1JEGA

Solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
b'SGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE CSK
publication title A novel, specific interaction involving the Csk SH3 domain and its natural ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/hydrolase
total genus 10
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jegA00
3GBQA 2K79A 2A37A 4DEYA 1U06A 2ROTA 4AFSC 2KRNA 1X6GA 3VS0A 2O31A 2EGAA 2G6FX 2JT4A 4RTYA 1B3QA 1PKSA 3UA7A 2PTKA 1MV3A 3EG2A 3VRYA 2D8JA 4HVVA 1G2BA 2F2XA 2CUDA 2JM8A 2FPDA 1PHTA 1XOVA 2RMOA 1M27C 2RPNA 1YN8A 2GNCA 2GGRA 2XMFA 2OJ2A 1M3CA 4E6RA 4Y92A 1GBQA 3M0RA 4OMLA 2DL5A 2DL7A 1K76A 1RUWA 2CREA 1QLYA 2CSQA 2J6FA 2ECZA 2KBTA 1NEGA 1UGVA 2DMOA 1HD3A 4ORZA 2M0YA 3VS1A 1VYTA 1X2KA 2YSQA 3REAB 1ZUKA 2AZVA 4GBQA 4DEXA 3NMZC 2C0TA 5IHNA 2MCNA 1N5ZA 4K11A 5IHKA 3M0QA 1YWOA 2DA9A 2F2VA 2FG0A 2JMAA 2FPEA 1K0XA 1GFDA 4HXJA 1TUDA 5I11A 1T3LA 1QWFA 2LJ1A 2L3QA 4X1VA 1SHFA 3FJ5A 2DRMA 1SRLA 2LZ6B 3EG3A 2DNUA 2LQNA 2VVKA 4RUGA 1SPKA 1JQQA 2D1XA 1ZUUA 4R0KA 2DX1A 1VYVA 2K6DA 2EYXA 2O9SA 2FRWA 4JPBW 1ZUYA 2EPDA 1SSHA 1YNZA 3M0PA 3IQLA 3H0FA 1IO6A 2KRMA 2NWMA 2BZXA 2CDTA 2FEIA 2W10A 1UDLA 2FO0A 2GTJA 1AEYA 3M0SA 4OMMA 1UJ0A 1T0HA 1SHGA 1NEBA 2QDLA 1NYGA 2CH4A 2RQRA 3VS3A 1RI9A 4J9HA 1OV3A 4LUDA 4OMOA 3VRZA 1UFFA 1I07A 3LH5A 1E6GA 2DYBA 2DILA 1JXOA 1KFZA 4AFQC 4FSSA 1K1ZA 2V1QA 1TUCA 2YT6A 3I5RA 2LMJA 1CKAA 1T0JA 3M0TA 1KJWA 1MUZA 2RNAA 2L2PA 1WXBA 4JZ3A 1AWXA 1EFNA 2KGTA 1QCFA 2V1RA 2KT8A 2LCSA 1E7OA 1NYFA 1WFWA 1I0CA 2RQWA 1UHFA 1WI7A 1V1CA 5FW9A 4LNPA 1T3SA 2PNIA 2YUNA 3VS2A 2ED1A 2EBPA 3THKA 4A63B 1B07A 1PRLC 3JV3A 2K3BA 2M51A 2EGCA 2GBQA 2O9VA 2EQIA 4CC2A 1GCQA 1OPLA 4OMQA 2J6OA 1BB9A 1X69A 2KE9A 1U3OA 2EYWA 2PZ1A 2K9GA 4ZNXA 1YCSB 2J05A 5IXBA 2DRKA 4F17A 1JO8A 1GCPA 3QWYA 3CQTA 4RTVA 1NM7A 1RLQC 5HCKA 4D8KA 1FYNA 1M30A 2B86A 2HSPA 1AOJA 1UJYA 1W6XA 1H8KA 1H92A 3NPFA 2O2OA 1WA7A 2RF0A 1OEBA 1A0NB 3ZL7C 2EYYA 4HVWA 1X6BA 3PVLA 2EW3A 1M3BA 3RBBB 2HEQA 2YUPA 3U23A 3H0IA 2SRCA 2O88A 2KRSA 1CKBA 4F14A 1JU5C 4GLMA 1E6HA 2JTEA 1WYXA 1VYUA 1CSKA 2DLPA 3EHQA 2L0AA 1UE9A 2AKKA 5GJVB 4HVUA 2J06A 5GJWB 2LJ0A 5IHIA 2EKHA 2ESWA 1Y57A 2FPFA 2I0NA 2KXDA 4J9EA 4Z8AA 2DJQA 1PNJA 1AD5A 4J9GA 4Z88A 2DL3A 1YWPA 1PWTA 2DE0X 2L3SA 4LE9A 1MV0B 2HBWA 1X2QA 2CUBA 4J9IA 2BTTA 2DM1A 5FWBA 2DL8A 4RTTA 2VWFA 1WLPB 1Y0MA 3NGPA 3M0UA 1GFCA 2DL4A 1J3TA 2EYZA 2GTOA 4KRTA 2LP5A 2L3PA 2AZSA 4AG1C 5IXFA 3UA6A 4J9FA 2FRYA 4D8DA 3H0HA 2A08A 4J9CA 1QKWA 1M8MA 1NLPC 2KYMA 4JJBA 2KROA 1QKXA 3R6NA 2VKNA 2ENMA 3PE0A 2AKLA 1Z9QA 2A28A 3EG1A 2MIOA 4Z89A 2JS0A 2D8HA 1UG1A 2YDLA 1WDXA 3EGUA 2C0OA 2H8HA 3A98A 4RTWA 1BU1A 1H3HA 4RTZA 4IIMA 4EIKA 2CT3A 1AWWA 2EVRA 2X3XD 2DBKA 1FMKA 3TVTA 3VS5A 3SHWA 1LCKA 1X27A 1GL5A 1X43A 4JZ4A 1UTIA 4IIOA 1W70A 4HCKA 2LQWA 2F2WA 4CC7A 1QWEA 2KEAA 4M4ZA 2JM9A 2LJ3A 2KXCA 1KSWA 1K4US 1ABQA 1ZBJA 3PVQA 4CC3A 1WX6A 1WIEA 2SEMA 2D0NA 3UF4A 3ULRB 1S1NA 5FWCA 2IIMA 2K2MA 3C0CA 2X3WD 1OOTA 2J6KA 2JXBA 4LUEA 1GRIA 1WXUA 1AVZC 3TSZA 1VA7A 4J9BA 4AG2C 2RQVA 3RNJA 1OPKA 4CC4B 2DBMA 2JMCA 3EHRA 1JXMA 2ABLA 4J9DA 3I5SA 1AZGB 2BZ8A 2KYBA 4QT7A 4RTUA 4WCIA 2GQIA 2P4RA 1AZEA 1I1JA 2KNBB 2E5KA 2RQUA 4ESRA 2KT1A 2W0ZA 1HJDA 1GBRA 1UUEA 2OI3A 3EG0A 1RLPC 4LN2A 1HSQA 2C0IA 1ZX6A 2HDAA 2HCKA 1BBZA 4OMPA 3UATA 3I9QA 4AFUC 5ECAA 1BK2A 1GCQC 1M3AA 3REBB 4AFZC 1Z9ZA 1PRMC 3VS6A 1AWJA 3VS4A 3O5ZA 3QWXX 2J7IA 4JJCA 1KIKA 2BZYA 2YUQA 2OAWA 1U5SA 2LX7A 1UHCA 1K0SA 1NLOC 2A36A 5L23A 1W1FA 3SEMA 2ROLA 2RN8A 1SRMA 1NG2A 1WXTA 2K7AA 1ZLMA 4JJDA 2JS2A 1ZSGA 2LNHB 1YP5A 3NHNA 1ARKA 2CSIA 1UECA 4F16A 1G83A 3TSWA 5IH2A 2ED0A 1K9AA 3VS7A 2MOXA 1ABOA 3H41A 2CH4W 3KFVA 5I22A 2KR3A 4OMNA 1TG0A 1JEGA 2JW4A 2NUZA 2YUOA 2AK5A 1SEMA 2DF6A 5EC7A 2RQTA 1PKTA 4RTXA 2DVJA 1AWOA 2CT4A 2EGEA 3I35A
chains in the Genus database with same CATH superfamily
4JUVA 1WZOA 3CD6A 4AFSC 3A8MB 3PNWC 1PSEA 3OSSC 4PJNA 2QA4T 3VS0A 2EGAA 5A2QE 1QW1A 5LJ3f 3JCMe 2PTKA 1MV3A 1N27A 3EG2A 4Y91A 4HVVA 1G2BA 2RI2A 5LJ3d 4BE1A 2HKNA 1PHTA 5GAN2 2M0OA 3J81E 2JJ9A 2XU8A 5CQYA 2LT1A 4II1A 3CC7T 4AMCA 1M3CA 3X24B 1WJSA 1GBQA 4YTLA 1KD1R 1RUWA 2CREA 2ECZA 2KBTA 5FLXE 3A8GB 2CS7A 3MJXA 2G3RA 1VYTA 1X2KA 3JCMc 3VS1A 4HCBA 3REAB 3VV0A 1Q82C 4HKEA 1RACB 3L42A 3MO8A 3SB2A 1YWOA 2JNGA 5CR2A 2DA9A 2F2VA 3QHSA 1YJ9T 1GFDA 4HXJA 1TUDA 5I11A 4RG8A 2L3QA 3H6ZA 3TEEA 3FJ5A 1SRLA 2LZ6B 1LVKA 2K4YA 1VQLA 1SPKA 1YJNT 5FU6B 2D1XA 4DBHA 2CZ1B 2HNIA 4R0KA 1MHNA 4KH0B 5HK3A 2PQWA 1ZUYA 5KYWA 1D0XA 2EPDA 3L2QA 3QBYA 1B7TA 2NUPA 3DB4A 1IO6A 5GAN4 2BIVA 2BZXA 1NBEB 3OA6A 1BKBA 2FO0A 1ZSZC 4C0DC 1B34A 1BIAA 1SHGA 1FMVA 2CH4A 1KQSS 3JCMd 1KC8U 3A5ZB 1YHQA 4LUDA 3JCMX 1YI2T 2DTIA 1WGSA 3VRZA 2XDPA 1BI3A 2PUOB 3E9FA 1Y7XA 4AFQC 4M75F 3QG1A 3I5RA 4PL6A 2LMJA 4C8QG 1MUZA 2RNAA 1Q81R 4X34A 2HD0A 1RAHB 4M7AC 1F1BB 2QG9B 4QVZA 2P0QA 1Q86R 4LXCA 3LWIA 4N4GA 5CKHA 4OF1A 2PNIA 2YUNA 4C92F 3OW2A 3THKA 2V8IA 4XU0A 1PRLC 2VV5A 2P4TA 5FROA 2QQ9A 2O9VA 1M90U 3MPUB 2QTXA 4MZTA 4J5YA 4M75B 4D6WA 3V7RA 3MCAB 3L1AA 2J6OA 1QVGA 2CP2A 2LX9A 1K8AR 1TU0B 3CCST 4PJOG 4KBMB 2ZZDA 3JCMW 2PZ1A 2K9GA 3MP8A 4QQGA 2D0QB 1YCSB 2DRKA 1GCPA 4RTVA 3HKSA 3QUIA 2VYTA 4N4HA 2PVGB 5KYXB 1VQ6Q 3PT9A 3JCMb 2DEUA 5LJ3j 1VQNT 4C92B 1U1TA 1H8KA 5EG2A 3NPFA 4FCYA 4ZN1A 3SD4A 1WA7A 1D1AA 4IUUA 2RJDA 3ZL7C 2DERA 3JCMg 4HVWA 1V29B 3A8LB 3U23A 5KE3A 2HL5C 2DZCA 1RL2A 1IHVA 5HKCA 2PVOB 1CKBA 1SKUB 3PIPA 3JCMh 3HRSA 2B8AA 2M16A 1VQMT 2RHIA 2BUDA 5GJWB 3CPWP 2ESWA 4OB2B 2I0NA 4J9EA 3ZBDA 3VJPA 1VQKA 4OMFB 3FRNA 3FLGA 2CZ0B 4MZMA 3MEVA 2E70A 2OTLA 2DL3A 3HFNA 1MV0B 3CC4A 3V7SA 1KC8C 4MMKA 4Q5WA 1M2OA 5FWBA 2DL8A 2QTVA 2VWFA 4M77D 3M0UA 2EFIA 2EYZA 3G7ZA 5KCOA 3JB9I 1YJWQ 2AZSA 4FT4A 1VQPA 2FRYA 1RADB 4XAXB 5FRNA 1Q82R 3O8VA 1H3ZA 3MHXA 2VKNA 3EAEA 2ENMA 3CMET 3QYHB 3HTRA 2A28A 4LD9K 3ASKA 3ER0A 4Z89A 4BE2A 2D8HA 1NZ9A 1Q7YU 1WDXA 1WQ7A 2F69A 2ATCB 1O75A 3EGUA 2KSSA 2ZPGB 4XQ3A 2QQSA 4RTWA 1PG5B 2XI9A 4BY6B 1K73U 2FL7A 5LJ5d 5GAMe 1M90C 1H3HA 