1JEGA

Solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
b'SGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE CSK
publication title A novel, specific interaction involving the Csk SH3 domain and its natural ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/hydrolase
total genus 10
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jegA00
3VS0A 2GGRA 4WCIA 1AZEA 1PKSA 1SPKA 3QWXX 2JTEA 3M0SA 4OMMA 2I0NA 4JJCA 4OMQA 3I35A 2J6OA 4F14A 1MV0B 4LE9A 2ESWA 2EYXA 3PE0A 2IIMA 5ECAA 2CT4A 4JZ4A 5FW9A 5GJWB 3M0UA 3QWYA 1NG2A 2B86A 4AG1C 3VRZA 2DILA 1YN8A 3H0IA 2V1RA 2F2VA 1AZGB 2AZSA 1HD3A 4J9EA 1X2KA 2KT1A 1AWXA 1QLYA 1ZLMA 1WXUA 2PTKA 2RF0A 2J06A 3UA7A 3U23A 4OMPA 2FRWA 3PVQA 2DVJA 2HDAA 2L2PA 2MCNA 2ENMA 2EW3A 2LMJA 2MOXA 2CDTA 2NWMA 2YUPA 2EVRA 2OI3A 2BTTA 2M51A 2BZYA 1PRLC 4ESRA 4RTYA 3VS1A 2VVKA 2KROA 2E5KA 2FO0A 2M0YA 4AFZC 1OPLA 3H0HA 1SEMA 5IXBA 3VS4A 2HBWA 2EGEA 1QWFA 4GBQA 2JS2A 3M0TA 5IHNA 1I1JA 4AG2C 2DM1A 2O2OA 1FMKA 3NPFA 2KGTA 1WLPB 1W1FA 1VA7A 1M3AA 2LP5A 1UECA 1UUEA 1K9AA 2V1QA 1Y57A 3M0QA 2L3PA 2KYMA 3O5ZA 1JO8A 3NGPA 4CC7A 2QDLA 1BBZA 2ED0A 1X6GA 5IXFA 4LUEA 2KRSA 1H3HA 4RUGA 1GBRA 1I07A 4AFQC 1QKWA 2KNBB 4CC3A 4J9DA 1KJWA 1NEGA 4ORZA 4QT7A 1GL5A 4Z89A 2DMOA 2ED1A 2CSIA 1TUCA 2MIOA 1JU5C 4FSSA 1UE9A 1T0HA 2J6KA 4RTTA 2LQNA 1NYFA 2RMOA 2K2MA 4M4ZA 3TSZA 3UA6A 3REAB 2DE0X 1ABQA 1HJDA 1BB9A 1KSWA 3I5SA 4RTUA 1NYGA 1E6HA 1ZUKA 1EFNA 2GBQA 3SHWA 1K0XA 2DNUA 2EBPA 1YNZA 4J9BA 1RUWA 1K76A 5FWCA 4J9CA 1AWOA 1M27C 2BZ8A 4DEYA 4IIMA 1MUZA 3NMZC 2P4RA 2RQUA 1CKBA 2XMFA 1OOTA 3H0FA 1ARKA 1QCFA 1J3TA 3VS3A 2EYYA 3EG2A 5EC7A 5I22A 3TVTA 3EHRA 2PZ1A 5L23A 4ZNXA 1T0JA 1VYVA 1ZSGA 2K6DA 5IH2A 1U06A 1UJYA 2D8HA 1B3QA 3RBBB 2SRCA 2JM8A 3EGUA 3I9QA 4KRTA 1U5SA 2GNCA 4J9GA 2DRMA 2GQIA 2YUNA 4RTWA 1M30A 2DF6A 1WXBA 1E7OA 2LNHB 2BZXA 3VS7A 2AKKA 1T3SA 1UGVA 4AFSC 3EG3A 1GCPA 1NLOC 1PKTA 2DL4A 1RLPC 3H41A 1LCKA 1JEGA 2DRKA 2DLPA 2LQWA 1HSQA 1JXMA 3REBB 3VS5A 2C0IA 2D1XA 3CQTA 1WFWA 4X1VA 2FRYA 1S1NA 2LX7A 2O9VA 3I5RA 4J9IA 1YWPA 2EGCA 4R0KA 1G83A 2HCKA 3R6NA 2K3BA 1W70A 1NLPC 2GTJA 3PVLA 2JMCA 3VRYA 1ZUUA 3EHQA 1JQQA 1JXOA 4K11A 2A08A 1AVZC 2W10A 2EPDA 1PRMC 2F2XA 1K4US 3UF4A 2FG0A 2EYZA 2EYWA 5IHIA 1OV3A 4JJBA 2A36A 4J9HA 1X43A 1PNJA 1CSKA 2F2WA 2GTOA 1SHGA 2CT3A 3KFVA 4D8DA 2OAWA 2X3XD 2YSQA 2JT4A 2KBTA 4DEXA 1WXTA 1OEBA 3ULRB 3VS2A 1UJ0A 4A63B 4HVWA 2L3SA 2CUDA 2K79A 1SSHA 1M8MA 1M3BA 2H8HA 2KXCA 2L3QA 1T3LA 3FJ5A 1IO6A 4IIOA 4F17A 2CREA 1K0SA 2KRMA 2PNIA 2RQWA 2J7IA 1YP5A 2JM9A 4HVVA 2RQRA 2A28A 2FPFA 5HCKA 1QWEA 2J05A 1U3OA 2LJ0A 4RTZA 4E6RA 4RTVA 4JPBW 2RNAA 2K9GA 3C0CA 1ABOA 3EG0A 4LNPA 3TSWA 1Y0MA 1MV3A 2ROTA 4JZ3A 5FWBA 4Z88A 1SHFA 2D8JA 2DBKA 4OMLA 1VYUA 2EQIA 2J6FA 1X6BA 2RPNA 2KR3A 2KEAA 3JV3A 1WA7A 1UTIA 1GBQA 1GFCA 1PHTA 2DL8A 1WX6A 2O9SA 3M0PA 1YWOA 2ROLA 1YCSB 2C0TA 4AFUC 2L0AA 1NM7A 2JS0A 1WDXA 1H92A 4JJDA 3GBQA 4HCKA 2KT8A 2DJQA 1TG0A 1VYTA 4GLMA 1NEBA 1WIEA 2FPDA 2ECZA 2VKNA 2G6FX 1OPKA 5GJVB 1N5ZA 1WI7A 2CUBA 2KRNA 4EIKA 2FPEA 5IHKA 2O31A 2HEQA 1BU1A 1H8KA 4D8KA 4CC2A 3A98A 2RQTA 2O88A 4Z8AA 2DYBA 2CH4A 2AK5A 1B07A 1AEYA 1E6GA 2VWFA 2YUOA 4HXJA 2DBMA 1RLQC 2DA9A 4CC4B 2DX1A 2LJ1A 1GCQA 2YT6A 2OJ2A 2KE9A 2RN8A 2DL5A 4Y92A 2W0ZA 2HSPA 2YDLA 1AOJA 4LN2A 1GRIA 1QKXA 4LUDA 1X2QA 2YUQA 1G2BA 1Z9ZA 3THKA 1ZBJA 1M3CA 2EGAA 2X3WD 3M0RA 3RNJA 2JMAA 2LCSA 1WYXA 4J9FA 1AWJA 1AWWA 5I11A 1SRLA 3UATA 2DL3A 1SRMA 3SEMA 1UFFA 2RQVA 2AKLA 1A0NB 2LJ3A 1K1ZA 1FYNA 1I0CA 1X69A 1GFDA 1W6XA 3VS6A 1ZUYA 4HVUA 1BK2A 2C0OA 2DL7A 2LZ6B 1RI9A 2CSQA 2JXBA 2D0NA 2KYBA 3EG1A 1UDLA 1AD5A 1KIKA 1UG1A 3IQLA 2FEIA 2JW4A 1KFZA 1PWTA 1TUDA 2CH4W 3ZL7C 3LH5A 4RTXA 1X27A 1Z9QA 4OMOA 2NUZA 2SEMA 4F16A 1V1CA 4OMNA 1ZX6A 2KXDA 2EKHA 3NHNA 1XOVA 1GCQC 1UHFA 2K7AA 2A37A 2ABLA 1CKAA 1UHCA 2AZVA
chains in the Genus database with same CATH superfamily
1AZEA 3CBOA 3M0SA 1VQNA 1YJ9T 1WGSA 2I0NA 4D6WA 4OMQA 4PJOF 5GAMj 2ZPHB 3I35A 1Q82R 2IG0A 1H3ZA 2WSCE 2ESWA 2QQ9A 1QMCA 1VQPT 1BKBA 2GCXA 2CT4A 1VQ9A 2MF2A 2KMTA 1M9SA 2Y4XA 1NBEB 3M54A 3MP1A 3QJYA 1N27A 1NG2A 1QQJA 3VRZA 2DILA 1NJIU 2FZCB 1C1AA 1YITA 3FDRA 1WXUA 4M75D 2OTLT 3HFOA 1VQ6A 3BFMA 2CP6A 1B34B 2J06A 3U23A 2RHXA 1IHWA 1O75A 2QEXQ 2DVJA 2L2PA 5L8RE 4F7UG 3Q1JA 2ENMA 2VC8A 2YUPA 4DBHA 1Y7XA 1I5OB 2EVRA 3WVEB 3OYIA 2E5KA 2M0YA 4M77F 1SG5A 2COWA 2RJCA 3CMEQ 4ZN1A 5DY9A 4M75A 2DD4A 2HBPA 3DLMA 1I1JA 2ATCB 4PK4A 3M4YA 2PQWA 1N8RC 1NJIR 3NPFA 5CO7A 2KGTA 1VA7A 1M3AA 5KYWA 2DXTA 2V1QA 1YJ9Q 4KH1B 3RR6A 2KYMA 1JO8A 2QQBA 3EG9B 2CP5A 4MDWA 5KYUB 5IXFA 3EGXA 1VQPQ 3UWNA 5LJ5j 1M1KU 3JCMX 1QVFA 1VIEA 3QKJA 3V7SA 3EGDB 1KJWA 5CAIA 1GL5A 2HZYA 2PUOB 1PD1A 2DMOA 2KAFA 1MNDA 4M78F 1JU5C 2YXYA 2LQNA 2OTLQ 2LTOA 2RMOA 3REAB 1KSWA 5GAN2 1K0XA 2MWPA 5IN1A 3CCRA 1K76A 3G4SA 3QJ6A 4IIMA 3NMZC 2DK3A 4BE1A 2X4JA 2JNGA 4F7UA 2P4RA 2QTVA 2ZPFB 3JCMJ 1ARKA 3EG2A 3FEOA 5EC7A 3TVTA 2GFUA 4RCBA 4M7AB 3JB9G 1YI2T 3BDUA 1Y96A 1OX8A 1T0JA 2VXFA 1RAAB 2HMAA 2K6DA 1U06A 1UJYA 2D8HA 3RBBB 2SRCA 4PJNA 5I21A 2MK5A 4JLIA 2L8DA 4KRTA 2BE7D 4J9GA 4XU2A 4HCZA 3M53A 1K8AU 3OW2P 4DBQA 2JJ9A 3CCLT 4KGZB 2VYTA 3NTHA 5A0DA 5KCHA 1UGVA 3EG3A 1D09B 4C0DB 3SFMA 1YBYA 2LCLA 1M5Q1 2P0QA 3F70A 2LQWA 1HSQA 2XK0A 3VS5A 3A8MB 1WFWA 2FRYA 4OF1A 2P84A 2HL5C 2BUDA 3CCST 3I5RA 2F1LA 2K3BA 3CXCP 1WJRA 2GTJA 3PVLA 5LJ5h 3VRYA 4N4IA 1JXOA 1M1FA 3I56T 3JB9D 2W10A 2EKOA 2MMPA 2F2XA 4LDWA 1K4US 1VQLT 1X01A 4C8QE 2EYWA 1IHVA 3HHTB 2LT4A 4JJBA 3GLXA 4TVRA 5LJ3h 1X43A 4OVAA 5AYFA 4PFZA 1XJWB 1CSKA 2GTOA 4X9CA 1K8AR 2K2VA 3KFVA 2X3XD 2YSQA 2JT4A 3P8DA 3EFOA 5KE3A 2QEXA 1OEBA 2RI3A 4IKFA 3MKDA 1UJ0A 1G3SA 2L3SA 1DJ7B 2L3QA 1YI2Q 5CQYA 1TSFA 5KYXA 1UGRB 4IIOA 5GAN3 2CREA 5DM7R 1K0SA 2F5TX 2RI5A 2DEQA 3EFRA 1PM3A 4HVVA 1JJ2P 1K9MC 4ZGJB 1U3OA 2LJ0A 4M7DF 4RTVA 3VUBA 3CCLQ 2MWOA 2L5QA 1Y0MA 2ROTA 1SHFA 2DBKA 1SSFA 3CMAT 5CKEA 2RPNA 2RH2A 4ZTJA 2AT1B 3OYLA 1O9SA 5CR2A 4LDUA 2O4XB 2QK0A 4FYWB 1Q7YU 3AT1B 2K5LA 3RERA 4OP0A 3CC7Q 1VQ5A 3CCSQ 1EZZB 3N5BB 4LD9K 2M9UA 5IT9E 2C0TA 4AFUC 1VQPA 2NUPB 4EMKC 1VQKQ 2L0AA 1GXIE 4JJDA 1LJOA 