1JE8A

Two-component response regulator narl/dna complex: dna bending found in a high affinity site
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*AP*TP*TP*AP*AP*TP*GP*GP*GP*TP*AP*
publication title Dimerization allows DNA target site recognition by the NarL response regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 21
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1je8A00
2AS5F 6PAXA 5E18F 1KYZA 1F5TA 1Z05A 2EFNA 4Q4ZF 3JAMZ 5BOXA 1R00A 3WODF 4A0ZA 2H09A 4M9ZA 4PCQA 4RB3C 4HLXA 1OMIA 4AIJA 5HLGA 3FWEA 3KP5A 5HS8A 2OD5A 4EMSA 1YFHA 1W5SA 1Z6RA 3V8KA 2FQ3A 1P6RA 2STWA 2UZKA 4G6QA 1AWCA 3K69A 4N0BA 3LAJA 2ISYA 1L0OC 1QPMA 2W84A 4XSXF 3ERED 3V8LA 4H0EA 3KP6A 2KIFA 3RKWA 2HGCA 5BPIA 3LA3A 3MAJA 1K78B 3GFIA 3EETA 5LRRA 3P7NA 2O0YA 4XSZF 1QGPA 1FBUA 1R1TA 3DEUA 5FLXZ 2QYOA 1FSHA 4MQVA 1EH7A 3R60A 2F2EA 3I71A 2G7HA 1YQAA 2DI3A 3I4PA 1L3LA 3O3KA 5E17F 1QZYA 2BBYA 4N9IA 5FD5A 2H6CA 2F5CA 4HQMA 4HV5A 4MEYF 3TOBA 3K2ZA 4CYDA 2V6CA 4IRGA 3U2RA 1F4KA 4BHPA 4P96A 3KEOA 4KIFA 3L00A 1K78A 3FM5A 2V1UA 1LEBA 2RKHA 4FX4A 2VOOA 1XCBA 2D45A 4IRHA 2ZNZA 5CVIA 1BM9A 1S7OA 5TRDA 1T98A 3HUGA 1J75A 1RI7A 5KK1A 1LJ9A 1BC7C 5LGTA 2P7VB 2E7WA 2JRTA 2XAGA 3BPXA 3K1PA 4CZZA 2Y75A 2VBWA 2M8EA 3IL2A 5IT3A 2ESNA 4EGYA 3D5LA 3EQLF 2XUBA 4MHGA 3V7SA 3GVAA 3CLOA 3E5XA 4M9SA 1IW7F 1XGMA 3EDPA 2OQRA 5CLSA 3CUQC 2D1HA 3HSFA 1OPCA 1KQ0A 1SMTA 2K7LA 3ELKA 2MH9A 1W7PD 3JTGA 3LA2A 4EM0B 1I6XA 3CUQB 2VODA 1YLFA 3GWZA 3IKTA 4EM1A 4WXDA 3F8FA 5FD6A 2V1XA 1IAWA 2ISZA 1KU2A 5EEHA 4MGRA 3RPUA 2NRAC 5TJJA 2ZKZA 2XVCA 3T5XA 2R3SA 3ZMVA 2FEZA 1HKQA 3MZYA 2LNBA 2GIVA 2P6SA 4BXUA 5LEKA 3SZTA 2Z5UA 4OMZA 1U8RA 1HKSA 5HDGA 4U88A 3GEZA 4GO1A 4KDPA 4AD9A 3W6KB 3E5UA 4RGXA 2V9VA 3K1MA 1SD7A 1R22A 2XAJA 4A12A 2MLKA 4EGZA 3IWZA 3CUQA 1D8JA 3QU6A 3G73A 1FT9A 1ZREA 3N97A 3RTRA 1KQ9A 4M9XA 3MEXA 3NRVA 2ADUA 5HS7A 4IRIA 2PN6A 1DPRA 3GUDA 2HTJA 3MZHA 4A2UA 3F23A 2LF8A 1OYWA 3J81K 5FGMA 4LG0B 2A68F 5D5VB 2C6YA 4UV8A 1HW1A 3VB2A 5H6QA 3O6BB 2L3DA 1GXQA 2H94A 3KE2A 4LB6B 2NNYA 2CYYA 2WWYA 1LNWA 4HBLA 4M6XA 3DXJF 1MKMA 4HOBA 1I5ZA 4HZFA 4GCVA 3F8NA 2ZFWA 1XGOA 1USTA 2WC2A 3HYIA 4WF2A 5CJ9A 2PMHA 5LRSA 4M6YA 4RS8A 2KIUA 4I7HA 5L3EA 4YFKF 3J7AO 2FE3A 4LG0A 1F9NA 2CQKA 4BAYA 4CDGA 1STZA 5L3CA 1S7AA 3E6CC 2G9WA 2A6HF 3LSTA 2NNNA 3WTWC 3R4KA 4WWCA 2H6BA 1REPC 1XB4A 3N4MA 3D0SA 2VE8A 1K6OA 3RYPA 4KA4A 2FMLA 1CF7B 2F5EA 3HRMA 3C3WA 3WG9A 3H92A 2VBZA 3HIFA 4HX4A 4LK0F 2QQBA 3KFWX 1XN7A 5D4SA 1BJAA 1B9NA 1EV7A 1AOYA 5HDKA 3QOPA 1XDUA 2IA1A 2CSOA 2ETHA 2D1VA 4E70A 5LHIA 1TLHB 2ZNYA 3RKYA 4MQ9F 3VOEA 1XGSA 4ZYHA 4HDVA 3TDUC 4P5OA 2QLZA 2RNJA 3Q9VA 1IZ1A 2P7CB 3TO9A 4FT8A 3CTAA 1R1VA 3KEQA 1C0WA 2Z33A 2JT1A 3F8CA 3GYHX 5F6FA 4OOIA 1U5TA 4G8XA 4AWXB 1WRJA 4B09A 4MNUA 3M7GA 2QQ9A 1LQ1A 5JHUA 4RB1A 4ASNA 2W57A 4HYEA 3RI4A 4QWQA 1TW3A 1ZGJA 4GXOA 3FX3A 2W24A 1LDJA 3QP5A 1OYYA 4PZJA 1J9IA 3B73A 5LHHA 1JGSA 1ON2A 3U9GA 3ABTA 4DQ2A 3ZN1A 4I09A 1ZLJA 3T1BA 5AONA 1ULYA 3K0LA 2VONA 3FMSA 3KP4A 1YS6A 2HR3A 4JBAA 3T0YA 3MWMA 2RV8A 4FHTA 1TQIA 3CJNA 4RGSA 3GZ5A 3VFZA 1HBXG 1G6NA 3M1EA 2BV6A 1R36A 1XGNA 5E8IA 3V7RA 4ETSA 1TNTA 2KKOA 2KJCA 1S8NA 3EUHA 1K79A 5ICEA 1ZG1A 1FBSA 1B6AA 2FXAA 2DBBA 1ZRDA 2CO5A 1B1BA 3RDIA 1J0RA 1H0MA 2YX7A 4KT5C 4A6EA 4ZZDA 4ZH4F 2Z99A 2Z9OA 1QQIA 4ZYEA 3SZPA 1R23A 3PQKA 2QM3A 3GFJA 5D6FA 2EFOA 1ZGAA 4O3MA 3K1NA 2K27A 4KMFA 3HSEA 2ACJA 1T39A 5LBQA 2OAZA 5K5RA 5K1YA 4Y17A 1MD0A 2P6TA 1O3SA 3KLNA 4UHTA 2HKOA 3CO7C 2MD5A 4ESFA 4RAYA 1YS7A 3CO6C 3WU1B 4RB2C 3F21A 4EV0A 3P9KA 2JPCA 1G3WA 4Q48A 1SFUA 2A3SA 3TO7A 2RQPA 3QRFF 4PGGA 1ZH5A 3ZPLA 1FYMA 1OR7A 4OIRF 2E1CA 2P5KA 5E1ZB 1FX7A 1ZLKA 2UXNA 3KP2A 4HF0A 2XKOA 5D4RA 2XAQA 1HSTA 1V3FA 1QZZA 4R8HA 4ESBA 1TTYA 3M8FA 1G3YA 1T0FA 3I5UA 4OU0A 4KUMA 5DD8A 1MGTA 5BMZA 4LK1F 4ZYGA 3PQJA 2DT5A 3GFLA 2FNAA 2Q2EA 1WWXA 4A5NA 4GYGA 1T38A 2O6GE 5HLIA 4EQQA 1XSVA 1SFEA 3I54A 1LDKB 3IHUA 5L3BA 2FA5A 1IRFA 2LKPA 4HA8A 1S6LA 4BHCA 2VBYA 1IXSB 1QNTA 3WE3A 2QBYB 3JTHA 4WK8F 1FC3A 2HQNA 1KU7A 2JTVA 4CICA 1EH8A 3P9CA 4WXHA 1ZYRF 1BI3A 2EV0A 1SFXA 2RN7A 2FOKA 2P8TA 5KVRA 5D8KB 5ICGA 1LEAA 1QO0D 2AXLA 4OMYA 3IC7A 2QUFA 4FX0A 1ODDA 2VBXA 1FZPB 3FHZA 3ML6A 2L4AA 1P92A 4OINF 1J59A 4I01A 2A5YB 4BQAA 3V7CA 4EJWA 3HTUA 4IJAA 2EA4A 3HOSA 4UXNA 2YPRA 2GXBA 4HDUA 1O3QA 5AIQA 5J6XA 1OKRA 4PGHA 1H9GA 2HOEA 2QBYA 3JSPA 1P4WA 1KA8A 2R7FA 2CWEA 2DO7A 2IPQX 4BHBA 1FWZA 1T6SA 4MTDA 2IT0A 1Z9CA 3BJ6A 2FSWA 2DPUA 1FLIA 3O2PE 1DP7P 3DF8A 1PDNC 4L0YB 1TW2A 1D8KA 2GQQA 2M87A 4N9HA 2ESHA 3GLXA 2DLLA 2GWRA 5DYMA 5JFRA 2IW5A 3ZQ7A 4CHUA 4NHJA 2GA1A 2KJBA 5D5UB 1IRGA 5EEGA 2HEOA 3QPHA 1RNLA 4KN7X 1ON1A 1D5VA 2GA2A 1V4RA 4HQEA 4BYYA 2MC3A 3DV8A 1HKTA 3HRUA 1FP2A 2FU4A 3IKVA 5HOOA 2O3FA 2EFPA 4P9UA 2XRNA 2VC0A 3WE2A 3QP6A 2ZBKA 2BE5F 2BGCA 2MLGA 1S3JA 3F8MA 2DW4A 4L9JA 3E6MA 3COAC 4ZZLA 4I0BA 2XAHA 3FMQA 3ECHA 3RIRA 1O7FA 2NS0A 2M30A 2V79A 3SHFA 1ONVA 1ZHFA 2HZTA 4TV7A 1R1UA 1E2XA 3HTSB 3HOTA 4RB0A 1Z1DA 4D0PA 5BS6A 5LGNA 2B0LA 2HKXA 5A2QK 5ERIA 1I1SA 4UVAA 1U78A 2GZWA 1IXCA 4A5MA 3J80K 1U5TC 2G7UA 1HW5A 2HYGD 5LLQA 2QQAA 4ZYDA 1R5GA 5HVQC 1FYKA 4EJVA 3LAPA 1LDDA 2XIGA 1HW2A 1GVJA 4ON0A 2LSOA 3SXYA 1YW8A 3LA7A 3MCZA 1KU9A 1RUNA 1U5TB 3E5QA 3GO5A 2A69F 4U0VA 2EV5A 5L3FA 3F6VA 5LHGA 1UFMA 4Q5SF 3KCCA 3E6BA 3ZMUA 4OIPF 2R7DA 4DNCA 2HWVA 3I53A 4M73A 1VTNC 3VEPA 4QLCU 1Z7UA 2BEOA 2PMUA 3J81Z 1KQ8A 4I02A 2RGVA 2VE9A 1A04A 4LLGF 2DK8A 2DTRA 2O61A 2D2WA 4ESJA 2EA2A 2NYXA 3WU0A 2KIMA 3BOQA 1BIAA 5K5QA 4KNYA 3LQQA 1YG2A 1IN8A 4BH9A 3M9AA 1MJ9A 1TQPA 2YX4A 3R0JA 3CUOA 4XBFA 4AIHA 4I0AA 5CVUA 3C7JA 2NAZA 1FY7A 3HHGA 3JAMK 3FZVA 2M45A 2DU9A 2E1NA 1J5YA 3HRSA 1U2WA 2ZXJA 5ILUA 3LFKA 4G7OF 5L3DA 2OZUA 1Z91A 2EB7A 4UVCA 4LMYA 3NEUA 2A6EF 1W4MA 5AIPA 5A2QZ 3OOPA 3H3ZA 4G9YA 2FMYA 3KLOA 4KICA 4G94A 2P4WA 3E6DA 1IN5A 4RGRA 2X4HA 3JW4A 2JZYA 2DK5A 1P4AA 2VC1A 3M8EA 2DAOA 5JVTA 2ELHA 2OZ6A 4YG2F 1GXPA 4HAMA 5J8CA 1D3YA 3G3ZA 4S04A 1QBJA 4LD5A 3IRQA 2QWWA 2LDUA 2PJPA 1MJBA 4B8XA 2Q0OA 4G7HF 3TQNA 4RGUA 1SD4A 2XKPA 2VT2A 4LLLA 4LJZF 3ULQB 1YTYA 2FRHA 5CVJA 1XDSA 2HTSA 2A61A 5JR3A 1P4XA 2FBKA 3CDHA 1BIBA 2RDPA 3BPVA 1YIOA 2JSCA 4GGGA 3BP8A 3ZP5A 1TNSA 2OBPA 3HRTA 2K4BA 3RKXA 2K02A 3V8JA 1W7PA 4I98B 1ZG3A 5E1XA 4YIFA 4L18B 1Z6TA 1T2KA 2CGPA 3L2CA 1G3SA 2JPBA 4ENJA 1J2XA 1JXSA 5JI6A 2EK5A 1U3EM 5H6RA 4ENMA 3BY6A 2EWNA 4HLYA 4IPAA 3WTZA 2YSRA 3C1DA 4WX9A 3ECOA 1MDMB 2P5VA 5ILVA 4U7BA 5ILSA 2V1DA 4Z2YA 2YU3A 1OYIA 3L9FA 2DQLA 3IRRA 4WCGA 1WQ2A 2YR2A 3AAFA 2XHKA 3WTYC 2PFBA 5CVRA 3JSOA 4R1HA 2L54A 4KYWA 1IUYA 2CW0F 2BYVE 3IWFA 5D6EA 1WI9A 3E3VA 3HHHA 1ZARA 3KZYA 3GW2A 2FBIA 2P5LC 5E8GA 4IHTA 3F3XA 1F1ZA 3TKYA 3KETA 5DCMB 1RIOH 1MDMA 2FNPA 5E20A 1O3TA 4EJTA 1BBYA 3Q5FA 2QZ8A 2FBHA 4ENNA 1KU3A 3F6OA 1SMYF 4XLPF 1ZRCA 3K9TA 1PP7U 4L9NA 1YO5C 1USSA 2Y0MA 1DPUA 4KN4X 1NHAA 3ABUA 5DUIA 1IXRC 2XASA 4PDKA 1B4AA 2VT3A 2PI0A 3WTTC 1XSDA 4EM2A 5BQTA 4NB5A 3F72A 4HF2A 3WGHA 2L4MA 2E7XA 4Y15A 1JHHA 5F1RA 5DCMA 3BJOA 4G6DA 5J8FA 4YFXF 3ROUA 4F7ZA 1J7KA 2L02A 2PBIA 3VODA 1TQMA 3QPTA 1RZ4A 3BZ6A 3KP3A 2O03A 5ICCA 2OQGA 2J5OA 2XV4S 2MH2A 4M74A 5K5OA 4M71A 3REOA 1BI2A 4M72A 2W85A 2PEXA 2VN2A 3KP7A 2CFXA 1EH6A 5D8LB 2UXXA 3FXQA 5DEQA 2K86A 4I2OA 1O7LA 1HXDA 3S2WA 3RYRA 2H27A 5FFZA 1S29A 4UV9A 4EJOA 1DUXC 4A6DA 3ISPA 4OIQF 2HFHA 4HF1A 1ZAOA 2DQRA 3WTUC 3C18A 2PQ8A 1BC8C 3WGGA 3I0TA 1B59A 2HQRA 3WTVC 5CVVA 3TO6A 4NQWA 1PUEE 3H3UA 5DCFA 4A0XA 4CO8A 1U6GA 3GXOA 3R6SA 2IA2A 5FFXA 2Q8KA 2K4JA 4EJUA 1IN6A 2ZO4A 4KIBA 3GF2A 1LB2A 1YW7A 2GXGA 5L3GA 1IN4A 2X0LA 2LF7A 1TBXA 3E97A 1IN7A 2IVMA 4YIIA 1UHWA 2XAFA 3ZMSA 1G4DA 2UWMA 1GHCA 2ZCWA 5LGUA 1FSEA 2M1BA 1DDNA 1G3TA 5DV5A 3ZMDA 3EYIA 3MQ0A 3TDZC 3BJAA 1FP1D 5DD4A 4K2EA 2WV0A 2QVOA 3LQRA 2W25A 5CYVA 2HS5A 3NQOA 2PLYA 1FOKA 1JHFA 4CGZA 3OV8A 3RPQA 2J5PA 1LVAA 4Q47A 2EJRA 1X3UA 1XSXA 2IA0A 1JE8A 4KFCA 3KZZA 1UB9A 1E17A 4R79A 1HSJA 2EFQA 1O3RA 5DUKA 4KIGA 3T8RA 1WSUA 4HX8A 4OIOF 4UVBA 4EVIA 4RAZA 3V4GA 1UCRA 3WTSC 3R61A 3L7WA 2MA3A 1BOAA 4XLNF 3DP7A 3ZMZA 5D5XB 1I1GA 4LFUA 2Y48A 4A0YA 1K7AA 1KYWA 3GX4X 2ZJ2A 5ICFA 1CGPA 5DDGA 2GAUA 3F8BA 2VOPA 5HDNA 3FF5A 3WTXC 1UHMA 2IJLA 4MEXF 4XRFA 5IT9K 4IXAA 1HQCA 4L5JA 3W6JB 1FBQA 5FB2A 3BROA 4GYIA 3T8TA 3FM3A 3F22A 3DPTA 1BN5A 1ZG5A 2HDCA 4ENKA 3GFMA 2DPDA 4HX7A 4U0WA 2HYFA 1ZN2A 1R7JA 1B9MA 2XGXA 2VXZA 1O57A 2FF4A 2ZMEB 3TOAA 4LGWA 1XMKA 2PG4A 4L9VA 3U1DA 4LB5A 2Z3YA 4JQFA 4U0YA 1SD5A 4MTEA 1IF1A 4G7ZF 5E1WA 1R58A 4L0ZB 2XROA 1SD6A 2L01A 3R0AA 1KGSA 1Q1HA 3HSRA 3ZN0A 4Y13A 3FXRA 3PFIA 5FO5A 1XCVA 1PP8F 3FMRA 4IF4A 1CF7A 5D5WB 2OU2A 3LWFA 2M5WA 1W5TA 1FYLA 4U7DA 1P2FA 1BI0A 3L09A 2RVCA 4CXFA 4O5VA 3ZMTA 1RUOA 1MZBA 2IRFG 4BNCA 2ZMEA 2A07F 1Y0UA 2COMA 3FXUA 1H9TA 3Q9SA 2EFWA 3DKWA 5LEJA 4AIKA 3J80Z 1XD7A 4L5IA 3I59B 3BWGA 4O6JA 4L9TA 2F5FA 3QU3A 2TDXA 3DFGA 3QAHA 1W7PB 2STTA 1WKMA 1SAXA 5IT9Z 4UUVA 4AVPA 4IHSA 4IVNA 5FLXK 2OA4A 4YFNF 5BPDA 3GZ6A 2KRFA 4KMUX 1R5HA 1FNNA 1BI1A 5ED4A 1XMAA 3EYYA 3SFZA 3TGNA 4HW0A 4HV6A 2DFIA 4S05A 3I58A 3SQNA 2QENA 5HS9A 3I64A 3DQVC 5HLHA 3MFKA 2EV6A 2RC4A 5H20A 1MJAA 4P9FA 3DPLC 3I59A 3BDDA 3B02A 1I27A 2O8XA 1FPQA 2MBFA 3RJPA 4LLNA 4P55A 1ZRFA 5F64A 4UNOA 3P9IA 2F5DA 3WGIA 2WTEA 1YYVA 2IP2A 2CG4A 4JK1X 1YW9A 4WXCA
chains in the Genus database with same CATH superfamily
2B7EA 3CP2A 3TP3A 2AS5F 6PAXA 5E18F 4AM3A 1KYZA 2KZGA 1Z05A 2EFNA 1MH4A 4Q4ZF 1F5TA 3JAMZ 5BOXA 1R00A 3WODF 4A0ZA 1IG7A 1BJZA 2H09A 4M9ZA 4PCQA 2FOWA 4RB3C 2R0QC 1RPWA 2DFEA 1ZK8A 4HLXA 1OMIA 1V5GA 2RAEA 4AIJA 5HLGA 3UKGA 1R4NB 1NG6A 2XGEA 3FWEA 3KP5A 5HS8A 3LSPA 5DM7F 4F92B 2OD5A 4EMSA 2K9SA 5GADJ 1OCOH 3OYCA 1YFHA 1W5SA 3PFYA 1NG7A 1Z6RA 2EZIA 3V8KA 2FQ3A 1P6RA 5JLWA 2STWA 2UZKA 4G6QA 3H36A 1AWCA 2WA0A 4D7MA 2BW3B 3K69A 1VQOI 4N0BA 3LAJA 3VYSB 2ISYA 2N8GA 2EQRA 4RA2A 4XONA 2R4GA 1L0OC 1QPMA 3OL4A 2Y69H 1A6IA 2DA6A 2KT0A 4E7KA 2W84A 4XSXF 3ERED 3V8LA 4H0EA 1JKPC 3HOWJ 3S17J 2OTLI 1HCRA 3KP6A 5F1JA 2KIFA 3ERMA 4HEA2 3RKWA 2IEKA 2HGCA 2NVQJ 5BPIA 3G6EI 3LA3A 3MAJA 3OS0A 1K78B 3GFIA 3LMMA 3FIWA 4A3FJ 1XG1A 1LVKA 3EETA 5LRRA 1HLVA 2DOEA 2VJJA 2OCCH 2LBFB 4B1RA 3P7NA 2O0YA 4ZTFA 4XSZF 3G71I 5E3MA 1QGPA 3A0BC 1FBUA 1R1TA 1MMGA 1Z3XA 3DEUA 3QYEA 3ZXSA 5FLXZ 1Y39A 2V6EA 2QYOA 1FSHA 4MQVA 1EH7A 3R60A 2F2EA 4BACA 3I71A 5F27A 2G7HA 2XDVA 4RAGA 4JP0A 2K3FA 1YQAA 2DI3A 3DKYA 3I4PA 4XRMA 4D1QA 2R5ZB 3HUGB 1GV5A 3K4NA 1GUUA 3BCAA 1L3LA 2PMZA 3O3KA 5E17F 3LSKA 3TMOA 1QZYA 2BBYA 4N9IA 1HDPA 2E19A 5FD5A 2H6CA 1FEXA 2F5CA 3K4MA 4HQMA 3PJRA 2E5NA 4HV5A 3A4CA 4DGWB 2XGCA 4MEYF 3TOBA 4XKBA 5B5EC 3ONQA 3IAM2 3VYUB 3K2ZA 1ERDA 5DS9A 3BG9A 3JRBA 5M5XJ 3LSJA 4CYDA 2V6CA 2H1LA 4IRGA 3U2RA 1F4KA 4BHPA 4P96A 3KEOA 4KIFA 3L00A 1JI8A 4BY7J 1K78A 1X3WB 2X1CA 1MNDA 4ZDPA 1Z7LA 3FM5A 2V1UA 3CC2I 2LBFA 2EILH 2ZSHB 1LEBA 2RKHA 4FX4A 2VOOA 1XCBA 4D9JA 2D45A 4IRHA 5J3LA 1IUFA 1WHUA 2ZNZA 3Q0WA 5CVIA 2LFBA 2Q1ZB 4BXFA 2Y9ZA 1BM9A 1S7OA 5TRDA 2QGUA 2IGMA 1T98A 4V2GA 2R5ZA 3HUGA 5FLVA 3CCRI 4LG3A 1J75A 1RI7A 4M3FA 1LJ9A 5KK1A 1BC7C 2JA7J 2L7FP 4ITVA 4BY1J 3GTPJ 2EPFA 5LD2C 5LGTA 2P7VB 2Z1DA 2E7WA 2JRTA 2XAGA 3BPXA 3K1PA 4X6AJ 4CZZA 2Y75A 2VBWA 2M8EA 3CMAI 1ZELA 2MG4A 3TW6A 3IL2A 3FHNA 5IT3A 4XORA 3BR5A 2ESNA 4E6KG 4EGYA 1RESA 2HVQA 3D5LA 3CJTB 3EQLF 2XUBA 4MHGA 3V7SA 2LD5A 2KIQA 3GVAA 3J7ZI 1WFXA 2HOAA 2JUCA 3RCOA 1VQPI 3CLOA 2CUZA 2L9VA 3E5XA 3H0DA 5EYRA 4M9SA 2LOOA 4M3GA 2W48A 4BEHB 1IW7F 1XGMA 3EDPA 2OQRA 5CLSA 3CUQC 1YRNA 1R6RA 1BL0A 2D1HA 3HSFA 3KIOA 1OPCA 3ZQIA 1S72I 2ID3A 2ECBA 1KQ0A 1WH5A 1SMTA 2K7LA 3BR2A 3ELKA 4OWRB 3ZQFA 