4IIMA 5GANf 4XTVA 2DXBA 3LGFA 3LLRA 1M9SA 2JOYA 2QEXQ 1YIJQ 3CCUQ 1LCKA 1X43A 3QSUA 1S72Q 4HCKA 5GMKh 1QCNA 3SWNB 2COYA 2X4WA 2KVQG 4M75E 2LC4A 3AHUA 2R5MA 1C0MA 1HXDA 2HQXA 3CCMQ 2OX7A 2FZKB 1VIFA 3V8JA 4RG2A 2K2MA 2X3WD 2CP7A 4XU2A 3OYFA 4M75G 1GRIA 4ZGEB 1WXUA 3J7AF 3TSZA 4J9BA 2RQVA 4A4KA 4CC4B 2HMAA 2E1HA 3EHRA 3CCEQ 4J9DA 5HY6A 2E41A 4LDXA 4QT7A 1KHIA 3FEOA 4ESRA 1MGQA 1VQ7Q 1EX4A 1UUEA 3CCRQ 4JRPA 3SFMA 1HSQA 2GQVA 2C0IA 2E12A 4ELYC 1QMCA 4PKCC 4HT9A 5ECAA 5GAOm 1BK2A 2E6ZA 1OQKA 1GCQC 4KT0E 1G3YA 8ATCB 2P0KA 2J7IA 2FZCB 3SDZA 1VQ8Q 2YUQA 2CYZB 2DFUA 4UC4A 1VQ5A 3EH1A 4M77C 5L23A 3CCVQ 3SEMA 2L8DA 2WSEE 5LJ5g 5GAMd 1NG2A 4B9WA 3S3MA 1UGRB 3OS5A 3X25B 1ZLMA 2DK3A 3CBMA 2RM4A 4E2FB 4CRIA 5LJ5h 5GAOr 2AHJB 3TSWA 5IH2A 1PD1A 1JB0E 1ABOA 3H41A 3G6EQ 3EH2A 1MMGA 3KFVA 2HSEB 1TG0A 5CKEA 2HQEA 3T9NA 2NUZA 3QDFA 5FU7C 3QZ9B 3OB9A 1SEMA 1Q7YC 4RTXA 3VUBA 1AWOA 4O5VA 2EGEA 5GAN8 2K79A 2A37A 1K73C 4DEYA 4DA4A 2DETA 1IZ6A 3M58A 5D7UA 5AYFA 4M75A 2O31A 3C94A 3UA7A 4EMKC 1DJ7B 1G8XA 3OMCA 3RMQA 2E4HA 1VQ6A 4BE0A 4JRKA 3CC2T 2DIQA 4LDUA 3JCMQ 2MWOA 2XK0A 4FM4B 5GMKi 2GGRA 2XMFA 4M7AF 1OZ2A 5KYXA 1UGSB 4AT1B 4Y92A 4RCBA 4C92A 3CXCP 2DL7A 1KC8R 1ZSZB 2E65A 5GANj 2J6FA 1ZA2B 3QIIA 2DTHA 1NEGA 3NTIA 2QA4Q 2DMOA 2WACA 2Y4XA 2M0YA 3VYHB 2LDMA 4A54A 5FRMA 2RHYA 2AZVA 4GBQA 4DEXA 5LJ3e 5GAMg 5IHKA 3OYNA 4JDSA 2I2LA 2FPEA 2CP5A 2JMAA 2E64A 1M5Q1 4M7AB 5GAMh 2LJ1A 1QWFA 5CO7A 3CC7Q 4X1VA 1SHFA 4EMHA 5KH6A 2DRMA 3EG3A 2LQNA 4RUGA 2C06A 4IURA 2QYZA 4B6MA 4NL2A 1M90R 2DX1A 4PLIA 2O9SA 3E1SA 3NTHA 4JPBW 2VUBA 5GAOn 3GNFB 1SSHA 3IQLA 3H0FA 4E7LA 2FEIA 4KUDK 2K5FA 1AEYA 3M0SA 1UJ0A 1T0HA 1YJ9Q 2FYKA 4NS5A 5KYYB 2RQRA 4F7UF 4J9HA 3ZEHA 1OV3A 2Y90A 2RO0A 1YITT 2YRCA 4HA8A 3LH5A 4FSSA 5D6YA 1YJNQ 4N0AC 3CEYA 3M55A 5CCAA 3OYYA 3I55T 2KAFA 1T0JA 1UEBA 1KJWA 1G3WA 4C0FA 1WXBA 2XICA 2QQBA 5GAN3 1AHJB 2MYSA 4X9DA 1I5OB 2V1RA 3META 2KT8A 3OBYA 5CAIA 2LCSA 2QEXA 1YIJA 1WFWA 3CCUA 7AT1B 4M7DC 1I0CA 4Y28E 1S72A 2XKOC 1IGQA 3S6WA 4DBQA 3OYHA 4LNPA 4F7UB 2PVDB 1YI2Q 2EBPA 1M2VB 4A63B 2K3BA 1G3SA 2RH2A 2EGCA 1XJWB 2EQIA 1ZBXA 2LTOA 1OPLA 3OSVA 3SWNA 1X69A 2K2VA 1NE8A 4ZNXA 4A4GA 4F17A 2VASA 3CQTA 2XD0A 2QQRA 1QVFP 1VQ9T 1AT1B 1D0ZA 2HZYA 3CCEA 4C8QD 2GFUA 3RERA 5D6WA 4KGZB 5GAN7 2HSPA 4C0ZA 1VQ7A 1W6XA 4KGVB 1D0YA 1H92A 1JJ2P 3CCRA 3OS2A 1QCOA 2AT1B 1OYXA 1I5LA 2CP6A 4ME7A 4JLGA 1A0NB 4BI4A 3CCSQ 3OW2S 2ZPEB 5GAN5 3FJPA 1X6BA 3P8BB 3PVLA 3RBBB 2EQJA 2HEQA 2YUPA 3CBOA 3M59A 1Q7YR 2SRCA 1FX7A 1O9SA 4A4EA 3CCJA 4C5HA 4PJOD 1JU5C 1QVGS 1VQ8A 4GLMA 1K73R 1WYXA 3OYCA 3R6OA 1UE9A 1VQNQ 4KUIA 4M7AE 2J06A 1W2BP 4C5EA 1Y57A 2KY9A 2KXDA 3CC4T 1AD5A 3CCQT 3PFSA 5GMKe 3EGDB 3HRUA 1YWPA 4FIBA 2K5LA 2L3SA 1JBMA 4LE9A 4M7AG 2E5QA 2HBWA 1UGQB 1X2QA 4EDUA 2CUBA 5LJ3g 2DM1A 2NLUA 2DD4A 3FB9A 3QXEB 3I56Q 5LJ3h 3GLXA 4IUPA 1VQMQ 2EJFA 2L3PA 3A8HB 4AG1C 4JLIA 1V76A 2KMTA 5J26A 3UA6A 2O4XB 2IG0A 1VQ4T 2EJ9A 4D8DA 3H0HA 3HL8A 1M8MA 1NLPC 2KYMA 4XK8E 2KROA 3S3OA 1TUGB 4FYYB 1SF9A 3PE0A 2AKLA 3EG1A 2MIOA 4M77F 1UG1A 4BACA 2HBPA 3OYAA 3JAME 4F04B 3A98A 1D3BB 3KBGA 1BU1A 2F5KA 4EIKA 3EG9B 1SSFA 2ZCFB 4IUTA 3TVTA 3V7CA 4F7UE 1X27A 2K3XA 1UTIA 4C8QC 1N9RA 4IKFA 3MEWA 4OGEA 2ZAEA 1QWEA 2FHDA 1YFNA 5D6XA 3CMEQ 1WJQA 2LJ3A 1ZSZA 1ABQA 4M77B 5CIUA 4QW2A 3OY9A 3G4SA 1VUBA 4F7UG 6AT1B 1BI1A 1WX6A 1WIEA 1KQ2A 3UF4A 4M78F 3LW5E 3RUXA 2JXBA 3OYJA 5LJ5e 4LUEA 2MAMA 1VA7A 2ZPBB 4C5GA 2JMCA 2Y4YA 2BZ8A 2KYBA 2HQHA 4RTUA 4PJOC 4OGCA 1I1JA 2KNBB 4M7AA 2QXFA 4V2SA 1HJDA 2QK0A 3EG0A 4E7HA 3I56T 3M5AA 1WPYA 1RLPC 1M1GA 5CQXA 2L5QA 3JCMJ 3I9QA 2DIGA 2YRDA 3MEAA 4M78B 3JB9F 3WXMB 1OZ3A 4BDZA 1VQ5T 1M3AA 1YJ9A 4LDWA 1MNEA 3O5ZA 4EMKB 2BZYA 4HCCA 3URGA 5J39A 2LX7A 1YJNA 1UHCA 2A36A 4M75D 3OYLA 3RKWA 1W1FA 5KYYA 2ROLA 2RN8A 1SRMA 2K7AA 1RAAB 4R55A 2LNHB 3WVEB 3LX7A 1YP5A 1ARKA 4ZGJB 1UECA 3GOXA 1KD1U 1K9AA 3VS7A 5KYUB 2YXYA 2MMPA 2MOXA 1Y96B 1NPPA 2F5TX 2EJGA 3EFOB 1MMAA 3RKXA 4OMNA 4FSXA 1YI2A 1JEGA 2X4YA 2JW4A 1KG1A 3HRTA 2VC8A 2XIDA 1N6AA 2AK5A 1G5VA 4F7UA 3X26B 2DAQA 2CT4A 4E7KA 1M2VA 2DVEA 4IUVA 2ROTA 2KRNA 5GANd 5FU6C 2G6FX 2JT4A 4RTYA 2L89A 1PKSA 4OB0B 5DM7R 3M4GA 2DYIA 3VRYA 2D8JA 3JCMV 2FPDA 3DKMA 2RMOA 1M27C 1YN8A 2GNCA 4BDYA 3OYGA 1JRIA 2OTJT 3M0RA 5I21A 2DL5A 2CGHA 1K76A 1M1FA 3CCSA 4M7DF 3L2RA 2E3HA 1QLYA 4R56A 2E10A 3C12A 1UGVA 1VQOT 2RJFA 2XG8D 4ORZA 4C92E 1BI2A 2JZ2A 1RAFB 3HFOA 2C0TA 5IHNA 2M02A 3TREA 3M0QA 3V8LA 1PSFA 1VQNA 2EQKA 2FG0A 3CC2Q 5GAOl 4J8OA 3CCLT 1X6OA 4GLKA 3CMAT 4C92G 5GAOq 1WHKA 2YLBA 2DNUA 2X35A 2VVKA 3H9NA 4M7DB 1JQQA 1ZUUA 1ZA1B 3OBWA 1VYVA 4M75C 1PM3A 1QVFA 3EGDA 4M78E 3GNGA 3A1PA 2PUKB 3M0PA 2KRMA 5A0GA 1VQMA 2YRVA 2CDTA 4MZPA 2W10A 4ATOA 1C6VX 5HK0A 3M56A 1JJ2A 2GTJA 5GANg 4OMMA 4P5NA 3VS3A 1RI9A 1RAIB 3OYDA 4M78G 4OMOA 1UFFA 2RD1A 1I07A 5CKBA 3WVDB 2MK5A 5GANh 1UB4A 4E7ZA 1E6GA 4IUQA 3OYEA 1JXOA 3G71T 2ZPIB 4L5GA 1TUCA 3JSCA 2YT6A 4MMLA 1N8RU 1YBYA 3M0TA 1WHJA 4OB1B 3L2UA 3CD6T 1OU8A 1AWXA 2HKQB 4FYWB 2KGTA 1K9MU 1QCFA 4NL3A 2DKGA 1NYFA 1KQSP 1D3BA 2DD5A 1OI1A 2A7YA 1V1CA 5FW9A 3GIBA 3EG9A 2K57A 1T3SA 3JB9G 4FL6A 2CZ7B 3J80E 1B07A 1YITQ 4EMGA 4XU1A 5A0LA 2IPOB 1GCQA 4OMQA 2JTMA 3I55Q 1BB9A 4E7JA 2KE9A 3PIOA 1U3OA 2EYWA 3OYMA 5IXBA 4M77A 4RMOA 1OULA 2HAXA 3L2ZA 1NM7A 4C0DB 1RLQC 5HCKA 1FYNA 2RK2A 2NYSA 4WTOB 2VXEA 2DJZA 3PGGA 1AOJA 1LOJA 1UJYA 4FYVB 4J7IA 2X9HA 2O2OA 3NFCA 5KE2A 3CPWS 2RF0A 1OEBA 4ZTJA 1VQLT 4EPCA 3CCJT 2EYYA 3V8KA 4C8QF 2QASA 2LCLA 2EW3A 1M3BA 3MKDA 3H0IA 1Y71A 2BKDN 5KYNA 1VQ9Q 2LQKA 4M78A 2O88A 1TWBA 5A0DA 2JTEA 4Z02A 4FYXB 4NOYA 2AKKA 2VXFA 4HVUA 4EMKA 4FU6A 5IHIA 4KH1B 1D1CA 3X28B 2EKHA 2DTOA 2FPFA 1R0BG 1YHQT 2DJQA 1YJWA 1PNJA 4M7DE 4Z88A 2RHZA 3G1JA 4HCZA 2EKOA 1PWTA 1GXIE 4C8QB 4PJOF 3TCJA 3DB3A 4J9IA 1U1SA 2BTTA 3KXTA 2DZ9A 4ZTFA 2L3RA 1BCMA 4M7DG 1WLPB 1Y0MA 5KYUA 2GTOA 1WHLA 4KRTA 5J3BA 1Y96A 2P84A 1N8RC 3EFOA 4TVRA 1W4SA 2OTLQ 2A08A 4QVCA 3MP6A 2JVVA 1QKXA 3R6NA 3CC4Q 2D6FA 1K9MC 3CPWA 3CCQQ 2VB6A 4PJOB 1ZQ1A 2YDLA 3M57A 2V8JA 2M1HA 4E47A 