1JEGA

Solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
SGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel, specific interaction involving the Csk SH3 domain and its natural ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/hydrolase
molecule keywords TYROSINE-PROTEIN KINASE CSK
total genus 10
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jegA00
1SPKA 1X27A 5L23A 1JQQA 2OJ2A 2OI3A 3GBQA 4J9FA 3M0QA 5EC7A 1NYFA 2KBTA 2DLPA 2K3BA 2RMOA 1OPKA 1SEMA 3UA6A 4EIKA 2YUNA 2LP5A 2EQIA 1W70A 3VS6A 1TG0A 1NM7A 1UJ0A 3QWYA 2YUPA 1ZX6A 3ZL7C 2AK5A 2DYBA 4GLMA 1BB9A 4M4ZA 1JXOA 1K1ZA 2DNUA 3SEMA 2O9VA 2I0NA 2CT3A 4OMNA 4JZ4A 2FRYA 2HCKA 3EHQA 1YN8A 1GBQA 1GRIA 1K76A 2DA9A 3C0CA 1UE9A 1PWTA 1X6GA 4LUEA 1HD3A 1WXBA 4DEXA 2A37A 2RQTA 2YUQA 3EHRA 3FJ5A 2L0AA 1NLPC 3TVTA 1ABOA 2FO0A 3PE0A 4ORZA 1X69A 1QWFA 3M0UA 1X43A 2KXDA 2L3SA 3REBB 4Y92A 4CC4B 2LJ1A 2YDLA 5FWBA 1AWOA 2DL4A 3TSZA 2ENMA 2RPNA 5FWCA 2K2MA 4LN2A 1AVZC 1ZUYA 1I0CA 1ZUKA 1AWWA 4AFQC 1GCQA 2DJQA 2RQWA 1NG2A 1QCFA 1UDLA 3H0FA 2PZ1A 4OMMA 4AG2C 2KRMA 1PRMC 1ABQA 3NPFA 1WIEA 2M51A 2RQUA 4RTWA 2J6KA 2KT1A 3KFVA 2EGEA 1HSQA 1ZBJA 4RTUA 1M3CA 3JV3A 1WXUA 1QLYA 3M0SA 2DL8A 3VS4A 2A36A 2FG0A 2LJ0A 2DX1A 5IXFA 4JPBW 5ECAA 1H3HA 1KSWA 1BU1A 1T0HA 2LCSA 2F2WA 1Z9QA 2GTOA 1X2KA 4CC2A 2JM8A 2AKLA 1X2QA 2EYWA 4J9GA 2ESWA 2KR3A 3I5RA 1M3BA 2EGCA 1SSHA 2MCNA 1Y57A 1AZGB 2XMFA 1E6HA 2DRMA 4HCKA 5IH2A 1SHFA 4KRTA 2FPFA 1U5SA 1ZLMA 2V1RA 2L3PA 1G83A 2GTJA 2KRNA 1CKBA 4AG1C 1T0JA 5GJWB 3M0PA 1PKSA 2AZVA 1RLQC 2L3QA 1UHFA 2QDLA 3QWXX 5HCKA 2DE0X 2DBKA 2C0TA 2JM9A 1GBRA 3NHNA 3PVQA 2A08A 1WDXA 3U23A 1H8KA 3REAB 1YP5A 5FW9A 2KYBA 2D1XA 5IXBA 1VYVA 2FPDA 2CUDA 4CC7A 3VS5A 2V1QA 4HXJA 1M30A 2JS0A 2VWFA 1JU5C 1OV3A 2JMAA 2RQRA 1U06A 2ROTA 4HVUA 2CH4W 1T3SA 1UJYA 2EVRA 1AD5A 3VRZA 1ZSGA 1NYGA 2D8JA 1GFCA 1SRMA 1IO6A 3TSWA 2PTKA 1VYUA 5IHNA 2VKNA 2EKHA 2X3XD 4RTTA 4OMQA 1H92A 4LNPA 4K11A 4LE9A 4OMOA 2BZ8A 1PHTA 1NEBA 3VS7A 2LJ3A 2AKKA 2EW3A 2F2XA 2LQNA 2IIMA 1KFZA 1RUWA 2X3WD 2KROA 2NUZA 1K0SA 2J7IA 3IQLA 1A0NB 2VVKA 1M8MA 4F17A 3R6NA 2KE9A 3CQTA 3VS2A 4DEYA 1JXMA 1Y0MA 2D0NA 4GBQA 1CKAA 1K4US 1AWXA 1NLOC 2O88A 1WFWA 2JS2A 3ULRB 2W10A 2DVJA 3H0HA 2D8HA 1OPLA 1MV0B 2DL5A 2J06A 1ARKA 2PNIA 2YSQA 2B86A 1T3LA 2FPEA 1K0XA 2ROLA 4IIMA 2DMOA 2W0ZA 1HJDA 1B3QA 2KGTA 2SRCA 2KRSA 4D8KA 2FEIA 2RF0A 1B07A 2LMJA 4J9BA 2ED0A 1BK2A 2LX7A 1OOTA 2M0YA 4AFSC 5IHIA 1XOVA 1WX6A 2L2PA 1X6BA 3NGPA 1UFFA 1QWEA 3LH5A 1SRLA 2FRWA 2HSPA 2GBQA 3UA7A 4J9CA 5I22A 1SHGA 4HVVA 1I1JA 1U3OA 1UHCA 2HBWA 4Z88A 4E6RA 4F14A 3SHWA 2G6FX 2DM1A 1KJWA 1E6GA 1WYXA 1CSKA 5GJVB 3EG2A 4HVWA 1YNZA 1FYNA 2K9GA 1GCQC 1I07A 1VA7A 1WLPB 4WCIA 3RNJA 1AWJA 2A28A 3NMZC 1OEBA 2CDTA 1YWOA 3RBBB 1FMKA 2KYMA 1NEGA 1LCKA 2K6DA 3EG1A 4R0KA 2MOXA 1V1CA 4X1VA 2YT6A 1MV3A 2KXCA 2NWMA 1N5ZA 2KT8A 1RLPC 1YWPA 1UG1A 2CUBA 2DILA 3PVLA 2CSQA 4J9DA 3H0IA 1YCSB 1QKWA 1AZEA 2EYYA 2C0IA 2DL7A 2CT4A 2ED1A 3I35A 1PNJA 2EPDA 4LUDA 2HDAA 4ZNXA 3VRYA 3VS1A 2H8HA 4IIOA 2LNHB 2ABLA 3I5SA 1TUCA 2CSIA 4JJDA 1WXTA 4RTVA 4Z8AA 2F2VA 1GL5A 4JZ3A 2RN8A 2JT4A 2DBMA 1K9AA 4J9HA 2AZSA 2O31A 3H41A 4QT7A 1J3TA 2K79A 4RUGA 4Z89A 4ESRA 2C0OA 1JEGA 2K7AA 1UTIA 3I9QA 2J05A 1GFDA 3O5ZA 3VS0A 1S1NA 4AFZC 4F16A 2EYXA 3VS3A 2CH4A 4J9IA 1W1FA 2MIOA 1GCPA 2JW4A 4D8DA 3UATA 1TUDA 4RTZA 1PRLC 4FSSA 2LQWA 2GNCA 2YUOA 1UECA 2BTTA 1UUEA 2RNAA 1KIKA 4OMPA 1E7OA 2ECZA 2GGRA 4RTYA 3M0RA 2JXBA 1Z9ZA 2DF6A 4CC3A 4AFUC 4OMLA 4RTXA 1WI7A 2DRKA 2O9SA 1M3AA 4J9EA 1RI9A 1AEYA 2BZYA 1AOJA 2HEQA 2BZXA 4A63B 5IHKA 2KNBB 2RQVA 3M0TA 2O2OA 2E5KA 2J6OA 4JJCA 2EYZA 2J6FA 1VYTA 2CREA 2EGAA 1PKTA 1G2BA 2LZ6B 2JMCA 1WA7A 2GQIA 3EG0A 4JJBA 1QKXA 2KEAA 1W6XA 1JO8A 1BBZA 1UGVA 3THKA 2SEMA 3EG3A 5I11A 1ZUUA 2P4RA 3A98A 3UF4A 3EGUA 1M27C 2JTEA 2EBPA 2DL3A 1MUZA 1EFNA 2OAWA
chains in the Genus database with same CATH superfamily
4F7UB 3OYEA 2GQVA 1JQQA 1Q86U 2E10A 1YITT 2KK4A 5EC7A 3L2UA 5GANj 2K3BA 2RMOA 1OPKA 4J7IA 1VQOT 4OVAA 4EIKA 2EQIA 5GAOp 1OZ2A 4FYXB 1KQSS 1NM7A 5GAN8 3MKDA 1ZX6A 4V2SA 1KG1A 3EGXA 4N4HA 4QKUA 1WNLA 2DNUA 3SEMA 3G4ST 2I0NA 4OMNA 1GBQA 3RUXA 1K76A 1PWTA 4IUUA 4Q5WA 4LUEA 4OF1A 1U1SA 3EHRA 1VQ8A 1JJ2A 2K2VA 1IZ6A 4ME7A 4M7AA 4PLIA 3CCUA 3PE0A 3LW5E 1QWFA 2LCLA 1UGRB 3J81E 2DEUA 2OTLT 2KXDA 3QPHA 3MCAB 4XTVA 3LWHA 3DLLA 4JS4A 1KQ2A 2RPNA 1WHHA 2K2MA 4LDUA 1AVZC 2DERA 5GAMd 1I0CA 2LVMA 1QP2A 4AFQC 3OSVA 4EMHA 3BE3A 1NG2A 4PJNA 1QCFA 3H0FA 1M1KC 5FU6C 4AG2C 4FYWB 5CK9A 5CQXA 1PRMC 2RK2A 4RTWA 4JRKA 2DXCA 2JN0A 3UPUA 1VQPQ 1ZBJA 4RTUA 1I5OB 3JV3A 4J5YA 1QLYA 1QVGS 3MP8A 1G3WA 2EWNA 3LLRA 2A36A 4KUDK 4P5NA 1UB4A 2DIQA 2DKGA 2DAQA 1BU1A 1BI1A 4CC2A 2LTOA 2EYWA 2EGCA 1AZGB 2XDDA 1M2OA 1M90C 5IH2A 1Q7YR 1VQ7Q 4JRQA 4C5HA 2FPFA 1U5SA 4MZTA 2GTJA 1CKBA 3O8VA 3M0PA 1PKSA 4C0GA 2AZVA 3LYIA 3V8KA 1FMWA 3HTRA 2DE0X 2C0TA 2JM9A 3A8LB 4MZPA 2VASA 1QQJA 3REAB 1VQOQ 4M77D 2KYBA 3JRZA 1R0CB 2D1XA 1PC0A 3VS5A 4HXJA 1M30A 1YCYA 1VQ9T 1OV3A 3EAEA 3PMTA 2RQRA 4QVCA 1U06A 2ROTA 1K9MC 2COZA 2QEXA 1VQ4T 3VRZA 2QQBA 1ZSGA 1G5VA 1SRMA 1IO6A 3TSWA 2OTJA 2PTKA 2RI2A 4C92E 4BD3A 3A1PA 2EKHA 1IXDA 3HRSA 4B9XA 2Y4YA 1W2BS 5FRMA 1H92A 4LNPA 4LE9A 1KQSP 3HKSA 4OMOA 1QW1A 3VS7A 2QEXQ 2LJ3A 2F2XA 2JNGA 3S3NA 5KYXB 1R0BG 3VUBA 5GAMj 1KFZA 3MHXA 2KROA 2QYZA 3M4YA 4EMKC 1NZ9A 3EGDA 4JS5A 2RM4A 4DBFA 2PVOB 2VVKA 3G6ET 5LJ3f 3R6NA 2NUPA 3JB9H 4ZGJB 1PSEA 2KE9A 3VS2A 3M9QA 1JXMA 2KSSA 5GAOn 4GBQA 3PFSA 4FT4A 3E1SA 1K4US 2CP6A 1NLOC 4BDYA 1WFWA 2RHIA 5GAN3 2JS2A 3ULRB 2DVJA 5J3BA 3X28B 3OBWA 4A4EA 3CPWS 3G6EA 4B9WA 1K0XA 1OU9A 3CCMT 5I21A 2SRCA 3MEUA 3E2UA 3CC4T 4LDWA 4PJOC 2DXBA 4J9BA 4OB1B 2LX7A 3MO8A 4Z02A 4DA4A 1XOVA 2RHYA 1YHQT 1X6BA 1I8FA 2OTJT 2E6NA 2EAYA 4DQ2A 1OX8A 3S3MA 2HSPA 3CCMA 1YIJT 1VQ7T 3CCLA 1W2BA 3UA7A 4RKUE 5I22A 1SHGA 4BDZA 3QIIA 5GAOq 4E6RA 5A2QE 4F14A 4XTZA 3SHWA 1N8RR 1KJWA 1E6GA 4M77C 3CD6Q 3WVEB 3DKMA 1GCQC 4MDWA 1VA7A 1KHCA 4WCIA 1W2BP 1ZBXA 4X9DA 1QVGA 2MK5A 1YWOA 2L8DA 3RBBB 1NEGA 3E9GA 1VQLQ 2KXCA 1N5ZA 4J9DA 3CCRT 5AYFA 3NTHA 3H0IA 3OS1A 4J6XA 3OS2A 3EFOA 2EIFA 3QZ5B 