1JE8A

Two-component response regulator narl/dna complex: dna bending found in a high affinity site
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization allows DNA target site recognition by the NarL response regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*AP*TP*TP*AP*AP*TP*GP*GP*GP*TP*AP*
total genus 21
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1je8A00
2JPBA 3TO7A 4PGHA 2F5EA 2GQQA 3TOBA 4FX0A 4F7ZA 1ULYA 1ZRCA 5D4RA 1P4AA 2VT3A 4QWQA 1PP7U 4KN4X 2P7CB 2G7UA 2VE8A 4ZH4F 3P9KA 1U8RA 2LKPA 1U6GA 4LG0B 2ELHA 4A5MA 2GWRA 3S2WA 1IRGA 3K1NA 3KP2A 1WWXA 3RYRA 3M8EA 1IRFA 2V1UA 1TNTA 2UWMA 4L9TA 5EEHA 4EGZA 5D5VB 1SAXA 2O8XA 2WV0A 2GA2A 3BOQA 2JRTA 4LD5A 1O57A 1WKMA 3WU1B 6PAXA 2B0LA 2GAUA 2FXAA 1DPUA 1GVJA 4PCQA 1RIOH 1EH7A 3WTZA 4I01A 1FSHA 2XAFA 4P96A 3LAPA 4LLNA 2DLLA 4IPAA 4ENKA 3HSRA 3TKYA 4RGRA 4ENNA 5HS9A 2X4HA 3RDIA 3QU3A 3ELKA 2KIFA 1P92A 1FBSA 4M9ZA 3R60A 4A0ZA 2F5CA 1MGTA 3ML6A 3HTSB 5HLIA 2ISYA 2A69F 3J80Z 3B02A 4UXNA 3HIFA 1ZREA 1HSTA 1KQ0A 1LJ9A 4AWXB 2NNNA 4N9IA 1LNWA 2VBYA 3TO9A 1J5YA 2RNJA 2VBWA 4HDVA 5E8GA 5BOXA 2JZYA 4BHBA 4G7HF 3TDUC 4TV7A 5FB2A 1ZG3A 1U2WA 1YW8A 5D4SA 4I09A 4PGGA 4KUMA 3F6VA 4MEYF 2ETHA 2G7HA 1DPRA 2XAHA 5ICGA 1HKQA 4GYIA 1I1GA 2Z5UA 3WG9A 1Y0UA 4JK1X 2ESNA 2FQ3A 3RPUA 4A6DA 4U0WA 3D5LA 3V8KA 3LA7A 3CLOA 1I1SA 3IHUA 3R0AA 5ICEA 2NRAC 4OIPF 2K4JA 1ON1A 1YYVA 2HZTA 3GZ6A 1K78B 4LK1F 3FMSA 1A04A 4B8XA 5LEJA 2D1VA 3VEPA 4XSXF 5HDNA 4RS8A 3KP4A 4ZYHA 2VODA 3JTGA 2WC2A 3I0TA 1LQ1A 1G4DA 2DPUA 1IN5A 4HX4A 4L0YB 1W5SA 3SFZA 4E70A 2YR2A 1GXPA 1FLIA 3N4MA 2Q0OA 4HW0A 2A61A 1JHHA 3V8JA 1T39A 1FYKA 1HW5A 1USTA 5LEKA 2F5FA 2XUBA 2A3SA 5D8LB 3HUGA 3E5UA 2IA1A 1Z6RA 3BJOA 1TW3A 1EH6A 3I54A 3WTTC 3VOEA 3FXRA 1ZGJA 4CXFA 3E6CC 2EA4A 3ECOA 4P9FA 4HQMA 1Q1HA 3RPQA 1Z6TA 4L9NA 3BWGA 2P5KA 1HQCA 1CF7B 2QWWA 4MTDA 3RJPA 1GHCA 1O3TA 3E6MA 4KDPA 4OIRF 2P7VB 1MJAA 2F2EA 1ZG5A 4EM0B 4HBLA 5LLQA 4ESBA 2H27A 4XLNF 1J2XA 3P7NA 1QBJA 5E1ZB 2RGVA 4MHGA 1RNLA 2OU2A 3REOA 1Z1DA 4ESJA 4RB0A 1W7PB 2RC4A 5D5XB 2E7XA 1EV7A 1B59A 3M9AA 1XCBA 5J8CA 2BBYA 4MEXF 3LFKA 4G6DA 3EYYA 1FBUA 3VODA 2FNPA 3F21A 4I2OA 4RGUA 3V7RA 1B1BA 2HGCA 1MDMB 4LK0F 3EUHA 2OAZA 1KU3A 5HLHA 2QQAA 4GO1A 1SMYF 2AXLA 2CGPA 4A6EA 2A68F 1REPC 3WODF 2K86A 1I6XA 4G94A 1S6LA 4CGZA 1J0RA 5FFZA 2D1HA 2DU9A 1ODDA 1Z91A 2P5VA 1D3YA 2NS0A 4YIFA 1Z05A 1RI7A 4RB1A 3ERED 2OA4A 3CJNA 4LJZF 5F64A 4A0YA 4JBAA 3QPHA 3MZHA 1MJ9A 2PFBA 4G7OF 2ZBKA 2CSOA 1F1ZA 3SZTA 4KN7X 1JXSA 1RUOA 2ZCWA 3K1MA 4KFCA 3CUQC 1BC8C 2YSRA 3RTRA 3ZPLA 4AIJA 2QENA 3BJ6A 4L5JA 2Q8KA 3IRRA 4WK8F 1P6RA 4UVCA 4DQ2A 3WGGA 2QQBA 3LAJA 2EA2A 2EV5A 1BI0A 3T8TA 5FD6A 2V1XA 4HV6A 4O3MA 2L3DA 1QZZA 4ASNA 1OYYA 2CO5A 5L3FA 4S04A 4BHCA 4L0ZB 1KGSA 4GGGA 4MNUA 1V4RA 2QM3A 3HRUA 5FLXK 4NQWA 2ZO4A 3C7JA 3KZYA 4EJWA 3B73A 3KP5A 3GEZA 5ERIA 3L09A 1T2KA 2D45A 3I53A 4YG2F 4OINF 1FBQA 1YIOA 2J5PA 2W24A 2IP2A 1STZA 2RKHA 1ZHFA 4HX8A 4ZYGA 2HS5A 3F22A 3CUQA 3F8NA 4K2EA 3P9CA 3VB2A 4L5IA 3WGHA 3U2RA 1CGPA 4KT5C 3F8MA 3VFZA 2CWEA 5D8KB 2V1DA 2E1CA 2IW5A 2P6SA 1JGSA 5LHIA 4PDKA 4M9SA 2QYOA 4GCVA 1TQIA 5DYMA 5CVUA 1TTYA 3MCZA 4IXAA 4KNYA 1TNSA 3ZN1A 3I64A 4I98B 1IF1A 2PLYA 5D5UB 2KJCA 2NYXA 2HEOA 2MH2A 2DBBA 3F3XA 3GZ5A 1TBXA 5D5WB 1IXCA 5F1RA 3F8BA 4Y15A 4Y17A 1IZ1A 1IXRC 3MWMA 2P4WA 4KMUX 2YX4A 1LDDA 3QU6A 4KIGA 2HR3A 1W7PA 3FM5A 5ILVA 2Y75A 1BI2A 2GA1A 1UHWA 5LBQA 1KU2A 1ZN2A 1HKSA 1BI3A 2ZXJA 1IXSB 1UHMA 4H0EA 2ZMEA 1MDMA 3F23A 4B09A 3BJAA 5L3EA 1G3YA 1J7KA 4IHSA 4L9JA 1XGNA 1IUYA 4ESFA 1FNNA 4ZZLA 2JT1A 1XD7A 2ZNZA 1P4XA 2VOPA 1G6NA 5FD5A 5KVRA 2QVOA 1R5HA 4BYYA 1O3RA 3ROUA 2VC0A 2O61A 2XGXA 2A6HF 1IN4A 3RI4A 4AIHA 3JAMK 4NHJA 3GYHX 1K79A 4Q47A 2DAOA 4M73A 2XAQA 3DPTA 1U78A 1U5TB 4HF0A 3N97A 2R7FA 3FZVA 1DP7P 4EV0A 4DNCA 3WTWC 2OZUA 3P9IA 1IW7F 3JAMZ 2XASA 2ZNYA 3JTHA 1YQAA 1HBXG 2ZKZA 3ZN0A 3RKWA 2W85A 1PUEE 2STTA 1SFEA 2O0YA 1LDKB 2VT2A 3M7GA 2PI0A 1U3EM 2IJLA 1O3SA 4Y13A 2O03A 1IN8A 1XB4A 3DEUA 1XMKA 2XAGA 4IJAA 1YS6A 5AIQA 3G73A 2VONA 2CG4A 4LFUA 1TQPA 3BDDA 4M72A 3IKTA 4I02A 1B9NA 2PQ8A 3C18A 4HQEA 4AVPA 3DKWA 4A5NA 3KETA 2DI3A 3D0SA 5K5OA 1OMIA 1R5GA 2LDUA 5HS8A 4HF1A 3AAFA 4M71A 2M1BA 3PQKA 2GXBA 3J80K 4WWCA 2J5OA 1XDSA 1LEBA 4U88A 2IRFG 4FT8A 4RAZA 4FHTA 3J81K 3ZMSA 1MZBA 5JR3A 3U1DA 2DTRA 4O5VA 2BE5F 4MTEA 3ZMDA 3GFLA 3CO6C 3COAC 2DFIA 2QZ8A 1NHAA 4UV8A 3NQOA 2XROA 4UV9A 1IN7A 3F8FA 3WTYC 2XVCA 3BPXA 3LA2A 1S8NA 4ON0A 4HOBA 1U5TA 1E2XA 5ILSA 1P2FA 1ZAOA 2FBKA 4WF2A 2VBZA 3TOAA 1H9GA 1KQ9A 1QO0D 2MD5A 1R36A 2L4AA 3IWFA 1HXDA 4BH9A 3QOPA 2HQRA 2ZJ2A 2KRFA 1YO5C 4P55A 5JI6A 2PN6A 3K1PA 1QPMA 4EMSA 5FGMA 1KU9A 5HDGA 1B9MA 4BHPA 4ETSA 3K9TA 3MAJA 1YW7A 1ON2A 2FSWA 4QLCU 3V4GA 5TJJA 4IVNA 3LWFA 1OYIA 3GVAA 4RAYA 4GYGA 1L3LA 4LMYA 2FMLA 2W25A 4LB6B 1WQ2A 2VC1A 3HOTA 3M1EA 3ZMVA 2A07F 2PEXA 2P8TA 1O7FA 1U5TC 3HSFA 3QPTA 5HS7A 3IWZA 3NEUA 5E1XA 3M8FA 2H6BA 2K7LA 2MLGA 4P9UA 2L01A 3K0LA 5E8IA 1YLFA 4KIBA 1TLHB 1K7AA 2COMA 2M30A 4U7BA 1R23A 3R61A 4U0VA 4EM1A 1GXQA 3PQJA 2NAZA 1DDNA 3BROA 1B4AA 1X3UA 2EB7A 2FE3A 3FF5A 2QLZA 4LG0A 1FYMA 4UNOA 5DCMA 2HTSA 2ISZA 4CO8A 2DK5A 3J81Z 3EQLF 4KMFA 1ZARA 4HLYA 5FFXA 5LGUA 4CICA 5ICCA 4Z2YA 1JE8A 4A0XA 4KICA 5IT3A 3ZMTA 5F6FA 2UZKA 5IT9Z 1KYZA 2XHKA 1S3JA 1I5ZA 2FNAA 5CVJA 1SD6A 1W4MA 3I58A 3SZPA 1W5TA 2HFHA 4HA8A 5DV5A 3W6KB 2WTEA 1YS7A 2H09A 2K27A 3KLOA 3HOSA 3HYIA 1USSA 3KP3A 1IN6A 1RUNA 3DQVC 2EV6A 1J59A 3GWZA 1O7LA 2FA5A 5DD4A 1FX7A 1UB9A 1D8KA 3GFJA 5CVIA 3DF8A 3CUQB 2K02A 5E20A 5LRSA 1C0WA 5DUKA 3KCCA 3LSTA 4I0BA 1XGOA 4U0YA 3HSEA 4M9XA 3JSOA 1XSDA 3HHHA 3ZMUA 1UFMA 4XLPF 3GFIA 3HRTA 3QP6A 2BV6A 1OYWA 1T38A 4UUVA 1S29A 4IRHA 1F4KA 3Q9SA 2Y0MA 1QNTA 2EFWA 4YIIA 2IA2A 1ZRFA 2KKOA 1LEAA 3SXYA 1SFUA 5A2QZ 3I5UA 3DPLC 4FX4A 3IKVA 1FY7A 5BMZA 1R00A 2KIMA 3I59B 2FMYA 5JHUA 2JTVA 1SFXA 2TDXA 2A6EF 4AD9A 3T8RA 2MC3A 1ONVA 2BGCA 3WE2A 1I27A 3O6BB 2A5YB 2VE9A 5TRDA 4NB5A 1UCRA 4HZFA 3W6JB 4IRIA 2HKOA 3EYIA 3WU0A 3F72A 4HAMA 4WCGA 1F5TA 2QBYA 1HSJA 4O6JA 3T1BA 1ZYRF 2CW0F 3HTUA 1LVAA 1WI9A 4WX9A 2ESHA 1R1VA 1O3QA 2OQGA 1BIBA 3WGIA 4LLLA 5CJ9A 5H6QA 5HDKA 1Z7UA 3ULQB 4EJUA 5E1WA 5H20A 5L3BA 5HLGA 2AS5F 3J7AO 2M5WA 3ABUA 3R4KA 3JW4A 2UXNA 2LF8A 2M8EA 4R1HA 4XRFA 1KQ8A 3GO5A 2H6CA 4LLGF 3DP7A 4RGXA 4WXHA 5K5QA 3WTXC 2KJBA 5FO5A 3QRFF 4HLXA 3MEXA 4I7HA 1BIAA 5L3DA 1XMAA 2DQLA 2K4BA 2LSOA 1B6AA 4BNCA 3C3WA 1H0MA 2GXGA 3EETA 3ABTA 2VXZA 3O2PE 1J9IA 4EJOA 5LGTA 2RQPA 2RDPA 2RN7A 3WTSC 1K78A 4KYWA 1PDNC 3E3VA 4UVBA 1QZYA 3FXUA 1J75A 2YPRA 3F6OA 2FEZA 2CQKA 2FBHA 1K6OA 2QUFA 3TQNA 4Q5SF 3E97A 1RZ4A 2E7WA 4RGSA 2W57A 3I59A 4LB5A 2R3SA 1SMTA 3FXQA 3G3ZA 5DCMB 3RYPA 3RKXA 2L4MA 2LNBA 2BEOA 1PP8F 1BM9A 2Z3YA 1KU7A 2FBIA 5AIPA 5FLXZ 3KP7A 2XKOA 3GLXA 2WWYA 1SD4A 2GZWA 4L18B 3CUOA 3R6SA 1FC3A 4M6XA 1H9TA 1BI1A 2HOEA 5E17F 3PFIA 3MFKA 1T0FA 2Q2EA 4EM2A 1ZLJA 2OQRA 1OR7A 3QAHA 3BY6A 2EFOA 5L3CA 5BQTA 2EJRA 5EEGA 1ZG1A 3L00A 1T98A 5HOOA 4BQAA 4KA4A 4HYEA 3GFMA 3KE2A 3FHZA 1QGPA 4RB3C 2Z33A 3IRQA 2OZ6A 3HRMA 3GXOA 1JHFA 5BPIA 4YFKF 1XN7A 1FP1D 2L02A 2UXXA 5ILUA 2RV8A 1WRJA 1SD7A 5LRRA 1BJAA 3IC7A 1XGMA 2RVCA 2EFQA 3FX3A 5K5RA 2PMHA 2KIUA 1ZRDA 2HKXA 2XV4S 1HW2A 3E5QA 3TO6A 1LB2A 4HV5A 1G3TA 4IF4A 2P6TA 4HX7A 2EFNA 2VBXA 2FF4A 1SD5A 3ZQ7A 3HRSA 5J6XA 1FZPB 4OMYA 5A2QK 3O3KA 1R7JA 3H3ZA 1YG2A 2HYFA 2MA3A 4XBFA 3K69A 4OOIA 2Z9OA 4CZZA 4MGRA 3I4PA 2PG4A 2EK5A 4GXOA 1HKTA 2JSCA 1VTNC 5DEQA 1FYLA 2DPDA 4G6QA 2QBYB 2ZFWA 3V7CA 3Q9VA 3NRVA 3BPVA 5DD8A 3U9GA 1BOAA 4UHTA 1OPCA 2IPQX 1Z9CA 5CVVA 3LQRA 1ZLKA 3FMQA 3TGNA 2XRNA 1FWZA 4BXUA 4U7DA 4WXCA 5HVQC 4S05A 1BN5A 5CYVA 3KEOA 3CDHA 4YFXF 5ED4A 1WSUA 2JPCA 2ADUA 2PJPA 4PZJA 1YFHA 1D5VA 2R7DA 4R8HA 2FOKA 1S7AA 3E6DA 4ZYEA 5LHHA 2OBPA 5IT9K 3F8CA 3FM3A 4R79A 2NNYA 1BC7C 5BPDA 1ZGAA 3RKYA 2O6GE 2OD5A 3HHGA 2PMUA 2C6YA 4OU0A 2V79A 4CDGA 3SQNA 1MD0A 4D0PA 4A12A 1R58A 1HW1A 3L2CA 2FU4A 5AONA 1XGSA 3ZMZA 1MJBA 1XSVA 3K2ZA 2MLKA 1T6SA 3H92A 3ISPA 3CO7C 1YW9A 3DFGA 2EV0A 4RB2C 3GX4X 2P5LC 5BS6A 4OIOF 1W7PD 1DUXC 2HWVA 3LQQA 4EGYA 2DQRA 3KZZA 3WTVC 2M87A 2ZMEB 3OV8A 4G9YA 4MQ9F 4CYDA 2F5DA 1ZH5A 5DCFA 2V6CA 4EJTA 3ECHA 3SHFA 2CYYA 2LF7A 3V8LA 3I71A 3T5XA 4M6YA 2CFXA 3H3UA 2L54A 2VN2A 3QP5A 4KIFA 1F9NA 2PBIA 2Z99A 5E18F 2E1NA 1IAWA 1S7OA 1AWCA 4N9HA 2HQNA 4IRGA 2IA0A 2YU3A 3EDPA 5ICFA 1FP2A 5DUIA 2W84A 2XAJA 4N0BA 3OOPA 3IL2A 4EVIA 5L3GA 2MH9A 1TW2A 5H6RA 2FRHA 5D6FA 1XCVA 3TDZC 1FSEA 5CLSA 2HDCA 3MZYA 4ENJA 5K1YA 2EWNA 3C1DA 3Q5FA 4Q48A 3MQ0A 2DT5A 4LGWA 4YFNF 2DK8A 4MQVA 1XDUA 3ZP5A 1QQIA 2BYVE 1OKRA 3V7SA 4G8XA 5DDGA 5J8FA 1XSXA 2X0LA 4HF2A 3T0YA 5LGNA 3DXJF 4EJVA 4ZYDA 1YTYA 4ENMA 2H94A 3KFWX 3KP6A 5CVRA 4Q4ZF 3DV8A 3KLNA 3L7WA 3WTUC 1P4WA 1R22A 5JVTA 1KYWA 2DO7A 1LDJA 4JQFA 3RIRA 3E6BA 2M45A 3E5XA 3GF2A 1FT9A 2V9VA 2XIGA 1FOKA 3R0JA 2XKPA 4AIKA 2HTJA 3JSPA 1L0OC 2MBFA 1EH8A 1R1TA 1KA8A 4EQQA 1E17A 5LHGA 4OIQF 4HDUA 2QQ9A 1BBYA 4XSZF 3CTAA 1G3SA 4BAYA 4P5OA 4IHTA 5JFRA 2STWA 5KK1A 3L9FA 3GUDA 2HYGD 3BP8A 2O3FA 1TQMA 2VOOA 1MKMA 5D6EA 4OMZA 2D2WA 4A2UA 2EFPA 3LA3A 4M74A 1V3FA 4L9VA 4ZZDA 1D8JA 2Y48A 4I0AA 1FPQA 1CF7A 2DW4A 4UVAA 2GIVA 4WXDA 3BZ6A 3FWEA 2IT0A 4G7ZF 4CHUA 3GW2A 3KEQA 1AOYA 1G3WA 2G9WA 1R1UA 2YX7A 2ACJA 3WE3A 3FMRA 2IVMA
chains in the Genus database with same CATH superfamily
2JPBA 3TO7A 4PGHA 1VQ8I 2F5EA 2KRCA 1X1DA 2GQQA 3TOBA 5F04A 1B72A 3HOYJ 1E0EA 4FX0A 4F7ZA 1ULYA 1ZRCA 2ZB9A 2DT6A 5D4RA 1P4AA 4BJ5C 2CS3A 3V42A 5KAFC 2VT3A 3PNYA 4QWQA 4KN4X 3IAS2 1PP7U 2P7CB 2G7UA 2VE8A 4ZH4F 1JTXA 4C3JJ 3UNGC 3P9KA 2F6CA 1U8RA 2LKPA 2ZC2A 4F91B 3AL0B 5JHFA 1U6GA 1WI3A 2DA7A 3IH4A 4LG0B 2AO9A 2ELHA 3D5SC 4A5MA 2X1DA 2GWRA 4XLHA 3VYUB 4YIRX 4M3BA 3S2WA 3K1NA 4PJMA 2HVQA 3KP2A 1IRGA 1FOXA 1WWXA 3RYRA 3M8EA 1IRFA 2V1UA 1AHDP 3C2BA 5H2FC 1TNTA 4BU2A 3K2AA 2UWMA 4L9TA 3MKWB 5EEHA 2LG4A 2W48A 4BJTA 1WJCA 3AG2H 4EGZA 4IHYA 5KHDA 1MH3A 2E36A 2DJIA 5D5VB 1SAXA 2E1OA 2O8XA 2WV0A 2MC4A 3AG4H 1LE8A 2GA2A 3RZDJ 2VB6A 2JRTA 3BOQA 4LD5A 5B1BH 4BXFA 3FHNA 3BLYA 1I6HJ 3DLAA 1O57A 1WKMA 3WU1B 3IH3A 3ZQLA 6PAXA 4LG3A 2B0LA 2GAUA 3ZQHA 2FXAA 2K5CA 2E1MB 3CMEI 1MNMC 3FBIB 1DPUA 1GVJA 4PCQA 2BY3A 1RIOH 1EH7A 3WTZA 4I01A 1FSHA 1V5FA 1ETKA 2XAFA 2EZLA 2LD5A 4P96A 1ETWA 3CESA 4F92B 3LAPA 4LLNA 3BR2A 2DLLA 3BCBA 3HZJA 4IPAA 4ENKA 3HSRA 2H8WA 3TKYA 5EGOA 4RGRA 3HOVJ 4ENNA 4ZTJA 5HS9A 1TWHJ 2XF5A 1SAUA 1GT0C 2X4HA 4CZCA 4M3DA 3RDIA 3QU3A 4D7NA 4HG2A 3ELKA 3DCFA 4C2UA 2KIFA 2XAUA 2K85A 1P92A 1FBSA 4M9ZA 1OCPA 2B7EA 3R60A 2F5CA 4A0ZA 5C44J 1MGTA 2QQ8A 3ML6A 4A3MJ 3CJQB 3OYAA 3HTSB 3CCLI 3HXLA 5HLIA 1I3QJ 4JP0A 2ISYA 2A69F 2M7AA 4BQNA 5FJ8J 3J80Z 1N25A 3B02A 4UXNA 1AA7A 3HIFA 2WA0A 2XGCA 1ZREA 1VQ5I 1DQUA 1HSTA 1KQ0A 1LJ9A 4AWXB 2NNNA 4N9IA 1LNWA 2VBYA 2FQ4A 3TO9A 1J5YA 2RNJA 2X51A 2VBWA 4HDVA 2JSPA 5E8GA 5BOXA 1HC8A 4FTHA 3SFIA 2JZYA 4BHBA 2L7MP 4G7HF 1Z77A 3LNQA 3H0GJ 2HXIA 4DJAA 4AM3A 3TDUC 2W00A 4TV7A 4DBRA 5FB2A 2Q1ZB 5GPAA 4IO9F 4YELA 1ZG3A 1U2WA 2O9LA 1YW8A 5D4SA 2I8DA 4I09A 4FCYA 4D5CA 4PGGA 1SFOJ 4OAYA 4KUMA 2DMTA 3F6VA 4MEYF 5M3FJ 1ACIA 4DGWB 1TT5B 4XM3A 2DDAA 2ETHA 2G7HA 3SEZA 2XAHA 1DPRA 5ICGA 1MBEA 1HKQA 4GYIA 1I1GA 1OR7C 5EG0B 3HJEA 1W5CC 2Z5UA 3WG9A 1I3AA 1Y0UA 4JK1X 4XQFA 2ESNA 3LSRA 2FQ3A 3RPUA 4A6DA 3DEWA 3DTIA 4U0WA 2LBFB 2PJRA 1TP4A 3D5LA 1ZQ3P 3V8KA 3LA7A 2Y2ZA 4IHWA 3CLOA 3IAM2 2L0KA 4J01A 3IHUA 3R0AA 1KZHA 1I1SA 1BOBA 5ICEA 4PJJA 2NRAC 4OIPF 2K4JA 1VQ4I 2KZVA 1VI0A 1H8AC 1ON1A 3OYDA 1IRXA 1YYVA 2LY9A 2MSYA 2HZTA 4N4NB 3GZ6A 1K78B 4LK1F 3FMSA 3QYBA 1A04A 4B8XA 1Y0NA 1YX3A 2HDDA 3K6GA 5LEJA 3TP3A 