2WSCE 5C6SA 3VUZA 4JS4A 2CT3A 4BI3A 4M7AD 1AWWA 3CCMA 2EVRA 4QQDA 2DBKA 4C0GA 1FMKA 2KQWA 4JZ4A 1W70A 1VQ4Q 2LQWA 3G4ST 2KEAA 4M4ZA 2D9TA 2JM9A 2KXCA 1K4US 2KK4A 1TXQA 3UDCA 1M8VA 3RESA 1BCOA 3JB9J 5LL6S 2D0NA 1VOMA 3E19A 3E2UA 1S1NA 5FWCA 2IIMA 3BDUA 3CC2A 2RJCA 3M4YA 4ZN3A 1OOTA 2J6KA 1SG5A 2NUTB 4N0AA 3DLLA 1OPKA 2DBMA 1JXMA 4J6YA 2DXTA 3I5SA 1AZGB 4PFOA 3UT1A 3OS1A 1YCYA 5AT1B 4WCIA 1KHCA 2P4RA 1AZEA 3GP8A 2E5KA 2OAUA 2RQUA 2X4XA 4DOWA 3EFSA 4JS5A 1GBRA 2OI3A 2ZPHB 3N5BB 2Z0WA 4LN2A 4M7DA 4J6XA 4XTYA 1VQKT 3CCVA 2VGMA 1XQHA 1BBZA 4AFUC 2OTLT 2RI5A 3VU3C 3AT1B 3ZFJA 1M1KU 2LCCA 2KDSA 3VYGA 4AFZC 1Z9ZA 1WHGA 2K5IA 3QWXX 1KIKA 3RIRA 4CI0C 2RHUA 4QVDA 2OAWA 1U5SA 2YWWA 1R77A 3G6EA 1VQPT 3VKIA 2CP0A 1WXTA 1N9SA 2R58A 4JJDA 1ZSGA 2EYQA 3JCMf 4C8QE 3EGXB 4L59A 1IRXA 3MEUA 4F16A 2JN0A 2ED0A 4LDVA 4J7FA 1WQWA 1VQ5Q 3P8DA 2CH4W 2FVUA 1VIEA 3RR6A 5I22A 2KR3A 2X4JA 2P0PA 1YITA 2PU9B 5M9OA 1PKTA 4BD3A 2MPXC 3LGLA 2DVJA 2IVWA 1NJIU 1OU9A 2RK1A 5DLQE 3I55A 4XTWA 1H641 3GBQA 2HL3A 4PLLA 4DBFA 3CXCS 4OP0A 1U06A 3OYKA 4FW1A 1Q95G 1X6GA 4PJOE 1B3QA 5DY9A 2QA4A 2F2XA 2CUDA 2JM8A 3FDRA 3HP9A 1FXXA 4XTZA 2GFAA 4KULA 1XOVA 4LDYA 2RPNA 3BW1A 2FZGB 2MI6A 2OJ2A 4L6V5 2V26A 4E6RA 1QVPA 4OMLA 2QGGA 2LQ8A 1EZZB 4PFPA 2CSQA 3CC7A 1XTDA 2RB6A 5CVIA 5GANe 1HD3A 1VQ9A 4A53A 2YSQA 1N8RR 1ZUKA 1KQSA 3NMZC 5DLOA 2F1LA 2MCNA 1N5ZA 4K11A 3FIFA 1TSFA 1K9MR 5FU7B 1RABB 2QI2A 1K0XA 4RCCA 1T3LA 1WJRA 3OS0A 4A4FA 2OTJQ 4PK4A 3NTKA 2XDDA 1M1KC 3F70A 3Q1JA 2O01E 2DXUA 2QQAA 1X75C 5CK9A 3CXCA 2K6DA 1VQOQ 2EYXA 2FRWA 1ZHIA 3E9GA 2CZ6B 3MP1A 5CKDA 3JB9H 2DXCA 3BE3A 1KK7A 3LYIA 4C8QA 1YNZA 3L2WA 4RKUE 2NWMA 4ANJA 3PMIA 3P8HA 1UDLA 1X01A 2E3IA 4QKUA 3CCLQ 1NEBA 3INZA 2QDLA 1NYGA 1QQJA 3CMAQ 2LVMA 2RI3A 3CPFA 5L8RE 3QO3A 3CCQA 3LH0A 2X51A 2DYBA 2DILA 2RHXA 3OYBA 1KFZA 3QKJA 4FT2A 1K1ZA 1FMWA 3GF5A 2V1QA 4BUGA 3QJ6A 4C92D 3HHTB 1CKAA 4JRQA 1ACMB 2L2PA 4JZ3A 4PJOA 1EIFA 2ZPFB 1LNXA 1TS9A 1EFNA 1NJIC 2COWA 5IAYA 3C95A 1E7OA 1QVFS 4QQ6A 1VQ6T 2RQWA 1UHFA 1WI7A 1R0CB 2MF2A 1VQ4A 1P92A 1MMDA 3VS2A 2ED1A 4PFZA 5LJ5f 3JV3A 3RKYA 2M51A 2JTFA 2GBQA 4CC2A 1JJ2S 3G71Q 3M54A 3QJYA 3L2VA 4M78D 4PJJA 3HPWA 1BYMA 2FB7A 2V8KA 3CD6Q 1IGUA 2J05A 1JO8A 1WHMA 3QWYA 1I8FA 2RA2A 3BY7A 1WNLA 3RMSA 4D8KA 1M30A 2A3LA 1UGPB 3H8ZA 4M77E 2DO3A 4PJLA 4VUBA 4JRIA 2B86A 4ZGDB 2NUTA 1RAEB 4A4HA 4J83A 4J6WA 3M53A 4O6JA 1MMNA 1W2BS 2LT4A 2QAZA 1Q81U 1LPLA 3JB9D 4M77G 1QP2A 4DQ2A 5CKFA 2YHTA 3S3NA 3OYIA 5C0MA 5GMKl 2RJEA 3PMTA 1BI0A 2EWNA 4WF2A 8AT1B 3KUFA 1Q86U 3TQ7P 2KRSA 4F14A 5GMKm 1E6HA 2R5AA 2XHCA 1VYUA 1CSKA 2DLPA 2DPPB 4ELZC 1YJWT 3EHQA 2L0AA 5GJVB 2BE7D 2LJ0A 1M4ZA 4MDXA 3I56A 5GMKj 4Z8AA 2QGFB 1K8AU 3ME9A 4J9GA 3BDLA 3OW2P 5KYWB 3OMGA 1MNDA 1VQLQ 1TH7A 2DE0X 3CCJQ 3JCMP 3UPUA 3EFRA 2CKKA 2NUPB 4PNOA 5GAMf 1KD1C 3M9QA 4C92C 1QVGP 3EGXA 2O4XA 1B34B 4RTTA 4BB7A 5GAOp 2M9UA 3NGPA 1OX9A 1GFCA 2DL4A 1J3TA 2LNVA 2EIFA 2WSFE 2LP5A 1R8OB 2GCXA 1NPRA 4E7SA 5IXFA 2QEXT 1YIJT 3CCUT 3JRZA 2EQMA 2GF7A 1TTHB 2CP3A 1S72T 4J9FA 4XU3A 1IXDA 4XTXA 4J9CA 1QKWA 1RAGB 4JJBA 1YHQQ 3UWNA 5KCHA 3OQ5A 1KQ1A 1W2BA 1Z9QA 1C1AA 2QDYB 2JS0A 3A8OB 3CCMT 2DEQA 1FWZA 3CMEA 4OVAA 2C0OA 3PTAA 2H8HA 1I4K1 2K3YA 1XNIA 4M78C 2BE9B 4RTZA 1WHHA 1M1KR 4MDWA 3C4SA 2X3XD 3CCET 1G3TA 2KI7A 1BIBA 3SHWA 3VS5A 1GL5A 1IB8A 4IIOA 1PD0A 4M7DD 1RI0A 4KGXB 1U8RA 4XTUA 1VQ7T 2F2WA 4CC7A 3DLMA 4FW2A 4C5IA 4HT8A 3CCRT 1KSWA 4DOVA 1ZBJA 3PVQA 4X9CA 3BFMA 4CC3A 2SEMA 2AIRB 3ULRB 5IT9E 5LJ5j 1QP3A 3C0CA 3D7SB 1AVZC 4AG2C 3RNJA 1D1BA 1Q81C 2OTJA 1VQ8T 2ABLA 4BI8B 1Q82U 4E7IA 2GQIA 2VGNA 3CCVT 2EQUA 2KT1A 2JUFA 3G4SQ 2W0ZA 1HYOA 3CBPA 3QPHA 1Q86C 1VQOA 1NJIR 1IREB 4BY6C 5I2SA 2H3JA 1ZX6A 2HDAA 5I2MA 3X20B 2HCKA 4OMPA 2MWPA 3UATA 5IN1A 1LJOA 2YLCA 1PC0A 3CCLA 3REBB 3QDRB 3G6ET 3GPLA 3SWNC 1PRMC 3VS6A 1K8AC 1AWJA 3CMAA 3VS4A 1HK9A 4JJCA 4GY5A 2XDBA 1Y07A 3TU4K 2R57A 3FC3A 2ZGWA 4B9XA 1K0SA 1NLOC 1D09B 4OB3B 4LD6A 5GAN6 1TOVA 3QYGB 1I81A 4N4IA 3RDVA 1OX8A 4DBRA 2JS2A 3QZ5B 4JJNK 1VQKQ 3NHNA 2CSIA 2E6NA 1G83A 1PCXA 2COZA 2EAYA 9ATCB 3LWHA 4PJMA 2H3EB 3HSBA 2LRQA 2YUOA 2DF6A 5EC7A 5GAMj 2RQTA 3G71A 1IHWA 1VQPQ 2A0FB 3I35A
chains in the Genus database with same CATH topology
3GBQA 2K79A 2A37A 4DEYA 1U06A 2ROTA 4AFSC 2KRNA 1X6GA 3VS0A 2O31A 2EGAA 2G6FX 2JT4A 4RTYA 1B3QA 1PKSA 3UA7A 2PTKA 1MV3A 3EG2A 3VRYA 2D8JA 4HVVA 1G2BA 2F2XA 2CUDA 2JM8A 2FPDA 1PHTA 1XOVA 2RMOA 1M27C 2RPNA 1YN8A 2GNCA 2GGRA 2XMFA 2OJ2A 1M3CA 4E6RA 4Y92A 1GBQA 3M0RA 4OMLA 2DL5A 2DL7A 1K76A 1RUWA 2CREA 1QLYA 2CSQA 2J6FA 2ECZA 2KBTA 1NEGA 1UGVA 2DMOA 1HD3A 4ORZA 2M0YA 3VS1A 1VYTA 1X2KA 2YSQA 3REAB 1ZUKA 2AZVA 4GBQA 4DEXA 3NMZC 2C0TA 5IHNA 2MCNA 1N5ZA 4K11A 5IHKA 3M0QA 1YWOA 2DA9A 2F2VA 2FG0A 2JMAA 2FPEA 1K0XA 1GFDA 4HXJA 1TUDA 5I11A 1T3LA 1QWFA 2LJ1A 2L3QA 4X1VA 1SHFA 3FJ5A 2DRMA 1SRLA 2LZ6B 3EG3A 2DNUA 2LQNA 2VVKA 4RUGA 1SPKA 1JQQA 2D1XA 1ZUUA 4R0KA 2DX1A 1VYVA 2K6DA 2EYXA 2O9SA 2FRWA 4JPBW 1ZUYA 2EPDA 1SSHA 1YNZA 3M0PA 3IQLA 3H0FA 1IO6A 2KRMA 2NWMA 2BZXA 2CDTA 2FEIA 2W10A 1UDLA 2FO0A 2GTJA 1AEYA 3M0SA 4OMMA 1UJ0A 1T0HA 1SHGA 1NEBA 2QDLA 1NYGA 2CH4A 2RQRA 3VS3A 1RI9A 4J9HA 1OV3A 4LUDA 4OMOA 3VRZA 1UFFA 1I07A 3LH5A 1E6GA 2DYBA 2DILA 1JXOA 1KFZA 4AFQC 4FSSA 1K1ZA 2V1QA 1TUCA 2YT6A 3I5RA 2LMJA 1CKAA 1T0JA 3M0TA 1KJWA 1MUZA 2RNAA 2L2PA 1WXBA 4JZ3A 1AWXA 1EFNA 2KGTA 1QCFA 2V1RA 2KT8A 2LCSA 1E7OA 1NYFA 1WFWA 1I0CA 2RQWA 1UHFA 1WI7A 1V1CA 5FW9A 4LNPA 1T3SA 2PNIA 2YUNA 3VS2A 2ED1A 2EBPA 3THKA 4A63B 1B07A 1PRLC 3JV3A 2K3BA 2M51A 2EGCA 2GBQA 2O9VA 2EQIA 4CC2A 1GCQA 1OPLA 4OMQA 2J6OA 1BB9A 1X69A 2KE9A 1U3OA 2EYWA 2PZ1A 2K9GA 4ZNXA 1YCSB 2J05A 5IXBA 2DRKA 4F17A 1JO8A 1GCPA 3QWYA 3CQTA 4RTVA 1NM7A 1RLQC 5HCKA 4D8KA 1FYNA 1M30A 2B86A 2HSPA 1AOJA 1UJYA 1W6XA 1H8KA 1H92A 3NPFA 2O2OA 1WA7A 2RF0A 1OEBA 1A0NB 3ZL7C 2EYYA 4HVWA 1X6BA 3PVLA 2EW3A 1M3BA 3RBBB 2HEQA 2YUPA 3U23A 3H0IA 2SRCA 2O88A 2KRSA 1CKBA 4F14A 1JU5C 4GLMA 1E6HA 2JTEA 1WYXA 1VYUA 1CSKA 2DLPA 3EHQA 2L0AA 1UE9A 2AKKA 5GJVB 4HVUA 2J06A 5GJWB 2LJ0A 