2MH9A 1W7PD 3SDBA 3JTGA 1DP3A 3LA2A 4EM0B 3HB9A 3BG5A 1I6XA 3CUQB 5F0HA 2VODA 1OFCX 3PSFA 4KT6A 2P81A 1YLFA 1IV8A 3GWZA 3IKTA 4EM1A 4N4NB 4WXDA 4Z6YA 4E7LA 1WVRA 4M3DA 3AG4H 2M0CA 3F8FA 4JYKA 4B43A 4CYCB 1AKHB 5FD6A 2V1XA 1MSEC 1IAWA 2V1NA 2ISZA 3GLLA 3BR3A 4E7JA 4AIDA 1KU2A 5EEHA 2WAEA 4MGRA 3CCYA 2MSYA 2JUGA 3I4MJ 1E3OC 3RPUA 3O8GA 2NRAC 2XF7A 5TJJA 2ZKZA 2XVCA 1Y8RB 2LY2A 3T5XA 2R3SA 3ZMVA 1X4OA 2LC2A 4CA0A 2FEZA 5FKLA 5K7HA 1HKQA 2QQ8A 3MZYA 3P5JA 2LNBA 2GIVA 2P6SA 4BEHA 4BXUA 5LEKA 3SZTA 2E2HJ 4BXXJ 1X1BA 3EUKL 4N4OB 2Z5UA 4OMZA 1U8RA 1HKSA 5HDGA 1EJ9A 4U88A 2HOTA 3GEZA 5IP6A 4GO1A 4KDPA 3W6KB 4AD9A 3E5UA 4RGXA 2V9VA 3G2BA 3K1MA 1SD7A 1VQ6I 4BQNA 2CQ7A 1R22A 3NAUA 3WG7H 2VJ4A 2XAJA 2V9PA 4A12A 1OCRH 2MLKA 4EGZA 1AU7A 2X51A 1WCMJ 3IWZA 3CUQA 1D8JA 3QODA 3QU6A 3G73A 1FT9A 1ZREA 3N97A 2KRHA 5J1UA 3RTRA 1KQ9A 2ID6A 3JRDA 4M9XA 3MEXA 3NRVA 4CCKA 5TISC 4Y7NJ 3A03A 2ADUA 5HS7A 4IRIA 2IS2A 2PN6A 4BUPA 4XR6A 5GTHC 1N78A 1HF0A 4LITA 5CQEA 1DPRA 3GUDA 1IRZA 2HTJA 2DMUA 2ZJRF 1AKHA 3MZHA 4JOMA 4A2UA 3ZCOA 3F23A 2CV2A 3JRGA 2LF8A 3KPHA 1OYWA 3J81K 2I5UA 5FGMA 4LG0B 2A68F 3BC8A 5D5VB 3OYJA 5FLMJ 3LNQA 2XRLA 2L9RA 1TC3C 1MMAA 3ZGKA 2C6YA 4UV8A 1HW1A 3VB2A 1IDYA 5H6QA 3O6BB 2L3DA 5B1AH 2HQAA 1GXQA 1OLTA 2H94A 2XC7A 4A93J 3KE2A 4LB6B 2NNYA 2CYYA 2WWYA 4A3CJ 1LNWA 4HBLA 4M6XA 3DXJF 1MKMA 4NNJA 2VKEA 4HOBA 1I5ZA 2JMWA 4DBQA 1KZHA 1JT0A 4PJJA 3DPUA 3H5NA 3FKIJ 4HZFA 2Y0SA 3BZKA 2HDWA 4GCVA 3F8NA 2ZFWA 5KNLA 2BOLA 4M3BA 2KP6A 4CSWA 1T8IA 1XGOA 1USTA 1CQTA 2WC2A 5GP9A 3HYIA 4WF2A 5CJ9A 5IOYA 4J19A 3W2AA 3C2GA 1PYVA 2DFFA 3DBLB 5E3LA 1G8XA 1OCTC 1LUJB 3BQZA 4A3GJ 1Y0NA 1VNDA 2PMHA 5LRSA 3H3VK 4M6YA 4RS8A 2KIUA 4I7HA 1ETQA 4YFKF 5L3EA 3HG9A 2VB6A 3LSGA 2L7KA 4ZYAA 3HOYJ 2BY1A 3J7AO 2FE3A 4LG0A 3CCLI 2AXTC 1V55H 2GBYA 1F9NA 2CQKA 4BAYA 1ZQ3P 4CCNA 3JCUC 2DTZA 4IO9F 4CDGA 3GTGJ 1STZA 2GOXB 5L3CA 2JJ7A 2K3PA 2O8KA 4D5CA 1S7AA 1BR4A 4IHVA 3E6CC 2R7VA 2G9WA 2A6HF 1YX3A 3QQAA 3LSTA 3ZQHA 4A69C 1VQ8I 5M3MJ 2NNNA 3H5AA 3WTWC 2XB5A 3R4KA 3SJMA 3BQYA 3FXJA 4WWCA 2H6BA 5EG0B 1VFCA 1REPC 3EUAA 1XB4A 4C3JJ 2L9SA 3N4MA 1VQ7I 3MD2A 3D0SA 2VE8A 4MFEA 3RYPA 4DZPA 3JRFA 4KA4A 1K6OA 2VKHA 4JX6A 1DU6A 2FMLA 3RQ4A 4F3QA 1SAUA 4LIUA 2CW8A 4IX7A 1CF7B 2F5EA 3HRMA 1FJLA 3C3WA 3WG9A 2G0EA 2VBZA 3H92A 4C3HJ 1X1DA 3OIPA 3HIFA 3A1YA 4HX4A 3WHBA 1YX5A 4B48A 2MFZA 3HKZA 4LK0F 2QQBA 3KFWX 4AYBN 1XN7A 3TBIA 5D4SA 1QU3A 1BJAA 5IYBJ 1B9NA 1EV7A 4FTHA 4PJLA 3S14J 1AOYA 2YS9A 4PSXA 5HDKA 3CZ6A 2EIJH 3QOPA 3J7AY 3Q0VA 4JX5A 5JVGF 2DN0A 4PUSA 1XDUA 2IA1A 2IS4A 2CSOA 2ETHA 1YJWI 2AO9A 2D1VA 3G1OA 4E70A 2Y30A 2KZVA 4LOCA 5LHIA 1TLHB 2ZNYA 2KL4A 3J7YJ 1K83J 1BA5A 2KPMA 3RKYA 1Z67A 4MQ9F 3UNGC 3VOEA 1XGSA 4ZYHA 4HDVA 5EG0A 4P5OA 3TDUC 3FXKA 3CJQB 5E79C 2QLZA 4XN0A 2RNJA 1R5ID 3Q9VA 2R7TA 1IZ1A 5F0CA 2P7CB 3TO9A 2ELKA 4FT8A 2LY1A 3CTAA 1R1VA 3KEQA 4XOTA 5GPCA 1C0WA 4C2UA 5IY5H 2Z33A 2R93J 2JT1A 3F8CA 3GYHX 5F6FA 4C3IJ 1QVUA 3AG3H 4OOIA 1U9NA 1U5TA 4EATA 4G8XA 4AWXB 1W0UA 1WRJA 1RKTA 4B09A 4MNUA 4HNTA 3EUHC 3M7GA 2QQ9A 1B72B 1LQ1A 3KX2A 2LG4A 2XSDC 5KCMA 5JHUA 3BTJA 2ZFUA 3GBGA 4RB1A 2E35A 2ZC2A 4ASNA 4AVZA 2W57A 4HYEA 1WGXA 3ZQQA 2OTJI 3PNYA 3RI4A 3BCBA 4QWQA 1YJ9I 5JHFA 1TW3A 1ZGJA 3CJRB 4GXOA 3FX3A 1H89C 2W24A 1LDJA 3QP5A 2NS8A 1OYYA 4PZJA 1J9IA 3CCUI 4XOPA 3B73A 5LHHA 1JGSA 1ON2A 2PJRB 2W00A 2ZXIA 3U9GA 5IOZA 2GLOA 3ABTA 3TW7A 2HI3A 4DQ2A 3PIOF 1Y1WJ 1VQLI 3ZN1A 1VQ5I 1I6HJ 2BY0A 4I09A 1ORKA 3AKZA 4ZTJA 2VXDA 1JKQC 2ZJQF 1ZLJA 3C2HA 1HA8A 3T1BA 1S9HA 3OOUA 2DJIA 4FE7A 1TWFJ 5AONA 2L5QA 2JWTA 1ULYA 3K0LA 1WH7A 5GAGJ 2VONA 3N05A 1MW7A 3FMSA 3ABMH 1YS6A 2HR3A 3KP4A 2IGNA 3JRIA 3S16J 1MSFC 4JBAA 2BHZA 3T0YA 3MWMA 2RV8A 3ZRGA 3ZQLA 3DCFA 4FHTA 2XF5A 1TQIA 3CJNA 4RGSA 3W2WA 4BE2A 3QPSA 3CCVI 3GZ5A 1B72A 3VFZA 1BR1A 1HBXG 3E0JB 1G6NA 3M1EA 2BV6A 1R36A 1XGNA 5E8IA 3V7RA 4PSWA 4ETSA 1TNTA 2KKOA 4XLAA 2KJCA 1S8NA 4C2MJ 4HNVA 1I3AA 2NVYJ 3EUHA 2WAFA 2Y31A 2BY3A 1K79A 2R7QA 5ICEA 4M6VA 2PJRA 1ZG1A 3CDLA 1FBSA 1B6AA 2FXAA 2DBBA 3RZOJ 4XRSA 2IBDA 2E60A 1YOVB 1ZRDA 2CO5A 4LIVA 1B1BA 4IHXA 4A3EJ 3RDIA 1J0RA 2JVHA 1H0MA 2YX7A 4KT5C 4A6EA 3H1CA 4ZZDA 2GIZA 3CMEI 2CU7A 4EEFG 4ZH4F 2Z99A 2K9MA 2Z9OA 2NXNB 1QQIA 5K7FA 1LE8B 2Z16A 4ZYEA 2AHQA 3M8JA 2KRCA 3SZPA 1R23A 3PQKA 1AHDP 5FJ8J 2QM3A 2F48A 2VASA 1ETXA 2YU9J 4MIMA 3A0HC 1T56A 2M7AA 4HRIA 2WAQN 2CMPA 3GFJA 2NVUB 4BE1A 2R7ZJ 4BL0B 1FOXA 3CC4I 2I8DA 5D6FA 4E7SA 1T0FC 1B8IB 2EFOA 1FTTA 5FKKA 1ZGAA 4O3MA 3K1NA 3F9KA 2K27A 4KMFA 3BT9A 3HSEA 2ACJA 2EZLA 1T39A 1XX5A 5LBQA 2OAZA 4BE0A 2ECCA 4XN3A 5K5RA 5K1YA 2QEXI 2M0MA 4Y17A 1IRXA 1YIJI 1MD0A 1MBFA 2P6TA 2DMTA 1O3SA 3KLNA 2KHMA 4UHTA 2HKOA 3CO7C 2MD5A 4ESFA 4DYCA 2CW7A 4RAYA 1UAAA 3G1LA 4B3AA 1YS7A 3CO6C 1UG0A 3WU1B 4RB2C 2F4OB 3F21A 4EV0A 1RKWA 3P9KA 2JPCA 1G3WA 4Q48A 1SFUA 2A3SA 3TO7A 4DOZA 3PUFA 2RQPA 3QRFF 1SC7A 3BLYA 4PGGA 1ZH5A 4D7NA 3ZPLA 1FYMA 1LE8A 1OR7A 4XM3A 4PFOA 2NVTJ 4OIRF 2E1CA 2P5KA 5E1ZB 1X1PA 1FX7A 1ZLKA 2UXNA 3KP2A 4HF0A 4F93B 1A5JA 2DA7A 3H9JA 1JTYA 2XKOA 4NBQA 1ETKA 5D4RA 4L5EA 1B8IA 3OYGA 2XAQA 1TWAJ 1HSTA 1V3FA 5B3SH 1I39A 2MGQA 3LFUA 1W0TA 3WHCA 1RR7A 1QZZA 2KISA 2H1KA 4R8HA 4ESBA 1MBEA 1TTYA 3M8FA 1H8AC 2LLKA 1G3YA 4XLFA 4B44A 5HNHA 2LTPA 4F52A 1T0FA 3I5UA 4OU0A 1W36C 3K70C 4KUMA 1APLC 4A3JJ 2EIKH 5DD8A 1MGTA 3IH3A 1Y1VJ 2L9NA 3PL8A 4PJNA 4BDZA 5BMZA 4LK1F 4ZYGA 3I9V2 3PQJA 1YRNB 2DT5A 5FRMA 3GFLA 2FNAA 2Q2EA 3M1CA 1WWXA 2MW8A 1WJBA 5C3EJ 2MABA 3D5RC 3BR1A 5B66C 4A5NA 3S32A 1QA6A 2CV1A 3ZQGA 2B63J 2DA5A 1U8BA 4GYGA 4XIDA 1T38A 3GTLJ 2O6GE 1E3HA 3DLAA 3BTCA 2DODA 4YEJA 3OR1C 5HLIA 4EQQA 1XSVA 1SFEA 5CPRB 1UG2A 1QPIA 3I54A 3HOXJ 1LDKB 3IHUA 1QVTA 4B3XA 5L3BA 4E7ZA 1VQKI 3FK6A 4F55A 2R7XA 2FA5A 1IRFA 1SVMA 2LKPA 1EF4A 1EKEA 3W3CA 3FISA 4HA8A 2DDAA 1R9TJ 1S6LA 4CCLA 4BHCA 2VBYA 3JRAA 1POGA 1IXSB 1QNTA 3WE3A 3DTEA 2QBYB 3JTHA 1QRYA 2WB1N 1FMVA 1FC3A 4WK8F 1IC8A 2HQNA 3OIQA 1KU7A 3GTKJ 3CF5F 3GZNB 2OCEA 3FXLA 2JTVA 4CICA 1VQ4I 1EH8A 2NS7A 4BQOA 5LFAA 3P9CA 4XQFA 2CUJA 4WXHA 1ZYRF 3HJEA 1BI3A 2EV0A 4BGDA 3GCMA 1LFBA 1SFXA 3MKLA 3KYDB 2RN7A 2FOKA 1WJCA 2P8TA 4MFDA 5KVRA 3HC7A 3CCJI 3K4CA 5D8KB 5ICGA 1LEAA 1QO0D 2AXLA 4OMYA 3IC7A 1S5LC 2JA6J 3MMYB 2QUFA 4G12A 4DYQA 3H0GJ 3H5RA 5GAEJ 2K5CA 4FX0A 2W7NA 1ODDA 4XNFA 2VBXA 2LRDA 1FZPB 4G6TB 3CDIA 3FHZA 2HNHA 3HOUJ 3ML6A 2FUG2 2L4AA 1P92A 4OINF 1J59A 4I01A 2A5YB 3IAS2 3OS2A 3M07A 2VL8A 4BQAA 3V7CA 4EJWA 2NVXJ 3HTUA 4IJAA 5EJCA 1ACIA 2EA4A 3QOEA 3BTIA 3HOSA 4UXNA 4FCYA 2YPRA 2GXBA 4HDUA 1O3QA 3HDDA 4A3LJ 5AIQA 5J6XA 1OKRA 4PGHA 1LPQA 1H9GA 2ME0A 1D0XA 2HOEA 2QBYA 2EBIA 3CCSI 1NK2P 3JSPA 1P4WA 1KA8A 3PSIA 2E2JJ 2R7FA 3AL0C 2CWEA 2DO7A 5E3OA 2IPQX 4BHBA 3I4NJ 4DBRA 1FWZA 1T6SA 1OCZH 4MTDA 2IT0A 3MVPA 3I3LA 3OL3A 2LKSA 1A35A 4PK4A 1Z9CA 3BJ6A 1ETVA 2FSWA 2XPWA 2DPUA 1A6QA 3H35A 4BJ5C 2CV0A 1FLIA 2WV1A 3O2PE 3W2VA 1DP7P 2HOSA 2CH0A 3DF8A 4KITB 1PDNC 4L0YB 3AL0B 1TW2A 1D8KA 1X2MA 2GQQA 2M87A 4N9HA 1N77A 2FQ4A 3PIPF 2ESHA 1EA3A 2XF6A 3ABLH 4V19K 2E5ZA 3GLXA 2DLLA 3I55I 2GWRA 5DYMA 3OYBA 2JSPA 3BG6A 5JFRA 2IW5A 3MZ8A 3K7AJ 4X0GA 3ZQ7A 4XKVA 5JLXA 1JJ8C 2CQNA 2DA2A 2VJ5A 4CHUA 3E1SA 4NHJA 2GA1A 2HXIA 3X2QH 2KJBA 5D5UB 1IRGA 3HOZJ 3PUBA 5EEGA 2O7OA 3QPHA 1RNLA 1OISA 2CRGA 2HEOA 4KN7X 1ON1A 1BW5A 1D5VA 2MD0A 2GA2A 1V4RA 2F6CA 4HQEA 1T95A 4BDYA 1V54H 2IGKA 4UB8C 3CESA 2VUMJ 2X48A 3SZGA 4BYYA 1WJEA 2AQEA 4HSRA 2CFOA 4DIQA 2CUEA 2Z2SB 3K10A 4DW6A 2MC3A 2OUMA 3DV8A 1HKTA 3HRUA 1XS9A 1FP2A 3PNVA 2FU4A 3IKVA 5HOOA 1HC8A 2O3FA 2EFPA 2VPRA 3DKXA 4P9UA 2XRNA 4RM2A 1G2HA 4I6ZA 2VC0A 3WE2A 3QP6A 3QWLA 2ZBKA 3HZJA 2BE5F 2BGCA 2MLGA 3ZR8X 1SFOJ 4AUXA 1JGGA 4A3DJ 2K9LA 2LH9A 1S3JA 2M34A 3GTJJ 3F8MA 2DW4A 4L9JA 3RQIA 1G59A 3E6MA 3COAC 3QYFA 4ZZLA 4PFPA 1P7JA 4UY8I 3DTIA 4I0BA 5J1YA 2XAHA 4XICA 3FMQA 3ECHA 3RIRA 1O7FA 2NS0A 1F36A 2M30A 4PJ0C 2V79A 4AYBA 3Q0UA 1Z77A 3SHFA 1ONVA 1ZHFA 2HZTA 5KAFC 4TV7A 1WJFA 1R1UA 1E2XA 3H9GA 3HTSB 1PJRA 4ANJA 2M4GA 1ETOA 3NARA 3HOTA 4RB0A 1Z1DA 4S0HB 4D0PA 1E3PA 1Z21A 1GLNA 3VSLA 5BS6A 5LGNA 2B0LA 2HKXA 5A2QK 2OC6A 4MO7A 5ERIA 1I1SA 4UVAA 1U78A 4QIWN 2ZXHA 2IS6A 5J47A 2GZWA 1IXCA 4A5MA 3J80K 2QSGX 1U5TC 2G7UA 1HW5A 2HYGD 2VQGA 2X1EA 3S93A 5LLQA 2QQAA 4ZYDA 3OYNA 1R5GA 3S1NJ 5HVQC 1FYKA 5CQGA 1X4PA 2W4SA 4RLQA 4EJVA 3LAPA 1LDDA 2XIGA 5EDNA 1HW2A 3FK7A 1GVJA 4ON0A 2LSOA 3SXYA 1YW8A 3TP0A 3LA7A 1KONA 5IP9J 4M3EA 3MCZA 1KU9A 1RUNA 2NOJB 2X6XA 1U5TB 3E5QA 3GO5A 2A69F 4U0VA 2GM4A 1W36D 2FX0A 3K70D 2EV5A 5L3FA 3F6VA 3SEZA 5LHGA 1UFMA 3L2RA 4Q5SF 3KCCA 3E6BA 3ZMUA 1HDDC 1YITI 4OIPF 4HG2A 2R7DA 4DNCA 2HWVA 3I53A 4XL9A 4M73A 1FTZA 1VTNC 3GTMJ 3VEPA 4QLCU 1Z7UA 2BEOA 2PMUA 3J81Z 2WADA 3DWLE 1ETYA 3K4KA 5CKTA 4I02A 1KQ8A 3DTKA 4JX4A 2Y9YA 5J40A 2RGVA 2VE9A 2L7ZA 3CMMA 1A04A 4LLGF 4A3IJ 2LVSA 4E7HA 2DK8A 2DTRA 2O61A 4OAYA 2D2WA 4ESJA 2EA2A 2NYXA 2VJIA 3WU0A 2KIMA 2M2EA 3BOQA 1BIAA 3RPUD 2L7MP 3OWTA 4BKXA 5K5QA 3O8HA 4ZDLA 2E2IJ 4KNYA 4Y52J 3LQQA 1W5CC 2OPTA 1YG2A 1IN8A 3DU5A 1UMQA 4BH9A 1BOBA 2K9NA 3M9AA 1MJ9A 1TQPA 2YX4A 2L2OA 3R0JA 3CUOA 5M3FJ 4XBFA 4AIHA 4I0AA 5CVUA 1UELB 4E4HA 2DOAA 3HBLA 3DU6A 3C7JA 2NAZA 1ZR2A 1FY7A 3HHGA 3OYMA 3JAMK 2QSFX 2A05A 2DOFA 4QSHA 3JR9A 3FZVA 3LL7A 2M45A 2DU9A 2E1NA 3ZQCA 1J5YA 3OYDA 2RREA 3HRSA 4II3A 1U2WA 2HU9A 3D5SC 2ZXJA 5ILUA 2K85A 3GTOJ 3LFKA 4G7OF 5L3DA 2OZUA 1MMSA 1Z91A 2EB7A 4UVCA 4LMYA 3VPRA 2RNGA 3NEUA 3S1MJ 2A6EF 2NOGA 1NH3A 1W4MA 2IXSA 4RAFA 2EZKA 5AIPA 1DGRM 5A2QZ 3OOPA 4HPQA 1I50J 1JTXA 5DTDA 3H3ZA 2X6YA 4G9YA 2FMYA 1GDTA 2P0WA 2XAUA 1OJLA 3KLOA 4IEJA 1IV6A 4IZZA 2V9KA 4IHYA 4KICA 1WJDA 2Y2ZA 1UHSA 1ZKGA 1LKXA 2OJED 5C44J 4G94A 2M9HA 2P4WA 3E6DA 1N75A 1FIPA 1IN5A 4RGRA 2X4HA 3JW4A 2JZYA 3HM5A 2DK5A 1UZCA 1P4AA 2VC1A 3WU2C 3CD6I 1NTCA 3M8EA 2DAOA 4H4KC 3IH2A 2WAQA 1QZEA 2DA4A 5JVTA 1GV2A 2ELHA 2OZ6A 4YG2F 1GXPA 3G4SI 4DZJA 1WJAA 4HAMA 5J8CA 1D3YA 3FXMA 3G3ZA 4S04A 1QBJA 1ZGWA 1JUSA 3DBHB 1WI3A 4LD5A 3F0CA 3OYIA 3IRQA 3OYHA 4NC8A 2QWWA 2LDUA 2F4MB 2PJPA 1MJBA 4B8XA 2Q0OA 4G7HF 3TQNA 4RGUA 1FOWA 1SD4A 2M4KA 2XKPA 2VT2A 4LLLA 4LJZF 3ULQB 1YTYA 3LSMA 2FRHA 3G1MA 5CVJA 4YRVA 1JUMA 1OR7C 4CCOA 3M4OJ 1WZ2A 4P1WA 4IOAF 1XDSA 2HTSA 3BTLA 1VQMI 2A61A 5JR3A 4J00A 1D1CA 1P4XA 2FBKA 4UB6C 3RSNA 4GFBA 4FQGA 1XC5A 3CDHA 4RBOA 1BIBA 2RDPA 3BPVA 5F04A 1YIOA 2JSCA 4GGGA 3BP8A 3ZP5A 1TNSA 4W1UA 2HQ5A 2OBPA 3HRTA 2K4BA 3JRCA 3RKXA 2K02A 1MIJA 3V8JA 4IHWA 2VI6A 1W7PA 1DGWY 4AC0A 4I98B 1ZG3A 5E1XA 2JA5J 1PVEA 4YIFA 4L18B 4GDFA 1Z6TA 2DT7B 3LSHA 1T2KA 3S8PA 2CGPA 3L2CA 2EIMH 1RETA 3CC7I 1G3SA 2JPBA 4ENJA 3GTQJ 1J2XA 1ZR4A 4RMNA 1JXSA 1V5EA 2EK5A 5JI6A 1TWHJ 1U3EM 5H6RA 1LFUP 4ENMA 4DJAA 4RM3A 2QKLB 1D1BA 5GTIC 1K4SA 3BY6A 3SEQA 2EWNA 1SVLA 4HLYA 3CCEI 4IPAA 3WTZA 4CUGA 1SFKA 2COBA 2YSRA 2E1MC 4I76A 3C1DA 3HPGA 4HSTA 4WX9A 1SANA 3ECOA 4C9YA 1MDMB 4QTRA 1D5YA 1H88C 1VZ0A 2P5VA 3TEDA 5ILVA 2Q2EB 4U7BA 2E36A 5ILSA 1VQ9I 2V1DA 3RKQA 4Z2YA 2BXYA 2QA4I 3OSGA 4YIRX 1FOYA 2LMDA 1RR8C 2YU3A 3S2HJ 2E1MB 1NK3P 1OYIA 3L9FA 2XB0X 2DQLA 4CCMA 3IRRA 3CF2A 3OSFA 1WJ5A 4WCGA 3LSRA 1WQ2A 2YR2A 1R49A 1VQNI 3B6CA 3ESWB 3A2KA 3PO3J 3AAFA 1X19A 2XHKA 1JKRC 3WTYC 2PFBA 5CVRA 3JSOA 1JKOC 4R1HA 1WPKA 2L54A 2X6WA 4KYWA 2VKVA 2R7OA 1IUYA 2CW0F 2BYVE 4XKWA 3IV5A 3IWFA 5D6EA 2JA8J 3Q3SA 1WI9A 3E3VA 1UJ8A 2VIXA 4I99C 2CQQA 3HHHA 1ZARA 2X9DA 3KZYA 3RZDJ 1ZTRA 3GW2A 3FBIB 1JJ6C 2FBIA 3L1PA 2P5LC 1YE9A 3PO2J 3OIOA 5E8GA 4AU7A 4IHTA 3F3XA 1F1ZA 3KZIC 2D5VA 9ANTA 3TKYA 3AFHA 3CCMI 3KETA 5DCMB 2WB1A 1YHQI 1RIOH 1MDMA 2JRMA 4BQQA 1Y6IA 1MBJA 3VDXA 4NDLA 2VPLA 2BW3A 3E7LA 2FNPA 5E20A 5KAIC 2RQQA 1O3TA 4EJTA 1BBYA 