;  2L54 A;  4OIQ F;  3V7C A;  3DPL C;  2IT0 A;  5DEQ A;  1MDM A;  1QBJ A;  4GYG A;  3I59 A;  1BN5 A;  1ODD A;  4G8X A;  2A68 F;  2JZY A;  3FXR A;  1J59 A;  3CO6 C;  1LQ1 A;  3JTG A;  1RUO A;  3QPT A;  3WTU C;  4ZZL A;  2Z99 A;  2W25 A;  1JE8 A;  2CSO A;  2NYX A;  3T8T A;  3E5U A;  1R1T A;  1HKS A;  5L3C A;  5LHG A;  3C3W A;  3J81 Z;  2VT2 A;  3FHZ A;  2K02 A;  1YO5 C;  4OIN F;  5J8C A;  4YFK F;  1R1V A;  2VT3 A;  3GZ6 A;  2LKP A;  2JPB A;  5A2Q K;  1IUY A;  4RB3 C;  3BJ6 A;  5LGN A;  5AIQ A;  2PLY A;  2FMY A;  2EV0 A;  3QU6 A;  3RTR A;  1ZRE A;  2XAQ A;  2VBX A;  5L3B A;  3K1M A;  1R5G A;  2W85 A;  3BJA A;  1ZLJ A;  1UFM A;  2XKP A;  2CWE A;  1TNS A;  1W7P D;  4E70 A;  3F23 A;  3PQK A;  4HA8 A;  1V4R A;  3SQN A;  2RKH A;  2NRA C;  3LAJ A;  2VOP A;  1S7O A;  3ZP5 A;  5H20 A;  4HYE A;  2FML A;  1TLH B;  4WXD A;  1FPQ A;  4YG2 F;  1B59 A;  5ILU A;  3WTS C;  4UXN A;  2P5L C;  1P92 A;  2NNY A;  3Q9S A;  3C18 A;  3T5X A;  2W84 A;  2HQR A;  1ZYR F;  1ZN2 A;  2KRF A;  2XIG A;  2Z33 A;  4IHS A;  3ABU A;  4LB5 A;  2ZBK A;  1FOK A;  2HYG D;  2EA4 A;  4ESB A;  2X4H A;  5ICE A;  1YQA A;  1KQ0 A;  4U7D A;  4MEY F;  3B73 A;  3E6B A;  1FYM A;  1BC8 C;  4P9F A;  1FWZ A;  3RKY A;  3L00 A;  4P96 A;  1D8K A;  3QAH A;  1Z7U A;  1FSE A;  3SHF A;  5FLX K;  3H3U A;  4EGZ A;  4PDK A;  3K2Z A;  2P5V A;  1NHA A;  2PN6 A;  1W7P B;  5HLH A;  2M87 A;  4B09 A;  2VOD A;  5KVR A;  3JSP A;  2FQ3 A;  3RIR A;  2EFQ A;  2NS0 A;  3HOS A;  5LHI A;  4LMY A;  2DT5 A;  1J9I A;  3HSE A;  2QQ9 A;  4G9Y A;  3TDZ C;  3DF8 A;  4IVN A;  3GLX A;  5CVI A;  4WX9 A;  2XAF A;  3HRT A;  1IN6 A;  3KP7 A;  5CYV A;  2RVC A;  3MCZ A;  2GIV A;  4Q5S F;  2F5F A;  5CVV A;  4ENJ A;  4A0Y A;  1K78 B;  1IZ1 A;  2E1N A;  2PG4 A;  4B8X A;  2BYV E;  2EFP A;  1EH7 A;  1H9G A;  2JT1 A;  2K86 A;  3K0L A;  4KUM A;  3IKT A;  1RIO H;  4KFC A;  1O7L A;  4ETS A;  2F5E A;  2W24 A;  2KJB A;  1L3L A;  3KCC A;  1Q1H A;  3JTH A;  3KP6 A;  2VOO A;  2GWR A;  4HLX A;  3GZ5 A;  1UST A;  4A6E A;  1R1U A;  3N97 A;  1VTN C;  4N9H A;  3I64 A;  2DLL A;  2ZXJ A;  3CUQ B;  4OIP F;  2ETH A;  2STT A;  2FRH A;  2W57 A;  3EYY A;  3M8E A;  3GVA A;  4KYW A;  3FZV A;  2HGC A;  2RNJ A;  1I5Z A;  3WE3 A;  3E97 A;  3WOD F;  1TQP A;  2O0Y A;  3E6C C;  3PQJ A;  5BS6 A;  3BPV A;  1IN4 A;  2FBI A;  4A0Z A;  1ULY A;  1FZP B;  3J80 K;  2PEX A;  3VOE A;  1U5T A;  4P55 A;  3ZN0 A;  3E3V A;  2GXG A;  1PP7 U;  4U0Y A;  5ICG A;  3CJN A;  4Y13 A;  4G7H F;  2PBI A;  2CQK A;  3TDU C;  3R0J A;  5LGU A;  2IVM A;  2HZT A;  2HFH A;  1MJB A;  1SFE A;  5HS8 A;  1U2W A;  4ASN A;  4MTD A;  3ML6 A;  1FBS A;  1MKM A;  3KLN A;  1IAW A;  1SFU A;  2ISZ A;  3ZMT A;  5AIP A;  3TKY A;  4RB0 A;  5ICC A;  3TQN A;  2CFX A;  3D5L A;  3K69 A;  2OA4 A;  3KZZ A;  5BOX A;  4NHJ A;  1IXC A;  2H27 A;  1XDS A;  1O3S A;  1HSJ A; 
#chains in the Genus database with same CATH topology
 1BOB A;  3H9G A;  1GHC A;  1V3F A;  3SFI A;  2Q8K A;  2RAE A;  3VFZ A;  1XD7 A;  2KIF A;  3L2U A;  1EA3 A;  1QPM A;  2K9Q A;  4I98 B;  4BEH A;  2GOM A;  2ZSI B;  3C7J A;  4GO1 A;  1QPI A;  1ZH5 A;  1IRG A;  1G4D A;  2MGQ A;  2WAF A;  1H88 C;  2VKH A;  3CC4 I;  3CP8 A;  3M4O J;  3R4K A;  3ONQ A;  5LFA A;  1OYY A;  4F92 B;  3AAF A;  2X1E A;  1SVL A;  1YW9 A;  2YSR A;  1WKM A;  2QGU A;  1B72 A;  1KGS A;  1YHQ I;  2GA1 A;  2CG4 A;  3GLL A;  3IWZ A;  2FD5 A;  4M6X A;  3PFI A;  5B3S H;  2ZJP F;  1OCT C;  3HEF A;  3ZMU A;  2FF4 A;  3I56 I;  3DPT A;  4HNV A;  5FLX Z;  1HQC A;  2E36 A;  3M07 A;  4EMS A;  2XPU A;  3PM1 A;  5HS9 A;  2LVS A;  1IXR C;  4EJW A;  2NOG A;  1TT5 B;  2ZO4 A;  2HVR A;  4GCV A;  2BOL A;  3OSG A;  1STZ A;  1V5E A;  2WY8 Q;  4D0P A;  3OYJ A;  1D0Y A;  4HF2 A;  3GXO A;  2BHY A;  3BJO A;  1LJ9 A;  4LLL A;  1KYZ A;  1R9T J;  4IZZ A;  4XLC A;  2ELH A;  4ZYE A;  1JUS A;  3LL7 A;  2D1H A;  2JVG A;  2OV7 A;  4LG0 B;  2EFO A;  3IAS 2;  2QYO A;  4E4H A;  4CZZ A;  3HSR A;  4CHU A;  3HXL A;  4Q4Z F;  1DPR A;  1ZRC A;  1GXP A;  5E1W A;  2CGP A;  1EKE A;  3S1Q J;  1RRJ A;  1ETY A;  2HZD A;  2Y48 A;  2LYC A;  3CLQ A;  1TWG J;  5CLS A;  3WTW C;  1L0O C;  3L7W A;  3I4M J;  2VJI A;  2ZME A;  5J3L A;  5GPA A;  1FBU A;  2ZC2 A;  5DD8 A;  2X6O A;  2IGM A;  2IAI A;  1HKT A;  2ESH A;  3MMY B;  1DU6 A;  2G7U A;  5F0C A;  1XS9 A;  5DM6 F;  4LB6 B;  1RES A;  4BXX J;  4II3 A;  5DCM A;  2QEX I;  1BIA A;  3S1M J;  2FXA A;  1G3Y A;  1PUF B;  3VPR A;  4D5C A;  4BHC A;  2FA5 A;  1FMV A;  1MW7 A;  4CCJ A;  4WCG A;  3TO6 A;  3PO2 J;  4U7B A;  3FKI J;  5M5W J;  1ZAR A;  1HDP A;  2FX0 A;  2XGC A;  2EIK H;  5D5U B;  3ECO A;  1T08 B;  3W2A A;  4O6J A;  5B1B H;  1R7J A;  2AQE A;  1G6N A;  2COM A;  1S3J A;  5KK1 A;  3S8P A;  3WE2 A;  5IOZ A;  1FIP A;  1RNL A;  3S14 J;  4IOA F;  2WY7 Q;  1VQK I;  5E8G A;  1Z3X A;  4OMZ A;  2FQ4 A;  2K3P A;  3J7Y J;  4M9S A;  2DDA A;  4N9I A;  3RPU D;  2MD0 A;  3OYC A;  3OOP A;  2M5W A;  1RR8 C;  4BXF A;  4CH7 A;  3H92 A;  2V9V A;  4NB5 A;  3F3X A;  1RKW A;  2Q1Z B;  3E1S A;  2Z16 A;  1Y39 A;  1OYI A;  1IV6 A;  3CJT B;  4ZTJ A;  4GGG A;  3BG5 A;  2M45 A;  1VQN I;  1J75 A;  3KX2 A;  5LHH A;  1TW3 A;  3WGG A;  1PDN C;  5GTH C;  2EV6 A;  3WG9 A;  1USS A;  3RYR A;  5F1R A;  2R0Q C;  4CSW A;  5HS7 A;  1ZKG A;  2R7F A;  2EBI A;  2EK5 A;  2V1D A;  2Z3Y A;  1VZ0 A;  4XIC A;  1XSV A;  2P4W A;  2FOW A;  3IHU A;  3T0Y A;  1BA5 A;  3TOB A;  2HR3 A;  4ZDL A;  3FXL A;  4HSR A;  5EEA A;  1W1W E;  4I0B A;  3T1B A;  3CUQ A;  3E5X A;  5JHF A;  1O7F A;  2LK2 A;  3G3Z A;  3FBI B;  1TWC J;  3IH2 A;  