5IHIA 2EKHA 2ESWA 1Y57A 2FPFA 2I0NA 2KXDA 4J9EA 4Z8AA 2DJQA 1PNJA 1AD5A 4J9GA 4Z88A 2DL3A 1YWPA 1PWTA 2DE0X 2L3SA 4LE9A 1MV0B 2HBWA 1X2QA 2CUBA 4J9IA 2BTTA 2DM1A 5FWBA 2DL8A 4RTTA 2VWFA 1WLPB 1Y0MA 3NGPA 3M0UA 1GFCA 2DL4A 1J3TA 2EYZA 2GTOA 4KRTA 2LP5A 2L3PA 2AZSA 4AG1C 5IXFA 3UA6A 4J9FA 2FRYA 4D8DA 3H0HA 2A08A 4J9CA 1QKWA 1M8MA 1NLPC 2KYMA 4JJBA 2KROA 1QKXA 3R6NA 2VKNA 2ENMA 3PE0A 2AKLA 1Z9QA 2A28A 3EG1A 2MIOA 4Z89A 2JS0A 2D8HA 1UG1A 2YDLA 1WDXA 3EGUA 2C0OA 2H8HA 3A98A 4RTWA 1BU1A 1H3HA 4RTZA 4IIMA 4EIKA 2CT3A 1AWWA 2EVRA 2X3XD 2DBKA 1FMKA 3TVTA 3VS5A 3SHWA 1LCKA 1X27A 1GL5A 1X43A 4JZ4A 1UTIA 4IIOA 1W70A 4HCKA 2LQWA 2F2WA 4CC7A 1QWEA 2KEAA 4M4ZA 2JM9A 2LJ3A 2KXCA 1KSWA 1K4US 1ABQA 1ZBJA 3PVQA 4CC3A 1WX6A 1WIEA 2SEMA 2D0NA 3UF4A 3ULRB 1S1NA 5FWCA 2IIMA 2K2MA 3C0CA 2X3WD 1OOTA 2J6KA 2JXBA 4LUEA 1GRIA 1WXUA 1AVZC 3TSZA 1VA7A 4J9BA 4AG2C 2RQVA 3RNJA 1OPKA 4CC4B 2DBMA 2JMCA 3EHRA 1JXMA 2ABLA 4J9DA 3I5SA 1AZGB 2BZ8A 2KYBA 4QT7A 4RTUA 4WCIA 2GQIA 2P4RA 1AZEA 1I1JA 2KNBB 2E5KA 2RQUA 4ESRA 2KT1A 2W0ZA 1HJDA 1GBRA 1UUEA 2OI3A 3EG0A 1RLPC 4LN2A 1HSQA 2C0IA 1ZX6A 2HDAA 2HCKA 1BBZA 4OMPA 3UATA 3I9QA 4AFUC 5ECAA 1BK2A 1GCQC 1M3AA 3REBB 4AFZC 1Z9ZA 1PRMC 3VS6A 1AWJA 3VS4A 3O5ZA 3QWXX 2J7IA 4JJCA 1KIKA 2BZYA 2YUQA 2OAWA 1U5SA 2LX7A 1UHCA 1K0SA 1NLOC 2A36A 5L23A 1W1FA 3SEMA 2ROLA 2RN8A 1SRMA 1NG2A 1WXTA 2K7AA 1ZLMA 4JJDA 2JS2A 1ZSGA 2LNHB 1YP5A 3NHNA 1ARKA 2CSIA 1UECA 4F16A 1G83A 3TSWA 5IH2A 2ED0A 1K9AA 3VS7A 2MOXA 1ABOA 3H41A 2CH4W 3KFVA 5I22A 2KR3A 4OMNA 1TG0A 1JEGA 2JW4A 2NUZA 2YUOA 2AK5A 1SEMA 2DF6A 5EC7A 2RQTA 1PKTA 4RTXA 2DVJA 1AWOA 2CT4A 2EGEA 3I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  2K79 A;  2A37 A;  4DEY A;  1U06 A;  2ROT A;  4AFS C;  2KRN A;  1X6G A;  3VS0 A;  2O31 A;  2EGA A;  2G6F X;  2JT4 A;  4RTY A;  1B3Q A;  1PKS A;  3UA7 A;  2PTK A;  1MV3 A;  3EG2 A;  3VRY A;  2D8J A;  4HVV A;  1G2B A;  2F2X A;  2CUD A;  2JM8 A;  2FPD A;  1PHT A;  1XOV A;  2RMO A;  1M27 C;  2RPN A;  1YN8 A;  2GNC A;  2GGR A;  2XMF A;  2OJ2 A;  1M3C A;  4E6R A;  4Y92 A;  1GBQ A;  3M0R A;  4OML A;  2DL5 A;  2DL7 A;  1K76 A;  1RUW A;  2CRE A;  1QLY A;  2CSQ A;  2J6F A;  2ECZ A;  2KBT A;  1NEG A;  1UGV A;  2DMO A;  1HD3 A;  4ORZ A;  2M0Y A;  3VS1 A;  1VYT A;  1X2K A;  2YSQ A;  3REA B;  1ZUK A;  2AZV A;  4GBQ A;  4DEX A;  3NMZ C;  2C0T A;  5IHN A;  2MCN A;  1N5Z A;  4K11 A;  5IHK A;  3M0Q A;  1YWO A;  2DA9 A;  2F2V A;  2FG0 A;  2JMA A;  2FPE A;  1K0X A;  1GFD A;  4HXJ A;  1TUD A;  5I11 A;  1T3L A;  1QWF A;  2LJ1 A;  2L3Q A;  4X1V A;  1SHF A;  3FJ5 A;  2DRM A;  1SRL A;  2LZ6 B;  3EG3 A;  2DNU A;  2LQN A;  2VVK A;  4RUG A;  1SPK A;  1JQQ A;  2D1X A;  1ZUU A;  4R0K A;  2DX1 A;  1VYV A;  2K6D A;  2EYX A;  2O9S A;  2FRW A;  4JPB W;  1ZUY A;  2EPD A;  1SSH A;  1YNZ A;  3M0P A;  3IQL A;  3H0F A;  1IO6 A;  2KRM A;  2NWM A;  2BZX A;  2CDT A;  2FEI A;  2W10 A;  1UDL A;  2FO0 A;  2GTJ A;  1AEY A;  3M0S A;  4OMM A;  1UJ0 A;  1T0H A;  1SHG A;  1NEB A;  2QDL A;  1NYG A;  2CH4 A;  2RQR A;  3VS3 A;  1RI9 A;  4J9H A;  1OV3 A;  4LUD A;  4OMO A;  3VRZ A;  1UFF A;  1I07 A;  3LH5 A;  1E6G A;  2DYB A;  2DIL A;  1JXO A;  1KFZ A;  4AFQ C;  4FSS A;  1K1Z A;  2V1Q A;  1TUC A;  2YT6 A;  3I5R A;  2LMJ A;  1CKA A;  1T0J A;  3M0T A;  1KJW A;  1MUZ A;  2RNA A;  2L2P A;  1WXB A;  4JZ3 A;  1AWX A;  1EFN A;  2KGT A;  1QCF A;  2V1R A;  2KT8 A;  2LCS A;  1E7O A;  1NYF A;  1WFW A;  1I0C A;  2RQW A;  1UHF A;  1WI7 A;  1V1C A;  5FW9 A;  4LNP A;  1T3S A;  2PNI A;  2YUN A;  3VS2 A;  2ED1 A;  2EBP A;  3THK A;  4A63 B;  1B07 A;  1PRL C;  3JV3 A;  2K3B A;  2M51 A;  2EGC A;  2GBQ A;  2O9V A;  2EQI A;  4CC2 A;  1GCQ A;  1OPL A;  4OMQ A;  2J6O A;  1BB9 A;  1X69 A;  2KE9 A;  1U3O A;  2EYW A;  2PZ1 A;  2K9G A;  4ZNX A;  1YCS B;  2J05 A;  5IXB A;  2DRK A;  4F17 A;  1JO8 A;  1GCP A;  3QWY A;  3CQT A;  4RTV A;  1NM7 A;  1RLQ C;  5HCK A;  4D8K A;  1FYN A;  1M30 A;  2B86 A;  2HSP A;  1AOJ A;  1UJY A;  1W6X A;  1H8K A;  1H92 A;  3NPF A;  2O2O A;  1WA7 A;  2RF0 A;  1OEB A;  1A0N B;  3ZL7 C;  2EYY A;  4HVW A;  1X6B A;  3PVL A;  2EW3 A;  1M3B A;  3RBB B;  2HEQ A;  2YUP A;  3U23 A;  3H0I A;  2SRC A;  2O88 A;  2KRS A;  1CKB A;  4F14 A;  1JU5 C;  4GLM A;  1E6H A;  2JTE A;  1WYX A;  1VYU A;  1CSK A;  2DLP A;  3EHQ A;  2L0A A;  1UE9 A;  2AKK A;  5GJV B;  4HVU A;  2J06 A;  5GJW B;  2LJ0 A;  5IHI A;  2EKH A;  2ESW A;  1Y57 A;  2FPF A;  2I0N A;  2KXD A;  4J9E A;  4Z8A A;  2DJQ A;  1PNJ A;  1AD5 A;  4J9G A;  4Z88 A;  2DL3 A;  1YWP A;  1PWT A;  2DE0 X;  2L3S A;  4LE9 A;  1MV0 B;  2HBW A;  1X2Q A;  2CUB A;  4J9I A;  2BTT A;  2DM1 A;  5FWB A;  2DL8 A;  4RTT A;  2VWF A;  1WLP B;  1Y0M A;  3NGP A;  3M0U A;  1GFC A;  2DL4 A;  1J3T A;  2EYZ A;  2GTO A;  4KRT A;  2LP5 A;  2L3P A;  2AZS A;  4AG1 C;  5IXF A;  3UA6 A;  4J9F A;  2FRY A;  4D8D A;  3H0H A;  2A08 A;  4J9C A;  1QKW A;  1M8M A;  1NLP C;  2KYM A;  4JJB A;  2KRO A;  1QKX A;  3R6N A;  2VKN A;  2ENM A;  3PE0 A;  2AKL A;  1Z9Q A;  2A28 A;  3EG1 A;  2MIO A;  4Z89 A;  2JS0 A;  2D8H A;  1UG1 A;  2YDL A;  1WDX A;  3EGU A;  2C0O A;  2H8H A;  3A98 A;  4RTW A;  1BU1 A;  1H3H A;  4RTZ A;  4IIM A;  4EIK A;  2CT3 A;  1AWW A;  2EVR A;  2X3X D;  2DBK A;  1FMK A;  3TVT A;  3VS5 A;  3SHW A;  1LCK A;  1X27 A;  1GL5 A;  1X43 A;  4JZ4 A;  1UTI A;  4IIO A;  1W70 A;  4HCK A;  2LQW A;  2F2W A;  4CC7 A;  1QWE A;  2KEA A;  4M4Z A;  2JM9 A;  2LJ3 A;  2KXC A;  1KSW A;  1K4U S;  1ABQ A;  1ZBJ A;  3PVQ A;  4CC3 A;  1WX6 A;  1WIE A;  2SEM A;  2D0N A;  3UF4 A;  3ULR B;  1S1N A;  5FWC A;  2IIM A;  2K2M A;  3C0C A;  2X3W D;  1OOT A;  2J6K A;  2JXB A;  4LUE A;  1GRI A;  1WXU A;  1AVZ C;  3TSZ A;  1VA7 A;  4J9B A;  4AG2 C;  2RQV A;  3RNJ A;  1OPK A;  4CC4 B;  2DBM A;  2JMC A;  3EHR A;  1JXM A;  2ABL A;  4J9D A;  3I5S A;  1AZG B;  2BZ8 A;  2KYB A;  4QT7 A;  4RTU A;  4WCI A;  2GQI A;  2P4R A;  1AZE A;  1I1J A;  2KNB B;  2E5K A;  2RQU A;  4ESR A;  2KT1 A;  2W0Z A;  1HJD A;  1GBR A;  1UUE A;  2OI3 A;  3EG0 A;  1RLP C;  4LN2 A;  1HSQ A;  2C0I A;  1ZX6 A;  2HDA A;  2HCK A;  1BBZ A;  4OMP A;  3UAT A;  3I9Q A;  4AFU C;  5ECA A;  1BK2 A;  1GCQ C;  1M3A A;  3REB B;  4AFZ C;  1Z9Z A;  1PRM C;  3VS6 A;  1AWJ A;  3VS4 A;  3O5Z A;  3QWX X;  2J7I A;  4JJC A;  1KIK A;  2BZY A;  2YUQ A;  2OAW A;  1U5S A;  2LX7 A;  1UHC A;  1K0S A;  1NLO C;  2A36 A;  5L23 A;  1W1F A;  3SEM A;  2ROL A;  2RN8 A;  1SRM A;  1NG2 A;  1WXT A;  2K7A A;  1ZLM A;  4JJD A;  2JS2 A;  1ZSG A;  2LNH B;  1YP5 A;  3NHN A;  1ARK A;  2CSI A;  1UEC A;  4F16 A;  1G83 A;  3TSW A;  5IH2 A;  2ED0 A;  1K9A A;  3VS7 A;  2MOX A;  1ABO A;  3H41 A;  2CH4 W;  3KFV A;  5I22 A;  2KR3 A;  4OMN A;  1TG0 A;  1JEG A;  2JW4 A;  2NUZ A;  2YUO A;  2AK5 A;  1SEM A;  2DF6 A;  5EC7 A;  2RQT A;  1PKT A;  4RTX A;  2DVJ A;  1AWO A;  2CT4 A;  2EGE A;  3I35 A; 