3U21A 4B47A 3Q5FA 1K4TA 2QZ8A 5F08A 1DU0A 2QKMB 4XLCA 2FBHA 4ENNA 1KU3A 1ENHA 3F6OA 4IQ4A 1SMYF 3U1KA 4XLPF 3W6VA 2XGDA 1ZRCA 3K9TA 3K4LA 3JREA 1PP7U 4L9NA 3KYLA 1YO5C 1USSA 2Y0MA 1DPUA 1I3QJ 4KN4X 1NHAA 3ABUA 3K6GA 5DUIA 1IXRC 2XASA 1VF9A 1B4AA 2VT3A 4PDKA 1HOMA 4GRIA 5EZHA 3BG3A 2PI0A 2MC4A 2FD5A 3UR3C 3NWTA 1D0ZA 3ABKH 2I10A 1M1EB 2BZTA 3WTTC 1XSDA 4EM2A 5BQTA 4NB5A 3L2QA 3F72A 1JUPA 3MKWB 1XMXA 5C4XJ 4HF2A 3WGHA 2L4MA 2E7XA 2PMZN 4Y15A 1JHHA 2R7SA 3MN2A 4XLHA 5F1RA 2WBMA 5DCMA 3BJOA 4G6DA 1LFPA 2KQRA 2V26A 1QHHD 5J8FA 4YFXF 2O5RA 4V2FA 4UUTA 2M3AA 3ROUA 4F7ZA 1J7KA 2L02A 2PBIA 3VODA 2FJ1A 1TQMA 3QPTA 4NQWB 2JVGA 2JA2A 2E1OA 1RZ4A 3ASNH 3BZ6A 4NUBA 3FXOA 3KP3A 2O03A 2LP0A 5ICCA 2OQGA 2J5OA 4Y3OA 1IGNA 2XV4S 2MH2A 4M74A 2IGOA 4U87A 5K5OA 2GXAA 1U0JA 4M71A 3REOA 1BI2A 4CCJA 4M72A 2IS1A 1RC9A 2W85A 4PJMA 1OCCH 3ZOBA 2KFDA 2PEXA 5TGTA 3EPZA 5E3NA 2VN2A 3KP7A 2CFXA 1EH6A 3FBNB 3KYCB 3BZCA 2BHYA 5D8LB 2UXXA 3BR6A 4UUSB 3FXQA 5FKMA 5DEQA 3M3YJ 2K86A 4I2OA 1O7LA 1HXDA 1D1AA 3S2WA 3RYRA 2H27A 2DFHA 2QSHX 5FFZA 1Z0XA 3PM1A 1S29A 4UV9A 4EJOA 3SDGA 4A6DA 1DUXC 3ISPA 4BU2A 4OIQF 2BY2A 2HYJA 3K4BA 2HFHA 4HF1A 2OV7A 1Q1VA 1ZAOA 3DBRB 2LY9A 2DQRA 3CLQA 3WTUC 3C18A 2PQ8A 3IH4A 2WY7Q 1BC8C 3WGGA 3I0TA 1A36A 3FKJA 5BNGA 1B59A 3LOCA 3OYLA 2HQRA 2IAIA 3CMYA 5FROA 2LR8A 3FDYA 5K7ZA 3WTVC 5CVVA 2K40A 2HPMA 3TO6A 3PNTA 2DCEA 4NQWA 1PUEE 3H3UA 5DCFA 4FISA 4A0XA 4CO8A 1ETWA 1U6GA 1O4XA 3GXOA 3R6SA 2IA2A 5FFXA 2DJNA 2Q8KA 3S1QJ 1N25A 5IYDJ 2K4JA 2TCTA 3JRHA 1P7IA 4EJUA 2UUZA 4MLOA 1IN6A 2DMPA 2ZO4A 2LKXA 4KIBA 3GF2A 1LB2A 2DYRH 3LSIA 1YW7A 4UUSA 1U9OA 2GXGA 2VKDA 4ZC3A 5L3GA 1RRJA 1IN4A 2X0LA 2LF7A 4QPQA 1GVDA 1TBXA 3CQZJ 3E97A 3OYKA 1IN7A 3HL2A 2V4JC 2IVMA 2A6TA 1X2NA 4YIIA 1UHWA 2XAFA 3ZMSA 2F4IA 1G4DA 1IDZA 2UWMA 1GHCA 2ZCWA 5LGUA 2O9LA 3S3OA 1FSEA 2M1BA 1DDNA 1G3TA 1MNMC 5DV5A 3ZMDA 3EYIA 3MQ0A 1D0YA 3SFIA 3TDZC 4CH7A 3BJAA 1FP1D 5DD4A 4CYCA 2TRTA 2JK3A 4K2EA 4W97A 5IPAA 2WV0A 3VYRB 2QVOA 4BBRJ 3LQRA 2W25A 2HDDA 5CYVA 2HS5A 2F5VA 4IKFA 3NQOA 1JT6A 2PLYA 5M5WJ 1J09A 1FOKA 4A3BJ 1FMWA 3NWSA 5EEAA 1JHFA 2ELJA 3QYBA 2H8WA 1R71A 5HLTA 3MKZA 4CGZA 3OV8A 4ZDOA 1MBKA 3RPQA 2VQLA 4ABZA 2J5PA 4Y4RA 1LVAA 4Q47A 2EJRA 1X3UA 4BBSJ 1XSXA 3HEFA 1SVOA 2IA0A 1JE8A 4KFCA 3KZZA 1UB9A 5J4VA 4OAZA 1E17A 4R79A 4NC7A 1HSJA 3VWBA 2EFQA 2BVMA 1O3RA 2R7UA 5DUKA 1P9QC 4KIGA 3T8RA 1WSUA 4E7IA 2CJJA 4YELA 2DYSH 4HX8A 4OIOF 4DYRA 5J1RA 4UVBA 4EVIA 1TT5B 4RAZA 3V4GA 1T33A 2DT6A 1UCRA 3WTSC 3R61A 1FIAA 2E34A 3L7WA 2MA3A 1BOAA 3KEYA 2HXOA 5HODA 4XLNF 3DP7A 4C30A 3ZMZA 1TZLA 1T08B 4KISA 5D5XB 1I1GA 1V5FA 3OYEA 4LFUA 2Y48A 4A0YA 5M5YJ 1R4MB 1K7AA 2X1DA 5EZGA 1K6YA 1KYWA 2VQHA 3GX4X 1YI2I 2BXZA 2ZJ2A 3OR2C 5ICFA 1CGPA 3DEWA 1X58A 5GAHJ 5DDGA 1Y56A 2GAUA 3F8BA 2VOPA 2QF7A 2QCOA 5HDNA 3V42A 3D1NI 3FF5A 1OQYA 5B1BH 3WTXC 1UHMA 3L2VA 2ZXWH 1Z3YA 2IJLA 3SYTA 4MEXF 4XRFA 4XMYA 5IT9K 4IXAA 1YJNI 2DMNA 1HQCA 3A01B 4L5JA 2ME6A 4A3MJ 3W6JB 1FBQA 5FB2A 2VQCA 3BROA 4FE4A 4GYIA 3T8TA 4Y33A 1A31A 2Y0SN 2HVSA 3FM3A 3F22A 1PUFB 2R7RA 2JN6A 2ZMEC 3VYTB 3DPTA 1BN5A 2W82A 5DM6F 1OCPA 1ZG5A 5HNFA 4IOCF 2MYSA 2HDCA 4ENKA 3GFMA 1E0EA 2ICWG 2DPDA 3L2UA 4HX7A 4U0WA 2ZSIB 2HYFA 1ZN2A 3QPLA 3IUOA 4ZJZA 1R7JA 5H2FC 1B9MA 2XGXA 1BW6A 2VXZA 1MBHA 4FETA 2R92J 1O57A 2FF4A 4XKCA 2VLAA 2ZMEB 3TOAA 4LGWA 2LREA 1XMKA 2W1OA 2PG4A 2DA1A 4L9VA 3U1DA 2R5YB 1ITYA 3OYAA 4J01A 3K4JA 1BR2A 4LB5A 4FASD 5IP7J 5FRNA 2Z3YA 1W1WE 4F91B 4JQFA 2X6OA 4U0YA 3I56I 1SD5A 4II2A 4MTEA 4X1EA 3B6AA 2KDZA 2BVLA 1IF1A 3TL4X 3OY9A 2M7BA 4D5FA 5E1WA 4G7ZF 1R58A 1VI0A 5J4YA 3C2BA 4B4CA 3A01A 4L0ZB 1TP4A 2XROA 3MKYB 1SD6A 4A3KJ 1TWGJ 2L01A 1DQUA 2L0KA 3R0AA 1IO2A 1KGSA 1Q1HA 3HSRA 3ZN0A 4Y13A 1PUFA 3AG2H 4XLEA 3FXRA 4BS9A 5EF6A 3PFIA 2DA3A 5FO5A 4RLFA 1XCVA 1PP8F 2AQFA 1S7EA 3S3MA 1XPXA 3FMRA 3DEEA 4IF4A 2V7FA 5C4JJ 2HZDA 5D5WB 2OU2A 1CF7A 3LWFA 5F0FA 2M5WA 1W5TA 3S1RJ 5EGOB 1FYLA 4U7DA 4C2TA 1P2FA 3OS1A 3VSKA 2HVRA 1BI0A 3HGGA 3L09A 2RVCA 2KDOA 3IP4B 1X3ZB 4CXFA 3HKZN 3GMEA 4O5VA 4BJTA 4XRSG 2XPVA 3ZMTA 1MZBA 2HPIA 5IYCJ 1RUOA 2IRFG 4BNCA 3H9QA 2ZMEA 3HXLA 3HOVJ 2A07F 4IL6C 4XK4A 1Y0UA 2COMA 1GT0C 3FXUA 1H9TA 2R5YA 3BR0A 1QHGA 1Y8QB 3HGYA 1MNEA 5GPAA 3Q9SA 2E71A 2EFWA 1MH3A 3DKWA 2CQXA 5LEJA 2R7WA 4AIKA 3J80Z 3S3NA 1XD7A 3S2DJ 2ZB9A 4L5IA 2LK2A 3I59B 3BWGA 2WY8Q 4O6JA 2H8RA 4L9TA 2F5FA 3ASOH 4RDUA 3QU3A 2OF7A 4IQJA 2TDXA 2XSJC 3DFGA 3QAHA 1W7PB 2JQ7A 2EH3A 2STTA 1WKMA 1SAXA 5IT9Z 1IJWC 2ZJPF 2DXIA 1F43A 1SEUA 4UUVA 4AVPA 4IHSA 4IVNA 3OMYA 3DLLF 5FLXK 2LYCA 2KLOA 1TWCJ 2OA4A 4YFNF 5BPDA 3GZ6A 5EGOA 1XTAA 2KRFA 4KMUX 1R5HA 3A02A 1FNNA 2CUFA 4BJ6C 1BI1A 5ED4A 1XMAA 3EYYA 3SFZA 4NC6A 3TGNA 3CCQI 4HW0A 1TT0A 2K9QA 3HPHA 1TL8A 4HV6A 2DFIA 4S05A 2B9SA 3I58A 3SQNA 2QENA 2XPUA 5HS9A 3I64A 4QPOA 2EINH 2KMUA 2X85A 2EZHA 3DQVC 4CZCA 2DMQA 5HLHA 3MFKA 2GOMA 2EV6A 2UV1A 2YUSA 2RC4A 3OYFA 5H20A 1MJAA 4P9FA 1X1CA 3DPLC 5KHDA 2M8GX 5FKNA 1X1AA 3BDDA 3I59A 3B02A 2DDBA 4KJZA 1I27A 2O8XA 3K2AA 1FPQA 2PX9A 2MBFA 2CS3A 3RJPA 4LLNA 4P55A 2A5WA 1ZRFA 1MMDA 5F64A 4HNUA 4UNOA 3P9IA 2F5DA 1MMNA 3WGIA 3BG7A 2WTEA 1YYVA 1MBGA 3CP8A 5FKOA 1AA7A 2IP2A 3S15J 2CG4A 3L2WA 4JK1X 1K61A 3AG1H 1YW9A 4WXCA
chains in the Genus database with same CATH topology
2AS5F 6PAXA 5E18F 1KYZA 1F5TA 1Z05A 2EFNA 4Q4ZF 3JAMZ 5BOXA 1R00A 3WODF 4A0ZA 2H09A 4M9ZA 4PCQA 4RB3C 4HLXA 1OMIA 4AIJA 5HLGA 3FWEA 3KP5A 5HS8A 2OD5A 4EMSA 1YFHA 1W5SA 1Z6RA 3V8KA 2FQ3A 1P6RA 2STWA 2UZKA 4G6QA 1AWCA 3K69A 4N0BA 3LAJA 2ISYA 1L0OC 1QPMA 2W84A 4XSXF 3ERED 3V8LA 4H0EA 3KP6A 2KIFA 3RKWA 2HGCA 5BPIA 3LA3A 3MAJA 1K78B 3GFIA 3EETA 5LRRA 3P7NA 2O0YA 4XSZF 1QGPA 1FBUA 1R1TA 3DEUA 5FLXZ 2QYOA 1FSHA 4MQVA 1EH7A 3R60A 2F2EA 3I71A 2G7HA 1YQAA 2DI3A 3I4PA 1L3LA 3O3KA 5E17F 1QZYA 2BBYA 4N9IA 5FD5A 2H6CA 2F5CA 4HQMA 4HV5A 4MEYF 3TOBA 3K2ZA 4CYDA 2V6CA 4IRGA 3U2RA 1F4KA 4BHPA 4P96A 3KEOA 4KIFA 3L00A 1K78A 3FM5A 2V1UA 1LEBA 2RKHA 4FX4A 2VOOA 1XCBA 2D45A 4IRHA 2ZNZA 5CVIA 1BM9A 1S7OA 5TRDA 1T98A 3HUGA 1J75A 1RI7A 5KK1A 1LJ9A 1BC7C 5LGTA 2P7VB 2E7WA 2JRTA 2XAGA 3BPXA 3K1PA 4CZZA 2Y75A 2VBWA 2M8EA 3IL2A 5IT3A 2ESNA 4EGYA 3D5LA 3EQLF 2XUBA 4MHGA 3V7SA 3GVAA 3CLOA 3E5XA 4M9SA 1IW7F 1XGMA 3EDPA 2OQRA 5CLSA 3CUQC 2D1HA 3HSFA 1OPCA 1KQ0A 1SMTA 2K7LA 3ELKA 2MH9A 1W7PD 3JTGA 3LA2A 4EM0B 1I6XA 3CUQB 2VODA 1YLFA 3GWZA 3IKTA 4EM1A 4WXDA 3F8FA 5FD6A 2V1XA 1IAWA 2ISZA 1KU2A 5EEHA 4MGRA 3RPUA 2NRAC 5TJJA 2ZKZA 2XVCA 3T5XA 2R3SA 3ZMVA 2FEZA 1HKQA 3MZYA 2LNBA 2GIVA 2P6SA 4BXUA 5LEKA 3SZTA 2Z5UA 4OMZA 1U8RA 1HKSA 5HDGA 4U88A 3GEZA 4GO1A 4KDPA 4AD9A 3W6KB 3E5UA 4RGXA 2V9VA 3K1MA 1SD7A 1R22A 2XAJA 4A12A 2MLKA 4EGZA 3IWZA 3CUQA 1D8JA 3QU6A 3G73A 1FT9A 1ZREA 3N97A 3RTRA 1KQ9A 4M9XA 3MEXA 3NRVA 2ADUA 5HS7A 4IRIA 2PN6A 1DPRA 3GUDA 2HTJA 3MZHA 4A2UA 3F23A 2LF8A 1OYWA 3J81K 5FGMA 4LG0B 2A68F 5D5VB 2C6YA 4UV8A 1HW1A 3VB2A 5H6QA 3O6BB 2L3DA 1GXQA 2H94A 3KE2A 4LB6B 2NNYA 2CYYA 2WWYA 1LNWA 4HBLA 4M6XA 3DXJF 1MKMA 4HOBA 1I5ZA 4HZFA 4GCVA 3F8NA 2ZFWA 1XGOA 1USTA 2WC2A 3HYIA 4WF2A 5CJ9A 2PMHA 5LRSA 4M6YA 4RS8A 2KIUA 4I7HA 5L3EA 4YFKF 3J7AO 2FE3A 4LG0A 1F9NA 2CQKA 4BAYA 4CDGA 1STZA 5L3CA 1S7AA 3E6CC 2G9WA 2A6HF 3LSTA 2NNNA 3WTWC 3R4KA 4WWCA 2H6BA 1REPC 1XB4A 3N4MA 3D0SA 2VE8A 1K6OA 3RYPA 4KA4A 2FMLA 1CF7B 2F5EA 3HRMA 3C3WA 3WG9A 3H92A 2VBZA 3HIFA 4HX4A 4LK0F 2QQBA 3KFWX 1XN7A 5D4SA 1BJAA 1B9NA 1EV7A 1AOYA 5HDKA 3QOPA 1XDUA 2IA1A 2CSOA 2ETHA 2D1VA 4E70A 5LHIA 1TLHB 2ZNYA 3RKYA 4MQ9F 3VOEA 1XGSA 4ZYHA 4HDVA 3TDUC 4P5OA 2QLZA 2RNJA 3Q9VA 1IZ1A 2P7CB 3TO9A 4FT8A 3CTAA 1R1VA 3KEQA 1C0WA 2Z33A 2JT1A 3F8CA 3GYHX 5F6FA 4OOIA 1U5TA 4G8XA 4AWXB 1WRJA 4B09A 4MNUA 3M7GA 2QQ9A 1LQ1A 5JHUA 4RB1A 4ASNA 2W57A 4HYEA 3RI4A 4QWQA 1TW3A 1ZGJA 4GXOA 3FX3A 2W24A 1LDJA 3QP5A 1OYYA 4PZJA 1J9IA 3B73A 5LHHA 1JGSA 1ON2A 3U9GA 3ABTA 4DQ2A 3ZN1A 4I09A 1ZLJA 3T1BA 5AONA 1ULYA 3K0LA 2VONA 3FMSA 3KP4A 1YS6A 2HR3A 4JBAA 3T0YA 3MWMA 2RV8A 4FHTA 1TQIA 3CJNA 4RGSA 3GZ5A 3VFZA 1HBXG 1G6NA 3M1EA 2BV6A 1R36A 1XGNA 5E8IA 3V7RA 4ETSA 1TNTA 2KKOA 2KJCA 1S8NA 3EUHA 1K79A 5ICEA 1ZG1A 1FBSA 1B6AA 2FXAA 2DBBA 1ZRDA 2CO5A 1B1BA 3RDIA 1J0RA 1H0MA 2YX7A 4KT5C 4A6EA 4ZZDA 4ZH4F 2Z99A 2Z9OA 1QQIA 4ZYEA 3SZPA 1R23A 3PQKA 2QM3A 3GFJA 5D6FA 2EFOA 1ZGAA 4O3MA 3K1NA 2K27A 4KMFA 3HSEA 2ACJA 1T39A 5LBQA 2OAZA 5K5RA 5K1YA 4Y17A 1MD0A 2P6TA 1O3SA 3KLNA 4UHTA 2HKOA 3CO7C 2MD5A 4ESFA 4RAYA 1YS7A 3CO6C 3WU1B 4RB2C 3F21A 4EV0A 3P9KA 2JPCA 1G3WA 4Q48A 1SFUA 2A3SA 3TO7A 2RQPA 3QRFF 4PGGA 1ZH5A 3ZPLA 1FYMA 1OR7A 4OIRF 2E1CA 2P5KA 5E1ZB 1FX7A 1ZLKA 2UXNA 3KP2A 4HF0A 2XKOA 5D4RA 2XAQA 1HSTA 1V3FA 1QZZA 4R8HA 4ESBA 1TTYA 3M8FA 1G3YA 1T0FA 3I5UA 4OU0A 4KUMA 5DD8A 1MGTA 5BMZA 4LK1F 4ZYGA 3PQJA 2DT5A 3GFLA 2FNAA 2Q2EA 1WWXA 4A5NA 4GYGA 1T38A 2O6GE 5HLIA 4EQQA 1XSVA 1SFEA 3I54A 1LDKB 3IHUA 5L3BA 2FA5A 1IRFA 2LKPA 4HA8A 1S6LA 4BHCA 2VBYA 1IXSB 1QNTA 3WE3A 2QBYB 3JTHA 4WK8F 1FC3A 2HQNA 1KU7A 2JTVA 4CICA 1EH8A 3P9CA 4WXHA 1ZYRF 1BI3A 2EV0A 1SFXA 2RN7A 2FOKA 2P8TA 5KVRA 5D8KB 5ICGA 1LEAA 1QO0D 2AXLA 4OMYA 3IC7A 2QUFA 4FX0A 1ODDA 2VBXA 1FZPB 3FHZA 3ML6A 2L4AA 1P92A 4OINF 1J59A 4I01A 2A5YB 4BQAA 3V7CA 4EJWA 3HTUA 4IJAA 2EA4A 3HOSA 4UXNA 2YPRA 2GXBA 4HDUA 1O3QA 5AIQA 5J6XA 1OKRA 4PGHA 1H9GA 2HOEA 2QBYA 3JSPA 1P4WA 1KA8A 2R7FA 2CWEA 2DO7A 2IPQX 4BHBA 1FWZA 1T6SA 4MTDA 2IT0A 1Z9CA 3BJ6A 2FSWA 2DPUA 1FLIA 3O2PE 1DP7P 3DF8A 1PDNC 4L0YB 1TW2A 1D8KA 2GQQA 2M87A 4N9HA 2ESHA 3GLXA 2DLLA 2GWRA 5DYMA 5JFRA 2IW5A 3ZQ7A 4CHUA 4NHJA 2GA1A 2KJBA 5D5UB 1IRGA 5EEGA 2HEOA 3QPHA 1RNLA 4KN7X 1ON1A 1D5VA 2GA2A 1V4RA 4HQEA 4BYYA 2MC3A 3DV8A 1HKTA 3HRUA 1FP2A 2FU4A 3IKVA 5HOOA 2O3FA 2EFPA 4P9UA 2XRNA 2VC0A 3WE2A 3QP6A 2ZBKA 2BE5F 2BGCA 2MLGA 1S3JA 3F8MA 2DW4A 4L9JA 3E6MA 3COAC 4ZZLA 4I0BA 2XAHA 3FMQA 3ECHA 3RIRA 1O7FA 2NS0A 2M30A 2V79A 3SHFA 1ONVA 1ZHFA 2HZTA 4TV7A 1R1UA 1E2XA 3HTSB 3HOTA 4RB0A 1Z1DA 4D0PA 5BS6A 5LGNA 2B0LA 2HKXA 5A2QK 5ERIA 1I1SA 4UVAA 1U78A 2GZWA 1IXCA 4A5MA 3J80K 1U5TC 2G7UA 1HW5A 2HYGD 5LLQA 2QQAA 4ZYDA 1R5GA 5HVQC 1FYKA 4EJVA 3LAPA 1LDDA 2XIGA 1HW2A 1GVJA 4ON0A 2LSOA 3SXYA 1YW8A 3LA7A 3MCZA 1KU9A 1RUNA 1U5TB 3E5QA 3GO5A 2A69F 4U0VA 2EV5A 5L3FA 3F6VA 5LHGA 1UFMA 4Q5SF 3KCCA 3E6BA 3ZMUA 4OIPF 2R7DA 4DNCA 2HWVA 3I53A 4M73A 1VTNC 3VEPA 4QLCU 1Z7UA 2BEOA 2PMUA 3J81Z 1KQ8A 4I02A 2RGVA 2VE9A 1A04A 4LLGF 2DK8A 2DTRA 2O61A 2D2WA 4ESJA 2EA2A 2NYXA 3WU0A 2KIMA 3BOQA 1BIAA 5K5QA 4KNYA 3LQQA 1YG2A 1IN8A 4BH9A 3M9AA 1MJ9A 1TQPA 2YX4A 3R0JA 3CUOA 4XBFA 4AIHA 4I0AA 5CVUA 3C7JA 2NAZA 1FY7A 3HHGA 3JAMK 3FZVA 2M45A 2DU9A 2E1NA 1J5YA 3HRSA 1U2WA 2ZXJA 5ILUA 3LFKA 4G7OF 5L3DA 2OZUA 1Z91A 2EB7A 4UVCA 4LMYA 3NEUA 2A6EF 1W4MA 5AIPA 5A2QZ 3OOPA 3H3ZA 4G9YA 2FMYA 3KLOA 4KICA 4G94A 2P4WA 3E6DA 1IN5A 4RGRA 2X4HA 3JW4A 2JZYA 2DK5A 1P4AA 2VC1A 3M8EA 2DAOA 5JVTA 2ELHA 2OZ6A 4YG2F 1GXPA 4HAMA 5J8CA 1D3YA 3G3ZA 4S04A 1QBJA 4LD5A 3IRQA 2QWWA 2LDUA 2PJPA 1MJBA 4B8XA 2Q0OA 4G7HF 3TQNA 4RGUA 1SD4A 2XKPA 2VT2A 4LLLA 4LJZF 3ULQB 1YTYA 2FRHA 5CVJA 1XDSA 2HTSA 2A61A 5JR3A 1P4XA 2FBKA 3CDHA 1BIBA 2RDPA 3BPVA 1YIOA 2JSCA 4GGGA 3BP8A 3ZP5A 1TNSA 2OBPA 3HRTA 2K4BA 3RKXA 2K02A 3V8JA 1W7PA 4I98B 1ZG3A 5E1XA 4YIFA 4L18B 1Z6TA 1T2KA 2CGPA 3L2CA 1G3SA 2JPBA 4ENJA 1J2XA 1JXSA 5JI6A 2EK5A 1U3EM 5H6RA 4ENMA 3BY6A 2EWNA 4HLYA 4IPAA 3WTZA 2YSRA 3C1DA 4WX9A 3ECOA 1MDMB 2P5VA 5ILVA 4U7BA 5ILSA 2V1DA 4Z2YA 2YU3A 1OYIA 3L9FA 2DQLA 3IRRA 4WCGA 1WQ2A 2YR2A 3AAFA 2XHKA 3WTYC 2PFBA 5CVRA 3JSOA 4R1HA 2L54A 4KYWA 1IUYA 2CW0F 2BYVE 3IWFA 5D6EA 1WI9A 3E3VA 3HHHA 1ZARA 3KZYA 3GW2A 2FBIA 2P5LC 5E8GA 4IHTA 3F3XA 1F1ZA 3TKYA 3KETA 5DCMB 1RIOH 1MDMA 2FNPA 