3SFZ A;  2LD5 A;  3EUH A;  2ECB A;  1MSE C;  4GDF A;  1HW1 A;  4PK4 A;  2QZ8 A;  2VUM J;  4X6A J;  4M74 A;  1R00 A;  5H2F C;  1TL8 A;  3ZQL A;  1D0X A;  1QA6 A;  4LIV A;  2Q0O A;  2XAJ A;  2GXB A;  4C3H J;  2YPR A;  3T8R A;  2BEO A;  2QBY A;  3OL3 A;  2XRN A;  1TC3 C;  2L2O A;  4YII A;  3UNG C;  3H5N A;  1FNN A;  4TV7 A;  4BE1 A;  3V8J A;  2PMH A;  1WJE A;  1UHW A;  3GCM A;  3HGG A;  4HST A;  4MQV A;  2HPM A;  5K1Y A;  2KJC A;  4IF4 A;  5FFX A;  3OMY A;  2YS9 A;  4BY7 J;  2VQL A;  2VBY A;  3U1D A;  1LDJ A;  4MFD A;  1P4X A;  3HM5 A;  1JXS A;  3QYB A;  4QTR A;  3KET A;  2K5C A;  3M1C A;  4AID A;  3H9J A;  3G2B A;  1ZRD A;  2DJI A;  3I9V 2;  3FDY A;  1NG6 A;  2L01 A;  4BAY A;  3J7A O;  4BHB A;  3CCS I;  4KJZ A;  4IEJ A;  1P6R A;  4NNJ A;  4E7Z A;  2OBP A;  1ZGW A;  3UKG A;  3H5A A;  3MVP A;  4QLC U;  3F0C A;  4EVI A;  2DA2 A;  5IP6 A;  4GFB A;  2FJ1 A;  3AG4 H;  4RGS A;  3CDH A;  1B8I A;  2R7X A;  3CC2 I;  4XOT A;  4EV0 A;  1XSX A;  2L5Q A;  4PZJ A;  2MH2 A;  1LDK B;  4OAZ A;  1IF1 A;  4HX7 A;  4U0W A;  5JI6 A;  5TIS C;  3P7N A;  2CQQ A;  3HKZ N;  3HOY J;  2XHK A;  2F4M B;  3I59 B;  1F1Z A;  2UXN A;  4IRH A;  3WTZ A;  1XGO A;  2CUJ A;  3BPX A;  3SZT A;  4M3G A;  1QVU A;  1MIJ A;  2GAU A;  2QM3 A;  2K7L A;  4YEL A;  3BRO A;  2Q2E B;  2M8E A;  2QQA A;  2VBW A;  3A02 A;  4K2E A;  5IT9 K;  2E7W A;  3A1Y A;  5ICF A;  4D7M A;  4JOM A;  3OYK A;  1V5G A;  2ELJ A;  1D1B A;  3GBG A;  3VOD A;  1ZHF A;  1BL0 A;  2AXT C;  3LSR A;  1NH3 A;  4WXH A;  1G3T A;  3D5S C;  2A3S A;  4I99 C;  5LEJ A;  1I39 A;  4HX4 A;  3U9G A;  3G6E I;  4A93 J;  1ETK A;  4FT8 A;  2E7X A;  1W36 D;  5F04 A;  3GW2 A;  1A36 A;  4BQA A;  2HXO A;  4ZJZ A;  4HQE A;  2F5V A;  3NEU A;  5JVT A;  2JA7 J;  1A04 A;  2K4J A;  4ON0 A;  3DU5 A;  1N78 A;  2ZXH A;  3GYH X;  4RA2 A;  4BHP A;  2IRF G;  2CFO A;  2L7K A;  3MKW B;  1ZG1 A;  5J8F A;  4RB1 A;  1AKH A;  4I0A A;  2XUB A;  4LLG F;  5J1R A;  2FSW A;  3OS0 A;  2JA5 J;  3HUG A;  1KU2 A;  5FD5 A;  1S72 I;  2OZU A;  3VYT B;  2HQA A;  3CCQ I;  1LEA A;  2KIQ A;  3LA2 A;  3GTM J;  2DOD A;  2ACJ A;  3CMY A;  2BY3 A;  3ZQF A;  1E2X A;  1R4M B;  3FWE A;  3NAU A;  2A61 A;  4JBA A;  1XDU A;  3ZQQ A;  1SAN A;  3IWF A;  3FXJ A;  5FKK A;  1SAX A;  2CV0 A;  3GTO J;  4PGG A;  5ILV A;  3RZO J;  3ZRG A;  2VQG A;  5HNF A;  2J5O A;  4B1R A;  4L18 B;  2FBK A;  3IRQ A;  2DOA A;  2FU4 A;  2NVY J;  4RGU A;  4HQM A;  3NRV A;  4DQ2 A;  3S2D J;  2VQH A;  3ISP A;  3MZY A;  2V9P A;  4ENM A;  3CCJ I;  5CVR A;  2E60 A;  2HS5 A;  3FMQ A;  3S2W A;  5L3G A;  1E3O C;  1S5L C;  3C1D A;  2PI0 A;  3TOA A;  4HEA 2;  4CCM A;  1YG2 A;  3GWZ A;  3LMM A;  3TW7 A;  5K5O A;  3JRG A;  3ZOB A;  2DMQ A;  1U5T C;  3CQZ J;  4UB6 C;  4M73 A;  2A6H F;  4IHY A;  1YS7 A;  3OYE A;  3OYL A;  1ZEL A;  3ERE D;  4J01 A;  3JSO A;  4HX8 A;  2IPQ X;  2QEN A;  4BH9 A;  1U9O A;  4A69 C;  1D5V A;  4I7H A;  4DIQ A;  3CCV I;  1LEB A;  2CUF A;  3HDD A;  2NVT J;  2STW A;  4I2O A;  2NNN A;  5ERI A;  1W4M A;  2KRC A;  1DU0 A;  2RQP A;  2IXS A;  5CVJ A;  2ZB9 A;  1DPU A;  3GFI A;  1R49 A;  1O3Q A;  3CUO A;  3WTX C;  1XX5 A;  2JA6 J;  2KT0 A;  2LBF B;  2E19 A;  4F91 B;  5JFR A;  2LF7 A;  3RPQ A;  4A3K J;  4ZH4 F;  3GF2 A;  3IH3 A;  1KQ8 A;  2BE5 F;  3BZ6 A;  4RB2 C;  4B4C A;  1FP1 D;  1QVT A;  3RI4 A;  2JA2 A;  3O8G A;  3JAM Z;  4U87 A;  2AS5 F;  2OC6 A;  2ZXI A;  1FC3 A;  3K4L A;  4H4K C;  1OKR A;  4XN0 A;  1JHH A;  1H89 C;  5DV5 A;  5F08 A;  4XQF A;  3JRI A;  1B4A A;  3HG9 A;  2BY1 A;  4A6D A;  3DTE A;  4WWC A;  2LTP A;  3E6M A;  3HC7 A;  3BY6 A;  1IDY A;  3DEE A;  3K4C A;  3E0J B;  2NVX J;  3TW6 A;  3BC8 A;  3PIO F;  2Z9O A;  3LSI A;  2XAS A;  3LSM A;  2VPR A;  4IHT A;  1KYW A;  2H94 A;  5IYC J;  4LK1 F;  3QP6 A;  4XSZ F;  4IHX A;  4RLQ A;  4HZF A;  1GVD A;  2NAZ A;  5L3F A;  4A3F J;  2KIS A;  2VN2 A;  1MBH A;  5L3D A;  2ID3 A;  4IOC F;  4IKF A;  4A12 A;  3A4C A;  4V2F A;  1W0T A;  4H0E A;  4GXO A;  2QWW A;  6PAX A;  1OYW A;  4CA0 A;  5B66 C;  3HRM A;  1ENH A;  4C9Y A;  3PSI A;  1HA8 A;  3OWT A;  1R5H A;  4JX5 A;  4Y15 A;  2VAS A;  3BCB A;  5E79 C;  1KU7 A;  3COA C;  1VQ4 I;  2ZFW A;  1R58 A;  1PUE E;  2PQ8 A;  3GTQ J;  2EV5 A;  1JUM A;  1ONV A;  4M6Y A;  1FMW A;  1F9N A;  2DMU A;  2O5R A;  4UHT A;  1IN7 A;  4UV9 A;  4XMY A;  2W00 A;  4N4O B;  3HZJ A;  4HOB A;  2MSY A;  3WG7 H;  3RKQ A;  1IUF A;  1V55 H;  3J80 Z;  4DYR A;  4RS8 A;  1JI8 A;  1T0F A;  4WK8 F;  2IP2 A;  2EZI A;  3CP2 A;  1H9T A;  4IRI A;  4UNO A;  1SFX A;  3IUO A;  2V9K A;  4IPA A;  1UMQ A;  4B43 A;  1JKR C;  1I50 J;  3DTK A;  4F93 B;  1XG1 A;  4KA4 A;  5FO5 A;  2R5Z B;  4XM3 A;  3BG7 A;  3F9K A;  3LA7 A;  2FUG 2;  4LJZ F;  2E5Z A;  2IA0 A;  1PJR A;  1JJ8 C;  3K1N A;  3L2C A;  1QQI A;  2HOS A;  1OIS A;  2ESN A;  1X4O A;  4NQW A;  2A5Y B;  3V42 A;  5IT3 A;  2LOO A;  4ESJ A;  4G94 A;  3TBI A;  3CCL I;  3VYR B;  3ULQ B;  2LY9 A;  5DYM A;  4HW0 A;  4BE2 A;  1KU3 A;  1AKH B;  4I01 A;  2KHM A;  4AVP A;  2F5C A;  2VON A;  5DUK A;  2DQL A;  2RNG A;  3QPL A;  1FOX A;  1KQ9 A;  3Q0U A;  1OCR H;  1R71 A;  1DUX C;  2Z5U A;  1JHF A;  1Z7L A;  2YX7 A;  1MBK A;  3JW4 A;  1MH4 A;  4XNF A;  5GTI C;  2HEO A;  2EB7 A;  1VF9 A;  4PSX A;  5F27 A;  3QOP A;  1RR7 A;  5C4X J;  1SVM A;  2VLA A;  2DN0 A;  4PGH A;  3EQL F;  1POG A;  1LB2 A;  2EJR A;  3ZGK A;  2XPV A;  2NS8 A;  1P2F A;  1LFP A;  4BYY A;  5IY5 H;  3G1O A;  3J81 K;  1QZE A;  2QLZ A;  4BL0 B;  3GUD A;  5TJJ A;  2LF8 A;  4CO8 A;  1CGP A;  3M8F A;  3ABK H;  1G3W A;  4RBO A;  2QA4 I;  1VQL I;  