1AZEA 3OYKA 2M9UA 2ED1A 3RESA 3CCLQ 3VRYA 4ZNXA 5A0DA 2R5AA 2HQXA 1TUCA 1WHGA 1YI2T 3L2QA 1K9MU 3DB4A 1M4ZA 3OMGA 4J9HA 3CC2Q 3FDRA 3H41A 2GFUA 4JRPA 1Y07A 4RUGA 2C0OA 2DJZA 1GFDA 2BE7D 3QDFA 3VKIA 1YJWQ 3LGLA 1U1TA 1S1NA 2BUDA 2P84A 2QGFB 3G4SQ 1N8RU 3NTIA 2EYXA 4RCBA 2HKNA 5DM7R 2CH4A 2V26A 2C06A 4M78E 3UATA 2CZ6B 5GAOm 1PRLC 3M53A 2EYQA 5CKBA 2YUOA 2FB7A 2PVDB 1QCOA 3OYYA 2RNAA 2CP2A 1UGQB 2JTFA 5LJ5f 3S3OA 2ZCFB 2CKKA 1K8AC 1Z9ZA 1YI2Q 2KY9A 3LWIA 1JBMA 3H9NA 4ANJA 1KD1C 5IT9E 4J9EA 1OZ3A 2V8KA 1AOJA 3CC2T 2KNBB 4ELYC 2RQVA 3I55Q 2H3JA 3EGDB 3OYAA 1ZSZC 1LJOA 4N0AA 2HBPA 2RB6A 3FEOA 3M55A 1Y96B 5GANf 2DPPB 2JMCA 2LZ6B 3CCSQ 3EG0A 1QKXA 1VUBA 4BY6C 2XHCA 2SEMA 3RIRA 4C8QE 1ZUUA 2MAMA 2QTXA 4XU2A 2HD0A 3NTKA 1XTDA 2HL5C 3QJYA 1EFNA 2OAWA 3VU3C 2ZPHB 1YJWA 1QVFP 5L23A 1VQOA 1VQMQ 1H641 3ZFJA 2OI3A 4R56A 3PIOA 3JCMe 3RMSA 2DLPA 1YITA 3OYGA 1VQ6T 1SEMA 5LJ5j 4LDXA 2LP5A 4M78B 3PTAA 5GAN5 3QWYA 5EG2A 3JCMQ 4M7AF 3ZL7C 2AK5A 2DYBA 3OYNA 1HXDA 3OY9A 1X01A 2XD0A 3ASKA 2CT3A 1GRIA 2DFUA 3C0CA 3CPWP 1UE9A 3V8JA 4DEXA 2RQTA 3FJ5A 1Y7XA 1RL2A 3I55A 2X4WA 3TVTA 1O75A 2FO0A 2OX7A 2XI9A 3VUZA 3EGXB 3HRUA 5CO7A 3REBB 1JRIA 4Y92A 4C0FA 4CC4B 4M7DG 1AWOA 4C8QC 1GXIE 4LN2A 2D0QB 2D9TA 3A8MB 1VQNT 2WSFE 5M9OA 6AT1B 2FZCB 4RMOA 1BI2A 4ATOA 2KT1A 1HSQA 1OI1A 2DXUA 2GFAA 4JLGA 1M3CA 2LDMA 3OQ5A 2L89A 1YJNQ 9ATCB 5HKCA 1VQ4Q 4N4IA 1WXUA 3M0SA 3V7CA 2K5LA 1FXXA 1TOVA 1WJRA 3GNFB 4ZTFA 4JPBW 4IKFA 2M02A 2DO3A 4R55A 1X2KA 3JCMV 1WJSA 2K3YA 3VV0A 2ZPFB 5GMKe 2XMFA 1E6HA 2DRMA 4HCKA 1VQ5T 3JCMf 1SHFA 3JB9G 4KRTA 3RR6A 4KULA 2M1HA 4XU0A 3EH2A 1ZA1B 3M57A 3RERA 3CMAA 5GJWB 1YITQ 4N4GA 3CC7A 3CD6T 4IUPA 3CCQT 1UHFA 3SWNA 1GBRA 3PVQA 3X20B 2A08A 5LJ3h 5FW9A 4DBQA 2HSEB 5A0GA 3NFCA 3GP8A 1JJ2P 1VOMA 1VYVA 2CUDA 4CC7A 4JUVA 1EIFA 2JS0A 2VYTA 2V8JA 4E7HA 1VIFA 1VQLA 4A54A 2R57A 5GMKl 1QVFS 4HVUA 3SD4A 1T3SA 5LJ3j 5GMKm 2DTHA 5KH6A 3G71Q 1GFCA 2DTOA 3BY7A 1B7TA 4L5GA 1VYUA 5A0LA 1M90U 2X3XD 4FCYA 1D1CA 3P8HA 3A8HB 3CCST 4K11A 4C8QA 3HFNA 1NEBA 2LQNA 2EW3A 4HCCA 3CCVT 4C8QG 1OX9A 3EFRA 4HKEA 1RAHB 2X3WD 4KUIA 5CQYA 2OAUA 4M7DD 5CKDA 4M78D 2QASA 1JB0E 3QDRB 4L6V5 3CCRA 2EQJA 2I2LA 3CQTA 3OB9A 4EDUA 2NYSA 3QO3A 2DEQA 2Z0WA 3N5BB 2R58A 1NJIR 5KYWB 1NPRA 2COYA 5KYNA 2J06A 2PNIA 5LL6S 1JJ2S 5GMKh 2B86A 1KD1R 4E47A 2IVWA 2DMOA 1O9SA 4JLIA 5GANe 1B3QA 2KGTA 1KC8U 1BCOA 3ZEHA 4KGXB 4M7DB 2WSEE 3EFOB 3CCUQ 1K9MR 1VQ5Q 4E7SA 3BDLA 3PIPA 2EQMA 2LX9A 4LXCA 1M2VA 4AFSC 1ZQ1A 2VUBA 3JCMb 2L2PA 3EG9A 7AT1B 1QWEA 4Y91A 3CC4A 2FRWA 2GBQA 1PG5B 5D7UA 1RAEB 3WXMB 4KH0B 3RKYA 3PMIA 4MDXA 1KQSA 1U3OA 1UHCA 3T9NA 4HT8A 2JUFA 5KE2A 2NUTB 4C92B 1WYXA 1D0YA 1CSKA 1TSFA 5GJVB 3EG2A 3HP9A 2DTIA 2K9GA 1I07A 1PM3A 1M1FA 3OYIA 3L2RA 1AWJA 3CCVA 3META 2ZZDA 2E3HA 3EFSA 3KUFA 3OYCA 1YJNA 3OYLA 4R0KA 1AT1B 1V1CA 2MOXA 4X1VA 3JCMh 2FZGB 1UG1A 2EQKA 2ZPBB 4HT9A 2HAXA 1YCSB 4ELZC 3J7AF 1YFNA 2DL7A 4UC4A 2CT4A 3QXEB 2QTVA 3F70A 4M7DE 4M7AB 3VS1A 2H8HA 3MP6A 4M75E 1K73R 2O4XB 4HCBA 3I56T 3FLGA 1WXTA 4RTVA 4Z8AA 2F2VA 4DOVA 2PUKB 2LC4A 1GL5A 4KGVB 2F5TX 2RHXA 2AZSA 1I81A 2K79A 2K7AA 1UTIA 3QUIA 4GLKA 4GY5A 4NL2A 4A53A 3CCQA 4F16A 2F5KA 3VS3A 5DLQE 2NLUA 3G7ZA 2MIOA 4FL6A 1NPPA 3C4SA 4D8DA 2QXFA 4C5GA 2EKOA 4RTZA 3OYJA 3QYGB 5FU6B 4E7JA 4F04B 1PD0A 1SSFA 1UUEA 3JB9I 1B34A 2CZ1B 2HMAA 4RTYA 3M0RA 5GAMe 2K3XA 1W4SA 2QQSA 4CC3A 3I56Q 2KQWA 5CVIA 2HNIA 1PD1A 4OMLA 2DZCA 4EMGA 4JJNK 2CS7A 1RI0A 1WI7A 2EJGA 1M3AA 1RI9A 3FRNA 3M0TA 2QA4T 3CMET 2J6FA 2CREA 4NOYA 1FMVA 1G2BA 5LJ5e 3PGGA 4JJBA 1YIJQ 3M59A 2KEAA 4PJOG 3PNWC 1BKBA 2JOYA 3URGA 5KYWA 2JJ9A 2XDBA 3INZA 4J8OA 4RCCA 2L3RA 3R6OA 2JTEA 3SDZA 3DB3A 2PQWA 4LD6A 3CXCA 5GAN4 1SPKA 3OW2P 1X27A 2RD1A 3M5AA 1YJ9A 4FW1A 4C92G 4BACA 2QDYB 3I55T 1OYXA 4J9FA 3M0QA 2KBTA 1VQ9Q 4PL6A 1W70A 3VS6A 2OTLA 4MMKA 2YRCA 1NJIU 5GAMg 1R77A 4C5EA 4M78G 3CCUT 1F1BB 2BE9B 4EMKB 2E65A 2E5QA 4FSXA 1K8AR 4J7FA 2EJ9A 4M4ZA 3JCMg 3OW2S 1VQPA 3AHUA 3LH0A 1WHMA 1EZZB 4PNOA 1BYMA 1YN8A 2L5QA 2DA9A 3JCMX 2O01E 4E7KA 1HD3A 4F7UG 1KC8C 2A37A 4WF2A 2L0AA 1NLPC 1IHVA 1ABOA 4BB7A 2X4XA 5GANh 4C8QB 2MWPA 4M78F 1YJWT 2X9HA 5LJ5h 3A8GB 1X43A 1VQ6Q 3TREA 1G3YA 4M7AE 2YDLA 3J80E 1M90R 2DL4A 2ENMA 2E41A 4A4HA 5AT1B 1TH7A 1LNXA 5D6WA 1KHIA 1C6VX 1LOJA 1ZUYA 2RK1A 4QW2A 1ZUKA 1WHLA 1AWWA 2EQUA 3LGFA 4QQGA 5I2MA 1GCQA 2XIDA 2DJQA 2RJFA 1C1AA 4MZMA 2KRMA 2RI5A 2DETA 4KGZB 4PKCC 3CMEA 4QVDA 1MMGA 3KXTA 3GNGA 2J6KA 2QGGA 1VQ8Q 3HL8A 3KFVA 1D09B 5CR2A 3CC2A 1QVPA 3X24B 1NE8A 1Q82C 3OYFA 4C8QD 3VS4A 2FG0A 2LJ0A 3FJPA 2CGHA 2XKOC 2F2WA 3EH1A 2GTOA 5GAN2 4XTUA 2JM8A 2VXFA 4XTXA 5L8RE 1X2QA 4J9GA 2ESWA 2KR3A 2OTJQ 3I56A 2MCNA 1Y57A 4M7AG 2DVEA 1PSFA 2HL3A 1VQNQ 2IG0A 1N9SA 1UGSB 1VQMA 3A5ZB 2V1RA 5FRNA 3P8DA 1RAAB 2MI6A 3HRTA 4BY6B 5DY9A 1RABB 4AT1B 1M1KR 2L3QA 1BCMA 1U8RA 3JB9J 1I5LA 2DBKA 4QVZA 1Q86R 4J6WA 3NHNA 1WDXA 3U23A 2GF7A 1YP5A 4J6YA 4KH1B 3MEAA 3CPWA 1ZSZB 3V7RA 2ATCB 4YTLA 3E19A 5GANg 1IHWA 4EMKA 1IB8A 4M7DF 3QJ6A 5IXBA 3OYMA 2PU9B 2V1QA 3GPLA 4C92C 1JU5C 2G3RA 2B8AA 2JMAA 5GAOl 4TVRA 2CP7A 4OB0B 5GAN6 1WQWA 2CH4W 1N27A 2YLCA 1Q82R 2EVRA 3CCEA 1AD5A 2CP3A 4N0AC 2D8JA 1NJIC 3M4GA 3X26B 3WVDB 5IHNA 3GF5A 2DYIA 2RHUA 4RTTA 4OMQA 5J26A 4PLLA 2LQKA 5CAIA 1PHTA 2IIMA 3G1JA 3TU4K 4M7AD 1HK9A 3GLXA 2J7IA 3TCJA 1A0NB 1VQKT 5LJ3e 5I2SA 1M8MA 2X4YA 5D6YA 3VJPA 1Y0MA 3OSSC 3TEEA 2D0NA 2P0QA 1AWXA 1ZA2B 1Q7YU 2O88A 3CMAQ 1YHQA 3JCMd 2W10A 2VB6A 4LDVA 2EFIA 1MV0B 2DL5A 1X6OA 3FC3A 1M9SA 1QMCA 2ROLA 1UEBA 4LDYA 4XK8E 4FYYB 1KC8R 4C0DB 4BI8B 2FEIA 1SF9A 2M16A 4FIBA 5FU7C 1D0ZA 2ED0A 1OOTA 5GAOr 1K8AU 4PJOD 2M0YA 5GMKj 1KK7A 1WX6A 2XK0A 2XG8D 1UFFA 1X75C 2O4XA 3S6WA 4F7UA 3RKXA 5HY6A 4KT0E 2JZ2A 1YHQQ 4M77B 5C0MA 4HVVA 4PJOA 1I1JA 4Z88A 1VQLT 2G6FX 4EPCA 2DM1A 4L59A 4M78A 1YNZA 1FYNA 2A3LA 1WLPB 3QSUA 2CP0A 1OEBA 2DIGA 1ZSZA 4C92F 2KYMA 1D3BA 1Q7YC 2K6DA 1LCKA 3EG1A 4PFPA 2YT6A 3OA6A 5CKFA 1MV3A 2NWMA 5GAN7 1YWPA 2CUBA 2YWWA 4LD9K 2PVGB 4PJOB 5KYYB 1VQKA 3E9FA 1M8VA 4C92A 4E7ZA 1QKWA 1LPLA 2EYYA 2C0IA 4XAXB 1BIBA 3L2VA 2DXTA 2V8IA 4FT2A 4DOWA 2E1HA 2HDAA 4LUDA 3JCMW 1VQ9A 