2D1VA 3O8GA 3VEPA 3GLLA 1MSFC 4XSXF 5HDNA 4RS8A 3KP4A 1OCTC 3DLLF 4ZYHA 2VODA 4A3FJ 3JTGA 3CCVI 3PFYA 5K7ZA 2WC2A 1ZELA 4CCLA 3I0TA 1LQ1A 1G4DA 3HDDA 5IOZA 1D1BA 2CUJA 2DPUA 3A4CA 1IN5A 3PSIA 4HX4A 4L0YB 3JRDA 4FASD 1W5SA 2V7FA 1V5EA 3SFZA 3DEEA 4E70A 1IJWC 2YR2A 1GXPA 3L2RA 1M1EB 1FLIA 3CD6I 2B9SA 3HOWJ 3ZQIA 3N4MA 1APLC 1FEXA 1VQ6I 2K40A 2Q0OA 4HW0A 2A61A 1JHHA 3PIPF 2VXDA 3V8JA 5DM6F 4E7SA 1T39A 1FYKA 1HW5A 1USTA 2L9SA 2KDOA 1PYVA 5LEKA 2F5FA 1VQNI 2XUBA 2A3SA 5D8LB 2JA8J 4IOCF 2EQRA 3HUGA 1IDYA 3E5UA 3BG5A 2IA1A 1P9QC 3K4CA 1Z6RA 2MABA 3SDGA 1FOWA 1FMVA 2LYCA 3BJOA 3HPGA 1TW3A 3OR2C 3H5NA 1EH6A 2LK2A 3BR1A 3I54A 3I3LA 3WTTC 3VOEA 4RBOA 3CCQI 3FXRA 4XRMA 1ZGJA 1YJNI 4CXFA 3E6CC 3OYNA 2EA4A 3ECOA 4P9FA 4HQMA 1Q1HA 3RPQA 1OLTA 1MMDA 3A0HC 5B3SH 1Z6TA 4NBQA 3OYGA 2E5NA 4L9NA 4A3LJ 3OL3A 2W4SA 3BWGA 2P5KA 1HQCA 1CF7B 2QWWA 3OYFA 3HEFA 4MTDA 3SZGA 3DBLB 3ZOBA 3RJPA 1GHCA 1O3TA 3E6MA 4KDPA 1ETOA 4OIRF 1GV5A 1ENHA 1MJAA 2F2EA 2P7VB 1ZG5A 3DTKA 4EM0B 4HBLA 2X6WA 5LLQA 3GTMJ 4IKFA 5JLWA 4ESBA 2CW7A 2H27A 4XLNF 4J19A 1J2XA 4HRIA 3P7NA 1A5JA 5E1ZB 1QBJA 2QKLB 2RGVA 1KONA 3DBRB 1RNLA 4MHGA 4D1QA 2OU2A 3REOA 1UZCA 1Z1DA 4B4CA 2JA7J 2M9HA 4ESJA 4RB0A 4XN3A 1W7PB 3QYFA 2RC4A 2IGMA 3KIOA 3VDXA 3Q0WA 1JJ6C 5D5XB 3DKXA 2E7XA 1EV7A 1B59A 3M9AA 1HA8A 1XCBA 5J8CA 5C4JJ 2V9KA 2BBYA 3IP4B 4LOCA 1QRYA 3LFKA 4G6DA 4MEXF 1Y8RB 3EYYA 2IS4A 5CPRB 1D0YA 1FBUA 3RQ4A 3VODA 2FNPA 2E2IJ 3SYTA 3C2HA 3F21A 4UUSB 4I2OA 2OCEA 4RGUA 3V7RA 3GTKJ 1B1BA 4EEFG 3W2VA 2HGCA 1MDMB 4LK0F 3EUHA 2OAZA 3OYHA 5EF6A 4YRVA 1KU3A 1I39A 4JOMA 2JUCA 3KYLA 5HLHA 1A36A 2QQAA 4M3EA 4GO1A 4UUTA 5J1UA 1SMYF 2JVHA 2RAEA 2AXLA 2CGPA 4A6EA 2A68F 3JRGA 1REPC 2VJJA 2WAEA 3WODF 4MFEA 2MW8A 2K86A 1VQKI 5EYRA 1I6XA 4G94A 3BZKA 1S6LA 3OWTA 2VKVA 4CGZA 4LIUA 5GPCA 1J0RA 5FFZA 2D1HA 2QGUA 2DJNA 1D5YA 1MNDA 2DU9A 4CH7A 3H0DA 3K4JA 1ODDA 1Z91A 2P5VA 1D3YA 2NS0A 4YIFA 1Z05A 1O4XA 1RI7A 3M07A 4V2FA 1JUMA 4RB1A 3ERED 2OA4A 3CJNA 2WAQN 2CJJA 1X1BA 4LJZF 5F64A 4A0YA 4JBAA 3MKYB 1F43A 3QPHA 3MZHA 1MJ9A 2PFBA 4G7OF 2ZBKA 2CSOA 1F1ZA 4A3DJ 3BG6A 1VQPI 4QIWN 3SZTA 4KN7X 1JXSA 2ELJA 1RUOA 2ZCWA 3MVPA 3FXLA 4DW6A 3K1MA 4KFCA 3CUQC 1BC8C 3TW6A 2KRHA 2DA4A 2DT7B 4P1WA 5FLMJ 3OS1A 1ETXA 2YSRA 1Z7LA 3G71I 3RTRA 4UB6C 3ZPLA 3JRAA 2K9LA 3I4MJ 2O7OA 2QENA 4AIJA 3BJ6A 4L5JA 2Q8KA 3IRRA 4WK8F 1ITYA 1P6RA 4UVCA 2VQLA 1JKQC 2CQ7A 4DQ2A 3WGGA 3GTLJ 2QQBA 3LAJA 2EA2A 2EV5A 3VYSB 1BI0A 3T8TA 5FD6A 2V1XA 3J7YJ 4HV6A 4O3MA 2L3DA 2P81A 1QZEA 1QZZA 1SVOA 1D1CA 4ASNA 5J4YA 1OYYA 3M4OJ 2CO5A 4M3FA 5L3FA 4S04A 4BHCA 1X3ZB 2QCOA 4L0ZB 2DA6A 1H89C 1KGSA 4GGGA 4MNUA 1V4RA 2QM3A 3HRUA 3FKIJ 5FLXK 3DKYA 4NQWA 2ZO4A 3C7JA 2Z1DA 3KZYA 4W97A 3QPSA 4EJWA 3IH2A 3B73A 1MBGA 3KP5A 3GEZA 1T95A 4FETA 3G1LA 5EZGA 1WJEA 2XPWA 2IS1A 5ERIA 1LKXA 4BL0B 3L09A 3UKGA 3IUOA 3ZQCA 1T2KA 2VASA 3MZ8A 2D45A 3I53A 3E0JB 4YG2F 4NC7A 2DA3A 3WHCA 1RR8C 2EPFA 3BC8A 4OINF 1FBQA 2LOOA 1YIOA 2J5PA 2NOJB 2VJ5A 2W24A 2KISA 3H1CA 4C3IJ 1QU3A 4BDZA 2IEKA 4XKBA 1QPIA 2BY0A 2M4GA 2IP2A 3BTJA 2L7ZA 1STZA 1ZKGA 2RKHA 1ZHFA 2Y0SA 2WV1A 4HX8A 4ZYGA 2HS5A 2X48A 4HNTA 3BCAA 3HOXJ 3F22A 3CUQA 3F8NA 4K2EA 3BT9A 3P9CA 3VB2A 3LSKA 2GBYA 4OWRB 1S9HA 4L5IA 2V6EA 4Y4RA 3OIOA 3WGHA 2KZGA 3U2RA 2LTPA 4KT5C 3F8MA 1CGPA 2JN6A 3VFZA 2CWEA 3BR5A 1Z3XA 2V1DA 5D8KB 5EDNA 5F0HA 5J3LA 2E1CA 2IW5A 4RM2A 2P6SA 3GTGJ 2KLOA 3ESWB 1MH4A 1ETVA 2AQEA 1JGSA 2H1KA 5LHIA 4PDKA 3H36A 4M9SA 5HNFA 1WJBA 1DGRM 1LUJB 1UMQA 2QYOA 2VKHA 4GCVA 1TQIA 5DYMA 2FD5A 5CVUA 1TTYA 2Y9ZA 2KP6A 3MCZA 4IXAA 4KNYA 1TNSA 3VSLA 2LP0A 3ZN1A 5IY5H 1VQ7I 2A5WA 3I64A 4I98B 1IF1A 4BE0A 3VWBA 3A0BC 2PLYA 1V5GA 5D5UB 4GDFA 3A03A 2PJRB 2KJCA 2NYXA 2FJ1A 2HEOA 2MH2A 2JQ7A 1BR1A 2DBBA 2IAIA 3F3XA 3GZ5A 2RQQA 3DU6A 4A3KJ 1TBXA 2KDZA 5D5WB 3H9GA 5C4XJ 2JA6J 1IXCA 3G2BA 5F1RA 3F8BA 4XKWA 2L7FP 4Y15A 2GOMA 1HOMA 4Y17A 1J09A 4JYKA 3DWLE 2NOGA 3GMEA 2BW3A 3BG7A 2QSFX 1IZ1A 2R0QC 1IXRC 4KT6A 3MWMA 2P4WA 2N8GA 4KMUX 3LSHA 4PSWA 1EKEA 1OCCH 2YX4A 1X1PA 2MG4A 1LDDA 3FXOA 2OJED 4FE4A 2Z16A 4ABZA 3L2QA 3QU6A 3M1CA 4XLAA 4KJZA 3HKZN 4NQWB 4AC0A 4BE2A 1WH5A 2HR3A 4KIGA 4PJ0C 2HQ5A 2CQQA 1HF0A 4BGDA 1W7PA 5GAHJ 3PUBA 3FM5A 1U0JA 5ILVA 2Y75A 1BI2A 3H3VK 2K9SA 2GA1A 1UHWA 5LBQA 1KU2A 1ZN2A 1HKSA 5B1AH 1BI3A 1I50J 1TWCJ 2ME0A 2ZXJA 3G1OA 4E4HA 4A3JJ 3ABKH 1IXSB 1UHMA 1D0XA 4H0EA 2OV7A 2ZMEA 1DU6A 2HU9A 4KISA 3C2GA 1MDMA 5JLXA 3F23A 3B6AA 2KIQA 4XIDA 3G6EI 4B09A 2IS2A 1EF4A 3BJAA 5L3EA 4PSXA 4XN0A 3ZCOA 1NK3P 1G3YA 1ZTRA 1LFBA 1J7KA 1E3OC 3CF2A 4IHSA 1MIJA 4L9JA 4FISA 3D5RC 1XGNA 1IUYA 5IYDJ 4ESFA 3RKQA 4MIMA 1FNNA 2YU9J 4ZZLA 2BZTA 1S5LC 2JT1A 3ZRGA 2HOSA 3Q0VA 1X4OA 1XD7A 2MGQA 1P4XA 2ZNZA 5FKLA 2VOPA 1G6NA 5FD5A 2CW8A 1MMSA 5KVRA 2QVOA 1R5HA 4BYYA 1O3RA 1H88C 3K4BA 1TWFJ 3RPUD 3ROUA 2VC0A 2VL8A 2O61A 1JTYA 2K3FA 2XGXA 2Y31A 2A6HF 3N05A 1IN4A 4B48A 3RI4A 4AIHA 3PO2J 3JAMK 3DBHB 4NHJA 3GYHX 1K79A 1RKWA 2PMZN 4Q47A 2A6TA 2DAOA 2ZXWH 2ZMEC 1WZ2A 1X4PA 4M73A 4A3EJ 2H8RA 4RAGA 2XAQA 2EH3A 1PVEA 2K9QA 3DPTA 3OL4A 3CJRB 1U78A 1U5TB 3H5AA 2M8GX 4GFBA 2ZJPF 4HF0A 4BBSJ 2EINH 4DYCA 1WJAA 3N97A 2R7FA 2DXIA 2M2EA 3FZVA 3PNVA 2JA2A 2OF7A 1DP7P 2E19A 4EV0A 4DNCA 3WTWC 2OZUA 4CCKA 3P9IA 1IW7F 4F3QA 1V55H 4A3GJ 3F0CA 3JAMZ 2XASA 1Y8QB 2ZNYA 3JTHA 3KZIC 1YQAA 1HBXG 2ZKZA 3ZN0A 3RKWA 1XPXA 3VSKA 2CFOA 2W85A 1PUEE 5GP9A 4B44A 2STTA 3LSJA 1SFEA 2BW3B 3CLQA 2AXTC 2XPUA 2O0YA 2M0CA 1LDKB 3QODA 2KMUA 2VT2A 3M7GA 2PI0A 3H35A 3RQIA 1U3EM 2IJLA 5FKMA 3OS2A 4XLFA 1O3SA 2ZXIA 4Y13A 2O03A 3S1MJ 3OYCA 1IN8A 1XB4A 3DEUA 1PUFA 1XMKA 2XAGA 1NK2P 4IJAA 1YS6A 2F4MB 4UB8C 5AIQA 2EILH 3K7AJ 3G73A 2VONA 3AG3H 4A3IJ 2CG4A 4LFUA 1TQPA 3BDDA 1Y39A 3LFUA 2L9NA 3MKZA 4M72A 3IKTA 4I02A 3TP0A 3S1RJ 1Z21A 1B9NA 2E34A 3FDYA 2PQ8A 3C18A 4C2MJ 4AVPA 3DKWA 4HQEA 3CC4I 4A5NA 3KETA 1SEUA 2DI3A 3D0SA 1OMIA 1R5GA 2MD0A 1Z67A 2LDUA 5K5OA 5HS8A 4HF1A 2EZHA 3AAFA 2DTZA 4M71A 5F1JA 2IBDA 2M1BA 3PQKA 2GXBA 1WHUA 3J80K 4WWCA 2J5OA 1XDSA 2NXNB 3S1QJ 1LEBA 3I56I 4U88A 2IRFG 2BXYA 3SJMA 1OFCX 1BW6A 4FT8A 1B72B 4RAZA 4FHTA 3J81K 2K9MA 1BR4A 4RMNA 3ZMSA 3OYEA 1MZBA 2LMDA 3BG3A 5JR3A 1QHGA 3K10A 4NNJA 3U1DA 2K9NA 2DTRA 1OCRH 2EZIA 4O5VA 2BE5F 4MTEA 3ZMDA 2DMPA 1XG1A 3GFLA 3CO6C 3COAC 2DFIA 2QZ8A 1NHAA 4UV8A 3NQOA 2PX9A 2DOAA 3PJRA 2XROA 3FK6A 4UV9A 2OPTA 2B63J 1LVKA 2PMZA 3CC7I 1IN7A 3CJTB 3F8FA 4ZDPA 3WTYC 2R5YB 2XVCA 3BPXA 4BBRJ 4CCNA 1X2MA 1IRZA 3LA2A 5K7FA 1S8NA 4ON0A 4ZTFA 4XOTA 4HOBA 1U5TA 1E2XA 5ILSA 4I6ZA 2Y0SN 1P2FA 3GBGA 1ZAOA 2FBKA 3SDBA 2R7OA 5CQEA 4WF2A 2VBZA 3TOAA 3PO3J 1H9GA 1KQ9A 5KAIC 1QO0D 3BTCA 1T0FC 1AKHB 2F4OB 1PJRA 2MD5A 1R36A 2L4AA 3IWFA 1HXDA 2DDBA 2VJIA 4BH9A 3RCOA 3QOPA 2M0MA 2R7QA 1GUUA 2HQRA 2ZJ2A 2BY2A 2KRFA 1YO5C 4P55A 2QSGX 5IYCJ 3BG9A 5JI6A 2PN6A 3A1YA 3K1PA 1G2HA 3PL8A 1QPMA 4EMSA 5FGMA 4E7HA 4ITVA 1KU9A 5HDGA 1FOYA 5B66C 1X58A 1B9MA 4BHPA 4ETSA 3HB9A 3K9TA 4ZDOA 2CUZA 3A01A 3MAJA 1YW7A 3ZQGA 1ON2A 2FSWA 4QLCU 3V4GA 4XORA 5TJJA 4IVNA 4C3HJ 1WPKA 4D7MA 2HPMA 3LWFA 1OYIA 3GVAA 4RAYA 2VI6A 5HLTA 1UHSA 2R7UA 4GYGA 3S17J 1L3LA 4LMYA 2FMLA 2W25A 4ZDLA 4G12A 4AYBA 3PIOF 3JRFA 4LB6B 2BHYA 1WQ2A 1IDZA 2VC1A 3HPHA 4PFPA 2NVXJ 2HZDA 4IHXA 2VQGA 5GAGJ 5EJCA 3HOTA 3M1EA 1VQMI 3ZMVA 2A07F 2PEXA 2P8TA 1WVRA 3E1SA 3FXMA 1O7FA 1U5TC 5B5EC 1PUFB 2HNHA 1MBFA 3HSFA 1MSEC 4IX7A 2X6YA 1TC3C 3QPTA 5HS7A 3IWZA 4HPQA 3JR9A 3NEUA 5E1XA 2JVGA 4BQQA 3CCEI 2JK3A 3M8FA 2H6BA 2TCTA 1EA3A 3LSMA 2ICWG 2YS9A 3BQYA 2K7LA 2MLGA 4DZJA 4P9UA 2L01A 1WGXA 3K0LA 4FQGA 3NAUA 5E8IA 4B1RA 4A3CJ 1YLFA 2BVLA 4KIBA 1TLHB 4E7ZA 4RAFA 5LFAA 3AKZA 3OY9A 4BUPA 1K7AA 1UAAA 3TMOA 1CQTA 1WJ5A 3HGGA 2COMA 5FKOA 5E3LA 3HOUJ 2M30A 4U7BA 1R23A 3R61A 1QVTA 1X2NA 4C30A 2M7BA 2VQCA 4U0VA 4PUSA 4EM1A 2L5QA 2I5UA 1XTAA 1GXQA 3S2DJ 2F4IA 3I55I 3PQJA 2NAZA 1DDNA 2QF7A 3BROA 4IQ4A 1B4AA 1X3UA 2EB7A 2FE3A 3FF5A 2QLZA 1JGGA 2L9VA 4LG0A 1FYMA 4UNOA 1YIJI 5IP6A 2FUG2 5DCMA 2HTSA 2ISZA 3D1NI 1JJ8C 4AU7A 4Z6YA 3K70D 4CO8A 1IV6A 2DK5A 3Q0UA 2WBMA 2HVSA 1R49A 2XSDC 4C9YA 3FKJA 3J81Z 3EQLF 4KMFA 1TZLA 3OSGA 1ZARA 4HLYA 5FFXA 5LGUA 4CICA 3OYMA 5ICCA 2OTJI 4FE7A 4Z2YA 1JE8A 4HEA2 4A0XA 3K4MA 4KICA 2TRTA 4XK4A 2JUGA 5IT3A 4BE1A 3ZMTA 1GLNA 5M3MJ 2NS7A 5HNHA 3MMYB 5F6FA 5M5WJ 3BQZA 1FTTA 3LL7A 2ID3A 4QPQA 3BTIA 2NVUB 3OYIA 2UZKA 5IT9Z 2ZJRF 1KYZA 4HNUA 2XHKA 1S72I 1S3JA 1I5ZA 2F5VA 2FNAA 5CVJA 1SD6A 1OISA 1X1CA 1W4MA 1G8XA 2DYRH 4ZC3A 3I58A 3SZPA 1Z0XA 1W5TA 2E35A 2HFHA 2R7VA 4CYCB 4HA8A 1YRNB 3CCYA 3E7LA 3K4NA 4NC6A 3PM1A 4M6VA 2IGOA 5DV5A 3W6KB 2WTEA 1YS7A 2H09A 2K27A 3VYTB 1GDTA 2CV0A 3KLOA 4JX4A 3HOSA 3HYIA 1USSA 3KP3A 1R4MB 4RA2A 1IGNA 2LH9A 3J7ZI 2KFDA 1IN6A 3JRHA 3GTJJ 1RUNA 4DOZA 3CMYA 3DQVC 1MMAA 3HUGB 4NUBA 2EV6A 2VIXA 1FIAA 1J59A 3GTPJ 3GWZA 3OYBA 4D5FA 1O7LA 2FA5A 5DD4A 3OOUA 5J40A 4D9JA 1FX7A 4W1UA 1UB9A 3B6CA 2ZJQF 3H5RA 1IG7A 1D8KA 3GFJA 3EUKL 1SFKA 5CVIA 3S32A 3JREA 3DF8A 3CUQB 2K02A 2LREA 5E20A 5LRSA 1C0WA 5DUKA 3KCCA 3LSTA 4I0BA 3H9QA 1XGOA 5GTHC 1W0TA 2DMUA 4U0YA 3HSEA 4M9XA 2R7TA 3JSOA 2E2HJ 2JRMA 1XSDA 4G6TB 3BZCA 3HHHA 3ZMUA 1NG7A 3NWTA 1UFMA 4XLPF 3GFIA 3HRTA 3QP6A 1W0UA 1K61A 2BV6A 1OYWA 1T38A 1X3WB 4II3A 2LLKA 4XONA 2DN0A 2CH0A 4UUVA 1S29A 5C3EJ 4IRHA 1F4KA 4CSWA 2GIZA 2H1LA 2M3AA 3Q9SA 2UV1A 2ME6A 4BS9A 2Y0MA 3CP2A 1QNTA 4F52A 5E3OA 2EFWA 1R71A 4YIIA 5CQGA 2BY1A 3TL4X 5GADJ 2LY2A 1MBKA 2L2OA 2IA2A 3ZQFA 1ZRFA 2KKOA 1LEAA 3SXYA 2JJ7A 2Y69H 2OC6A 1JKOC 1TWAJ 1SFUA 4UUSA 2VUMJ 1AKHA 2DA5A 5A2QZ 3I5UA 3DPLC 4FX4A 3IKVA 4M3GA 4BDYA 2R7RA 1FY7A 1T08B 5BMZA 1EJ9A 1R00A 2KIMA 3I59B 2FMYA 5JHUA 2JTVA 4E7IA 1SFXA 3CCJI 1POGA 2TDXA 2A6EF 4AD9A 2IGKA 3T8RA 4XKVA 1MBJA 1YITI 2MC3A 1ONVA 2BGCA 3WE2A 1R6RA 4ANJA 1I27A 4L5EA 4BJ6C 3O6BB 3CCRI 2A5YB 4XICA 2VE9A 2NVYJ 3H9JA 5TRDA 5CKTA 4NB5A 1BJZA 1A6IA 1UCRA 2IS6A 3EUAA 4HZFA 3W6JB 4IRIA 1K83J 1GV2A 2HKOA 2VPRA 5E3MA 3EYIA 3AL0C 4AUXA 3WU0A 1YRNA 3F72A 4HAMA 4WCGA 2R5ZB 2ECCA 4NC8A 1A6QA 2GM4A 1F5TA 2QBYA 1NTCA 4BY7J 5EG0A 4RLQA 1HSJA 4O6JA 2Q2EB 3T1BA 1ZYRF 2CW0F 3CDLA 1YJWI 3JRBA 3M3YJ 3HTUA 3JRCA 1LVAA 1WI9A 2FOWA 4CYCA 2HI3A 4WX9A 4DZPA 1R9TJ 2ESHA 1FJLA 1R1VA 2HYJA 2W7NA 3L2UA 1O3QA 2P0WA 2OQGA 1BIBA 3WGIA 1Y1WJ 4IEJA 4LLLA 1SVLA 2KL4A 5CJ9A 1N78A 5H6QA 5HDKA 4LIVA 1Z7UA 2BVMA 3ULQB 4EJUA 5E1WA 5H20A 5L3BA 5HLGA 4S0HB 2EIJH 2AS5F 3J7AO 2M5WA 3ABUA 3R4KA 3JW4A 3CMAI 4E7JA 2UXNA 2CQNA 2LF8A 2M8EA 4R1HA 4XRFA 1KQ8A 3GO5A 2H6CA 4LLGF 3DP7A 4RGXA 1HDPA 4U87A 1WJFA 2EIMH 4WXHA 5K5QA 3WTXC 3IV5A 3QWLA 2KJBA 5FO5A 3QRFF 1QVUA 1WJDA 3W6VA 2RNGA 3OYLA 2VPLA 4HLXA 3MEXA 4I7HA 4BEHA 2VLAA 2LRDA 1BIAA 2QA4I 3J7AY 3A2KA 3RSNA 3ABLH 3UR3C 4XR6A 5L3DA 1XMAA 2XGDA 2DQLA 2K4BA 5JVGF 2LSOA 3QOEA 1YHQI 3O8HA 1B6AA 3A02A 4BNCA 3C3WA 2XPVA 4X6AJ 1H0MA 4XLEA 4RLFA 2GXGA 2WB1A 5F08A 3S93A 3WHBA 3TW7A 2ZXHA 3EETA 3ABTA 3A01B 5LD2C 4C2TA 2VXZA 3O2PE 1J9IA 3W3CA 3S8PA 4EJOA 5IP7J 5LGTA 4PFOA 2RQPA 2RDPA 2RN7A 3WTSC 1K78A 4KYWA 2V4JC 2JMWA 1PDNC 3E3VA 4UVBA 1QA6A 1QZYA 2KPMA 3FXUA 1J75A 2YPRA 3F6OA 2FEZA 1BR2A 2CQKA 2FBHA 2CV1A 1K6OA 2QUFA 2BXZA 1WFXA 3ABMH 4B47A 3TQNA 3KYCB 4Q5SF 3E97A 1RZ4A 5F0CA 4RM3A 4XMYA 2E7WA 2Y30A 5K7HA 4RGSA 2X6OA 2XSJC 2W57A 3JRIA 3OMYA 2EZKA 2WY7Q 3I59A 2GXAA 3HKZA 4LB5A 1Y6IA 2R3SA 1SMTA 2XF6A 3PSFA 2R7ZJ 3FXQA 3G3ZA 5DCMB 3RYPA 3RKXA 2X1EA 1RETA 3OSFA 1YE9A 2L4MA 4E6KG 2LNBA 2BEOA 1YOVB 2R5ZA 1PP8F 2IXSA 2ZSHB 2XB5A 4XRSA 1BM9A 2Z3YA 1KU7A 1MMGA 2FBIA 4OAZA 2CRGA 3GZNB 5IPAA 4UY8I 5AIPA 2KHMA 3LOCA 5FLXZ 4IZZA 3KP7A 2LKXA 4PJNA 2DA1A 4XKCA 2XKOA 3GLXA 4N4OB 2WWYA 1SD4A 2GZWA 4L18B 2CU7A 1W1WE 3VPRA 3CUOA 1K4SA 4LITA 3R6SA 1FC3A 