2YRDA 2A0FB 3S3NA 1UGPB 3I56Q 1M8VA 4GLMA 1VQLQ 5GAN4 3G1JA 2G6FX 1U8RA 1OPKA 1VQ8A 2CUBA 5FU6B 2DJZA 5J39A 1PD0A 4EIKA 2FPEA 4XU3A 2O31A 2HEQA 2RA2A 2DD5A 4CC2A 2RQTA 2VV5A 3G71A 3CD6Q 3CCMA 4NS5A 3I55T 1Y71A 2QA4T 1RLQC 5GMKm 4CC4B 1Q7YR 2LJ1A 4BACA 5I2SA 5GAOn 2YT6A 4RG2A 2W0ZA 2YDLA 4E7JA 2QAZA 3M9QA 4LUDA 1X2QA 1G2BA 3THKA 2EJ9A 2DZ9A 4C5GA 4M7AG 1KC8C 4BY6C 1Q81C 3BY7A 2P0PA 2LCSA 3S6WA 3CCJT 3OW2A 1JRIA 1IGQA 3CMAQ 4J9FA 1AT1B 1AWJA 1D0YA 2DTOA 2DL3A 2RK2A 3SEMA 4N0AA 2AKLA 4MMLA 4XTXA 2DEUA 3G6ET 1I0CA 1TH7A 1GFDA 3R6OA 1W6XA 1NE8A 1ZUYA 4HVUA 4F7UF 2C0OA 1Q82C 2YRCA 2LZ6B 2CZ0B 3JCMg 3L2UA 1KIKA 1UG1A 3QYGB 3ZL7C 4RTXA 3EG9A 1X27A 5KYUA 3OYEA 3QZ9B 4KGVB 1WJSA 1D1CA 1OYXA 3NHNA 1VQOA 1EIFA 1WHMA 2R5MA 1FXXA 1VQMT 1MMNA 3EGDA 4WCIA 2YHTA 3QWXX 2JTEA 1TS9A 4E7IA 4OMMA 5GANd 4M7AD 4JJCA 2JTFA 2RK1A 2KK4A 3GNFB 5GMKh 2QA4Q 1BCOA 4ELZC 2EYXA 5GAMd 1IREB 1WHHA 4JZ4A 3HRUA 2E6NA 3A8OB 1QP2A 3M0UA 2FZGB 1QVPA 4MZPA 2F2VA 3E1SA 5D7UA 1AZGB 2AZSA 3CCET 1YHQQ 1G3WA 2KT1A 2R5AA 1VUBA 1JJ2A 2E6ZA 4XU0A 3CCJQ 2RF0A 3OYGA 2B8AA 2HD0A 4QVZA 4M7AA 3RMQA 3VJPA 1NJIC 3CCLA 3PVQA 2NLUA 1Q86U 5M9OA 5GAOm 1WHLA 3G6EQ 2COYA 3HTRA 5GANg 2M51A 1PRLC 4ESRA 3HSBA 3VS1A 1LOJA 4B6MA 4RCCA 2DTIA 8ATCB 2FO0A 4PJLA 5IXBA 4XTVA 5GAMg 3CCSA 1P92A 5GANf 1VOMA 3QG1A 1M2OA 2M1HA 3CPFA 1YJNA 5GAMf 3V7RA 4A4EA 2OX7A 1W1FA 3CC4Q 4DA4A 4MZMA 1VQLA 1V76A 1YCYA 3CCUA 2E3IA 4DBRA 4CC7A 2GQVA 2CZ1B 2YWWA 2ED0A 1N9SA 3OYMA 1Q86R 1OU9A 4O6JA 3P8BB 3X28B 1MGQA 4C0ZA 4C8QB 3CMET 1JBMA 2OTJA 1RAGB 5CQXA 1NEGA 4ORZA 2KI7A 4Z89A 1MNEA 3JAME 2ZZDA 4R55A 1RAEB 1Q81R 4HCBA 4ZGEB 4PKCC 2ZPBB 3GIBA 3CCEQ 2MIOA 2ZGWA 4RTTA 2LNVA 1QVGS 2KSSA 4QQDA 2LC4A 3LWIA 1M1KC 2EJFA 3QHSA 2K2MA 3TSZA 3UA6A 2IVWA 2DE0X 2YLCA 1BB9A 2H3EB 1E6HA 1EFNA 3QXEB 4RMOA 4FU6A 1UB4A 1BI0A 3OYBA 2DNUA 5GAOq 1VQ7T 4J6WA 2EBPA 4J9BA 1RUWA 1M90U 3CMAA 5FWCA 4J9CA 1AWOA 1M27C 4M75C 4DEYA 4WTOB 1MUZA 2QQAA 4JJNK 2E1HA 1D0ZA 3OSVA 4B9XA 3MP6A 2RQUA 2ZAEA 1CKBA 3JB9H 3H0FA 2RB6A 3PTAA 3EHRA 2PZ1A 2FZKB 2EQKA 2E12A 1WQWA 5IH2A 3GP8A 1KG1A 3G7ZA 5LJ5g 2JM8A 4II1A 3I9QA 2O4XA 3MPUB 1YIJQ 4PJOB 1U5SA 2GNCA 1BCMA 3MEWA 2DRMA 4M75E 3DLLA 2VUBA 1PC0A 2DF6A 3H9NA 1UEBA 1KQSP 4XTZA 3DB4A 1PG5B 2LNHB 4LDVA 1ZSZB 2NUPA 1YFNA 5A2QE 4ANJA 3BDLA 1PKTA 4CI0C 2DL4A 1RLPC 3CC2T 1K8AC 1KD1U 1JXMA 4OGEA 5C6SA 1M90R 4X1VA 1S1NA 3PNWC 4BUGA 3I55A 1KQ1A 1YWPA 2EGCA 2HCKA 3R6NA 1NLPC 1R0BG 2LCCA 4KULA 3META 3HL8A 3OS0A 2CYZB 2RO0A 2A08A 1AVZC 2EPDA 1PRMC 1S72Q 2E5QA 2PVDB 4P5NA 3UF4A 3SWNB 4C5HA 2A36A 4J8OA 4M77B 1VQ4A 1VQ7Q 1RI0A 2F2WA 1M2VA 4J7IA 3CCJA 1SHGA 2CT3A 4D8DA 2OAWA 3V8LA 4DEXA 3VS2A 2F69A 2HKQB 4FL6A 4IUVA 4HVWA 3JCMe 2BE9B 1SSHA 4F7UE 1RAIB 1M8MA 5LL6S 2H8HA 3LW5E 3JCMQ 1KD1R 2MYSA 1XTDA 2JUFA 3V8KA 5LJ3j 2EQJA 3MP8A 2PNIA 1FX7A 2RQWA 3JB9J 1YP5A 4BDYA 5FU7C 3PGGA 4IURA 1RADB 4Z02A 1W2BS 1AHJB 2J05A 4RTZA 4HT9A 4JPBW 2RNAA 3ZFJA 3C0CA 4OB0B 3BW1A 2I2LA 4LNPA 3GOXA 3OYCA 1XQHA 3TSWA 3L1AA 4JZ3A 1TXQA 4Z88A 4BY6B 2G3RA 2LRQA 1VQMA 2EQIA 3CC2Q 2V26A 1G3YA 3JRZA 3PT9A 3JV3A 1UTIA 4M78B 1GFCA 1WX6A 2O9SA 1YWOA 1ACMB 2ROLA 1WNLA 1M1KR 1TTHB 3M5AA 1NM7A 2JS0A 2HL3A 1Q7YC 4J83A 2R57A 1V29B 4J6XA 2YRVA 3A8LB 3CCVT 2LQ8A 3CPWS 1TG0A 3PFSA 4C8QG 2FPDA 3OS5A 2ECZA 1BI1A 1N5ZA 1WI7A 3L42A 5HK3A 5IHKA 2EYQA 1BU1A 2JZ2A 2XHCA 5GANe 4Q5WA 3A98A 4IUTA 4BE2A 4QW2A 5CKHA 2EAYA 2RHUA 2V8KA 3JCMV 2AK5A 2DYIA 3CC7T 5CCAA 1AEYA 1E6GA 2VWFA 5GAMe 2CS7A 1VQKT 1GCQA 3OS1A 3QDRB 1SF9A 3LH0A 3ME9A 4PFOA 4PFPA 4JS4A 1WHKA 3ZBDA 3OSSC 1GRIA 1QKXA 3BE3A 4E7SA 3OYAA 2ZPGB 4N4GA 2EGAA 4PJMA 1TUGB 4FW2A 2Z0WA 5GAOr 1KQSA 2PVOB 5EG2A 2E70A 1SKUB 4PJOG 3CD6T 1SRMA 2M02A 2EQUA 1TOVA 2VASA 1K1ZA 1WHGA 2DETA 4A4GA 4A4HA 2NUTB 2CSQA 4ZN3A 2DIQA 2D0NA 2KYBA 2QGGA 3CMEA 2QYZA 1MMAA 1F1BB 2FEIA 2JW4A 1KFZA 1PWTA 1TUDA 2CH4W 3CCVQ 3E2UA 1D1AA 2ZPIB 1Z9QA 4LXCA 2SEMA 4OMNA 3M59A 5CKFA 1ZX6A 2A37A 2HQEA 1YJWT 2ABLA 5GAN8 8AT1B 2RJFA 2DKGA 3GNGA 3X24B 6AT1B 1SPKA 1YJ9A 1FMWA 1VQ7A 1VQNT 2J6OA 4MMKA 3M4GA 1NPRA 4M7DB 4M77G 4C92B 4PJOD 4KGXB 1OI1A 1I81A 2IIMA 5ECAA 3MEAA 3MJXA 5GJWB 5LJ5e 3QDFA 2QTXA 2D6FA 2ZCFB 4N0AC 4M75F 1YN8A 1N9RA 1HD3A 4J9EA 2L89A 1X2KA 2BIVA 1KHCA 3OBWA 1AWXA 2OTLA 5GMKj 1ZLMA 4QQGA 1QP3A 2PTKA 1VQ6T 3UA7A 4OMPA 1H641 3QPHA 4BI8B 5DLOA 2CZ6B 5A0GA 3FIFA 4ATOA 2MOXA 2LMJA 3JCMd 4PJOA 1B34A 2BZYA 2DVEA 4L6V5 2VVKA 5AT1B 3OS2A 3DKMA 5FLXE 1FMVA 3M55A 2E3HA 3HP9A 1Q86C 3VUZA 1HK9A 3H0HA 4BDZA 4AT1B 1ZSZA 5HY6A 2WSFE 4M78G 1QWFA 1RL2A 4M77D 2JS2A 3M0TA 5IHNA 1YHQT 4HT8A 2HAXA 2RHIA 1QVFS 2XKOC 4CRIA 2O2OA 4XTWA 1G3TA 3HKSA 1FMKA 1YJWQ 3PIPA 4GY5A 2QQRA 3SB2A 3J80E 1VQNQ 2L3PA 2VXEA 2E65A 2FB7A 4EMHA 2QDLA 1BBZA 2CP7A 4LUEA 1H3HA 2E64A 4FYXB 3C95A 3SWNA 2DAQA 1VQ9Q 4Y91A 4CC3A 1BIAA 4M7AC 3MCAB 2RD1A 4M77A 4J9DA 4QT7A 1Y07A 2CKKA 4L59A 2VGMA 2ED1A 3JCMf 5CK9A 1OX9A 4FSSA 1YITQ 1UE9A 2J6KA 1NYFA 7AT1B 3CC4T 4KT0E 2A3LA 4M4ZA 4NL3A 1VQ6Q 1PSEA 2X51A 2EFIA 3I5SA 4RTUA 1NYGA 2XDBA 1OQKA 3D7SB 3SHWA 4DOVA 4HKEA 3SDZA 4M7AE 4OB2B 3E9GA 3M58A 3NTIA 2V8IA 4C0DC 3DB3A 3MHXA 1QW1A 3G4ST 3OYYA 4J6YA 2EWNA 4BB7A 3QZ5B 1OOTA 3CBMA 1QCFA 3X20B 1YI2A 2EYYA 2QXFA 3J81E 1M90C 5L23A 4DBFA 3L2ZA 4ZNXA 1K73U 4OB3B 3FLGA 3VYGA 2E41A 1W2BA 1VYVA 3FJPA 1R0CB 3WVDB 4KUDK 1B3QA 2DERA 4M78A 4RTWA 1M30A 3TEEA 3ASKA 1WXBA 3RKXA 3EAEA 4JRQA 4C5EA 2DZCA 2BZXA 5D6YA 3VS7A 5HKCA 1T3SA 4AFSC 4PNOA 1NLOC 3TREA 3H41A 5CIUA 2XG8D 3H6ZA 4FCYA 1JEGA 1PCXA 3REBB 3FB9A 2D1XA 1FWZA 2DPPB 3CQTA 3TCJA 3CC7A 2DXUA 4N4HA 2LX7A 3JCMb 1I4K1 1VQKA 1G83A 3CPWA 1W70A 2DXBA 1KD1C 3JB9F 2DO3A 1YIJT 1XNIA 4M7DG 1JQQA 3X25B 3I56A 4K11A 4C92G 1K73R 3QUIA 2K5FA 2P0KA 3CEYA 2FVUA 4PLLA 3OMGA 2EYZA 4OGCA 1OV3A 5IHIA 4J9HA 3T9NA 1WQ7A 3CCRQ 5KYYB 2NYSA 3RIRA 4KH0B 2KBTA 3G4SQ 1WXTA 4PLIA 3CD6A 4A63B 2CUDA 2GF7A 2KXCA 3FJ5A 5LJ5d 1IO6A 2XDPA 4F17A 4A54A 5FRMA 2KRMA 1IB8A 4XTYA 2J7IA 2MI6A 2JM9A 1QCNA 2RJEA 4LD6A 1RABB 5HCKA 5LJ3d 3MO8A 1S72T 3M56A 2CP3A 3HFNA 3INZA 2XDDA 3OYJA 1ABOA 5FU6C 2NUTA 1PSFA 1MV3A 3QIIA 5FWBA 4C92D 1KHIA 1VYUA 2J6FA 3HRTA 1X6BA 4PL6A 4DQ2A 