1RAIB 4IIOA 2LNHB 2AIRB 2X51A 1WHJA 1M5Q1 1MMNA 4JJDA 4JZ3A 2ZAEA 4A4FA 4NL3A 2DBMA 2O31A 5CKHA 2QK0A 1MHNA 4QT7A 4F7UE 4Z89A 3CCET 2BIVA 3MJXA 1R8OB 2J05A 3MEVA 4AFZC 1TXQA 2GCXA 5LJ3d 5KCHA 1GCPA 4O5VA 2FHDA 1Q81R 4HA8A 3SWNC 3RMQA 1C0MA 4BE2A 2JW4A 3JAME 3CCJT 1TUDA 3A8OB 3OS0A 2RO0A 4FSSA 1N8RC 2QI2A 2GNCA 4M77E 3RKWA 4D6WA 2CYZB 2BTTA 1KIKA 5C6SA 1E7OA 4BE0A 2KDSA 4BI3A 2KMTA 4QQ6A 3L2WA 3QYHB 2ZPIB 1V76A 2DRKA 1XJWB 2O9SA 1AEYA 2BZYA 2HEQA 2BZXA 2YLBA 4A63B 4PJOE 4OB3B 2CZ7B 1Y96A 2LCCA 5CCAA 1TUGB 1VIEA 3V8LA 2FL7A 3CPFA 1FX7A 3QKJA 4OGCA 3HHTB 3CD6A 3SB2A 4M7DC 2GQIA 2FYKA 2K5FA 3CMAT 1RAGB 1WQ7A 1JO8A 1Q81C 1N6AA 1G8XA 2RJDA 3A98A 3JB9D 3EGUA 1M27C 2K57A 2DL3A 3UWNA 3V7SA 1W6XA 1WPYA 4FU6A 1Q95G 3ME9A 2H3EB 2OJ2A 3GBQA 3OMCA 3P8BB 1NYFA 3C94A 2ZPGB 5HK3A 3KBGA 1YJ9T 1TU0B 4XTYA 1OU8A 3UA6A 4FM4B 2YUNA 1NBEB 2DZ9A 2LRQA 1TG0A 1MNDA 1Y71A 4IUTA 1UJ0A 1QCNA 2YUPA 2WSCE 4GLMA 1BB9A 3JCMc 3OBYA 3OS5A 1JXOA 3JB9F 4IUVA 2E70A 1K1ZA 3UT1A 2O9VA 1QVGP 4JZ4A 2FRYA 2HCKA 3EHQA 1VQNA 1X6GA 1B34B 3QZ9B 4A4KA 1XNIA 1WXBA 2QQRA 5D6XA 2YUQA 2EJFA 1VQPT 5KE3A 3H8ZA 1HYOA 4OP0A 1PCXA 5GAMf 4ORZA 1X69A 3M0UA 2LT4A 4M75G 2A0FB 1G3SA 2L3SA 4A4GA 2LJ1A 2VGMA 5FWBA 4FYVB 4BI4A 3TSZA 2DD4A 2JTMA 5FWCA 1D0XA 3JCMP 4C5IA 3C95A 4F7UF 1S72A 3CBOA 2RQWA 3CC7Q 1UDLA 1WZOA 4OMMA 2PZ1A 4X9CA 5GAMh 2E3IA 3ZBDA 1OQKA 1ABQA 3NPFA 1WIEA 2M51A 5IAYA 3M58A 2RQUA 2M0OA 3SWNB 1RACB 2RI3A 3AT1B 1XQHA 4ZGEB 3HFOA 4PFZA 2EGEA 5CIUA 4II1A 4ZTJA 5HK0A 1S72Q 4NS5A 1IRXA 2COWA 4C8QF 1RAFB 2DL8A 1WJQA 3BFMA 2DX1A 3CMEQ 1VQ6A 5IXFA 4OB2B 5ECAA 1H3HA 2HQEA 3CXCP 1KSWA 1T0HA 2LCSA 1MNEA 1Z9QA 4Y28E 1AHJB 2QA4A 2XU8A 3LX7A 4CI0C 2AKLA 4M75A 3CCMQ 2PUOB 3I5RA 1M3BA 1YI2A 1SSHA 1LVKA 2E12A 3FB9A 4OMFB 4CRIA 2VXEA 3CCEQ 1ZLMA 4XQ3A 2QQ9A 2AT1B 1G83A 2HKQB 2L3PA 3FIFA 5KYUB 2KRNA 2MF2A 4M77A 4AG1C 1T0JA 2E6ZA 4OGEA 2F1LA 3DLMA 1H3ZA 1BI0A 1RLQC 3HPWA 2QDLA 3QWXX 4M75B 2WACA 2ZPEB 3MP1A 5HCKA 3VYGA 2ZGWA 1UGPB 3Q1JA 3G6EQ 3OYDA 1VQKQ 1YJNT 3CCJA 1H8KA 2QQAA 1N9RA 1TWBA 1YJ9Q 1M2VB 3OYHA 3VYHB 3G71A 2E64A 1D1AA 1SG5A 1OULA 4C92D 2FPDA 3JSCA 2VWFA 2XDPA 2VV5A 4JDSA 1M1KU 4IURA 3CCLT 1G3TA 1UJYA 3D7SB 2QA4Q 1YIJA 1Q82U 1NYGA 2YXYA 1SKUB 2X4JA 2VKNA 3JCMJ 1TTHB 4PJOF 5LJ5g 4B6MA 3SFMA 2MYSA 2Y4XA 4PJLA 2CZ0B 5FU7B 1TS9A 2RHZA 2BZ8A 4PFOA 2AKKA 4XU3A 4M75F 4C0DC 1KQ1A 4X34A 1RUWA 2NUZA 3EG9B 5IN1A 3QBYA 1K0SA 2F69A 3CBMA 3IQLA 2LT1A 2VC8A 1ZHIA 4M78C 4F17A 4PJJA 1RADB 4J83A 4KBMB 2RA2A 4PJMA 4DEYA 2LQ8A 1IGUA 4MMLA 3BDUA 4HCZA 3CC4Q 4M77F 1CKAA 3CBPA 3GOXA 3ER0A 4JRIA 5GMKi 3H0HA 2D8HA 4BUGA 2BKDN 1OPLA 2LNVA 3L42A 2MWOA 1ARKA 4M7AC 2YSQA 1T3LA 1I4K1 2FPEA 3QHSA 3CCJQ 4IIMA 2W0ZA 1HJDA 2KRSA 2JVVA 3X25B 4D8KA 1D1BA 4M7DA 2P4TA 1QP3A 2RF0A 1KD1U 3OYBA 3OW2A 1B07A 2LMJA 4M77G 2QG9B 4E2FB 1BK2A 1MMDA 3CCSA 4RG8A 5KYXA 3CCQQ 5IHIA 2AHJB 2CP5A 3NGPA 2DK3A 1FWZA 4ZN1A 2R5MA 3LH5A 4XU1A 1IGQA 3RDVA 2VGNA 1SRLA 2HQHA 3UDCA 1K73C 4ZGDB 1VQ4A 2QEXT 1WGSA 4J9CA 2NUTA 3QG1A 4FW2A 2HBWA 1Q86C 1BIAA 4O6JA 4ZN3A 1VQ7A 2YHTA 3M54A 3CEYA 4HVWA 3MEWA 1WHKA 3RNJA 2A28A 1BI3A 1MGQA 3BW1A 3NMZC 4E7LA 2CDTA 5FLXE 1FMKA 5CKEA 4E7IA 2OTLQ 2FVUA 2DILA 1RLPC 2KT8A 3PVLA 2CSQA 2IPOB 3CC7T 2DD5A 8ATCB 1MMAA 5J39A 5GANd 2E4HA 3I35A 1PNJA 2EPDA 2XICA 2KAFA 2ABLA 1ACMB 2RJEA 3I5SA 1P92A 5FROA 5LJ3g 2CSIA 1Q81U 5KYUA 3L2ZA 2QAZA 3G71T 4AMCA 4M75D 2RN8A 2JT4A 1K9AA 3CCVQ 5LJ5d 1J3TA 4ESRA 5DLOA 1JEGA 3I9QA 3O5ZA 3MPUB 2KI7A 3VS0A 3L1AA 2YRDA 3CXCS 2NUPB 1QVFA 4J9IA 1W1FA 2X35A 2Y90A 4WTOB 2K5IA 3TQ7P 2KVQG 4BE1A 2LQWA 4DBRA 4RG2A 3GIBA 2P0PA 1UECA 1YBYA 4OMPA 4XTWA 3H6ZA 2ECZA 2GGRA 2RJCA 4IUQA 2JXBA 3CCRQ 2YRVA 2DF6A 1VQMT 2FZKB 1V29B 1VQ5A 1DJ7B 3C12A 3M56A 4AFUC 4RTXA 4QQDA 4VUBA 2HZYA 2K4YA 8AT1B 4DBHA 5IHKA 4C0ZA 4PK4A 2A7YA 2O2OA 1M1GA 2E5KA 2J6OA 1D3BB 2MMPA 4JJCA 1VQ8T 2D6FA 2EYZA 5KCOA 1VYTA 1IREB 2EGAA 3HSBA 1PKTA 4M75C 5KYYA 3G4SA 1WA7A 1S72T 3PT9A 2P0KA 2RH2A 1EX4A 1BBZA 1UGVA 3THKA 3EG3A 5I11A 2P4RA 3UF4A 2EBPA 2MPXC 1MUZA 1K73U
chains in the Genus database with same CATH topology
1SPKA 1X27A 5L23A 1JQQA 2OJ2A 2OI3A 3GBQA 4J9FA 3M0QA 5EC7A 1NYFA 2KBTA 2DLPA 2K3BA 2RMOA 1OPKA 1SEMA 3UA6A 4EIKA 2YUNA 2LP5A 2EQIA 1W70A 3VS6A 1TG0A 1NM7A 1UJ0A 3QWYA 2YUPA 1ZX6A 3ZL7C 2AK5A 2DYBA 4GLMA 1BB9A 4M4ZA 1JXOA 1K1ZA 2DNUA 3SEMA 2O9VA 2I0NA 2CT3A 4OMNA 4JZ4A 2FRYA 2HCKA 3EHQA 1YN8A 1GBQA 1GRIA 1K76A 2DA9A 3C0CA 1UE9A 1PWTA 1X6GA 4LUEA 1HD3A 1WXBA 4DEXA 2A37A 2RQTA 2YUQA 3EHRA 3FJ5A 2L0AA 1NLPC 3TVTA 1ABOA 2FO0A 3PE0A 4ORZA 1X69A 1QWFA 3M0UA 1X43A 2KXDA 2L3SA 3REBB 4Y92A 4CC4B 2LJ1A 2YDLA 5FWBA 1AWOA 2DL4A 3TSZA 2ENMA 2RPNA 5FWCA 2K2MA 4LN2A 1AVZC 1ZUYA 1I0CA 1ZUKA 1AWWA 4AFQC 1GCQA 2DJQA 2RQWA 1NG2A 1QCFA 1UDLA 3H0FA 2PZ1A 4OMMA 4AG2C 2KRMA 1PRMC 1ABQA 3NPFA 1WIEA 2M51A 2RQUA 4RTWA 2J6KA 2KT1A 3KFVA 2EGEA 1HSQA 1ZBJA 4RTUA 1M3CA 3JV3A 1WXUA 1QLYA 3M0SA 2DL8A 3VS4A 2A36A 2FG0A 2LJ0A 2DX1A 5IXFA 4JPBW 5ECAA 1H3HA 1KSWA 1BU1A 1T0HA 2LCSA 2F2WA 1Z9QA 2GTOA 1X2KA 4CC2A 2JM8A 2AKLA 1X2QA 2EYWA 4J9GA 2ESWA 2KR3A 3I5RA 1M3BA 2EGCA 1SSHA 2MCNA 1Y57A 1AZGB 2XMFA 1E6HA 2DRMA 4HCKA 5IH2A 1SHFA 4KRTA 2FPFA 1U5SA 1ZLMA 2V1RA 2L3PA 1G83A 2GTJA 2KRNA 1CKBA 4AG1C 1T0JA 5GJWB 3M0PA 1PKSA 2AZVA 1RLQC 2L3QA 1UHFA 2QDLA 3QWXX 5HCKA 2DE0X 2DBKA 2C0TA 2JM9A 1GBRA 3NHNA 3PVQA 2A08A 1WDXA 3U23A 1H8KA 3REAB 1YP5A 5FW9A 2KYBA 2D1XA 5IXBA 1VYVA 2FPDA 2CUDA 4CC7A 3VS5A 2V1QA 4HXJA 1M30A 2JS0A 2VWFA 1JU5C 1OV3A 2JMAA 2RQRA 1U06A 2ROTA 4HVUA 2CH4W 1T3SA 1UJYA 2EVRA 1AD5A 3VRZA 1ZSGA 1NYGA 2D8JA 1GFCA 1SRMA 1IO6A 3TSWA 2PTKA 1VYUA 5IHNA 2VKNA 2EKHA 2X3XD 4RTTA 4OMQA 1H92A 4LNPA 4K11A 4LE9A 4OMOA 2BZ8A 1PHTA 1NEBA 3VS7A 2LJ3A 2AKKA 2EW3A 2F2XA 2LQNA 2IIMA 1KFZA 1RUWA 2X3WD 2KROA 2NUZA 1K0SA 2J7IA 3IQLA 1A0NB 2VVKA 1M8MA 4F17A 3R6NA 2KE9A 3CQTA 3VS2A 4DEYA 1JXMA 1Y0MA 2D0NA 4GBQA 1CKAA 1K4US 1AWXA 1NLOC 2O88A 1WFWA 2JS2A 3ULRB 2W10A 2DVJA 3H0HA 2D8HA 1OPLA 1MV0B 2DL5A 2J06A 1ARKA 2PNIA 2YSQA 2B86A 1T3LA 2FPEA 1K0XA 2ROLA 4IIMA 2DMOA 2W0ZA 1HJDA 1B3QA 2KGTA 2SRCA 2KRSA 4D8KA 2FEIA 2RF0A 1B07A 2LMJA 4J9BA 