3S14J 4M6XA 1H9TA 1BI1A 2HOEA 5E17F 3MD2A 4CA0A 3PFIA 3M8JA 3MFKA 1T0FA 3LSPA 2Q2EA 1Y1VJ 2ECBA 3KYDB 5EEAA 2VQHA 4EM2A 1F36A 5GAEJ 1ZLJA 2I10A 2OQRA 1W36D 4BXXJ 1OR7A 3QAHA 3BY6A 2EFOA 2R7SA 5L3CA 5BQTA 3BR0A 1SANA 4BKXA 1VQ9I 2EJRA 4JX6A 5EEGA 1ZG1A 4IQJA 1HLVA 2YUSA 5EZHA 3L00A 1T98A 1Z3YA 5HOOA 4BQAA 4KA4A 2WAFA 3L2WA 4HYEA 2XF7A 5DTDA 1JKRC 3ASOH 4ZJZA 3K4LA 1JUPA 1RR7A 3GFMA 4E7KA 3KE2A 3FHZA 3CCMI 1QGPA 3X2QH 4RB3C 2Z33A 3IRQA 1DP3A 2OZ6A 2DOEA 2DODA 3HRMA 1RRJA 1BW5A 3GTOJ 5J1RA 1VFCA 3GXOA 4V19K 1JHFA 3KPHA 5BPIA 4YFKF 2WB1N 1XN7A 1FP1D 2L02A 2UXXA 5ILUA 2RV8A 4ZYAA 1TT0A 1WRJA 1SD7A 1UG0A 5LRRA 1BJAA 2FX0A 3IC7A 1XGMA 2RVCA 2BOLA 3L2VA 2R93J 2DYSH 2EFQA 3OIQA 1IO2A 4CCJA 3FX3A 2R4GA 5K5RA 3FK7A 2AHQA 4A69C 2COBA 2PMHA 2CV2A 2KIUA 4CUGA 1TWGJ 1ZRDA 1YX5A 2HKXA 2XV4S 1B8IB 1HW2A 4I99C 5DM7F 1HDDC 2Y9YA 5FKKA 5M5XJ 3HM5A 2F48A 1RKTA 3E5QA 3TO6A 4HV5A 3K70C 2R7WA 1G3TA 4IF4A 4J00A 1LB2A 3DU5A 2P6TA 4HX7A 2EFNA 4MO7A 1ORKA 3WU2C 2VBXA 3HL2A 5FRMA 2FF4A 3P5JA 1FIPA 3OYKA 1SD5A 4X1EA 1K4TA 4KITB 1AU7A 3ASNH 3QYEA 3ZQ7A 1VF9A 3HRSA 2UUZA 5J6XA 1FZPB 2CUEA 4OMYA 5A2QK 1DU0A 1Y56A 1R7JA 3H3ZA 3HBLA 3O3KA 4A3BJ 3SEQA 3AG1H 3GTQJ 2E2JJ 1FMWA 5FKNA 1YG2A 3FISA 2HYFA 5E79C 2MA3A 1JT0A 4XBFA 1U8BA 2LVSA 3K69A 4CCOA 1A31A 4OOIA 2Z9OA 4CZZA 4MGRA 4AYBN 3I4PA 1SVMA 2EK5A 2PG4A 1QHHD 4GXOA 3FBNB 1HKTA 2HVRA 3OIPA 4B3AA 2JSCA 1VTNC 2X85A 5DEQA 4HSRA 3ZGKA 5E3NA 1FYLA 4XOPA 2DPDA 4H4KC 4G6QA 1XC5A 2QBYB 4A93J 4IOAF 1IUFA 2ZFWA 1NH3A 3V7CA 3Q9VA 3NRVA 3BPVA 5DD8A 1XS9A 3U9GA 4HNVA 1BOAA 4HSTA 3JCUC 3QPLA 1DGWY 2XDVA 1OPCA 2IPQX 4UHTA 1ZR4A 1Z9CA 1OCZH 3AFHA 2LKSA 5CVVA 3LQRA 4BQOA 3FMQA 3CQZJ 3TGNA 1ZLKA 2XRNA 1OJLA 2LFBA 2ID6A 1FWZA 3OR1C 4BXUA 3EPZA 4WXCA 4U7DA 5HVQC 2ZSIB 4S05A 1BN5A 5CYVA 3KEOA 4DYRA 3HOZJ 3CDHA 3VYRB 4BEHB 3MKLA 2NVQJ 4YFXF 5ED4A 1WSUA 1SC7A 3LSIA 2JPCA 2XRLA 3BR6A 2ADUA 2PJPA 4PZJA 2M34A 1YFHA 1D5VA 2HXOA 2R7DA 2OUMA 2QEXI 2X6XA 2O5RA 4R8HA 2FOKA 5HODA 1S7AA 1S7EA 3E6DA 4ZYEA 3PNTA 5LHHA 2OBPA 2BHZA 2AQFA 3F8CA 1TL8A 5IT9K 4E7LA 3FM3A 4R79A 2NNYA 2HDWA 1T33A 5BPDA 1BC7C 1ZGAA 1G59A 3I4NJ 3RKYA 1FTZA 5TISC 3WG7H 2O6GE 5GTIC 2DFHA 2HOTA 2OD5A 4EATA 3ZXSA 5DS9A 1WCMJ 3HHGA 1ZK8A 2PMUA 4MFDA 2C6YA 4XNFA 4OU0A 3L1PA 1LPQA 2D5VA 1T56A 3OS0A 2V79A 3LMMA 3KX2A 4CDGA 3SQNA 1MD0A 4D0PA 4A12A 1R58A 1HW1A 3CF5F 3GCMA 3L2CA 2FU4A 2KQRA 1E3HA 2DCEA 5AONA 1XGSA 1ETYA 3ZMZA 1LE8B 1MJBA 2OTLI 4MLOA 1XSVA 3K2ZA 2HOAA 5BNGA 3RZOJ 1NG6A 2CMPA 2MLKA 2CUFA 4AIDA 1JKPC 1T6SA 1UJ8A 3H92A 3ISPA 2ZFUA 5F0FA 3CO7C 2QSHX 3PUFA 1YW9A 1T8IA 3CC2I 3DFGA 2M4KA 2XGEA 1HCRA 2EV0A 3EUHC 4RB2C 2E60A 3GX4X 2QKMB 4IL6C 2DA2A 2P5LC 4IHVA 5BS6A 4OIOF 2HPIA 1W7PD 1U9OA 4X0GA 1DUXC 2HWVA 2LR8A 2WAQA 3LQQA 3HGYA 4EGYA 4B43A 2DQRA 4Y3OA 3MN2A 3NWSA 4QTRA 2WY8Q 3KZZA 5EGOB 2G0EA 2GOXB 1VZ0A 2JWTA 1WH7A 3WTVC 5KCMA 3KEYA 4BACA 2M87A 2ZMEB 3OV8A 4G9YA 4JX5A 4MQ9F 3W2AA 5FROA 4BY1J 5FLVA 4AVZA 4CYDA 2F5DA 1ZH5A 3OYJA 5DCFA 2V6CA 4EJTA 3ECHA 3SHFA 2MYSA 2XB0X 3LSGA 2CYYA 2LF7A 3V8LA 1LFUP 3I71A 4II2A 3CCSI 4I76A 3T5XA 4M6YA 5KNLA 3G1MA 2CFXA 2DOFA 3U1KA 3H3UA 5J47A 1ERDA 2L54A 2VN2A 3QP5A 4KIFA 3S3OA 1Q1VA 1F9NA 2PBIA 2Z99A 5E18F 2E1NA 2GLOA 3S15J 1IAWA 1S7OA 3S16J 1AWCA 1YJ9I 4N9HA 2OCCH 2V9PA 2CQXA 1D0ZA 2HQNA 4IRGA 2IA0A 2YU3A 2WADA 2DFFA 3EDPA 2RREA 5ICFA 1FP2A 2W84A 5DUIA 2XAJA 4N0BA 3OOPA 3IL2A 4EVIA 5L3GA 2XC7A 5IP9J 4DBQA 9ANTA 2MH9A 1TW2A 4Y33A 1JUSA 2L7KA 2W1OA 3S2HJ 2LC2A 5H6RA 3S1NJ 3DPUA 1JT6A 2FRHA 1IC8A 5D6FA 2W82A 2VKEA 4XL9A 2E1MC 1XCVA 2X9DA 3TDZC 2K3PA 2LBFA 3FXJA 3FXKA 4F93B 1VQLI 2R5YA 1U9NA 2MFZA 1XX5A 1FSEA 2IGNA 5CLSA 2HDCA 3MZYA 4ENJA 4RDUA 3BR3A 2EWNA 5K1YA 1VQOI 3C1DA 1R4NB 3Q5FA 2DFEA 4Q48A 3MQ0A 4Y7NJ 3HC7A 2DT5A 4LGWA 2KT0A 2DMQA 4YFNF 1V54H 2DK8A 2VKDA 3W2WA 4MQVA 1XDUA 2V1NA 2O8KA 1X1AA 3ZP5A 1QQIA 3ONQA 2BYVE 1OQYA 1OKRA 3K4KA 3V7SA 4G8XA 5DDGA 5J8FA 1D1AA 4CCMA 1XSXA 2X0LA 1YI2I 4HF2A 3T0YA 5LGNA 3DXJF 4EJVA 4ZYDA 1YTYA 3U21A 5IOYA 4ENMA 2H94A 4QSHA 3KFWX 3KP6A 3F9KA 3I9V2 3G4SI 3S3MA 1OCOH 3QQAA 3DV8A 5CVRA 4DIQA 3KLNA 3L7WA 4Q4ZF 3CMMA 1ETQA 3Q3SA 4YEJA 1BL0A 3WTUC 1P4WA 1R22A 1RPWA 3TEDA 5JVTA 1KYWA 2DO7A 1RESA 3CZ6A 1LDJA 4JQFA 2DMNA 3RIRA 3E6BA 2M45A 3E5XA 3GF2A 1FT9A 3BTLA 4PK4A 2V9VA 3CDIA 1IV8A 2XIGA 4F55A 1FOKA 3R0JA 2XKPA 4AIKA 2HTJA 3JSPA 1L0OC 4GRIA 1N77A 2MBFA 2E5ZA 1K6YA 1EH8A 1R1TA 1KA8A 2NS8A 4EQQA 1MW7A 4DYQA 1N75A 1P7JA 5J1YA 1E17A 2R92J 3NARA 1X19A 1R5ID 5LHGA 4OIQF 2R7XA 4HDUA 4NDLA 2QQ9A 1BBYA 3CCUI 4XSZF 3CTAA 1G3SA 4BAYA 1B8IA 4P5OA 2X1CA 1W36C 4IHTA 4Y52J 5JFRA 2STWA 5KK1A 4PJLA 5F27A 3L9FA 2VJ4A 3GUDA 2HYGD 1UELB 1GVDA 3BP8A 2O3FA 3ZR8X 1TQMA 2Z2SB 1LFPA 1JI8A 2VOOA 1MKMA 3CP8A 5D6EA 3ERMA 4OMZA 3S3NA 2JA5J 3ZQQA 5FRNA 2NVTJ 2D2WA 4A2UA 2LY1A 1E3PA 2EFPA 1MMNA 1ZR2A 3LA3A 1UG2A 5M5YJ 4V2GA 4M74A 1V3FA 4L9VA 4ZZDA 1D8JA 2E71A 2HQAA 4B3XA 2Y48A 4I0AA 1FPQA 2L9RA 1MBHA 3FIWA 1CF7A 2DW4A 1BA5A 4UVAA 2GIVA 5TGTA 4WXDA 5IYBJ 2EBIA 2ELKA 1MNEA 3BZ6A 3FWEA 2IT0A 3TBIA 3HG9A 4XRSG 2V26A 3GW2A 3KEQA 4QPOA 4G7ZF 4CHUA 1AOYA 1P7IA 3DTEA 1G3WA 5J4VA 2G9WA 1VNDA 1RC9A 1R1UA 2YX7A 4XLCA 3WE3A 2ACJA 1A35A 1XMXA 3FMRA 2A05A 1ZGWA 2EIKH 2IVMA
chains in the Genus database with same CATH topology
2JPBA 3TO7A 4PGHA 2F5EA 2GQQA 3TOBA 4FX0A 4F7ZA 1ULYA 1ZRCA 5D4RA 1P4AA 2VT3A 4QWQA 1PP7U 4KN4X 2P7CB 2G7UA 2VE8A 4ZH4F 3P9KA 1U8RA 2LKPA 1U6GA 4LG0B 2ELHA 4A5MA 2GWRA 3S2WA 1IRGA 3K1NA 3KP2A 1WWXA 3RYRA 3M8EA 1IRFA 2V1UA 1TNTA 2UWMA 4L9TA 5EEHA 4EGZA 5D5VB 1SAXA 2O8XA 2WV0A 2GA2A 3BOQA 2JRTA 4LD5A 1O57A 1WKMA 3WU1B 6PAXA 2B0LA 2GAUA 2FXAA 1DPUA 1GVJA 4PCQA 1RIOH 1EH7A 3WTZA 4I01A 1FSHA 2XAFA 4P96A 3LAPA 4LLNA 2DLLA 4IPAA 4ENKA 3HSRA 3TKYA 4RGRA 4ENNA 5HS9A 2X4HA 3RDIA 3QU3A 3ELKA 2KIFA 1P92A 1FBSA 4M9ZA 3R60A 4A0ZA 2F5CA 1MGTA 3ML6A 3HTSB 5HLIA 2ISYA 2A69F 3J80Z 3B02A 4UXNA 3HIFA 1ZREA 1HSTA 1KQ0A 1LJ9A 4AWXB 2NNNA 4N9IA 1LNWA 2VBYA 3TO9A 1J5YA 2RNJA 2VBWA 4HDVA 5E8GA 5BOXA 2JZYA 4BHBA 4G7HF 3TDUC 4TV7A 5FB2A 1ZG3A 1U2WA 1YW8A 5D4SA 4I09A 4PGGA 4KUMA 3F6VA 4MEYF 2ETHA 2G7HA 1DPRA 2XAHA 5ICGA 1HKQA 4GYIA 1I1GA 2Z5UA 3WG9A 1Y0UA 4JK1X 2ESNA 2FQ3A 3RPUA 4A6DA 4U0WA 3D5LA 3V8KA 3LA7A 3CLOA 1I1SA 3IHUA 3R0AA 5ICEA 2NRAC 4OIPF 2K4JA 1ON1A 1YYVA 2HZTA 3GZ6A 1K78B 4LK1F 3FMSA 1A04A 4B8XA 5LEJA 2D1VA 3VEPA 4XSXF 5HDNA 4RS8A 3KP4A 4ZYHA 2VODA 3JTGA 2WC2A 3I0TA 1LQ1A 1G4DA 2DPUA 1IN5A 4HX4A 4L0YB 1W5SA 3SFZA 4E70A 2YR2A 1GXPA 1FLIA 3N4MA 2Q0OA 4HW0A 2A61A 1JHHA 3V8JA 1T39A 1FYKA 1HW5A 1USTA 5LEKA 2F5FA 2XUBA 2A3SA 5D8LB 3HUGA 3E5UA 2IA1A 1Z6RA 3BJOA 1TW3A 1EH6A 3I54A 3WTTC 3VOEA 3FXRA 1ZGJA 4CXFA 3E6CC 2EA4A 3ECOA 4P9FA 4HQMA 1Q1HA 3RPQA 1Z6TA 4L9NA 3BWGA 2P5KA 1HQCA 1CF7B 2QWWA 4MTDA 3RJPA 1GHCA 1O3TA 3E6MA 4KDPA 4OIRF 2P7VB 1MJAA 2F2EA 1ZG5A 4EM0B 4HBLA 5LLQA 4ESBA 2H27A 4XLNF 1J2XA 3P7NA 1QBJA 5E1ZB 2RGVA 4MHGA 1RNLA 2OU2A 3REOA 1Z1DA 4ESJA 4RB0A 1W7PB 2RC4A 5D5XB 2E7XA 1EV7A 1B59A 3M9AA 1XCBA 5J8CA 2BBYA 4MEXF 3LFKA 4G6DA 3EYYA 1FBUA 3VODA 2FNPA 3F21A 4I2OA 4RGUA 3V7RA 1B1BA 2HGCA 1MDMB 4LK0F 3EUHA 2OAZA 1KU3A 5HLHA 2QQAA 4GO1A 1SMYF 2AXLA 2CGPA 4A6EA 2A68F 1REPC 3WODF 2K86A 1I6XA 4G94A 1S6LA 4CGZA 1J0RA 5FFZA 2D1HA 2DU9A 1ODDA 1Z91A 2P5VA 1D3YA 2NS0A 4YIFA 1Z05A 1RI7A 4RB1A 3ERED 2OA4A 3CJNA 4LJZF 5F64A 4A0YA 4JBAA 3QPHA 3MZHA 1MJ9A 2PFBA 4G7OF 2ZBKA 2CSOA 1F1ZA 3SZTA 4KN7X 1JXSA 1RUOA 2ZCWA 3K1MA 4KFCA 3CUQC 1BC8C 2YSRA 3RTRA 3ZPLA 4AIJA 2QENA 3BJ6A 4L5JA 2Q8KA 3IRRA 4WK8F 1P6RA 4UVCA 4DQ2A 3WGGA 2QQBA 3LAJA 2EA2A 2EV5A 1BI0A 3T8TA 5FD6A 2V1XA 4HV6A 4O3MA 2L3DA 1QZZA 4ASNA 1OYYA 2CO5A 5L3FA 4S04A 4BHCA 4L0ZB 1KGSA 4GGGA 4MNUA 1V4RA 2QM3A 3HRUA 5FLXK 4NQWA 2ZO4A 3C7JA 3KZYA 4EJWA 3B73A 3KP5A 3GEZA 5ERIA 3L09A 1T2KA 2D45A 3I53A 4YG2F 4OINF 1FBQA 1YIOA 2J5PA 2W24A 2IP2A 1STZA 2RKHA 1ZHFA 4HX8A 4ZYGA 2HS5A 3F22A 3CUQA 3F8NA 4K2EA 3P9CA 3VB2A 4L5IA 3WGHA 3U2RA 1CGPA 4KT5C 3F8MA 3VFZA 2CWEA 5D8KB 2V1DA 2E1CA 2IW5A 2P6SA 1JGSA 5LHIA 4PDKA 4M9SA 2QYOA 4GCVA 1TQIA 5DYMA 5CVUA 1TTYA 3MCZA 4IXAA 4KNYA 1TNSA 3ZN1A 3I64A 4I98B 1IF1A 2PLYA 5D5UB 2KJCA 2NYXA 2HEOA 2MH2A 2DBBA 3F3XA 3GZ5A 1TBXA 5D5WB 1IXCA 5F1RA 3F8BA 4Y15A 4Y17A 1IZ1A 1IXRC 3MWMA 2P4WA 4KMUX 2YX4A 1LDDA 3QU6A 4KIGA 2HR3A 1W7PA 3FM5A 5ILVA 2Y75A 1BI2A 2GA1A 1UHWA 5LBQA 1KU2A 1ZN2A 1HKSA 1BI3A 2ZXJA 1IXSB 1UHMA 4H0EA 2ZMEA 1MDMA 3F23A 4B09A 3BJAA 5L3EA 1G3YA 1J7KA 4IHSA 4L9JA 1XGNA 1IUYA 4ESFA 1FNNA 4ZZLA 2JT1A 1XD7A 2ZNZA 1P4XA 2VOPA 1G6NA 5FD5A 5KVRA 2QVOA 1R5HA 4BYYA 1O3RA 3ROUA 2VC0A 2O61A 2XGXA 2A6HF 1IN4A 3RI4A 4AIHA 3JAMK 4NHJA 3GYHX 1K79A 4Q47A 2DAOA 4M73A 2XAQA 3DPTA 1U78A 1U5TB 4HF0A 3N97A 2R7FA 3FZVA 1DP7P 4EV0A 4DNCA 3WTWC 2OZUA 3P9IA 1IW7F 3JAMZ 2XASA 2ZNYA 3JTHA 1YQAA 1HBXG 2ZKZA 3ZN0A 3RKWA 2W85A 1PUEE 2STTA 1SFEA 2O0YA 1LDKB 2VT2A 3M7GA 2PI0A 1U3EM 2IJLA 1O3SA 4Y13A 2O03A 1IN8A 1XB4A 3DEUA 1XMKA 2XAGA 4IJAA 1YS6A 5AIQA 3G73A 2VONA 2CG4A 4LFUA 1TQPA 3BDDA 4M72A 3IKTA 4I02A 1B9NA 2PQ8A 3C18A 4HQEA 4AVPA 3DKWA 4A5NA 3KETA 2DI3A 3D0SA 5K5OA 1OMIA 1R5GA 2LDUA 5HS8A 4HF1A 3AAFA 4M71A 2M1BA 3PQKA 2GXBA 3J80K 4WWCA 2J5OA 1XDSA 1LEBA 4U88A 2IRFG 4FT8A 4RAZA 4FHTA 3J81K 3ZMSA 1MZBA 5JR3A 3U1DA 2DTRA 4O5VA 2BE5F 4MTEA 3ZMDA 3GFLA 3CO6C 3COAC 2DFIA 2QZ8A 1NHAA 4UV8A 3NQOA 2XROA 4UV9A 1IN7A 3F8FA 3WTYC 2XVCA 3BPXA 3LA2A 1S8NA 4ON0A 4HOBA 1U5TA 1E2XA 5ILSA 1P2FA 1ZAOA 2FBKA 4WF2A 2VBZA 3TOAA 1H9GA 1KQ9A 1QO0D 2MD5A 1R36A 2L4AA 3IWFA 1HXDA 4BH9A 3QOPA 2HQRA 2ZJ2A 2KRFA 1YO5C 4P55A 5JI6A 2PN6A 3K1PA 1QPMA 4EMSA 5FGMA 1KU9A 5HDGA 1B9MA 4BHPA 4ETSA 3K9TA 3MAJA 1YW7A 1ON2A 2FSWA 4QLCU 3V4GA 5TJJA 4IVNA 3LWFA 1OYIA 3GVAA 4RAYA 4GYGA 1L3LA 4LMYA 2FMLA 2W25A 4LB6B 1WQ2A 2VC1A 3HOTA 3M1EA 3ZMVA 2A07F 2PEXA 2P8TA 1O7FA 1U5TC 3HSFA 3QPTA 5HS7A 3IWZA 3NEUA 5E1XA 3M8FA 2H6BA 2K7LA 2MLGA 4P9UA 2L01A 3K0LA 5E8IA 1YLFA 4KIBA 1TLHB 1K7AA 2COMA 2M30A 4U7BA 1R23A 3R61A 4U0VA 4EM1A 1GXQA 3PQJA 2NAZA 1DDNA 3BROA 1B4AA 1X3UA 2EB7A 2FE3A 3FF5A 2QLZA 4LG0A 1FYMA 4UNOA 5DCMA 2HTSA 2ISZA 4CO8A 2DK5A 3J81Z 3EQLF 4KMFA 1ZARA 4HLYA 5FFXA 5LGUA 4CICA 5ICCA 4Z2YA 1JE8A 4A0XA 4KICA 5IT3A 3ZMTA 5F6FA 2UZKA 5IT9Z 1KYZA 2XHKA 1S3JA 1I5ZA 2FNAA 5CVJA 1SD6A 1W4MA 3I58A 3SZPA 1W5TA 2HFHA 4HA8A 5DV5A 3W6KB 2WTEA 1YS7A 2H09A 2K27A 3KLOA 3HOSA 3HYIA 1USSA 3KP3A 1IN6A 1RUNA 3DQVC 2EV6A 1J59A 3GWZA 1O7LA 2FA5A 5DD4A 1FX7A 1UB9A 1D8KA 3GFJA 5CVIA 3DF8A 3CUQB 2K02A 5E20A 5LRSA 1C0WA 5DUKA 3KCCA 3LSTA 4I0BA 1XGOA 4U0YA 3HSEA 4M9XA 3JSOA 1XSDA 3HHHA 3ZMUA 1UFMA 4XLPF 3GFIA 3HRTA 3QP6A 2BV6A 1OYWA 1T38A 4UUVA 1S29A 4IRHA 1F4KA 3Q9SA 2Y0MA 1QNTA 2EFWA 4YIIA 2IA2A 1ZRFA 2KKOA 1LEAA 3SXYA 1SFUA 5A2QZ 3I5UA 3DPLC 4FX4A 3IKVA 1FY7A 5BMZA 1R00A 2KIMA 3I59B 2FMYA 5JHUA 2JTVA 1SFXA 2TDXA 2A6EF 4AD9A 3T8RA 2MC3A 1ONVA 2BGCA 3WE2A 1I27A 3O6BB 2A5YB 2VE9A 5TRDA 4NB5A 1UCRA 4HZFA 3W6JB 4IRIA 2HKOA 3EYIA 3WU0A 3F72A 4HAMA 4WCGA 1F5TA 2QBYA 1HSJA 4O6JA 3T1BA 1ZYRF 2CW0F 3HTUA 1LVAA 1WI9A 4WX9A 2ESHA 1R1VA 1O3QA 2OQGA 1BIBA 3WGIA 4LLLA 5CJ9A 5H6QA 5HDKA 1Z7UA 3ULQB 4EJUA 5E1WA 5H20A 5L3BA 5HLGA 2AS5F 3J7AO 2M5WA 3ABUA 3R4KA 3JW4A 2UXNA 2LF8A 2M8EA 4R1HA 4XRFA 1KQ8A 3GO5A 2H6CA 4LLGF 3DP7A 4RGXA 4WXHA 5K5QA 3WTXC 2KJBA 5FO5A 3QRFF 4HLXA 3MEXA 4I7HA 1BIAA 5L3DA 1XMAA 2DQLA 2K4BA 2LSOA 1B6AA 4BNCA 3C3WA 1H0MA 2GXGA 3EETA 3ABTA 2VXZA 3O2PE 1J9IA 4EJOA 5LGTA 2RQPA 2RDPA 2RN7A 3WTSC 1K78A 4KYWA 1PDNC 3E3VA 4UVBA 1QZYA 3FXUA 1J75A 2YPRA 3F6OA 2FEZA 2CQKA 2FBHA 1K6OA 2QUFA 3TQNA 4Q5SF 3E97A 1RZ4A 2E7WA 4RGSA 2W57A 3I59A 4LB5A 2R3SA 1SMTA 3FXQA 3G3ZA 5DCMB 3RYPA 3RKXA 2L4MA 2LNBA 2BEOA 1PP8F 1BM9A 