1IGUA 3LYIA 2JVVA 2KEAA 1D3BB 1GBQA 1PHTA 4OB1B 4XK8E 2P4TA 2VB6A 2QASA 3GF5A 3JCMc 1VQ5T 1YCSB 1WDXA 2XIDA 3GBQA 3JCMh 4HCKA 4IUQA 4AMCA 2CP2A 1LNXA 2DJQA 2MAMA 1NEBA 1NZ9A 2EJGA 2VKNA 4M7DA 5LJ3g 2JTMA 2LVMA 3OB9A 3HPWA 4C92A 5LJ5f 1VQ8T 1I8FA 2QQSA 4FIBA 4D8KA 1R8OB 3OYKA 2O88A 4Z8AA 2DYBA 2KY9A 3M57A 5LJ3f 3G71T 1B07A 3CCMT 1HYOA 2QA4A 3OW2S 1M4ZA 4BE0A 4WF2A 2YUOA 2DBMA 2DA9A 2X35A 2DX1A 3FC3A 4EMKB 2OJ2A 1QCOA 3QO3A 4VUBA 2DL5A 2CGHA 2HSPA 2M16A 5FRNA 4GLKA 3HRSA 4LN2A 5J3BA 3X26B 3JCMW 4J7FA 2YUQA 1YHQA 2FYKA 3RKWA 1Z9ZA 1ZBJA 1ZQ1A 4JUVA 2JOYA 2DXCA 3A1PA 2OAUA 4HCCA 4L5GA 4JS5A 1WYXA 3FRNA 3CXCS 4LDYA 5CKDA 3JSCA 3NFCA 1OULA 3G6EA 3RUXA 1FYNA 1X69A 3JCMP 2V8JA 3VS6A 5GANh 2XU8A 1QVGP 1VQ5Q 1BK2A 9ATCB 2DL7A 3EFSA 2JXBA 4FM4B 2K4YA 3EG1A 1UDLA 1AD5A 5GAMh 4JRKA 2CP0A 2XD0A 1TU0B 1EX4A 3UT1A 2RJDA 1D0XA 1IXDA 3WXMB 4OMOA 2RM4A 3MEVA 1RAFB 2NUZA 4ME7A 1VQ8Q 2KXDA 4RKUE 2EKHA 1ZHIA 3CC4A 1GCQC 1UHFA 1VQOT 4M7AF 5GAN5 3UDCA 2AZVA 3V8JA 3VS0A 2GGRA 4EPCA 2HNIA 2HQHA 1PKSA 2Y90A 1WZOA 4R56A 1JJ2S 3G71Q 3OY9A 3P8HA 3CCMQ 2KDSA 1M1GA 2D9TA 4F14A 1MV0B 1UGSB 4LE9A 3LGFA 2X4YA 5GAN7 2VGNA 3PE0A 3CCQT 1KK7A 5FW9A 1WHJA 2QDYB 3QWYA 4AG1C 2B86A 1LVKA 3CCEA 2CZ7B 2V1RA 3H0IA 4A53A 2E10A 2KVQG 1QLYA 3GPLA 3PMIA 2DTHA 4MDXA 4HA8A 5CKBA 2JN0A 2FRWA 4A4FA 3OA6A 2HDAA 2LQKA 2MCNA 2EW3A 2QG9B 2CDTA 2NWMA 2OI3A 2IPOB 4XTUA 2BTTA 1N6AA 4RTYA 2MPXC 5J26A 4E7HA 2KROA 3QBYA 4C8QC 4AFZC 1OPLA 4FYYB 1SEMA 1N8RU 3LLRA 3VS4A 3A8GB 2HBWA 2X9HA 3MEUA 2M0OA 4DOWA 1BI2A 1ZA2B 5GAN6 2EGEA 4GBQA 1OZ3A 4JDSA 4AG2C 1YIJA 4EMGA 3A5ZB 2DM1A 1VQOQ 1ZBXA 4IUUA 1YJNT 1WLPB 1R77A 4ZTFA 4C8QD 2O01E 2LP5A 1UECA 4X9DA 1UUEA 1C6VX 1K9AA 1MHNA 1RAHB 1Y57A 3CCUT 2COZA 1NPPA 3M0QA 5A0LA 3O5ZA 4QVDA 3NGPA 3SD4A 2BKDN 1X6GA 1W2BP 2KRSA 4RUGA 3CCQQ 1GBRA 1I07A 4AFQC 3OYNA 1QKWA 1IZ6A 2KNBB 4NL2A 2OTJT 3ZEHA 5KYYA 2CSIA 1TUCA 1N8RR 3URGA 4PJOC 3E9FA 1BYMA 1T0HA 4ELYC 2PUKB 4C8QA 3KXTA 2K57A 1S72A 4QKUA 4FT4A 2D0QB 5GMKl 3QYHB 3J7AF 1ABQA 1HJDA 1G8XA 1ZUKA 4C92F 2GBQA 1ZSZC 1HXDA 1OU8A 1YNZA 2A7YA 1BI3A 2BZ8A 2K3YA 4RG8A 3L2VA 3CPWP 3LX7A 4J5YA 1BIBA 4PJOE 1VQ9T 2XMFA 3TQ7P 1J3TA 3VS3A 1C0MA 1MMDA 1LPLA 5I22A 3VV0A 2HQXA 1QVGA 2RI2A 5KH6A 1ZSGA 5LJ3e 1YITT 1Q95G 4YTLA 2HKNA 5C0MA 3EGUA 1D3BA 5FROA 2GQIA 2YUNA 1YJNQ 2HSEB 1E7OA 1K73C 3SWNC 3ER0A 3V7CA 4M77C 2AKKA 3CCUQ 2EIFA 4QVCA 3CC2A 1GCPA 2LT1A 4XQ3A 4M75B 2QI2A 1LCKA 3A8HB 4JRPA 1TWBA 2F5KA 3VU3C 2DRKA 2DLPA 4E7KA 2C0IA 1D1BA 4EDUA 2O9VA 4E47A 2OTJQ 4J9IA 4C5IA 5KYWB 3AHUA 4R0KA 2QGFB 4M77E 2X4XA 3C12A 2JMCA 5DLQE 5KYNA 3L2QA 1ZUUA 3EHQA 1M2VB 2PVGB 1RACB 3EGXB 2Y4YA 5KE2A 3VKIA 4LDXA 4XAXB 2FG0A 1OZ2A 2AIRB 3NTKA 2XICA 3S3OA 4FW1A 3VYHB 1PNJA 4EMKA 4B9WA 1VQ4T 2K5IA 3ULRB 4M78C 4MZTA 2PU9B 2K79A 2ZPEB 1K9MU 3JB9I 1M3BA 3RKYA 1T3LA 2LDMA 3OBYA 5GAOl 4IUPA 2XI9A 3OQ5A 3OMCA 2RQRA 2A28A 3RESA 2FPFA 4M78D 1QWEA 4F7UB 2K3XA 3RMSA 4E6RA 4M78E 2K9GA 3CXCA 2EQMA 3E19A 1W4SA 3EG0A 4BD3A 2FL7A 3RDVA 3LWHA 4FT2A 1Y96B 1X6OA 3CCRT 4XU1A 4FSXA 2R58A 2D8JA 4OMLA 3PIOA 2DFUA 2KR3A 4JRIA 1WA7A 4BI3A 4ZGDB 5GMKi 2DL8A 5CVIA 3M0PA 3OYDA 3C4SA 3UPUA 4A4KA 3I55Q 3EH2A 3CCQA 3L2WA 1H92A 4KUIA 1VIFA 2DIGA 4FYVB 1K9MR 5D6XA 5FU7B 3CCVA 5I2MA 4E7LA 2LX9A 2KT8A 1VYTA 4E2FB 1WIEA 3C94A 4Y28E 5GJVB 2YLBA 4BI4A 4X34A 2L3RA 2KRNA 2WSEE 4O5VA 3L2RA 4E7ZA 1VQ4Q 4NOYA 1H8KA 3QSUA 4V2SA 4KBMB 3OYHA 3EH1A 2CH4A 3KUFA 1KQSS 1UGQB 1QVFP 4HXJA 3CBPA 1G5VA 1WPYA 1MMGA 2H3JA 1KC8U 3O8VA 2KE9A 2RN8A 2AHJB 4Y92A 1Q81U 2RHZA 3KBGA 2FHDA 1B7TA 3TU4K 5KCOA 1AOJA 3PMTA 3EFOB 5D6WA 2X4WA 2WACA 4UC4A 1M3CA 2X3WD 4C8QF 3M0RA 3RNJA 2JMAA 5HK0A 5KYXB 5GMKe 1Q82U 4JLGA 1VQMQ 1AWWA 5I11A 1SRLA 3UATA 2QEXT 1UFFA 1U1SA 4OMFB 2RQVA 1A0NB 2LJ3A 1JB0E 2RHYA 5IAYA 3OYFA 4M7DC 1ZA1B 4C92C 1KQ2A 5GAOp 1RI9A 3S3MA 2KQWA 1U1TA 4PJJA 3H8ZA 4M75G 3IQLA 1IRXA 2E4HA 3LH5A 1X75C 3LGLA 4QQ6A 4C0GA 1KC8R 1WJQA 4F04B 2C06A 4F16A 1V1CA 4M7DD 2GFAA 1YJWA 1XOVA 5GANj 4M7DE 2K7AA 4C0FA 4C92E 1CKAA 1I5LA 1UHCA
chains in the Genus database with same CATH topology
3VS0A 2GGRA 4WCIA 1AZEA 1PKSA 1SPKA 3QWXX 2JTEA 3M0SA 4OMMA 2I0NA 4JJCA 4OMQA 3I35A 2J6OA 4F14A 1MV0B 4LE9A 2ESWA 2EYXA 3PE0A 2IIMA 5ECAA 2CT4A 4JZ4A 5FW9A 5GJWB 3M0UA 3QWYA 1NG2A 2B86A 4AG1C 3VRZA 2DILA 1YN8A 3H0IA 2V1RA 2F2VA 1AZGB 2AZSA 1HD3A 4J9EA 1X2KA 2KT1A 1AWXA 1QLYA 1ZLMA 1WXUA 2PTKA 2RF0A 2J06A 3UA7A 3U23A 4OMPA 2FRWA 3PVQA 2DVJA 2HDAA 2L2PA 2MCNA 2ENMA 2EW3A 2LMJA 2MOXA 2CDTA 2NWMA 2YUPA 2EVRA 2OI3A 2BTTA 2M51A 2BZYA 1PRLC 4ESRA 4RTYA 3VS1A 2VVKA 2KROA 2E5KA 2FO0A 2M0YA 4AFZC 1OPLA 3H0HA 1SEMA 5IXBA 3VS4A 2HBWA 2EGEA 1QWFA 4GBQA 2JS2A 3M0TA 5IHNA 1I1JA 4AG2C 2DM1A 2O2OA 1FMKA 3NPFA 2KGTA 1WLPB 1W1FA 1VA7A 1M3AA 2LP5A 1UECA 1UUEA 1K9AA 2V1QA 1Y57A 3M0QA 2L3PA 2KYMA 3O5ZA 1JO8A 3NGPA 4CC7A 2QDLA 1BBZA 2ED0A 1X6GA 5IXFA 4LUEA 2KRSA 1H3HA 4RUGA 1GBRA 1I07A 4AFQC 1QKWA 2KNBB 4CC3A 4J9DA 1KJWA 1NEGA 4ORZA 4QT7A 1GL5A 4Z89A 2DMOA 2ED1A 2CSIA 1TUCA 2MIOA 1JU5C 4FSSA 1UE9A 1T0HA 2J6KA 4RTTA 2LQNA 1NYFA 2RMOA 2K2MA 4M4ZA 3TSZA 3UA6A 3REAB 2DE0X 1ABQA 1HJDA 1BB9A 1KSWA 3I5SA 4RTUA 1NYGA 1E6HA 1ZUKA 1EFNA 2GBQA 3SHWA 1K0XA 2DNUA 2EBPA 1YNZA 4J9BA 1RUWA 1K76A 5FWCA 4J9CA 1AWOA 1M27C 2BZ8A 4DEYA 4IIMA 1MUZA 3NMZC 2P4RA 2RQUA 1CKBA 2XMFA 1OOTA 3H0FA 1ARKA 1QCFA 1J3TA 3VS3A 2EYYA 3EG2A 5EC7A 5I22A 3TVTA 3EHRA 2PZ1A 5L23A 4ZNXA 1T0JA 1VYVA 1ZSGA 2K6DA 5IH2A 1U06A 1UJYA 2D8HA 1B3QA 3RBBB 2SRCA 2JM8A 3EGUA 3I9QA 4KRTA 1U5SA 2GNCA 4J9GA 2DRMA 2GQIA 2YUNA 4RTWA 1M30A 2DF6A 1WXBA 1E7OA 2LNHB 2BZXA 3VS7A 2AKKA 1T3SA 1UGVA 4AFSC 3EG3A 1GCPA 1NLOC 1PKTA 2DL4A 1RLPC 3H41A 1LCKA 1JEGA 2DRKA 2DLPA 2LQWA 1HSQA 1JXMA 3REBB 3VS5A 2C0IA 2D1XA 3CQTA 1WFWA 4X1VA 2FRYA 1S1NA 2LX7A 2O9VA 3I5RA 4J9IA 1YWPA 2EGCA 4R0KA 1G83A 2HCKA 3R6NA 2K3BA 1W70A 1NLPC 2GTJA 3PVLA 2JMCA 3VRYA 1ZUUA 3EHQA 1JQQA 1JXOA 4K11A 2A08A 1AVZC 2W10A 2EPDA 1PRMC 2F2XA 1K4US 3UF4A 2FG0A 2EYZA 2EYWA 5IHIA 1OV3A 4JJBA 2A36A 4J9HA 1X43A 1PNJA 1CSKA 2F2WA 2GTOA 1SHGA 2CT3A 3KFVA 4D8DA 2OAWA 2X3XD 2YSQA 2JT4A 2KBTA 4DEXA 1WXTA 1OEBA 3ULRB 3VS2A 1UJ0A 