2HKX A;  2KL4 A;  2R7W A;  3HHH A;  2HOE A;  3MZH A;  2K9N A;  3EET A;  3W2V A;  5KCM A;  3CZ6 A;  3DBH B;  4R8H A;  5HDN A;  1W7P A;  1Y56 A;  3KP4 A;  3L09 A;  3I58 A;  3Q3S A;  4CYD A;  1F36 A;  1U0J A;  2PJP A;  2IS1 A;  3KYL A;  2R3S A;  3U2R A;  2HTS A;  1GLN A;  2P5K A;  4LOC A;  4OMY A;  1OJL A;  1R23 A;  2L7M P;  4ZDO A;  2RRE A;  3TL4 X;  2CJJ A;  2EZH A;  2H09 A;  5E17 F;  4KT6 A;  1OFC X;  1TTY A;  2M4G A;  4XKV A;  1F4K A;  2F4I A;  1X1A A;  2H1L A;  3HYI A;  1BIB A;  3IL2 A;  2W1O A;  3D0S A;  3VYU B;  1IN8 A;  5FLM J;  3JRD A;  3JRA A;  3QRF F;  2CQX A;  1J09 A;  3KYD B;  3P9K A;  2OD5 A;  4U0V A;  2XSJ C;  4MTE A;  2ZSH B;  1BC7 C;  4RM3 A;  3BTJ A;  4OOI A;  2NOJ B;  1IRZ A;  4AWX B;  1SD6 A;  4KN7 X;  1R4N B;  2X9D A;  5F64 A;  4E7L A;  3LFU A;  4L9V A;  2M30 A;  5M5Y J;  3CD6 I;  3FK7 A;  3HL2 A;  5LGT A;  5C3E J;  5EYR A;  1MZB A;  2R7O A;  1HLV A;  3ASO H;  4L9N A;  3ZMZ A;  4C3J J;  3KEO A;  3PL8 A;  2E2J J;  2D1V A;  3F6O A;  4GRI A;  4MHG A;  2J5P A;  1D1C A;  1VQO I;  2DTR A;  3G1L A;  1KA8 A;  4LD5 A;  4EJT A;  1YS6 A;  2CO5 A;  1WJ5 A;  5FRO A;  3L2W A;  2IS4 A;  4S04 A;  4AIH A;  4C3I J;  3KLO A;  3S93 A;  2BHZ A;  1X1P A;  4AUX A;  2L02 A;  1SD7 A;  4RGX A;  3SZG A;  3VSK A;  2LKS A;  3F72 A;  3OS1 A;  1K6O A;  3JRE A;  3LA3 A;  1BI1 A;  3S17 J;  2FNA A;  2X6Y A;  2XF7 A;  3WTT C;  3RQ4 A;  4DZP A;  2WAQ A;  3WHB A;  3H5R A;  4JX4 A;  2VQC A;  2CU7 A;  1OCP A;  3RSN A;  1JUP A;  1MNM C;  1W5T A;  2QF7 A;  3GZN B;  1UG2 A;  2OTL I;  2ZME B;  4W1U A;  4HG2 A;  1IN5 A;  4CXF A;  4HAM A;  4Y7N J;  2B63 J;  3GTP J;  3DTI A;  2JMW A;  3HSF A;  1ZGJ A;  3WGH A;  3PNV A;  4ZC3 A;  4L5J A;  2HYJ A;  2JPC A;  5M3F J;  5FKM A;  3WU1 B;  4XKC A;  1FT9 A;  1MMG A;  3RYP A;  2LRD A;  1FOY A;  1WSU A;  4MEX F;  3RCO A;  2DA7 A;  3M3Y J;  2QCO A;  1YJN I;  3MFK A;  1I3Q J;  1IRX A;  2O8X A;  4JP0 A;  2H8R A;  4A3D J;  1BOA A;  4DZJ A;  4L9J A;  1BI2 A;  1RET A;  3ELK A;  1MBJ A;  3AG1 H;  1Y1W J;  2COB A;  3KEQ A;  5BPD A;  3A0H C;  5C44 J;  1B8I B;  2DU9 A;  2XGX A;  2ZNZ A;  3MD2 A;  5B1A H;  2D2W A;  5AON A;  2XV4 S;  2KDZ A;  3PJR A;  2V26 A;  4BXU A;  5K5Q A;  2DCE A;  3RJP A;  1E0E A;  5HVQ C;  3HUG B;  5D6F A;  5J1U A;  4JK1 X;  3DP7 A;  3BG3 A;  1BI0 A;  1RZ4 A;  1SMY F;  3K10 A;  3N4M A;  1K61 A;  1OR7 C;  2DK5 A;  3MQ0 A;  1RKT A;  3K4M A;  2BY0 A;  2M0C A;  2KLO A;  4M3B A;  1X2N A;  3VEP A;  2DK8 A;  1I6X A;  3WU2 C;  1UG0 A;  1I1G A;  3W6J B;  5FGM A;  5DCF A;  3QOD A;  1I6H J;  1QU3 A;  1UB9 A;  1XCB A;  2PMU A;  5IYD J;  2OQG A;  2HTJ A;  2VJ4 A;  3S3N A;  3KZY A;  1REP C;  2CW8 A;  1YE9 A;  2KPM A;  2UWM A;  4BUP A;  4PUS A;  2WC2 A;  2EIJ H;  3LSH A;  4E7K A;  3J7Z I;  4YIF A;  2JK3 A;  3FX3 A;  1G2H A;  2UXX A;  1S8N A;  2OAZ A;  1QRY A;  1U5T B;  3TMO A;  1IC8 A;  1GT0 C;  1DDN A;  4Q47 A;  4HLY A;  4RGR A;  4BBS J;  2M2E A;  2I8D A;  1ZLK A;  2R5Y A;  2GQQ A;  1HOM A;  4KIG A;  3M7G A;  4HDV A;  5FFZ A;  2FEZ A;  1S6L A;  1TW2 A;  3K4B A;  3KE2 A;  1JJ6 C;  2FOK A;  2QSH X;  2A6E F;  5GAD J;  5D4S A;  1LE8 B;  2MLK A;  4YFX F;  4BS9 A;  2DBB A;  3FKJ A;  3O3K A;  4V19 K;  2R7D A;  5K5R A;  1Y6I A;  2BXY A;  4II2 A;  2XAG A;  3F21 A;  2ZKZ A;  4G7Z F;  1LKX A;  1FP2 A;  1MJ9 A;  2DFH A;  2VB6 A;  2Y9Y A;  4E6K G;  1ZAO A;  5D6E A;  2KZG A;  4Y17 A;  2MAB A;  3G1M A;  1FSH A;  2ZFU A;  2MA3 A;  1OLT A;  3JRH A;  1WJA A;  4XK4 A;  1X3Z B;  2IW5 A;  2D45 A;  2HPI A;  1X1C A;  2AXL A;  3CTA A;  4HNU A;  4I6Z A;  4BQQ A;  3BT9 A;  1ZG3 A;  2CQ7 A;  4DGW B;  2IA1 A;  1ACI A;  2OCE A;  1WH7 A;  2DJN A;  1X3U A;  2VKD A;  5D8L B;  1RUN A;  5M5X J;  5HLT A;  1SD5 A;  1SC7 A;  2MFZ A;  3G73 A;  4L0Z B;  3GFM A;  2Y69 H;  1R6R A;  3JCU C;  2OPT A;  5BPI A;  3ABT A;  5DD4 A;  4D7N A;  3G4S I;  1MNE A;  2QBY B;  1Z9C A;  3BG6 A;  2EFW A;  2EZL A;  4IX7 A;  3MN2 A;  3CCE I;  4I02 A;  3FF5 A;  1XMK A;  2ADU A;  4LIU A;  3CJQ B;  3CLO A;  3RKW A;  4A5M A;  2ID6 A;  1HXD A;  5E3L A;  5BNG A;  2HDC A;  1HW5 A;  2BVL A;  2M0M A;  2F4O B;  5M3M J;  2C6Y A;  4AM3 A;  4EQQ A;  2P6S A;  1UZC A;  3PFY A;  2HVS A;  2DDB A;  4P1W A;  1A35 A;  4G7O F;  4M3F A;  2IEK A;  3M8J A;  4L5E A;  4S0H B;  1UHM A;  4MQ9 F;  3H9Q A;  3SJM A;  5EZG A;  1P4A A;  2VPL A;  1VI0 A;  5LRS A;  1XB4 A;  5J47 A;  5FKN A;  2QVO A;  2W4S A;  3B6C A;  3R0A A;  2VE8 A;  1R22 A;  4HV5 A;  2QSF X;  1YJ9 I;  1ERD A;  2OQR A;  3HOZ J;  3H36 A;  3HRS A;  3OYB A;  1I3A A;  4G12 A;  2G9W A;  1IRF A;  3SDG A;  2GLO A;  2ZNY A;  3LQQ A;  1MJA A;  4AYB A;  3P9I A;  1P7J A;  1XMA A;  1M1E B;  1ETO A;  1FBQ A;  5K7H A;  2VL8 A;  1K4T A;  1XGN A;  3S16 J;  3HB9 A;  3JAM K;  1ZRF A;  2ZJ2 A;  2WAQ N;  3WHC A;  4A0X A;  4ZZD A;  1WJB A;  1E3H A;  4XLN F;  3DKW A;  4Y4R A;  2FE3 A;  5E20 A;  3PSF A;  1G3S A;  4NUB A;  5GP9 A;  1BR1 A;  3HOX J;  5FLV A;  3SXY A;  2M3A A;  4EGY A;  3EYI A;  1N77 A;  2UZK A;  4E7J A;  4WXC A;  4O3M A;  2DFI A;  2X1C A;  2XF6 A;  1TBX A;  2AHQ A;  4LG3 A;  2ZCW A;  4F55 A;  1NK2 P;  3DCF A;  4KIS A;  2MLG A;  1YLF A;  3V8K A;  4G6T B;  4ZTF A;  4LFU A;  1WI3 A;  4XLF A;  1YIT I;  2CW7 A;  2I10 A;  4PJN A;  4LGW A;  5D5V B;  3R61 A;  1U78 A;  4XSX F;  5ED4 A;  3OR1 C;  5GPC A;  5CPR B;  1LVA A;  4HF1 A;  3K9T A;  2O7O A;  2D5V A;  5F1J A;  5LLQ A;  2X0L A;  4HDU A;  4M3E A;  3N05 A;  2ECC A;  3IV5 A;  1OR7 A;  2AQF A;  1WRJ A;  1XSD A;  2DFE A;  1F5T A;  4X0G A;  2WWY A;  2VIX A;  1ZR4 A;  2EWN A;  1T6S A;  4KMU X;  2R5Z A;  1N25 