#chains in the Genus database with same CATH topology
 4JUV A;  1WZO A;  3CD6 A;  4AFS C;  3A8M B;  3PNW C;  1PSE A;  3OSS C;  4PJN A;  2QA4 T;  3VS0 A;  2EGA A;  5A2Q E;  1QW1 A;  5LJ3 f;  3JCM e;  2PTK A;  1MV3 A;  1N27 A;  3EG2 A;  4Y91 A;  4HVV A;  1G2B A;  2RI2 A;  5LJ3 d;  4BE1 A;  2HKN A;  1PHT A;  5GAN 2;  2M0O A;  3J81 E;  2JJ9 A;  2XU8 A;  5CQY A;  2LT1 A;  4II1 A;  3CC7 T;  4AMC A;  1M3C A;  3X24 B;  1WJS A;  1GBQ A;  4YTL A;  1KD1 R;  1RUW A;  2CRE A;  2ECZ A;  2KBT A;  5FLX E;  3A8G B;  2CS7 A;  3MJX A;  2G3R A;  1VYT A;  1X2K A;  3JCM c;  3VS1 A;  4HCB A;  3REA B;  3VV0 A;  1Q82 C;  4HKE A;  1RAC B;  3L42 A;  3MO8 A;  3SB2 A;  1YWO A;  2JNG A;  5CR2 A;  2DA9 A;  2F2V A;  3QHS A;  1YJ9 T;  1GFD A;  4HXJ A;  1TUD A;  5I11 A;  4RG8 A;  2L3Q A;  3H6Z A;  3TEE A;  3FJ5 A;  1SRL A;  2LZ6 B;  1LVK A;  2K4Y A;  1VQL A;  1SPK A;  1YJN T;  5FU6 B;  2D1X A;  4DBH A;  2CZ1 B;  2HNI A;  4R0K A;  1MHN A;  4KH0 B;  5HK3 A;  2PQW A;  1ZUY A;  5KYW A;  1D0X A;  2EPD A;  3L2Q A;  3QBY A;  1B7T A;  2NUP A;  3DB4 A;  1IO6 A;  5GAN 4;  2BIV A;  2BZX A;  1NBE B;  3OA6 A;  1BKB A;  2FO0 A;  1ZSZ C;  4C0D C;  1B34 A;  1BIA A;  1SHG A;  1FMV A;  2CH4 A;  1KQS S;  3JCM d;  1KC8 U;  3A5Z B;  1YHQ A;  4LUD A;  3JCM X;  1YI2 T;  2DTI A;  1WGS A;  3VRZ A;  2XDP A;  1BI3 A;  2PUO B;  3E9F A;  1Y7X A;  4AFQ C;  4M75 F;  3QG1 A;  3I5R A;  4PL6 A;  2LMJ A;  4C8Q G;  1MUZ A;  2RNA A;  1Q81 R;  4X34 A;  2HD0 A;  1RAH B;  4M7A C;  1F1B B;  2QG9 B;  4QVZ A;  2P0Q A;  1Q86 R;  4LXC A;  3LWI A;  4N4G A;  5CKH A;  4OF1 A;  2PNI A;  2YUN A;  4C92 F;  3OW2 A;  3THK A;  2V8I A;  4XU0 A;  1PRL C;  2VV5 A;  2P4T A;  5FRO A;  2QQ9 A;  2O9V A;  1M90 U;  3MPU B;  2QTX A;  4MZT A;  4J5Y A;  4M75 B;  4D6W A;  3V7R A;  3MCA B;  3L1A A;  2J6O A;  1QVG A;  2CP2 A;  2LX9 A;  1K8A R;  1TU0 B;  3CCS T;  4PJO G;  4KBM B;  2ZZD A;  3JCM W;  2PZ1 A;  2K9G A;  3MP8 A;  4QQG A;  2D0Q B;  1YCS B;  2DRK A;  1GCP A;  4RTV A;  3HKS A;  3QUI A;  2VYT A;  4N4H A;  2PVG B;  5KYX B;  1VQ6 Q;  3PT9 A;  3JCM b;  2DEU A;  5LJ3 j;  1VQN T;  4C92 B;  1U1T A;  1H8K A;  5EG2 A;  3NPF A;  4FCY A;  4ZN1 A;  3SD4 A;  1WA7 A;  1D1A A;  4IUU A;  2RJD A;  3ZL7 C;  2DER A;  3JCM g;  4HVW A;  1V29 B;  3A8L B;  3U23 A;  5KE3 A;  2HL5 C;  2DZC A;  1RL2 A;  1IHV A;  5HKC A;  2PVO B;  1CKB A;  1SKU B;  3PIP A;  3JCM h;  3HRS A;  2B8A A;  2M16 A;  1VQM T;  2RHI A;  2BUD A;  5GJW B;  3CPW P;  2ESW A;  4OB2 B;  2I0N A;  4J9E A;  3ZBD A;  3VJP A;  1VQK A;  4OMF B;  3FRN A;  3FLG A;  2CZ0 B;  4MZM A;  3MEV A;  2E70 A;  2OTL A;  2DL3 A;  3HFN A;  1MV0 B;  3CC4 A;  3V7S A;  1KC8 C;  4MMK A;  4Q5W A;  1M2O A;  5FWB A;  2DL8 A;  2QTV A;  2VWF A;  4M77 D;  3M0U A;  2EFI A;  2EYZ A;  3G7Z A;  5KCO A;  3JB9 I;  1YJW Q;  2AZS A;  4FT4 A;  1VQP A;  2FRY A;  1RAD B;  4XAX B;  5FRN A;  1Q82 R;  3O8V A;  1H3Z A;  3MHX A;  2VKN A;  3EAE A;  2ENM A;  3CME T;  3QYH B;  3HTR A;  2A28 A;  4LD9 K;  3ASK A;  3ER0 A;  4Z89 A;  4BE2 A;  2D8H A;  1NZ9 A;  1Q7Y U;  1WDX A;  1WQ7 A;  2F69 A;  2ATC B;  1O75 A;  3EGU A;  2KSS A;  2ZPG B;  4XQ3 A;  2QQS A;  4RTW A;  1PG5 B;  2XI9 A;  4BY6 B;  1K73 U;  2FL7 A;  5LJ5 d;  5GAM e;  1M90 C;  1H3H A;  4IIM A;  5GAN f;  4XTV A;  2DXB A;  3LGF A;  3LLR A;  1M9S A;  2JOY A;  2QEX Q;  1YIJ Q;  3CCU Q;  1LCK A;  1X43 A;  3QSU A;  1S72 Q;  4HCK A;  5GMK h;  1QCN A;  3SWN B;  2COY A;  2X4W A;  2KVQ G;  4M75 E;  2LC4 A;  3AHU A;  2R5M A;  1C0M A;  1HXD A;  2HQX A;  3CCM Q;  2OX7 A;  2FZK B;  1VIF A;  3V8J A;  4RG2 A;  2K2M A;  2X3W D;  2CP7 A;  4XU2 A;  3OYF A;  4M75 G;  1GRI A;  4ZGE B;  1WXU A;  3J7A F;  3TSZ A;  4J9B A;  2RQV A;  4A4K A;  4CC4 B;  2HMA A;  2E1H A;  3EHR A;  3CCE Q;  4J9D A;  5HY6 A;  2E41 A;  4LDX A;  4QT7 A;  1KHI A;  3FEO A;  4ESR A;  1MGQ A;  1VQ7 Q;  1EX4 A;  1UUE A;  3CCR Q;  4JRP A;  3SFM A;  1HSQ A;  2GQV A;  2C0I A;  2E12 A;  4ELY C;  1QMC A;  4PKC C;  4HT9 A;  5ECA A;  5GAO m;  1BK2 A;  2E6Z A;  1OQK A;  1GCQ C;  4KT0 E;  1G3Y A;  8ATC B;  2P0K A;  2J7I A;  2FZC B;  3SDZ A;  1VQ8 Q;  2YUQ A;  2CYZ B;  2DFU A;  4UC4 A;  1VQ5 A;  3EH1 A;  4M77 C;  5L23 A;  3CCV Q;  3SEM A;  2L8D A;  2WSE E;  5LJ5 g;  5GAM d;  1NG2 A;  4B9W A;  3S3M A;  1UGR B;  3OS5 A;  3X25 B;  1ZLM A;  2DK3 A;  3CBM A;  2RM4 A;  4E2F B;  4CRI A;  5LJ5 h;  5GAO r;  2AHJ B;  3TSW A;  5IH2 A;  1PD1 A;  1JB0 E;  1ABO A;  3H41 A;  3G6E Q;  3EH2 A;  1MMG A;  3KFV A;  2HSE B;  1TG0 A;  5CKE A;  2HQE A;  3T9N A;  2NUZ A;  3QDF A;  5FU7 C;  3QZ9 B;  3OB9 A;  1SEM A;  1Q7Y C;  4RTX A;  3VUB A;  1AWO A;  4O5V A;  2EGE A;  5GAN 8;  2K79 A;  2A37 A;  1K73 C;  4DEY A;  4DA4 A;  2DET A;  1IZ6 A;  3M58 A;  5D7U A;  5AYF A;  4M75 A;  2O31 A;  3C94 A;  3UA7 A;  4EMK C;  1DJ7 B;  1G8X A;  3OMC A;  3RMQ A;  2E4H A;  1VQ6 A;  4BE0 A;  4JRK A;  3CC2 T;  2DIQ A;  4LDU A;  3JCM Q;  2MWO A;  2XK0 A;  4FM4 B;  5GMK i;  2GGR A;  2XMF A;  4M7A F;  1OZ2 A;  5KYX A;  1UGS B;  4AT1 B;  4Y92 A;  4RCB A;  4C92 A;  3CXC P;  2DL7 A;  1KC8 R;  1ZSZ B;  2E65 A;  5GAN j;  2J6F A;  1ZA2 B;  3QII A;  2DTH A;  1NEG A;  3NTI A;  2QA4 Q;  2DMO