4A63B 4HVWA 2L3SA 2CUDA 2K79A 1SSHA 1M8MA 1M3BA 2H8HA 2KXCA 2L3QA 1T3LA 3FJ5A 1IO6A 4IIOA 4F17A 2CREA 1K0SA 2KRMA 2PNIA 2RQWA 2J7IA 1YP5A 2JM9A 4HVVA 2RQRA 2A28A 2FPFA 5HCKA 1QWEA 2J05A 1U3OA 2LJ0A 4RTZA 4E6RA 4RTVA 4JPBW 2RNAA 2K9GA 3C0CA 1ABOA 3EG0A 4LNPA 3TSWA 1Y0MA 1MV3A 2ROTA 4JZ3A 5FWBA 4Z88A 1SHFA 2D8JA 2DBKA 4OMLA 1VYUA 2EQIA 2J6FA 1X6BA 2RPNA 2KR3A 2KEAA 3JV3A 1WA7A 1UTIA 1GBQA 1GFCA 1PHTA 2DL8A 1WX6A 2O9SA 3M0PA 1YWOA 2ROLA 1YCSB 2C0TA 4AFUC 2L0AA 1NM7A 2JS0A 1WDXA 1H92A 4JJDA 3GBQA 4HCKA 2KT8A 2DJQA 1TG0A 1VYTA 4GLMA 1NEBA 1WIEA 2FPDA 2ECZA 2VKNA 2G6FX 1OPKA 5GJVB 1N5ZA 1WI7A 2CUBA 2KRNA 4EIKA 2FPEA 5IHKA 2O31A 2HEQA 1BU1A 1H8KA 4D8KA 4CC2A 3A98A 2RQTA 2O88A 4Z8AA 2DYBA 2CH4A 2AK5A 1B07A 1AEYA 1E6GA 2VWFA 2YUOA 4HXJA 2DBMA 1RLQC 2DA9A 4CC4B 2DX1A 2LJ1A 1GCQA 2YT6A 2OJ2A 2KE9A 2RN8A 2DL5A 4Y92A 2W0ZA 2HSPA 2YDLA 1AOJA 4LN2A 1GRIA 1QKXA 4LUDA 1X2QA 2YUQA 1G2BA 1Z9ZA 3THKA 1ZBJA 1M3CA 2EGAA 2X3WD 3M0RA 3RNJA 2JMAA 2LCSA 1WYXA 4J9FA 1AWJA 1AWWA 5I11A 1SRLA 3UATA 2DL3A 1SRMA 3SEMA 1UFFA 2RQVA 2AKLA 1A0NB 2LJ3A 1K1ZA 1FYNA 1I0CA 1X69A 1GFDA 1W6XA 3VS6A 1ZUYA 4HVUA 1BK2A 2C0OA 2DL7A 2LZ6B 1RI9A 2CSQA 2JXBA 2D0NA 2KYBA 3EG1A 1UDLA 1AD5A 1KIKA 1UG1A 3IQLA 2FEIA 2JW4A 1KFZA 1PWTA 1TUDA 2CH4W 3ZL7C 3LH5A 4RTXA 1X27A 1Z9QA 4OMOA 2NUZA 2SEMA 4F16A 1V1CA 4OMNA 1ZX6A 2KXDA 2EKHA 3NHNA 1XOVA 1GCQC 1UHFA 2K7AA 2A37A 2ABLA 1CKAA 1UHCA 2AZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS0 A;  2GGR A;  4WCI A;  1AZE A;  1PKS A;  1SPK A;  3QWX X;  2JTE A;  3M0S A;  4OMM A;  2I0N A;  4JJC A;  4OMQ A;  3I35 A;  2J6O A;  4F14 A;  1MV0 B;  4LE9 A;  2ESW A;  2EYX A;  3PE0 A;  2IIM A;  5ECA A;  2CT4 A;  4JZ4 A;  5FW9 A;  5GJW B;  3M0U A;  3QWY A;  1NG2 A;  2B86 A;  4AG1 C;  3VRZ A;  2DIL A;  1YN8 A;  3H0I A;  2V1R A;  2F2V A;  1AZG B;  2AZS A;  1HD3 A;  4J9E A;  1X2K A;  2KT1 A;  1AWX A;  1QLY A;  1ZLM A;  1WXU A;  2PTK A;  2RF0 A;  2J06 A;  3UA7 A;  3U23 A;  4OMP A;  2FRW A;  3PVQ A;  2DVJ A;  2HDA A;  2L2P A;  2MCN A;  2ENM A;  2EW3 A;  2LMJ A;  2MOX A;  2CDT A;  2NWM A;  2YUP A;  2EVR A;  2OI3 A;  2BTT A;  2M51 A;  2BZY A;  1PRL C;  4ESR A;  4RTY A;  3VS1 A;  2VVK A;  2KRO A;  2E5K A;  2FO0 A;  2M0Y A;  4AFZ C;  1OPL A;  3H0H A;  1SEM A;  5IXB A;  3VS4 A;  2HBW A;  2EGE A;  1QWF A;  4GBQ A;  2JS2 A;  3M0T A;  5IHN A;  1I1J A;  4AG2 C;  2DM1 A;  2O2O A;  1FMK A;  3NPF A;  2KGT A;  1WLP B;  1W1F A;  1VA7 A;  1M3A A;  2LP5 A;  1UEC A;  1UUE A;  1K9A A;  2V1Q A;  1Y57 A;  3M0Q A;  2L3P A;  2KYM A;  3O5Z A;  1JO8 A;  3NGP A;  4CC7 A;  2QDL A;  1BBZ A;  2ED0 A;  1X6G A;  5IXF A;  4LUE A;  2KRS A;  1H3H A;  4RUG A;  1GBR A;  1I07 A;  4AFQ C;  1QKW A;  2KNB B;  4CC3 A;  4J9D A;  1KJW A;  1NEG A;  4ORZ A;  4QT7 A;  1GL5 A;  4Z89 A;  2DMO A;  2ED1 A;  2CSI A;  1TUC A;  2MIO A;  1JU5 C;  4FSS A;  1UE9 A;  1T0H A;  2J6K A;  4RTT A;  2LQN A;  1NYF A;  2RMO A;  2K2M A;  4M4Z A;  3TSZ A;  3UA6 A;  3REA B;  2DE0 X;  1ABQ A;  1HJD A;  1BB9 A;  1KSW A;  3I5S A;  4RTU A;  1NYG A;  1E6H A;  1ZUK A;  1EFN A;  2GBQ A;  3SHW A;  1K0X A;  2DNU A;  2EBP A;  1YNZ A;  4J9B A;  1RUW A;  1K76 A;  5FWC A;  4J9C A;  1AWO A;  1M27 C;  2BZ8 A;  4DEY A;  4IIM A;  1MUZ A;  3NMZ C;  2P4R A;  2RQU A;  1CKB A;  2XMF A;  1OOT A;  3H0F A;  1ARK A;  1QCF A;  1J3T A;  3VS3 A;  2EYY A;  3EG2 A;  5EC7 A;  5I22 A;  3TVT A;  3EHR A;  2PZ1 A;  5L23 A;  4ZNX A;  1T0J A;  1VYV A;  1ZSG A;  2K6D A;  5IH2 A;  1U06 A;  1UJY A;  2D8H A;  1B3Q A;  3RBB B;  2SRC A;  2JM8 A;  3EGU A;  3I9Q A;  4KRT A;  1U5S A;  2GNC A;  4J9G A;  2DRM A;  2GQI A;  2YUN A;  4RTW A;  1M30 A;  2DF6 A;  1WXB A;  1E7O A;  2LNH B;  2BZX A;  3VS7 A;  2AKK A;  1T3S A;  1UGV A;  4AFS C;  3EG3 A;  1GCP A;  1NLO C;  1PKT A;  2DL4 A;  1RLP C;  3H41 A;  1LCK A;  1JEG A;  2DRK A;  2DLP A;  2LQW A;  1HSQ A;  1JXM A;  3REB B;  3VS5 A;  2C0I A;  2D1X A;  3CQT A;  1WFW A;  4X1V A;  2FRY A;  1S1N A;  2LX7 A;  2O9V A;  3I5R A;  4J9I A;  1YWP A;  2EGC A;  4R0K A;  1G83 A;  2HCK A;  3R6N A;  2K3B A;  1W70 A;  1NLP C;  2GTJ A;  3PVL A;  2JMC A;  3VRY A;  1ZUU A;  3EHQ A;  1JQQ A;  1JXO A;  4K11 A;  2A08 A;  1AVZ C;  2W10 A;  2EPD A;  1PRM C;  2F2X A;  1K4U S;  3UF4 A;  2FG0 A;  2EYZ A;  2EYW A;  5IHI A;  1OV3 A;  4JJB A;  2A36 A;  4J9H A;  1X43 A;  1PNJ A;  1CSK A;  2F2W A;  2GTO A;  1SHG A;  2CT3 A;  3KFV A;  4D8D A;  2OAW A;  2X3X D;  2YSQ A;  2JT4 A;  2KBT A;  4DEX A;  1WXT A;  1OEB A;  3ULR B;  3VS2 A;  1UJ0 A;  4A63 B;  4HVW A;  2L3S A;  2CUD A;  2K79 A;  1SSH A;  1M8M A;  1M3B A;  2H8H A;  2KXC A;  2L3Q A;  1T3L A;  3FJ5 A;  1IO6 A;  4IIO A;  4F17 A;  2CRE A;  1K0S A;  2KRM A;  2PNI A;  2RQW A;  2J7I A;  1YP5 A;  2JM9 A;  4HVV A;  2RQR A;  2A28 A;  2FPF A;  5HCK A;  1QWE A;  2J05 A;  1U3O A;  2LJ0 A;  4RTZ A;  4E6R A;  4RTV A;  4JPB W;  2RNA A;  2K9G A;  3C0C A;  1ABO A;  3EG0 A;  4LNP A;  3TSW A;  1Y0M A;  1MV3 A;  2ROT A;  4JZ3 A;  5FWB A;  4Z88 A;  1SHF A;  2D8J A;  2DBK A;  4OML A;  1VYU A;  2EQI A;  2J6F A;  1X6B A;  2RPN A;  2KR3 A;  2KEA A;  3JV3 A;  1WA7 A;  1UTI A;  1GBQ A;  1GFC A;  1PHT A;  2DL8 A;  1WX6 A;  2O9S A;  3M0P A;  1YWO A;  2ROL A;  1YCS B;  2C0T A;  4AFU C;  2L0A A;  1NM7 A;  2JS0 A;  1WDX A;  1H92 A;  4JJD A;  3GBQ A;  4HCK A;  2KT8 A;  2DJQ A;  1TG0 A;  1VYT A;  4GLM A;  1NEB A;  1WIE A;  2FPD A;  2ECZ A;  2VKN A;  2G6F X;  1OPK A;  5GJV B;  1N5Z A;  1WI7 A;  2CUB A;  2KRN A;  4EIK A;  2FPE A;  5IHK A;  2O31 A;  2HEQ A;  1BU1 A;  1H8K A;  4D8K A;  4CC2 A;  3A98 A;  2RQT A;  2O88 A;  4Z8A A;  2DYB A;  2CH4 A;  2AK5 A;  1B07 A;  1AEY A;  1E6G A;  2VWF A;  2YUO A;  4HXJ A;  2DBM A;  1RLQ C;  2DA9 A;  4CC4 B;  2DX1 A;  2LJ1 A;  1GCQ A;  2YT6 A;  2OJ2 A;  2KE9 A;  2RN8 A;  2DL5 A;  4Y92 A;  2W0Z A;  2HSP A;  2YDL A;  1AOJ A;  4LN2 A;  1GRI A;  1QKX A;  4LUD A;  1X2Q A;  2YUQ A;  1G2B A;  1Z9Z A;  3THK A;  1ZBJ A;  1M3C A;  2EGA A;  2X3W D;  3M0R A;  3RNJ A;  2JMA A;  2LCS A;  1WYX A;  4J9F A;  1AWJ A;  1AWW A;  5I11 A;  1SRL A;  3UAT A;  2DL3 A;  1SRM A;  3SEM A;  1UFF A;  2RQV A;  2AKL A;  1A0N B;  2LJ3 A;  1K1Z A;  1FYN A;  1I0C A;  1X69 A;  1GFD A;  1W6X A;  3VS6 A;  1ZUY A;  4HVU A;  1BK2 A;  2C0O A;  2DL7 A;  2LZ6 B;  1RI9 A;  2CSQ A;  2JXB A;  2D0N A;  2KYB A;  3EG1 A;  1UDL A;  1AD5 A;  1KIK A;  1UG1 A;  3IQL A;  2FEI A;  2JW4 A;  1KFZ A;  1PWT A;  1TUD A;  2CH4 W;  3ZL7 C;  3LH5 A;  4RTX A;  1X27 A;  1Z9Q A;  4OMO A;  2NUZ A;  2SEM A;  4F16 A;  1V1C A;  4OMN A;  1ZX6 A;  2KXD A;  2EKH A;  3NHN A;  1XOV A;  1GCQ C;  1UHF A;  2K7A A;  2A37 A;  2ABL A;  1CKA A;  1UHC A;  2AZV A; 