A;  4JQF A;  4BE0 A;  2JUC A;  1BI3 A;  1SD4 A;  4Q48 A;  3SEZ A;  1J7K A;  2W48 A;  3DLA A;  2YR2 A;  5LBQ A;  5J1Y A;  2VJJ A;  2IGO A;  3BOQ A;  1RPW A;  2LBF A;  5IYB J;  1IG7 A;  3OL4 A;  1VFC A;  2G7H A;  2VKE A;  5E8I A;  2CV1 A;  1Y1V J;  3BZC A;  3WTV C;  3H3Z A;  4RAF A;  3CCM I;  2L9V A;  3F8F A;  2ELK A;  3CMA I;  2IS2 A;  2LY1 A;  3HRU A;  3PUB A;  4L5I A;  4KNY A;  1QGP A;  4A3M J;  1JKP C;  3HTU A;  4KIF A;  4B47 A;  5JVG F;  5F6F A;  1Z1D A;  1MBG A;  3O8H A;  5DUI A;  1ZK8 A;  1Z3Y A;  1IDZ A;  4CDG A;  5E3N A;  4WF2 A;  1D1A A;  4IO9 F;  3ECH A;  1OMI A;  2K9S A;  2WAE A;  4NC6 A;  4X1E A;  5KAI C;  2L7F P;  4IRG A;  3GTG J;  1U6G A;  4IQJ A;  1Y0U A;  2K4B A;  1H8A C;  4A3G J;  3M9A A;  3Q9V A;  4XR6 A;  2XDV A;  3TGN A;  3CO7 C;  5DM7 F;  2JRT A;  4A3B J;  3CC7 I;  3A0B C;  3WGI A;  3VWB A;  2F2E A;  4KIC A;  3GEZ A;  1WPK A;  3UR3 C;  2M4K A;  2EQR A;  2A6T A;  2P0W A;  2QKM B;  2R7R A;  3CCU I;  3VDX A;  4B3A A;  2RV8 A;  2NVQ J;  4AIK A;  1IXS B;  4XKB A;  2HWV A;  5E3O A;  3DKX A;  5BQT A;  1MD0 A;  5ILS A;  3BP8 A;  2GIZ A;  4M9Z A;  2HVQ A;  1Z77 A;  2OTJ I;  2DA5 A;  4QWQ A;  3IRR A;  1U8B A;  2PMZ A;  1K79 A;  2UUZ A;  3ZQI A;  1PYV A;  2MG4 A;  2VE9 A;  1ZGA A;  1ON1 A;  4ZYH A;  4Y3O A;  4HBL A;  4C2T A;  4A3L J;  3ZN1 A;  2Z2S B;  3L9F A;  4KT5 C;  3K4J A;  4ANJ A;  2B9S A;  4UVA A;  2KMU A;  3RPU A;  1Z21 A;  1C0W A;  1WJD A;  2LR8 A;  4HF0 A;  4PCQ A;  1O3R A;  1HDD C;  3MEX A;  4ZYG A;  3LAP A;  1SVO A;  2R7V A;  2O03 A;  3QP5 A;  2QQB A;  1ORK A;  3JRB A;  2OF7 A;  3FXQ A;  4NBQ A;  3V7S A;  4XLP F;  2HDD A;  1ZG5 A;  1XGM A;  2JTV A;  2EA2 A;  1NK3 P;  3QQA A;  3C2B A;  4F7Z A;  3SEQ A;  5DDG A;  2RC4 A;  5EDN A;  2NXN B;  2GA2 A;  3ZCO A;  1A6I A;  2VJ5 A;  2HI3 A;  5DS9 A;  2VC0 A;  5B5E C;  2FBH A;  4ENN A;  5HOD A;  1Y8R B;  1HF0 A;  3OYN A;  3HHG A;  3HJE A;  3I4P A;  1LVK A;  4UUS B;  2KIU A;  2EIM H;  1BM9 A;  4A3E J;  4BBR J;  3FXO A;  1JTX A;  4NQW B;  2F6C A;  2KRH A;  2V6C A;  3FHN A;  3BZK A;  1W0U A;  3GTK J;  1LUJ B;  1UCR A;  3REO A;  1MSF C;  4RAY A;  5HLI A;  3ABL H;  2CH0 A;  4ENK A;  4ZDP A;  5HDK A;  3RZD J;  2K3F A;  4BQN A;  1G59 A;  1FYK A;  4GYI A;  3V8L A;  3CMM A;  2JVH A;  3BQY A;  3K2A A;  2BV6 A;  3DV8 A;  3WTY C;  5K7F A;  1DQU A;  4KMF A;  3QWL A;  2MW8 A;  2RN7 A;  2ISY A;  3FM5 A;  5KNL A;  4N4N B;  3X2Q H;  5D5W B;  3V4G A;  3EDP A;  4G6D A;  1HST A;  2BY2 A;  1XMX A;  2M8G X;  4PJ0 C;  5E1X A;  4G6Q A;  4B3X A;  2L4A A;  4ZYD A;  2YX4 A;  1T95 A;  5JHU A;  2LDU A;  1EV7 A;  5F0H A;  2E2H J;  2MH9 A;  2CUZ A;  2L3D A;  1NG7 A;  3KEY A;  1GVJ A;  3DLL F;  1BR4 A;  3FXK A;  1X58 A;  4XON A;  4AU7 A;  2V6E A;  2DPU A;  2VXD A;  4C2M J;  2MYS A;  1Y0N A;  4UVB A;  4R79 A;  3VB2 A;  2DW4 A;  2NS7 A;  4MIM A;  2R7Q A;  3DPU A;  2Y31 A;  5IT9 Z;  3QOE A;  3ASN H;  1E17 A;  1TWA J;  3AL0 B;  1QHG A;  1JGS A;  4MGR A;  1IGN A;  1TZL A;  4N0B A;  1EJ9 A;  5EG0 A;  1KU9 A;  3K1P A;  3TO9 A;  3PNT A;  3IP4 B;  1LE8 A;  2H8W A;  4FX4 A;  1XPX A;  1MBE A;  4KIT B;  4J19 A;  4IJA A;  3HTS B;  3HOU J;  1SFO J;  4RAZ A;  4FX0 A;  4KIB A;  4E7I A;  1AWC A;  2X6X A;  4FET A;  5DCM B;  1B6A A;  1UJ8 A;  1T0F C;  3CES A;  1B1B A;  2K27 A;  2P7C B;  4IQ4 A;  1N75 A;  1S29 A;  2IJL A;  3ZQH A;  4A2U A;  1QZY A;  1OQY A;  4NC8 A;  2BGC A;  1AHD P;  2BW3 B;  2TDX A;  2O9L A;  3M1E A;  1K7A A;  1YW8 A;  5FRM A;  2JSC A;  4HV6 A;  3U21 A;  3HIF A;  1FLI A;  2RDP A;  3LQR A;  4XLE A;  2GM4 A;  4BNC A;  4PFP A;  3SYT A;  1VQP I;  5TRD A;  1WH5 A;  3PO3 J;  4M9X A;  1R36 A;  1TWF J;  1Z0X A;  5EJC A;  3DEU A;  3I71 A;  3E6D A;  2DO7 A;  2XKO A;  3OY9 A;  5D8K B;  1TQM A;  1MGT A;  5FB2 A;  3F22 A;  4JX6 A;  1O57 A;  2V4J C;  3ROU A;  4DYC A;  2XGD A;  3PIP F;  2JQ7 A;  2K9M A;  2OU2 A;  4RLF A;  2A07 F;  1WVR A;  3QPH A;  3KPH A;  1WQ2 A;  1T33 A;  3Q0W A;  3ZMS A;  1BW5 A;  2LLK A;  5J6X A;  1WCM J;  5FRN A;  4OIR F;  2LP0 A;  3RDI A;  1TNT A;  3LWF A;  2DAO A;  2V1U A;  4M71 A;  2DOF A;  2WB1 A;  2WTE A;  4XBF A;  1GV5 A;  4BY1 J;  4BQO A;  1JKQ C;  4CGZ A;  3BTC A;  2XVC A;  5EF6 A;  3NAR A;  1Z05 A;  1A31 A;  1MMA A;  2GOX B;  4BAC A;  1MMS A;  2BBY A;  2LG4 A;  1B9N A;  4M72 A;  4FCY A;  5D5X B;  3S1N J;  2R92 J;  3FIW A;  3LSK A;  1PP8 F;  1WZ2 A;  2IS6 A;  3F8B A;  2GZW A;  1KON A;  1W5S A;  3VSL A;  3BR1 A;  5JR3 A;  2B7E A;  5H6R A;  1MH3 A;  4L0Y B;  2I5U A;  3LSJ A;  3MAJ A;  2LNB A;  1YFH A;  4S05 A;  4IXA A;  2IGK A;  4B48 A;  4O5V A;  1I27 A;  5CQE A;  2CYY A;  4DYQ A;  4L9T A;  3ZQ7 A;  3BR2 A;  3S3M A;  3WU0 A;  2DQR A;  2WBM A;  4C30 A;  2K40 A;  4A3I J;  2KKO A;  3KZI C;  1QNT A;  5J40 A;  2WV1 A;  3F8M A;  3FMS A;  2W7N A;  5JLX A;  2H6C A;  3Q5F A;  3I55 I;  1Z6T A;  5HLG A;  2VBZ A;  3W2W A;  5BMZ A;  3FM3 A;  1T98 A;  4DBQ A;  3P5J A;  3L2Q A;  2NVU B;  2X48 A;  1MDM B;  2DYS H;  2OJE D;  2E1C A;  1IW7 F;  2VC1 A;  3LFK A;  4Y52 J;  1BJA A;  4NDL A;  4E7S A;  4CCK A;  3NWS A;  1WJF A;  4XRS A;  2VKV A;  3I0T A;  3I5U A;  1DP7 P;  4EM2 A;  3IC7 A;  4AC0 A;  3A2K A;  3F8C A;  3ESW B;  3AG3 H;  5LEK A;  1Z6R A;  1O3T A;  1V54 H;  4Y33 A;  4P5O A;  4Z2Y A;  1LNW A;  3CCY A;  4A3C J;  1D8J A;  3W3C A;  1YIJ I;  3R6S A;  2VI6 A;  5HOO A;  1XTA A;  3GO5 A;  1H0M A;  5C4J J;  3S15 J;  3KFW X;  2M1B A;  4MNU A;  5F0F A;  2L0K A;  1S9H A;  3LOC A;  3CCR I;  2DA1 A;  4A5N A;  2W82 A;  1T2K A;  1WI9 A;  2CW0 F;  5HDG A;  1WWX A;  2EIL H;  1YI2 I;  1JKO C;  3LSP A;  3BLY A;  2OZ6 A;  4EM1 A;  2Q2E A;  4LK0 F;  3AG2 H;  1YYV A;  1AA7 A;  3A01 B;  2HYF A;  2DMT A;  1DGR M;  3DXJ F;  3TO7 A;  2L7Z A;  1P4W A;  1AOY A;  4XID A;  4DOZ A;  4AYB N;  3BR5 A;  1FX7 A;  4D9J A;  1JT6 A;  1X1D A;  1OPC A;  2Y30 A;  1CQT A;  5EZH A;  3BR0 A;  2CS3 A;  1RI7 A;  3TP3 A;  3OYA A;  3I54 A;  1A6Q A;  4PJJ A;  4KDP A;  1D3Y A;  1X4P A;  3ZR8 X;  4FE7 A;  4BJT A;  1Z91 A;  3S3O A;  3CJR B;  3GFL A;  4UUT A;  3SZP A;  1XN7 A;  1GXQ A;  2XAU A;  4F3Q A;  2YU3 A;  5FD6 A;  1J0R A;  2P8T A;  2HQN A;  1ON2 A;  3GFJ A;  4LLN A;  4QPO A;  4KN4 X;  1BJZ A;  3U1K A;  3BDD A;  2JSP A;  4BJ5 C;  1YW7 A;  1UHS A;  2V7F A;  2MC3 A;  2H6B A;  1BR2 A;  4LG0 A;  3B02 A;  5H6Q A;  2HQ5 A;  1HCR A;  1OCC H;  2AO9 A;  3R60 A;  2UV1 A;  3AKZ A;  3A03 A;  2IBD A;  3L2R A;  2JN6 A;  3LSG A;  2P6T A;  3DQV C;  1HKQ A;  4QIW N;  3RKX A;  1CF7 B;  1QZZ A;  2VXZ A;  4MLO A;  4C2U A;  5KHD A;  1EH8 A;  2OCC H;  2EFN A;  3H0D A;  2Y75 A;  3O6B B;  2HOT A;  1K78 A;  3DFG A;  3EUA A;  2XB5 A;  4UUS A;  2O61 A;  1T39 A;  5LRR A;  1X2M A;  4CCO A;  4RM2 A;  1YIO A;  5EEH A;  5CJ9 A;  3MZ8 A;  2A69 F;  3MWM A;  4DW6 A;  1JGG A;  1HBX G;  2E1M C;  2X1D A;  3QYE A;  4XRF A;  3FXU A;  2DI3 A;  3V7R A;  1FYL A;  3OV8 A;  1P7I A;  2V1X A;  2DTZ A;  2PX9 A;  2B0L A;  3I53 A;  2O8K A;  5CVU A;  1VQ9 I;  4IHV A;  4UUV A;  1BBY A;  2JJ7 A;  1T38 A;  1B9M A;  1CF7 A;  3ZPL A;  2R93 J;  4UY8 I;  1JTY A;  4RMN A;  5FKL A;  3FIS A;  2LRE A;  5A2Q Z;  3E5Q A;  4CYC B;  2E35 A;  4DNC A;  1VND A;  1YX3 A;  5IP9 J;  5E3M A;  2QUF A;  2DPD A;  3HGY A;  2EPF A;  3S32 A;  5LD2 C;  4QPQ A;  3QPS A;  3L1P A;  2KDO A;  3KP3 A;  2QSG X;  3W6K B;  4JYK A;  1XGS A;  2YUS A;  3EUH C;  2L4M A;  1ZTR A;  4DBR A;  1S7A A;  4M6V A;  4YIR X;  3FMR A;  5K7Z A;  2O3F A;  2V79 A;  1IV8 A;  3KP5 A;  3S1R J;  1FY7 A;  3P9C A;  4BDZ A;  3I4N J;  3OS2 A;  4ESF A;  2JUG A;  3F8N A;  2IA2 A;  5EEG A;  1SFK A;  2XAH A;  4EM0 B;  4XOP A;  1FOW A;  4RDU A;  1W36 C;  3H0G J;  4PFO A;  3PNY A;  1T8I A;  2LSO A;  4P9U A;  2RQQ A;  1YTY A;  4I09 A;  4EJU A;  4AD9 A;  2XPW A;  3C2H A;  3CUQ C;  4FE4 A;  1XCV A;  4U88 A;  1EH6 A;  2BXZ A;  2P7V B;  2H1K A;  3ERM A;  4EJO A;  1DGW Y;  2RGV A;  2MBF A;  3D1N I;  1QO0 D;  2WAD A;  3K6G A;  4OU0 A;  2O6G E;  1HW2 A;  1MBF A;  3QU3 A;  2XRO A;  1FJL A;  3MKZ A;  5GAH J;  1WHU A;  2KFD A;  4CIC A;  3GX4 X;  4YFN F;  3F6V A;  2PFB A;  1A5J A;  1LDD A;  2HKO A;  5L3E A;  3O2P E;  4CCL A;  3BWG A;  3OYI A;  1TQI A;  5E1Z B;  5E18 F;  2E5N A;  2DT6 A;  4EJV A;  3IKV A;  2MD5 A;  3OR2 C;  5GAG J;  1DP3 A;  2QQ8 A;  2Y0M A;  3KP2 A;  4OIO F;  2KIM A;  4NC7 A;  1I1S A;  1O4X A;  2BVM A;  1U8R A;  3NQO A;  2EH3 A;  2KQR A;  2Y0S A;  1VQ7 I;  4UV8 A;  2ZXW H;  2WA0 A;  2WV0 A;  4EEF G;  1KZH A;  3ZMV A;  1SMT A;  2A5W A;  1YX5 A;  1VQ8 I;  3ZMD A;  4AIJ A;  4V2G A;  4FHT A;  2F5D A;  3LST A;  4R1H A;  5HNH A;  1U3E M;  5D4R A;  1J5Y A;  3HOT A;  1FIA A;  2FNP A;  4AVZ A;  4UVC A;  1J2X A;  5IOY A;  1ETW A;  2L54 A;  4OIQ F;  3OIO A;  3S2H J;  3V7C A;  3DPL C;  2IT0 A;  1GDT A;  4FIS A;  4FTH A;  5DEQ A;  1MDM A;  2R4G A;  2E34 A;  2E2I J;  1QBJ A;  3A01 A;  3OIP A;  3CDI A;  1X1B A;  4I76 A;  4GYG A;  5KAF C;  4PJM A;  3I59 A;  4RAG A;  4YRV A;  1BN5 A;  1ODD A;  4G8X A;  4CZC A;  1LFB A;  2A68 F;  2R5Y B;  2L9S A;  2CUE A;  2JZY A;  4D5F A;  3H3V K;  2PMZ N;  1VQ5 I;  1BW6 A;  2K85 A;  3FXR A;  5FKO A;  1J59 A;  2X6W A;  3FXM A;  4IHW A;  3CO6 C;  1LQ1 A;  3JTG A;  3MKL A;  4BEH B;  1RUO A;  4BDY A;  3QPT A;  3WTU C;  4ZZL A;  2Z99 A;  2W25 A;  1JE8 A;  2CSO A;  2NYX A;  3T8T A;  3E5U A;  1R1T A;  4YEJ A;  2L9R A;  1HKS A;  1XC5 A;  5L3C A;  5LHG A;  2EZK A;  3C3W A;  3OYG A;  3J81 Z;  2VT2 A;  3FHZ A;  2K02 A;  2X85 A;  1YO5 C;  4OIN F;  3VYS B;  3OOU A;  3ZQG A;  4BGD A;  5J8C A;  1ZR2 A;  1SEU A;  4YFK F;  3DWL E;  2DOE A;  1R1V A;  3K4N A;  2V1N A;  5IP7 J;  2DA6 A;  2LC2 A;  2P81 A;  2VT3 A;  3GZ6 A;  2LKP A;  3EUK L;  3H1C A;  2JPB A;  2DMN A;  2JA8 J;  5A2Q K;  3PUF A;  4BJ6 C;  1IUY A;  1X3W B;  4RB3 C;  2R7S A;  2OUM A;  3BJ6 A;  1NTC A;  1D5Y A;  5LGN A;  2LY2 A;  5AIQ A;  3OYH A;  3K70 C;  2PLY A;  5JLW A;  2FMY A;  1G8X A;  2KP6 A;  2EV0 A;  3OYD A;  1IO2 A;  3QU6 A;  3RTR A;  1ZRE A;  2XAQ A;  3OIQ A;  4B44 A;  1FTZ A;  2VBX A;  4OAY A;  2DMP A;  2TRT A;  5L3B A;  1B72 B;  3K1M A;  3QYF A;  4UB8 C;  1R5G A;  2LFB A;  2W85 A;  3BJA A;  2GXA A;  4XOR A;  3Q0V A;  1ZLJ A;  1UFM A;  3K7A J;  2E1M B;  2XKP A;  2CWE A;  3DBR B;  1TNS A;  3FBN B;  1W7P D;  1Q1V A;  4E70 A;  3F23 A;  3PQK A;  4HA8 A;  1V4R A;  2M34 A;  3K70 D;  2XC7 A;  2CRG A;  3SQN A;  2RKH A;  4ITV A;  2NRA C;  3LAJ A;  2VOP A;  1S7O A;  1P9Q C;  3ZP5 A;  5H20 A;  4HYE A;  4Z6Y A;  3BTI A;  1UAA A;  2FML A;  2XGE A;  3SDB A;  1TLH B;  3HKZ A;  4WXD A;  1QHH D;  2Y0S N;  1FPQ A;  2E71 A;  4YG2 F;  1B59 A;  3JRC A;  2XB0 X;  4MFE A;  1GUU A;  2ME6 A;  5ILU A;  3WTS C;  1K6Y A;  3HPH A;  4UXN A;  2P5L C;  3ZXS A;  4FAS D;  1P92 A;  2NNY A;  1K4S A;  2F48 A;  3Q9S A;  1K83 J;  3C18 A;  2HNH A;  3BCA A;  2W84 A;  2HQR A;  3T5X A;  5EGO A;  1ZYR F;  1ZN2 A;  1OCO H;  2KRF A;  2YU9 J;  2XIG A;  2Z33 A;  4IHS A;  3ABU A;  3H35 A;  4LB5 A;  2ZBK A;  1FOK A;  3FK6 A;  2HU9 A;  2HYG D;  2EA4 A;  4ESB A;  2X4H A;  5ICE A;  3G71 I;  1YQA A;  2DXI A;  4MO7 A;  2XF5 A;  4FQG A;  1KQ0 A;  1HC8 A;  4U7D A;  4MEY F;  4M3D A;  9ANT A;  1Y8Q B;  2EIN H;  4OWR B;  3B73 A;  1U9N A;  3BTL A;  3E6B A;  