2ED0A 1BK2A 2LX7A 1OOTA 2M0YA 4AFSC 5IHIA 1XOVA 1WX6A 2L2PA 1X6BA 3NGPA 1UFFA 1QWEA 3LH5A 1SRLA 2FRWA 2HSPA 2GBQA 3UA7A 4J9CA 5I22A 1SHGA 4HVVA 1I1JA 1U3OA 1UHCA 2HBWA 4Z88A 4E6RA 4F14A 3SHWA 2G6FX 2DM1A 1KJWA 1E6GA 1WYXA 1CSKA 5GJVB 3EG2A 4HVWA 1YNZA 1FYNA 2K9GA 1GCQC 1I07A 1VA7A 1WLPB 4WCIA 3RNJA 1AWJA 2A28A 3NMZC 1OEBA 2CDTA 1YWOA 3RBBB 1FMKA 2KYMA 1NEGA 1LCKA 2K6DA 3EG1A 4R0KA 2MOXA 1V1CA 4X1VA 2YT6A 1MV3A 2KXCA 2NWMA 1N5ZA 2KT8A 1RLPC 1YWPA 1UG1A 2CUBA 2DILA 3PVLA 2CSQA 4J9DA 3H0IA 1YCSB 1QKWA 1AZEA 2EYYA 2C0IA 2DL7A 2CT4A 2ED1A 3I35A 1PNJA 2EPDA 4LUDA 2HDAA 4ZNXA 3VRYA 3VS1A 2H8HA 4IIOA 2LNHB 2ABLA 3I5SA 1TUCA 2CSIA 4JJDA 1WXTA 4RTVA 4Z8AA 2F2VA 1GL5A 4JZ3A 2RN8A 2JT4A 2DBMA 1K9AA 4J9HA 2AZSA 2O31A 3H41A 4QT7A 1J3TA 2K79A 4RUGA 4Z89A 4ESRA 2C0OA 1JEGA 2K7AA 1UTIA 3I9QA 2J05A 1GFDA 3O5ZA 3VS0A 1S1NA 4AFZC 4F16A 2EYXA 3VS3A 2CH4A 4J9IA 1W1FA 2MIOA 1GCPA 2JW4A 4D8DA 3UATA 1TUDA 4RTZA 1PRLC 4FSSA 2LQWA 2GNCA 2YUOA 1UECA 2BTTA 1UUEA 2RNAA 1KIKA 4OMPA 1E7OA 2ECZA 2GGRA 4RTYA 3M0RA 2JXBA 1Z9ZA 2DF6A 4CC3A 4AFUC 4OMLA 4RTXA 1WI7A 2DRKA 2O9SA 1M3AA 4J9EA 1RI9A 1AEYA 2BZYA 1AOJA 2HEQA 2BZXA 4A63B 5IHKA 2KNBB 2RQVA 3M0TA 2O2OA 2E5KA 2J6OA 4JJCA 2EYZA 2J6FA 1VYTA 2CREA 2EGAA 1PKTA 1G2BA 2LZ6B 2JMCA 1WA7A 2GQIA 3EG0A 4JJBA 1QKXA 2KEAA 1W6XA 1JO8A 1BBZA 1UGVA 3THKA 2SEMA 3EG3A 5I11A 1ZUUA 2P4RA 3A98A 3UF4A 3EGUA 1M27C 2JTEA 2EBPA 2DL3A 1MUZA 1EFNA 2OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPK A;  1X27 A;  5L23 A;  1JQQ A;  2OJ2 A;  2OI3 A;  3GBQ A;  4J9F A;  3M0Q A;  5EC7 A;  1NYF A;  2KBT A;  2DLP A;  2K3B A;  2RMO A;  1OPK A;  1SEM A;  3UA6 A;  4EIK A;  2YUN A;  2LP5 A;  2EQI A;  1W70 A;  3VS6 A;  1TG0 A;  1NM7 A;  1UJ0 A;  3QWY A;  2YUP A;  1ZX6 A;  3ZL7 C;  2AK5 A;  2DYB A;  4GLM A;  1BB9 A;  4M4Z A;  1JXO A;  1K1Z A;  2DNU A;  3SEM A;  2O9V A;  2I0N A;  2CT3 A;  4OMN A;  4JZ4 A;  2FRY A;  2HCK A;  3EHQ A;  1YN8 A;  1GBQ A;  1GRI A;  1K76 A;  2DA9 A;  3C0C A;  1UE9 A;  1PWT A;  1X6G A;  4LUE A;  1HD3 A;  1WXB A;  4DEX A;  2A37 A;  2RQT A;  2YUQ A;  3EHR A;  3FJ5 A;  2L0A A;  1NLP C;  3TVT A;  1ABO A;  2FO0 A;  3PE0 A;  4ORZ A;  1X69 A;  1QWF A;  3M0U A;  1X43 A;  2KXD A;  2L3S A;  3REB B;  4Y92 A;  4CC4 B;  2LJ1 A;  2YDL A;  5FWB A;  1AWO A;  2DL4 A;  3TSZ A;  2ENM A;  2RPN A;  5FWC A;  2K2M A;  4LN2 A;  1AVZ C;  1ZUY A;  1I0C A;  1ZUK A;  1AWW A;  4AFQ C;  1GCQ A;  2DJQ A;  2RQW A;  1NG2 A;  1QCF A;  1UDL A;  3H0F A;  2PZ1 A;  4OMM A;  4AG2 C;  2KRM A;  1PRM C;  1ABQ A;  3NPF A;  1WIE A;  2M51 A;  2RQU A;  4RTW A;  2J6K A;  2KT1 A;  3KFV A;  2EGE A;  1HSQ A;  1ZBJ A;  4RTU A;  1M3C A;  3JV3 A;  1WXU A;  1QLY A;  3M0S A;  2DL8 A;  3VS4 A;  2A36 A;  2FG0 A;  2LJ0 A;  2DX1 A;  5IXF A;  4JPB W;  5ECA A;  1H3H A;  1KSW A;  1BU1 A;  1T0H A;  2LCS A;  2F2W A;  1Z9Q A;  2GTO A;  1X2K A;  4CC2 A;  2JM8 A;  2AKL A;  1X2Q A;  2EYW A;  4J9G A;  2ESW A;  2KR3 A;  3I5R A;  1M3B A;  2EGC A;  1SSH A;  2MCN A;  1Y57 A;  1AZG B;  2XMF A;  1E6H A;  2DRM A;  4HCK A;  5IH2 A;  1SHF A;  4KRT A;  2FPF A;  1U5S A;  1ZLM A;  2V1R A;  2L3P A;  1G83 A;  2GTJ A;  2KRN A;  1CKB A;  4AG1 C;  1T0J A;  5GJW B;  3M0P A;  1PKS A;  2AZV A;  1RLQ C;  2L3Q A;  1UHF A;  2QDL A;  3QWX X;  5HCK A;  2DE0 X;  2DBK A;  2C0T A;  2JM9 A;  1GBR A;  3NHN A;  3PVQ A;  2A08 A;  1WDX A;  3U23 A;  1H8K A;  3REA B;  1YP5 A;  5FW9 A;  2KYB A;  2D1X A;  5IXB A;  1VYV A;  2FPD A;  2CUD A;  4CC7 A;  3VS5 A;  2V1Q A;  4HXJ A;  1M30 A;  2JS0 A;  2VWF A;  1JU5 C;  1OV3 A;  2JMA A;  2RQR A;  1U06 A;  2ROT A;  4HVU A;  2CH4 W;  1T3S A;  1UJY A;  2EVR A;  1AD5 A;  3VRZ A;  1ZSG A;  1NYG A;  2D8J A;  1GFC A;  1SRM A;  1IO6 A;  3TSW A;  2PTK A;  1VYU A;  5IHN A;  2VKN A;  2EKH A;  2X3X D;  4RTT A;  4OMQ A;  1H92 A;  4LNP A;  4K11 A;  4LE9 A;  4OMO A;  2BZ8 A;  1PHT A;  1NEB A;  3VS7 A;  2LJ3 A;  2AKK A;  2EW3 A;  2F2X A;  2LQN A;  2IIM A;  1KFZ A;  1RUW A;  2X3W D;  2KRO A;  2NUZ A;  1K0S A;  2J7I A;  3IQL A;  1A0N B;  2VVK A;  1M8M A;  4F17 A;  3R6N A;  2KE9 A;  3CQT A;  3VS2 A;  4DEY A;  1JXM A;  1Y0M A;  2D0N A;  4GBQ A;  1CKA A;  1K4U S;  1AWX A;  1NLO C;  2O88 A;  1WFW A;  2JS2 A;  3ULR B;  2W10 A;  2DVJ A;  3H0H A;  2D8H A;  1OPL A;  1MV0 B;  2DL5 A;  2J06 A;  1ARK A;  2PNI A;  2YSQ A;  2B86 A;  1T3L A;  2FPE A;  1K0X A;  2ROL A;  4IIM A;  2DMO A;  2W0Z A;  1HJD A;  1B3Q A;  2KGT A;  2SRC A;  2KRS A;  4D8K A;  2FEI A;  2RF0 A;  1B07 A;  2LMJ A;  4J9B A;  2ED0 A;  1BK2 A;  2LX7 A;  1OOT A;  2M0Y A;  4AFS C;  5IHI A;  1XOV A;  1WX6 A;  2L2P A;  1X6B A;  3NGP A;  1UFF A;  1QWE A;  3LH5 A;  1SRL A;  2FRW A;  2HSP A;  2GBQ A;  3UA7 A;  4J9C A;  5I22 A;  1SHG A;  4HVV A;  1I1J A;  1U3O A;  1UHC A;  2HBW A;  4Z88 A;  4E6R A;  4F14 A;  3SHW A;  2G6F X;  2DM1 A;  1KJW A;  1E6G A;  1WYX A;  1CSK A;  5GJV B;  3EG2 A;  4HVW A;  1YNZ A;  1FYN A;  2K9G A;  1GCQ C;  1I07 A;  1VA7 A;  1WLP B;  4WCI A;  3RNJ A;  1AWJ A;  2A28 A;  3NMZ C;  1OEB A;  2CDT A;  1YWO A;  3RBB B;  1FMK A;  2KYM A;  1NEG A;  1LCK A;  2K6D A;  3EG1 A;  4R0K A;  2MOX A;  1V1C A;  4X1V A;  2YT6 A;  1MV3 A;  2KXC A;  2NWM A;  1N5Z A;  2KT8 A;  1RLP C;  1YWP A;  1UG1 A;  2CUB A;  2DIL A;  3PVL A;  2CSQ A;  4J9D A;  3H0I A;  1YCS B;  1QKW A;  1AZE A;  2EYY A;  2C0I A;  2DL7 A;  2CT4 A;  2ED1 A;  3I35 A;  1PNJ A;  2EPD A;  4LUD A;  2HDA A;  4ZNX A;  3VRY A;  3VS1 A;  2H8H A;  4IIO A;  2LNH B;  2ABL A;  3I5S A;  1TUC A;  2CSI A;  4JJD A;  1WXT A;  4RTV A;  4Z8A A;  2F2V A;  1GL5 A;  4JZ3 A;  2RN8 A;  2JT4 A;  2DBM A;  1K9A A;  4J9H A;  2AZS A;  2O31 A;  3H41 A;  4QT7 A;  1J3T A;  2K79 A;  4RUG A;  4Z89 A;  4ESR A;  2C0O A;  1JEG A;  2K7A A;  1UTI A;  3I9Q A;  2J05 A;  1GFD A;  3O5Z A;  3VS0 A;  1S1N A;  4AFZ C;  4F16 A;  2EYX A;  3VS3 A;  2CH4 A;  4J9I A;  1W1F A;  2MIO A;  1GCP A;  2JW4 A;  4D8D A;  3UAT A;  1TUD A;  4RTZ A;  1PRL C;  4FSS A;  2LQW A;  2GNC A;  2YUO A;  1UEC A;  2BTT A;  1UUE A;  2RNA A;  1KIK A;  4OMP A;  1E7O A;  2ECZ A;  2GGR A;  4RTY A;  3M0R A;  2JXB A;  1Z9Z A;  2DF6 A;  4CC3 A;  4AFU C;  4OML A;  4RTX A;  1WI7 A;  2DRK A;  2O9S A;  1M3A A;  4J9E A;  1RI9 A;  1AEY A;  2BZY A;  1AOJ A;  2HEQ A;  2BZX A;  4A63 B;  5IHK A;  2KNB B;  2RQV A;  3M0T A;  2O2O A;  2E5K A;  2J6O A;  4JJC A;  2EYZ A;  2J6F A;  1VYT A;  2CRE A;  2EGA A;  1PKT A;  1G2B A;  2LZ6 B;  2JMC A;  1WA7 A;  2GQI A;  3EG0 A;  4JJB A;  1QKX A;  2KEA A;  1W6X A;  1JO8 A;  1BBZ A;  1UGV A;  3THK A;  2SEM A;  3EG3 A;  5I11 A;  1ZUU A;  2P4R A;  3A98 A;  3UF4 A;  3EGU A;  1M27 C;  2JTE A;  2EBP A;  2DL3 A;  1MUZ A;  1EFN A;  2OAW A; 