#chains in the Genus database with same CATH topology
 1AZE A;  3CBO A;  3M0S A;  1VQN A;  1YJ9 T;  1WGS A;  2I0N A;  4D6W A;  4OMQ A;  4PJO F;  5GAM j;  2ZPH B;  3I35 A;  1Q82 R;  2IG0 A;  1H3Z A;  2WSC E;  2ESW A;  2QQ9 A;  1QMC A;  1VQP T;  1BKB A;  2GCX A;  2CT4 A;  1VQ9 A;  2MF2 A;  2KMT A;  1M9S A;  2Y4X A;  1NBE B;  3M54 A;  3MP1 A;  3QJY A;  1N27 A;  1NG2 A;  1QQJ A;  3VRZ A;  2DIL A;  1NJI U;  2FZC B;  1C1A A;  1YIT A;  3FDR A;  1WXU A;  4M75 D;  2OTL T;  3HFO A;  1VQ6 A;  3BFM A;  2CP6 A;  1B34 B;  2J06 A;  3U23 A;  2RHX A;  1IHW A;  1O75 A;  2QEX Q;  2DVJ A;  2L2P A;  5L8R E;  4F7U G;  3Q1J A;  2ENM A;  2VC8 A;  2YUP A;  4DBH A;  1Y7X A;  1I5O B;  2EVR A;  3WVE B;  3OYI A;  2E5K A;  2M0Y A;  4M77 F;  1SG5 A;  2COW A;  2RJC A;  3CME Q;  4ZN1 A;  5DY9 A;  4M75 A;  2DD4 A;  2HBP A;  3DLM A;  1I1J A;  2ATC B;  4PK4 A;  3M4Y A;  2PQW A;  1N8R C;  1NJI R;  3NPF A;  5CO7 A;  2KGT A;  1VA7 A;  1M3A A;  5KYW A;  2DXT A;  2V1Q A;  1YJ9 Q;  4KH1 B;  3RR6 A;  2KYM A;  1JO8 A;  2QQB A;  3EG9 B;  2CP5 A;  4MDW A;  5KYU B;  5IXF A;  3EGX A;  1VQP Q;  3UWN A;  5LJ5 j;  1M1K U;  3JCM X;  1QVF A;  1VIE A;  3QKJ A;  3V7S A;  3EGD B;  1KJW A;  5CAI A;  1GL5 A;  2HZY A;  2PUO B;  1PD1 A;  2DMO A;  2KAF A;  1MND A;  4M78 F;  1JU5 C;  2YXY A;  2LQN A;  2OTL Q;  2LTO A;  2RMO A;  3REA B;  1KSW A;  5GAN 2;  1K0X A;  2MWP A;  5IN1 A;  3CCR A;  1K76 A;  3G4S A;  3QJ6 A;  4IIM A;  3NMZ C;  2DK3 A;  4BE1 A;  2X4J A;  2JNG A;  4F7U A;  2P4R A;  2QTV A;  2ZPF B;  3JCM J;  1ARK A;  3EG2 A;  3FEO A;  5EC7 A;  3TVT A;  2GFU A;  4RCB A;  4M7A B;  3JB9 G;  1YI2 T;  3BDU A;  1Y96 A;  1OX8 A;  1T0J A;  2VXF A;  1RAA B;  2HMA A;  2K6D A;  1U06 A;  1UJY A;  2D8H A;  3RBB B;  2SRC A;  4PJN A;  5I21 A;  2MK5 A;  4JLI A;  2L8D A;  4KRT A;  2BE7 D;  4J9G A;  4XU2 A;  4HCZ A;  3M53 A;  1K8A U;  3OW2 P;  4DBQ A;  2JJ9 A;  3CCL T;  4KGZ B;  2VYT A;  3NTH A;  5A0D A;  5KCH A;  1UGV A;  3EG3 A;  1D09 B;  4C0D B;  3SFM A;  1YBY A;  2LCL A;  1M5Q 1;  2P0Q A;  3F70 A;  2LQW A;  1HSQ A;  2XK0 A;  3VS5 A;  3A8M B;  1WFW A;  2FRY A;  4OF1 A;  2P84 A;  2HL5 C;  2BUD A;  3CCS T;  3I5R A;  2F1L A;  2K3B A;  3CXC P;  1WJR A;  2GTJ A;  3PVL A;  5LJ5 h;  3VRY A;  4N4I A;  1JXO A;  1M1F A;  3I56 T;  3JB9 D;  2W10 A;  2EKO A;  2MMP A;  2F2X A;  4LDW A;  1K4U S;  1VQL T;  1X01 A;  4C8Q E;  2EYW A;  1IHV A;  3HHT B;  2LT4 A;  4JJB A;  3GLX A;  4TVR A;  5LJ3 h;  1X43 A;  4OVA A;  5AYF A;  4PFZ A;  1XJW B;  1CSK A;  2GTO A;  4X9C A;  1K8A R;  2K2V A;  3KFV A;  2X3X D;  2YSQ A;  2JT4 A;  3P8D A;  3EFO A;  5KE3 A;  2QEX A;  1OEB A;  2RI3 A;  4IKF A;  3MKD A;  1UJ0 A;  1G3S A;  2L3S A;  1DJ7 B;  2L3Q A;  1YI2 Q;  5CQY A;  1TSF A;  5KYX A;  1UGR B;  4IIO A;  5GAN 3;  2CRE A;  5DM7 R;  1K0S A;  2F5T X;  2RI5 A;  2DEQ A;  3EFR A;  1PM3 A;  4HVV A;  1JJ2 P;  1K9M C;  4ZGJ B;  1U3O A;  2LJ0 A;  4M7D F;  4RTV A;  3VUB A;  3CCL Q;  2MWO A;  2L5Q A;  1Y0M A;  2ROT A;  1SHF A;  2DBK A;  1SSF A;  3CMA T;  5CKE A;  2RPN A;  2RH2 A;  4ZTJ A;  2AT1 B;  3OYL A;  1O9S A;  5CR2 A;  4LDU A;  2O4X B;  2QK0 A;  4FYW B;  1Q7Y U;  3AT1 B;  2K5L A;  3RER A;  4OP0 A;  3CC7 Q;  1VQ5 A;  3CCS Q;  1EZZ B;  3N5B B;  4LD9 K;  2M9U A;  5IT9 E;  2C0T A;  4AFU C;  1VQP A;  2NUP B;  4EMK C;  1VQK Q;  2L0A A;  1GXI E;  4JJD A;  1LJO A;  2YRD A;  2A0F B;  3S3N A;  1UGP B;  3I56 Q;  1M8V A;  4GLM A;  1VQL Q;  5GAN 4;  3G1J A;  2G6F X;  1U8R A;  1OPK A;  1VQ8 A;  2CUB A;  5FU6 B;  2DJZ A;  5J39 A;  1PD0 A;  4EIK A;  2FPE A;  4XU3 A;  2O31 A;  2HEQ A;  2RA2 A;  2DD5 A;  4CC2 A;  2RQT A;  2VV5 A;  3G71 A;  3CD6 Q;  3CCM A;  4NS5 A;  3I55 T;  1Y71 A;  2QA4 T;  1RLQ C;  5GMK m;  4CC4 B;  1Q7Y R;  2LJ1 A;  4BAC A;  5I2S A;  5GAO n;  2YT6 A;  4RG2 A;  2W0Z A;  2YDL A;  4E7J A;  2QAZ A;  3M9Q A;  4LUD A;  1X2Q A;  1G2B A;  3THK A;  2EJ9 A;  2DZ9 A;  4C5G A;  4M7A G;  1KC8 C;  4BY6 C;  1Q81 C;  3BY7 A;  2P0P A;  2LCS A;  3S6W A;  3CCJ T;  3OW2 A;  1JRI A;  1IGQ A;  3CMA Q;  4J9F A;  1AT1 B;  1AWJ A;  1D0Y A;  2DTO A;  2DL3 A;  2RK2 A;  3SEM A;  4N0A A;  2AKL A;  4MML A;  4XTX A;  2DEU A;  3G6E T;  1I0C A;  1TH7 A;  1GFD A;  3R6O A;  1W6X A;  1NE8 A;  1ZUY A;  4HVU A;  4F7U F;  2C0O A;  1Q82 C;  2YRC A;  2LZ6 B;  2CZ0 B;  3JCM g;  3L2U A;  1KIK A;  1UG1 A;  3QYG B;  3ZL7 C;  4RTX A;  3EG9 A;  1X27 A;  5KYU A;  3OYE A;  3QZ9 B;  4KGV B;  1WJS A;  1D1C A;  1OYX A;  3NHN A;  1VQO A;  1EIF A;  1WHM A;  2R5M A;  1FXX A;  1VQM T;  1MMN A;  3EGD A;  4WCI A;  2YHT A;  3QWX X;  2JTE A;  1TS9 A;  4E7I A;  4OMM A;  5GAN d;  4M7A D;  4JJC A;  2JTF A;  2RK1 A;  2KK4 A;  3GNF B;  5GMK h;  2QA4 Q;  1BCO A;  4ELZ C;  2EYX A;  5GAM d;  1IRE B;  1WHH A;  4JZ4 A;  3HRU A;  2E6N A;  3A8O B;  1QP2 A;  3M0U A;  2FZG B;  1QVP A;  4MZP A;  2F2V A;  3E1S A;  5D7U A;  1AZG B;  2AZS A;  3CCE T;  1YHQ Q;  1G3W A;  2KT1 A;  2R5A A;  1VUB A;  1JJ2 A;  2E6Z A;  4XU0 A;  3CCJ Q;  2RF0 A;  3OYG A;  2B8A A;  2HD0 A;  4QVZ A;  4M7A A;  3RMQ A;  3VJP A;  1NJI C;  3CCL A;  3PVQ A;  2NLU A;  1Q86 U;  5M9O A;  5GAO m;  1WHL A;  3G6E Q;  2COY A;  3HTR A;  5GAN g;  2M51 A;  1PRL C;  4ESR A;  3HSB A;  3VS1 A;  1LOJ A;  4B6M A;  4RCC A;  2DTI A;  8ATC B;  2FO0 A;  4PJL A;  5IXB A;  4XTV A;  5GAM g;  3CCS A;  1P92 A;  5GAN f;  1VOM A;  3QG1 A;  1M2O A;  2M1H A;  3CPF A;  1YJN A;  5GAM f;  3V7R A;  4A4E A;  2OX7 A;  1W1F A;  3CC4 Q;  4DA4 A;  4MZM A;  1VQL A;  1V76 A;  1YCY A;  3CCU A;  2E3I A;  4DBR A;  4CC7 