5E20A 1O3TA 4EJTA 1BBYA 3Q5FA 2QZ8A 2FBHA 4ENNA 1KU3A 3F6OA 1SMYF 4XLPF 1ZRCA 3K9TA 1PP7U 4L9NA 1YO5C 1USSA 2Y0MA 1DPUA 4KN4X 1NHAA 3ABUA 5DUIA 1IXRC 2XASA 4PDKA 1B4AA 2VT3A 2PI0A 3WTTC 1XSDA 4EM2A 5BQTA 4NB5A 3F72A 4HF2A 3WGHA 2L4MA 2E7XA 4Y15A 1JHHA 5F1RA 5DCMA 3BJOA 4G6DA 5J8FA 4YFXF 3ROUA 4F7ZA 1J7KA 2L02A 2PBIA 3VODA 1TQMA 3QPTA 1RZ4A 3BZ6A 3KP3A 2O03A 5ICCA 2OQGA 2J5OA 2XV4S 2MH2A 4M74A 5K5OA 4M71A 3REOA 1BI2A 4M72A 2W85A 2PEXA 2VN2A 3KP7A 2CFXA 1EH6A 5D8LB 2UXXA 3FXQA 5DEQA 2K86A 4I2OA 1O7LA 1HXDA 3S2WA 3RYRA 2H27A 5FFZA 1S29A 4UV9A 4EJOA 1DUXC 4A6DA 3ISPA 4OIQF 2HFHA 4HF1A 1ZAOA 2DQRA 3WTUC 3C18A 2PQ8A 1BC8C 3WGGA 3I0TA 1B59A 2HQRA 3WTVC 5CVVA 3TO6A 4NQWA 1PUEE 3H3UA 5DCFA 4A0XA 4CO8A 1U6GA 3GXOA 3R6SA 2IA2A 5FFXA 2Q8KA 2K4JA 4EJUA 1IN6A 2ZO4A 4KIBA 3GF2A 1LB2A 1YW7A 2GXGA 5L3GA 1IN4A 2X0LA 2LF7A 1TBXA 3E97A 1IN7A 2IVMA 4YIIA 1UHWA 2XAFA 3ZMSA 1G4DA 2UWMA 1GHCA 2ZCWA 5LGUA 1FSEA 2M1BA 1DDNA 1G3TA 5DV5A 3ZMDA 3EYIA 3MQ0A 3TDZC 3BJAA 1FP1D 5DD4A 4K2EA 2WV0A 2QVOA 3LQRA 2W25A 5CYVA 2HS5A 3NQOA 2PLYA 1FOKA 1JHFA 4CGZA 3OV8A 3RPQA 2J5PA 1LVAA 4Q47A 2EJRA 1X3UA 1XSXA 2IA0A 1JE8A 4KFCA 3KZZA 1UB9A 1E17A 4R79A 1HSJA 2EFQA 1O3RA 5DUKA 4KIGA 3T8RA 1WSUA 4HX8A 4OIOF 4UVBA 4EVIA 4RAZA 3V4GA 1UCRA 3WTSC 3R61A 3L7WA 2MA3A 1BOAA 4XLNF 3DP7A 3ZMZA 5D5XB 1I1GA 4LFUA 2Y48A 4A0YA 1K7AA 1KYWA 3GX4X 2ZJ2A 5ICFA 1CGPA 5DDGA 2GAUA 3F8BA 2VOPA 5HDNA 3FF5A 3WTXC 1UHMA 2IJLA 4MEXF 4XRFA 5IT9K 4IXAA 1HQCA 4L5JA 3W6JB 1FBQA 5FB2A 3BROA 4GYIA 3T8TA 3FM3A 3F22A 3DPTA 1BN5A 1ZG5A 2HDCA 4ENKA 3GFMA 2DPDA 4HX7A 4U0WA 2HYFA 1ZN2A 1R7JA 1B9MA 2XGXA 2VXZA 1O57A 2FF4A 2ZMEB 3TOAA 4LGWA 1XMKA 2PG4A 4L9VA 3U1DA 4LB5A 2Z3YA 4JQFA 4U0YA 1SD5A 4MTEA 1IF1A 4G7ZF 5E1WA 1R58A 4L0ZB 2XROA 1SD6A 2L01A 3R0AA 1KGSA 1Q1HA 3HSRA 3ZN0A 4Y13A 3FXRA 3PFIA 5FO5A 1XCVA 1PP8F 3FMRA 4IF4A 1CF7A 5D5WB 2OU2A 3LWFA 2M5WA 1W5TA 1FYLA 4U7DA 1P2FA 1BI0A 3L09A 2RVCA 4CXFA 4O5VA 3ZMTA 1RUOA 1MZBA 2IRFG 4BNCA 2ZMEA 2A07F 1Y0UA 2COMA 3FXUA 1H9TA 3Q9SA 2EFWA 3DKWA 5LEJA 4AIKA 3J80Z 1XD7A 4L5IA 3I59B 3BWGA 4O6JA 4L9TA 2F5FA 3QU3A 2TDXA 3DFGA 3QAHA 1W7PB 2STTA 1WKMA 1SAXA 5IT9Z 4UUVA 4AVPA 4IHSA 4IVNA 5FLXK 2OA4A 4YFNF 5BPDA 3GZ6A 2KRFA 4KMUX 1R5HA 1FNNA 1BI1A 5ED4A 1XMAA 3EYYA 3SFZA 3TGNA 4HW0A 4HV6A 2DFIA 4S05A 3I58A 3SQNA 2QENA 5HS9A 3I64A 3DQVC 5HLHA 3MFKA 2EV6A 2RC4A 5H20A 1MJAA 4P9FA 3DPLC 3I59A 3BDDA 3B02A 1I27A 2O8XA 1FPQA 2MBFA 3RJPA 4LLNA 4P55A 1ZRFA 5F64A 4UNOA 3P9IA 2F5DA 3WGIA 2WTEA 1YYVA 2IP2A 2CG4A 4JK1X 1YW9A 4WXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AS5 F;  6PAX A;  5E18 F;  1KYZ A;  1F5T A;  1Z05 A;  2EFN A;  4Q4Z F;  3JAM Z;  5BOX A;  1R00 A;  3WOD F;  4A0Z A;  2H09 A;  4M9Z A;  4PCQ A;  4RB3 C;  4HLX A;  1OMI A;  4AIJ A;  5HLG A;  3FWE A;  3KP5 A;  5HS8 A;  2OD5 A;  4EMS A;  1YFH A;  1W5S A;  1Z6R A;  3V8K A;  2FQ3 A;  1P6R A;  2STW A;  2UZK A;  4G6Q A;  1AWC A;  3K69 A;  4N0B A;  3LAJ A;  2ISY A;  1L0O C;  1QPM A;  2W84 A;  4XSX F;  3ERE D;  3V8L A;  4H0E A;  3KP6 A;  2KIF A;  3RKW A;  2HGC A;  5BPI A;  3LA3 A;  3MAJ A;  1K78 B;  3GFI A;  3EET A;  5LRR A;  3P7N A;  2O0Y A;  4XSZ F;  1QGP A;  1FBU A;  1R1T A;  3DEU A;  5FLX Z;  2QYO A;  1FSH A;  4MQV A;  1EH7 A;  3R60 A;  2F2E A;  3I71 A;  2G7H A;  1YQA A;  2DI3 A;  3I4P A;  1L3L A;  3O3K A;  5E17 F;  1QZY A;  2BBY A;  4N9I A;  5FD5 A;  2H6C A;  2F5C A;  4HQM A;  4HV5 A;  4MEY F;  3TOB A;  3K2Z A;  4CYD A;  2V6C A;  4IRG A;  3U2R A;  1F4K A;  4BHP A;  4P96 A;  3KEO A;  4KIF A;  3L00 A;  1K78 A;  3FM5 A;  2V1U A;  1LEB A;  2RKH A;  4FX4 A;  2VOO A;  1XCB A;  2D45 A;  4IRH A;  2ZNZ A;  5CVI A;  1BM9 A;  1S7O A;  5TRD A;  1T98 A;  3HUG A;  1J75 A;  1RI7 A;  5KK1 A;  1LJ9 A;  1BC7 C;  5LGT A;  2P7V B;  2E7W A;  2JRT A;  2XAG A;  3BPX A;  3K1P A;  4CZZ A;  2Y75 A;  2VBW A;  2M8E A;  3IL2 A;  5IT3 A;  2ESN A;  4EGY A;  3D5L A;  3EQL F;  2XUB A;  4MHG A;  3V7S A;  3GVA A;  3CLO A;  3E5X A;  4M9S A;  1IW7 F;  1XGM A;  3EDP A;  2OQR A;  5CLS A;  3CUQ C;  2D1H A;  3HSF A;  1OPC A;  1KQ0 A;  1SMT A;  2K7L A;  3ELK A;  2MH9 A;  1W7P D;  3JTG A;  3LA2 A;  4EM0 B;  1I6X A;  3CUQ B;  2VOD A;  1YLF A;  3GWZ A;  3IKT A;  4EM1 A;  4WXD A;  3F8F A;  5FD6 A;  2V1X A;  1IAW A;  2ISZ A;  1KU2 A;  5EEH A;  4MGR A;  3RPU A;  2NRA C;  5TJJ A;  2ZKZ A;  2XVC A;  3T5X A;  2R3S A;  3ZMV A;  2FEZ A;  1HKQ A;  3MZY A;  2LNB A;  2GIV A;  2P6S A;  4BXU A;  5LEK A;  3SZT A;  2Z5U A;  4OMZ A;  1U8R A;  1HKS A;  5HDG A;  4U88 A;  3GEZ A;  4GO1 A;  4KDP A;  4AD9 A;  3W6K B;  3E5U A;  4RGX A;  2V9V A;  3K1M A;  1SD7 A;  1R22 A;  2XAJ A;  4A12 A;  2MLK A;  4EGZ A;  3IWZ A;  3CUQ A;  1D8J A;  3QU6 A;  3G73 A;  1FT9 A;  1ZRE A;  3N97 A;  3RTR A;  1KQ9 A;  4M9X A;  3MEX A;  3NRV A;  2ADU A;  5HS7 A;  4IRI A;  2PN6 A;  1DPR A;  3GUD A;  2HTJ A;  3MZH A;  4A2U A;  3F23 A;  2LF8 A;  1OYW A;  3J81 K;  5FGM A;  4LG0 B;  2A68 F;  5D5V B;  2C6Y A;  4UV8 A;  1HW1 A;  3VB2 A;  5H6Q A;  3O6B B;  2L3D A;  1GXQ A;  2H94 A;  3KE2 A;  4LB6 B;  2NNY A;  2CYY A;  2WWY A;  1LNW A;  4HBL A;  4M6X A;  3DXJ F;  1MKM A;  4HOB A;  1I5Z A;  4HZF A;  4GCV A;  3F8N A;  2ZFW A;  1XGO A;  1UST A;  2WC2 A;  3HYI A;  4WF2 A;  5CJ9 A;  2PMH A;  5LRS A;  4M6Y A;  4RS8 A;  2KIU A;  4I7H A;  5L3E A;  4YFK F;  3J7A O;  2FE3 A;  4LG0 A;  1F9N A;  2CQK A;  4BAY A;  4CDG A;  1STZ A;  5L3C A;  1S7A A;  3E6C C;  2G9W A;  2A6H F;  3LST A;  2NNN A;  3WTW C;  3R4K A;  4WWC A;  2H6B A;  1REP C;  1XB4 A;  3N4M A;  3D0S A;  2VE8 A;  1K6O A;  3RYP A;  4KA4 A;  2FML A;  1CF7 B;  2F5E A;  3HRM A;  3C3W A;  3WG9 A;  3H92 A;  2VBZ A;  3HIF A;  4HX4 A;  4LK0 F;  2QQB A;  3KFW X;  1XN7 A;  5D4S A;  1BJA A;  1B9N A;  1EV7 A;  1AOY A;  5HDK A;  3QOP A;  1XDU A;  2IA1 A;  2CSO A;  2ETH A;  2D1V A;  4E70 A;  5LHI A;  1TLH B;  2ZNY A;  3RKY A;  4MQ9 F;  3VOE A;  1XGS A;  4ZYH A;  4HDV A;  3TDU C;  4P5O A;  2QLZ A;  2RNJ A;  3Q9V A;  1IZ1 A;  2P7C B;  3TO9 A;  4FT8 A;  3CTA A;  1R1V A;  3KEQ A;  1C0W A;  2Z33 A;  2JT1 A;  3F8C A;  3GYH X;  5F6F A;  4OOI A;  1U5T A;  4G8X A;  4AWX B;  1WRJ A;  4B09 A;  4MNU A;  3M7G A;  2QQ9 A;  1LQ1 A;  5JHU A;  4RB1 A;  4ASN A;  2W57 A;  4HYE A;  3RI4 A;  4QWQ A;  1TW3 A;  1ZGJ A;  4GXO A;  3FX3 A;  2W24 A;  1LDJ A;  3QP5 A;  1OYY A;  4PZJ A;  1J9I A;  3B73 A;  5LHH A;  1JGS A;  1ON2 A;  3U9G A;  3ABT A;  4DQ2 A;  3ZN1 A;  4I09 A;  1ZLJ A;  3T1B A;  5AON A;  1ULY A;  3K0L A;  2VON A;  3FMS A;  3KP4 A;  1YS6 A;  2HR3 A;  4JBA A;  3T0Y A;  3MWM A;  2RV8 A;  4FHT A;  1TQI A;  3CJN A;  4RGS A;  3GZ5 A;  3VFZ A;  1HBX G;  1G6N A;  3M1E A;  2BV6 A;  1R36 A;  1XGN A;  5E8I A;  3V7R A;  4ETS A;  1TNT A;  2KKO A;  2KJC A;  1S8N A;  3EUH A;  1K79 A;  5ICE A;  1ZG1 A;  1FBS A;  1B6A A;  2FXA A;  2DBB A;  1ZRD A;  2CO5 A;  1B1B A;  3RDI A;  1J0R A;  1H0M A;  2YX7 A;  4KT5 C;  4A6E A;  4ZZD A;  4ZH4 F;  2Z99 A;  2Z9O A;  1QQI A;  4ZYE A;  3SZP A;  1R23 A;  3PQK A;  2QM3 A;  3GFJ A;  5D6F A;  2EFO A;  1ZGA A;  4O3M A;  3K1N A;  2K27 A;  4KMF A;  3HSE A;  2ACJ A;  1T39 A;  5LBQ A;  2OAZ A;  5K5R A;  5K1Y A;  4Y17 A;  1MD0 A;  2P6T A;  1O3S A;  3KLN A;  4UHT A;  2HKO A;  3CO7 C;  2MD5 A;  4ESF A;  4RAY A;  1YS7 A;  3CO6 C;  3WU1 B;  4RB2 C;  3F21 A;  4EV0 A;  3P9K A;  2JPC A;  1G3W A;  4Q48 A;  1SFU A;  2A3S A;  3TO7 A;  2RQP A;  3QRF F;  4PGG A;  1ZH5 A;  3ZPL A;  1FYM A;  1OR7 A;  4OIR F;  2E1C A;  2P5K A;  5E1Z B;  1FX7 A;  1ZLK A;  2UXN A;  3KP2 A;  4HF0 A;  2XKO A;  5D4R A;  2XAQ A;  1HST A;  1V3F A;  1QZZ A;  4R8H A;  4ESB A;  1TTY A;  3M8F A;  1G3Y A;  1T0F A;  3I5U A;  4OU0 A;  4KUM A;  5DD8 A;  1MGT A;  5BMZ A;  4LK1 F;  4ZYG A;  3PQJ A;  2DT5 A;  3GFL A;  2FNA A;  2Q2E A;  1WWX A;  4A5N A;  4GYG A;  1T38 A;  2O6G E;  5HLI A;  4EQQ A;  1XSV A;  1SFE A;  3I54 A;  1LDK B;  3IHU A;  5L3B A;  2FA5 A;  1IRF A;  2LKP A;  4HA8 A;  1S6L A;  4BHC A;  2VBY A;  1IXS B;  1QNT A;  3WE3 A;  2QBY B;  3JTH A;  4WK8 F;  1FC3 A;  2HQN A;  1KU7 A;  2JTV A;  4CIC A;  1EH8 A;  3P9C A;  4WXH A;  1ZYR F;  1BI3 A;  2EV0 A;  1SFX A;  2RN7 A;  2FOK A;  2P8T A;  5KVR A;  5D8K B;  5ICG A;  1LEA A;  1QO0 D;  2AXL A;  4OMY A;  3IC7 A;  2QUF A;  4FX0 A;  1ODD A;  2VBX A;  1FZP B;  3FHZ A;  3ML6 A;  2L4A A;  1P92 A;  4OIN F;  1J59 A;  4I01 A;  2A5Y B;  4BQA A;  3V7C A;  4EJW A;  3HTU A;  4IJA A;  2EA4 A;  3HOS A;  4UXN A;  2YPR A;  2GXB A;  4HDU A;  1O3Q A;  5AIQ A;  5J6X A;  1OKR A;  4PGH A;  1H9G A;  2HOE A;  2QBY A;  3JSP A;  1P4W A;  1KA8 A;  2R7F A;  2CWE A;  2DO7 A;  2IPQ X;  4BHB A;  1FWZ A;  1T6S A;  4MTD A;  2IT0 A;  1Z9C A;  3BJ6 A;  2FSW A;  2DPU A;  1FLI A;  3O2P E;  1DP7 P;  3DF8 A;  1PDN C;  4L0Y B;  1TW2 A;  1D8K A;  2GQQ A;  2M87 A;  4N9H A;  2ESH A;  3GLX A;  2DLL A;  2GWR A;  5DYM A;  5JFR A;  2IW5 A;  3ZQ7 A;  4CHU A;  4NHJ A;  2GA1 A;  2KJB A;  5D5U B;  1IRG A;  5EEG A;  2HEO A;  3QPH A;  1RNL A;  4KN7 X;  1ON1 A;  1D5V A;  2GA2 A;  1V4R A;  4HQE A;  4BYY A;  2MC3 A;  3DV8 A;  1HKT A;  3HRU A;  1FP2 A;  2FU4 A;  3IKV A;  5HOO A;  2O3F A;  2EFP A;  4P9U A;  2XRN A;  2VC0 A;  3WE2 A;  3QP6 A;  2ZBK A;  2BE5 F;  2BGC A;  2MLG A;  1S3J A;  3F8M A;  2DW4 A;  4L9J A;  3E6M A;  3COA C;  4ZZL A;  4I0B A;  2XAH A;  3FMQ A;  3ECH A;  3RIR A;  1O7F A;  2NS0 A;  2M30 A;  2V79 A;  3SHF A;  1ONV A;  1ZHF A;  2HZT A;  4TV7 A;  1R1U A;  1E2X A;  3HTS B;  3HOT A;  4RB0 A;  1Z1D A;  4D0P A;  5BS6 A;  5LGN A;  2B0L A;  2HKX A;  5A2Q K;  5ERI A;  1I1S A;  4UVA A;  1U78 A;  2GZW A;  1IXC A;  4A5M A;  3J80 K;  1U5T C;  2G7U A;  1HW5 A;  2HYG D;  5LLQ A;  2QQA A;  4ZYD A;  1R5G A;  5HVQ C;  1FYK A;  4EJV A;  3LAP A;  1LDD A;  2XIG A;  1HW2 A;  1GVJ A;  4ON0 A;  2LSO A;  3SXY A;  1YW8 A;  3LA7 A;  3MCZ A;  1KU9 A;  1RUN A;  1U5T B;  3E5Q A;  3GO5 A;  2A69 F;  4U0V A;  2EV5 A;  5L3F A;  3F6V A;  5LHG A;  1UFM A;  4Q5S F;  3KCC A;  3E6B A;  3ZMU A;  4OIP F;  2R7D A;  4DNC A;  2HWV A;  3I53 A;  4M73 A;  1VTN C;  3VEP A;  4QLC U;  1Z7U A;  2BEO A;  2PMU A;  3J81 Z;  1KQ8 A;  4I02 A;  2RGV A;  2VE9 A;  1A04 A;  4LLG F;  2DK8 A;  2DTR A;  2O61 A;  2D2W A;  4ESJ A;  2EA2 A;  2NYX A;  3WU0 A;  2KIM A;  3BOQ A;  1BIA A;  5K5Q A;  4KNY A;  3LQQ A;  1YG2 A;  1IN8 A;  4BH9 A;  3M9A A;  1MJ9 A;  1TQP A;  2YX4 A;  3R0J A;  3CUO A;  4XBF A;  4AIH A;  4I0A A;  5CVU A;  3C7J A;  2NAZ A;  1FY7 A;  3HHG A;  3JAM K;  3FZV A;  2M45 A;  2DU9 A;  2E1N A;  1J5Y A;  3HRS A;  1U2W A;  2ZXJ A;  5ILU A;  3LFK A;  4G7O F;  5L3D A;  2OZU A;  1Z91 A;  2EB7 A;  4UVC A;  4LMY A;  3NEU A;  2A6E F;  1W4M A;  5AIP A;  5A2Q Z;  3OOP A;  3H3Z A;  4G9Y A;  2FMY A;  3KLO A;  4KIC A;  4G94 A;  2P4W A;  3E6D A;  1IN5 A;  4RGR A;  2X4H A;  3JW4 A;  2JZY A;  2DK5 A;  1P4A A;  2VC1 A;  3M8E A;  2DAO A;  5JVT A;  2ELH A;  2OZ6 A;  4YG2 F;  1GXP A;  4HAM A;  5J8C A;  1D3Y A;  3G3Z A;  4S04 A;  1QBJ A;  4LD5 A;  3IRQ A;  2QWW A;  2LDU A;  2PJP A;  1MJB A;  4B8X A;  2Q0O A;  4G7H F;  3TQN A;  4RGU A;  1SD4 A;  2XKP A;  2VT2 A;  4LLL A;  4LJZ F;  3ULQ B;  1YTY A;  2FRH A;  5CVJ A;  1XDS A;  2HTS A;  2A61 A;  5JR3 A;  1P4X A;  2FBK A;  3CDH A;  1BIB A;  2RDP A;  3BPV A;  1YIO A;  2JSC A;  4GGG A;  3BP8 A;  3ZP5 A;  1TNS A;  2OBP A;  3HRT A;  2K4B A;  3RKX A;  2K02 A;  3V8J A;  1W7P A;  4I98 B;  1ZG3 A;  5E1X A;  4YIF A;  4L18 B;  1Z6T A;  1T2K A;  2CGP A;  3L2C A;  1G3S A;  2JPB A;  4ENJ A;  1J2X A;  1JXS A;  5JI6 A;  2EK5 A;  1U3E M;  5H6R A;  4ENM A;  3BY6 A;  2EWN A;  4HLY A;  4IPA A;  3WTZ A;  