1FYM A;  1BC8 C;  4P9F A;  1FWZ A;  3RKY A;  3L00 A;  4P96 A;  3HPG A;  2CQN A;  1D8K A;  2LH9 A;  3QAH A;  1Z7U A;  1FSE A;  3SHF A;  5FLX K;  3GME A;  2GBY A;  4XLA A;  3H3U A;  2X51 A;  1EF4 A;  2Y2Z A;  1W5C C;  2IGN A;  4EGZ A;  4PDK A;  3K2Z A;  1GV2 A;  4A3J J;  2P5V A;  2LMD A;  1NHA A;  3ZQC A;  2PN6 A;  1AU7 A;  5TGT A;  1W7P B;  4IL6 C;  1MND A;  5HLH A;  2DYR H;  2M87 A;  3BR3 A;  4B09 A;  2VOD A;  5KVR A;  3JSP A;  5FJ8 J;  2PJR B;  2FQ3 A;  3RIR A;  2EFQ A;  2DFF A;  2NS0 A;  4CYC A;  3HOS A;  3CME I;  5LHI A;  4LMY A;  2DT5 A;  1J9I A;  3HSE A;  2QQ9 A;  2N8G A;  1VQM I;  4G9Y A;  4QSH A;  3TDZ C;  2HOA A;  1V5F A;  3DF8 A;  2ME0 A;  2G0E A;  4IVN A;  3GLX A;  4HPQ A;  5CVI A;  3K4K A;  5GAE J;  1SAU A;  5J4V A;  2DT7 B;  1LPQ A;  4WX9 A;  2XAF A;  3DU6 A;  3HRT A;  1E3P A;  1IN6 A;  1YRN A;  3KP7 A;  3ABM H;  4LIT A;  5CYV A;  2RVC A;  2WB1 N;  4XL9 A;  4CCN A;  3MCZ A;  2A05 A;  2GIV A;  2M9H A;  1MMN A;  3C2G A;  2F5F A;  4Q5S F;  5CVV A;  4XN3 A;  2K9L A;  4ENJ A;  4A0Y A;  1K78 B;  4HNT A;  1IZ1 A;  1RC9 A;  3IH4 A;  2E1N A;  2PG4 A;  4B8X A;  3MKY B;  2BYV E;  2EFP A;  2R7T A;  1YOV B;  2BW3 A;  1EH7 A;  1H9G A;  2JT1 A;  2K86 A;  3K0L A;  4KUM A;  1ITY A;  1FEX A;  3HOW J;  3IKT A;  1RIO H;  1O7L A;  4KFC A;  4XRM A;  4ETS A;  2F5E A;  2W24 A;  2KJB A;  3EPZ A;  2L9N A;  3BR6 A;  1L3L A;  3HBL A;  1ETQ A;  3KCC A;  4ZYA A;  1Q1H A;  1TWH J;  3JTH A;  5DTD A;  4W97 A;  4DJA A;  2KZV A;  1YRN B;  3KP6 A;  2VOO A;  2XSD C;  2GWR A;  4HLX A;  3GZ5 A;  1UST A;  4E7H A;  4J00 A;  2HXI A;  2Z1D A;  4A6E A;  2JWT A;  1R1U A;  3DKY A;  4BKX A;  3N97 A;  3J7A Y;  1VTN C;  2XRL A;  4N9H A;  3I64 A;  2DLL A;  3JRF A;  2ZXJ A;  3CUQ B;  4HRI A;  2ETH A;  4OIP F;  2STT A;  5J4Y A;  2FRH A;  3JR9 A;  2W57 A;  3EYY A;  3LNQ A;  3M8E A;  5EGO B;  1FTT A;  3GVA A;  3BQZ A;  4PSW A;  4KYW A;  1YJW I;  3KIO A;  3BG9 A;  4XRS G;  3FZV A;  1JT0 A;  2HGC A;  3GTL J;  1F43 A;  2RNJ A;  1I5Z A;  3I3L A;  3WE3 A;  3E97 A;  3WOD F;  1TQP A;  1WFX A;  3TED A;  5CQG A;  2O0Y A;  2ZJR F;  2LKX A;  2HDW A;  3OYM A;  3GTJ J;  1ETX A;  3OYF A;  1LFU P;  3E6C C;  2CV2 A;  3PQJ A;  5BS6 A;  1S7E A;  3BPV A;  1IN4 A;  2FBI A;  4A0Z A;  1X19 A;  1D0Z A;  1ULY A;  1ZQ3 P;  1PVE A;  1FZP B;  1T56 A;  3CDL A;  3J80 K;  2PEX A;  3VOE A;  2QKL B;  1U5T A;  3DEW A;  4P55 A;  5CKT A;  3ZN0 A;  3DBL B;  4EAT A;  4D1Q A;  3E3V A;  2GXG A;  1PP7 U;  1TP4 A;  4U0Y A;  5ICG A;  1UEL B;  2CMP A;  1TT0 A;  3CJN A;  2Y9Z A;  4Y13 A;  4G7H F;  2PBI A;  1MMD A;  5IPA A;  2CQK A;  3TDU C;  3CF5 F;  4XLH A;  3RQI A;  3R0J A;  3NWT A;  5LGU A;  1PUF A;  2IVM A;  2HZT A;  2DA4 A;  2HFH A;  2ZME C;  5EG0 B;  3W6V A;  1MJB A;  1SFE A;  5HS8 A;  3AFH A;  3IAM 2;  3L2V A;  1U2W A;  1R5I D;  3KYC B;  4ASN A;  4MTD A;  2PJR A;  2R7U A;  3ML6 A;  1FBS A;  1MKM A;  2E1O A;  3KLN A;  3OSF A;  1IAW A;  2JRM A;  1SFU A;  2M7B A;  2ISZ A;  3ZMT A;  3CF2 A;  5AIP A;  3AL0 C;  2R7Z J;  3D5R C;  4XKW A;  2DA3 A;  3TKY A;  3TP0 A;  1VQ6 I;  4RB0 A;  3B6A A;  5ICC A;  2TCT A;  2ZJQ F;  3TQN A;  2CFX A;  3D5L A;  3K69 A;  4CUG A;  4ABZ A;  2OA4 A;  3KZZ A;  5BOX A;  1Z67 A;  3HOV J;  4NHJ A;  1IXC A;  1OCZ H;  2BZT A;  2ICW G;  1APL C;  4F52 A;  4BU2 A;  1WGX A;  1ETV A;  2H27 A;  1IJW C;  2M7A A;  4PJL A;  1XDS A;  1O3S A;  2MC4 A;  1HSJ A;  1WJC A;  3E7L A; 
#chains in the Genus database with same CATH homology
 1GHC A;  1V3F A;  2Q8K A;  3VFZ A;  1XD7 A;  2KIF A;  1QPM A;  4I98 B;  3C7J A;  4GO1 A;  1ZH5 A;  1IRG A;  1G4D A;  3R4K A;  1OYY A;  3AAF A;  1YW9 A;  2YSR A;  1WKM A;  1KGS A;  2GA1 A;  2CG4 A;  3IWZ A;  4M6X A;  3PFI A;  3ZMU A;  2FF4 A;  3DPT A;  5FLX Z;  1HQC A;  4EMS A;  5HS9 A;  1IXR C;  4EJW A;  2ZO4 A;  4GCV A;  1STZ A;  4D0P A;  4HF2 A;  3GXO A;  3BJO A;  1LJ9 A;  4LLL A;  1KYZ A;  2ELH A;  4ZYE A;  2D1H A;  4LG0 B;  2EFO A;  2QYO A;  4CZZ A;  3HSR A;  4CHU A;  4Q4Z F;  1DPR A;  1ZRC A;  1GXP A;  5E1W A;  2CGP A;  2Y48 A;  5CLS A;  3WTW C;  1L0O C;  3L7W A;  2ZME A;  1FBU A;  5DD8 A;  1HKT A;  2ESH A;  2G7U A;  4LB6 B;  5DCM A;  1BIA A;  2FXA A;  1G3Y A;  4BHC A;  2FA5 A;  4WCG A;  3TO6 A;  4U7B A;  1ZAR A;  5D5U B;  3ECO A;  4O6J A;  1R7J A;  1G6N A;  2COM A;  1S3J A;  5KK1 A;  3WE2 A;  1RNL A;  5E8G A;  4OMZ A;  4M9S A;  4N9I A;  3OOP A;  2M5W A;  3H92 A;  2V9V A;  4NB5 A;  3F3X A;  1OYI A;  4GGG A;  2M45 A;  1J75 A;  5LHH A;  1TW3 A;  3WGG A;  1PDN C;  1IF1 A;  2EV6 A;  3WG9 A;  1USS A;  3RYR A;  5F1R A;  5HS7 A;  2R7F A;  2EK5 A;  2V1D A;  2Z3Y A;  1XSV A;  2P4W A;  3IHU A;  3T0Y A;  3TOB A;  2HR3 A;  4I0B A;  3T1B A;  3CUQ A;  3E5X A;  1O7F A;  3G3Z A;  3SFZ A;  3EUH A;  1HW1 A;  2QZ8 A;  4M74 A;  1R00 A;  2Q0O A;  2XAJ A;  2GXB A;  2YPR A;  3T8R A;  2BEO A;  2QBY A;  2XRN A;  4YII A;  1FNN A;  4TV7 A;  3V8J A;  2PMH A;  1UHW A;  4MQV A;  5K1Y A;  2KJC A;  4IF4 A;  5FFX A;  2VBY A;  3U1D A;  1LDJ A;  1P4X A;  1JXS A;  3KET A;  1ZRD A;  2L01 A;  4BAY A;  3J7A O;  4BHB A;  1P6R A;  2OBP A;  4QLC U;  4EVI A;  4RGS A;  3CDH A;  4EV0 A;  1XSX A;  4PZJ A;  2MH2 A;  1LDK B;  4HX7 A;  4U0W A;  5JI6 A;  3P7N A;  2XHK A;  3I59 B;  1F1Z A;  2UXN A;  4IRH A;  3WTZ A;  1XGO A;  3BPX A;  3SZT A;  2GAU A;  2QM3 A;  2K7L A;  3BRO A;  2M8E A;  2QQA A;  2VBW A;  4K2E A;  5IT9 K;  2E7W A;  5ICF A;  3VOD A;  1ZHF A;  4WXH A;  1G3T A;  2A3S A;  5LEJ A;  4HX4 A;  3U9G A;  4FT8 A;  2E7X A;  3GW2 A;  4BQA A;  4HQE A;  3NEU A;  5JVT A;  1A04 A;  2K4J A;  4ON0 A;  3GYH X;  