A;  2GQV A;  2CZ1 B;  2YWW A;  2ED0 A;  1N9S A;  3OYM A;  1Q86 R;  1OU9 A;  4O6J A;  3P8B B;  3X28 B;  1MGQ A;  4C0Z A;  4C8Q B;  3CME T;  1JBM A;  2OTJ A;  1RAG B;  5CQX A;  1NEG A;  4ORZ A;  2KI7 A;  4Z89 A;  1MNE A;  3JAM E;  2ZZD A;  4R55 A;  1RAE B;  1Q81 R;  4HCB A;  4ZGE B;  4PKC C;  2ZPB B;  3GIB A;  3CCE Q;  2MIO A;  2ZGW A;  4RTT A;  2LNV A;  1QVG S;  2KSS A;  4QQD A;  2LC4 A;  3LWI A;  1M1K C;  2EJF A;  3QHS A;  2K2M A;  3TSZ A;  3UA6 A;  2IVW A;  2DE0 X;  2YLC A;  1BB9 A;  2H3E B;  1E6H A;  1EFN A;  3QXE B;  4RMO A;  4FU6 A;  1UB4 A;  1BI0 A;  3OYB A;  2DNU A;  5GAO q;  1VQ7 T;  4J6W A;  2EBP A;  4J9B A;  1RUW A;  1M90 U;  3CMA A;  5FWC A;  4J9C A;  1AWO A;  1M27 C;  4M75 C;  4DEY A;  4WTO B;  1MUZ A;  2QQA A;  4JJN K;  2E1H A;  1D0Z A;  3OSV A;  4B9X A;  3MP6 A;  2RQU A;  2ZAE A;  1CKB A;  3JB9 H;  3H0F A;  2RB6 A;  3PTA A;  3EHR A;  2PZ1 A;  2FZK B;  2EQK A;  2E12 A;  1WQW A;  5IH2 A;  3GP8 A;  1KG1 A;  3G7Z A;  5LJ5 g;  2JM8 A;  4II1 A;  3I9Q A;  2O4X A;  3MPU B;  1YIJ Q;  4PJO B;  1U5S A;  2GNC A;  1BCM A;  3MEW A;  2DRM A;  4M75 E;  3DLL A;  2VUB A;  1PC0 A;  2DF6 A;  3H9N A;  1UEB A;  1KQS P;  4XTZ A;  3DB4 A;  1PG5 B;  2LNH B;  4LDV A;  1ZSZ B;  2NUP A;  1YFN A;  5A2Q E;  4ANJ A;  3BDL A;  1PKT A;  4CI0 C;  2DL4 A;  1RLP C;  3CC2 T;  1K8A C;  1KD1 U;  1JXM A;  4OGE A;  5C6S A;  1M90 R;  4X1V A;  1S1N A;  3PNW C;  4BUG A;  3I55 A;  1KQ1 A;  1YWP A;  2EGC A;  2HCK A;  3R6N A;  1NLP C;  1R0B G;  2LCC A;  4KUL A;  3MET A;  3HL8 A;  3OS0 A;  2CYZ B;  2RO0 A;  2A08 A;  1AVZ C;  2EPD A;  1PRM C;  1S72 Q;  2E5Q A;  2PVD B;  4P5N A;  3UF4 A;  3SWN B;  4C5H A;  2A36 A;  4J8O A;  4M77 B;  1VQ4 A;  1VQ7 Q;  1RI0 A;  2F2W A;  1M2V A;  4J7I A;  3CCJ A;  1SHG A;  2CT3 A;  4D8D A;  2OAW A;  3V8L A;  4DEX A;  3VS2 A;  2F69 A;  2HKQ B;  4FL6 A;  4IUV A;  4HVW A;  3JCM e;  2BE9 B;  1SSH A;  4F7U E;  1RAI B;  1M8M A;  5LL6 S;  2H8H A;  3LW5 E;  3JCM Q;  1KD1 R;  2MYS A;  1XTD A;  2JUF A;  3V8K A;  5LJ3 j;  2EQJ A;  3MP8 A;  2PNI A;  1FX7 A;  2RQW A;  3JB9 J;  1YP5 A;  4BDY A;  5FU7 C;  3PGG A;  4IUR A;  1RAD B;  4Z02 A;  1W2B S;  1AHJ B;  2J05 A;  4RTZ A;  4HT9 A;  4JPB W;  2RNA A;  3ZFJ A;  3C0C A;  4OB0 B;  3BW1 A;  2I2L A;  4LNP A;  3GOX A;  3OYC A;  1XQH A;  3TSW A;  3L1A A;  4JZ3 A;  1TXQ A;  4Z88 A;  4BY6 B;  2G3R A;  2LRQ A;  1VQM A;  2EQI A;  3CC2 Q;  2V26 A;  1G3Y A;  3JRZ A;  3PT9 A;  3JV3 A;  1UTI A;  4M78 B;  1GFC A;  1WX6 A;  2O9S A;  1YWO A;  1ACM B;  2ROL A;  1WNL A;  1M1K R;  1TTH B;  3M5A A;  1NM7 A;  2JS0 A;  2HL3 A;  1Q7Y C;  4J83 A;  2R57 A;  1V29 B;  4J6X A;  2YRV A;  3A8L B;  3CCV T;  2LQ8 A;  3CPW S;  1TG0 A;  3PFS A;  4C8Q G;  2FPD A;  3OS5 A;  2ECZ A;  1BI1 A;  1N5Z A;  1WI7 A;  3L42 A;  5HK3 A;  5IHK A;  2EYQ A;  1BU1 A;  2JZ2 A;  2XHC A;  5GAN e;  4Q5W A;  3A98 A;  4IUT A;  4BE2 A;  4QW2 A;  5CKH A;  2EAY A;  2RHU A;  2V8K A;  3JCM V;  2AK5 A;  2DYI A;  3CC7 T;  5CCA A;  1AEY A;  1E6G A;  2VWF A;  5GAM e;  2CS7 A;  1VQK T;  1GCQ A;  3OS1 A;  3QDR B;  1SF9 A;  3LH0 A;  3ME9 A;  4PFO A;  4PFP A;  4JS4 A;  1WHK A;  3ZBD A;  3OSS C;  1GRI A;  1QKX A;  3BE3 A;  4E7S A;  3OYA A;  2ZPG B;  4N4G A;  2EGA A;  4PJM A;  1TUG B;  4FW2 A;  2Z0W A;  5GAO r;  1KQS A;  2PVO B;  5EG2 A;  2E70 A;  1SKU B;  4PJO G;  3CD6 T;  1SRM A;  2M02 A;  2EQU A;  1TOV A;  2VAS A;  1K1Z A;  1WHG A;  2DET A;  4A4G A;  4A4H A;  2NUT B;  2CSQ A;  4ZN3 A;  2DIQ A;  2D0N A;  2KYB A;  2QGG A;  3CME A;  2QYZ A;  1MMA A;  1F1B B;  2FEI A;  2JW4 A;  1KFZ A;  1PWT A;  1TUD A;  2CH4 W;  3CCV Q;  3E2U A;  1D1A A;  2ZPI B;  1Z9Q A;  4LXC A;  2SEM A;  4OMN A;  3M59 A;  5CKF A;  1ZX6 A;  2A37 A;  2HQE A;  1YJW T;  2ABL A;  5GAN 8;  8AT1 B;  2RJF A;  2DKG A;  3GNG A;  3X24 B;  6AT1 B;  1SPK A;  1YJ9 A;  1FMW A;  1VQ7 A;  1VQN T;  2J6O A;  4MMK A;  3M4G A;  1NPR A;  4M7D B;  4M77 G;  4C92 B;  4PJO D;  4KGX B;  1OI1 A;  1I81 A;  2IIM A;  5ECA A;  3MEA A;  3MJX A;  5GJW B;  5LJ5 e;  3QDF A;  2QTX A;  2D6F A;  2ZCF B;  4N0A C;  4M75 F;  1YN8 A;  1N9R A;  1HD3 A;  4J9E A;  2L89 A;  1X2K A;  2BIV A;  1KHC A;  3OBW A;  1AWX A;  2OTL A;  5GMK j;  1ZLM A;  4QQG A;  1QP3 A;  2PTK A;  1VQ6 T;  3UA7 A;  4OMP A;  1H64 1;  3QPH A;  4BI8 B;  5DLO A;  2CZ6 B;  5A0G A;  3FIF A;  4ATO A;  2MOX A;  2LMJ A;  3JCM d;  4PJO A;  1B34 A;  2BZY A;  2DVE A;  4L6V 5;  2VVK A;  5AT1 B;  3OS2 A;  3DKM A;  5FLX E;  1FMV A;  3M55 A;  2E3H A;  3HP9 A;  1Q86 C;  3VUZ A;  1HK9 A;  3H0H A;  4BDZ A;  4AT1 B;  1ZSZ A;  5HY6 A;  2WSF E;  4M78 G;  1QWF A;  1RL2 A;  4M77 D;  2JS2 A;  3M0T A;  5IHN A;  1YHQ T;  4HT8 A;  2HAX A;  2RHI A;  1QVF S;  2XKO C;  4CRI A;  2O2O A;  4XTW A;  1G3T A;  3HKS A;  1FMK A;  1YJW Q;  3PIP A;  4GY5 A;  2QQR A;  3SB2 A;  3J80 E;  1VQN Q;  2L3P A;  2VXE A;  2E65 A;  2FB7 A;  4EMH A;  2QDL A;  1BBZ A;  2CP7 A;  4LUE A;  1H3H A;  2E64 A;  4FYX B;  3C95 A;  3SWN A;  2DAQ A;  1VQ9 Q;  4Y91 A;  4CC3 A;  1BIA A;  4M7A C;  3MCA B;  2RD1 A;  4M77 A;  4J9D A;  4QT7 A;  1Y07 A;  2CKK A;  4L59 A;  2VGM A;  2ED1 A;  3JCM f;  5CK9 A;  1OX9 A;  4FSS A;  1YIT Q;  1UE9 A;  2J6K A;  1NYF A;  7AT1 B;  3CC4 T;  4KT0 E;  2A3L A;  4M4Z A;  4NL3 A;  1VQ6 Q;  1PSE A;  2X51 A;  2EFI A;  3I5S A;  4RTU A;  1NYG A;  2XDB A;  1OQK A;  3D7S B;  3SHW A;  4DOV A;  4HKE A;  3SDZ A;  4M7A E;  4OB2 B;  3E9G A;  3M58 A;  3NTI A;  2V8I A;  4C0D C;  3DB3 A;  3MHX A;  1QW1 A;  3G4S T;  3OYY A;  4J6Y A;  2EWN A;  4BB7 A;  3QZ5 B;  1OOT A;  3CBM A;  1QCF A;  3X20 B;  1YI2 A;  2EYY A;  2QXF A;  3J81 E;  1M90 C;  5L23 A;  4DBF A;  3L2Z A;  4ZNX A;  1K73 U;  4OB3 B;  3FLG A;  3VYG A;  2E41 A;  1W2B A;  1VYV A;  3FJP A;  1R0C B;  3WVD B;  4KUD K;  1B3Q A;  2DER A;  4M78 A;  4RTW A;  1M30 A;  3TEE A;  3ASK A;  1WXB A;  3RKX A;  3EAE A;  4JRQ A;  4C5E A;  2DZC A;  2BZX A;  5D6Y A;  3VS7 A;  5HKC A;  1T3S A;  4AFS C;  4PNO A;  1NLO C;  3TRE A;  3H41 A;  5CIU A;  2XG8 D;  3H6Z A;  4FCY A;  1JEG A;  1PCX A;  3REB B;  3FB9 A;  2D1X A;  1FWZ A;  2DPP B;  3CQT A;  3TCJ A;  3CC7 A;  2DXU A;  4N4H A;  2LX7 A;  3JCM b;  1I4K 1;  1VQK A;  1G83 A;  3CPW A;  1W70 A;  2DXB A;  1KD1 C;  3JB9 F;  2DO3 A;  1YIJ T;  1XNI A;  4M7D G;  1JQQ A;  3X25 B;  3I56 A;  4K11 A;  4C92 G;  1K73 R;  3QUI A;  2K5F A;  2P0K A;  3CEY A;  2FVU A;  4PLL A;  3OMG A;  2EYZ A;  4OGC A;  1OV3 A;  5IHI A;  4J9H A;  3T9N A;  1WQ7 A;  3CCR Q;  5KYY B;  2NYS A;  3RIR A;  4KH0 B;  2KBT A;  3G4S Q;  1WXT A;  4PLI A;  3CD6 A;  4A63 B;  2CUD A;  2GF7 A;  2KXC A;  3FJ5 A;  5LJ5 d;  1IO6 A;  2XDP A;  4F17 A;  4A54 A;  5FRM A;  2KRM A;  1IB8 A;  4XTY A;  2J7I A;  2MI6 A;  2JM9 A;  1QCN A;  2RJE A;  4LD6 A;  1RAB B;  5HCK A;  5LJ3 d;  3MO8 A;  1S72 T;  3M56 A;  2CP3 A;  3HFN A;  3INZ A;  2XDD A;  3OYJ A;  1ABO A;  5FU6 C;  2NUT A;  1PSF A;  1MV3 A;  3QII A;  5FWB A;  4C92 D;  1KHI A;  1VYU A;  2J6F A;  3HRT A;  1X6B A;  4PL6 A;  4DQ2 A;  1IGU A;  3LYI A;  2JVV A;  2KEA A;  1D3B B;  1GBQ A;  1PHT A;  4OB1 B;  4XK8 E;  2P4T A;  2VB6 A;  2QAS A;  3GF5 A;  3JCM c;  1VQ5 T;  1YCS B;  1WDX A;  2XID A;  3GBQ A;  3JCM h;  4HCK A;  4IUQ A;  4AMC A;  2CP2 A;  1LNX A;  2DJQ A;  2MAM A;  1NEB A;  1NZ9 A;  2EJG A;  2VKN A;  4M7D A;  5LJ3 g;  2JTM A;  2LVM A;  3OB9 A;  3HPW A;  4C92 A;  5LJ5 f;  1VQ8 T;  1I8F A;  2QQS A;  4FIB A;  4D8K A;  1R8O B;  3OYK A;  2O88 A;  4Z8A A;  2DYB A;  2KY9 A;  3M57 A;  5LJ3 f;  3G71 T;  1B07 A;  3CCM T;  1HYO A;  2QA4 A;  3OW2 S;  1M4Z A;  4BE0 A;  4WF2 A;  2YUO A;  2DBM A;  2DA9 A;  2X35 A;  2DX1 A;  3FC3 A;  4EMK B;  2OJ2 A;  1QCO A;  3QO3 A;  4VUB A;  2DL5 A;  2CGH A;  2HSP A;  2M16 A;  5FRN A;  4GLK A;  3HRS A;  4LN2 A;  5J3B A;  3X26 B;  3JCM W;  4J7F A;  2YUQ A;  1YHQ A;  2FYK A;  3RKW A;  1Z9Z A;  1ZBJ A;  1ZQ1 A;  4JUV A;  2JOY A;  2DXC A;  3A1P A;  2OAU A;  4HCC A;  4L5G A;  4JS5 A;  1WYX A;  3FRN A;  3CXC S;  4LDY A;  5CKD A;  3JSC A;  3NFC A;  1OUL A;  3G6E A;  3RUX A;  1FYN A;  1X69 A;  3JCM P;  2V8J A;  3VS6 A;  5GAN h;  2XU8 A;  1QVG P;  1VQ5 Q;  1BK2 A;  9ATC B;  2DL7 A;  3EFS A;  2JXB A;  4FM4 B;  2K4Y A;  3EG1 A;  1UDL A;  1AD5 A;  5GAM h;  4JRK A;  2CP0 A;  2XD0 A;  1TU0 B;  1EX4 A;  3UT1 A;  2RJD A;  1D0X A;  1IXD A;  3WXM B;  4OMO A;  2RM4 A;  3MEV A;  1RAF B;  2NUZ A;  4ME7 A;  1VQ8 Q;  2KXD A;  4RKU E;  2EKH A;  1ZHI A;  3CC4 A;  1GCQ C;  1UHF A;  1VQO T;  4M7A F;  5GAN 5;  3UDC A;  2AZV A;  3V8J A;  3VS0 A;  2GGR A;  4EPC A;  2HNI A;  2HQH A;  1PKS A;  2Y90 A;  1WZO A;  4R56 A;  1JJ2 S;  3G71 Q;  3OY9 A;  3P8H A;  3CCM Q;  2KDS A;  1M1G A;  2D9T A;  4F14 A;  1MV0 B;  1UGS B;  4LE9 A;  3LGF A;  2X4Y A;  5GAN 7;  2VGN A;  3PE0 A;  3CCQ T;  1KK7 A;  5FW9 A;  1WHJ A;  2QDY B;  3QWY A;  4AG1 C;  2B86 A;  1LVK A;  3CCE A;  2CZ7 B;  2V1R A;  3H0I A;  4A53 A;  2E10 A;  2KVQ G;  1QLY A;  3GPL A;  3PMI A;  2DTH A;  4MDX A;  4HA8 A;  5CKB A;  2JN0 A;  2FRW A;  4A4F A;  3OA6 A;  2HDA A;  2LQK A;  2MCN A;  2EW3 A;  2QG9 B;  2CDT A;  2NWM A;  2OI3 A;  2IPO B;  4XTU A;  2BTT A;  1N6A A;  4RTY A;  2MPX C;  5J26 A;  4E7H A;  2KRO A;  3QBY A;  4C8Q C;  4AFZ C;  1OPL A;  4FYY B;  1SEM A;  1N8R U;  3LLR A;  3VS4 A;  3A8G B;  2HBW A;  2X9H A;  3MEU A;  2M0O A;  4DOW A;  1BI2 A;  1ZA2 B;  5GAN 6;  2EGE A;  4GBQ A;  1OZ3 A;  4JDS A;  4AG2 C;  1YIJ A;  4EMG A;  3A5Z B;  2DM1 A;  1VQO Q;  1ZBX A;  4IUU A;  1YJN T;  1WLP B;  1R77 A;  4ZTF A;  4C8Q D;  2O01 E;  2LP5 A;  1UEC A;  4X9D A;  1UUE A;  1C6V X;  1K9A A;  1MHN A;  1RAH B;  1Y57 A;  3CCU T;  2COZ A;  1NPP A;  3M0Q A;  5A0L A;  3O5Z A;  4QVD A;  3NGP A;  3SD4 A;  2BKD N;  1X6G A;  1W2B P;  2KRS A;  4RUG A;  3CCQ Q;  1GBR A;  1I07 A;  4AFQ C;  3OYN A;  1QKW A;  1IZ6 A;  2KNB B;  4NL2 A;  2OTJ T;  3ZEH A;  5KYY A;  2CSI A;  1TUC A;  1N8R R;  3URG A;  4PJO C;  3E9F A;  1BYM A;  1T0H A;  4ELY C;  2PUK B;  4C8Q A;  3KXT A;  2K57 A;  1S72 A;  4QKU A;  4FT4 A;  2D0Q B;  5GMK l;  3QYH B;  3J7A F;  1ABQ A;  1HJD A;  1G8X A;  1ZUK A;  4C92 F;  2GBQ A;  1ZSZ C;  1HXD A;  1OU8 A;  1YNZ A;  2A7Y A;  1BI3 A;  2BZ8 A;  2K3Y A;  4RG8 A;  3L2V A;  3CPW P;  3LX7 A;  4J5Y A;  1BIB A;  4PJO E;  1VQ9 T;  2XMF A;  3TQ7 P;  1J3T A;  3VS3 A;  1C0M A;  1MMD A;  1LPL A;  5I22 A;  3VV0 A;  2HQX A;  1QVG A;  2RI2 A;  5KH6 A;  1ZSG A;  5LJ3 e;  1YIT T;  1Q95 G;  4YTL A;  2HKN A;  5C0M A;  3EGU A;  1D3B A;  5FRO A;  2GQI A;  2YUN A;  1YJN Q;  2HSE B;  1E7O A;  1K73 C;  3SWN C;  3ER0 A;  3V7C A;  4M77 C;  2AKK A;  3CCU Q;  2EIF A;  4QVC A;  3CC2 A;  1GCP A;  2LT1 A;  4XQ3 A;  4M75 B;  2QI2 A;  1LCK A;  3A8H B;  4JRP A;  1TWB A;  2F5K A;  3VU3 C;  2DRK A;  2DLP A;  4E7K A;  2C0I A;  1D1B A;  4EDU A;  2O9V A;  4E47 A;  2OTJ Q;  4J9I A;  4C5I A;  5KYW B;  3AHU A;  4R0K A;  2QGF B;  4M77 E;  2X4X A;  3C12 A;  2JMC A;  5DLQ E;  5KYN A;  3L2Q A;  1ZUU A;  3EHQ A;  1M2V B;  2PVG B;  1RAC B;  3EGX B;  2Y4Y A;  5KE2 A;  3VKI A;  4LDX A;  4XAX B;  2FG0 A;  1OZ2 A;  2AIR B;  3NTK A;  2XIC A;  3S3O A;  4FW1 A;  3VYH B;  1PNJ A;  4EMK A;  4B9W A;  1VQ4 T;  2K5I A;  3ULR B;  4M78 C;  4MZT A;  2PU9 B;  2K79 A;  2ZPE B;  1K9M U;  3JB9 I;  1M3B A;  3RKY A;  1T3L A;  2LDM A;  3OBY A;  5GAO l;  4IUP A;  2XI9 A;  3OQ5 A;  3OMC A;  2RQR A;  2A28 A;  3RES A;  2FPF A;  4M78 D;  1QWE A;  4F7U B;  2K3X A;  3RMS A;  4E6R A;  4M78 E;  2K9G A;  3CXC A;  2EQM A;  3E19 A;  1W4S A;  3EG0 A;  4BD3 A;  2FL7 A;  3RDV A;  3LWH A;  4FT2 A;  1Y96 B;  1X6O A;  3CCR T;  4XU1 A;  4FSX A;  2R58 A;  2D8J A;  4OML A;  3PIO A;  2DFU A;  2KR3 A;  4JRI A;  1WA7 A;  4BI3 A;  4ZGD B;  5GMK i;  2DL8 A;  5CVI A;  3M0P A;  3OYD A;  3C4S A;  3UPU A;  4A4K A;  3I55 Q;  3EH2 A;  3CCQ A;  3L2W A;  1H92 A;  4KUI A;  1VIF A;  2DIG A;  4FYV B;  1K9M R;  5D6X A;  5FU7 B;  3CCV A;  5I2M A;  4E7L A;  2LX9 A;  2KT8 A;  1VYT A;  4E2F B;  1WIE A;  3C94 A;  4Y28 E;  5GJV B;  2YLB A;  4BI4 A;  4X34 A;  2L3R A;  2KRN A;  2WSE E;  4O5V A;  3L2R A;  4E7Z A;  1VQ4 Q;  4NOY A;  1H8K A;  3QSU A;  4V2S A;  4KBM B;  3OYH A;  3EH1 A;  2CH4 A;  3KUF A;  1KQS S;  1UGQ B;  1QVF P;  4HXJ A;  3CBP A;  1G5V A;  1WPY A;  1MMG A;  2H3J A;  1KC8 U;  3O8V A;  2KE9 A;  2RN8 A;  2AHJ B;  4Y92 A;  1Q81 U;  2RHZ A;  3KBG A;  2FHD A;  1B7T A;  3TU4 K;  5KCO A;  1AOJ A;  3PMT A;  3EFO B;  5D6W A;  2X4W A;  2WAC A;  4UC4 A;  1M3C A;  2X3W D;  4C8Q F;  3M0R A;  3RNJ A;  2JMA A;  5HK0 A;  5KYX B;  5GMK e;  1Q82 U;  4JLG A;  1VQM Q;  1AWW A;  5I11 A;  1SRL A;  3UAT A;  2QEX T;  1UFF A;  1U1S A;  4OMF B;  2RQV A;  1A0N B;  2LJ3 A;  1JB0 E;  2RHY A;  5IAY A;  3OYF A;  4M7D C;  1ZA1 B;  4C92 C;  1KQ2 A;  5GAO p;  1RI9 A;  3S3M A;  2KQW A;  1U1T A;  4PJJ A;  3H8Z A;  4M75 G;  3IQL A;  1IRX A;  2E4H A;  3LH5 A;  1X75 C;  3LGL A;  4QQ6 A;  4C0G A;  1KC8 R;  1WJQ A;  4F04 B;  2C06 A;  4F16 A;  1V1C A;  4M7D D;  2GFA A;  1YJW A;  1XOV A;  5GAN j;  4M7D E;  2K7A A;  4C0F A;  4C92 E;  1CKA A;  1I5L A;  1UHC A; 