2YSR A;  3C1D A;  4WX9 A;  3ECO A;  1MDM B;  2P5V A;  5ILV A;  4U7B A;  5ILS A;  2V1D A;  4Z2Y A;  2YU3 A;  1OYI A;  3L9F A;  2DQL A;  3IRR A;  4WCG A;  1WQ2 A;  2YR2 A;  3AAF A;  2XHK A;  3WTY C;  2PFB A;  5CVR A;  3JSO A;  4R1H A;  2L54 A;  4KYW A;  1IUY A;  2CW0 F;  2BYV E;  3IWF A;  5D6E A;  1WI9 A;  3E3V A;  3HHH A;  1ZAR A;  3KZY A;  3GW2 A;  2FBI A;  2P5L C;  5E8G A;  4IHT A;  3F3X A;  1F1Z A;  3TKY A;  3KET A;  5DCM B;  1RIO H;  1MDM A;  2FNP A;  5E20 A;  1O3T A;  4EJT A;  1BBY A;  3Q5F A;  2QZ8 A;  2FBH A;  4ENN A;  1KU3 A;  3F6O A;  1SMY F;  4XLP F;  1ZRC A;  3K9T A;  1PP7 U;  4L9N A;  1YO5 C;  1USS A;  2Y0M A;  1DPU A;  4KN4 X;  1NHA A;  3ABU A;  5DUI A;  1IXR C;  2XAS A;  4PDK A;  1B4A A;  2VT3 A;  2PI0 A;  3WTT C;  1XSD A;  4EM2 A;  5BQT A;  4NB5 A;  3F72 A;  4HF2 A;  3WGH A;  2L4M A;  2E7X A;  4Y15 A;  1JHH A;  5F1R A;  5DCM A;  3BJO A;  4G6D A;  5J8F A;  4YFX F;  3ROU A;  4F7Z A;  1J7K A;  2L02 A;  2PBI A;  3VOD A;  1TQM A;  3QPT A;  1RZ4 A;  3BZ6 A;  3KP3 A;  2O03 A;  5ICC A;  2OQG A;  2J5O A;  2XV4 S;  2MH2 A;  4M74 A;  5K5O A;  4M71 A;  3REO A;  1BI2 A;  4M72 A;  2W85 A;  2PEX A;  2VN2 A;  3KP7 A;  2CFX A;  1EH6 A;  5D8L B;  2UXX A;  3FXQ A;  5DEQ A;  2K86 A;  4I2O A;  1O7L A;  1HXD A;  3S2W A;  3RYR A;  2H27 A;  5FFZ A;  1S29 A;  4UV9 A;  4EJO A;  1DUX C;  4A6D A;  3ISP A;  4OIQ F;  2HFH A;  4HF1 A;  1ZAO A;  2DQR A;  3WTU C;  3C18 A;  2PQ8 A;  1BC8 C;  3WGG A;  3I0T A;  1B59 A;  2HQR A;  3WTV C;  5CVV A;  3TO6 A;  4NQW A;  1PUE E;  3H3U A;  5DCF A;  4A0X A;  4CO8 A;  1U6G A;  3GXO A;  3R6S A;  2IA2 A;  5FFX A;  2Q8K A;  2K4J A;  4EJU A;  1IN6 A;  2ZO4 A;  4KIB A;  3GF2 A;  1LB2 A;  1YW7 A;  2GXG A;  5L3G A;  1IN4 A;  2X0L A;  2LF7 A;  1TBX A;  3E97 A;  1IN7 A;  2IVM A;  4YII A;  1UHW A;  2XAF A;  3ZMS A;  1G4D A;  2UWM A;  1GHC A;  2ZCW A;  5LGU A;  1FSE A;  2M1B A;  1DDN A;  1G3T A;  5DV5 A;  3ZMD A;  3EYI A;  3MQ0 A;  3TDZ C;  3BJA A;  1FP1 D;  5DD4 A;  4K2E A;  2WV0 A;  2QVO A;  3LQR A;  2W25 A;  5CYV A;  2HS5 A;  3NQO A;  2PLY A;  1FOK A;  1JHF A;  4CGZ A;  3OV8 A;  3RPQ A;  2J5P A;  1LVA A;  4Q47 A;  2EJR A;  1X3U A;  1XSX A;  2IA0 A;  1JE8 A;  4KFC A;  3KZZ A;  1UB9 A;  1E17 A;  4R79 A;  1HSJ A;  2EFQ A;  1O3R A;  5DUK A;  4KIG A;  3T8R A;  1WSU A;  4HX8 A;  4OIO F;  4UVB A;  4EVI A;  4RAZ A;  3V4G A;  1UCR A;  3WTS C;  3R61 A;  3L7W A;  2MA3 A;  1BOA A;  4XLN F;  3DP7 A;  3ZMZ A;  5D5X B;  1I1G A;  4LFU A;  2Y48 A;  4A0Y A;  1K7A A;  1KYW A;  3GX4 X;  2ZJ2 A;  5ICF A;  1CGP A;  5DDG A;  2GAU A;  3F8B A;  2VOP A;  5HDN A;  3FF5 A;  3WTX C;  1UHM A;  2IJL A;  4MEX F;  4XRF A;  5IT9 K;  4IXA A;  1HQC A;  4L5J A;  3W6J B;  1FBQ A;  5FB2 A;  3BRO A;  4GYI A;  3T8T A;  3FM3 A;  3F22 A;  3DPT A;  1BN5 A;  1ZG5 A;  2HDC A;  4ENK A;  3GFM A;  2DPD A;  4HX7 A;  4U0W A;  2HYF A;  1ZN2 A;  1R7J A;  1B9M A;  2XGX A;  2VXZ A;  1O57 A;  2FF4 A;  2ZME B;  3TOA A;  4LGW A;  1XMK A;  2PG4 A;  4L9V A;  3U1D A;  4LB5 A;  2Z3Y A;  4JQF A;  4U0Y A;  1SD5 A;  4MTE A;  1IF1 A;  4G7Z F;  5E1W A;  1R58 A;  4L0Z B;  2XRO A;  1SD6 A;  2L01 A;  3R0A A;  1KGS A;  1Q1H A;  3HSR A;  3ZN0 A;  4Y13 A;  3FXR A;  3PFI A;  5FO5 A;  1XCV A;  1PP8 F;  3FMR A;  4IF4 A;  1CF7 A;  5D5W B;  2OU2 A;  3LWF A;  2M5W A;  1W5T A;  1FYL A;  4U7D A;  1P2F A;  1BI0 A;  3L09 A;  2RVC A;  4CXF A;  4O5V A;  3ZMT A;  1RUO A;  1MZB A;  2IRF G;  4BNC A;  2ZME A;  2A07 F;  1Y0U A;  2COM A;  3FXU A;  1H9T A;  3Q9S A;  2EFW A;  3DKW A;  5LEJ A;  4AIK A;  3J80 Z;  1XD7 A;  4L5I A;  3I59 B;  3BWG A;  4O6J A;  4L9T A;  2F5F A;  3QU3 A;  2TDX A;  3DFG A;  3QAH A;  1W7P B;  2STT A;  1WKM A;  1SAX A;  5IT9 Z;  4UUV A;  4AVP A;  4IHS A;  4IVN A;  5FLX K;  2OA4 A;  4YFN F;  5BPD A;  3GZ6 A;  2KRF A;  4KMU X;  1R5H A;  1FNN A;  1BI1 A;  5ED4 A;  1XMA A;  3EYY A;  3SFZ A;  3TGN A;  4HW0 A;  4HV6 A;  2DFI A;  4S05 A;  3I58 A;  3SQN A;  2QEN A;  5HS9 A;  3I64 A;  3DQV C;  5HLH A;  3MFK A;  2EV6 A;  2RC4 A;  5H20 A;  1MJA A;  4P9F A;  3DPL C;  3I59 A;  3BDD A;  3B02 A;  1I27 A;  2O8X A;  1FPQ A;  2MBF A;  3RJP A;  4LLN A;  4P55 A;  1ZRF A;  5F64 A;  4UNO A;  3P9I A;  2F5D A;  3WGI A;  2WTE A;  1YYV A;  2IP2 A;  2CG4 A;  4JK1 X;  1YW9 A;  4WXC A; 
#chains in the Genus database with same CATH topology
 2B7E A;  3CP2 A;  3TP3 A;  2AS5 F;  6PAX A;  5E18 F;  4AM3 A;  1KYZ A;  2KZG A;  1Z05 A;  2EFN A;  1MH4 A;  4Q4Z F;  1F5T A;  3JAM Z;  5BOX A;  1R00 A;  3WOD F;  4A0Z A;  1IG7 A;  1BJZ A;  2H09 A;  4M9Z A;  4PCQ A;  2FOW A;  4RB3 C;  2R0Q C;  1RPW A;  2DFE A;  1ZK8 A;  4HLX A;  1OMI A;  1V5G A;  2RAE A;  4AIJ A;  5HLG A;  3UKG A;  1R4N B;  1NG6 A;  2XGE A;  3FWE A;  3KP5 A;  5HS8 A;  3LSP A;  5DM7 F;  4F92 B;  2OD5 A;  4EMS A;  2K9S A;  5GAD J;  1OCO H;  3OYC A;  1YFH A;  1W5S A;  3PFY A;  1NG7 A;  1Z6R A;  2EZI A;  3V8K A;  2FQ3 A;  1P6R A;  5JLW A;  2STW A;  2UZK A;  4G6Q A;  3H36 A;  1AWC A;  2WA0 A;  4D7M A;  2BW3 B;  3K69 A;  1VQO I;  4N0B A;  3LAJ A;  3VYS B;  2ISY A;  2N8G A;  2EQR A;  4RA2 A;  4XON A;  2R4G A;  1L0O C;  1QPM A;  3OL4 A;  2Y69 H;  1A6I A;  2DA6 A;  2KT0 A;  4E7K A;  2W84 A;  4XSX F;  3ERE D;  3V8L A;  4H0E A;  1JKP C;  3HOW J;  3S17 J;  2OTL I;  1HCR A;  3KP6 A;  5F1J A;  2KIF A;  3ERM A;  4HEA 2;  3RKW A;  2IEK A;  2HGC A;  2NVQ J;  5BPI A;  3G6E I;  3LA3 A;  3MAJ A;  3OS0 A;  1K78 B;  3GFI A;  3LMM A;  3FIW A;  4A3F J;  1XG1 A;  1LVK A;  3EET A;  5LRR A;  1HLV A;  2DOE A;  2VJJ A;  2OCC H;  2LBF B;  4B1R A;  3P7N A;  2O0Y A;  4ZTF A;  4XSZ F;  3G71 I;  5E3M A;  1QGP A;  3A0B C;  1FBU A;  1R1T A;  1MMG A;  1Z3X A;  3DEU A;  3QYE A;  3ZXS A;  5FLX Z;  1Y39 A;  2V6E A;  2QYO A;  1FSH A;  4MQV A;  1EH7 A;  3R60 A;  2F2E A;  4BAC A;  3I71 A;  5F27 A;  2G7H A;  2XDV A;  4RAG A;  4JP0 A;  2K3F A;  1YQA A;  2DI3 A;  3DKY A;  3I4P A;  4XRM A;  4D1Q A;  2R5Z B;  3HUG B;  1GV5 A;  3K4N A;  1GUU A;  3BCA A;  1L3L A;  2PMZ A;  3O3K A;  5E17 F;  3LSK A;  3TMO A;  1QZY A;  2BBY A;  4N9I A;  1HDP A;  2E19 A;  5FD5 A;  2H6C A;  1FEX A;  2F5C A;  3K4M A;  4HQM A;  3PJR A;  2E5N A;  4HV5 A;  3A4C A;  4DGW B;  2XGC A;  4MEY F;  3TOB A;  4XKB A;  5B5E C;  3ONQ A;  3IAM 2;  3VYU B;  3K2Z A;  1ERD A;  5DS9 A;  3BG9 A;  3JRB A;  5M5X J;  3LSJ A;  4CYD A;  2V6C A;  2H1L A;  4IRG A;  3U2R A;  1F4K A;  4BHP A;  4P96 A;  3KEO A;  4KIF A;  3L00 A;  1JI8 A;  4BY7 J;  1K78 A;  1X3W B;  2X1C A;  1MND A;  4ZDP A;  1Z7L A;  3FM5 A;  2V1U A;  3CC2 I;  2LBF A;  2EIL H;  2ZSH B;  1LEB A;  2RKH A;  4FX4 A;  2VOO A;  1XCB A;  4D9J A;  2D45 A;  4IRH A;  5J3L A;  1IUF A;  1WHU A;  2ZNZ A;  3Q0W A;  5CVI A;  2LFB A;  2Q1Z B;  4BXF A;  2Y9Z A;  1BM9 A;  1S7O A;  5TRD A;  2QGU A;  2IGM A;  1T98 A;  4V2G A;  2R5Z A;  3HUG A;  5FLV A;  3CCR I;  4LG3 A;  1J75 A;  1RI7 A;  4M3F A;  1LJ9 A;  5KK1 A;  1BC7 C;  2JA7 J;  2L7F P;  4ITV A;  4BY1 J;  3GTP J;  2EPF A;  5LD2 C;  5LGT A;  2P7V B;  2Z1D A;  2E7W A;  2JRT A;  2XAG A;  3BPX A;  3K1P A;  4X6A J;  4CZZ A;  2Y75 A;  2VBW A;  2M8E A;  3CMA I;  1ZEL A;  2MG4 A;  3TW6 A;  3IL2 A;  3FHN A;  5IT3 A;  4XOR A;  3BR5 A;  2ESN A;  4E6K G;  4EGY A;  1RES A;  2HVQ A;  3D5L A;  3CJT B;  3EQL F;  2XUB A;  4MHG A;  3V7S A;  2LD5 A;  2KIQ A;  3GVA A;  3J7Z I;  1WFX A;  2HOA A;  2JUC A;  3RCO A;  1VQP I;  3CLO A;  2CUZ A;  2L9V A;  3E5X A;  3H0D A;  5EYR A;  4M9S A;  2LOO A;  4M3G A;  2W48 A;  4BEH B;  1IW7 F;  1XGM A;  3EDP A;  2OQR A;  5CLS A;  3CUQ C;  1YRN A;  1R6R A;  1BL0 A;  2D1H A;  3HSF A;  3KIO A;  1OPC A;  3ZQI A;  1S72 I;  2ID3 A;  2ECB A;  1KQ0 A;  1WH5 A;  1SMT A;  2K7L A;  3BR2 A;  3ELK A;  4OWR B;  3ZQF A;  2MH9 A;  1W7P D;  3SDB A;  3JTG A;  1DP3 A;  3LA2 A;  4EM0 B;  3HB9 A;  3BG5 A;  1I6X A;  3CUQ B;  5F0H A;  2VOD A;  1OFC X;  3PSF A;  4KT6 A;  2P81 A;  1YLF A;  1IV8 A;  3GWZ A;  3IKT A;  4EM1 A;  4N4N B;  4WXD A;  4Z6Y A;  4E7L A;  1WVR A;  4M3D A;  3AG4 H;  2M0C A;  3F8F A;  4JYK A;  4B43 A;  4CYC B;  1AKH B;  5FD6 A;  2V1X A;  1MSE C;  1IAW A;  2V1N A;  2ISZ A;  3GLL A;  3BR3 A;  4E7J A;  4AID A;  1KU2 A;  5EEH A;  2WAE A;  4MGR A;  3CCY A;  2MSY A;  2JUG A;  3I4M J;  1E3O C;  3RPU A;  3O8G A;  2NRA C;  2XF7 A;  5TJJ A;  2ZKZ A;  2XVC A;  1Y8R B;  2LY2 A;  3T5X A;  2R3S A;  3ZMV A;  1X4O A;  2LC2 A;  4CA0 A;  2FEZ A;  5FKL A;  5K7H A;  1HKQ A;  2QQ8 A;  3MZY A;  3P5J A;  2LNB A;  2GIV A;  2P6S A;  4BEH A;  4BXU A;  5LEK A;  3SZT A;  2E2H J;  4BXX J;  1X1B A;  3EUK L;  4N4O B;  2Z5U A;  4OMZ A;  1U8R A;  1HKS A;  5HDG A;  1EJ9 A;  4U88 A;  2HOT A;  3GEZ A;  5IP6 A;  4GO1 A;  4KDP A;  3W6K B;  4AD9 A;  3E5U A;  4RGX A;  2V9V A;  3G2B A;  3K1M A;  1SD7 A;  1VQ6 I;  4BQN A;  2CQ7 A;  1R22 A;  3NAU A;  3WG7 H;  2VJ4 A;  2XAJ A;  2V9P A;  4A12 A;  1OCR H;  2MLK A;  4EGZ A;  1AU7 A;  2X51 A;  1WCM J;  3IWZ A;  3CUQ A;  1D8J A;  3QOD A;  3QU6 A;  3G73 A;  1FT9 A;  1ZRE A;  3N97 A;  2KRH A;  5J1U A;  3RTR A;  1KQ9 A;  2ID6 A;  3JRD A;  4M9X A;  3MEX A;  3NRV A;  4CCK A;  5TIS C;  4Y7N J;  3A03 A;  2ADU A;  5HS7 A;  4IRI A;  2IS2 A;  2PN6 A;  4BUP A;  4XR6 A;  5GTH C;  1N78 A;  1HF0 A;  4LIT A;  5CQE A;  1DPR A;  3GUD A;  1IRZ A;  2HTJ A;  2DMU A;  2ZJR F;  1AKH A;  3MZH A;  4JOM A;  4A2U A;  3ZCO A;  3F23 A;  2CV2 A;  3JRG A;  2LF8 A;  3KPH A;  1OYW A;  3J81 K;  2I5U A;  5FGM A;  4LG0 B;  2A68 F;  3BC8 A;  5D5V B;  3OYJ A;  5FLM J;  3LNQ A;  2XRL A;  2L9R A;  1TC3 C;  1MMA A;  3ZGK A;  2C6Y A;  4UV8 A;  1HW1 A;  3VB2 A;  1IDY A;  5H6Q A;  3O6B B;  2L3D A;  5B1A H;  2HQA A;  1GXQ A;  1OLT A;  2H94 A;  2XC7 A;  4A93 J;  3KE2 A;  4LB6 B;  2NNY A;  2CYY A;  2WWY A;  4A3C J;  1LNW A;  4HBL A;  4M6X A;  3DXJ F;  1MKM A;  4NNJ A;  2VKE A;  4HOB A;  1I5Z A;  2JMW A;  4DBQ A;  1KZH A;  1JT0 A;  4PJJ A;  3DPU A;  3H5N A;  3FKI J;  4HZF A;  2Y0S A;  3BZK A;  2HDW A;  4GCV A;  3F8N A;  2ZFW A;  5KNL A;  2BOL A;  4M3B A;  2KP6 A;  4CSW A;  1T8I A;  1XGO A;  1UST A;  1CQT A;  2WC2 A;  5GP9 A;  3HYI A;  4WF2 A;  5CJ9 A;  5IOY A;  4J19 A;  3W2A A;  3C2G A;  1PYV A;  2DFF A;  3DBL B;  5E3L A;  1G8X A;  1OCT C;  1LUJ B;  3BQZ A;  4A3G J;  1Y0N A;  1VND A;  2PMH A;  5LRS A;  3H3V K;  4M6Y A;  4RS8 A;  2KIU A;  4I7H A;  1ETQ A;  4YFK F;  5L3E A;  3HG9 A;  2VB6 A;  3LSG A;  2L7K A;  4ZYA A;  3HOY J;  2BY1 A;  3J7A O;  2FE3 A;  4LG0 A;  3CCL I;  2AXT C;  1V55 H;  2GBY A;  1F9N A;  2CQK A;  4BAY A;  1ZQ3 P;  4CCN A;  3JCU C;  2DTZ A;  4IO9 F;  4CDG A;  3GTG J;  1STZ A;  2GOX B;  5L3C A;  2JJ7 A;  2K3P A;  2O8K A;  4D5C A;  1S7A A;  1BR4 A;  4IHV A;  3E6C C;  2R7V A;  2G9W A;  2A6H F;  1YX3 A;  3QQA A;  3LST A;  3ZQH A;  4A69 C;  1VQ8 I;  5M3M J;  2NNN A;  3H5A A;  3WTW C;  2XB5 A;  3R4K A;  3SJM A;  3BQY A;  3FXJ A;  4WWC A;  2H6B A;  5EG0 B;  1VFC A;  1REP C;  3EUA A;  1XB4 A;  4C3J J;  2L9S A;  3N4M A;  1VQ7 I;  3MD2 A;  3D0S A;  2VE8 A;  4MFE A;  3RYP A;  4DZP A;  3JRF A;  4KA4 A;  1K6O A;  2VKH A;  4JX6 A;  1DU6 A;  2FML A;  3RQ4 A;  4F3Q A;  1SAU A;  4LIU A;  2CW8 A;  4IX7 A;  1CF7 B;  2F5E A;  3HRM A;  1FJL A;  3C3W A;  3WG9 A;  2G0E A;  2VBZ A;  3H92 A;  4C3H J;  1X1D A;  3OIP A;  3HIF A;  3A1Y A;  4HX4 A;  3WHB A;  1YX5 A;  4B48 A;  2MFZ A;  3HKZ A;  4LK0 F;  2QQB A;  3KFW X;  4AYB N;  1XN7 A;  3TBI A;  5D4S A;  1QU3 A;  1BJA A;  5IYB J;  1B9N A;  1EV7 A;  4FTH A;  4PJL A;  3S14 J;  1AOY A;  2YS9 A;  4PSX A;  5HDK A;  3CZ6 A;  2EIJ H;  3QOP A;  3J7A Y;  3Q0V A;  4JX5 A;  5JVG F;  2DN0 A;  4PUS A;  1XDU