4BHP A;  2IRF G;  1ZG1 A;  5J8F A;  4RB1 A;  4I0A A;  2XUB A;  4LLG F;  2FSW A;  3HUG A;  1KU2 A;  5FD5 A;  2OZU A;  1LEA A;  3LA2 A;  2ACJ A;  1E2X A;  3FWE A;  2A61 A;  4JBA A;  1XDU A;  3IWF A;  1SAX A;  4PGG A;  5ILV A;  2J5O A;  4L18 B;  2FBK A;  3IRQ A;  2FU4 A;  4RGU A;  4HQM A;  3NRV A;  4DQ2 A;  3ISP A;  3MZY A;  4ENM A;  5CVR A;  2HS5 A;  3FMQ A;  3S2W A;  5L3G A;  3C1D A;  2PI0 A;  3TOA A;  5K5O A;  1YG2 A;  3GWZ A;  1U5T C;  4M73 A;  2A6H F;  1YS7 A;  3ERE D;  3JSO A;  4HX8 A;  2IPQ X;  2QEN A;  4BH9 A;  1D5V A;  4I7H A;  1LEB A;  2STW A;  4I2O A;  2NNN A;  5ERI A;  1W4M A;  2RQP A;  5CVJ A;  1DPU A;  3GFI A;  1O3Q A;  3CUO A;  3WTX C;  5JFR A;  2LF7 A;  3RPQ A;  4ZH4 F;  3GF2 A;  1KQ8 A;  2BE5 F;  3BZ6 A;  4RB2 C;  1FP1 D;  3RI4 A;  3JAM Z;  2AS5 F;  1FC3 A;  1OKR A;  1JHH A;  5DV5 A;  1B4A A;  4A6D A;  4WWC A;  3E6M A;  3BY6 A;  2Z9O A;  2XAS A;  4IHT A;  1KYW A;  2H94 A;  4LK1 F;  3QP6 A;  4XSZ F;  4HZF A;  2NAZ A;  5L3F A;  2VN2 A;  5L3D A;  4A12 A;  4H0E A;  4GXO A;  2QWW A;  6PAX A;  1OYW A;  3HRM A;  1R5H A;  4Y15 A;  1KU7 A;  3COA C;  2ZFW A;  1R58 A;  1PUE E;  2PQ8 A;  2EV5 A;  1ONV A;  4M6Y A;  1F9N A;  4UHT A;  1IN7 A;  4UV9 A;  4HOB A;  3J80 Z;  4RS8 A;  1T0F A;  4WK8 F;  2IP2 A;  1H9T A;  4IRI A;  4UNO A;  1SFX A;  4IPA A;  4KA4 A;  5FO5 A;  3LA7 A;  4LJZ F;  2IA0 A;  3K1N A;  3L2C A;  1QQI A;  2ESN A;  4NQW A;  2A5Y B;  5IT3 A;  4ESJ A;  4G94 A;  3ULQ B;  5DYM A;  4HW0 A;  1KU3 A;  4I01 A;  4AVP A;  2F5C A;  2VON A;  5DUK A;  2DQL A;  1KQ9 A;  1DUX C;  2Z5U A;  1JHF A;  2YX7 A;  3JW4 A;  2HEO A;  2EB7 A;  3QOP A;  4PGH A;  3EQL F;  1LB2 A;  2EJR A;  1P2F A;  4BYY A;  3J81 K;  2QLZ A;  3GUD A;  5TJJ A;  2LF8 A;  4CO8 A;  1CGP A;  3M8F A;  1G3W A;  2HKX A;  3HHH A;  2HOE A;  3MZH A;  3EET A;  4R8H A;  5HDN A;  1W7P A;  3KP4 A;  3L09 A;  3I58 A;  4CYD A;  2PJP A;  2R3S A;  3U2R A;  2HTS A;  2P5K A;  4OMY A;  1R23 A;  2H09 A;  5E17 F;  1F4K A;  1TTY A;  3HYI A;  1BIB A;  3IL2 A;  3D0S A;  1IN8 A;  3QRF F;  3P9K A;  2OD5 A;  4U0V A;  4MTE A;  1BC7 C;  4OOI A;  4AWX B;  1SD6 A;  4KN7 X;  5F64 A;  4L9V A;  2M30 A;  5LGT A;  1MZB A;  4L9N A;  3ZMZ A;  3KEO A;  2D1V A;  3F6O A;  4MHG A;  2J5P A;  2DTR A;  1KA8 A;  4LD5 A;  4EJT A;  1YS6 A;  2CO5 A;  4S04 A;  4AIH A;  3KLO A;  2L02 A;  1SD7 A;  4RGX A;  3F72 A;  1K6O A;  3LA3 A;  1BI1 A;  2FNA A;  3WTT C;  1W5T A;  2ZME B;  1IN5 A;  4CXF A;  4HAM A;  3HSF A;  1ZGJ A;  3WGH A;  4L5J A;  2JPC A;  3WU1 B;  3RYP A;  1FT9 A;  4MEX F;  1WSU A;  3MFK A;  2O8X A;  1BOA A;  4L9J A;  1BI2 A;  3ELK A;  3KEQ A;  5BPD A;  2DU9 A;  2XGX A;  2ZNZ A;  2D2W A;  5AON A;  2XV4 S;  4BXU A;  5K5Q A;  3RJP A;  5HVQ C;  5D6F A;  3N4M A;  4JK1 X;  3DP7 A;  1BI0 A;  1RZ4 A;  1SMY F;  2DK5 A;  3MQ0 A;  3VEP A;  2DK8 A;  1I6X A;  1I1G A;  3W6J B;  5FGM A;  5DCF A;  1UB9 A;  1XCB A;  2PMU A;  2OQG A;  2HTJ A;  3KZY A;  1REP C;  2UWM A;  2WC2 A;  4YIF A;  3FX3 A;  2UXX A;  1S8N A;  2OAZ A;  1U5T B;  1DDN A;  4Q47 A;  4HLY A;  4RGR A;  1ZLK A;  2GQQ A;  4KIG A;  3M7G A;  4HDV A;  5FFZ A;  2FEZ A;  1S6L A;  1TW2 A;  3KE2 A;  2FOK A;  2A6E F;  5D4S A;  2MLK A;  4YFX F;  2DBB A;  3O3K A;  2R7D A;  5K5R A;  2XAG A;  3F21 A;  2ZKZ A;  4G7Z F;  1MJ9 A;  1FP2 A;  1ZAO A;  5D6E A;  4Y17 A;  1FSH A;  2MA3 A;  2IW5 A;  2D45 A;  2AXL A;  3CTA A;  1ZG3 A;  2IA1 A;  1X3U A;  5D8L B;  1RUN A;  1SD5 A;  3G73 A;  4L0Z B;  3GFM A;  5BPI A;  3ABT A;  5DD4 A;  2QBY B;  1Z9C A;  2EFW A;  4I02 A;  3FF5 A;  1XMK A;  2ADU A;  3CLO A;  3RKW A;  4A5M A;  2HDC A;  1HXD A;  1HW5 A;  2C6Y A;  4EQQ A;  2P6S A;  4G7O F;  1UHM A;  4MQ9 F;  1P4A A;  5LRS A;  1XB4 A;  2QVO A;  3R0A A;  2VE8 A;  1R22 A;  4HV5 A;  2OQR A;  3HRS A;  2G9W A;  1IRF A;  2ZNY A;  3LQQ A;  1MJA A;  3P9I A;  1XMA A;  1FBQ A;  1XGN A;  3JAM K;  1ZRF A;  2ZJ2 A;  4A0X A;  4ZZD A;  4XLN F;  3DKW A;  2FE3 A;  5E20 A;  1G3S A;  3SXY A;  4EGY A;  3EYI A;  2UZK A;  4WXC A;  4O3M A;  2DFI A;  1TBX A;  2ZCW A;  2MLG A;  1YLF A;  3V8K A;  4LFU A;  4LGW A;  5D5V B;  3R61 A;  1U78 A;  4XSX F;  5ED4 A;  4HF1 A;  1LVA A;  3K9T A;  5LLQ A;  2X0L A;  4HDU A;  1OR7 A;  1WRJ A;  1XSD A;  1F5T A;  2WWY A;  2EWN A;  1T6S A;  4KMU X;  4JQF A;  1BI3 A;  1SD4 A;  4Q48 A;  1J7K A;  2YR2 A;  5LBQ A;  3BOQ A;  2G7H A;  5E8I A;  3WTV C;  3H3Z A;  3F8F A;  3HRU A;  4KNY A;  4L5I A;  1QGP A;  3HTU A;  4KIF A;  5F6F A;  1Z1D A;  5DUI A;  4CDG A;  4WF2 A;  3ECH A;  1OMI A;  4IRG A;  1U6G A;  1Y0U A;  2K4B A;  3M9A A;  3Q9V A;  3TGN A;  3CO7 C;  2JRT A;  3WGI A;  2F2E A;  4KIC A;  3GEZ A;  2RV8 A;  4AIK A;  1IXS B;  2HWV A;  5BQT A;  1MD0 A;  5ILS A;  3BP8 A;  4M9Z A;  1K79 A;  4QWQ A;  3IRR A;  2VE9 A;  1ZGA A;  1ON1 A;  4ZYH A;  4HBL A;  3ZN1 A;  3L9F A;  4KT5 C;  4UVA A;  3RPU A;  1C0W A;  4HF0 A;  4PCQ A;  1O3R A;  3MEX A;  4ZYG A;  3LAP A;  2O03 A;  3QP5 A;  2QQB A;  3FXQ A;  3V7S A;  4XLP F;  1ZG5 A;  1XGM A;  2JTV A;  2EA2 A;  4F7Z A;  5DDG A;  2RC4 A;  2GA2 A;  2VC0 A;  2FBH A;  4ENN A;  3HHG A;  3I4P A;  2KIU A;  1BM9 A;  2V6C A;  1UCR A;  3REO A;  4RAY A;  5HLI A;  4ENK A;  5HDK A;  1FYK A;  4GYI A;  3V8L A;  2BV6 A;  3DV8 A;  3WTY C;  4KMF A;  2RN7 A;  2ISY A;  3FM5 A;  5D5W B;  3V4G A;  3EDP A;  4G6D A;  1HST A;  5E1X A;  4G6Q A;  2L4A A;  4ZYD A;  2YX4 A;  5JHU A;  2LDU A;  1EV7 A;  2MH9 A;  2L3D A;  1GVJ A;  2DPU A;  4UVB A;  4R79 A;  3VB2 A;  2DW4 A;  5IT9 Z;  1E17 A;  1JGS A;  4MGR A;  4N0B A;  1KU9 A;  3K1P A;  3TO9 A;  4FX4 A;  4IJA A;  3HTS B;  4RAZ A;  4FX0 