#chains in the Genus database with same CATH homology
 3VS0 A;  2GGR A;  4WCI A;  1AZE A;  1PKS A;  1SPK A;  3QWX X;  2JTE A;  3M0S A;  4OMM A;  2I0N A;  4JJC A;  4OMQ A;  3I35 A;  2J6O A;  4F14 A;  1MV0 B;  4LE9 A;  2ESW A;  2EYX A;  3PE0 A;  2IIM A;  5ECA A;  2CT4 A;  4JZ4 A;  5FW9 A;  5GJW B;  3M0U A;  3QWY A;  1NG2 A;  2B86 A;  4AG1 C;  3VRZ A;  2DIL A;  1YN8 A;  3H0I A;  2V1R A;  2F2V A;  1AZG B;  2AZS A;  1HD3 A;  4J9E A;  1X2K A;  2KT1 A;  1AWX A;  1QLY A;  1ZLM A;  1WXU A;  2PTK A;  2RF0 A;  2J06 A;  3UA7 A;  3U23 A;  4OMP A;  2FRW A;  3PVQ A;  2DVJ A;  2HDA A;  2L2P A;  2MCN A;  2ENM A;  2EW3 A;  2LMJ A;  2MOX A;  2CDT A;  2NWM A;  2YUP A;  2EVR A;  2OI3 A;  2BTT A;  2M51 A;  2BZY A;  1PRL C;  4ESR A;  4RTY A;  3VS1 A;  2VVK A;  2KRO A;  2E5K A;  2FO0 A;  2M0Y A;  4AFZ C;  1OPL A;  3H0H A;  1SEM A;  5IXB A;  3VS4 A;  2HBW A;  2EGE A;  1QWF A;  4GBQ A;  2JS2 A;  3M0T A;  5IHN A;  1I1J A;  4AG2 C;  2DM1 A;  2O2O A;  1FMK A;  3NPF A;  2KGT A;  1WLP B;  1W1F A;  1VA7 A;  1M3A A;  2LP5 A;  1UEC A;  1UUE A;  1K9A A;  2V1Q A;  1Y57 A;  3M0Q A;  2L3P A;  2KYM A;  3O5Z A;  1JO8 A;  3NGP A;  4CC7 A;  2QDL A;  1BBZ A;  2ED0 A;  1X6G A;  5IXF A;  4LUE A;  2KRS A;  1H3H A;  4RUG A;  1GBR A;  1I07 A;  4AFQ C;  1QKW A;  2KNB B;  4CC3 A;  4J9D A;  1KJW A;  1NEG A;  4ORZ A;  4QT7 A;  1GL5 A;  4Z89 A;  2DMO A;  2ED1 A;  2CSI A;  1TUC A;  2MIO A;  1JU5 C;  4FSS A;  1UE9 A;  1T0H A;  2J6K A;  4RTT A;  2LQN A;  1NYF A;  2RMO A;  2K2M A;  4M4Z A;  3TSZ A;  3UA6 A;  3REA B;  2DE0 X;  1ABQ A;  1HJD A;  1BB9 A;  1KSW A;  3I5S A;  4RTU A;  1NYG A;  1E6H A;  1ZUK A;  1EFN A;  2GBQ A;  3SHW A;  1K0X A;  2DNU A;  2EBP A;  1YNZ A;  4J9B A;  1RUW A;  1K76 A;  5FWC A;  4J9C A;  1AWO A;  1M27 C;  2BZ8 A;  4DEY A;  4IIM A;  1MUZ A;  3NMZ C;  2P4R A;  2RQU A;  1CKB A;  2XMF A;  1OOT A;  3H0F A;  1ARK A;  1QCF A;  1J3T A;  3VS3 A;  2EYY A;  3EG2 A;  5EC7 A;  5I22 A;  3TVT A;  3EHR A;  2PZ1 A;  5L23 A;  4ZNX A;  1T0J A;  1VYV A;  1ZSG A;  2K6D A;  5IH2 A;  1U06 A;  1UJY A;  2D8H A;  1B3Q A;  3RBB B;  2SRC A;  2JM8 A;  3EGU A;  3I9Q A;  4KRT A;  1U5S A;  2GNC A;  4J9G A;  2DRM A;  2GQI A;  2YUN A;  4RTW A;  1M30 A;  2DF6 A;  1WXB A;  1E7O A;  2LNH B;  2BZX A;  3VS7 A;  2AKK A;  1T3S A;  1UGV A;  4AFS C;  3EG3 A;  1GCP A;  1NLO C;  1PKT A;  2DL4 A;  1RLP C;  3H41 A;  1LCK A;  1JEG A;  2DRK A;  2DLP A;  2LQW A;  1HSQ A;  1JXM A;  3REB B;  3VS5 A;  2C0I A;  2D1X A;  3CQT A;  1WFW A;  4X1V A;  2FRY A;  1S1N A;  2LX7 A;  2O9V A;  3I5R A;  4J9I A;  1YWP A;  2EGC A;  4R0K A;  1G83 A;  2HCK A;  3R6N A;  2K3B A;  1W70 A;  1NLP C;  2GTJ A;  3PVL A;  2JMC A;  3VRY A;  1ZUU A;  3EHQ A;  1JQQ A;  1JXO A;  4K11 A;  2A08 A;  1AVZ C;  2W10 A;  2EPD A;  1PRM C;  2F2X A;  1K4U S;  3UF4 A;  2FG0 A;  2EYZ A;  2EYW A;  5IHI A;  1OV3 A;  4JJB A;  2A36 A;  4J9H A;  1X43 A;  1PNJ A;  1CSK A;  2F2W A;  2GTO A;  1SHG A;  2CT3 A;  3KFV A;  4D8D A;  2OAW A;  2X3X D;  2YSQ A;  2JT4 A;  2KBT A;  4DEX A;  1WXT A;  1OEB A;  3ULR B;  3VS2 A;  1UJ0 A;  4A63 B;  4HVW A;  2L3S A;  2CUD A;  2K79 A;  1SSH A;  1M8M A;  1M3B A;  2H8H A;  2KXC A;  2L3Q A;  1T3L A;  3FJ5 A;  1IO6 A;  4IIO A;  4F17 A;  2CRE A;  1K0S A;  2KRM A;  2PNI A;  2RQW A;  2J7I A;  1YP5 A;  2JM9 A;  4HVV A;  2RQR A;  2A28 A;  2FPF A;  5HCK A;  1QWE A;  2J05 A;  1U3O A;  2LJ0 A;  4RTZ A;  4E6R A;  4RTV A;  4JPB W;  2RNA A;  2K9G A;  3C0C A;  1ABO A;  3EG0 A;  4LNP A;  3TSW A;  1Y0M A;  1MV3 A;  2ROT A;  4JZ3 A;  5FWB A;  4Z88 A;  1SHF A;  2D8J A;  2DBK A;  4OML A;  1VYU A;  2EQI A;  2J6F A;  1X6B A;  2RPN A;  2KR3 A;  2KEA A;  3JV3 A;  1WA7 A;  1UTI A;  1GBQ A;  1GFC A;  1PHT A;  2DL8 A;  1WX6 A;  2O9S A;  3M0P A;  1YWO A;  2ROL A;  1YCS B;  2C0T A;  4AFU C;  2L0A A;  1NM7 A;  2JS0 A;  1WDX A;  1H92 A;  4JJD A;  3GBQ A;  4HCK A;  2KT8 A;  2DJQ A;  1TG0 A;  1VYT A;  4GLM A;  1NEB A;  1WIE A;  2FPD A;  2ECZ A;  2VKN A;  2G6F X;  1OPK A;  5GJV B;  1N5Z A;  1WI7 A;  2CUB A;  2KRN A;  4EIK A;  2FPE A;  5IHK A;  2O31 A;  2HEQ A;  1BU1 A;  1H8K A;  4D8K A;  4CC2 A;  3A98 A;  2RQT A;  2O88 A;  4Z8A A;  2DYB A;  2CH4 A;  2AK5 A;  1B07 A;  1AEY A;  1E6G A;  2VWF A;  2YUO A;  4HXJ A;  2DBM A;  1RLQ C;  2DA9 A;  4CC4 B;  2DX1 A;  2LJ1 A;  1GCQ A;  2YT6 A;  2OJ2 A;  2KE9 A;  2RN8 A;  2DL5 A;  4Y92 A;  2W0Z A;  2HSP A;  2YDL A;  1AOJ A;  4LN2 A;  1GRI A;  1QKX A;  4LUD A;  1X2Q A;  2YUQ A;  1G2B A;  1Z9Z A;  3THK A;  1ZBJ A;  1M3C A;  2EGA A;  2X3W D;  3M0R A;  3RNJ A;  2JMA A;  2LCS A;  1WYX A;  4J9F A;  1AWJ A;  1AWW A;  5I11 A;  1SRL A;  3UAT A;  2DL3 A;  1SRM A;  3SEM A;  1UFF A;  2RQV A;  2AKL A;  1A0N B;  2LJ3 A;  1K1Z A;  1FYN A;  1I0C A;  1X69 A;  1GFD A;  1W6X A;  3VS6 A;  1ZUY A;  4HVU A;  1BK2 A;  2C0O A;  2DL7 A;  2LZ6 B;  1RI9 A;  2CSQ A;  2JXB A;  2D0N A;  2KYB A;  3EG1 A;  1UDL A;  1AD5 A;  1KIK A;  1UG1 A;  3IQL A;  2FEI A;  2JW4 A;  1KFZ A;  1PWT A;  1TUD A;  2CH4 W;  3ZL7 C;  3LH5 A;  4RTX A;  1X27 A;  1Z9Q A;  4OMO A;  2NUZ A;  2SEM A;  4F16 A;  1V1C A;  4OMN A;  1ZX6 A;  2KXD A;  2EKH A;  3NHN A;  1XOV A;  1GCQ C;  1UHF A;  2K7A A;  2A37 A;  2ABL A;  1CKA A;  1UHC A;  2AZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...