2Z3YA 1KU7A 2FBIA 5AIPA 5FLXZ 3KP7A 2XKOA 3GLXA 2WWYA 1SD4A 2GZWA 4L18B 3CUOA 3R6SA 1FC3A 4M6XA 1H9TA 1BI1A 2HOEA 5E17F 3PFIA 3MFKA 1T0FA 2Q2EA 4EM2A 1ZLJA 2OQRA 1OR7A 3QAHA 3BY6A 2EFOA 5L3CA 5BQTA 2EJRA 5EEGA 1ZG1A 3L00A 1T98A 5HOOA 4BQAA 4KA4A 4HYEA 3GFMA 3KE2A 3FHZA 1QGPA 4RB3C 2Z33A 3IRQA 2OZ6A 3HRMA 3GXOA 1JHFA 5BPIA 4YFKF 1XN7A 1FP1D 2L02A 2UXXA 5ILUA 2RV8A 1WRJA 1SD7A 5LRRA 1BJAA 3IC7A 1XGMA 2RVCA 2EFQA 3FX3A 5K5RA 2PMHA 2KIUA 1ZRDA 2HKXA 2XV4S 1HW2A 3E5QA 3TO6A 1LB2A 4HV5A 1G3TA 4IF4A 2P6TA 4HX7A 2EFNA 2VBXA 2FF4A 1SD5A 3ZQ7A 3HRSA 5J6XA 1FZPB 4OMYA 5A2QK 3O3KA 1R7JA 3H3ZA 1YG2A 2HYFA 2MA3A 4XBFA 3K69A 4OOIA 2Z9OA 4CZZA 4MGRA 3I4PA 2PG4A 2EK5A 4GXOA 1HKTA 2JSCA 1VTNC 5DEQA 1FYLA 2DPDA 4G6QA 2QBYB 2ZFWA 3V7CA 3Q9VA 3NRVA 3BPVA 5DD8A 3U9GA 1BOAA 4UHTA 1OPCA 2IPQX 1Z9CA 5CVVA 3LQRA 1ZLKA 3FMQA 3TGNA 2XRNA 1FWZA 4BXUA 4U7DA 4WXCA 5HVQC 4S05A 1BN5A 5CYVA 3KEOA 3CDHA 4YFXF 5ED4A 1WSUA 2JPCA 2ADUA 2PJPA 4PZJA 1YFHA 1D5VA 2R7DA 4R8HA 2FOKA 1S7AA 3E6DA 4ZYEA 5LHHA 2OBPA 5IT9K 3F8CA 3FM3A 4R79A 2NNYA 1BC7C 5BPDA 1ZGAA 3RKYA 2O6GE 2OD5A 3HHGA 2PMUA 2C6YA 4OU0A 2V79A 4CDGA 3SQNA 1MD0A 4D0PA 4A12A 1R58A 1HW1A 3L2CA 2FU4A 5AONA 1XGSA 3ZMZA 1MJBA 1XSVA 3K2ZA 2MLKA 1T6SA 3H92A 3ISPA 3CO7C 1YW9A 3DFGA 2EV0A 4RB2C 3GX4X 2P5LC 5BS6A 4OIOF 1W7PD 1DUXC 2HWVA 3LQQA 4EGYA 2DQRA 3KZZA 3WTVC 2M87A 2ZMEB 3OV8A 4G9YA 4MQ9F 4CYDA 2F5DA 1ZH5A 5DCFA 2V6CA 4EJTA 3ECHA 3SHFA 2CYYA 2LF7A 3V8LA 3I71A 3T5XA 4M6YA 2CFXA 3H3UA 2L54A 2VN2A 3QP5A 4KIFA 1F9NA 2PBIA 2Z99A 5E18F 2E1NA 1IAWA 1S7OA 1AWCA 4N9HA 2HQNA 4IRGA 2IA0A 2YU3A 3EDPA 5ICFA 1FP2A 5DUIA 2W84A 2XAJA 4N0BA 3OOPA 3IL2A 4EVIA 5L3GA 2MH9A 1TW2A 5H6RA 2FRHA 5D6FA 1XCVA 3TDZC 1FSEA 5CLSA 2HDCA 3MZYA 4ENJA 5K1YA 2EWNA 3C1DA 3Q5FA 4Q48A 3MQ0A 2DT5A 4LGWA 4YFNF 2DK8A 4MQVA 1XDUA 3ZP5A 1QQIA 2BYVE 1OKRA 3V7SA 4G8XA 5DDGA 5J8FA 1XSXA 2X0LA 4HF2A 3T0YA 5LGNA 3DXJF 4EJVA 4ZYDA 1YTYA 4ENMA 2H94A 3KFWX 3KP6A 5CVRA 4Q4ZF 3DV8A 3KLNA 3L7WA 3WTUC 1P4WA 1R22A 5JVTA 1KYWA 2DO7A 1LDJA 4JQFA 3RIRA 3E6BA 2M45A 3E5XA 3GF2A 1FT9A 2V9VA 2XIGA 1FOKA 3R0JA 2XKPA 4AIKA 2HTJA 3JSPA 1L0OC 2MBFA 1EH8A 1R1TA 1KA8A 4EQQA 1E17A 5LHGA 4OIQF 4HDUA 2QQ9A 1BBYA 4XSZF 3CTAA 1G3SA 4BAYA 4P5OA 4IHTA 5JFRA 2STWA 5KK1A 3L9FA 3GUDA 2HYGD 3BP8A 2O3FA 1TQMA 2VOOA 1MKMA 5D6EA 4OMZA 2D2WA 4A2UA 2EFPA 3LA3A 4M74A 1V3FA 4L9VA 4ZZDA 1D8JA 2Y48A 4I0AA 1FPQA 1CF7A 2DW4A 4UVAA 2GIVA 4WXDA 3BZ6A 3FWEA 2IT0A 4G7ZF 4CHUA 3GW2A 3KEQA 1AOYA 1G3WA 2G9WA 1R1UA 2YX7A 2ACJA 3WE3A 3FMRA 2IVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPB A;  3TO7 A;  4PGH A;  2F5E A;  2GQQ A;  3TOB A;  4FX0 A;  4F7Z A;  1ULY A;  1ZRC A;  5D4R A;  1P4A A;  2VT3 A;  4QWQ A;  1PP7 U;  4KN4 X;  2P7C B;  2G7U A;  2VE8 A;  4ZH4 F;  3P9K A;  1U8R A;  2LKP A;  1U6G A;  4LG0 B;  2ELH A;  4A5M A;  2GWR A;  3S2W A;  1IRG A;  3K1N A;  3KP2 A;  1WWX A;  3RYR A;  3M8E A;  1IRF A;  2V1U A;  1TNT A;  2UWM A;  4L9T A;  5EEH A;  4EGZ A;  5D5V B;  1SAX A;  2O8X A;  2WV0 A;  2GA2 A;  3BOQ A;  2JRT A;  4LD5 A;  1O57 A;  1WKM A;  3WU1 B;  6PAX A;  2B0L A;  2GAU A;  2FXA A;  1DPU A;  1GVJ A;  4PCQ A;  1RIO H;  1EH7 A;  3WTZ A;  4I01 A;  1FSH A;  2XAF A;  4P96 A;  3LAP A;  4LLN A;  2DLL A;  4IPA A;  4ENK A;  3HSR A;  3TKY A;  4RGR A;  4ENN A;  5HS9 A;  2X4H A;  3RDI A;  3QU3 A;  3ELK A;  2KIF A;  1P92 A;  1FBS A;  4M9Z A;  3R60 A;  4A0Z A;  2F5C A;  1MGT A;  3ML6 A;  3HTS B;  5HLI A;  2ISY A;  2A69 F;  3J80 Z;  3B02 A;  4UXN A;  3HIF A;  1ZRE A;  1HST A;  1KQ0 A;  1LJ9 A;  4AWX B;  2NNN A;  4N9I A;  1LNW A;  2VBY A;  3TO9 A;  1J5Y A;  2RNJ A;  2VBW A;  4HDV A;  5E8G A;  5BOX A;  2JZY A;  4BHB A;  4G7H F;  3TDU C;  4TV7 A;  5FB2 A;  1ZG3 A;  1U2W A;  1YW8 A;  5D4S A;  4I09 A;  4PGG A;  4KUM A;  3F6V A;  4MEY F;  2ETH A;  2G7H A;  1DPR A;  2XAH A;  5ICG A;  1HKQ A;  4GYI A;  1I1G A;  2Z5U A;  3WG9 A;  1Y0U A;  4JK1 X;  2ESN A;  2FQ3 A;  3RPU A;  4A6D A;  4U0W A;  3D5L A;  3V8K A;  3LA7 A;  3CLO A;  1I1S A;  3IHU A;  3R0A A;  5ICE A;  2NRA C;  4OIP F;  2K4J A;  1ON1 A;  1YYV A;  2HZT A;  3GZ6 A;  1K78 B;  4LK1 F;  3FMS A;  1A04 A;  4B8X A;  5LEJ A;  2D1V A;  3VEP A;  4XSX F;  5HDN A;  4RS8 A;  3KP4 A;  4ZYH A;  2VOD A;  3JTG A;  2WC2 A;  3I0T A;  1LQ1 A;  1G4D A;  2DPU A;  1IN5 A;  4HX4 A;  4L0Y B;  1W5S A;  3SFZ A;  4E70 A;  2YR2 A;  1GXP A;  1FLI A;  3N4M A;  2Q0O A;  4HW0 A;  2A61 A;  1JHH A;  3V8J A;  1T39 A;  1FYK A;  1HW5 A;  1UST A;  5LEK A;  2F5F A;  2XUB A;  2A3S A;  5D8L B;  3HUG A;  3E5U A;  2IA1 A;  1Z6R A;  3BJO A;  1TW3 A;  1EH6 A;  3I54 A;  3WTT C;  3VOE A;  3FXR A;  1ZGJ A;  4CXF A;  3E6C C;  2EA4 A;  3ECO A;  4P9F A;  4HQM A;  1Q1H A;  3RPQ A;  1Z6T A;  4L9N A;  3BWG A;  2P5K A;  1HQC A;  1CF7 B;  2QWW A;  4MTD A;  3RJP A;  1GHC A;  1O3T A;  3E6M A;  4KDP A;  4OIR F;  2P7V B;  1MJA A;  2F2E A;  1ZG5 A;  4EM0 B;  4HBL A;  5LLQ A;  4ESB A;  2H27 A;  4XLN F;  1J2X A;  3P7N A;  1QBJ A;  5E1Z B;  2RGV A;  4MHG A;  1RNL A;  2OU2 A;  3REO A;  1Z1D A;  4ESJ A;  4RB0 A;  1W7P B;  2RC4 A;  5D5X B;  2E7X A;  1EV7 A;  1B59 A;  3M9A A;  1XCB A;  5J8C A;  2BBY A;  4MEX F;  3LFK A;  4G6D A;  3EYY A;  1FBU A;  3VOD A;  2FNP A;  3F21 A;  4I2O A;  4RGU A;  3V7R A;  1B1B A;  2HGC A;  1MDM B;  4LK0 F;  3EUH A;  2OAZ A;  1KU3 A;  5HLH A;  2QQA A;  4GO1 A;  1SMY F;  2AXL A;  2CGP A;  4A6E A;  2A68 F;  1REP C;  3WOD F;  2K86 A;  1I6X A;  4G94 A;  1S6L A;  4CGZ A;  1J0R A;  5FFZ A;  2D1H A;  2DU9 A;  1ODD A;  1Z91 A;  2P5V A;  1D3Y A;  2NS0 A;  4YIF A;  1Z05 A;  1RI7 A;  4RB1 A;  3ERE D;  2OA4 A;  3CJN A;  4LJZ F;  5F64 A;  4A0Y A;  4JBA A;  3QPH A;  3MZH A;  1MJ9 A;  2PFB A;  4G7O F;  2ZBK A;  2CSO A;  1F1Z A;  3SZT A;  4KN7 X;  1JXS A;  1RUO A;  2ZCW A;  3K1M A;  4KFC A;  3CUQ C;  1BC8 C;  2YSR A;  3RTR A;  3ZPL A;  4AIJ A;  2QEN A;  3BJ6 A;  4L5J A;  2Q8K A;  3IRR A;  4WK8 F;  1P6R A;  4UVC A;  4DQ2 A;  3WGG A;  2QQB A;  3LAJ A;  2EA2 A;  2EV5 A;  1BI0 A;  3T8T A;  5FD6 A;  2V1X A;  4HV6 A;  4O3M A;  2L3D A;  1QZZ A;  4ASN A;  1OYY A;  2CO5 A;  5L3F A;  4S04 A;  4BHC A;  4L0Z B;  1KGS A;  4GGG A;  4MNU A;  1V4R A;  2QM3 A;  3HRU A;  5FLX K;  4NQW A;  2ZO4 A;  3C7J A;  3KZY A;  4EJW A;  3B73 A;  3KP5 A;  3GEZ A;  5ERI A;  3L09 A;  1T2K A;  2D45 A;  3I53 A;  4YG2 F;  4OIN F;  1FBQ A;  1YIO A;  2J5P A;  2W24 A;  2IP2 A;  1STZ A;  2RKH A;  1ZHF A;  4HX8 A;  4ZYG A;  2HS5 A;  3F22 A;  3CUQ A;  3F8N A;  4K2E A;  3P9C A;  3VB2 A;  4L5I A;  3WGH A;  3U2R A;  1CGP A;  4KT5 C;  3F8M A;  3VFZ A;  2CWE A;  5D8K B;  2V1D A;  2E1C A;  2IW5 A;  2P6S A;  1JGS A;  5LHI A;  4PDK A;  4M9S A;  2QYO A;  4GCV A;  1TQI A;  5DYM A;  5CVU A;  1TTY A;  3MCZ A;  4IXA A;  4KNY A;  1TNS A;  3ZN1 A;  3I64 A;  4I98 B;  1IF1 A;  2PLY A;  5D5U B;  2KJC A;  2NYX A;  2HEO A;  2MH2 A;  2DBB A;  3F3X A;  3GZ5 A;  1TBX A;  5D5W B;  1IXC A;  5F1R A;  3F8B A;  4Y15 A;  4Y17 A;  1IZ1 A;  1IXR C;  3MWM A;  2P4W A;  4KMU X;  2YX4 A;  1LDD A;  3QU6 A;  4KIG A;  2HR3 A;  1W7P A;  3FM5 A;  5ILV A;  2Y75 A;  1BI2 A;  2GA1 A;  1UHW A;  5LBQ A;  1KU2 A;  1ZN2 A;  1HKS A;  1BI3 A;  2ZXJ A;  1IXS B;  1UHM A;  4H0E A;  2ZME A;  1MDM A;  3F23 A;  4B09 A;  3BJA A;  5L3E A;  1G3Y A;  1J7K A;  4IHS A;  4L9J A;  1XGN A;  1IUY A;  4ESF A;  1FNN A;  4ZZL A;  2JT1 A;  1XD7 A;  2ZNZ A;  1P4X A;  2VOP A;  1G6N A;  5FD5 A;  5KVR A;  2QVO A;  1R5H A;  4BYY A;  1O3R A;  3ROU A;  2VC0 A;  2O61 A;  2XGX A;  2A6H F;  1IN4 A;  3RI4 A;  4AIH A;  3JAM K;  4NHJ A;  3GYH X;  1K79 A;  4Q47 A;  2DAO A;  4M73 A;  2XAQ A;  3DPT A;  1U78 A;  1U5T B;  4HF0 A;  3N97 A;  2R7F A;  3FZV A;  1DP7 P;  4EV0 A;  4DNC A;  3WTW C;  2OZU A;  3P9I A;  1IW7 F;  3JAM Z;  2XAS A;  2ZNY A;  3JTH A;  1YQA A;  1HBX G;  2ZKZ A;  3ZN0 A;  3RKW A;  2W85 A;  1PUE E;  2STT A;  1SFE A;  2O0Y A;  1LDK B;  2VT2 A;  3M7G A;  2PI0 A;  1U3E M;  2IJL A;  1O3S A;  4Y13 A;  2O03 A;  1IN8 A;  1XB4 A;  3DEU A;  1XMK A;  2XAG A;  4IJA A;  1YS6 A;  5AIQ A;  3G73 A;  2VON A;  2CG4 A;  4LFU A;  1TQP A;  3BDD A;  4M72 A;  3IKT A;  4I02 A;  1B9N A;  2PQ8 A;  3C18 A;  4HQE A;  4AVP A;  3DKW A;  4A5N A;  3KET A;  2DI3 A;  3D0S A;  5K5O A;  1OMI A;  1R5G A;  2LDU A;  5HS8 A;  4HF1 A;  3AAF A;  4M71 A;  2M1B A;  3PQK A;  2GXB A;  3J80 K;  4WWC A;  2J5O A;  1XDS A;  1LEB A;  4U88 A;  2IRF G;  4FT8 A;  4RAZ A;  4FHT A;  3J81 K;  3ZMS A;  1MZB A;  5JR3 A;  3U1D A;  2DTR A;  4O5V A;  2BE5 F;  4MTE A;  3ZMD A;  3GFL A;  3CO6 C;  3COA C;  2DFI A;  2QZ8 A;  1NHA A;  4UV8 A;  3NQO A;  2XRO A;  4UV9 A;  1IN7 A;  3F8F A;  3WTY C;  2XVC A;  3BPX A;  3LA2 A;  1S8N A;  4ON0 A;  4HOB A;  1U5T A;  1E2X A;  5ILS A;  1P2F A;  1ZAO A;  2FBK A;  4WF2 A;  2VBZ A;  3TOA A;  1H9G A;  1KQ9 A;  1QO0 D;  2MD5 A;  1R36 A;  2L4A A;  3IWF A;  1HXD A;  4BH9 A;  3QOP A;  2HQR A;  2ZJ2 A;  2KRF A;  1YO5 C;  4P55 A;  5JI6 A;  2PN6 A;  3K1P A;  1QPM A;  4EMS A;  5FGM A;  1KU9 A;  5HDG A;  1B9M A;  4BHP A;  4ETS A;  3K9T A;  3MAJ A;  1YW7 A;  1ON2 A;  2FSW A;  4QLC U;  3V4G A;  5TJJ A;  4IVN A;  3LWF A;  1OYI A;  3GVA A;  4RAY A;  4GYG A;  1L3L A;  4LMY A;  2FML A;  2W25 A;  4LB6 B;  1WQ2 A;  2VC1 A;  3HOT A;  3M1E A;  3ZMV A;  2A07 F;  2PEX A;  2P8T A;  1O7F A;  1U5T C;  3HSF A;  3QPT A;  5HS7 A;  3IWZ A;  3NEU A;  5E1X A;  3M8F A;  2H6B A;  2K7L A;  2MLG A;  4P9U A;  2L01 A;  3K0L A;  5E8I A;  1YLF A;  4KIB A;  1TLH B;  1K7A A;  2COM A;  2M30 A;  4U7B A;  1R23 A;  3R61 A;  4U0V A;  4EM1 A;  1GXQ A;  3PQJ A;  2NAZ A;  1DDN A;  3BRO A;  1B4A A;  1X3U A;  2EB7 A;  2FE3 A;  3FF5 A;  2QLZ A;  4LG0 A;  1FYM A;  4UNO A;  5DCM A;  2HTS A;  2ISZ A;  4CO8 A;  2DK5 A;  3J81 Z;  3EQL F;  4KMF A;  1ZAR A;  4HLY A;  5FFX A;  5LGU A;  4CIC A;  5ICC A;  4Z2Y A;  1JE8 A;  4A0X A;  4KIC A;  5IT3 A;  3ZMT A;  5F6F A;  2UZK A;  5IT9 Z;  1KYZ A;  2XHK A;  1S3J A;  1I5Z A;  2FNA A;  5CVJ A;  1SD6 A;  1W4M A;  3I58 A;  3SZP A;  1W5T A;  2HFH A;  4HA8 A;  5DV5 A;  3W6K B;  2WTE A;  1YS7 A;  2H09 A;  2K27 A;  3KLO A;  3HOS A;  3HYI A;  1USS A;  3KP3 A;  1IN6 A;  1RUN A;  3DQV C;  2EV6 A;  1J59 A;  3GWZ A;  1O7L A;  2FA5 A;  5DD4 A;  1FX7 A;  1UB9 A;  1D8K A;  3GFJ A;  5CVI A;  3DF8 A;  3CUQ B;  2K02 A;  5E20 A;  5LRS A;  1C0W A;  5DUK A;  3KCC A;  3LST A;  4I0B A;  1XGO A;  4U0Y A;  3HSE A;  4M9X A;  3JSO A;  1XSD A;  3HHH A;  3ZMU A;  1UFM A;  4XLP F;  3GFI A;  3HRT A;  3QP6 A;  2BV6 A;  1OYW A;  1T38 A;  4UUV A;  1S29 A;  4IRH A;  1F4K A;  3Q9S A;  2Y0M A;  1QNT A;  2EFW A;  4YII A;  2IA2 A;  1ZRF A;  2KKO A;  1LEA A;  3SXY A;  1SFU A;  5A2Q Z;  3I5U A;  3DPL C;  4FX4 A;  3IKV A;  1FY7 A;  5BMZ A;  1R00 A;  2KIM A;  3I59 B;  2FMY A;  5JHU A;  2JTV A;  1SFX A;  2TDX A;  2A6E F;  4AD9 A;  3T8R A;  2MC3 A;  1ONV A;  2BGC A;  3WE2 A;  1I27 A;  3O6B B;  2A5Y B;  2VE9 A;  5TRD A;  4NB5 A;  1UCR A;  4HZF A;  3W6J B;  4IRI A;  2HKO A;  3EYI A;  3WU0 A;  3F72 A;  4HAM A;  4WCG A;  1F5T A;  2QBY A;  1HSJ A;  4O6J A;  3T1B A;  1ZYR F;  2CW0 F;  3HTU A;  1LVA A;  1WI9 A;  4WX9 A;  2ESH A;  1R1V A;  1O3Q A;  2OQG A;  1BIB A;  3WGI A;  4LLL A;  5CJ9 A;  5H6Q A;  5HDK A;  1Z7U A;  3ULQ B;  4EJU A;  5E1W A;  5H20 A;  5L3B A;  5HLG A;  2AS5 F;  3J7A O;  2M5W A;  3ABU A;  3R4K A;  3JW4 A;  2UXN A;  2LF8 A;  2M8E A;  4R1H A;  4XRF A;  1KQ8 A;  3GO5 A;  2H6C A;  4LLG F;  3DP7 A;  4RGX A;  4WXH A;  5K5Q A;  3WTX C;  2KJB A;  5FO5 A;  3QRF F;  4HLX A;  3MEX A;  4I7H A;  1BIA A;  5L3D A;  1XMA A;  2DQL A;  2K4B A;  2LSO A;  1B6A