A;  2IA1 A;  2IS4 A;  2CSO A;  2ETH A;  1YJW I;  2AO9 A;  2D1V A;  3G1O A;  4E70 A;  2Y30 A;  2KZV A;  4LOC A;  5LHI A;  1TLH B;  2ZNY A;  2KL4 A;  3J7Y J;  1K83 J;  1BA5 A;  2KPM A;  3RKY A;  1Z67 A;  4MQ9 F;  3UNG C;  3VOE A;  1XGS A;  4ZYH A;  4HDV A;  5EG0 A;  4P5O A;  3TDU C;  3FXK A;  3CJQ B;  5E79 C;  2QLZ A;  4XN0 A;  2RNJ A;  1R5I D;  3Q9V A;  2R7T A;  1IZ1 A;  5F0C A;  2P7C B;  3TO9 A;  2ELK A;  4FT8 A;  2LY1 A;  3CTA A;  1R1V A;  3KEQ A;  4XOT A;  5GPC A;  1C0W A;  4C2U A;  5IY5 H;  2Z33 A;  2R93 J;  2JT1 A;  3F8C A;  3GYH X;  5F6F A;  4C3I J;  1QVU A;  3AG3 H;  4OOI A;  1U9N A;  1U5T A;  4EAT A;  4G8X A;  4AWX B;  1W0U A;  1WRJ A;  1RKT A;  4B09 A;  4MNU A;  4HNT A;  3EUH C;  3M7G A;  2QQ9 A;  1B72 B;  1LQ1 A;  3KX2 A;  2LG4 A;  2XSD C;  5KCM A;  5JHU A;  3BTJ A;  2ZFU A;  3GBG A;  4RB1 A;  2E35 A;  2ZC2 A;  4ASN A;  4AVZ A;  2W57 A;  4HYE A;  1WGX A;  3ZQQ A;  2OTJ I;  3PNY A;  3RI4 A;  3BCB A;  4QWQ A;  1YJ9 I;  5JHF A;  1TW3 A;  1ZGJ A;  3CJR B;  4GXO A;  3FX3 A;  1H89 C;  2W24 A;  1LDJ A;  3QP5 A;  2NS8 A;  1OYY A;  4PZJ A;  1J9I A;  3CCU I;  4XOP A;  3B73 A;  5LHH A;  1JGS A;  1ON2 A;  2PJR B;  2W00 A;  2ZXI A;  3U9G A;  5IOZ A;  2GLO A;  3ABT A;  3TW7 A;  2HI3 A;  4DQ2 A;  3PIO F;  1Y1W J;  1VQL I;  3ZN1 A;  1VQ5 I;  1I6H J;  2BY0 A;  4I09 A;  1ORK A;  3AKZ A;  4ZTJ A;  2VXD A;  1JKQ C;  2ZJQ F;  1ZLJ A;  3C2H A;  1HA8 A;  3T1B A;  1S9H A;  3OOU A;  2DJI A;  4FE7 A;  1TWF J;  5AON A;  2L5Q A;  2JWT A;  1ULY A;  3K0L A;  1WH7 A;  5GAG J;  2VON A;  3N05 A;  1MW7 A;  3FMS A;  3ABM H;  1YS6 A;  2HR3 A;  3KP4 A;  2IGN A;  3JRI A;  3S16 J;  1MSF C;  4JBA A;  2BHZ A;  3T0Y A;  3MWM A;  2RV8 A;  3ZRG A;  3ZQL A;  3DCF A;  4FHT A;  2XF5 A;  1TQI A;  3CJN A;  4RGS A;  3W2W A;  4BE2 A;  3QPS A;  3CCV I;  3GZ5 A;  1B72 A;  3VFZ A;  1BR1 A;  1HBX G;  3E0J B;  1G6N A;  3M1E A;  2BV6 A;  1R36 A;  1XGN A;  5E8I A;  3V7R A;  4PSW A;  4ETS A;  1TNT A;  2KKO A;  4XLA A;  2KJC A;  1S8N A;  4C2M J;  4HNV A;  1I3A A;  2NVY J;  3EUH A;  2WAF A;  2Y31 A;  2BY3 A;  1K79 A;  2R7Q A;  5ICE A;  4M6V A;  2PJR A;  1ZG1 A;  3CDL A;  1FBS A;  1B6A A;  2FXA A;  2DBB A;  3RZO J;  4XRS A;  2IBD A;  2E60 A;  1YOV B;  1ZRD A;  2CO5 A;  4LIV A;  1B1B A;  4IHX A;  4A3E J;  3RDI A;  1J0R A;  2JVH A;  1H0M A;  2YX7 A;  4KT5 C;  4A6E A;  3H1C A;  4ZZD A;  2GIZ A;  3CME I;  2CU7 A;  4EEF G;  4ZH4 F;  2Z99 A;  2K9M A;  2Z9O A;  2NXN B;  1QQI A;  5K7F A;  1LE8 B;  2Z16 A;  4ZYE A;  2AHQ A;  3M8J A;  2KRC A;  3SZP A;  1R23 A;  3PQK A;  1AHD P;  5FJ8 J;  2QM3 A;  2F48 A;  2VAS A;  1ETX A;  2YU9 J;  4MIM A;  3A0H C;  1T56 A;  2M7A A;  4HRI A;  2WAQ N;  2CMP A;  3GFJ A;  2NVU B;  4BE1 A;  2R7Z J;  4BL0 B;  1FOX A;  3CC4 I;  2I8D A;  5D6F A;  4E7S A;  1T0F C;  1B8I B;  2EFO A;  1FTT A;  5FKK A;  1ZGA A;  4O3M A;  3K1N A;  3F9K A;  2K27 A;  4KMF A;  3BT9 A;  3HSE A;  2ACJ A;  2EZL A;  1T39 A;  1XX5 A;  5LBQ A;  2OAZ A;  4BE0 A;  2ECC A;  4XN3 A;  5K5R A;  5K1Y A;  2QEX I;  2M0M A;  4Y17 A;  1IRX A;  1YIJ I;  1MD0 A;  1MBF A;  2P6T A;  2DMT A;  1O3S A;  3KLN A;  2KHM A;  4UHT A;  2HKO A;  3CO7 C;  2MD5 A;  4ESF A;  4DYC A;  2CW7 A;  4RAY A;  1UAA A;  3G1L A;  4B3A A;  1YS7 A;  3CO6 C;  1UG0 A;  3WU1 B;  4RB2 C;  2F4O B;  3F21 A;  4EV0 A;  1RKW A;  3P9K A;  2JPC A;  1G3W A;  4Q48 A;  1SFU A;  2A3S A;  3TO7 A;  4DOZ A;  3PUF A;  2RQP A;  3QRF F;  1SC7 A;  3BLY A;  4PGG A;  1ZH5 A;  4D7N A;  3ZPL A;  1FYM A;  1LE8 A;  1OR7 A;  4XM3 A;  4PFO A;  2NVT J;  4OIR F;  2E1C A;  2P5K A;  5E1Z B;  1X1P A;  1FX7 A;  1ZLK A;  2UXN A;  3KP2 A;  4HF0 A;  4F93 B;  1A5J A;  2DA7 A;  3H9J A;  1JTY A;  2XKO A;  4NBQ A;  1ETK A;  5D4R A;  4L5E A;  1B8I A;  3OYG A;  2XAQ A;  1TWA J;  1HST A;  1V3F A;  5B3S H;  1I39 A;  2MGQ A;  3LFU A;  1W0T A;  3WHC A;  1RR7 A;  1QZZ A;  2KIS A;  2H1K A;  4R8H A;  4ESB A;  1MBE A;  1TTY A;  3M8F A;  1H8A C;  2LLK A;  1G3Y A;  4XLF A;  4B44 A;  5HNH A;  2LTP A;  4F52 A;  1T0F A;  3I5U A;  4OU0 A;  1W36 C;  3K70 C;  4KUM A;  1APL C;  4A3J J;  2EIK H;  5DD8 A;  1MGT A;  3IH3 A;  1Y1V J;  2L9N A;  3PL8 A;  4PJN A;  4BDZ A;  5BMZ A;  4LK1 F;  4ZYG A;  3I9V 2;  3PQJ A;  1YRN B;  2DT5 A;  5FRM A;  3GFL A;  2FNA A;  2Q2E A;  3M1C A;  1WWX A;  2MW8 A;  1WJB A;  5C3E J;  2MAB A;  3D5R C;  3BR1 A;  5B66 C;  4A5N A;  3S32 A;  1QA6 A;  2CV1 A;  3ZQG A;  2B63 J;  2DA5 A;  1U8B A;  4GYG A;  4XID A;  1T38 A;  3GTL J;  2O6G E;  1E3H A;  3DLA A;  3BTC A;  2DOD A;  4YEJ A;  3OR1 C;  5HLI A;  4EQQ A;  1XSV A;  1SFE A;  5CPR B;  1UG2 A;  1QPI A;  3I54 A;  3HOX J;  1LDK B;  3IHU A;  1QVT A;  4B3X A;  5L3B A;  4E7Z A;  1VQK I;  3FK6 A;  4F55 A;  2R7X A;  2FA5 A;  1IRF A;  1SVM A;  2LKP A;  1EF4 A;  1EKE A;  3W3C A;  3FIS A;  4HA8 A;  2DDA A;  1R9T J;  1S6L A;  4CCL A;  4BHC A;  2VBY A;  3JRA A;  1POG A;  1IXS B;  1QNT A;  3WE3 A;  3DTE A;  2QBY B;  3JTH A;  1QRY A;  2WB1 N;  1FMV A;  1FC3 A;  4WK8 F;  1IC8 A;  2HQN A;  3OIQ A;  1KU7 A;  3GTK J;  3CF5 F;  3GZN B;  2OCE A;  3FXL A;  2JTV A;  4CIC A;  1VQ4 I;  1EH8 A;  2NS7 A;  4BQO A;  5LFA A;  3P9C A;  4XQF A;  2CUJ A;  4WXH A;  1ZYR F;  3HJE A;  1BI3 A;  2EV0 A;  4BGD A;  3GCM A;  1LFB A;  1SFX A;  3MKL A;  3KYD B;  2RN7 A;  2FOK A;  1WJC A;  2P8T A;  4MFD A;  5KVR A;  3HC7 A;  3CCJ I;  3K4C A;  5D8K B;  5ICG A;  1LEA A;  1QO0 D;  2AXL A;  4OMY A;  3IC7 A;  1S5L C;  2JA6 J;  3MMY B;  2QUF A;  4G12 A;  4DYQ A;  3H0G J;  3H5R A;  5GAE J;  2K5C A;  4FX0 A;  2W7N A;  1ODD A;  4XNF A;  2VBX A;  2LRD A;  1FZP B;  4G6T B;  3CDI A;  3FHZ A;  2HNH A;  3HOU J;  3ML6 A;  2FUG 2;  2L4A A;  1P92 A;  4OIN F;  1J59 A;  4I01 A;  2A5Y B;  3IAS 2;  3OS2 A;  3M07 A;  2VL8 A;  4BQA A;  3V7C A;  4EJW A;  2NVX J;  3HTU A;  4IJA A;  5EJC A;  1ACI A;  2EA4 A;  3QOE A;  3BTI A;  3HOS A;  4UXN A;  4FCY A;  2YPR A;  2GXB A;  4HDU A;  1O3Q A;  3HDD A;  4A3L J;  5AIQ A;  5J6X A;  1OKR A;  4PGH A;  1LPQ A;  1H9G A;  2ME0 A;  1D0X A;  2HOE A;  2QBY A;  2EBI A;  3CCS I;  1NK2 P;  3JSP A;  1P4W A;  1KA8 A;  3PSI A;  2E2J J;  2R7F A;  3AL0 C;  2CWE A;  2DO7 A;  5E3O A;  2IPQ X;  4BHB A;  3I4N J;  4DBR A;  1FWZ A;  1T6S A;  1OCZ H;  4MTD A;  2IT0 A;  3MVP A;  3I3L A;  3OL3 A;  2LKS A;  1A35 A;  4PK4 A;  1Z9C A;  3BJ6 A;  1ETV A;  2FSW A;  2XPW A;  2DPU A;  1A6Q A;  3H35 A;  4BJ5 C;  2CV0 A;  1FLI A;  2WV1 A;  3O2P E;  3W2V A;  1DP7 P;  2HOS A;  2CH0 A;  3DF8 A;  4KIT B;  1PDN C;  4L0Y B;  3AL0 B;  1TW2 A;  1D8K A;  1X2M A;  2GQQ A;  2M87 A;  4N9H A;  1N77 A;  2FQ4 A;  3PIP F;  2ESH A;  1EA3 A;  2XF6 A;  3ABL H;  4V19 K;  2E5Z A;  3GLX A;  2DLL A;  3I55 I;  2GWR A;  5DYM A;  3OYB A;  2JSP A;  3BG6 A;  5JFR A;  2IW5 A;  3MZ8 A;  3K7A J;  4X0G A;  3ZQ7 A;  4XKV A;  5JLX A;  1JJ8 C;  2CQN A;  2DA2 A;  2VJ5 A;  4CHU A;  3E1S A;  4NHJ A;  2GA1 A;  2HXI A;  3X2Q H;  2KJB A;  5D5U B;  1IRG A;  3HOZ J;  3PUB A;  5EEG A;  2O7O A;  3QPH A;  1RNL A;  1OIS A;  2CRG A;  2HEO A;  4KN7 X;  1ON1 A;  1BW5 A;  1D5V A;  2MD0 A;  2GA2 A;  1V4R A;  2F6C A;  4HQE A;  1T95 A;  4BDY A;  1V54 H;  2IGK A;  4UB8 C;  3CES A;  2VUM J;  2X48 A;  3SZG A;  4BYY A;  1WJE A;  2AQE A;  4HSR A;  2CFO A;  4DIQ A;  2CUE A;  2Z2S B;  3K10 A;  4DW6 A;  2MC3 A;  2OUM A;  3DV8 A;  1HKT A;  3HRU A;  1XS9 A;  1FP2 A;  3PNV A;  2FU4 A;  3IKV A;  5HOO A;  1HC8 A;  2O3F A;  2EFP A;  2VPR A;  3DKX A;  4P9U A;  2XRN A;  4RM2 A;  1G2H A;  4I6Z A;  2VC0 A;  3WE2 A;  3QP6 A;  3QWL A;  2ZBK A;  3HZJ A;  2BE5 F;  2BGC A;  2MLG A;  3ZR8 X;  1SFO J;  4AUX A;  1JGG A;  4A3D J;  2K9L A;  2LH9 A;  1S3J A;  2M34 A;  3GTJ J;  3F8M A;  2DW4 A;  4L9J A;  3RQI A;  1G59 A;  3E6M A;  3COA C;  3QYF A;  4ZZL A;  4PFP A;  1P7J A;  4UY8 I;  3DTI A;  4I0B A;  5J1Y A;  2XAH A;  4XIC A;  3FMQ A;  3ECH A;  3RIR A;  1O7F A;  2NS0 A;  1F36 A;  2M30 A;  4PJ0 C;  2V79 A;  4AYB A;  3Q0U A;  1Z77 A;  3SHF A;  1ONV A;  1ZHF A;  2HZT A;  5KAF C;  4TV7 A;  1WJF A;  1R1U A;  1E2X A;  3H9G A;  3HTS B;  1PJR A;  4ANJ A;  2M4G A;  1ETO A;  3NAR A;  3HOT A;  4RB0 A;  1Z1D A;  4S0H B;  4D0P A;  1E3P A;  1Z21 A;  1GLN A;  3VSL A;  5BS6 A;  5LGN A;  2B0L A;  2HKX A;  5A2Q K;  2OC6 A;  4MO7 A;  5ERI A;  1I1S A;  4UVA A;  1U78 A;  4QIW N;  2ZXH A;  2IS6 A;  5J47 A;  2GZW A;  1IXC A;  4A5M A;  3J80 K;  2QSG X;  1U5T C;  2G7U A;  1HW5 A;  2HYG D;  2VQG A;  2X1E A;  3S93 A;  5LLQ A;  2QQA A;  4ZYD A;  3OYN A;  1R5G A;  3S1N J;  5HVQ C;  1FYK A;  5CQG A;  1X4P A;  2W4S A;  4RLQ A;  4EJV A;  3LAP A;  1LDD A;  2XIG A;  5EDN A;  1HW2 A;  3FK7 A;  1GVJ A;  4ON0 A;  2LSO A;  3SXY A;  1YW8 A;  3TP0 A;  3LA7 A;  1KON A;  5IP9 J;  4M3E A;  3MCZ A;  1KU9 A;  1RUN A;  2NOJ B;  2X6X A;  1U5T B;  3E5Q A;  3GO5 A;  2A69 F;  4U0V A;  2GM4 A;  1W36 D;  2FX0 A;  3K70 D;  2EV5 A;  5L3F A;  3F6V A;  3SEZ A;  5LHG A;  1UFM A;  3L2R A;  4Q5S F;  3KCC A;  3E6B A;  3ZMU A;  1HDD C;  1YIT I;  4OIP F;  4HG2 A;  2R7D A;  4DNC A;  2HWV A;  3I53 A;  4XL9 A;  4M73 A;  1FTZ A;  1VTN C;  3GTM J;  3VEP A;  4QLC U;  1Z7U A;  2BEO A;  2PMU A;  3J81 Z;  2WAD A;  3DWL E;  1ETY A;  3K4K A;  5CKT A;  4I02 A;  1KQ8 A;  3DTK A;  4JX4 A;  2Y9Y A;  5J40 A;  2RGV A;  2VE9 A;  2L7Z A;  3CMM A;  1A04 A;  4LLG F;  4A3I J;  2LVS A;  4E7H A;  2DK8 A;  2DTR A;  2O61 A;  4OAY A;  2D2W A;  4ESJ A;  2EA2 A;  2NYX A;  2VJI A;  3WU0 A;  2KIM A;  2M2E A;  3BOQ A;  1BIA A;  3RPU D;  2L7M P;  3OWT A;  4BKX A;  5K5Q A;  3O8H A;  4ZDL A;  2E2I J;  4KNY A;  4Y52 J;  3LQQ A;  1W5C C;  2OPT A;  1YG2 A;  1IN8 A;  3DU5 A;  1UMQ A;  4BH9 A;  1BOB A;  2K9N A;  3M9A A;  1MJ9 A;  1TQP A;  2YX4 A;  2L2O A;  3R0J A;  3CUO A;  5M3F J;  4XBF A;  4AIH A;  4I0A A;  5CVU A;  1UEL B;  4E4H A;  2DOA A;  3HBL A;  3DU6 A;  3C7J A;  2NAZ A;  1ZR2 A;  1FY7 A;  3HHG A;  3OYM A;  3JAM K;  2QSF X;  2A05 A;  2DOF A;  4QSH A;  3JR9 A;  3FZV A;  3LL7 A;  2M45 A;  2DU9 A;  2E1N A;  3ZQC A;  1J5Y A;  3OYD A;  2RRE A;  3HRS A;  4II3 A;  1U2W A;  2HU9 A;  3D5S C;  2ZXJ A;  5ILU A;  2K85 A;  3GTO J;  3LFK A;  4G7O F;  5L3D A;  2OZU A;  1MMS A;  1Z91 A;  2EB7 A;  4UVC A;  4LMY A;  3VPR A;  2RNG A;  3NEU A;  3S1M J;  2A6E F;  2NOG A;  1NH3 A;  1W4M A;  2IXS A;  4RAF A;  2EZK A;  5AIP A;  1DGR M;  5A2Q Z;  3OOP A;  4HPQ A;  1I50 J;  1JTX A;  5DTD A;  3H3Z A;  2X6Y A;  4G9Y A;  2FMY A;  1GDT A;  2P0W A;  2XAU A;  1OJL A;  3KLO A;  4IEJ A;  1IV6 A;  4IZZ A;  2V9K A;  4IHY A;  4KIC A;  1WJD A;  2Y2Z A;  1UHS A;  1ZKG A;  1LKX A;  2OJE D;  5C44 J;  4G94 A;  2M9H A;  2P4W A;  3E6D A;  1N75 A;  1FIP A;  1IN5 A;  4RGR A;  2X4H A;  3JW4 A;  2JZY A;  3HM5 A;  2DK5 A;  1UZC A;  1P4A A;  2VC1 A;  3WU2 C;  3CD6 I;  1NTC A;  3M8E A;  2DAO A;  4H4K C;  3IH2 A;  2WAQ A;  1QZE A;  2DA4 A;  5JVT A;  1GV2 A;  2ELH A;  2OZ6 A;  4YG2 F;  1GXP A;  3G4S I;  4DZJ A;  1WJA A;  4HAM A;  5J8C A;  1D3Y A;  3FXM A;  3G3Z A;  4S04 A;  1QBJ A;  1ZGW A;  1JUS A;  3DBH B;  1WI3 A;  4LD5 A;  3F0C A;  3OYI A;  3IRQ A;  3OYH A;  4NC8 A;  2QWW A;  2LDU A;  2F4M B;  2PJP A;  1MJB A;  4B8X A;  2Q0O A;  4G7H F;  3TQN A;  4RGU A;  1FOW A;  1SD4 A;  2M4K A;  2XKP A;  2VT2 A;  4LLL A;  4LJZ F;  3ULQ B;  1YTY A;  3LSM A;  2FRH A;  3G1M A;  5CVJ A;  4YRV A;  1JUM A;  1OR7 C;  4CCO A;  3M4O J;  1WZ2 A;  4P1W A;  4IOA F;  1XDS A;  2HTS A;  3BTL A;  1VQM I;  2A61 A;  5JR3 A;  4J00 A;  1D1C A;  1P4X A;  2FBK A;  4UB6 C;  3RSN A;  4GFB A;  4FQG A;  1XC5 A;  3CDH A;  4RBO A;  1BIB A;  2RDP A;  3BPV A;  5F04 A;  1YIO A;  2JSC A;  