#chains in the Genus database with same CATH topology
 4F7U B;  3OYE A;  2GQV A;  1JQQ A;  1Q86 U;  2E10 A;  1YIT T;  2KK4 A;  5EC7 A;  3L2U A;  5GAN j;  2K3B A;  2RMO A;  1OPK A;  4J7I A;  1VQO T;  4OVA A;  4EIK A;  2EQI A;  5GAO p;  1OZ2 A;  4FYX B;  1KQS S;  1NM7 A;  5GAN 8;  3MKD A;  1ZX6 A;  4V2S A;  1KG1 A;  3EGX A;  4N4H A;  4QKU A;  1WNL A;  2DNU A;  3SEM A;  3G4S T;  2I0N A;  4OMN A;  1GBQ A;  3RUX A;  1K76 A;  1PWT A;  4IUU A;  4Q5W A;  4LUE A;  4OF1 A;  1U1S A;  3EHR A;  1VQ8 A;  1JJ2 A;  2K2V A;  1IZ6 A;  4ME7 A;  4M7A A;  4PLI A;  3CCU A;  3PE0 A;  3LW5 E;  1QWF A;  2LCL A;  1UGR B;  3J81 E;  2DEU A;  2OTL T;  2KXD A;  3QPH A;  3MCA B;  4XTV A;  3LWH A;  3DLL A;  4JS4 A;  1KQ2 A;  2RPN A;  1WHH A;  2K2M A;  4LDU A;  1AVZ C;  2DER A;  5GAM d;  1I0C A;  2LVM A;  1QP2 A;  4AFQ C;  3OSV A;  4EMH A;  3BE3 A;  1NG2 A;  4PJN A;  1QCF A;  3H0F A;  1M1K C;  5FU6 C;  4AG2 C;  4FYW B;  5CK9 A;  5CQX A;  1PRM C;  2RK2 A;  4RTW A;  4JRK A;  2DXC A;  2JN0 A;  3UPU A;  1VQP Q;  1ZBJ A;  4RTU A;  1I5O B;  3JV3 A;  4J5Y A;  1QLY A;  1QVG S;  3MP8 A;  1G3W A;  2EWN A;  3LLR A;  2A36 A;  4KUD K;  4P5N A;  1UB4 A;  2DIQ A;  2DKG A;  2DAQ A;  1BU1 A;  1BI1 A;  4CC2 A;  2LTO A;  2EYW A;  2EGC A;  1AZG B;  2XDD A;  1M2O A;  1M90 C;  5IH2 A;  1Q7Y R;  1VQ7 Q;  4JRQ A;  4C5H A;  2FPF A;  1U5S A;  4MZT A;  2GTJ A;  1CKB A;  3O8V A;  3M0P A;  1PKS A;  4C0G A;  2AZV A;  3LYI A;  3V8K A;  1FMW A;  3HTR A;  2DE0 X;  2C0T A;  2JM9 A;  3A8L B;  4MZP A;  2VAS A;  1QQJ A;  3REA B;  1VQO Q;  4M77 D;  2KYB A;  3JRZ A;  1R0C B;  2D1X A;  1PC0 A;  3VS5 A;  4HXJ A;  1M30 A;  1YCY A;  1VQ9 T;  1OV3 A;  3EAE A;  3PMT A;  2RQR A;  4QVC A;  1U06 A;  2ROT A;  1K9M C;  2COZ A;  2QEX A;  1VQ4 T;  3VRZ A;  2QQB A;  1ZSG A;  1G5V A;  1SRM A;  1IO6 A;  3TSW A;  2OTJ A;  2PTK A;  2RI2 A;  4C92 E;  4BD3 A;  3A1P A;  2EKH A;  1IXD A;  3HRS A;  4B9X A;  2Y4Y A;  1W2B S;  5FRM A;  1H92 A;  4LNP A;  4LE9 A;  1KQS P;  3HKS A;  4OMO A;  1QW1 A;  3VS7 A;  2QEX Q;  2LJ3 A;  2F2X A;  2JNG A;  3S3N A;  5KYX B;  1R0B G;  3VUB A;  5GAM j;  1KFZ A;  3MHX A;  2KRO A;  2QYZ A;  3M4Y A;  4EMK C;  1NZ9 A;  3EGD A;  4JS5 A;  2RM4 A;  4DBF A;  2PVO B;  2VVK A;  3G6E T;  5LJ3 f;  3R6N A;  2NUP A;  3JB9 H;  4ZGJ B;  1PSE A;  2KE9 A;  3VS2 A;  3M9Q A;  1JXM A;  2KSS A;  5GAO n;  4GBQ A;  3PFS A;  4FT4 A;  3E1S A;  1K4U S;  2CP6 A;  1NLO C;  4BDY A;  1WFW A;  2RHI A;  5GAN 3;  2JS2 A;  3ULR B;  2DVJ A;  5J3B A;  3X28 B;  3OBW A;  4A4E A;  3CPW S;  3G6E A;  4B9W A;  1K0X A;  1OU9 A;  3CCM T;  5I21 A;  2SRC A;  3MEU A;  3E2U A;  3CC4 T;  4LDW A;  4PJO C;  2DXB A;  4J9B A;  4OB1 B;  2LX7 A;  3MO8 A;  4Z02 A;  4DA4 A;  1XOV A;  2RHY A;  1YHQ T;  1X6B A;  1I8F A;  2OTJ T;  2E6N A;  2EAY A;  4DQ2 A;  1OX8 A;  3S3M A;  2HSP A;  3CCM A;  1YIJ T;  1VQ7 T;  3CCL A;  1W2B A;  3UA7 A;  4RKU E;  5I22 A;  1SHG A;  4BDZ A;  3QII A;  5GAO q;  4E6R A;  5A2Q E;  4F14 A;  4XTZ A;  3SHW A;  1N8R R;  1KJW A;  1E6G A;  4M77 C;  3CD6 Q;  3WVE B;  3DKM A;  1GCQ C;  4MDW A;  1VA7 A;  1KHC A;  4WCI A;  1W2B P;  1ZBX A;  4X9D A;  1QVG A;  2MK5 A;  1YWO A;  2L8D A;  3RBB B;  1NEG A;  3E9G A;  1VQL Q;  2KXC A;  1N5Z A;  4J9D A;  3CCR T;  5AYF A;  3NTH A;  3H0I A;  3OS1 A;  4J6X A;  3OS2 A;  3EFO A;  2EIF A;  3QZ5 B;  1AZE A;  3OYK A;  2M9U A;  2ED1 A;  3RES A;  3CCL Q;  3VRY A;  4ZNX A;  5A0D A;  2R5A A;  2HQX A;  1TUC A;  1WHG A;  1YI2 T;  3L2Q A;  1K9M U;  3DB4 A;  1M4Z A;  3OMG A;  4J9H A;  3CC2 Q;  3FDR A;  3H41 A;  2GFU A;  4JRP A;  1Y07 A;  4RUG A;  2C0O A;  2DJZ A;  1GFD A;  2BE7 D;  3QDF A;  3VKI A;  1YJW Q;  3LGL A;  1U1T A;  1S1N A;  2BUD A;  2P84 A;  2QGF B;  3G4S Q;  1N8R U;  3NTI A;  2EYX A;  4RCB A;  2HKN A;  5DM7 R;  2CH4 A;  2V26 A;  2C06 A;  4M78 E;  3UAT A;  2CZ6 B;  5GAO m;  1PRL C;  3M53 A;  2EYQ A;  5CKB A;  2YUO A;  2FB7 A;  2PVD B;  1QCO A;  3OYY A;  2RNA A;  2CP2 A;  1UGQ B;  2JTF A;  5LJ5 f;  3S3O A;  2ZCF B;  2CKK A;  1K8A C;  1Z9Z A;  1YI2 Q;  2KY9 A;  3LWI A;  1JBM A;  3H9N A;  4ANJ A;  1KD1 C;  5IT9 E;  4J9E A;  1OZ3 A;  2V8K A;  1AOJ A;  3CC2 T;  2KNB B;  4ELY C;  2RQV A;  3I55 Q;  2H3J A;  3EGD B;  3OYA A;  1ZSZ C;  1LJO A;  4N0A A;  2HBP A;  2RB6 A;  3FEO A;  3M55 A;  1Y96 B;  5GAN f;  2DPP B;  2JMC A;  2LZ6 B;  3CCS Q;  3EG0 A;  1QKX A;  1VUB A;  4BY6 C;  2XHC A;  2SEM A;  3RIR A;  4C8Q E;  1ZUU A;  2MAM A;  2QTX A;  4XU2 A;  2HD0 A;  3NTK A;  1XTD A;  2HL5 C;  3QJY A;  1EFN A;  2OAW A;  3VU3 C;  2ZPH B;  1YJW A;  1QVF P;  5L23 A;  1VQO A;  1VQM Q;  1H64 1;  3ZFJ A;  2OI3 A;  4R56 A;  3PIO A;  3JCM e;  3RMS A;  2DLP A;  1YIT A;  3OYG A;  1VQ6 T;  1SEM A;  5LJ5 j;  4LDX A;  2LP5 A;  4M78 B;  3PTA A;  5GAN 5;  3QWY A;  5EG2 A;  3JCM Q;  4M7A F;  3ZL7 C;  2AK5 A;  2DYB A;  3OYN A;  1HXD A;  3OY9 A;  1X01 A;  2XD0 A;  3ASK A;  2CT3 A;  1GRI A;  2DFU A;  3C0C A;  3CPW P;  1UE9 A;  3V8J A;  4DEX A;  2RQT A;  3FJ5 A;  1Y7X A;  1RL2 A;  3I55 A;  2X4W A;  3TVT A;  1O75 A;  2FO0 A;  2OX7 A;  2XI9 A;  3VUZ A;  3EGX B;  3HRU A;  5CO7 A;  3REB B;  1JRI A;  4Y92 A;  4C0F A;  4CC4 B;  4M7D G;  1AWO A;  4C8Q C;  1GXI E;  4LN2 A;  2D0Q B;  2D9T A;  3A8M B;  1VQN T;  2WSF E;  5M9O A;  6AT1 B;  2FZC B;  4RMO A;  1BI2 A;  4ATO A;  2KT1 A;  1HSQ A;  1OI1 A;  2DXU A;  2GFA A;  4JLG A;  1M3C A;  2LDM A;  3OQ5 A;  2L89 A;  1YJN Q;  9ATC B;  5HKC A;  1VQ4 Q;  4N4I A;  1WXU A;  3M0S A;  3V7C A;  2K5L A;  1FXX A;  1TOV A;  1WJR A;  3GNF B;  