A;  4BNC A;  3C3W A;  1H0M A;  2GXG A;  3EET A;  3ABT A;  2VXZ A;  3O2P E;  1J9I A;  4EJO A;  5LGT A;  2RQP A;  2RDP A;  2RN7 A;  3WTS C;  1K78 A;  4KYW A;  1PDN C;  3E3V A;  4UVB A;  1QZY A;  3FXU A;  1J75 A;  2YPR A;  3F6O A;  2FEZ A;  2CQK A;  2FBH A;  1K6O A;  2QUF A;  3TQN A;  4Q5S F;  3E97 A;  1RZ4 A;  2E7W A;  4RGS A;  2W57 A;  3I59 A;  4LB5 A;  2R3S A;  1SMT A;  3FXQ A;  3G3Z A;  5DCM B;  3RYP A;  3RKX A;  2L4M A;  2LNB A;  2BEO A;  1PP8 F;  1BM9 A;  2Z3Y A;  1KU7 A;  2FBI A;  5AIP A;  5FLX Z;  3KP7 A;  2XKO A;  3GLX A;  2WWY A;  1SD4 A;  2GZW A;  4L18 B;  3CUO A;  3R6S A;  1FC3 A;  4M6X A;  1H9T A;  1BI1 A;  2HOE A;  5E17 F;  3PFI A;  3MFK A;  1T0F A;  2Q2E A;  4EM2 A;  1ZLJ A;  2OQR A;  1OR7 A;  3QAH A;  3BY6 A;  2EFO A;  5L3C A;  5BQT A;  2EJR A;  5EEG A;  1ZG1 A;  3L00 A;  1T98 A;  5HOO A;  4BQA A;  4KA4 A;  4HYE A;  3GFM A;  3KE2 A;  3FHZ A;  1QGP A;  4RB3 C;  2Z33 A;  3IRQ A;  2OZ6 A;  3HRM A;  3GXO A;  1JHF A;  5BPI A;  4YFK F;  1XN7 A;  1FP1 D;  2L02 A;  2UXX A;  5ILU A;  2RV8 A;  1WRJ A;  1SD7 A;  5LRR A;  1BJA A;  3IC7 A;  1XGM A;  2RVC A;  2EFQ A;  3FX3 A;  5K5R A;  2PMH A;  2KIU A;  1ZRD A;  2HKX A;  2XV4 S;  1HW2 A;  3E5Q A;  3TO6 A;  1LB2 A;  4HV5 A;  1G3T A;  4IF4 A;  2P6T A;  4HX7 A;  2EFN A;  2VBX A;  2FF4 A;  1SD5 A;  3ZQ7 A;  3HRS A;  5J6X A;  1FZP B;  4OMY A;  5A2Q K;  3O3K A;  1R7J A;  3H3Z A;  1YG2 A;  2HYF A;  2MA3 A;  4XBF A;  3K69 A;  4OOI A;  2Z9O A;  4CZZ A;  4MGR A;  3I4P A;  2PG4 A;  2EK5 A;  4GXO A;  1HKT A;  2JSC A;  1VTN C;  5DEQ A;  1FYL A;  2DPD A;  4G6Q A;  2QBY B;  2ZFW A;  3V7C A;  3Q9V A;  3NRV A;  3BPV A;  5DD8 A;  3U9G A;  1BOA A;  4UHT A;  1OPC A;  2IPQ X;  1Z9C A;  5CVV A;  3LQR A;  1ZLK A;  3FMQ A;  3TGN A;  2XRN A;  1FWZ A;  4BXU A;  4U7D A;  4WXC A;  5HVQ C;  4S05 A;  1BN5 A;  5CYV A;  3KEO A;  3CDH A;  4YFX F;  5ED4 A;  1WSU A;  2JPC A;  2ADU A;  2PJP A;  4PZJ A;  1YFH A;  1D5V A;  2R7D A;  4R8H A;  2FOK A;  1S7A A;  3E6D A;  4ZYE A;  5LHH A;  2OBP A;  5IT9 K;  3F8C A;  3FM3 A;  4R79 A;  2NNY A;  1BC7 C;  5BPD A;  1ZGA A;  3RKY A;  2O6G E;  2OD5 A;  3HHG A;  2PMU A;  2C6Y A;  4OU0 A;  2V79 A;  4CDG A;  3SQN A;  1MD0 A;  4D0P A;  4A12 A;  1R58 A;  1HW1 A;  3L2C A;  2FU4 A;  5AON A;  1XGS A;  3ZMZ A;  1MJB A;  1XSV A;  3K2Z A;  2MLK A;  1T6S A;  3H92 A;  3ISP A;  3CO7 C;  1YW9 A;  3DFG A;  2EV0 A;  4RB2 C;  3GX4 X;  2P5L C;  5BS6 A;  4OIO F;  1W7P D;  1DUX C;  2HWV A;  3LQQ A;  4EGY A;  2DQR A;  3KZZ A;  3WTV C;  2M87 A;  2ZME B;  3OV8 A;  4G9Y A;  4MQ9 F;  4CYD A;  2F5D A;  1ZH5 A;  5DCF A;  2V6C A;  4EJT A;  3ECH A;  3SHF A;  2CYY A;  2LF7 A;  3V8L A;  3I71 A;  3T5X A;  4M6Y A;  2CFX A;  3H3U A;  2L54 A;  2VN2 A;  3QP5 A;  4KIF A;  1F9N A;  2PBI A;  2Z99 A;  5E18 F;  2E1N A;  1IAW A;  1S7O A;  1AWC A;  4N9H A;  2HQN A;  4IRG A;  2IA0 A;  2YU3 A;  3EDP A;  5ICF A;  1FP2 A;  5DUI A;  2W84 A;  2XAJ A;  4N0B A;  3OOP A;  3IL2 A;  4EVI A;  5L3G A;  2MH9 A;  1TW2 A;  5H6R A;  2FRH A;  5D6F A;  1XCV A;  3TDZ C;  1FSE A;  5CLS A;  2HDC A;  3MZY A;  4ENJ A;  5K1Y A;  2EWN A;  3C1D A;  3Q5F A;  4Q48 A;  3MQ0 A;  2DT5 A;  4LGW A;  4YFN F;  2DK8 A;  4MQV A;  1XDU A;  3ZP5 A;  1QQI A;  2BYV E;  1OKR A;  3V7S A;  4G8X A;  5DDG A;  5J8F A;  1XSX A;  2X0L A;  4HF2 A;  3T0Y A;  5LGN A;  3DXJ F;  4EJV A;  4ZYD A;  1YTY A;  4ENM A;  2H94 A;  3KFW X;  3KP6 A;  5CVR A;  4Q4Z F;  3DV8 A;  3KLN A;  3L7W A;  3WTU C;  1P4W A;  1R22 A;  5JVT A;  1KYW A;  2DO7 A;  1LDJ A;  4JQF A;  3RIR A;  3E6B A;  2M45 A;  3E5X A;  3GF2 A;  1FT9 A;  2V9V A;  2XIG A;  1FOK A;  3R0J A;  2XKP A;  4AIK A;  2HTJ A;  3JSP A;  1L0O C;  2MBF A;  1EH8 A;  1R1T A;  1KA8 A;  4EQQ A;  1E17 A;  5LHG A;  4OIQ F;  4HDU A;  2QQ9 A;  1BBY A;  4XSZ F;  3CTA A;  1G3S A;  4BAY A;  4P5O A;  4IHT A;  5JFR A;  2STW A;  5KK1 A;  3L9F A;  3GUD A;  2HYG D;  3BP8 A;  2O3F A;  1TQM A;  2VOO A;  1MKM A;  5D6E A;  4OMZ A;  2D2W A;  4A2U A;  2EFP A;  3LA3 A;  4M74 A;  1V3F A;  4L9V A;  4ZZD A;  1D8J A;  2Y48 A;  4I0A A;  1FPQ A;  1CF7 A;  2DW4 A;  4UVA A;  2GIV A;  4WXD A;  3BZ6 A;  3FWE A;  2IT0 A;  4G7Z F;  4CHU A;  3GW2 A;  3KEQ A;  1AOY A;  1G3W A;  2G9W A;  1R1U A;  2YX7 A;  2ACJ A;  3WE3 A;  3FMR A;  2IVM A; 
#chains in the Genus database with same CATH topology
 2JPB A;  3TO7 A;  4PGH A;  1VQ8 I;  2F5E A;  2KRC A;  1X1D A;  2GQQ A;  3TOB A;  5F04 A;  1B72 A;  3HOY J;  1E0E A;  4FX0 A;  4F7Z A;  1ULY A;  1ZRC A;  2ZB9 A;  2DT6 A;  5D4R A;  1P4A A;  4BJ5 C;  2CS3 A;  3V42 A;  5KAF C;  2VT3 A;  3PNY A;  4QWQ A;  4KN4 X;  3IAS 2;  1PP7 U;  2P7C B;  2G7U A;  2VE8 A;  4ZH4 F;  1JTX A;  4C3J J;  3UNG C;  3P9K A;  2F6C A;  1U8R A;  2LKP A;  2ZC2 A;  4F91 B;  3AL0 B;  5JHF A;  1U6G A;  1WI3 A;  2DA7 A;  3IH4 A;  4LG0 B;  2AO9 A;  2ELH A;  3D5S C;  4A5M A;  2X1D A;  2GWR A;  4XLH A;  3VYU B;  4YIR X;  4M3B A;  3S2W A;  3K1N A;  4PJM A;  2HVQ A;  3KP2 A;  1IRG A;  1FOX A;  1WWX A;  3RYR A;  3M8E A;  1IRF A;  2V1U A;  1AHD P;  3C2B A;  5H2F C;  1TNT A;  4BU2 A;  3K2A A;  2UWM A;  4L9T A;  3MKW B;  5EEH A;  2LG4 A;  2W48 A;  4BJT A;  1WJC A;  3AG2 H;  4EGZ A;  4IHY A;  5KHD A;  1MH3 A;  2E36 A;  2DJI A;  5D5V B;  1SAX A;  2E1O A;  2O8X A;  2WV0 A;  2MC4 A;  3AG4 H;  1LE8 A;  2GA2 A;  3RZD J;  2VB6 A;  2JRT A;  3BOQ A;  4LD5 A;  5B1B H;  4BXF A;  3FHN A;  3BLY A;  1I6H J;  3DLA A;  1O57 A;  1WKM A;  3WU1 B;  3IH3 A;  3ZQL A;  6PAX A;  4LG3 A;  2B0L A;  2GAU A;  3ZQH A;  2FXA A;  2K5C A;  2E1M B;  3CME I;  1MNM C;  3FBI B;  1DPU A;  1GVJ A;  4PCQ A;  2BY3 A;  1RIO H;  1EH7 A;  3WTZ A;  4I01 A;  1FSH A;  1V5F A;  1ETK A;  2XAF A;  2EZL A;  2LD5 A;  4P96 A;  1ETW A;  3CES A;  4F92 B;  3LAP A;  4LLN A;  3BR2 A;  2DLL A;  3BCB A;  3HZJ A;  4IPA A;  4ENK A;  3HSR A;  2H8W A;  3TKY A;  5EGO A;  4RGR A;  3HOV J;  4ENN A;  4ZTJ A;  5HS9 A;  1TWH J;  2XF5 A;  1SAU A;  1GT0 C;  2X4H A;  4CZC A;  4M3D A;  3RDI A;  3QU3 A;  4D7N A;  4HG2 A;  3ELK A;  3DCF A;  4C2U A;  2KIF A;  2XAU A;  2K85 A;  1P92 A;  1FBS A;  4M9Z A;  1OCP A;  2B7E A;  3R60 A;  2F5C A;  4A0Z A;  5C44 J;  1MGT A;  2QQ8 A;  3ML6 A;  4A3M J;  3CJQ B;  3OYA A;  3HTS B;  3CCL I;  3HXL A;  5HLI A;  1I3Q J;  4JP0 A;  2ISY A;  2A69 F;  2M7A A;  4BQN A;  5FJ8 J;  3J80 Z;  1N25 A;  3B02 A;  4UXN A;  1AA7 A;  3HIF A;  2WA0 A;  2XGC A;  1ZRE A;  1VQ5 I;  1DQU A;  1HST A;  1KQ0 A;  1LJ9 A;  4AWX B;  2NNN A;  4N9I A;  1LNW A;  2VBY A;  2FQ4 A;  3TO9 A;  1J5Y A;  2RNJ A;  2X51 A;  2VBW A;  4HDV A;  2JSP A;  5E8G A;  5BOX A;  1HC8 A;  4FTH A;  3SFI A;  2JZY A;  4BHB A;  2L7M P;  4G7H F;  1Z77 A;  3LNQ A;  3H0G J;  2HXI A;  4DJA A;  4AM3 A;  3TDU C;  2W00 A;  4TV7 A;  4DBR A;  5FB2 A;  2Q1Z B;  5GPA A;  4IO9 F;  4YEL A;  1ZG3 A;  1U2W A;  2O9L A;  1YW8 A;  5D4S A;  2I8D A;  4I09 A;  4FCY A;  4D5C A;  4PGG A;  1SFO J;  4OAY A;  4KUM A;  2DMT A;  3F6V A;  4MEY F;  5M3F J;  1ACI A;  4DGW B;  1TT5 B;  4XM3 A;  2DDA A;  2ETH A;  2G7H A;  3SEZ A;  2XAH A;  1DPR A;  5ICG A;  1MBE A;  1HKQ A;  4GYI A;  1I1G A;  1OR7 C;  5EG0 B;  3HJE A;  1W5C C;  2Z5U A;  3WG9 A;  1I3A A;  1Y0U A;  4JK1 X;  4XQF A;  2ESN A;  3LSR A;  2FQ3 A;  3RPU A;  4A6D A;  3DEW A;  3DTI A;  4U0W A;  2LBF B;  2PJR A;  1TP4 A;  3D5L A;  1ZQ3 P;  3V8K A;  3LA7 A;  2Y2Z A;  4IHW A;  3CLO A;  3IAM 2;  2L0K A;  4J01 A;  3IHU A;  3R0A A;  1KZH A;  1I1S A;  1BOB A;  5ICE A;  4PJJ A;  2NRA C;  4OIP F;  2K4J A;  1VQ4 I;  2KZV A;  1VI0 A;  1H8A C;  1ON1 A;  3OYD A;  1IRX A;  1YYV A;  2LY9 A;  2MSY A;  2HZT A;  4N4N B;  3GZ6 A;  1K78 B;  4LK1 F;  3FMS A;  3QYB A;  1A04 A;  4B8X A;  1Y0N A;  1YX3 A;  2HDD A;  3K6G A;  5LEJ A;  3TP3 A;  2D1V A;  3O8G A;  3VEP A;  3GLL A;  1MSF C;  4XSX F;  5HDN A;  4RS8 A;  3KP4 A;  1OCT C;  3DLL F;  4ZYH A;  2VOD A;  4A3F J;  3JTG A;  3CCV I;  3PFY A;  5K7Z A;  2WC2 A;  1ZEL A;  4CCL A;  3I0T A;  1LQ1 A;  1G4D A;  3HDD A;  5IOZ A;  1D1B A;  2CUJ A;  2DPU A;  3A4C A;  1IN5 A;  3PSI A;  4HX4 A;  4L0Y B;  3JRD A;  4FAS D;  1W5S A;  2V7F A;  1V5E A;  3SFZ A;  3DEE A;  4E70 A;  1IJW C;  2YR2 A;  1GXP A;  3L2R A;  1M1E B;  1FLI A;  3CD6 I;  2B9S A;  3HOW J;  3ZQI A;  3N4M A;  1APL C;  1FEX A;  1VQ6 I;  2K40 A;  2Q0O A;  4HW0 A;  2A61 A;  1JHH A;  3PIP F;  2VXD A;  3V8J A;  5DM6 F;  4E7S A;  1T39 A;  1FYK A;  1HW5 A;  1UST A;  2L9S A;  2KDO A;  1PYV A;  5LEK A;  2F5F A;  1VQN I;  2XUB A;  2A3S A;  5D8L B;  2JA8 J;  4IOC F;  2EQR A;  3HUG A;  1IDY A;  3E5U A;  3BG5 A;  2IA1 A;  1P9Q C;  3K4C A;  1Z6R A;  2MAB A;  3SDG A;  1FOW A;  1FMV A;  2LYC A;  3BJO A;  3HPG A;  1TW3 A;  3OR2 C;  3H5N A;  1EH6 A;  2LK2 A;  3BR1 A;  3I54 A;  3I3L A;  3WTT C;  3VOE A;  4RBO A;  3CCQ I;  3FXR A;  4XRM A;  1ZGJ A;  1YJN I;  4CXF A;  3E6C C;  3OYN A;  2EA4 A;  3ECO A;  4P9F A;  4HQM A;  1Q1H A;  3RPQ A;  1OLT A;  1MMD A;  3A0H C;  5B3S H;  1Z6T A;  4NBQ A;  3OYG A;  2E5N A;  4L9N A;  4A3L J;  3OL3 A;  2W4S A;  3BWG A;  2P5K A;  1HQC A;  1CF7 B;  2QWW A;  3OYF A;  3HEF A;  4MTD A;  3SZG A;  3DBL B;  3ZOB A;  3RJP A;  1GHC A;  1O3T A;  3E6M A;  4KDP A;  1ETO A;  4OIR F;  1GV5 A;  1ENH A;  1MJA A;  2F2E A;  2P7V B;  1ZG5 A;  3DTK A;  4EM0 B;  4HBL A;  2X6W A;  5LLQ A;  3GTM J;  4IKF A;  5JLW A;  4ESB A;  2CW7 A;  2H27 A;  4XLN F;  4J19 A;  1J2X A;  4HRI A;  3P7N A;  1A5J A;  5E1Z B;  1QBJ A;  2QKL B;  2RGV A;  1KON A;  3DBR B;  1RNL A;  4MHG A;  4D1Q A;  2OU2 A;  3REO A;  1UZC A;  1Z1D A;  4B4C A;  2JA7 J;  2M9H A;  4ESJ A;  4RB0 A;  4XN3 A;  1W7P B;  3QYF A;  2RC4 A;  2IGM A;  3KIO A;  3VDX A;  3Q0W A;  1JJ6 C;  5D5X B;  3DKX A;  2E7X A;  1EV7 A;  1B59 A;  3M9A A;  1HA8 A;  1XCB A;  5J8C A;  5C4J J;  2V9K A;  2BBY A;  3IP4 B;  4LOC A;  1QRY A;  3LFK A;  4G6D A;  4MEX F;  1Y8R B;  3EYY A;  2IS4 A;  5CPR B;  1D0Y A;  1FBU A;  3RQ4 A;  3VOD A;  2FNP A;  2E2I J;  3SYT A;  3C2H A;  3F21 A;  4UUS B;  4I2O A;  2OCE A;  4RGU A;  3V7R A;  3GTK J;  1B1B A;  4EEF G;  3W2V A;  2HGC A;  1MDM B;  4LK0 F;  3EUH A;  2OAZ A;  3OYH A;  5EF6 A;  4YRV A;  1KU3 A;  1I39 A;  4JOM A;  2JUC A;  3KYL A;  5HLH A;  1A36 A;  2QQA A;  4M3E A;  4GO1 A;  4UUT A;  5J1U A;  1SMY F;  2JVH A;  2RAE A;  2AXL A;  2CGP A;  4A6E A;  2A68 F;  3JRG A;  1REP C;  2VJJ A;  2WAE A;  3WOD F;  4MFE A;  2MW8 A;  2K86 A;  1VQK I;  5EYR A;  1I6X A;  4G94 A;  3BZK A;  1S6L A;  3OWT A;  2VKV A;  4CGZ A;  4LIU A;  5GPC A;  1J0R A;  5FFZ A;  2D1H A;  2QGU A;  2DJN A;  1D5Y A;  1MND A;  2DU9 A;  4CH7 A;  3H0D A;  3K4J A;  1ODD A;  1Z91 A;  2P5V A;  1D3Y A;  2NS0 A;  4YIF A;  1Z05 A;  1O4X A;  1RI7 A;  3M07 A;  4V2F A;  1JUM A;  4RB1 A;  3ERE D;  2OA4 A;  3CJN A;  2WAQ N;  2CJJ A;  1X1B A;  4LJZ F;  5F64 A;  4A0Y A;  4JBA A;  3MKY B;  1F43 A;  3QPH A;  3MZH A;  1MJ9 A;  2PFB A;  4G7O F;  2ZBK A;  2CSO A;  1F1Z A;  4A3D J;  3BG6 A;  1VQP I;  4QIW N;  3SZT A;  4KN7 X;  1JXS A;  2ELJ A;  1RUO A;  2ZCW A;  3MVP A;  3FXL A;  4DW6 A;  3K1M A;  4KFC A;  3CUQ C;  1BC8 C;  3TW6 A;  2KRH A;  2DA4 A;  2DT7 B;  4P1W A;  5FLM J;  3OS1 A;  1ETX A;  2YSR A;  1Z7L A;  3G71 I;  3RTR A;  4UB6 C;  3ZPL A;  3JRA A;  2K9L A;  3I4M J;  2O7O A;  2QEN A;  4AIJ A;  3BJ6 A;  4L5J A;  2Q8K A;  3IRR A;  4WK8 F;  1ITY A;  1P6R A;  4UVC A;  2VQL A;  1JKQ C;  2CQ7 A;  4DQ2 A;  3WGG A;  3GTL J;  2QQB A;  3LAJ A;  2EA2 A;  2EV5 A;  3VYS B;  1BI0 A;  3T8T A;  5FD6 A;  2V1X A;  3J7Y J;  4HV6 A;  4O3M A;  2L3D A;  2P81 A;  1QZE A;  1QZZ A;  1SVO A;  1D1C A;  4ASN A;  5J4Y A;  1OYY A;  