A;  2WAC A;  2Y4X A;  2M0Y A;  3VYH B;  2LDM A;  4A54 A;  5FRM A;  2RHY A;  2AZV A;  4GBQ A;  4DEX A;  5LJ3 e;  5GAM g;  5IHK A;  3OYN A;  4JDS A;  2I2L A;  2FPE A;  2CP5 A;  2JMA A;  2E64 A;  1M5Q 1;  4M7A B;  5GAM h;  2LJ1 A;  1QWF A;  5CO7 A;  3CC7 Q;  4X1V A;  1SHF A;  4EMH A;  5KH6 A;  2DRM A;  3EG3 A;  2LQN A;  4RUG A;  2C06 A;  4IUR A;  2QYZ A;  4B6M A;  4NL2 A;  1M90 R;  2DX1 A;  4PLI A;  2O9S A;  3E1S A;  3NTH A;  4JPB W;  2VUB A;  5GAO n;  3GNF B;  1SSH A;  3IQL A;  3H0F A;  4E7L A;  2FEI A;  4KUD K;  2K5F A;  1AEY A;  3M0S A;  1UJ0 A;  1T0H A;  1YJ9 Q;  2FYK A;  4NS5 A;  5KYY B;  2RQR A;  4F7U F;  4J9H A;  3ZEH A;  1OV3 A;  2Y90 A;  2RO0 A;  1YIT T;  2YRC A;  4HA8 A;  3LH5 A;  4FSS A;  5D6Y A;  1YJN Q;  4N0A C;  3CEY A;  3M55 A;  5CCA A;  3OYY A;  3I55 T;  2KAF A;  1T0J A;  1UEB A;  1KJW A;  1G3W A;  4C0F A;  1WXB A;  2XIC A;  2QQB A;  5GAN 3;  1AHJ B;  2MYS A;  4X9D A;  1I5O B;  2V1R A;  3MET A;  2KT8 A;  3OBY A;  5CAI A;  2LCS A;  2QEX A;  1YIJ A;  1WFW A;  3CCU A;  7AT1 B;  4M7D C;  1I0C A;  4Y28 E;  1S72 A;  2XKO C;  1IGQ A;  3S6W A;  4DBQ A;  3OYH A;  4LNP A;  4F7U B;  2PVD B;  1YI2 Q;  2EBP A;  1M2V B;  4A63 B;  2K3B A;  1G3S A;  2RH2 A;  2EGC A;  1XJW B;  2EQI A;  1ZBX A;  2LTO A;  1OPL A;  3OSV A;  3SWN A;  1X69 A;  2K2V A;  1NE8 A;  4ZNX A;  4A4G A;  4F17 A;  2VAS A;  3CQT A;  2XD0 A;  2QQR A;  1QVF P;  1VQ9 T;  1AT1 B;  1D0Z A;  2HZY A;  3CCE A;  4C8Q D;  2GFU A;  3RER A;  5D6W A;  4KGZ B;  5GAN 7;  2HSP A;  4C0Z A;  1VQ7 A;  1W6X A;  4KGV B;  1D0Y A;  1H92 A;  1JJ2 P;  3CCR A;  3OS2 A;  1QCO A;  2AT1 B;  1OYX A;  1I5L A;  2CP6 A;  4ME7 A;  4JLG A;  1A0N B;  4BI4 A;  3CCS Q;  3OW2 S;  2ZPE B;  5GAN 5;  3FJP A;  1X6B A;  3P8B B;  3PVL A;  3RBB B;  2EQJ A;  2HEQ A;  2YUP A;  3CBO A;  3M59 A;  1Q7Y R;  2SRC A;  1FX7 A;  1O9S A;  4A4E A;  3CCJ A;  4C5H A;  4PJO D;  1JU5 C;  1QVG S;  1VQ8 A;  4GLM A;  1K73 R;  1WYX A;  3OYC A;  3R6O A;  1UE9 A;  1VQN Q;  4KUI A;  4M7A E;  2J06 A;  1W2B P;  4C5E A;  1Y57 A;  2KY9 A;  2KXD A;  3CC4 T;  1AD5 A;  3CCQ T;  3PFS A;  5GMK e;  3EGD B;  3HRU A;  1YWP A;  4FIB A;  2K5L A;  2L3S A;  1JBM A;  4LE9 A;  4M7A G;  2E5Q A;  2HBW A;  1UGQ B;  1X2Q A;  4EDU A;  2CUB A;  5LJ3 g;  2DM1 A;  2NLU A;  2DD4 A;  3FB9 A;  3QXE B;  3I56 Q;  5LJ3 h;  3GLX A;  4IUP A;  1VQM Q;  2EJF A;  2L3P A;  3A8H B;  4AG1 C;  4JLI A;  1V76 A;  2KMT A;  5J26 A;  3UA6 A;  2O4X B;  2IG0 A;  1VQ4 T;  2EJ9 A;  4D8D A;  3H0H A;  3HL8 A;  1M8M A;  1NLP C;  2KYM A;  4XK8 E;  2KRO A;  3S3O A;  1TUG B;  4FYY B;  1SF9 A;  3PE0 A;  2AKL A;  3EG1 A;  2MIO A;  4M77 F;  1UG1 A;  4BAC A;  2HBP A;  3OYA A;  3JAM E;  4F04 B;  3A98 A;  1D3B B;  3KBG A;  1BU1 A;  2F5K A;  4EIK A;  3EG9 B;  1SSF A;  2ZCF B;  4IUT A;  3TVT A;  3V7C A;  4F7U E;  1X27 A;  2K3X A;  1UTI A;  4C8Q C;  1N9R A;  4IKF A;  3MEW A;  4OGE A;  2ZAE A;  1QWE A;  2FHD A;  1YFN A;  5D6X A;  3CME Q;  1WJQ A;  2LJ3 A;  1ZSZ A;  1ABQ A;  4M77 B;  5CIU A;  4QW2 A;  3OY9 A;  3G4S A;  1VUB A;  4F7U G;  6AT1 B;  1BI1 A;  1WX6 A;  1WIE A;  1KQ2 A;  3UF4 A;  4M78 F;  3LW5 E;  3RUX A;  2JXB A;  3OYJ A;  5LJ5 e;  4LUE A;  2MAM A;  1VA7 A;  2ZPB B;  4C5G A;  2JMC A;  2Y4Y A;  2BZ8 A;  2KYB A;  2HQH A;  4RTU A;  4PJO C;  4OGC A;  1I1J A;  2KNB B;  4M7A A;  2QXF A;  4V2S A;  1HJD A;  2QK0 A;  3EG0 A;  4E7H A;  3I56 T;  3M5A A;  1WPY A;  1RLP C;  1M1G A;  5CQX A;  2L5Q A;  3JCM J;  3I9Q A;  2DIG A;  2YRD A;  3MEA A;  4M78 B;  3JB9 F;  3WXM B;  1OZ3 A;  4BDZ A;  1VQ5 T;  1M3A A;  1YJ9 A;  4LDW A;  1MNE A;  3O5Z A;  4EMK B;  2BZY A;  4HCC A;  3URG A;  5J39 A;  2LX7 A;  1YJN A;  1UHC A;  2A36 A;  4M75 D;  3OYL A;  3RKW A;  1W1F A;  5KYY A;  2ROL A;  2RN8 A;  1SRM A;  2K7A A;  1RAA B;  4R55 A;  2LNH B;  3WVE B;  3LX7 A;  1YP5 A;  1ARK A;  4ZGJ B;  1UEC A;  3GOX A;  1KD1 U;  1K9A A;  3VS7 A;  5KYU B;  2YXY A;  2MMP A;  2MOX A;  1Y96 B;  1NPP A;  2F5T X;  2EJG A;  3EFO B;  1MMA A;  3RKX A;  4OMN A;  4FSX A;  1YI2 A;  1JEG A;  2X4Y A;  2JW4 A;  1KG1 A;  3HRT A;  2VC8 A;  2XID A;  1N6A A;  2AK5 A;  1G5V A;  4F7U A;  3X26 B;  2DAQ A;  2CT4 A;  4E7K A;  1M2V A;  2DVE A;  4IUV A;  2ROT A;  2KRN A;  5GAN d;  5FU6 C;  2G6F X;  2JT4 A;  4RTY A;  2L89 A;  1PKS A;  4OB0 B;  5DM7 R;  3M4G A;  2DYI A;  3VRY A;  2D8J A;  3JCM V;  2FPD A;  3DKM A;  2RMO A;  1M27 C;  1YN8 A;  2GNC A;  4BDY A;  3OYG A;  1JRI A;  2OTJ T;  3M0R A;  5I21 A;  2DL5 A;  2CGH A;  1K76 A;  1M1F A;  3CCS A;  4M7D F;  3L2R A;  2E3H A;  1QLY A;  4R56 A;  2E10 A;  3C12 A;  1UGV A;  1VQO T;  2RJF A;  2XG8 D;  4ORZ A;  4C92 E;  1BI2 A;  2JZ2 A;  1RAF B;  3HFO A;  2C0T A;  5IHN A;  2M02 A;  3TRE A;  3M0Q A;  3V8L A;  1PSF A;  1VQN A;  2EQK A;  2FG0 A;  3CC2 Q;  5GAO l;  4J8O A;  3CCL T;  1X6O A;  4GLK A;  3CMA T;  4C92 G;  5GAO q;  1WHK A;  2YLB A;  2DNU A;  2X35 A;  2VVK A;  3H9N A;  4M7D B;  1JQQ A;  1ZUU A;  1ZA1 B;  3OBW A;  1VYV A;  4M75 C;  1PM3 A;  1QVF A;  3EGD A;  4M78 E;  3GNG A;  3A1P A;  2PUK B;  3M0P A;  2KRM A;  5A0G A;  1VQM A;  2YRV A;  2CDT A;  4MZP A;  2W10 A;  4ATO A;  1C6V X;  5HK0 A;  3M56 A;  1JJ2 A;  2GTJ A;  5GAN g;  4OMM A;  4P5N A;  3VS3 A;  1RI9 A;  1RAI B;  3OYD A;  4M78 G;  4OMO A;  1UFF A;  2RD1 A;  1I07 A;  5CKB A;  3WVD B;  2MK5 A;  5GAN h;  1UB4 A;  4E7Z A;  1E6G A;  4IUQ A;  3OYE A;  1JXO A;  3G71 T;  2ZPI B;  4L5G A;  1TUC A;  3JSC A;  2YT6 A;  4MML A;  1N8R U;  1YBY A;  3M0T A;  1WHJ A;  4OB1 B;  3L2U A;  3CD6 T;  1OU8 A;  1AWX A;  2HKQ B;  4FYW B;  2KGT A;  1K9M U;  1QCF A;  4NL3 A;  2DKG A;  1NYF A;  1KQS P;  1D3B A;  2DD5 A;  1OI1 A;  2A7Y A;  1V1C A;  5FW9 A;  3GIB A;  3EG9 A;  2K57 A;  1T3S A;  3JB9 G;  4FL6 A;  2CZ7 B;  3J80 E;  1B07 A;  1YIT Q;  4EMG A;  4XU1 A;  5A0L A;  2IPO B;  1GCQ A;  4OMQ A;  2JTM A;  3I55 Q;  1BB9 A;  4E7J A;  2KE9 A;  3PIO A;  1U3O A;  2EYW A;  3OYM A;  5IXB A;  4M77 A;  4RMO A;  1OUL A;  2HAX A;  3L2Z A;  1NM7 A;  4C0D B;  1RLQ C;  5HCK A;  1FYN