4ZTF A;  4JPB W;  4IKF A;  2M02 A;  2DO3 A;  4R55 A;  1X2K A;  3JCM V;  1WJS A;  2K3Y A;  3VV0 A;  2ZPF B;  5GMK e;  2XMF A;  1E6H A;  2DRM A;  4HCK A;  1VQ5 T;  3JCM f;  1SHF A;  3JB9 G;  4KRT A;  3RR6 A;  4KUL A;  2M1H A;  4XU0 A;  3EH2 A;  1ZA1 B;  3M57 A;  3RER A;  3CMA A;  5GJW B;  1YIT Q;  4N4G A;  3CC7 A;  3CD6 T;  4IUP A;  3CCQ T;  1UHF A;  3SWN A;  1GBR A;  3PVQ A;  3X20 B;  2A08 A;  5LJ3 h;  5FW9 A;  4DBQ A;  2HSE B;  5A0G A;  3NFC A;  3GP8 A;  1JJ2 P;  1VOM A;  1VYV A;  2CUD A;  4CC7 A;  4JUV A;  1EIF A;  2JS0 A;  2VYT A;  2V8J A;  4E7H A;  1VIF A;  1VQL A;  4A54 A;  2R57 A;  5GMK l;  1QVF S;  4HVU A;  3SD4 A;  1T3S A;  5LJ3 j;  5GMK m;  2DTH A;  5KH6 A;  3G71 Q;  1GFC A;  2DTO A;  3BY7 A;  1B7T A;  4L5G A;  1VYU A;  5A0L A;  1M90 U;  2X3X D;  4FCY A;  1D1C A;  3P8H A;  3A8H B;  3CCS T;  4K11 A;  4C8Q A;  3HFN A;  1NEB A;  2LQN A;  2EW3 A;  4HCC A;  3CCV T;  4C8Q G;  1OX9 A;  3EFR A;  4HKE A;  1RAH B;  2X3W D;  4KUI A;  5CQY A;  2OAU A;  4M7D D;  5CKD A;  4M78 D;  2QAS A;  1JB0 E;  3QDR B;  4L6V 5;  3CCR A;  2EQJ A;  2I2L A;  3CQT A;  3OB9 A;  4EDU A;  2NYS A;  3QO3 A;  2DEQ A;  2Z0W A;  3N5B B;  2R58 A;  1NJI R;  5KYW B;  1NPR A;  2COY A;  5KYN A;  2J06 A;  2PNI A;  5LL6 S;  1JJ2 S;  5GMK h;  2B86 A;  1KD1 R;  4E47 A;  2IVW A;  2DMO A;  1O9S A;  4JLI A;  5GAN e;  1B3Q A;  2KGT A;  1KC8 U;  1BCO A;  3ZEH A;  4KGX B;  4M7D B;  2WSE E;  3EFO B;  3CCU Q;  1K9M R;  1VQ5 Q;  4E7S A;  3BDL A;  3PIP A;  2EQM A;  2LX9 A;  4LXC A;  1M2V A;  4AFS C;  1ZQ1 A;  2VUB A;  3JCM b;  2L2P A;  3EG9 A;  7AT1 B;  1QWE A;  4Y91 A;  3CC4 A;  2FRW A;  2GBQ A;  1PG5 B;  5D7U A;  1RAE B;  3WXM B;  4KH0 B;  3RKY A;  3PMI A;  4MDX A;  1KQS A;  1U3O A;  1UHC A;  3T9N A;  4HT8 A;  2JUF A;  5KE2 A;  2NUT B;  4C92 B;  1WYX A;  1D0Y A;  1CSK A;  1TSF A;  5GJV B;  3EG2 A;  3HP9 A;  2DTI A;  2K9G A;  1I07 A;  1PM3 A;  1M1F A;  3OYI A;  3L2R A;  1AWJ A;  3CCV A;  3MET A;  2ZZD A;  2E3H A;  3EFS A;  3KUF A;  3OYC A;  1YJN A;  3OYL A;  4R0K A;  1AT1 B;  1V1C A;  2MOX A;  4X1V A;  3JCM h;  2FZG B;  1UG1 A;  2EQK A;  2ZPB B;  4HT9 A;  2HAX A;  1YCS B;  4ELZ C;  3J7A F;  1YFN A;  2DL7 A;  4UC4 A;  2CT4 A;  3QXE B;  2QTV A;  3F70 A;  4M7D E;  4M7A B;  3VS1 A;  2H8H A;  3MP6 A;  4M75 E;  1K73 R;  2O4X B;  4HCB A;  3I56 T;  3FLG A;  1WXT A;  4RTV A;  4Z8A A;  2F2V A;  4DOV A;  2PUK B;  2LC4 A;  1GL5 A;  4KGV B;  2F5T X;  2RHX A;  2AZS A;  1I81 A;  2K79 A;  2K7A A;  1UTI A;  3QUI A;  4GLK A;  4GY5 A;  4NL2 A;  4A53 A;  3CCQ A;  4F16 A;  2F5K A;  3VS3 A;  5DLQ E;  2NLU A;  3G7Z A;  2MIO A;  4FL6 A;  1NPP A;  3C4S A;  4D8D A;  2QXF A;  4C5G A;  2EKO A;  4RTZ A;  3OYJ A;  3QYG B;  5FU6 B;  4E7J A;  4F04 B;  1PD0 A;  1SSF A;  1UUE A;  3JB9 I;  1B34 A;  2CZ1 B;  2HMA A;  4RTY A;  3M0R A;  5GAM e;  2K3X A;  1W4S A;  2QQS A;  4CC3 A;  3I56 Q;  2KQW A;  5CVI A;  2HNI A;  1PD1 A;  4OML A;  2DZC A;  4EMG A;  4JJN K;  2CS7 A;  1RI0 A;  1WI7 A;  2EJG A;  1M3A A;  1RI9 A;  3FRN A;  3M0T A;  2QA4 T;  3CME T;  2J6F A;  2CRE A;  4NOY A;  1FMV A;  1G2B A;  5LJ5 e;  3PGG A;  4JJB A;  1YIJ Q;  3M59 A;  2KEA A;  4PJO G;  3PNW C;  1BKB A;  2JOY A;  3URG A;  5KYW A;  2JJ9 A;  2XDB A;  3INZ A;  4J8O A;  4RCC A;  2L3R A;  3R6O A;  2JTE A;  3SDZ A;  3DB3 A;  2PQW A;  4LD6 A;  3CXC A;  5GAN 4;  1SPK A;  3OW2 P;  1X27 A;  2RD1 A;  3M5A A;  1YJ9 A;  4FW1 A;  4C92 G;  4BAC A;  2QDY B;  3I55 T;  1OYX A;  4J9F A;  3M0Q A;  2KBT A;  1VQ9 Q;  4PL6 A;  1W70 A;  3VS6 A;  2OTL A;  4MMK A;  2YRC A;  1NJI U;  5GAM g;  1R77 A;  4C5E A;  4M78 G;  3CCU T;  1F1B B;  2BE9 B;  4EMK B;  2E65 A;  2E5Q A;  4FSX A;  1K8A R;  4J7F A;  2EJ9 A;  4M4Z A;  3JCM g;  3OW2 S;  1VQP A;  3AHU A;  3LH0 A;  1WHM A;  1EZZ B;  4PNO A;  1BYM A;  1YN8 A;  2L5Q A;  2DA9 A;  3JCM X;  2O01 E;  4E7K A;  1HD3 A;  4F7U G;  1KC8 C;  2A37 A;  4WF2 A;  2L0A A;  1NLP C;  1IHV A;  1ABO A;  4BB7 A;  2X4X A;  5GAN h;  4C8Q B;  2MWP A;  4M78 F;  1YJW T;  2X9H A;  5LJ5 h;  3A8G B;  1X43 A;  1VQ6 Q;  3TRE A;  1G3Y A;  4M7A E;  2YDL A;  3J80 E;  1M90 R;  2DL4 A;  2ENM A;  2E41 A;  4A4H A;  5AT1 B;  1TH7 A;  1LNX A;  5D6W A;  1KHI A;  1C6V X;  1LOJ A;  1ZUY A;  2RK1 A;  4QW2 A;  1ZUK A;  1WHL A;  1AWW A;  2EQU A;  3LGF A;  4QQG A;  5I2M A;  1GCQ A;  2XID A;  2DJQ A;  2RJF A;  1C1A A;  4MZM A;  2KRM A;  2RI5 A;  2DET A;  4KGZ B;  4PKC C;  3CME A;  4QVD A;  1MMG A;  3KXT A;  3GNG A;  2J6K A;  2QGG A;  1VQ8 Q;  3HL8 A;  3KFV A;  1D09 B;  5CR2 A;  3CC2 A;  1QVP A;  3X24 B;  1NE8 A;  1Q82 C;  3OYF A;  4C8Q D;  3VS4 A;  2FG0 A;  2LJ0 A;  3FJP A;  2CGH A;  2XKO C;  2F2W A;  3EH1 A;  2GTO A;  5GAN 2;  4XTU A;  2JM8 A;  2VXF A;  4XTX A;  5L8R E;  1X2Q A;  4J9G A;  2ESW A;  2KR3 A;  2OTJ Q;  3I56 A;  2MCN A;  1Y57 A;  4M7A G;  2DVE A;  1PSF A;  2HL3 A;  1VQN Q;  2IG0 A;  1N9S A;  1UGS B;  1VQM A;  3A5Z B;  2V1R A;  5FRN A;  3P8D A;  1RAA B;  2MI6 A;  3HRT A;  4BY6 B;  5DY9 A;  1RAB B;  4AT1 B;  1M1K R;  2L3Q A;  1BCM A;  1U8R A;  3JB9 J;  1I5L A;  2DBK A;  4QVZ A;  1Q86 R;  4J6W A;  3NHN A;  1WDX A;  3U23 A;  2GF7 A;  1YP5 A;  4J6Y A;  4KH1 B;  3MEA A;  3CPW A;  1ZSZ B;  3V7R A;  2ATC B;  4YTL A;  3E19 A;  5GAN g;  1IHW A;  4EMK A;  1IB8 A;  4M7D F;  3QJ6 A;  5IXB A;  3OYM A;  2PU9 B;  2V1Q A;  3GPL A;  4C92 C;  1JU5 C;  2G3R A;  2B8A A;  2JMA A;  5GAO l;  4TVR A;  2CP7 A;  4OB0 B;  5GAN 6;  1WQW A;  2CH4 W;  1N27 A;  2YLC A;  1Q82 R;  2EVR A;  3CCE A;  1AD5 A;  2CP3 A;  4N0A C;  2D8J A;  1NJI C;  3M4G A;  3X26 B;  3WVD B;  5IHN A;  3GF5 A;  2DYI A;  2RHU A;  4RTT A;  4OMQ A;  5J26 A;  4PLL A;  2LQK A;  5CAI A;  1PHT A;  2IIM A;  3G1J A;  3TU4 K;  4M7A D;  1HK9 A;  3GLX A;  2J7I A;  3TCJ A;  1A0N B;  1VQK T;  5LJ3 e;  5I2S A;  1M8M A;  2X4Y A;  5D6Y A;  3VJP A;  1Y0M A;  3OSS C;  3TEE A;  2D0N A;  2P0Q A;  1AWX A;  1ZA2 B;  1Q7Y U;  2O88 A;  3CMA Q;  1YHQ A;  3JCM d;  2W10 A;  2VB6 A;  4LDV A;  2EFI A;  1MV0 B;  2DL5 A;  1X6O A;  3FC3 A;  1M9S A;  1QMC A;  2ROL A;  1UEB A;  4LDY A;  4XK8 E;  4FYY B;  1KC8 R;  