3M4O J;  2CO5 A;  4M3F A;  5L3F A;  4S04 A;  4BHC A;  1X3Z B;  2QCO A;  4L0Z B;  2DA6 A;  1H89 C;  1KGS A;  4GGG A;  4MNU A;  1V4R A;  2QM3 A;  3HRU A;  3FKI J;  5FLX K;  3DKY A;  4NQW A;  2ZO4 A;  3C7J A;  2Z1D A;  3KZY A;  4W97 A;  3QPS A;  4EJW A;  3IH2 A;  3B73 A;  1MBG A;  3KP5 A;  3GEZ A;  1T95 A;  4FET A;  3G1L A;  5EZG A;  1WJE A;  2XPW A;  2IS1 A;  5ERI A;  1LKX A;  4BL0 B;  3L09 A;  3UKG A;  3IUO A;  3ZQC A;  1T2K A;  2VAS A;  3MZ8 A;  2D45 A;  3I53 A;  3E0J B;  4YG2 F;  4NC7 A;  2DA3 A;  3WHC A;  1RR8 C;  2EPF A;  3BC8 A;  4OIN F;  1FBQ A;  2LOO A;  1YIO A;  2J5P A;  2NOJ B;  2VJ5 A;  2W24 A;  2KIS A;  3H1C A;  4C3I J;  1QU3 A;  4BDZ A;  2IEK A;  4XKB A;  1QPI A;  2BY0 A;  2M4G A;  2IP2 A;  3BTJ A;  2L7Z A;  1STZ A;  1ZKG A;  2RKH A;  1ZHF A;  2Y0S A;  2WV1 A;  4HX8 A;  4ZYG A;  2HS5 A;  2X48 A;  4HNT A;  3BCA A;  3HOX J;  3F22 A;  3CUQ A;  3F8N A;  4K2E A;  3BT9 A;  3P9C A;  3VB2 A;  3LSK A;  2GBY A;  4OWR B;  1S9H A;  4L5I A;  2V6E A;  4Y4R A;  3OIO A;  3WGH A;  2KZG A;  3U2R A;  2LTP A;  4KT5 C;  3F8M A;  1CGP A;  2JN6 A;  3VFZ A;  2CWE A;  3BR5 A;  1Z3X A;  2V1D A;  5D8K B;  5EDN A;  5F0H A;  5J3L A;  2E1C A;  2IW5 A;  4RM2 A;  2P6S A;  3GTG J;  2KLO A;  3ESW B;  1MH4 A;  1ETV A;  2AQE A;  1JGS A;  2H1K A;  5LHI A;  4PDK A;  3H36 A;  4M9S A;  5HNF A;  1WJB A;  1DGR M;  1LUJ B;  1UMQ A;  2QYO A;  2VKH A;  4GCV A;  1TQI A;  5DYM A;  2FD5 A;  5CVU A;  1TTY A;  2Y9Z A;  2KP6 A;  3MCZ A;  4IXA A;  4KNY A;  1TNS A;  3VSL A;  2LP0 A;  3ZN1 A;  5IY5 H;  1VQ7 I;  2A5W A;  3I64 A;  4I98 B;  1IF1 A;  4BE0 A;  3VWB A;  3A0B C;  2PLY A;  1V5G A;  5D5U B;  4GDF A;  3A03 A;  2PJR B;  2KJC A;  2NYX A;  2FJ1 A;  2HEO A;  2MH2 A;  2JQ7 A;  1BR1 A;  2DBB A;  2IAI A;  3F3X A;  3GZ5 A;  2RQQ A;  3DU6 A;  4A3K J;  1TBX A;  2KDZ A;  5D5W B;  3H9G A;  5C4X J;  2JA6 J;  1IXC A;  3G2B A;  5F1R A;  3F8B A;  4XKW A;  2L7F P;  4Y15 A;  2GOM A;  1HOM A;  4Y17 A;  1J09 A;  4JYK A;  3DWL E;  2NOG A;  3GME A;  2BW3 A;  3BG7 A;  2QSF X;  1IZ1 A;  2R0Q C;  1IXR C;  4KT6 A;  3MWM A;  2P4W A;  2N8G A;  4KMU X;  3LSH A;  4PSW A;  1EKE A;  1OCC H;  2YX4 A;  1X1P A;  2MG4 A;  1LDD A;  3FXO A;  2OJE D;  4FE4 A;  2Z16 A;  4ABZ A;  3L2Q A;  3QU6 A;  3M1C A;  4XLA A;  4KJZ A;  3HKZ N;  4NQW B;  4AC0 A;  4BE2 A;  1WH5 A;  2HR3 A;  4KIG A;  4PJ0 C;  2HQ5 A;  2CQQ A;  1HF0 A;  4BGD A;  1W7P A;  5GAH J;  3PUB A;  3FM5 A;  1U0J A;  5ILV A;  2Y75 A;  1BI2 A;  3H3V K;  2K9S A;  2GA1 A;  1UHW A;  5LBQ A;  1KU2 A;  1ZN2 A;  1HKS A;  5B1A H;  1BI3 A;  1I50 J;  1TWC J;  2ME0 A;  2ZXJ A;  3G1O A;  4E4H A;  4A3J J;  3ABK H;  1IXS B;  1UHM A;  1D0X A;  4H0E A;  2OV7 A;  2ZME A;  1DU6 A;  2HU9 A;  4KIS A;  3C2G A;  1MDM A;  5JLX A;  3F23 A;  3B6A A;  2KIQ A;  4XID A;  3G6E I;  4B09 A;  2IS2 A;  1EF4 A;  3BJA A;  5L3E A;  4PSX A;  4XN0 A;  3ZCO A;  1NK3 P;  1G3Y A;  1ZTR A;  1LFB A;  1J7K A;  1E3O C;  3CF2 A;  4IHS A;  1MIJ A;  4L9J A;  4FIS A;  3D5R C;  1XGN A;  1IUY A;  5IYD J;  4ESF A;  3RKQ A;  4MIM A;  1FNN A;  2YU9 J;  4ZZL A;  2BZT A;  1S5L C;  2JT1 A;  3ZRG A;  2HOS A;  3Q0V A;  1X4O A;  1XD7 A;  2MGQ A;  1P4X A;  2ZNZ A;  5FKL A;  2VOP A;  1G6N A;  5FD5 A;  2CW8 A;  1MMS A;  5KVR A;  2QVO A;  1R5H A;  4BYY A;  1O3R A;  1H88 C;  3K4B A;  1TWF J;  3RPU D;  3ROU A;  2VC0 A;  2VL8 A;  2O61 A;  1JTY A;  2K3F A;  2XGX A;  2Y31 A;  2A6H F;  3N05 A;  1IN4 A;  4B48 A;  3RI4 A;  4AIH A;  3PO2 J;  3JAM K;  3DBH B;  4NHJ A;  3GYH X;  1K79 A;  1RKW A;  2PMZ N;  4Q47 A;  2A6T A;  2DAO A;  2ZXW H;  2ZME C;  1WZ2 A;  1X4P A;  4M73 A;  4A3E J;  2H8R A;  4RAG A;  2XAQ A;  2EH3 A;  1PVE A;  2K9Q A;  3DPT A;  3OL4 A;  3CJR B;  1U78 A;  1U5T B;  3H5A A;  2M8G X;  4GFB A;  2ZJP F;  4HF0 A;  4BBS J;  2EIN H;  4DYC A;  1WJA A;  3N97 A;  2R7F A;  2DXI A;  2M2E A;  3FZV A;  3PNV A;  2JA2 A;  2OF7 A;  1DP7 P;  2E19 A;  4EV0 A;  4DNC A;  3WTW C;  2OZU A;  4CCK A;  3P9I A;  1IW7 F;  4F3Q A;  1V55 H;  4A3G J;  3F0C A;  3JAM Z;  2XAS A;  1Y8Q B;  2ZNY A;  3JTH A;  3KZI C;  1YQA A;  1HBX G;  2ZKZ A;  3ZN0 A;  3RKW A;  1XPX A;  3VSK A;  2CFO A;  2W85 A;  1PUE E;  5GP9 A;  4B44 A;  2STT A;  3LSJ A;  1SFE A;  2BW3 B;  3CLQ A;  2AXT C;  2XPU A;  2O0Y A;  2M0C A;  1LDK B;  3QOD A;  2KMU A;  2VT2 A;  3M7G A;  2PI0 A;  3H35 A;  3RQI A;  1U3E M;  2IJL A;  5FKM A;  3OS2 A;  4XLF A;  1O3S A;  2ZXI A;  4Y13 A;  2O03 A;  3S1M J;  3OYC A;  1IN8 A;  1XB4 A;  3DEU A;  1PUF A;  1XMK A;  2XAG A;  1NK2 P;  4IJA A;  1YS6 A;  2F4M B;  4UB8 C;  5AIQ A;  2EIL H;  3K7A J;  3G73 A;  2VON A;  3AG3 H;  4A3I J;  2CG4 A;  4LFU A;  1TQP A;  3BDD A;  1Y39 A;  3LFU A;  2L9N A;  3MKZ A;  4M72 A;  3IKT A;  4I02 A;  3TP0 A;  3S1R J;  1Z21 A;  1B9N A;  2E34 A;  3FDY A;  2PQ8 A;  3C18 A;  4C2M J;  4AVP A;  3DKW A;  4HQE A;  3CC4 I;  4A5N A;  3KET A;  1SEU A;  2DI3 A;  3D0S A;  1OMI A;  1R5G A;  2MD0 A;  1Z67 A;  2LDU A;  5K5O A;  5HS8 A;  4HF1 A;  2EZH A;  3AAF A;  2DTZ A;  4M71 A;  5F1J A;  2IBD A;  2M1B A;  3PQK A;  2GXB A;  1WHU A;  3J80 K;  4WWC A;  2J5O A;  1XDS A;  2NXN B;  3S1Q J;  1LEB A;  3I56 I;  4U88 A;  2IRF G;  2BXY A;  3SJM A;  1OFC X;  1BW6 A;  4FT8 A;  1B72 B;  4RAZ A;  4FHT A;  3J81 K;  2K9M A;  1BR4 A;  4RMN A;  3ZMS A;  3OYE A;  1MZB A;  2LMD A;  3BG3 A;  5JR3 A;  1QHG A;  3K10 A;  4NNJ A;  3U1D A;  2K9N A;  2DTR A;  1OCR H;  2EZI A;  4O5V A;  2BE5 F;  4MTE A;  3ZMD A;  2DMP A;  1XG1 A;  3GFL A;  3CO6 C;  3COA C;  2DFI A;  2QZ8 A;  1NHA A;  4UV8 A;  3NQO A;  2PX9 A;  2DOA A;  3PJR A;  2XRO A;  3FK6 A;  4UV9 A;  2OPT A;  2B63 J;  1LVK A;  2PMZ A;  3CC7 I;  1IN7 A;  3CJT B;  3F8F A;  4ZDP A;  3WTY C;  2R5Y B;  2XVC A;  3BPX A;  4BBR J;  4CCN A;  1X2M A;  1IRZ A;  3LA2 A;  5K7F A;  1S8N A;  4ON0 A;  4ZTF A;  4XOT A;  4HOB A;  1U5T A;  1E2X A;  5ILS A;  4I6Z A;  2Y0S N;  1P2F A;  3GBG A;  1ZAO A;  2FBK A;  3SDB A;  2R7O A;  5CQE A;  4WF2 A;  2VBZ A;  3TOA A;  3PO3 J;  1H9G A;  1KQ9 A;  5KAI C;  1QO0 D;  3BTC A;  1T0F C;  1AKH B;  2F4O B;  1PJR A;  2MD5 A;  1R36 A;  2L4A A;  3IWF A;  1HXD A;  2DDB A;  2VJI A;  4BH9 A;  3RCO A;  3QOP A;  2M0M A;  2R7Q A;  1GUU A;  2HQR A;  2ZJ2 A;  2BY2 A;  2KRF A;  1YO5 C;  4P55 A;  2QSG X;  5IYC J;  3BG9 A;  5JI6 A;  2PN6 A;  3A1Y A;  3K1P A;  1G2H A;  3PL8 A;  1QPM A;  4EMS A;  5FGM A;  4E7H A;  4ITV A;  1KU9 A;  5HDG A;  1FOY A;  5B66 C;  1X58 A;  1B9M A;  4BHP A;  4ETS A;  3HB9 A;  3K9T A;  4ZDO A;  2CUZ A;  3A01 A;  3MAJ A;  1YW7 A;  3ZQG A;  1ON2 A;  2FSW A;  4QLC U;  3V4G A;  4XOR A;  5TJJ A;  4IVN A;  4C3H J;  1WPK A;  4D7M A;  2HPM A;  3LWF A;  1OYI A;  3GVA A;  4RAY A;  2VI6 A;  5HLT A;  1UHS A;  2R7U A;  4GYG A;  3S17 J;  1L3L A;  4LMY A;  2FML A;  2W25 A;  4ZDL A;  4G12 A;  4AYB A;  3PIO F;  3JRF A;  4LB6 B;  2BHY A;  1WQ2 A;  1IDZ A;  2VC1 A;  3HPH A;  4PFP A;  2NVX J;  2HZD A;  4IHX A;  2VQG A;  5GAG J;  5EJC A;  3HOT A;  3M1E A;  1VQM I;  3ZMV A;  2A07 F;  2PEX A;  2P8T A;  1WVR A;  3E1S A;  3FXM A;  1O7F A;  1U5T C;  5B5E C;  1PUF B;  2HNH A;  1MBF A;  3HSF A;  1MSE C;  4IX7 A;  2X6Y A;  1TC3 C;  3QPT A;  5HS7 A;  3IWZ A;  4HPQ A;  3JR9 A;  3NEU A;  5E1X A;  2JVG A;  4BQQ A;  3CCE I;  2JK3 A;  3M8F A;  2H6B A;  2TCT A;  1EA3 A;  3LSM A;  2ICW G;  2YS9 A;  3BQY A;  2K7L A;  2MLG A;  4DZJ A;  4P9U A;  2L01 A;  1WGX A;  3K0L A;  4FQG A;  3NAU A;  5E8I A;  4B1R A;  4A3C J;  1YLF A;  2BVL A;  4KIB A;  1TLH B;  4E7Z A;  4RAF A;  5LFA A;  3AKZ A;  3OY9 A;  4BUP A;  1K7A A;  1UAA A;  3TMO A;  1CQT A;  1WJ5 A;  3HGG A;  2COM A;  5FKO A;  5E3L A;  3HOU J;  2M30 A;  4U7B A;  1R23 A;  3R61 A;  1QVT A;  1X2N A;  4C30 A;  2M7B A;  2VQC A;  4U0V A;  4PUS A;  4EM1 A;  2L5Q A;  2I5U A;  1XTA A;  1GXQ A;  3S2D J;  2F4I A;  3I55 I;  3PQJ A;  2NAZ A;  1DDN A;  2QF7 A;  3BRO A;  4IQ4 A;  1B4A A;  1X3U A;  2EB7 A;  2FE3 A;  3FF5 A;  2QLZ A;  1JGG A;  2L9V A;  4LG0 A;  1FYM A;  4UNO A;  1YIJ I;  5IP6 A;  2FUG 2;  5DCM A;  2HTS A;  2ISZ A;  3D1N I;  1JJ8 C;  4AU7 A;  4Z6Y A;  3K70 D;  4CO8 A;  1IV6 A;  2DK5 A;  3Q0U A;  2WBM A;  2HVS A;  1R49 A;  2XSD C;  4C9Y A;  3FKJ A;  3J81 Z;  3EQL F;  4KMF A;  1TZL A;  3OSG A;  1ZAR A;  4HLY A;  5FFX A;  5LGU A;  4CIC A;  3OYM A;  5ICC A;  2OTJ I;  4FE7 A;  4Z2Y A;  1JE8 A;  4HEA 2;  4A0X A;  3K4M A;  4KIC A;  2TRT A;  4XK4 A;  2JUG A;  5IT3 A;  4BE1 A;  3ZMT A;  1GLN A;  5M3M J;  2NS7 A;  5HNH A;  3MMY B;  5F6F A;  5M5W J;  3BQZ A;  1FTT A;  3LL7 A;  2ID3 A;  4QPQ A;  3BTI A;  2NVU B;  3OYI A;  2UZK A;  5IT9 Z;  2ZJR F;  1KYZ A;  4HNU A;  2XHK A;  1S72 I;  1S3J A;  1I5Z A;  2F5V A;  2FNA A;  5CVJ A;  1SD6 A;  1OIS A;  1X1C A;  1W4M A;  1G8X A;  2DYR H;  4ZC3 A;  3I58 A;  3SZP A;  1Z0X A;  1W5T A;  2E35 A;  2HFH A;  2R7V A;  4CYC B;  4HA8 A;  1YRN B;  3CCY A;  3E7L A;  3K4N A;  4NC6 A;  3PM1 A;  4M6V A;  2IGO A;  5DV5 A;  3W6K B;  2WTE A;  1YS7 A;  2H09 A;  2K27 A;  3VYT B;  1GDT A;  2CV0 A;  3KLO A;  4JX4 A;  3HOS A;  3HYI A;  1USS A;  3KP3 A;  1R4M B;  4RA2 A;  1IGN A;  2LH9 A;  3J7Z I;  2KFD A;  1IN6 A;  3JRH A;  3GTJ J;  1RUN A;  4DOZ A;  3CMY A;  3DQV C;  1MMA A;  3HUG B;  4NUB A;  2EV6 A;  2VIX A;  1FIA A;  1J59 A;  3GTP J;  3GWZ A;  3OYB A;  4D5F A;  1O7L A;  2FA5 A;  5DD4 A;  3OOU A;  5J40 A;  4D9J A;  1FX7 A;  4W1U A;  1UB9 A;  3B6C A;  2ZJQ F;  3H5R A;  1IG7 A;  1D8K A;  3GFJ A;  3EUK L;  1SFK A;  5CVI A;  3S32 A;  3JRE A;  3DF8 A;  3CUQ B;  2K02 A;  2LRE A;  5E20 A;  5LRS A;  1C0W A;  5DUK A;  3KCC A;  3LST A;  4I0B A;  3H9Q A;  1XGO A;  5GTH C;  1W0T A;  2DMU A;  4U0Y A;  3HSE A;  4M9X A;  2R7T A;  3JSO A;  2E2H J;  2JRM A;  1XSD A;  4G6T B;  3BZC A;  3HHH A;  3ZMU A;  1NG7 A;  3NWT A;  1UFM A;  4XLP F;  3GFI A;  3HRT A;  3QP6 A;  1W0U A;  1K61 A;  2BV6 A;  1OYW A;  1T38 A;  1X3W B;  4II3 A;  2LLK A;  4XON A;  2DN0 A;  2CH0 A;  4UUV A;  1S29 A;  5C3E J;  4IRH A;  1F4K A;  4CSW A;  2GIZ A;  2H1L A;  2M3A A;  3Q9S A;  2UV1 A;  2ME6 A;  4BS9 A;  2Y0M A;  3CP2 A;  1QNT A;  4F52 A;  5E3O A;  2EFW A;  1R71 A;  4YII A;  5CQG A;  2BY1 A;  3TL4 X;  5GAD J;  2LY2 A;  1MBK A;  2L2O A;  2IA2 A;  3ZQF A;  1ZRF A;  2KKO A;  1LEA A;  3SXY A;  2JJ7 A;  2Y69 H;  2OC6 A;  1JKO C;  1TWA J;  1SFU A;  4UUS A;  2VUM J;  1AKH A;  2DA5 A;  5A2Q Z;  3I5U A;  3DPL C;  4FX4 A;  3IKV A;  4M3G A;  4BDY A;  2R7R A;  1FY7 A;  1T08 B;  5BMZ A;  1EJ9 A;  1R00 A;  2KIM A;  3I59 B;  2FMY A;  5JHU A;  2JTV A;  4E7I A;  1SFX A;  3CCJ I;  1POG A;  2TDX A;  2A6E F;  4AD9 A;  2IGK A;  3T8R A;  4XKV A;  1MBJ A;  1YIT I;  2MC3 A;  1ONV A;  2BGC A;  3WE2 A;  1R6R A;  4ANJ A;  1I27 A;  4L5E A;  4BJ6 C;  3O6B B;  3CCR I;  2A5Y B;  4XIC A;  2VE9 A;  2NVY J;  3H9J A;  5TRD A;  5CKT A;  4NB5 A;  1BJZ A;  1A6I A;  1UCR A;  2IS6 A;  3EUA A;  4HZF A;  3W6J B;  4IRI A;  1K83 J;  1GV2 A;  2HKO A;  2VPR A;  5E3M A;  3EYI A;  3AL0 C;  4AUX A;  3WU0 A;  1YRN A;  3F72 A;  4HAM A;  4WCG A;  2R5Z B;  2ECC A;  4NC8 A;  1A6Q A;  2GM4 A;  1F5T A;  2QBY A;  1NTC A;  4BY7 J;  5EG0 A;  4RLQ A;  1HSJ A;  4O6J A;  2Q2E B;  3T1B A;  1ZYR F;  2CW0 F;  3CDL A;  1YJW I;  3JRB A;  3M3Y J;  3HTU A;  3JRC A;  1LVA A;  1WI9 A;  2FOW A;  4CYC A;  2HI3 A;  4WX9 A;  4DZP A;  1R9T J;  2ESH A;  1FJL A;  1R1V A;  2HYJ A;  2W7N A;  3L2U A;  1O3Q A;  2P0W A;  2OQG A;  1BIB A;  3WGI A;  1Y1W J;  4IEJ A;  4LLL A;  1SVL A;  2KL4 A;  5CJ9 A;  1N78 A;  5H6Q A;  5HDK A;  4LIV A;  1Z7U A;  2BVM A;  3ULQ B;  4EJU A;  5E1W A;  5H20 A;  5L3B A;  5HLG A;  4S0H B;  2EIJ H;  2AS5 F;  3J7A O;  2M5W A;  3ABU A;  3R4K A;  3JW4 A;  3CMA I;  4E7J A;  2UXN A;  2CQN A;  2LF8 A;  2M8E A;  4R1H A;  4XRF A;  1KQ8 A;  3GO5 A;  2H6C A;  4LLG F;  3DP7 A;  4RGX A;  1HDP A;  4U87 A;  1WJF A;  2EIM H;  4WXH A;  5K5Q A;  3WTX C;  3IV5 A;  3QWL A;  2KJB A;  5FO5 A;  3QRF F;  1QVU A;  1WJD A;  3W6V A;  2RNG A;  3OYL A;  2VPL A;  4HLX A;  3MEX A;  4I7H A;  4BEH A;  2VLA A;  2LRD A;  1BIA A;  2QA4 I;  3J7A Y;  3A2K A;  3RSN A;  3ABL H;  3UR3 C;  4XR6 A;  5L3D A;  1XMA A;  2XGD A;  2DQL A;  2K4B A;  5JVG F;  2LSO A;  3QOE A;  1YHQ I;  3O8H A;  1B6A A;  3A02 A;  4BNC A;  3C3W A;  2XPV A;  4X6A J;  1H0M A;  4XLE A;  4RLF A;  2GXG A;  2WB1 A;  5F08 A;  3S93 A;  3WHB A;  3TW7 A;  2ZXH A;  3EET A;  3ABT A;  3A01 B;  5LD2 C;  4C2T A;  2VXZ A;  3O2P E;  1J9I A;  3W3C A;  3S8P A;  4EJO A;  5IP7 J;  5LGT A;  4PFO A;  2RQP A;  2RDP A;  2RN7 A;  3WTS C;  1K78 A;  4KYW A;  2V4J C;  2JMW A;  1PDN C;  3E3V A;  4UVB A;  1QA6 A;  1QZY A;  2KPM A;  3FXU A;  1J75 A;  2YPR A;  3F6O A;  2FEZ A;  1BR2 A;  2CQK A;  2FBH A;  2CV1 A;  1K6O A;  2QUF A;  2BXZ A;  1WFX A;  3ABM H;  4B47 A;  3TQN A;  3KYC B;  4Q5S F;  3E97 A;  1RZ4 A;  5F0C A;  4RM3 A;  4XMY A;  2E7W A;  2Y30 A;  5K7H A;  4RGS A;  2X6O A;  2XSJ C;  2W57 A;  3JRI A;  3OMY A;  2EZK A;  2WY7 Q;  3I59 A;  2GXA A;  3HKZ A;  4LB5 A;  1Y6I A;  2R3S A;  1SMT A;  2XF6 A;  3PSF A;  2R7Z J;  3FXQ A;  3G3Z A;  5DCM B;  3RYP A;  3RKX A;  2X1E A;  1RET A;  3OSF A;  1YE9 A;  2L4M A;  4E6K G;  2LNB A;  2BEO A;  1YOV B;  2R5Z A;  1PP8 F;  2IXS A;  2ZSH B;  2XB5 A;  4XRS A;  1BM9 A;  2Z3Y A;  1KU7 A;  1MMG A;  2FBI A;  4OAZ A;  2CRG A;  3GZN B;  5IPA A;  4UY8 I;  5AIP A;  2KHM A;  3LOC A;  5FLX Z;  4IZZ A;  3KP7 A;  2LKX A;  4PJN A;  2DA1 A;  4XKC A;  2XKO A;  3GLX A;  4N4O B;  2WWY A;  1SD4 A;  2GZW A;  4L18 B;  2CU7 A;  1W1W E;  3VPR A;  3CUO A;  1K4S A;  4LIT A;  3R6S A;  1FC3 A;  3S14 J;  4M6X A;  1H9T A;  1BI1 A;  2HOE A;  5E17 F;  3MD2 A;  4CA0 A;  3PFI A;  3M8J A;  3MFK A;  1T0F A;  3LSP A;  2Q2E A;  1Y1V J;  2ECB A;  3KYD B;  5EEA A;  2VQH A;  4EM2 A;  1F36 A;  5GAE J;  1ZLJ A;  2I10 A;  2OQR A;  1W36 D;  4BXX J;  1OR7 A;  3QAH A;  3BY6 A;  2EFO A;  2R7S A;  5L3C A;  5BQT A;  3BR0 A;  1SAN A;  4BKX A;  1VQ9 I;  2EJR A;  4JX6 A;  5EEG A;  1ZG1 A;  4IQJ A;  1HLV A;  2YUS A;  5EZH A;  3L00 A;  1T98 A;  1Z3Y A;  5HOO A;  4BQA A;  4KA4 A;  2WAF A;  3L2W A;  4HYE A;  2XF7 A;  5DTD A;  1JKR C;  3ASO H;  4ZJZ A;  3K4L A;  1JUP A;  1RR7 A;  3GFM A;  4E7K A;  3KE2 A;  3FHZ A;  3CCM I;  1QGP A;  3X2Q H;  4RB3 C;  2Z33 A;  3IRQ A;  1DP3 A;  2OZ6 A;  2DOE A;  2DOD A;  3HRM A;  1RRJ A;  1BW5 A;  3GTO J;  5J1R A;  1VFC A;  3GXO A;  4V19 K;  1JHF A;  3KPH A;  5BPI A;  4YFK F;  2WB1 N;  1XN7 A;  1FP1 D;  2L02 A;  2UXX A;  5ILU A;  2RV8 A;  4ZYA A;  1TT0 A;  1WRJ A;  1SD7 A;  1UG0 A;  5LRR A;  1BJA A;  2FX0 A;  3IC7 A;  1XGM A;  2RVC A;  2BOL A;  3L2V A;  2R93 J;  2DYS H;  2EFQ A;  3OIQ A;  1IO2 A;  4CCJ A;  3FX3 A;  2R4G A;  5K5R A;  3FK7 A;  2AHQ A;  4A69 C;  2COB A;  2PMH A;  2CV2 A;  2KIU A;  4CUG A;  1TWG J;  1ZRD A;  1YX5 A;  2HKX A;  2XV4 S;  1B8I B;  1HW2 A;  4I99 C;  5DM7 F;  1HDD C;  2Y9Y A;  5FKK A;  5M5X J;  3HM5 A;  2F48 A;  1RKT A;  3E5Q A;  3TO6 A;  4HV5 A;  3K70 C;  2R7W A;  1G3T A;  4IF4 A;  4J00 A;  1LB2 A;  3DU5 A;  2P6T A;  4HX7 A;  2EFN A;  4MO7 A;  1ORK A;  3WU2 C;  2VBX A;  3HL2 A;  5FRM A;  2FF4 A;  3P5J A;  1FIP A;  3OYK A;  1SD5 A;  4X1E A;  1K4T A;  4KIT B;  1AU7 A;  3ASN H;  3QYE A;  3ZQ7 A;  1VF9 A;  3HRS A;  2UUZ A;  5J6X A;  1FZP B;  2CUE A;  4OMY A;  5A2Q K;  1DU0 A;  1Y56 A;  1R7J A;  3H3Z A;  3HBL A;  3O3K A;  4A3B J;  3SEQ A;  3AG1 H;  3GTQ J;  2E2J J;  1FMW A;  5FKN A;  1YG2 A;  3FIS A;  2HYF A;  5E79 C;  2MA3 A;  1JT0 A;  4XBF A;  1U8B A;  2LVS A;  3K69 A;  4CCO A;  1A31 A;  4OOI A;  2Z9O A;  4CZZ A;  4MGR A;  4AYB N;  3I4P A;  1SVM A;  2EK5 A;  2PG4 A;  1QHH D;  4GXO A;  3FBN B;  1HKT A;  2HVR A;  3OIP A;  4B3A A;  2JSC A;  1VTN C;  2X85 A;  5DEQ A;  4HSR A;  3ZGK A;  5E3N A;  1FYL A;  4XOP A;  2DPD A;  4H4K C;  4G6Q A;  1XC5 A;  2QBY B;  4A93 J;  4IOA F;  1IUF A;  2ZFW A;  1NH3 A;  3V7C A;  3Q9V A;  3NRV A;  3BPV A;  5DD8 A;  1XS9 A;  3U9G A;  4HNV A;  1BOA A;  4HST A;  3JCU C;  3QPL A;  1DGW Y;  2XDV A;  1OPC A;  2IPQ X;  4UHT A;  1ZR4 A;  1Z9C A;  1OCZ H;  3AFH A;  2LKS A;  5CVV A;  3LQR A;  4BQO A;  3FMQ A;  3CQZ J;  3TGN A;  1ZLK A;  2XRN A;  1OJL A;  2LFB A;  2ID6 A;  1FWZ A;  3OR1 C;  4BXU A;  3EPZ A;  4WXC A;  4U7D A;  5HVQ C;  2ZSI B;  4S05 A;  1BN5 A;  5CYV A;  3KEO A;  4DYR A;  3HOZ J;  3CDH A;  3VYR B;  4BEH B;  3MKL A;  2NVQ J;  4YFX F;  5ED4 A;  1WSU A;  1SC7 A;  3LSI A;  2JPC A;  2XRL A;  3BR6 A;  2ADU A;  2PJP A;  4PZJ A;  2M34 A;  1YFH A;  1D5V A;  2HXO A;  2R7D A;  2OUM A;  2QEX I;  2X6X A;  2O5R A;  4R8H A;  2FOK A;  5HOD A;  1S7A A;  1S7E A;  3E6D A;  4ZYE A;  3PNT A;  5LHH A;  2OBP A;  2BHZ A;  2AQF A;  3F8C A;  1TL8 A;  5IT9 K;  4E7L A;  3FM3 A;  4R79 A;  2NNY A;  2HDW A;  1T33 A;  5BPD A;  1BC7 C;  1ZGA A;  1G59 A;  3I4N J;  3RKY A;  1FTZ A;  5TIS C;  3WG7 H;  2O6G E;  5GTI C;  2DFH A;  2HOT A;  2OD5 A;  4EAT A;  3ZXS A;  5DS9 A;  1WCM J;  3HHG A;  1ZK8 A;  2PMU A;  4MFD A;  2C6Y A;  4XNF A;  4OU0 A;  3L1P A;  1LPQ A;  2D5V A;  1T56 A;  3OS0 A;  2V79 A;  3LMM A;  3KX2 A;  4CDG A;  3SQN A;  1MD0 A;  4D0P A;  4A12 A;  1R58 A;  1HW1 A;  3CF5 F;  3GCM A;  3L2C A;  2FU4 A;  2KQR A;  1E3H A;  2DCE A;  5AON A;  1XGS A;  1ETY A;  3ZMZ A;  1LE8 B;  1MJB A;  2OTL I;  4MLO A;  1XSV A;  3K2Z A;  2HOA A;  5BNG A;  3RZO J;  1NG6 A;  2CMP A;  2MLK A;  2CUF A;  4AID A;  1JKP C;  1T6S A;  1UJ8 A;  3H92 A;  3ISP A;  2ZFU A;  5F0F A;  3CO7 C;  2QSH X;  3PUF A;  1YW9 A;  1T8I A;  3CC2 I;  3DFG A;  2M4K A;  2XGE A;  1HCR A;  2EV0 A;  3EUH C;  4RB2 C;  2E60 A;  3GX4 X;  2QKM B;  4IL6 C;  2DA2 A;  2P5L C;  4IHV A;  5BS6 A;  4OIO F;  2HPI A;  1W7P D;  1U9O A;  4X0G A;  1DUX C;  2HWV A;  2LR8 A;  2WAQ A;  3LQQ A;  3HGY A;  4EGY A;  4B43 A;  2DQR A;  4Y3O A;  3MN2 A;  3NWS A;  4QTR A;  2WY8 Q;  3KZZ A;  5EGO B;  2G0E A;  2GOX B;  1VZ0 A;  2JWT A;  1WH7 A;  3WTV C;  5KCM A;  3KEY A;  4BAC A;  2M87 A;  2ZME B;  3OV8 A;  4G9Y A;  4JX5 A;  4MQ9 F;  3W2A A;  5FRO A;  4BY1 J;  5FLV A;  4AVZ A;  4CYD A;  2F5D A;  1ZH5 A;  3OYJ A;  5DCF A;  2V6C A;  4EJT A;  3ECH A;  3SHF A;  2MYS A;  2XB0 X;  3LSG A;  2CYY A;  2LF7 A;  3V8L A;  1LFU P;  3I71 A;  4II2 A;  3CCS I;  4I76 A;  3T5X A;  4M6Y A;  5KNL A;  3G1M A;  2CFX A;  2DOF A;  3U1K A;  3H3U A;  5J47 A;  1ERD A;  2L54 A;  2VN2 A;  3QP5 A;  4KIF A;  3S3O A;  1Q1V A;  1F9N A;  2PBI A;  2Z99 A;  5E18 F;  2E1N A;  2GLO A;  3S15 J;  1IAW A;  1S7O A;  3S16 J;  1AWC A;  1YJ9 I;  4N9H A;  2OCC H;  2V9P A;  2CQX A;  1D0Z A;  2HQN A;  4IRG A;  2IA0 A;  2YU3 A;  2WAD A;  2DFF A;  3EDP A;  2RRE A;  5ICF A;  1FP2 A;  2W84 A;  5DUI A;  2XAJ A;  4N0B A;  3OOP A;  3IL2 A;  4EVI A;  5L3G A;  2XC7 A;  5IP9 J;  4DBQ A;  9ANT A;  2MH9 A;  1TW2 A;  4Y33 A;  1JUS A;  2L7K A;  2W1O A;  3S2H J;  2LC2 A;  5H6R A;  3S1N J;  3DPU A;  1JT6 A;  2FRH A;  1IC8 A;  5D6F A;  2W82 A;  2VKE A;  4XL9 A;  2E1M C;  1XCV A;  2X9D A;  3TDZ C;  2K3P A;  2LBF A;  3FXJ A;  3FXK A;  4F93 B;  1VQL I;  2R5Y A;  1U9N A;  2MFZ A;  1XX5 A;  1FSE A;  2IGN A;  5CLS A;  2HDC A;  3MZY A;  4ENJ A;  4RDU A;  3BR3 A;  2EWN A;  5K1Y A;  1VQO I;  3C1D A;  1R4N B;  3Q5F A;  2DFE A;  4Q48 A;  3MQ0 A;  4Y7N J;  3HC7 A;  2DT5 A;  4LGW A;  2KT0 A;  2DMQ A;  4YFN F;  1V54 H;  2DK8 A;  2VKD A;  3W2W A;  4MQV A;  1XDU A;  2V1N A;  2O8K A;  1X1A A;  3ZP5 A;  1QQI A;  3ONQ A;  2BYV E;  1OQY A;  1OKR A;  3K4K A;  3V7S A;  4G8X A;  5DDG A;  5J8F A;  1D1A A;  4CCM A;  1XSX A;  2X0L A;  1YI2 I;  4HF2 A;  3T0Y A;  5LGN A;  3DXJ F;  4EJV A;  4ZYD A;  1YTY A;  3U21 A;  5IOY A;  4ENM A;  2H94 A;  4QSH A;  3KFW X;  3KP6 A;  3F9K A;  3I9V 2;  3G4S I;  3S3M A;  1OCO H;  3QQA A;  3DV8 A;  5CVR A;  4DIQ A;  3KLN A;  3L7W A;  4Q4Z F;  3CMM A;  1ETQ A;  3Q3S A;  4YEJ A;  1BL0 A;  3WTU C;  1P4W A;  1R22 A;  1RPW A;  3TED A;  5JVT A;  1KYW A;  2DO7 A;  1RES A;  3CZ6 A;  1LDJ A;  4JQF A;  2DMN A;  3RIR A;  3E6B A;  2M45 A;  3E5X A;  3GF2 A;  1FT9 A;  3BTL A;  4PK4 A;  2V9V A;  3CDI A;  1IV8 A;  2XIG A;  4F55 A;  1FOK A;  3R0J A;  2XKP A;  4AIK A;  2HTJ A;  3JSP A;  1L0O C;  4GRI A;  1N77 A;  2MBF A;  2E5Z A;  1K6Y A;  1EH8 A;  1R1T A;  1KA8 A;  2NS8 A;  4EQQ A;  1MW7 A;  4DYQ A;  1N75 A;  1P7J A;  5J1Y A;  1E17 A;  2R92 J;  3NAR A;  1X19 A;  1R5I D;  5LHG A;  4OIQ F;  2R7X A;  4HDU A;  4NDL A;  2QQ9 A;  1BBY A;  3CCU I;  4XSZ F;  3CTA A;  1G3S A;  4BAY A;  1B8I A;  4P5O A;  2X1C A;  1W36 C;  4IHT A;  4Y52 J;  5JFR A;  2STW A;  5KK1 A;  4PJL A;  5F27 A;  3L9F A;  2VJ4 A;  3GUD A;  2HYG D;  1UEL B;  1GVD A;  3BP8 A;  2O3F A;  3ZR8 X;  1TQM A;  2Z2S B;  1LFP A;  1JI8 A;  2VOO A;  1MKM A;  3CP8 A;  5D6E A;  3ERM A;  4OMZ A;  3S3N A;  2JA5 J;  3ZQQ A;  5FRN A;  2NVT J;  2D2W A;  4A2U A;  2LY1 A;  1E3P A;  2EFP A;  1MMN A;  1ZR2 A;  3LA3 A;  1UG2 A;  5M5Y J;  4V2G A;  4M74 A;  1V3F A;  4L9V A;  4ZZD A;  1D8J A;  2E71 A;  2HQA A;  4B3X A;  2Y48 A;  4I0A A;  1FPQ A;  2L9R A;  1MBH A;  3FIW A;  1CF7 A;  2DW4 A;  1BA5 A;  4UVA A;  2GIV A;  5TGT A;  4WXD A;  5IYB J;  2EBI A;  2ELK A;  1MNE A;  3BZ6 A;  3FWE A;  2IT0 A;  3TBI A;  3HG9 A;  4XRS G;  2V26 A;  3GW2 A;  3KEQ A;  4QPO A;  4G7Z F;  4CHU A;  1AOY A;  1P7I A;  3DTE A;  1G3W A;  5J4V A;  2G9W A;  1VND A;  1RC9 A;  1R1U A;  2YX7 A;  4XLC A;  3WE3 A;  2ACJ A;  1A35 A;  1XMX A;  3FMR A;  2A05 A;  1ZGW A;  2EIK H;  2IVM A; 
#chains in the Genus database with same CATH homology
 2JPB A;  3TO7 A;  4PGH A;  2F5E A;  2GQQ A;  3TOB A;  4FX0 A;  4F7Z A;  1ULY A;  1ZRC A;  5D4R A;  1P4A A;  2VT3 A;  4QWQ A;  1PP7 U;  4KN4 X;  2P7C B;  2G7U A;  2VE8 A;  4ZH4 F;  3P9K A;  1U8R A;  2LKP A;  1U6G A;  4LG0 B;  2ELH A;  4A5M A;  2GWR A;  3S2W A;  1IRG A;  3K1N A;  3KP2 A;  1WWX A;  3RYR A;  3M8E A;  1IRF A;  2V1U A;  1TNT A;  2UWM A;  4L9T A;  5EEH A;  4EGZ A;  5D5V B;  1SAX A;  2O8X A;  2WV0 A;  2GA2 A;  3BOQ A;  2JRT A;  4LD5 A;  1O57 A;  1WKM A;  3WU1 B;  6PAX A;  2B0L A;  2GAU A;  2FXA A;  1DPU A;  1GVJ A;  4PCQ A;  1RIO H;  1EH7 A;  3WTZ A;  4I01 A;  1FSH A;  2XAF A;  4P96 A;  3LAP A;  4LLN A;  2DLL A;  4IPA A;  4ENK A;  3HSR A;  3TKY A;  4RGR A;  4ENN A;  5HS9 A;  2X4H A;  3RDI A;  3QU3 A;  3ELK A;  2KIF A;  1P92 A;  1FBS A;  4M9Z A;  3R60 A;  4A0Z A;  2F5C A;  1MGT A;  3ML6 A;  3HTS B;  5HLI A;  2ISY A;  2A69 F;  3J80 Z;  3B02 A;  4UXN A;  3HIF A;  1ZRE A;  1HST A;  1KQ0 A;  1LJ9 A;  4AWX B;  2NNN A;  4N9I A;  1LNW A;  2VBY A;  3TO9 A;  1J5Y A;  2RNJ A;  2VBW A;  4HDV A;  5E8G A;  5BOX A;  2JZY A;  4BHB A;  4G7H F;  3TDU C;  4TV7 A;  5FB2 A;  1ZG3 A;  1U2W A;  1YW8 A;  5D4S A;  4I09 A;  4PGG A;  4KUM A;  3F6V A;  4MEY F;  2ETH A;  2G7H A;  1DPR A;  2XAH A;  5ICG A;  1HKQ A;  4GYI A;  1I1G A;  2Z5U A;  3WG9 A;  1Y0U A;  4JK1 X;  2ESN A;  2FQ3 A;  3RPU A;  4A6D A;  4U0W A;  3D5L A;  3V8K A;  3LA7 A;  3CLO A;  1I1S A;  3IHU A;  3R0A A;  5ICE A;  2NRA C;  4OIP F;  2K4J A;  1ON1 A;  1YYV A;  2HZT A;  3GZ6 A;  1K78 B;  4LK1 F;  3FMS A;  1A04 A;  4B8X A;  5LEJ A;  2D1V A;  3VEP A;  4XSX F;  5HDN A;  4RS8 A;  3KP4 A;  4ZYH A;  2VOD A;  3JTG A;  2WC2 A;  3I0T A;  1LQ1 A;  1G4D A;  2DPU A;  1IN5 A;  4HX4 A;  4L0Y B;  1W5S A;  