4GGG A;  3BP8 A;  3ZP5 A;  1TNS A;  4W1U A;  2HQ5 A;  2OBP A;  3HRT A;  2K4B A;  3JRC A;  3RKX A;  2K02 A;  1MIJ A;  3V8J A;  4IHW A;  2VI6 A;  1W7P A;  1DGW Y;  4AC0 A;  4I98 B;  1ZG3 A;  5E1X A;  2JA5 J;  1PVE A;  4YIF A;  4L18 B;  4GDF A;  1Z6T A;  2DT7 B;  3LSH A;  1T2K A;  3S8P A;  2CGP A;  3L2C A;  2EIM H;  1RET A;  3CC7 I;  1G3S A;  2JPB A;  4ENJ A;  3GTQ J;  1J2X A;  1ZR4 A;  4RMN A;  1JXS A;  1V5E A;  2EK5 A;  5JI6 A;  1TWH J;  1U3E M;  5H6R A;  1LFU P;  4ENM A;  4DJA A;  4RM3 A;  2QKL B;  1D1B A;  5GTI C;  1K4S A;  3BY6 A;  3SEQ A;  2EWN A;  1SVL A;  4HLY A;  3CCE I;  4IPA A;  3WTZ A;  4CUG A;  1SFK A;  2COB A;  2YSR A;  2E1M C;  4I76 A;  3C1D A;  3HPG A;  4HST A;  4WX9 A;  1SAN A;  3ECO A;  4C9Y A;  1MDM B;  4QTR A;  1D5Y A;  1H88 C;  1VZ0 A;  2P5V A;  3TED A;  5ILV A;  2Q2E B;  4U7B A;  2E36 A;  5ILS A;  1VQ9 I;  2V1D A;  3RKQ A;  4Z2Y A;  2BXY A;  2QA4 I;  3OSG A;  4YIR X;  1FOY A;  2LMD A;  1RR8 C;  2YU3 A;  3S2H J;  2E1M B;  1NK3 P;  1OYI A;  3L9F A;  2XB0 X;  2DQL A;  4CCM A;  3IRR A;  3CF2 A;  3OSF A;  1WJ5 A;  4WCG A;  3LSR A;  1WQ2 A;  2YR2 A;  1R49 A;  1VQN I;  3B6C A;  3ESW B;  3A2K A;  3PO3 J;  3AAF A;  1X19 A;  2XHK A;  1JKR C;  3WTY C;  2PFB A;  5CVR A;  3JSO A;  1JKO C;  4R1H A;  1WPK A;  2L54 A;  2X6W A;  4KYW A;  2VKV A;  2R7O A;  1IUY A;  2CW0 F;  2BYV E;  4XKW A;  3IV5 A;  3IWF A;  5D6E A;  2JA8 J;  3Q3S A;  1WI9 A;  3E3V A;  1UJ8 A;  2VIX A;  4I99 C;  2CQQ A;  3HHH A;  1ZAR A;  2X9D A;  3KZY A;  3RZD J;  1ZTR A;  3GW2 A;  3FBI B;  1JJ6 C;  2FBI A;  3L1P A;  2P5L C;  1YE9 A;  3PO2 J;  3OIO A;  5E8G A;  4AU7 A;  4IHT A;  3F3X A;  1F1Z A;  3KZI C;  2D5V A;  9ANT A;  3TKY A;  3AFH A;  3CCM I;  3KET A;  5DCM B;  2WB1 A;  1YHQ I;  1RIO H;  1MDM A;  2JRM A;  4BQQ A;  1Y6I A;  1MBJ A;  3VDX A;  4NDL A;  2VPL A;  2BW3 A;  3E7L A;  2FNP A;  5E20 A;  5KAI C;  2RQQ A;  1O3T A;  4EJT A;  1BBY A;  3U21 A;  4B47 A;  3Q5F A;  1K4T A;  2QZ8 A;  5F08 A;  1DU0 A;  2QKM B;  4XLC A;  2FBH A;  4ENN A;  1KU3 A;  1ENH A;  3F6O A;  4IQ4 A;  1SMY F;  3U1K A;  4XLP F;  3W6V A;  2XGD A;  1ZRC A;  3K9T A;  3K4L A;  3JRE A;  1PP7 U;  4L9N A;  3KYL A;  1YO5 C;  1USS A;  2Y0M A;  1DPU A;  1I3Q J;  4KN4 X;  1NHA A;  3ABU A;  3K6G A;  5DUI A;  1IXR C;  2XAS A;  1VF9 A;  1B4A A;  2VT3 A;  4PDK A;  1HOM A;  4GRI A;  5EZH A;  3BG3 A;  2PI0 A;  2MC4 A;  2FD5 A;  3UR3 C;  3NWT A;  1D0Z A;  3ABK H;  2I10 A;  1M1E B;  2BZT A;  3WTT C;  1XSD A;  4EM2 A;  5BQT A;  4NB5 A;  3L2Q A;  3F72 A;  1JUP A;  3MKW B;  1XMX A;  5C4X J;  4HF2 A;  3WGH A;  2L4M A;  2E7X A;  2PMZ N;  4Y15 A;  1JHH A;  2R7S A;  3MN2 A;  4XLH A;  5F1R A;  2WBM A;  5DCM A;  3BJO A;  4G6D A;  1LFP A;  2KQR A;  2V26 A;  1QHH D;  5J8F A;  4YFX F;  2O5R A;  4V2F A;  4UUT A;  2M3A A;  3ROU A;  4F7Z A;  1J7K A;  2L02 A;  2PBI A;  3VOD A;  2FJ1 A;  1TQM A;  3QPT A;  4NQW B;  2JVG A;  2JA2 A;  2E1O A;  1RZ4 A;  3ASN H;  3BZ6 A;  4NUB A;  3FXO A;  3KP3 A;  2O03 A;  2LP0 A;  5ICC A;  2OQG A;  2J5O A;  4Y3O A;  1IGN A;  2XV4 S;  2MH2 A;  4M74 A;  2IGO A;  4U87 A;  5K5O A;  2GXA A;  1U0J A;  4M71 A;  3REO A;  1BI2 A;  4CCJ A;  4M72 A;  2IS1 A;  1RC9 A;  2W85 A;  4PJM A;  1OCC H;  3ZOB A;  2KFD A;  2PEX A;  5TGT A;  3EPZ A;  5E3N A;  2VN2 A;  3KP7 A;  2CFX A;  1EH6 A;  3FBN B;  3KYC B;  3BZC A;  2BHY A;  5D8L B;  2UXX A;  3BR6 A;  4UUS B;  3FXQ A;  5FKM A;  5DEQ A;  3M3Y J;  2K86 A;  4I2O A;  1O7L A;  1HXD A;  1D1A A;  3S2W A;  3RYR A;  2H27 A;  2DFH A;  2QSH X;  5FFZ A;  1Z0X A;  3PM1 A;  1S29 A;  4UV9 A;  4EJO A;  3SDG A;  4A6D A;  1DUX C;  3ISP A;  4BU2 A;  4OIQ F;  2BY2 A;  2HYJ A;  3K4B A;  2HFH A;  4HF1 A;  2OV7 A;  1Q1V A;  1ZAO A;  3DBR B;  2LY9 A;  2DQR A;  3CLQ A;  3WTU C;  3C18 A;  2PQ8 A;  3IH4 A;  2WY7 Q;  1BC8 C;  3WGG A;  3I0T A;  1A36 A;  3FKJ A;  5BNG A;  1B59 A;  3LOC A;  3OYL A;  2HQR A;  2IAI A;  3CMY A;  5FRO A;  2LR8 A;  3FDY A;  5K7Z A;  3WTV C;  5CVV A;  2K40 A;  2HPM A;  3TO6 A;  3PNT A;  2DCE A;  4NQW A;  1PUE E;  3H3U A;  5DCF A;  4FIS A;  4A0X A;  4CO8 A;  1ETW A;  1U6G A;  1O4X A;  3GXO A;  3R6S A;  2IA2 A;  5FFX A;  2DJN A;  2Q8K A;  3S1Q J;  1N25 A;  5IYD J;  2K4J A;  2TCT A;  3JRH A;  1P7I A;  4EJU A;  2UUZ A;  4MLO A;  1IN6 A;  2DMP A;  2ZO4 A;  2LKX A;  4KIB A;  3GF2 A;  1LB2 A;  2DYR H;  3LSI A;  1YW7 A;  4UUS A;  1U9O A;  2GXG A;  2VKD A;  4ZC3 A;  5L3G A;  1RRJ A;  1IN4 A;  2X0L A;  2LF7 A;  4QPQ A;  1GVD A;  1TBX A;  3CQZ J;  3E97 A;  3OYK A;  1IN7 A;  3HL2 A;  2V4J C;  2IVM A;  2A6T A;  1X2N A;  4YII A;  1UHW A;  2XAF A;  3ZMS A;  2F4I A;  1G4D A;  1IDZ A;  2UWM A;  1GHC A;  2ZCW A;  5LGU A;  2O9L A;  3S3O A;  1FSE A;  2M1B A;  1DDN A;  1G3T A;  1MNM C;  5DV5 A;  3ZMD A;  3EYI A;  3MQ0 A;  1D0Y A;  3SFI A;  3TDZ C;  4CH7 A;  3BJA A;  1FP1 D;  5DD4 A;  4CYC A;  2TRT A;  2JK3 A;  4K2E A;  4W97 A;  5IPA A;  2WV0 A;  3VYR B;  2QVO A;  4BBR J;  3LQR A;  2W25 A;  2HDD A;  5CYV A;  2HS5 A;  2F5V A;  4IKF A;  3NQO A;  1JT6 A;  2PLY A;  5M5W J;  1J09 A;  1FOK A;  4A3B J;  1FMW A;  3NWS A;  5EEA A;  1JHF A;  2ELJ A;  3QYB A;  2H8W A;  1R71 A;  5HLT A;  3MKZ A;  4CGZ A;  3OV8 A;  4ZDO A;  1MBK A;  3RPQ A;  2VQL A;  4ABZ A;  2J5P A;  4Y4R A;  1LVA A;  4Q47 A;  2EJR A;  1X3U A;  4BBS J;  1XSX A;  3HEF A;  1SVO A;  2IA0 A;  1JE8 A;  4KFC A;  3KZZ A;  1UB9 A;  5J4V A;  4OAZ A;  1E17 A;  4R79 A;  4NC7 A;  1HSJ A;  3VWB A;  2EFQ A;  2BVM A;  1O3R A;  2R7U A;  5DUK A;  1P9Q C;  4KIG A;  3T8R A;  1WSU A;  4E7I A;  2CJJ A;  4YEL A;  2DYS H;  4HX8 A;  4OIO F;  4DYR A;  5J1R A;  4UVB A;  4EVI A;  1TT5 B;  4RAZ A;  3V4G A;  1T33 A;  2DT6 A;  1UCR A;  3WTS C;  3R61 A;  1FIA A;  2E34 A;  3L7W A;  2MA3 A;  1BOA A;  3KEY A;  2HXO A;  5HOD A;  4XLN F;  3DP7 A;  4C30 A;  3ZMZ A;  1TZL A;  1T08 B;  4KIS A;  5D5X B;  1I1G A;  1V5F A;  3OYE A;  4LFU A;  2Y48 A;  4A0Y A;  5M5Y J;  1R4M B;  1K7A A;  2X1D A;  5EZG A;  1K6Y A;  1KYW A;  2VQH A;  3GX4 X;  1YI2 I;  2BXZ A;  2ZJ2 A;  3OR2 C;  5ICF A;  1CGP A;  3DEW A;  1X58 A;  5GAH J;  5DDG A;  1Y56 A;  2GAU A;  3F8B A;  2VOP A;  2QF7 A;  2QCO A;  5HDN A;  3V42 A;  3D1N I;  3FF5 A;  1OQY A;  5B1B H;  3WTX C;  1UHM A;  3L2V A;  2ZXW H;  1Z3Y A;  2IJL A;  3SYT A;  4MEX F;  4XRF A;  4XMY A;  5IT9 K;  4IXA A;  1YJN I;  2DMN A;  1HQC A;  3A01 B;  4L5J A;  2ME6 A;  4A3M J;  3W6J B;  1FBQ A;  5FB2 A;  2VQC A;  3BRO A;  4FE4 A;  4GYI A;  3T8T A;  4Y33 A;  1A31 A;  2Y0S N;  2HVS A;  3FM3 A;  3F22 A;  1PUF B;  2R7R A;  2JN6 A;  2ZME C;  3VYT B;  3DPT A;  1BN5 A;  2W82 A;  5DM6 F;  1OCP A;  1ZG5 A;  5HNF A;  4IOC F;  2MYS A;  2HDC A;  4ENK A;  3GFM A;  1E0E A;  2ICW G;  2DPD A;  3L2U A;  4HX7 A;  4U0W A;  2ZSI B;  2HYF A;  1ZN2 A;  3QPL A;  3IUO A;  4ZJZ A;  1R7J A;  5H2F C;  1B9M A;  2XGX A;  1BW6 A;  2VXZ A;  1MBH A;  4FET A;  2R92 J;  1O57 A;  2FF4 A;  4XKC A;  2VLA A;  2ZME B;  3TOA A;  4LGW A;  2LRE A;  1XMK A;  2W1O A;  2PG4 A;  2DA1 A;  4L9V A;  3U1D A;  2R5Y B;  1ITY A;  3OYA A;  4J01 A;  3K4J A;  1BR2 A;  4LB5 A;  4FAS D;  5IP7 J;  5FRN A;  2Z3Y A;  1W1W E;  4F91 B;  4JQF A;  2X6O A;  4U0Y A;  3I56 I;  1SD5 A;  4II2 A;  4MTE A;  4X1E A;  3B6A A;  2KDZ A;  2BVL A;  1IF1 A;  3TL4 X;  3OY9 A;  2M7B A;  4D5F A;  5E1W A;  4G7Z F;  1R58 A;  1VI0 A;  5J4Y A;  3C2B A;  4B4C A;  3A01 A;  4L0Z B;  1TP4 A;  2XRO A;  3MKY B;  1SD6 A;  4A3K J;  1TWG J;  2L01 A;  1DQU A;  2L0K A;  3R0A A;  1IO2 A;  1KGS A;  1Q1H A;  3HSR A;  3ZN0 A;  4Y13 A;  1PUF A;  3AG2 H;  4XLE A;  3FXR A;  4BS9 A;  5EF6 A;  3PFI A;  2DA3 A;  5FO5 A;  4RLF A;  1XCV A;  1PP8 F;  2AQF A;  1S7E A;  3S3M A;  1XPX A;  3FMR A;  3DEE A;  4IF4 A;  2V7F A;  5C4J J;  2HZD A;  5D5W B;  2OU2 A;  1CF7 A;  3LWF A;  5F0F A;  2M5W A;  1W5T A;  3S1R J;  5EGO B;  1FYL A;  4U7D A;  4C2T A;  1P2F A;  3OS1 A;  3VSK A;  2HVR A;  1BI0 A;  3HGG A;  3L09 A;  2RVC A;  2KDO A;  3IP4 B;  1X3Z B;  4CXF A;  3HKZ N;  3GME A;  4O5V A;  4BJT A;  4XRS G;  2XPV A;  3ZMT A;  1MZB A;  2HPI A;  5IYC J;  1RUO A;  2IRF G;  4BNC A;  3H9Q A;  2ZME A;  3HXL A;  3HOV J;  2A07 F;  4IL6 C;  4XK4 A;  1Y0U A;  2COM A;  1GT0 C;  3FXU A;  1H9T A;  2R5Y A;  3BR0 A;  1QHG A;  1Y8Q B;  3HGY A;  1MNE A;  5GPA A;  3Q9S A;  2E71 A;  2EFW A;  1MH3 A;  3DKW A;  2CQX A;  5LEJ A;  2R7W A;  4AIK A;  3J80 Z;  3S3N A;  1XD7 A;  3S2D J;  2ZB9 A;  4L5I A;  2LK2 A;  3I59 B;  3BWG A;  2WY8 Q;  4O6J A;  2H8R A;  4L9T A;  2F5F A;  3ASO H;  4RDU A;  3QU3 A;  2OF7 A;  4IQJ A;  2TDX A;  2XSJ C;  3DFG A;  3QAH A;  1W7P B;  2JQ7 A;  2EH3 A;  2STT A;  1WKM A;  1SAX A;  5IT9 Z;  1IJW C;  2ZJP F;  2DXI A;  1F43 A;  1SEU A;  4UUV A;  4AVP A;  4IHS A;  4IVN A;  3OMY A;  3DLL F;  5FLX K;  2LYC A;  2KLO A;  1TWC J;  2OA4 A;  4YFN F;  5BPD A;  3GZ6 A;  5EGO A;  1XTA A;  2KRF A;  4KMU X;  1R5H A;  3A02 A;  1FNN A;  2CUF A;  4BJ6 C;  1BI1 A;  5ED4 A;  1XMA A;  3EYY A;  3SFZ A;  4NC6 A;  3TGN A;  3CCQ I;  4HW0 A;  1TT0 A;  2K9Q A;  3HPH A;  1TL8 A;  4HV6 A;  2DFI A;  4S05 A;  2B9S A;  3I58 A;  3SQN A;  2QEN A;  2XPU A;  5HS9 A;  3I64 A;  4QPO A;  2EIN H;  2KMU A;  2X85 A;  2EZH A;  3DQV C;  4CZC A;  2DMQ A;  5HLH A;  3MFK A;  2GOM A;  2EV6 A;  2UV1 A;  2YUS A;  2RC4 A;  3OYF A;  5H20 A;  1MJA A;  4P9F A;  1X1C A;  3DPL C;  5KHD A;  2M8G X;  5FKN A;  1X1A A;  3BDD A;  3I59 A;  3B02 A;  2DDB A;  4KJZ A;  1I27 A;  2O8X A;  3K2A A;  1FPQ A;  2PX9 A;  2MBF A;  2CS3 A;  3RJP A;  4LLN A;  4P55 A;  2A5W A;  1ZRF A;  1MMD A;  5F64 A;  4HNU A;  4UNO A;  3P9I A;  2F5D A;  1MMN A;  3WGI A;  3BG7 A;  2WTE A;  1YYV A;  1MBG A;  3CP8 A;  5FKO A;  1AA7 A;  2IP2 A;  3S15 J;  2CG4 A;  3L2W A;  4JK1 X;  1K61 A;  3AG1 H;  1YW9 A;  4WXC A; 
#chains in the Genus database with same CATH homology
 2AS5 F;  6PAX A;  5E18 F;  1KYZ A;  1F5T A;  1Z05 A;  2EFN A;  4Q4Z F;  3JAM Z;  5BOX A;  1R00 A;  3WOD F;  4A0Z A;  2H09 A;  4M9Z A;  4PCQ A;  4RB3 C;  4HLX A;  1OMI A;  4AIJ A;  5HLG A;  3FWE A;  3KP5 A;  5HS8 A;  2OD5 A;  4EMS A;  1YFH A;  1W5S A;  1Z6R A;  3V8K A;  2FQ3 A;  1P6R A;  2STW A;  2UZK A;  4G6Q A;  1AWC A;  3K69 A;  4N0B A;  3LAJ A;  2ISY A;  1L0O C;  1QPM A;  2W84 A;  4XSX F;  3ERE D;  3V8L A;  4H0E A;  3KP6 A;  2KIF A;  3RKW A;  2HGC A;  5BPI A;  3LA3 A;  3MAJ A;  1K78 B;  3GFI A;  3EET A;  5LRR A;  3P7N A;  2O0Y A;  4XSZ F;  1QGP A;  1FBU A;  1R1T A;  3DEU A;  5FLX Z;  2QYO A;  1FSH A;  4MQV A;  1EH7 A;  3R60 A;  2F2E A;  3I71 A;  2G7H A;  1YQA A;  2DI3 A;  3I4P A;  1L3L A;  3O3K A;  5E17 F;  1QZY A;  2BBY A;  4N9I A;  5FD5 A;  2H6C A;  2F5C A;  4HQM A;  4HV5 A;  4MEY F;  3TOB A;  3K2Z A;  4CYD A;  2V6C A;  4IRG A;  3U2R A;  1F4K A;  4BHP A;  4P96 A;  3KEO A;  4KIF A;  3L00 A;  1K78 A;  3FM5 A;  2V1U A;  1LEB A;  2RKH A;  4FX4 A;  2VOO A;  1XCB A;  2D45 A;  4IRH A;  2ZNZ A;  5CVI A;  1BM9 A;  1S7O A;  5TRD A;  1T98 A;  3HUG A;  1J75 A;  1RI7 A;  5KK1 A;  1LJ9 A;  1BC7 C;  5LGT A;  2P7V B;  2E7W A;  2JRT A;  2XAG A;  3BPX A;  3K1P A;  4CZZ A;  2Y75 A;  2VBW A;  2M8E A;  3IL2 A;  5IT3 A;  2ESN A;  4EGY A;  3D5L A;  3EQL F;  2XUB A;  4MHG A;  3V7S A;  3GVA A;  3CLO A;  3E5X A;  4M9S A;  1IW7 F;  1XGM A;  3EDP A;  2OQR A;  5CLS A;  3CUQ C;  2D1H A;  3HSF A;  1OPC A;  1KQ0 A;  1SMT A;  2K7L A;  3ELK A;  2MH9 A;  1W7P D;  3JTG A;  3LA2 A;  4EM0 B;  1I6X A;  3CUQ B;  2VOD A;  1YLF A;  3GWZ A;  3IKT A;  4EM1 A;  4WXD A;  3F8F A;  5FD6 A;  2V1X A;  1IAW A;  2ISZ A;  1KU2 A;  5EEH A;  4MGR A;  3RPU A;  2NRA C;  5TJJ A;  2ZKZ A;  2XVC A;  3T5X A;  2R3S A;  3ZMV A;  2FEZ A;  1HKQ A;  3MZY A;  2LNB A;  2GIV A;  2P6S A;  4BXU A;  5LEK A;  3SZT A;  2Z5U A;  4OMZ A;  1U8R A;  1HKS A;  5HDG A;  4U88 A;  3GEZ A;  4GO1 A;  4KDP A;  4AD9 A;  3W6K B;  3E5U A;  4RGX A;  2V9V A;  3K1M A;  1SD7 A;  1R22 A;  2XAJ A;  4A12 A;  2MLK A;  4EGZ A;  3IWZ A;  3CUQ A;  1D8J A;  3QU6 A;  3G73 A;  1FT9 A;  1ZRE A;  3N97 A;  3RTR A;  1KQ9 A;  4M9X A;  3MEX A;  3NRV A;  2ADU A;  5HS7 A;  4IRI A;  2PN6 A;  1DPR A;  3GUD A;  2HTJ A;  3MZH A;  4A2U A;  3F23 A;  2LF8 A;  1OYW A;  3J81 K;  5FGM A;  4LG0 B;  2A68 F;  5D5V B;  2C6Y A;  4UV8 A;  1HW1 A;  3VB2 A;  5H6Q A;  3O6B B;  2L3D A;  1GXQ A;  2H94 A;  3KE2 A;  4LB6 B;  2NNY A;  2CYY A;  2WWY A;  1LNW A;  4HBL A;  4M6X A;  3DXJ F;  1MKM A;  4HOB A;  1I5Z A;  4HZF A;  4GCV A;  3F8N A;  2ZFW A;  1XGO A;  1UST A;  2WC2 A;  3HYI A;  4WF2 A;  5CJ9 A;  2PMH A;  5LRS A;  4M6Y A;  4RS8 A;  2KIU A;  4I7H A;  5L3E A;  4YFK F;  3J7A O;  2FE3 A;  4LG0 A;  1F9N A;  2CQK A;  4BAY A;  4CDG A;  1STZ A;  5L3C A;  1S7A A;  3E6C C;  2G9W A;  2A6H F;  3LST A;  2NNN A;  3WTW C;  3R4K A;  4WWC A;  2H6B A;  1REP C;  1XB4 A;  3N4M A;  3D0S A;  2VE8 A;  1K6O A;  3RYP A;  4KA4 A;  2FML A;  1CF7 B;  2F5E A;  3HRM A;  3C3W A;  3WG9 A;  3H92 A;  2VBZ A;  3HIF A;  4HX4 A;  4LK0 F;  2QQB A;  3KFW X;  1XN7 A;  5D4S A;  1BJA A;  1B9N A;  1EV7 A;  1AOY A;  5HDK A;  3QOP A;  1XDU A;  2IA1 A;  2CSO A;  2ETH A;  2D1V A;  4E70 A;  5LHI A;  1TLH B;  2ZNY A;  3RKY A;  4MQ9 F;  3VOE A;  1XGS A;  4ZYH A;  4HDV A;  3TDU C;  4P5O A;  2QLZ A;  2RNJ A;  3Q9V A;  1IZ1 A;  2P7C B;  3TO9 A;  4FT8 A;  3CTA A;  1R1V A;  3KEQ A;  1C0W A;  2Z33 A;  2JT1 A;  3F8C A;  3GYH X;  5F6F A;  4OOI A;  1U5T A;  4G8X A;  4AWX B;  1WRJ A;  4B09 A;  4MNU A;  3M7G A;  2QQ9 A;  1LQ1 A;  5JHU A;  4RB1 A;  4ASN A;  2W57 A;  4HYE A;  3RI4 A;  4QWQ A;  1TW3 A;  1ZGJ A;  4GXO A;  3FX3 A;  2W24 A;  1LDJ A;  3QP5 A;  1OYY A;  4PZJ A;  1J9I A;  3B73 A;  5LHH A;  1JGS A;  1ON2 A;  3U9G A;  3ABT A;  4DQ2 A;  3ZN1 A;  4I09 A;  1ZLJ A;  3T1B A;  5AON A;  1ULY A;  3K0L A;  2VON A;  3FMS A;  3KP4 A;  1YS6 A;  2HR3 A;  4JBA A;  3T0Y A;  3MWM A;  2RV8 A;  4FHT A;  1TQI A;  3CJN A;  4RGS A;  3GZ5 A;  3VFZ A;  1HBX G;  1G6N A;  3M1E A;  2BV6 A;  1R36 A;  1XGN A;  5E8I A;  3V7R A;  4ETS A;  1TNT A;  2KKO A;  2KJC A;  1S8N A;  3EUH A;  1K79 A;  5ICE A;  1ZG1 A;  1FBS A;  1B6A A;  2FXA A;  2DBB A;  1ZRD A;  2CO5 A;  1B1B A;  3RDI A;  1J0R A;  1H0M A;  2YX7 A;  4KT5 C;  4A6E A;  4ZZD A;  4ZH4 F;  2Z99 A;  2Z9O A;  1QQI A;  4ZYE A;  3SZP A;  1R23 A;  3PQK A;  2QM3 A;  3GFJ A;  5D6F A;  2EFO A;  1ZGA A;  4O3M A;  3K1N A;  2K27 A;  4KMF A;  3HSE A;  2ACJ A;  1T39 A;  5LBQ A;  2OAZ A;  5K5R A;  5K1Y A;  4Y17 A;  1MD0 A;  2P6T A;  1O3S A;  3KLN A;  4UHT A;  2HKO A;  3CO7 C;  2MD5 A;  4ESF A;  4RAY A;  1YS7 A;  3CO6 C;  3WU1 B;  4RB2 C;  3F21 A;  4EV0 A;  3P9K A;  2JPC A;  1G3W A;  4Q48 A;  1SFU A;  2A3S A;  3TO7 A;  2RQP A;  3QRF F;  4PGG A;  1ZH5 A;  3ZPL A;  1FYM A;  1OR7 A;  4OIR F;  2E1C A;  2P5K A;  5E1Z B;  1FX7 A;  1ZLK A;  2UXN A;  3KP2 A;  4HF0 A;  2XKO A;  5D4R A;  2XAQ A;  1HST A;  1V3F A;  1QZZ A;  4R8H A;  4ESB A;  1TTY A;  3M8F A;  1G3Y A;  1T0F A;  3I5U A;  4OU0 A;  4KUM A;  5DD8 A;  1MGT A;  5BMZ A;  4LK1 F;  4ZYG A;  3PQJ A;  2DT5 A;  3GFL A;  2FNA A;  2Q2E A;  1WWX A;  4A5N A;  4GYG A;  1T38 A;  2O6G E;  5HLI A;  4EQQ A;  1XSV A;  1SFE A;  3I54 A;  1LDK B;  3IHU A;  5L3B A;  2FA5 A;  1IRF A;  2LKP A;  4HA8 A;  1S6L A;  4BHC A;  2VBY A;  1IXS B;  1QNT A;  3WE3 A;  2QBY B;  3JTH A;  4WK8 F;  1FC3 A;  2HQN A;  1KU7 A;  2JTV A;  4CIC A;  1EH8 A;  3P9C A;  4WXH A;  1ZYR F;  1BI3 A;  2EV0 A;  1SFX A;  2RN7 A;  2FOK A;  2P8T A;  5KVR A;  5D8K B;  5ICG A;  1LEA A;  1QO0 D;  2AXL A;  4OMY A;  3IC7 A;  2QUF A;  4FX0 A;  1ODD A;  2VBX A;  1FZP B;  3FHZ A;  3ML6 A;  2L4A A;  1P92 A;  4OIN F;  1J59 A;  4I01 A;  2A5Y B;  4BQA A;  3V7C A;  4EJW A;  3HTU A;  4IJA A;  2EA4 A;  3HOS A;  4UXN A;  2YPR A;  2GXB A;  4HDU A;  1O3Q A;  5AIQ A;  5J6X A;  1OKR A;  4PGH A;  1H9G A;  2HOE A;  2QBY A;  3JSP A;  1P4W A;  1KA8 A;  2R7F A;  2CWE A;  2DO7 A;  2IPQ X;  4BHB A;  1FWZ A;  1T6S A;  4MTD A;  2IT0 A;  1Z9C A;  3BJ6 A;  2FSW A;  2DPU A;  1FLI A;  3O2P E;  1DP7 P;  3DF8 A;  1PDN C;  4L0Y B;  1TW2 A;  1D8K A;  2GQQ A;  2M87 A;  4N9H A;  2ESH A;  3GLX A;  2DLL A;  2GWR A;  5DYM A;  5JFR A;  2IW5 A;  3ZQ7 A;  4CHU A;  4NHJ A;  2GA1 A;  2KJB A;  5D5U B;  1IRG A;  5EEG A;  2HEO A;  3QPH A;  1RNL A;  4KN7 X;  1ON1 A;  1D5V A;  2GA2 A;  1V4R A;  4HQE A;  4BYY A;  2MC3 A;  3DV8 A;  1HKT A;  3HRU A;  1FP2 A;  2FU4 A;  3IKV A;  5HOO A;  2O3F A;  2EFP A;  4P9U A;  2XRN A;  2VC0 A;  3WE2 A;  3QP6 A;  2ZBK A;  2BE5 F;  2BGC A;  2MLG A;  1S3J A;  3F8M A;  2DW4 A;  4L9J A;  3E6M A;  3COA C;  4ZZL A;  4I0B A;  2XAH A;  3FMQ A;  3ECH A;  3RIR A;  1O7F A;  2NS0 A;  2M30 A;  2V79 A;  3SHF A;  1ONV A;  1ZHF A;  2HZT A;  4TV7 A;  1R1U A;  1E2X A;  3HTS B;  3HOT A;  4RB0 A;  1Z1D A;  4D0P A;  5BS6 A;  5LGN A;  2B0L A;  2HKX A;  5A2Q K;  5ERI A;  1I1S A;  4UVA A;  1U78 A;  2GZW A;  1IXC A;  4A5M A;  3J80 K;  1U5T C;  2G7U A;  1HW5 A;  2HYG D;  5LLQ A;  2QQA A;  4ZYD A;  1R5G A;  5HVQ C;  1FYK A;  4EJV A;  3LAP A;  1LDD A;  2XIG A;  1HW2 A;  1GVJ A;  4ON0 A;  2LSO A;  3SXY A;  1YW8 A;  3LA7 A;  3MCZ A;  1KU9 A;  1RUN A;  1U5T B;  3E5Q A;  3GO5 A;  2A69 F;  4U0V A;  2EV5 A;  5L3F A;  3F6V A;  5LHG A;  1UFM A;  4Q5S F;  3KCC A;  3E6B A;  3ZMU A;  4OIP F;  2R7D A;  4DNC A;  2HWV A;  3I53 A;  4M73 A;  1VTN C;  3VEP A;  4QLC U;  1Z7U A;  2BEO A;  2PMU A;  3J81 Z;  1KQ8 A;  4I02 A;  2RGV A;  2VE9 A;  1A04 A;  4LLG F;  2DK8 A;  2DTR A;  2O61 A;  2D2W A;  4ESJ A;  2EA2 A;  2NYX A;  3WU0 A;  2KIM A;  3BOQ A;  1BIA A;  5K5Q A;  4KNY A;  3LQQ A;  1YG2 A;  1IN8 A;  4BH9 A;  3M9A A;  1MJ9 A;  1TQP A;  2YX4 A;  3R0J A;  3CUO A;  4XBF A;  4AIH A;  4I0A A;  5CVU A;  3C7J A;  2NAZ A;  1FY7 A;  3HHG A;  3JAM K;  3FZV A;  2M45 A;  2DU9 A;  2E1N A;  1J5Y A;  3HRS A;  1U2W A;  2ZXJ A;  5ILU A;  3LFK A;  4G7O F;  5L3D A;  2OZU A;  1Z91 A;  2EB7 A;  4UVC A;  4LMY A;  3NEU A;  2A6E F;  1W4M A;  5AIP A;  5A2Q Z;  3OOP A;  3H3Z A;  4G9Y A;  2FMY A;  3KLO A;  4KIC A;  4G94 A;  2P4W A;  3E6D A;  1IN5 A;  4RGR A;  2X4H A;  3JW4 A;  2JZY A;  2DK5 A;  1P4A A;  2VC1 A;  3M8E A;  2DAO A;  5JVT A;  2ELH A;  2OZ6 A;  4YG2 F;  1GXP A;  4HAM A;  5J8C A;  1D3Y A;  3G3Z A;  4S04 A;  1QBJ A;  4LD5 A;  3IRQ A;  2QWW A;  2LDU A;  2PJP A;  1MJB A;  4B8X A;  2Q0O A;  4G7H F;  3TQN A;  4RGU A;  1SD4 A;  2XKP A;  2VT2 A;  4LLL A;  4LJZ F;  3ULQ B;  1YTY A;  2FRH A;  5CVJ A;  1XDS A;  2HTS A;  2A61 A;  5JR3 A;  1P4X A;  2FBK A;  3CDH A;  1BIB A;  2RDP A;  3BPV A;  1YIO A;  2JSC A;  4GGG A;  3BP8 A;  3ZP5 A;  1TNS A;  2OBP A;  3HRT A;  2K4B A;  3RKX A;  2K02 A;  3V8J A;  1W7P A;  4I98 B;  1ZG3 A;  5E1X A;  4YIF A;  4L18 B;  1Z6T A;  1T2K A;  2CGP A;  3L2C A;  1G3S A;  2JPB A;  4ENJ A;  1J2X A;  1JXS A;  5JI6 A;  2EK5 A;  1U3E M;  5H6R A;  4ENM A;  3BY6 A;  2EWN A;  4HLY A;  4IPA A;  3WTZ A;  2YSR A;  3C1D A;  4WX9 A;  3ECO A;  1MDM B;  2P5V A;  5ILV A;  4U7B A;  5ILS A;  2V1D A;  4Z2Y A;  2YU3 A;  1OYI A;  3L9F A;  2DQL A;  3IRR A;  4WCG A;  1WQ2 A;  2YR2 A;  3AAF A;  2XHK A;  3WTY C;  2PFB A;  5CVR A;  3JSO A;  4R1H A;  2L54 A;  4KYW A;  1IUY A;  2CW0 F;  2BYV E;  3IWF A;  5D6E A;  1WI9 A;  3E3V A;  3HHH A;  1ZAR A;  3KZY A;  3GW2 A;  2FBI A;  2P5L C;  5E8G A;  4IHT A;  3F3X A;  1F1Z A;  3TKY A;  3KET A;  5DCM B;  1RIO H;  1MDM A;  2FNP A;  5E20 A;  1O3T A;  4EJT A;  1BBY A;  3Q5F A;  2QZ8 A;  2FBH A;  4ENN A;  1KU3 A;  3F6O A;  1SMY F;  4XLP F;  1ZRC A;  3K9T A;  1PP7 U;  4L9N A;  1YO5 C;  1USS A;  2Y0M A;  1DPU A;  4KN4 X;  1NHA A;  3ABU A;  5DUI A;  1IXR C;  2XAS A;  4PDK A;  1B4A A;  2VT3 A;  2PI0 A;  3WTT C;  1XSD A;  4EM2 A;  5BQT A;  4NB5 A;  3F72 A;  4HF2 A;  3WGH A;  2L4M A;  2E7X A;  4Y15 A;  1JHH A;  5F1R A;  5DCM A;  3BJO A;  4G6D A;  5J8F A;  4YFX F;  3ROU A;  4F7Z A;  1J7K A;  2L02 A;  2PBI A;  3VOD A;  1TQM A;  3QPT A;  1RZ4 A;  3BZ6 A;  3KP3 A;  2O03 A;  5ICC A;  2OQG A;  2J5O A;  2XV4 S;  2MH2 A;  4M74 A;  5K5O A;  4M71 A;  3REO A;  1BI2 A;  4M72 A;  2W85 A;  2PEX A;  2VN2 A;  3KP7 A;  2CFX A;  1EH6 A;  5D8L B;  2UXX A;  3FXQ A;  5DEQ A;  2K86 A;  4I2O A;  1O7L A;  1HXD A;  3S2W A;  3RYR A;  2H27 A;  5FFZ A;  1S29 A;  4UV9 A;  4EJO A;  1DUX C;  4A6D A;  3ISP A;  4OIQ F;  2HFH A;  4HF1 A;  1ZAO A;  2DQR A;  3WTU C;  3C18 A;  2PQ8 A;  1BC8 C;  3WGG A;  3I0T A;  1B59 A;  2HQR A;  3WTV C;  5CVV A;  3TO6 A;  4NQW A;  1PUE E;  3H3U A;  5DCF A;  4A0X A;  4CO8 A;  1U6G A;  3GXO A;  3R6S A;  2IA2 A;  5FFX A;  2Q8K A;  2K4J A;  4EJU A;  1IN6 A;  2ZO4 A;  4KIB A;  3GF2 A;  1LB2 A;  1YW7 A;  2GXG A;  5L3G A;  1IN4 A;  2X0L A;  2LF7 A;  1TBX A;  3E97 A;  1IN7 A;  2IVM A;  4YII A;  1UHW A;  2XAF A;  3ZMS A;  1G4D A;  2UWM A;  1GHC A;  2ZCW A;  5LGU A;  1FSE A;  2M1B A;  1DDN A;  1G3T A;  5DV5 A;  3ZMD A;  3EYI A;  3MQ0 A;  3TDZ C;  3BJA A;  1FP1 D;  5DD4 A;  4K2E A;  2WV0 A;  2QVO A;  3LQR A;  2W25 A;  5CYV A;  2HS5 A;  3NQO A;  2PLY A;  1FOK A;  1JHF A;  4CGZ A;  3OV8 A;  3RPQ A;  2J5P A;  1LVA A;  4Q47 A;  2EJR A;  1X3U A;  1XSX A;  2IA0 A;  1JE8 A;  4KFC A;  3KZZ A;  1UB9 A;  1E17 A;  4R79 A;  1HSJ A;  2EFQ A;  1O3R A;  5DUK A;  4KIG A;  3T8R A;  1WSU A;  4HX8 A;  4OIO F;  4UVB A;  4EVI A;  4RAZ A;  3V4G A;  1UCR A;  3WTS C;  3R61 A;  3L7W A;  2MA3 A;  1BOA A;  4XLN F;  3DP7 A;  3ZMZ A;  5D5X B;  1I1G A;  4LFU A;  2Y48 A;  4A0Y A;  1K7A A;  1KYW A;  3GX4 X;  2ZJ2 A;  5ICF A;  1CGP A;  5DDG A;  2GAU A;  3F8B A;  2VOP A;  5HDN A;  3FF5 A;  3WTX C;  1UHM A;  2IJL A;  4MEX F;  4XRF A;  5IT9 K;  4IXA A;  1HQC A;  4L5J A;  3W6J B;  1FBQ A;  5FB2 A;  3BRO A;  4GYI A;  3T8T A;  3FM3 A;  3F22 A;  3DPT A;  1BN5 A;  1ZG5 A;  2HDC A;  4ENK A;  3GFM A;  2DPD A;  4HX7 A;  4U0W A;  2HYF A;  1ZN2 A;  1R7J A;  1B9M A;  2XGX A;  2VXZ A;  1O57 A;  2FF4 A;  2ZME B;  3TOA A;  4LGW A;  1XMK A;  2PG4 A;  4L9V A;  3U1D A;  4LB5 A;  2Z3Y A;  4JQF A;  4U0Y A;  1SD5 A;  4MTE A;  1IF1 A;  4G7Z F;  5E1W A;  1R58 A;  4L0Z B;  2XRO A;  1SD6 A;  2L01 A;  3R0A A;  1KGS A;  1Q1H A;  3HSR A;  3ZN0 A;  4Y13 A;  3FXR A;  3PFI A;  5FO5 A;  1XCV A;  1PP8 F;  3FMR A;  4IF4 A;  1CF7 A;  5D5W B;  2OU2 A;  3LWF A;  2M5W A;  1W5T A;  1FYL A;  4U7D A;  1P2F A;  1BI0 A;  3L09 A;  2RVC A;  4CXF A;  4O5V A;  3ZMT A;  1RUO A;  1MZB A;  2IRF G;  4BNC A;  2ZME A;  2A07 F;  1Y0U A;  2COM A;  3FXU A;  1H9T A;  3Q9S A;  2EFW A;  3DKW A;  5LEJ A;  4AIK A;  3J80 Z;  1XD7 A;  4L5I A;  3I59 B;  3BWG A;  4O6J A;  4L9T A;  2F5F A;  3QU3 A;  2TDX A;  3DFG A;  3QAH A;  1W7P B;  2STT A;  1WKM A;  1SAX A;  5IT9 Z;  4UUV A;  4AVP A;  4IHS A;  4IVN A;  5FLX K;  2OA4 A;  4YFN F;  5BPD A;  3GZ6 A;  2KRF A;  4KMU X;  1R5H A;  1FNN A;  1BI1 A;  5ED4 A;  1XMA A;  3EYY A;  3SFZ A;  3TGN A;  4HW0 A;  4HV6 A;  2DFI A;  4S05 A;  3I58 A;  3SQN A;  2QEN A;  5HS9 A;  3I64 A;  3DQV C;  5HLH A;  3MFK A;  2EV6 A;  2RC4 A;  5H20 A;  1MJA A;  4P9F A;  3DPL C;  3I59 A;  3BDD A;  3B02 A;  1I27 A;  2O8X A;  1FPQ A;  2MBF A;  3RJP A;  4LLN A;  4P55 A;  1ZRF A;  5F64 A;  4UNO A;  3P9I A;  2F5D A;  3WGI A;  2WTE A;  1YYV A;  2IP2 A;  2CG4 A;  4JK1 X;  1YW9 A;  4WXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...