A;  2RK2 A;  2NYS A;  4WTO B;  2VXE A;  2DJZ A;  3PGG A;  1AOJ A;  1LOJ A;  1UJY A;  4FYV B;  4J7I A;  2X9H A;  2O2O A;  3NFC A;  5KE2 A;  3CPW S;  2RF0 A;  1OEB A;  4ZTJ A;  1VQL T;  4EPC A;  3CCJ T;  2EYY A;  3V8K A;  4C8Q F;  2QAS A;  2LCL A;  2EW3 A;  1M3B A;  3MKD A;  3H0I A;  1Y71 A;  2BKD N;  5KYN A;  1VQ9 Q;  2LQK A;  4M78 A;  2O88 A;  1TWB A;  5A0D A;  2JTE A;  4Z02 A;  4FYX B;  4NOY A;  2AKK A;  2VXF A;  4HVU A;  4EMK A;  4FU6 A;  5IHI A;  4KH1 B;  1D1C A;  3X28 B;  2EKH A;  2DTO A;  2FPF A;  1R0B G;  1YHQ T;  2DJQ A;  1YJW A;  1PNJ A;  4M7D E;  4Z88 A;  2RHZ A;  3G1J A;  4HCZ A;  2EKO A;  1PWT A;  1GXI E;  4C8Q B;  4PJO F;  3TCJ A;  3DB3 A;  4J9I A;  1U1S A;  2BTT A;  3KXT A;  2DZ9 A;  4ZTF A;  2L3R A;  1BCM A;  4M7D G;  1WLP B;  1Y0M A;  5KYU A;  2GTO A;  1WHL A;  4KRT A;  5J3B A;  1Y96 A;  2P84 A;  1N8R C;  3EFO A;  4TVR A;  1W4S A;  2OTL Q;  2A08 A;  4QVC A;  3MP6 A;  2JVV A;  1QKX A;  3R6N A;  3CC4 Q;  2D6F A;  1K9M C;  3CPW A;  3CCQ Q;  2VB6 A;  4PJO B;  1ZQ1 A;  2YDL A;  3M57 A;  2V8J A;  2M1H A;  4E47 A;  2WSC E;  5C6S A;  3VUZ A;  4JS4 A;  2CT3 A;  4BI3 A;  4M7A D;  1AWW A;  3CCM A;  2EVR A;  4QQD A;  2DBK A;  4C0G A;  1FMK A;  2KQW A;  4JZ4 A;  1W70 A;  1VQ4 Q;  2LQW A;  3G4S T;  2KEA A;  4M4Z A;  2D9T A;  2JM9 A;  2KXC A;  1K4U S;  2KK4 A;  1TXQ A;  3UDC A;  1M8V A;  3RES A;  1BCO A;  3JB9 J;  5LL6 S;  2D0N A;  1VOM A;  3E19 A;  3E2U A;  1S1N A;  5FWC A;  2IIM A;  3BDU A;  3CC2 A;  2RJC A;  3M4Y A;  4ZN3 A;  1OOT A;  2J6K A;  1SG5 A;  2NUT B;  4N0A A;  3DLL A;  1OPK A;  2DBM A;  1JXM A;  4J6Y A;  2DXT A;  3I5S A;  1AZG B;  4PFO A;  3UT1 A;  3OS1 A;  1YCY A;  5AT1 B;  4WCI A;  1KHC A;  2P4R A;  1AZE A;  3GP8 A;  2E5K A;  2OAU A;  2RQU A;  2X4X A;  4DOW A;  3EFS A;  4JS5 A;  1GBR A;  2OI3 A;  2ZPH B;  3N5B B;  2Z0W A;  4LN2 A;  4M7D A;  4J6X A;  4XTY A;  1VQK T;  3CCV A;  2VGM A;  1XQH A;  1BBZ A;  4AFU C;  2OTL T;  2RI5 A;  3VU3 C;  3AT1 B;  3ZFJ A;  1M1K U;  2LCC A;  2KDS A;  3VYG A;  4AFZ C;  1Z9Z A;  1WHG A;  2K5I A;  3QWX X;  1KIK A;  3RIR A;  4CI0 C;  2RHU A;  4QVD A;  2OAW A;  1U5S A;  2YWW A;  1R77 A;  3G6E A;  1VQP T;  3VKI A;  2CP0 A;  1WXT A;  1N9S A;  2R58 A;  4JJD A;  1ZSG A;  2EYQ A;  3JCM f;  4C8Q E;  3EGX B;  4L59 A;  1IRX A;  3MEU A;  4F16 A;  2JN0 A;  2ED0 A;  4LDV A;  4J7F A;  1WQW A;  1VQ5 Q;  3P8D A;  2CH4 W;  2FVU A;  1VIE A;  3RR6 A;  5I22 A;  2KR3 A;  2X4J A;  2P0P A;  1YIT A;  2PU9 B;  5M9O A;  1PKT A;  4BD3 A;  2MPX C;  3LGL A;  2DVJ A;  2IVW A;  1NJI U;  1OU9 A;  2RK1 A;  5DLQ E;  3I55 A;  4XTW A;  1H64 1;  3GBQ A;  2HL3 A;  4PLL A;  4DBF A;  3CXC S;  4OP0 A;  1U06 A;  3OYK A;  4FW1 A;  1Q95 G;  1X6G A;  4PJO E;  1B3Q A;  5DY9 A;  2QA4 A;  2F2X A;  2CUD A;  2JM8 A;  3FDR A;  3HP9 A;  1FXX A;  4XTZ A;  2GFA A;  4KUL A;  1XOV A;  4LDY A;  2RPN A;  3BW1 A;  2FZG B;  2MI6 A;  2OJ2 A;  4L6V 5;  2V26 A;  4E6R A;  1QVP A;  4OML A;  2QGG A;  2LQ8 A;  1EZZ B;  4PFP A;  2CSQ A;  3CC7 A;  1XTD A;  2RB6 A;  5CVI A;  5GAN e;  1HD3 A;  1VQ9 A;  4A53 A;  2YSQ A;  1N8R R;  1ZUK A;  1KQS A;  3NMZ C;  5DLO A;  2F1L A;  2MCN A;  1N5Z A;  4K11 A;  3FIF A;  1TSF A;  1K9M R;  5FU7 B;  1RAB B;  2QI2 A;  1K0X A;  4RCC A;  1T3L A;  1WJR A;  3OS0 A;  4A4F A;  2OTJ Q;  4PK4 A;  3NTK A;  2XDD A;  1M1K C;  3F70 A;  3Q1J A;  2O01 E;  2DXU A;  2QQA A;  1X75 C;  5CK9 A;  3CXC A;  2K6D A;  1VQO Q;  2EYX A;  2FRW A;  1ZHI A;  3E9G A;  2CZ6 B;  3MP1 A;  5CKD A;  3JB9 H;  2DXC A;  3BE3 A;  1KK7 A;  3LYI A;  4C8Q A;  1YNZ A;  3L2W A;  4RKU E;  2NWM A;  4ANJ A;  3PMI A;  3P8H A;  1UDL A;  1X01 A;  2E3I A;  4QKU A;  3CCL Q;  1NEB A;  3INZ A;  2QDL A;  1NYG A;  1QQJ A;  3CMA Q;  2LVM A;  2RI3 A;  3CPF A;  5L8R E;  3QO3 A;  3CCQ A;  3LH0 A;  2X51 A;  2DYB A;  2DIL A;  2RHX A;  3OYB A;  1KFZ A;  3QKJ A;  4FT2 A;  1K1Z A;  1FMW A;  3GF5 A;  2V1Q A;  4BUG A;  3QJ6 A;  4C92 D;  3HHT B;  1CKA A;  4JRQ A;  1ACM B;  2L2P A;  4JZ3 A;  4PJO A;  1EIF A;  2ZPF B;  1LNX A;  1TS9 A;  1EFN A;  1NJI C;  2COW A;  5IAY A;  3C95 A;  1E7O A;  1QVF S;  4QQ6 A;  1VQ6 T;  2RQW A;  1UHF A;  1WI7 A;  1R0C B;  2MF2 A;  1VQ4 A;  1P92 A;  1MMD A;  3VS2 A;  2ED1 A;  4PFZ A;  5LJ5 f;  3JV3 A;  3RKY A;  2M51 A;  2JTF A;  2GBQ A;  4CC2 A;  1JJ2 S;  3G71 Q;  3M54 A;  3QJY A;  3L2V A;  4M78 D;  4PJJ A;  3HPW A;  1BYM A;  2FB7 A;  2V8K A;  3CD6 Q;  1IGU A;  2J05 A;  1JO8 A;  1WHM A;  3QWY A;  1I8F A;  2RA2 A;  3BY7 A;  1WNL A;  3RMS A;  4D8K A;  1M30 A;  2A3L A;  1UGP B;  3H8Z A;  4M77 E;  2DO3 A;  4PJL A;  4VUB A;  4JRI A;  2B86 A;  4ZGD B;  2NUT A;  1RAE B;  4A4H A;  4J83 A;  4J6W A;  3M53 A;  4O6J A;  1MMN A;  1W2B S;  2LT4 A;  2QAZ A;  1Q81 U;  1LPL A;  3JB9 D;  4M77 G;  1QP2 A;  4DQ2 A;  5CKF A;  2YHT A;  3S3N A;  3OYI A;  5C0M A;  5GMK l;  2RJE A;  3PMT A;  1BI0 A;  2EWN A;  4WF2 A;  8AT1 B;  3KUF A;  1Q86 U;  3TQ7 P;  2KRS A;  4F14 A;  5GMK m;  1E6H A;  2R5A A;  2XHC A;  1VYU A;  1CSK A;  2DLP A;  2DPP B;  4ELZ C;  1YJW T;  3EHQ A;  2L0A A;  5GJV B;  2BE7 D;  2LJ0 A;  1M4Z A;  4MDX A;  3I56 A;  5GMK j;  4Z8A A;  2QGF B;  1K8A U;  3ME9 A;  4J9G A;  3BDL A;  3OW2 P;  5KYW B;  3OMG A;  1MND A;  1VQL Q;  1TH7 A;  2DE0 X;  3CCJ Q;  3JCM P;  3UPU A;  3EFR A;  2CKK A;  2NUP B;  4PNO A;  5GAM f;  1KD1 C;  3M9Q A;  4C92 C;  1QVG P;  3EGX A;  2O4X A;  1B34 B;  4RTT A;  4BB7 A;  5GAO p;  2M9U A;  3NGP A;  1OX9 A;  1GFC A;  2DL4 A;  1J3T A;  2LNV A;  2EIF A;  2WSF E;  2LP5 A;  1R8O B;  2GCX A;  1NPR A;  4E7S A;  5IXF A;  2QEX T;  1YIJ T;  3CCU T;  3JRZ A;  2EQM A;  2GF7 A;  1TTH B;  2CP3 A;  1S72 T;  4J9F A;  4XU3 A;  1IXD A;  4XTX A;  4J9C A;  1QKW A;  1RAG B;  4JJB A;  1YHQ Q;  3UWN A;  5KCH A;  3OQ5 A;  1KQ1 A;  1W2B A;  1Z9Q A;  1C1A A;  2QDY B;  2JS0 A;  3A8O B;  3CCM T;  2DEQ A;  1FWZ A;  3CME A;  4OVA A;  2C0O A;  3PTA A;  2H8H A;  1I4K 1;  2K3Y A;  1XNI A;  4M78 C;  2BE9 B;  4RTZ A;  1WHH A;  1M1K R;  4MDW A;  3C4S A;  2X3X D;  3CCE T;  1G3T A;  