3SFZ A;  4E70 A;  2YR2 A;  1GXP A;  1FLI A;  3N4M A;  2Q0O A;  4HW0 A;  2A61 A;  1JHH A;  3V8J A;  1T39 A;  1FYK A;  1HW5 A;  1UST A;  5LEK A;  2F5F A;  2XUB A;  2A3S A;  5D8L B;  3HUG A;  3E5U A;  2IA1 A;  1Z6R A;  3BJO A;  1TW3 A;  1EH6 A;  3I54 A;  3WTT C;  3VOE A;  3FXR A;  1ZGJ A;  4CXF A;  3E6C C;  2EA4 A;  3ECO A;  4P9F A;  4HQM A;  1Q1H A;  3RPQ A;  1Z6T A;  4L9N A;  3BWG A;  2P5K A;  1HQC A;  1CF7 B;  2QWW A;  4MTD A;  3RJP A;  1GHC A;  1O3T A;  3E6M A;  4KDP A;  4OIR F;  2P7V B;  1MJA A;  2F2E A;  1ZG5 A;  4EM0 B;  4HBL A;  5LLQ A;  4ESB A;  2H27 A;  4XLN F;  1J2X A;  3P7N A;  1QBJ A;  5E1Z B;  2RGV A;  4MHG A;  1RNL A;  2OU2 A;  3REO A;  1Z1D A;  4ESJ A;  4RB0 A;  1W7P B;  2RC4 A;  5D5X B;  2E7X A;  1EV7 A;  1B59 A;  3M9A A;  1XCB A;  5J8C A;  2BBY A;  4MEX F;  3LFK A;  4G6D A;  3EYY A;  1FBU A;  3VOD A;  2FNP A;  3F21 A;  4I2O A;  4RGU A;  3V7R A;  1B1B A;  2HGC A;  1MDM B;  4LK0 F;  3EUH A;  2OAZ A;  1KU3 A;  5HLH A;  2QQA A;  4GO1 A;  1SMY F;  2AXL A;  2CGP A;  4A6E A;  2A68 F;  1REP C;  3WOD F;  2K86 A;  1I6X A;  4G94 A;  1S6L A;  4CGZ A;  1J0R A;  5FFZ A;  2D1H A;  2DU9 A;  1ODD A;  1Z91 A;  2P5V A;  1D3Y A;  2NS0 A;  4YIF A;  1Z05 A;  1RI7 A;  4RB1 A;  3ERE D;  2OA4 A;  3CJN A;  4LJZ F;  5F64 A;  4A0Y A;  4JBA A;  3QPH A;  3MZH A;  1MJ9 A;  2PFB A;  4G7O F;  2ZBK A;  2CSO A;  1F1Z A;  3SZT A;  4KN7 X;  1JXS A;  1RUO A;  2ZCW A;  3K1M A;  4KFC A;  3CUQ C;  1BC8 C;  2YSR A;  3RTR A;  3ZPL A;  4AIJ A;  2QEN A;  3BJ6 A;  4L5J A;  2Q8K A;  3IRR A;  4WK8 F;  1P6R A;  4UVC A;  4DQ2 A;  3WGG A;  2QQB A;  3LAJ A;  2EA2 A;  2EV5 A;  1BI0 A;  3T8T A;  5FD6 A;  2V1X A;  4HV6 A;  4O3M A;  2L3D A;  1QZZ A;  4ASN A;  1OYY A;  2CO5 A;  5L3F A;  4S04 A;  4BHC A;  4L0Z B;  1KGS A;  4GGG A;  4MNU A;  1V4R A;  2QM3 A;  3HRU A;  5FLX K;  4NQW A;  2ZO4 A;  3C7J A;  3KZY A;  4EJW A;  3B73 A;  3KP5 A;  3GEZ A;  5ERI A;  3L09 A;  1T2K A;  2D45 A;  3I53 A;  4YG2 F;  4OIN F;  1FBQ A;  1YIO A;  2J5P A;  2W24 A;  2IP2 A;  1STZ A;  2RKH A;  1ZHF A;  4HX8 A;  4ZYG A;  2HS5 A;  3F22 A;  3CUQ A;  3F8N A;  4K2E A;  3P9C A;  3VB2 A;  4L5I A;  3WGH A;  3U2R A;  1CGP A;  4KT5 C;  3F8M A;  3VFZ A;  2CWE A;  5D8K B;  2V1D A;  2E1C A;  2IW5 A;  2P6S A;  1JGS A;  5LHI A;  4PDK A;  4M9S A;  2QYO A;  4GCV A;  1TQI A;  5DYM A;  5CVU A;  1TTY A;  3MCZ A;  4IXA A;  4KNY A;  1TNS A;  3ZN1 A;  3I64 A;  4I98 B;  1IF1 A;  2PLY A;  5D5U B;  2KJC A;  2NYX A;  2HEO A;  2MH2 A;  2DBB A;  3F3X A;  3GZ5 A;  1TBX A;  5D5W B;  1IXC A;  5F1R A;  3F8B A;  4Y15 A;  4Y17 A;  1IZ1 A;  1IXR C;  3MWM A;  2P4W A;  4KMU X;  2YX4 A;  1LDD A;  3QU6 A;  4KIG A;  2HR3 A;  1W7P A;  3FM5 A;  5ILV A;  2Y75 A;  1BI2 A;  2GA1 A;  1UHW A;  5LBQ A;  1KU2 A;  1ZN2 A;  1HKS A;  1BI3 A;  2ZXJ A;  1IXS B;  1UHM A;  4H0E A;  2ZME A;  1MDM A;  3F23 A;  4B09 A;  3BJA A;  5L3E A;  1G3Y A;  1J7K A;  4IHS A;  4L9J A;  1XGN A;  1IUY A;  4ESF A;  1FNN A;  4ZZL A;  2JT1 A;  1XD7 A;  2ZNZ A;  1P4X A;  2VOP A;  1G6N A;  5FD5 A;  5KVR A;  2QVO A;  1R5H A;  4BYY A;  1O3R A;  3ROU A;  2VC0 A;  2O61 A;  2XGX A;  2A6H F;  1IN4 A;  3RI4 A;  4AIH A;  3JAM K;  4NHJ A;  3GYH X;  1K79 A;  4Q47 A;  2DAO A;  4M73 A;  2XAQ A;  3DPT A;  1U78 A;  1U5T B;  4HF0 A;  3N97 A;  2R7F A;  3FZV A;  1DP7 P;  4EV0 A;  4DNC A;  3WTW C;  2OZU A;  3P9I A;  1IW7 F;  3JAM Z;  2XAS A;  2ZNY A;  3JTH A;  1YQA A;  1HBX G;  2ZKZ A;  3ZN0 A;  3RKW A;  2W85 A;  1PUE E;  2STT A;  1SFE A;  2O0Y A;  1LDK B;  2VT2 A;  3M7G A;  2PI0 A;  1U3E M;  2IJL A;  1O3S A;  4Y13 A;  2O03 A;  1IN8 A;  1XB4 A;  3DEU A;  1XMK A;  2XAG A;  4IJA A;  1YS6 A;  5AIQ A;  3G73 A;  2VON A;  2CG4 A;  4LFU A;  1TQP A;  3BDD A;  4M72 A;  3IKT A;  4I02 A;  1B9N A;  2PQ8 A;  3C18 A;  4HQE A;  4AVP A;  3DKW A;  4A5N A;  3KET A;  2DI3 A;  3D0S A;  5K5O A;  1OMI A;  1R5G A;  2LDU A;  5HS8 A;  4HF1 A;  3AAF A;  4M71 A;  2M1B A;  3PQK A;  2GXB A;  3J80 K;  4WWC A;  2J5O A;  1XDS A;  1LEB A;  4U88 A;  2IRF G;  4FT8 A;  4RAZ A;  4FHT A;  3J81 K;  3ZMS A;  1MZB A;  5JR3 A;  3U1D A;  2DTR A;  4O5V A;  2BE5 F;  4MTE A;  3ZMD A;  3GFL A;  3CO6 C;  3COA C;  2DFI A;  2QZ8 A;  1NHA A;  4UV8 A;  3NQO A;  2XRO A;  4UV9 A;  1IN7 A;  3F8F A;  3WTY C;  2XVC A;  3BPX A;  3LA2 A;  1S8N A;  4ON0 A;  4HOB A;  1U5T A;  1E2X A;  5ILS A;  1P2F A;  1ZAO A;  2FBK A;  4WF2 A;  2VBZ A;  3TOA A;  1H9G A;  1KQ9 A;  1QO0 D;  2MD5 A;  1R36 A;  2L4A A;  3IWF A;  1HXD A;  4BH9 A;  3QOP A;  2HQR A;  2ZJ2 A;  2KRF A;  1YO5 C;  4P55 A;  5JI6 A;  2PN6 A;  3K1P A;  1QPM A;  4EMS A;  5FGM A;  1KU9 A;  5HDG A;  1B9M A;  4BHP A;  4ETS A;  3K9T A;  3MAJ A;  1YW7 A;  1ON2 A;  2FSW A;  4QLC U;  3V4G A;  5TJJ A;  4IVN A;  3LWF A;  1OYI A;  3GVA A;  4RAY A;  4GYG A;  1L3L A;  4LMY A;  2FML A;  2W25 A;  4LB6 B;  1WQ2 A;  2VC1 A;  3HOT A;  3M1E A;  3ZMV A;  2A07 F;  2PEX A;  2P8T A;  1O7F A;  1U5T C;  3HSF A;  3QPT A;  5HS7 A;  3IWZ A;  3NEU A;  5E1X A;  3M8F A;  2H6B A;  2K7L A;  2MLG A;  4P9U A;  2L01 A;  3K0L A;  5E8I A;  1YLF A;  4KIB A;  1TLH B;  1K7A A;  2COM A;  2M30 A;  4U7B A;  1R23 A;  3R61 A;  4U0V A;  4EM1 A;  1GXQ A;  3PQJ A;  2NAZ A;  1DDN A;  3BRO A;  1B4A A;  1X3U A;  2EB7 A;  2FE3 A;  3FF5 A;  2QLZ A;  4LG0 A;  1FYM A;  4UNO A;  5DCM A;  2HTS A;  2ISZ A;  4CO8 A;  2DK5 A;  3J81 Z;  3EQL F;  4KMF A;  1ZAR A;  4HLY A;  5FFX A;  5LGU A;  4CIC A;  5ICC A;  4Z2Y A;  1JE8 A;  4A0X A;  4KIC A;  5IT3 A;  3ZMT A;  5F6F A;  2UZK A;  5IT9 Z;  1KYZ A;  2XHK A;  1S3J A;  1I5Z A;  2FNA A;  5CVJ A;  1SD6 A;  1W4M A;  3I58 A;  3SZP A;  1W5T A;  2HFH A;  4HA8 A;  5DV5 A;  3W6K B;  2WTE A;  1YS7 A;  2H09 A;  2K27 A;  3KLO A;  3HOS A;  3HYI A;  1USS A;  3KP3 A;  1IN6 A;  1RUN A;  3DQV C;  2EV6 A;  1J59 A;  3GWZ A;  1O7L A;  2FA5 A;  5DD4 A;  1FX7 A;  1UB9 A;  1D8K A;  3GFJ A;  5CVI A;  3DF8 A;  3CUQ B;  2K02 A;  5E20 A;  5LRS A;  1C0W A;  5DUK A;  3KCC A;  3LST A;  4I0B A;  1XGO A;  4U0Y A;  3HSE A;  4M9X A;  3JSO A;  1XSD A;  3HHH A;  3ZMU A;  1UFM A;  4XLP F;  3GFI A;  3HRT A;  3QP6 A;  2BV6 A;  1OYW A;  1T38 A;  4UUV A;  1S29 A;  4IRH A;  1F4K A;  3Q9S A;  2Y0M A;  1QNT A;  2EFW A;  4YII A;  2IA2 A;  1ZRF A;  2KKO A;  1LEA A;  3SXY A;  1SFU A;  5A2Q Z;  3I5U A;  3DPL C;  4FX4 A;  3IKV A;  1FY7 A;  5BMZ A;  1R00 A;  2KIM A;  3I59 B;  2FMY A;  5JHU A;  2JTV A;  1SFX A;  2TDX A;  2A6E F;  4AD9 A;  3T8R A;  2MC3 A;  1ONV A;  2BGC A;  3WE2 A;  1I27 A;  3O6B B;  2A5Y B;  2VE9 A;  5TRD A;  4NB5 A;  1UCR A;  4HZF A;  3W6J B;  4IRI A;  2HKO A;  3EYI A;  3WU0 A;  3F72 A;  4HAM A;  4WCG A;  1F5T A;  2QBY A;  1HSJ A;  4O6J A;  3T1B A;  1ZYR F;  2CW0 F;  3HTU A;  1LVA A;  1WI9 A;  4WX9 A;  2ESH A;  1R1V A;  1O3Q A;  2OQG A;  1BIB A;  3WGI A;  4LLL A;  5CJ9 A;  5H6Q A;  5HDK A;  1Z7U A;  3ULQ B;  4EJU A;  5E1W A;  5H20 A;  5L3B A;  5HLG A;  2AS5 F;  3J7A O;  2M5W A;  3ABU A;  3R4K A;  3JW4 A;  2UXN A;  2LF8 A;  2M8E A;  4R1H A;  4XRF A;  1KQ8 A;  3GO5 A;  2H6C A;  4LLG F;  3DP7 A;  4RGX A;  4WXH A;  5K5Q A;  3WTX C;  2KJB A;  5FO5 A;  3QRF F;  4HLX A;  3MEX A;  4I7H A;  1BIA A;  5L3D A;  1XMA A;  2DQL A;  2K4B A;  2LSO A;  1B6A A;  4BNC A;  3C3W A;  1H0M A;  2GXG A;  3EET A;  3ABT A;  2VXZ A;  3O2P E;  1J9I A;  4EJO A;  5LGT A;  2RQP A;  2RDP A;  2RN7 A;  3WTS C;  1K78 A;  4KYW A;  1PDN C;  3E3V A;  4UVB A;  1QZY A;  3FXU A;  1J75 A;  2YPR A;  3F6O A;  2FEZ A;  2CQK A;  2FBH A;  1K6O A;  2QUF A;  3TQN A;  4Q5S F;  3E97 A;  1RZ4 A;  2E7W A;  4RGS A;  2W57 A;  3I59 A;  4LB5 A;  2R3S A;  1SMT A;  3FXQ A;  3G3Z A;  5DCM B;  3RYP A;  3RKX A;  2L4M A;  2LNB A;  2BEO A;  1PP8 F;  1BM9 A;  2Z3Y A;  1KU7 A;  2FBI A;  5AIP A;  5FLX Z;  3KP7 A;  2XKO A;  3GLX A;  2WWY A;  1SD4 A;  2GZW A;  4L18 B;  3CUO A;  3R6S A;  1FC3 A;  4M6X A;  1H9T A;  1BI1 A;  2HOE A;  5E17 F;  3PFI A;  3MFK A;  1T0F A;  2Q2E A;  4EM2 A;  1ZLJ A;  2OQR A;  1OR7 A;  3QAH A;  3BY6 A;  2EFO A;  5L3C A;  5BQT A;  2EJR A;  5EEG A;  1ZG1 A;  3L00 A;  1T98 A;  5HOO A;  4BQA A;  4KA4 A;  4HYE A;  3GFM A;  3KE2 A;  3FHZ A;  1QGP A;  4RB3 C;  2Z33 A;  3IRQ A;  2OZ6 A;  3HRM A;  3GXO A;  1JHF A;  5BPI A;  4YFK F;  1XN7 A;  1FP1 D;  2L02 A;  2UXX A;  5ILU A;  2RV8 A;  1WRJ A;  1SD7 A;  5LRR A;  1BJA A;  3IC7 A;  1XGM A;  2RVC A;  2EFQ A;  3FX3 A;  5K5R A;  2PMH A;  2KIU A;  1ZRD A;  2HKX A;  2XV4 S;  1HW2 A;  3E5Q A;  3TO6 A;  1LB2 A;  4HV5 A;  1G3T A;  4IF4 A;  2P6T A;  4HX7 A;  2EFN A;  2VBX A;  2FF4 A;  1SD5 A;  3ZQ7 A;  3HRS A;  5J6X A;  1FZP B;  4OMY A;  5A2Q K;  3O3K A;  1R7J A;  3H3Z A;  1YG2 A;  2HYF A;  2MA3 A;  4XBF A;  3K69 A;  4OOI A;  2Z9O A;  4CZZ A;  4MGR A;  3I4P A;  2PG4 A;  2EK5 A;  4GXO A;  1HKT A;  2JSC A;  1VTN C;  5DEQ A;  1FYL A;  2DPD A;  4G6Q A;  2QBY B;  2ZFW A;  3V7C A;  3Q9V A;  3NRV A;  3BPV A;  5DD8 A;  3U9G A;  1BOA A;  4UHT A;  1OPC A;  2IPQ X;  1Z9C A;  5CVV A;  3LQR A;  1ZLK A;  3FMQ A;  3TGN A;  2XRN A;  1FWZ A;  4BXU A;  4U7D A;  4WXC A;  5HVQ C;  4S05 A;  1BN5 A;  5CYV A;  3KEO A;  3CDH A;  4YFX F;  5ED4 A;  1WSU A;  2JPC A;  2ADU A;  2PJP A;  4PZJ A;  1YFH A;  1D5V A;  2R7D A;  4R8H A;  2FOK A;  1S7A A;  3E6D A;  4ZYE A;  5LHH A;  2OBP A;  5IT9 K;  3F8C A;  3FM3 A;  4R79 A;  2NNY A;  1BC7 C;  5BPD A;  1ZGA A;  3RKY A;  2O6G E;  2OD5 A;  3HHG A;  2PMU A;  2C6Y A;  4OU0 A;  2V79 A;  4CDG A;  3SQN A;  1MD0 A;  4D0P A;  4A12 A;  1R58 A;  1HW1 A;  3L2C A;  2FU4 A;  5AON A;  1XGS A;  3ZMZ A;  1MJB A;  1XSV A;  3K2Z A;  2MLK A;  1T6S A;  3H92 A;  3ISP A;  3CO7 C;  1YW9 A;  3DFG A;  2EV0 A;  4RB2 C;  3GX4 X;  2P5L C;  5BS6 A;  4OIO F;  1W7P D;  1DUX C;  2HWV A;  3LQQ A;  4EGY A;  2DQR A;  3KZZ A;  3WTV C;  2M87 A;  2ZME B;  3OV8 A;  4G9Y A;  4MQ9 F;  4CYD A;  2F5D A;  1ZH5 A;  5DCF A;  2V6C A;  4EJT A;  3ECH A;  3SHF A;  2CYY A;  2LF7 A;  3V8L A;  3I71 A;  3T5X A;  4M6Y A;  2CFX A;  3H3U A;  2L54 A;  2VN2 A;  3QP5 A;  4KIF A;  1F9N A;  2PBI A;  2Z99 A;  5E18 F;  2E1N A;  1IAW A;  1S7O A;  1AWC A;  4N9H A;  2HQN A;  4IRG A;  2IA0 A;  2YU3 A;  3EDP A;  5ICF A;  1FP2 A;  5DUI A;  2W84 A;  2XAJ A;  4N0B A;  3OOP A;  3IL2 A;  4EVI A;  5L3G A;  2MH9 A;  1TW2 A;  5H6R A;  2FRH A;  5D6F A;  1XCV A;  3TDZ C;  1FSE A;  5CLS A;  2HDC A;  3MZY A;  4ENJ A;  5K1Y A;  2EWN A;  3C1D A;  3Q5F A;  4Q48 A;  3MQ0 A;  2DT5 A;  4LGW A;  4YFN F;  2DK8 A;  4MQV A;  1XDU A;  3ZP5 A;  1QQI A;  2BYV E;  1OKR A;  3V7S A;  4G8X A;  5DDG A;  5J8F A;  1XSX A;  2X0L A;  4HF2 A;  3T0Y A;  5LGN A;  3DXJ F;  4EJV A;  4ZYD A;  1YTY A;  4ENM A;  2H94 A;  3KFW X;  3KP6 A;  5CVR A;  4Q4Z F;  3DV8 A;  3KLN A;  3L7W A;  3WTU C;  1P4W A;  1R22 A;  5JVT A;  1KYW A;  2DO7 A;  1LDJ A;  4JQF A;  3RIR A;  3E6B A;  2M45 A;  3E5X A;  3GF2 A;  1FT9 A;  2V9V A;  2XIG A;  1FOK A;  3R0J A;  2XKP A;  4AIK A;  2HTJ A;  3JSP A;  1L0O C;  2MBF A;  1EH8 A;  1R1T A;  1KA8 A;  4EQQ A;  1E17 A;  5LHG A;  4OIQ F;  4HDU A;  2QQ9 A;  1BBY A;  4XSZ F;  3CTA A;  1G3S A;  4BAY A;  4P5O A;  4IHT A;  5JFR A;  2STW A;  5KK1 A;  3L9F A;  3GUD A;  2HYG D;  3BP8 A;  2O3F A;  1TQM A;  2VOO A;  1MKM A;  5D6E A;  4OMZ A;  2D2W A;  4A2U A;  2EFP A;  3LA3 A;  4M74 A;  1V3F A;  4L9V A;  4ZZD A;  1D8J A;  2Y48 A;  4I0A A;  1FPQ A;  1CF7 A;  2DW4 A;  4UVA A;  2GIV A;  4WXD A;  3BZ6 A;  3FWE A;  2IT0 A;  4G7Z F;  4CHU A;  3GW2 A;  3KEQ A;  1AOY A;  1G3W A;  2G9W A;  1R1U A;  2YX7 A;  2ACJ A;  3WE3 A;  3FMR A;  2IVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...