A;  4KIB A;  1AWC A;  5DCM B;  1B6A A;  2K27 A;  1B1B A;  2P7C B;  1S29 A;  2IJL A;  4A2U A;  1QZY A;  2BGC A;  2TDX A;  3M1E A;  1K7A A;  1YW8 A;  2JSC A;  4HV6 A;  1FLI A;  3HIF A;  2RDP A;  3LQR A;  4BNC A;  5TRD A;  4M9X A;  1R36 A;  3DEU A;  3I71 A;  3E6D A;  2DO7 A;  2XKO A;  5D8K B;  1TQM A;  1MGT A;  5FB2 A;  3F22 A;  1O57 A;  3ROU A;  2OU2 A;  2A07 F;  3QPH A;  1WQ2 A;  3ZMS A;  5J6X A;  4OIR F;  3RDI A;  1TNT A;  3LWF A;  2DAO A;  2V1U A;  4M71 A;  2WTE A;  4XBF A;  4CGZ A;  2XVC A;  1Z05 A;  2BBY A;  1B9N A;  4M72 A;  5D5X B;  1PP8 F;  3F8B A;  2GZW A;  1W5S A;  5JR3 A;  5H6R A;  4L0Y B;  3MAJ A;  2LNB A;  1YFH A;  4S05 A;  4IXA A;  4O5V A;  1I27 A;  2CYY A;  4L9T A;  3ZQ7 A;  3WU0 A;  2DQR A;  2KKO A;  1QNT A;  3F8M A;  3FMS A;  2H6C A;  3Q5F A;  1Z6T A;  5HLG A;  2VBZ A;  5BMZ A;  3FM3 A;  1T98 A;  1MDM B;  2E1C A;  1IW7 F;  2VC1 A;  3LFK A;  1BJA A;  3I0T A;  3I5U A;  1DP7 P;  4EM2 A;  3IC7 A;  3F8C A;  5LEK A;  1Z6R A;  1O3T A;  4P5O A;  4Z2Y A;  1LNW A;  1D8J A;  3R6S A;  5HOO A;  3GO5 A;  1H0M A;  3KFW X;  2M1B A;  4MNU A;  4A5N A;  1T2K A;  1WI9 A;  2CW0 F;  5HDG A;  1WWX A;  2OZ6 A;  4EM1 A;  2Q2E A;  4LK0 F;  1YYV A;  2HYF A;  3DXJ F;  3TO7 A;  1P4W A;  1AOY A;  1FX7 A;  1OPC A;  1RI7 A;  3I54 A;  4KDP A;  1D3Y A;  1Z91 A;  3GFL A;  3SZP A;  1XN7 A;  1GXQ A;  2YU3 A;  5FD6 A;  1J0R A;  2P8T A;  2HQN A;  1ON2 A;  3GFJ A;  4LLN A;  4KN4 X;  3BDD A;  1YW7 A;  2MC3 A;  2H6B A;  4LG0 A;  3B02 A;  5H6Q A;  3R60 A;  2P6T A;  3DQV C;  1HKQ A;  3RKX A;  1CF7 B;  1QZZ A;  2VXZ A;  1EH8 A;  2EFN A;  2Y75 A;  3O6B B;  1K78 A;  3DFG A;  2O61 A;  1T39 A;  5LRR A;  1YIO A;  5EEH A;  5CJ9 A;  2A69 F;  3MWM A;  1HBX G;  4XRF A;  3FXU A;  2DI3 A;  3V7R A;  1FYL A;  3OV8 A;  2V1X A;  2B0L A;  3I53 A;  5CVU A;  4UUV A;  1BBY A;  1T38 A;  1B9M A;  1CF7 A;  3ZPL A;  5A2Q Z;  3E5Q A;  4DNC A;  2QUF A;  2DPD A;  3KP3 A;  3W6K B;  1XGS A;  2L4M A;  1S7A A;  3FMR A;  2O3F A;  2V79 A;  3KP5 A;  1FY7 A;  3P9C A;  4ESF A;  3F8N A;  2IA2 A;  5EEG A;  2XAH A;  4EM0 B;  2LSO A;  4P9U A;  1YTY A;  4I09 A;  4EJU A;  4AD9 A;  3CUQ C;  1XCV A;  4U88 A;  1EH6 A;  2P7V B;  4EJO A;  2RGV A;  2MBF A;  1QO0 D;  4OU0 A;  2O6G E;  1HW2 A;  3QU3 A;  2XRO A;  4CIC A;  3GX4 X;  4YFN F;  3F6V A;  2PFB A;  1LDD A;  2HKO A;  5L3E A;  3O2P E;  3BWG A;  1TQI A;  5E1Z B;  5E18 F;  4EJV A;  3IKV A;  2MD5 A;  2Y0M A;  3KP2 A;  4OIO F;  2KIM A;  1I1S A;  1U8R A;  3NQO A;  4UV8 A;  2WV0 A;  3ZMV A;  1SMT A;  3ZMD A;  4AIJ A;  4FHT A;  2F5D A;  3LST A;  4R1H A;  1U3E M;  5D4R A;  1J5Y A;  3HOT A;  2FNP A;  4UVC A;  1J2X A;  2L54 A;  4OIQ F;  3V7C A;  3DPL C;  2IT0 A;  5DEQ A;  1MDM A;  1QBJ A;  4GYG A;  3I59 A;  1BN5 A;  1ODD A;  4G8X A;  2A68 F;  2JZY A;  3FXR A;  1J59 A;  3CO6 C;  1LQ1 A;  3JTG A;  1RUO A;  3QPT A;  3WTU C;  4ZZL A;  2Z99 A;  2W25 A;  1JE8 A;  2CSO A;  2NYX A;  3T8T A;  3E5U A;  1R1T A;  1HKS A;  5L3C A;  5LHG A;  3C3W A;  3J81 Z;  2VT2 A;  3FHZ A;  2K02 A;  1YO5 C;  4OIN F;  5J8C A;  4YFK F;  1R1V A;  2VT3 A;  3GZ6 A;  2LKP A;  2JPB A;  5A2Q K;  1IUY A;  4RB3 C;  3BJ6 A;  5LGN A;  5AIQ A;  2PLY A;  2FMY A;  2EV0 A;  3QU6 A;  3RTR A;  1ZRE A;  2XAQ A;  2VBX A;  5L3B A;  3K1M A;  1R5G A;  2W85 A;  3BJA A;  1ZLJ A;  1UFM A;  2XKP A;  2CWE A;  1TNS A;  1W7P D;  4E70 A;  3F23 A;  3PQK A;  4HA8 A;  1V4R A;  3SQN A;  2RKH A;  2NRA C;  3LAJ A;  2VOP A;  1S7O A;  3ZP5 A;  5H20 A;  4HYE A;  2FML A;  1TLH B;  4WXD A;  1FPQ A;  4YG2 F;  1B59 A;  5ILU A;  3WTS C;  4UXN A;  2P5L C;  1P92 A;  2NNY A;  3Q9S A;  3C18 A;  3T5X A;  2W84 A;  2HQR A;  1ZYR F;  1ZN2 A;  2KRF A;  2XIG A;  2Z33 A;  4IHS A;  3ABU A;  4LB5 A;  2ZBK A;  1FOK A;  2HYG D;  2EA4 A;  4ESB A;  2X4H A;  5ICE A;  1YQA A;  1KQ0 A;  4U7D A;  4MEY F;  3B73 A;  3E6B A;  1FYM A;  1BC8 C;  4P9F A;  1FWZ A;  3RKY A;  3L00 A;  4P96 A;  1D8K A;  3QAH A;  1Z7U A;  1FSE A;  3SHF A;  5FLX K;  3H3U A;  4EGZ A;  4PDK A;  3K2Z A;  2P5V A;  1NHA A;  2PN6 A;  1W7P B;  5HLH A;  2M87 A;  4B09 A;  2VOD A;  5KVR A;  3JSP A;  2FQ3 A;  3RIR A;  2EFQ A;  2NS0 A;  3HOS A;  5LHI A;  4LMY A;  2DT5 A;  1J9I A;  3HSE A;  2QQ9 A;  4G9Y A;  3TDZ C;  3DF8 A;  4IVN A;  3GLX A;  5CVI A;  4WX9 A;  2XAF A;  3HRT A;  1IN6 A;  3KP7 A;  5CYV A;  2RVC A;  3MCZ A;  2GIV A;  4Q5S F;  2F5F A;  5CVV A;  4ENJ A;  4A0Y A;  1K78 B;  1IZ1 A;  2E1N A;  2PG4 A;  4B8X A;  2BYV E;  2EFP A;  1EH7 A;  1H9G A;  2JT1 A;  2K86 A;  3K0L A;  4KUM A;  3IKT A;  1RIO H;  4KFC A;  1O7L A;  4ETS A;  2F5E A;  2W24 A;  2KJB A;  1L3L A;  3KCC A;  1Q1H A;  3JTH A;  3KP6 A;  2VOO A;  2GWR A;  4HLX A;  3GZ5 A;  1UST A;  4A6E A;  1R1U A;  3N97 A;  1VTN C;  4N9H A;  3I64 A;  2DLL A;  2ZXJ A;  3CUQ B;  4OIP F;  2ETH A;  2STT A;  2FRH A;  2W57 A;  3EYY A;  3M8E A;  3GVA A;  4KYW A;  3FZV A;  2HGC A;  2RNJ A;  1I5Z A;  3WE3 A;  3E97 A;  3WOD F;  1TQP A;  2O0Y A;  3E6C C;  3PQJ A;  5BS6 A;  3BPV A;  1IN4 A;  2FBI A;  4A0Z A;  1ULY A;  1FZP B;  3J80 K;  2PEX A;  3VOE A;  1U5T A;  4P55 A;  3ZN0 A;  3E3V A;  2GXG A;  1PP7 U;  4U0Y A;  5ICG A;  3CJN A;  4Y13 A;  4G7H F;  2PBI A;  2CQK A;  3TDU C;  3R0J A;  5LGU A;  2IVM A;  2HZT A;  2HFH A;  1MJB A;  1SFE A;  5HS8 A;  1U2W A;  4ASN A;  4MTD A;  3ML6 A;  1FBS A;  1MKM A;  3KLN A;  1IAW A;  1SFU A;  2ISZ A;  3ZMT A;  5AIP A;  3TKY A;  4RB0 A;  5ICC A;  3TQN A;  2CFX A;  3D5L A;  3K69 A;  2OA4 A;  3KZZ A;  5BOX A;  4NHJ A;  1IXC A;  2H27 A;  1XDS A;  1O3S A;  1HSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...