4C0D B;  4BI8 B;  2FEI A;  1SF9 A;  2M16 A;  4FIB A;  5FU7 C;  1D0Z A;  2ED0 A;  1OOT A;  5GAO r;  1K8A U;  4PJO D;  2M0Y A;  5GMK j;  1KK7 A;  1WX6 A;  2XK0 A;  2XG8 D;  1UFF A;  1X75 C;  2O4X A;  3S6W A;  4F7U A;  3RKX A;  5HY6 A;  4KT0 E;  2JZ2 A;  1YHQ Q;  4M77 B;  5C0M A;  4HVV A;  4PJO A;  1I1J A;  4Z88 A;  1VQL T;  2G6F X;  4EPC A;  2DM1 A;  4L59 A;  4M78 A;  1YNZ A;  1FYN A;  2A3L A;  1WLP B;  3QSU A;  2CP0 A;  1OEB A;  2DIG A;  1ZSZ A;  4C92 F;  2KYM A;  1D3B A;  1Q7Y C;  2K6D A;  1LCK A;  3EG1 A;  4PFP A;  2YT6 A;  3OA6 A;  5CKF A;  1MV3 A;  2NWM A;  5GAN 7;  1YWP A;  2CUB A;  2YWW A;  4LD9 K;  2PVG B;  4PJO B;  5KYY B;  1VQK A;  3E9F A;  1M8V A;  4C92 A;  4E7Z A;  1QKW A;  1LPL A;  2EYY A;  2C0I A;  4XAX B;  1BIB A;  3L2V A;  2DXT A;  2V8I A;  4FT2 A;  4DOW A;  2E1H A;  2HDA A;  4LUD A;  3JCM W;  1VQ9 A;  1RAI B;  4IIO A;  2LNH B;  2AIR B;  2X51 A;  1WHJ A;  1M5Q 1;  1MMN A;  4JJD A;  4JZ3 A;  2ZAE A;  4A4F A;  4NL3 A;  2DBM A;  2O31 A;  5CKH A;  2QK0 A;  1MHN A;  4QT7 A;  4F7U E;  4Z89 A;  3CCE T;  2BIV A;  3MJX A;  1R8O B;  2J05 A;  3MEV A;  4AFZ C;  1TXQ A;  2GCX A;  5LJ3 d;  5KCH A;  1GCP A;  4O5V A;  2FHD A;  1Q81 R;  4HA8 A;  3SWN C;  3RMQ A;  1C0M A;  4BE2 A;  2JW4 A;  3JAM E;  3CCJ T;  1TUD A;  3A8O B;  3OS0 A;  2RO0 A;  4FSS A;  1N8R C;  2QI2 A;  2GNC A;  4M77 E;  3RKW A;  4D6W A;  2CYZ B;  2BTT A;  1KIK A;  5C6S A;  1E7O A;  4BE0 A;  2KDS A;  4BI3 A;  2KMT A;  4QQ6 A;  3L2W A;  3QYH B;  2ZPI B;  1V76 A;  2DRK A;  1XJW B;  2O9S A;  1AEY A;  2BZY A;  2HEQ A;  2BZX A;  2YLB A;  4A63 B;  4PJO E;  4OB3 B;  2CZ7 B;  1Y96 A;  2LCC A;  5CCA A;  1TUG B;  1VIE A;  3V8L A;  2FL7 A;  3CPF A;  1FX7 A;  3QKJ A;  4OGC A;  3HHT B;  3CD6 A;  3SB2 A;  4M7D C;  2GQI A;  2FYK A;  2K5F A;  3CMA T;  1RAG B;  1WQ7 A;  1JO8 A;  1Q81 C;  1N6A A;  1G8X A;  2RJD A;  3A98 A;  3JB9 D;  3EGU A;  1M27 C;  2K57 A;  2DL3 A;  3UWN A;  3V7S A;  1W6X A;  1WPY A;  4FU6 A;  1Q95 G;  3ME9 A;  2H3E B;  2OJ2 A;  3GBQ A;  3OMC A;  3P8B B;  1NYF A;  3C94 A;  2ZPG B;  5HK3 A;  3KBG A;  1YJ9 T;  1TU0 B;  4XTY A;  1OU8 A;  3UA6 A;  4FM4 B;  2YUN A;  1NBE B;  2DZ9 A;  2LRQ A;  1TG0 A;  1MND A;  1Y71 A;  4IUT A;  1UJ0 A;  1QCN A;  2YUP A;  2WSC E;  4GLM A;  1BB9 A;  3JCM c;  3OBY A;  3OS5 A;  1JXO A;  3JB9 F;  4IUV A;  2E70 A;  1K1Z A;  3UT1 A;  2O9V A;  1QVG P;  4JZ4 A;  2FRY A;  2HCK A;  3EHQ A;  1VQN A;  1X6G A;  1B34 B;  3QZ9 B;  4A4K A;  1XNI A;  1WXB A;  2QQR A;  5D6X A;  2YUQ A;  2EJF A;  1VQP T;  5KE3 A;  3H8Z A;  1HYO A;  4OP0 A;  1PCX A;  5GAM f;  4ORZ A;  1X69 A;  3M0U A;  2LT4 A;  4M75 G;  2A0F B;  1G3S A;  2L3S A;  4A4G A;  2LJ1 A;  2VGM A;  5FWB A;  4FYV B;  4BI4 A;  3TSZ A;  2DD4 A;  2JTM A;  5FWC A;  1D0X A;  3JCM P;  4C5I A;  3C95 A;  4F7U F;  1S72 A;  3CBO A;  2RQW A;  3CC7 Q;  1UDL A;  1WZO A;  4OMM A;  2PZ1 A;  4X9C A;  5GAM h;  2E3I A;  3ZBD A;  1OQK A;  1ABQ A;  3NPF A;  1WIE A;  2M51 A;  5IAY A;  3M58 A;  2RQU A;  2M0O A;  3SWN B;  1RAC B;  2RI3 A;  3AT1 B;  1XQH A;  4ZGE B;  3HFO A;  4PFZ A;  2EGE A;  5CIU A;  4II1 A;  4ZTJ A;  5HK0 A;  1S72 Q;  4NS5 A;  1IRX A;  2COW A;  4C8Q F;  1RAF B;  2DL8 A;  1WJQ A;  3BFM A;  2DX1 A;  3CME Q;  1VQ6 A;  5IXF A;  4OB2 B;  5ECA A;  1H3H A;  2HQE A;  3CXC P;  1KSW A;  1T0H A;  2LCS A;  1MNE A;  1Z9Q A;  4Y28 E;  1AHJ B;  2QA4 A;  2XU8 A;  3LX7 A;  4CI0 C;  2AKL A;  4M75 A;  3CCM Q;  2PUO B;  3I5R A;  1M3B A;  1YI2 A;  1SSH A;  1LVK A;  2E12 A;  3FB9 A;  4OMF B;  4CRI A;  2VXE A;  3CCE Q;  1ZLM A;  4XQ3 A;  2QQ9 A;  2AT1 B;  1G83 A;  2HKQ B;  2L3P A;  3FIF A;  5KYU B;  2KRN A;  2MF2 A;  4M77 A;  4AG1 C;  1T0J A;  2E6Z A;  4OGE A;  2F1L A;  3DLM A;  1H3Z A;  1BI0 A;  1RLQ C;  3HPW A;  2QDL A;  3QWX X;  4M75 B;  2WAC A;  2ZPE B;  3MP1 A;  5HCK A;  3VYG A;  2ZGW A;  1UGP B;  3Q1J A;  3G6E Q;  3OYD A;  1VQK Q;  1YJN T;  3CCJ A;  1H8K A;  2QQA A;  1N9R A;  1TWB A;  1YJ9 Q;  1M2V B;  3OYH A;  3VYH B;  3G71 A;  2E64 A;  1D1A A;  1SG5 A;  1OUL A;  4C92 D;  2FPD A;  3JSC A;  2VWF A;  2XDP A;  2VV5 A;  4JDS A;  1M1K U;  4IUR A;  3CCL T;  1G3T A;  1UJY A;  3D7S B;  2QA4 Q;  1YIJ A;  1Q82 U;  1NYG A;  2YXY A;  1SKU B;  2X4J A;  2VKN A;  3JCM J;  1TTH B;  4PJO F;  5LJ5 g;  4B6M A;  3SFM A;  2MYS A;  2Y4X A;  4PJL A;  2CZ0 B;  5FU7 B;  1TS9 A;  2RHZ A;  2BZ8 A;  4PFO A;  2AKK A;  4XU3 A;  4M75 F;  4C0D C;  1KQ1 A;  4X34 A;  1RUW A;  2NUZ A;  3EG9 B;  5IN1 A;  3QBY A;  1K0S A;  2F69 A;  3CBM A;  3IQL A;  2LT1 A;  2VC8 A;  1ZHI A;  4M78 C;  4F17 A;  4PJJ A;  1RAD B;  4J83 A;  4KBM B;  2RA2 A;  4PJM A;  4DEY A;  2LQ8 A;  1IGU A;  4MML A;  3BDU A;  4HCZ A;  3CC4 Q;  4M77 F;  1CKA A;  3CBP A;  3GOX A;  3ER0 A;  4JRI A;  5GMK i;  3H0H A;  2D8H A;  4BUG A;  2BKD N;  1OPL A;  2LNV A;  3L42 A;  2MWO A;  1ARK A;  4M7A C;  2YSQ A;  1T3L A;  1I4K 1;  2FPE A;  3QHS A;  3CCJ Q;  4IIM A;  2W0Z A;  1HJD A;  2KRS A;  2JVV A;  3X25 B;  4D8K A;  1D1B A;  4M7D A;  2P4T A;  1QP3 A;  2RF0 A;  1KD1 U;  3OYB A;  3OW2 A;  1B07 A;  2LMJ A;  4M77 G;  2QG9 B;  4E2F B;  1BK2 A;  1MMD A;  3CCS A;  4RG8 A;  5KYX A;  3CCQ Q;  5IHI A;  2AHJ B;  2CP5 A;  3NGP A;  2DK3 A;  1FWZ A;  4ZN1 A;  2R5M A;  3LH5 A;  4XU1 A;  1IGQ A;  3RDV A;  2VGN A;  1SRL A;  2HQH A;  3UDC A;  1K73 C;  4ZGD B;  1VQ4 A;  2QEX T;  1WGS A;  4J9C A;  2NUT A;  3QG1 A;  4FW2 A;  2HBW A;  1Q86 C;  1BIA A;  4O6J A;  4ZN3 A;  1VQ7 A;  2YHT A;  3M54 A;  3CEY A;  4HVW A;  3MEW A;  1WHK A;  3RNJ A;  2A28 A;  1BI3 A;  1MGQ A;  3BW1 A;  3NMZ C;  4E7L A;  2CDT A;  5FLX E;  1FMK A;  5CKE A;  4E7I A;  2OTL Q;  2FVU A;  2DIL A;  1RLP C;  2KT8 A;  3PVL A;  2CSQ A;  2IPO B;  3CC7 T;  2DD5 A;  8ATC B;  1MMA A;  5J39 A;  5GAN d;  2E4H A;  3I35 A;  1PNJ A;  2EPD A;  2XIC A;  2KAF A;  2ABL A;  1ACM B;  2RJE A;  3I5S A;  1P92 A;  5FRO A;  5LJ3 g;  2CSI A;  1Q81 U;  5KYU A;  3L2Z A;  2QAZ A;  3G71 T;  4AMC A;  4M75 D;  2RN8 A;  2JT4 A;  1K9A A;  3CCV Q;  5LJ5 d;  1J3T A;  4ESR A;  5DLO A;  1JEG A;  3I9Q A;  3O5Z A;  3MPU B;  2KI7 A;  3VS0 A;  3L1A A;  2YRD A;  3CXC S;  2NUP B;  1QVF A;  4J9I A;  1W1F A;  2X35 A;  2Y90 A;  4WTO B;  2K5I A;  3TQ7 P;  2KVQ G;  4BE1 A;  2LQW A;  4DBR A;  4RG2 A;  3GIB A;  2P0P A;  1UEC A;  1YBY A;  4OMP A;  4XTW A;  3H6Z A;  2ECZ A;  2GGR A;  2RJC A;  4IUQ A;  2JXB A;  3CCR Q;  2YRV A;  2DF6 A;  1VQM T;  2FZK B;  1V29 B;  1VQ5 A;  1DJ7 B;  3C12 A;  3M56 A;  4AFU C;  4RTX A;  4QQD A;  4VUB A;  2HZY A;  2K4Y A;  8AT1 B;  4DBH A;  5IHK A;  4C0Z A;  4PK4 A;  2A7Y A;  2O2O A;  1M1G A;  2E5K A;  2J6O A;  1D3B B;  2MMP A;  4JJC A;  1VQ8 T;  2D6F A;  2EYZ A;  5KCO A;  1VYT A;  1IRE B;  2EGA A;  3HSB A;  1PKT A;  4M75 C;  5KYY A;  3G4S A;  1WA7 A;  1S72 T;  3PT9 A;  2P0K A;  2RH2 A;  1EX4 A;  1BBZ A;  1UGV A;  3THK A;  3EG3 A;  5I11 A;  2P4R A;  3UF4 A;  2EBP A;  2MPX C;  1MUZ A;  1K73 U; 
#chains in the Genus database with same CATH homology
 1SPK A;  1X27 A;  5L23 A;  1JQQ A;  2OJ2 A;  2OI3 A;  3GBQ A;  4J9F A;  3M0Q A;  5EC7 A;  1NYF A;  2KBT A;  2DLP A;  2K3B A;  2RMO A;  1OPK A;  1SEM A;  3UA6 A;  4EIK A;  2YUN A;  2LP5 A;  2EQI A;  1W70 A;  3VS6 A;  1TG0 A;  1NM7 A;  1UJ0 A;  3QWY A;  2YUP A;  1ZX6 A;  3ZL7 C;  2AK5 A;  2DYB A;  4GLM A;  1BB9 A;  4M4Z A;  1JXO A;  1K1Z A;  2DNU A;  3SEM A;  2O9V A;  2I0N A;  2CT3 A;  4OMN A;  4JZ4 A;  2FRY A;  2HCK A;  3EHQ A;  1YN8 A;  1GBQ A;  1GRI A;  1K76 A;  2DA9 A;  3C0C A;  1UE9 A;  1PWT A;  1X6G A;  4LUE A;  1HD3 A;  1WXB A;  4DEX A;  2A37 A;  2RQT A;  2YUQ A;  3EHR A;  3FJ5 A;  2L0A A;  1NLP C;  3TVT A;  1ABO A;  2FO0 A;  3PE0 A;  4ORZ A;  1X69 A;  1QWF A;  3M0U A;  1X43 A;  2KXD A;  2L3S A;  3REB B;  4Y92 A;  4CC4 B;  2LJ1 A;  2YDL A;  5FWB A;  1AWO A;  2DL4 A;  3TSZ A;  2ENM A;  2RPN A;  5FWC A;  2K2M A;  4LN2 A;  1AVZ C;  1ZUY A;  1I0C A;  1ZUK A;  1AWW A;  4AFQ C;  1GCQ A;  2DJQ A;  2RQW A;  1NG2 A;  1QCF A;  1UDL A;  3H0F A;  2PZ1 A;  4OMM A;  4AG2 C;  2KRM A;  1PRM C;  1ABQ A;  3NPF A;  1WIE A;  2M51 A;  2RQU A;  4RTW A;  2J6K A;  2KT1 A;  3KFV A;  2EGE A;  1HSQ A;  1ZBJ A;  4RTU A;  1M3C A;  3JV3 A;  1WXU A;  1QLY A;  3M0S A;  2DL8 A;  3VS4 A;  2A36 A;  2FG0 A;  2LJ0 A;  2DX1 A;  5IXF A;  4JPB W;  5ECA A;  1H3H A;  1KSW A;  1BU1 A;  1T0H A;  2LCS A;  2F2W A;  1Z9Q A;  2GTO A;  1X2K A;  4CC2 A;  2JM8 A;  2AKL A;  1X2Q A;  2EYW A;  4J9G A;  2ESW A;  2KR3 A;  3I5R A;  1M3B A;  2EGC A;  1SSH A;  2MCN A;  1Y57 A;  1AZG B;  2XMF A;  1E6H A;  2DRM A;  4HCK A;  5IH2 A;  1SHF A;  4KRT A;  2FPF A;  1U5S A;  1ZLM A;  2V1R A;  2L3P A;  1G83 A;  2GTJ A;  2KRN A;  1CKB A;  4AG1 C;  1T0J A;  5GJW B;  3M0P A;  1PKS A;  2AZV A;  1RLQ C;  2L3Q A;  1UHF A;  2QDL A;  3QWX X;  5HCK A;  2DE0 X;  2DBK A;  2C0T A;  2JM9 A;  1GBR A;  3NHN A;  3PVQ A;  2A08 A;  1WDX A;  3U23 A;  1H8K A;  3REA B;  1YP5 A;  5FW9 A;  2KYB A;  2D1X A;  5IXB A;  1VYV A;  2FPD A;  2CUD A;  4CC7 A;  3VS5 A;  2V1Q A;  4HXJ A;  1M30 A;  2JS0 A;  2VWF A;  1JU5 C;  1OV3 A;  2JMA A;  2RQR A;  1U06 A;  2ROT A;  4HVU A;  2CH4 W;  1T3S A;  1UJY A;  2EVR A;  1AD5 A;  3VRZ A;  1ZSG A;  1NYG A;  2D8J A;  1GFC A;  1SRM A;  1IO6 A;  3TSW A;  2PTK A;  1VYU A;  5IHN A;  2VKN A;  2EKH A;  2X3X D;  4RTT A;  4OMQ A;  1H92 A;  4LNP A;  4K11 A;  4LE9 A;  4OMO A;  2BZ8 A;  1PHT A;  1NEB A;  3VS7 A;  2LJ3 A;  2AKK A;  2EW3 A;  2F2X A;  2LQN A;  2IIM A;  1KFZ A;  1RUW A;  2X3W D;  2KRO A;  2NUZ A;  1K0S A;  2J7I A;  3IQL A;  1A0N B;  2VVK A;  1M8M A;  4F17 A;  3R6N A;  2KE9 A;  3CQT A;  3VS2 A;  4DEY A;  1JXM A;  1Y0M A;  2D0N A;  4GBQ A;  1CKA A;  1K4U S;  1AWX A;  1NLO C;  2O88 A;  1WFW A;  2JS2 A;  3ULR B;  2W10 A;  2DVJ A;  3H0H A;  2D8H A;  1OPL A;  1MV0 B;  2DL5 A;  2J06 A;  1ARK A;  2PNI A;  2YSQ A;  2B86 A;  1T3L A;  2FPE A;  1K0X A;  2ROL A;  4IIM A;  2DMO A;  2W0Z A;  1HJD A;  1B3Q A;  2KGT A;  2SRC A;  2KRS A;  4D8K A;  2FEI A;  2RF0 A;  1B07 A;  2LMJ A;  4J9B A;  2ED0 A;  1BK2 A;  2LX7 A;  1OOT A;  2M0Y A;  4AFS C;  5IHI A;  1XOV A;  1WX6 A;  2L2P A;  1X6B A;  3NGP A;  1UFF A;  1QWE A;  3LH5 A;  1SRL A;  2FRW A;  2HSP A;  2GBQ A;  3UA7 A;  4J9C A;  5I22 A;  1SHG A;  4HVV A;  1I1J A;  1U3O A;  1UHC A;  2HBW A;  4Z88 A;  4E6R A;  4F14 A;  3SHW A;  2G6F X;  2DM1 A;  1KJW A;  1E6G A;  1WYX A;  1CSK A;  5GJV B;  3EG2 A;  4HVW A;  1YNZ A;  1FYN A;  2K9G A;  1GCQ C;  1I07 A;  1VA7 A;  1WLP B;  4WCI A;  3RNJ A;  1AWJ A;  2A28 A;  3NMZ C;  1OEB A;  2CDT A;  1YWO A;  3RBB B;  1FMK A;  2KYM A;  1NEG A;  1LCK A;  2K6D A;  3EG1 A;  4R0K A;  2MOX A;  1V1C A;  4X1V A;  2YT6 A;  1MV3 A;  2KXC A;  2NWM A;  1N5Z A;  2KT8 A;  1RLP C;  1YWP A;  1UG1 A;  2CUB A;  2DIL A;  3PVL A;  2CSQ A;  4J9D A;  3H0I A;  1YCS B;  1QKW A;  1AZE A;  2EYY A;  2C0I A;  2DL7 A;  2CT4 A;  2ED1 A;  3I35 A;  1PNJ A;  2EPD A;  4LUD A;  2HDA A;  4ZNX A;  3VRY A;  3VS1 A;  2H8H A;  4IIO A;  2LNH B;  2ABL A;  3I5S A;  1TUC A;  2CSI A;  4JJD A;  1WXT A;  4RTV A;  4Z8A A;  2F2V A;  1GL5 A;  4JZ3 A;  2RN8 A;  2JT4 A;  2DBM A;  1K9A A;  4J9H A;  2AZS A;  2O31 A;  3H41 A;  4QT7 A;  1J3T A;  2K79 A;  4RUG A;  4Z89 A;  4ESR A;  2C0O A;  1JEG A;  2K7A A;  1UTI A;  3I9Q A;  2J05 A;  1GFD A;  3O5Z A;  3VS0 A;  1S1N A;  4AFZ C;  4F16 A;  2EYX A;  3VS3 A;  2CH4 A;  4J9I A;  1W1F A;  2MIO A;  1GCP A;  2JW4 A;  4D8D A;  3UAT A;  1TUD A;  4RTZ A;  1PRL C;  4FSS A;  2LQW A;  2GNC A;  2YUO A;  1UEC A;  2BTT A;  1UUE A;  2RNA A;  1KIK A;  4OMP A;  1E7O A;  2ECZ A;  2GGR A;  4RTY A;  3M0R A;  2JXB A;  1Z9Z A;  2DF6 A;  4CC3 A;  4AFU C;  4OML A;  4RTX A;  1WI7 A;  2DRK A;  2O9S A;  1M3A A;  4J9E A;  1RI9 A;  1AEY A;  2BZY A;  1AOJ A;  2HEQ A;  2BZX A;  4A63 B;  5IHK A;  2KNB B;  2RQV A;  3M0T A;  2O2O A;  2E5K A;  2J6O A;  4JJC A;  2EYZ A;  2J6F A;  1VYT A;  2CRE A;  2EGA A;  1PKT A;  1G2B A;  2LZ6 B;  2JMC A;  1WA7 A;  2GQI A;  3EG0 A;  4JJB A;  1QKX A;  2KEA A;  1W6X A;  1JO8 A;  1BBZ A;  1UGV A;  3THK A;  2SEM A;  3EG3 A;  5I11 A;  1ZUU A;  2P4R A;  3A98 A;  3UF4 A;  3EGU A;  1M27 C;  2JTE A;  2EBP A;  2DL3 A;  1MUZ A;  1EFN A;  2OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...