2KI7 A;  1BIB A;  3SHW A;  3VS5 A;  1GL5 A;  1IB8 A;  4IIO A;  1PD0 A;  4M7D D;  1RI0 A;  4KGX B;  1U8R A;  4XTU A;  1VQ7 T;  2F2W A;  4CC7 A;  3DLM A;  4FW2 A;  4C5I A;  4HT8 A;  3CCR T;  1KSW A;  4DOV A;  1ZBJ A;  3PVQ A;  4X9C A;  3BFM A;  4CC3 A;  2SEM A;  2AIR B;  3ULR B;  5IT9 E;  5LJ5 j;  1QP3 A;  3C0C A;  3D7S B;  1AVZ C;  4AG2 C;  3RNJ A;  1D1B A;  1Q81 C;  2OTJ A;  1VQ8 T;  2ABL A;  4BI8 B;  1Q82 U;  4E7I A;  2GQI A;  2VGN A;  3CCV T;  2EQU A;  2KT1 A;  2JUF A;  3G4S Q;  2W0Z A;  1HYO A;  3CBP A;  3QPH A;  1Q86 C;  1VQO A;  1NJI R;  1IRE B;  4BY6 C;  5I2S A;  2H3J A;  1ZX6 A;  2HDA A;  5I2M A;  3X20 B;  2HCK A;  4OMP A;  2MWP A;  3UAT A;  5IN1 A;  1LJO A;  2YLC A;  1PC0 A;  3CCL A;  3REB B;  3QDR B;  3G6E T;  3GPL A;  3SWN C;  1PRM C;  3VS6 A;  1K8A C;  1AWJ A;  3CMA A;  3VS4 A;  1HK9 A;  4JJC A;  4GY5 A;  2XDB A;  1Y07 A;  3TU4 K;  2R57 A;  3FC3 A;  2ZGW A;  4B9X A;  1K0S A;  1NLO C;  1D09 B;  4OB3 B;  4LD6 A;  5GAN 6;  1TOV A;  3QYG B;  1I81 A;  4N4I A;  3RDV A;  1OX8 A;  4DBR A;  2JS2 A;  3QZ5 B;  4JJN K;  1VQK Q;  3NHN A;  2CSI A;  2E6N A;  1G83 A;  1PCX A;  2COZ A;  2EAY A;  9ATC B;  3LWH A;  4PJM A;  2H3E B;  3HSB A;  2LRQ A;  2YUO A;  2DF6 A;  5EC7 A;  5GAM j;  2RQT A;  3G71 A;  1IHW A;  1VQP Q;  2A0F B;  3I35 A; 
#chains in the Genus database with same CATH homology
 3GBQ A;  2K79 A;  2A37 A;  4DEY A;  1U06 A;  2ROT A;  4AFS C;  2KRN A;  1X6G A;  3VS0 A;  2O31 A;  2EGA A;  2G6F X;  2JT4 A;  4RTY A;  1B3Q A;  1PKS A;  3UA7 A;  2PTK A;  1MV3 A;  3EG2 A;  3VRY A;  2D8J A;  4HVV A;  1G2B A;  2F2X A;  2CUD A;  2JM8 A;  2FPD A;  1PHT A;  1XOV A;  2RMO A;  1M27 C;  2RPN A;  1YN8 A;  2GNC A;  2GGR A;  2XMF A;  2OJ2 A;  1M3C A;  4E6R A;  4Y92 A;  1GBQ A;  3M0R A;  4OML A;  2DL5 A;  2DL7 A;  1K76 A;  1RUW A;  2CRE A;  1QLY A;  2CSQ A;  2J6F A;  2ECZ A;  2KBT A;  1NEG A;  1UGV A;  2DMO A;  1HD3 A;  4ORZ A;  2M0Y A;  3VS1 A;  1VYT A;  1X2K A;  2YSQ A;  3REA B;  1ZUK A;  2AZV A;  4GBQ A;  4DEX A;  3NMZ C;  2C0T A;  5IHN A;  2MCN A;  1N5Z A;  4K11 A;  5IHK A;  3M0Q A;  1YWO A;  2DA9 A;  2F2V A;  2FG0 A;  2JMA A;  2FPE A;  1K0X A;  1GFD A;  4HXJ A;  1TUD A;  5I11 A;  1T3L A;  1QWF A;  2LJ1 A;  2L3Q A;  4X1V A;  1SHF A;  3FJ5 A;  2DRM A;  1SRL A;  2LZ6 B;  3EG3 A;  2DNU A;  2LQN A;  2VVK A;  4RUG A;  1SPK A;  1JQQ A;  2D1X A;  1ZUU A;  4R0K A;  2DX1 A;  1VYV A;  2K6D A;  2EYX A;  2O9S A;  2FRW A;  4JPB W;  1ZUY A;  2EPD A;  1SSH A;  1YNZ A;  3M0P A;  3IQL A;  3H0F A;  1IO6 A;  2KRM A;  2NWM A;  2BZX A;  2CDT A;  2FEI A;  2W10 A;  1UDL A;  2FO0 A;  2GTJ A;  1AEY A;  3M0S A;  4OMM A;  1UJ0 A;  1T0H A;  1SHG A;  1NEB A;  2QDL A;  1NYG A;  2CH4 A;  2RQR A;  3VS3 A;  1RI9 A;  4J9H A;  1OV3 A;  4LUD A;  4OMO A;  3VRZ A;  1UFF A;  1I07 A;  3LH5 A;  1E6G A;  2DYB A;  2DIL A;  1JXO A;  1KFZ A;  4AFQ C;  4FSS A;  1K1Z A;  2V1Q A;  1TUC A;  2YT6 A;  3I5R A;  2LMJ A;  1CKA A;  1T0J A;  3M0T A;  1KJW A;  1MUZ A;  2RNA A;  2L2P A;  1WXB A;  4JZ3 A;  1AWX A;  1EFN A;  2KGT A;  1QCF A;  2V1R A;  2KT8 A;  2LCS A;  1E7O A;  1NYF A;  1WFW A;  1I0C A;  2RQW A;  1UHF A;  1WI7 A;  1V1C A;  5FW9 A;  4LNP A;  1T3S A;  2PNI A;  2YUN A;  3VS2 A;  2ED1 A;  2EBP A;  3THK A;  4A63 B;  1B07 A;  1PRL C;  3JV3 A;  2K3B A;  2M51 A;  2EGC A;  2GBQ A;  2O9V A;  2EQI A;  4CC2 A;  1GCQ A;  1OPL A;  4OMQ A;  2J6O A;  1BB9 A;  1X69 A;  2KE9 A;  1U3O A;  2EYW A;  2PZ1 A;  2K9G A;  4ZNX A;  1YCS B;  2J05 A;  5IXB A;  2DRK A;  4F17 A;  1JO8 A;  1GCP A;  3QWY A;  3CQT A;  4RTV A;  1NM7 A;  1RLQ C;  5HCK A;  4D8K A;  1FYN A;  1M30 A;  2B86 A;  2HSP A;  1AOJ A;  1UJY A;  1W6X A;  1H8K A;  1H92 A;  3NPF A;  2O2O A;  1WA7 A;  2RF0 A;  1OEB A;  1A0N B;  3ZL7 C;  2EYY A;  4HVW A;  1X6B A;  3PVL A;  2EW3 A;  1M3B A;  3RBB B;  2HEQ A;  2YUP A;  3U23 A;  3H0I A;  2SRC A;  2O88 A;  2KRS A;  1CKB A;  4F14 A;  1JU5 C;  4GLM A;  1E6H A;  2JTE A;  1WYX A;  1VYU A;  1CSK A;  2DLP A;  3EHQ A;  2L0A A;  1UE9 A;  2AKK A;  5GJV B;  4HVU A;  2J06 A;  5GJW B;  2LJ0 A;  5IHI A;  2EKH A;  2ESW A;  1Y57 A;  2FPF A;  2I0N A;  2KXD A;  4J9E A;  4Z8A A;  2DJQ A;  1PNJ A;  1AD5 A;  4J9G A;  4Z88 A;  2DL3 A;  1YWP A;  1PWT A;  2DE0 X;  2L3S A;  4LE9 A;  1MV0 B;  2HBW A;  1X2Q A;  2CUB A;  4J9I A;  2BTT A;  2DM1 A;  5FWB A;  2DL8 A;  4RTT A;  2VWF A;  1WLP B;  1Y0M A;  3NGP A;  3M0U A;  1GFC A;  2DL4 A;  1J3T A;  2EYZ A;  2GTO A;  4KRT A;  2LP5 A;  2L3P A;  2AZS A;  4AG1 C;  5IXF A;  3UA6 A;  4J9F A;  2FRY A;  4D8D A;  3H0H A;  2A08 A;  4J9C A;  1QKW A;  1M8M A;  1NLP C;  2KYM A;  4JJB A;  2KRO A;  1QKX A;  3R6N A;  2VKN A;  2ENM A;  3PE0 A;  2AKL A;  1Z9Q A;  2A28 A;  3EG1 A;  2MIO A;  4Z89 A;  2JS0 A;  2D8H A;  1UG1 A;  2YDL A;  1WDX A;  3EGU A;  2C0O A;  2H8H A;  3A98 A;  4RTW A;  1BU1 A;  1H3H A;  4RTZ A;  4IIM A;  4EIK A;  2CT3 A;  1AWW A;  2EVR A;  2X3X D;  2DBK A;  1FMK A;  3TVT A;  3VS5 A;  3SHW A;  1LCK A;  1X27 A;  1GL5 A;  1X43 A;  4JZ4 A;  1UTI A;  4IIO A;  1W70 A;  4HCK A;  2LQW A;  2F2W A;  4CC7 A;  1QWE A;  2KEA A;  4M4Z A;  2JM9 A;  2LJ3 A;  2KXC A;  1KSW A;  1K4U S;  1ABQ A;  1ZBJ A;  3PVQ A;  4CC3 A;  1WX6 A;  1WIE A;  2SEM A;  2D0N A;  3UF4 A;  3ULR B;  1S1N A;  5FWC A;  2IIM A;  2K2M A;  3C0C A;  2X3W D;  1OOT A;  2J6K A;  2JXB A;  4LUE A;  1GRI A;  1WXU A;  1AVZ C;  3TSZ A;  1VA7 A;  4J9B A;  4AG2 C;  2RQV A;  3RNJ A;  1OPK A;  4CC4 B;  2DBM A;  2JMC A;  3EHR A;  1JXM A;  2ABL A;  4J9D A;  3I5S A;  1AZG B;  2BZ8 A;  2KYB A;  4QT7 A;  4RTU A;  4WCI A;  2GQI A;  2P4R A;  1AZE A;  1I1J A;  2KNB B;  2E5K A;  2RQU A;  4ESR A;  2KT1 A;  2W0Z A;  1HJD A;  1GBR A;  1UUE A;  2OI3 A;  3EG0 A;  1RLP C;  4LN2 A;  1HSQ A;  2C0I A;  1ZX6 A;  2HDA A;  2HCK A;  1BBZ A;  4OMP A;  3UAT A;  3I9Q A;  4AFU C;  5ECA A;  1BK2 A;  1GCQ C;  1M3A A;  3REB B;  4AFZ C;  1Z9Z A;  1PRM C;  3VS6 A;  1AWJ A;  3VS4 A;  3O5Z A;  3QWX X;  2J7I A;  4JJC A;  1KIK A;  2BZY A;  2YUQ A;  2OAW A;  1U5S A;  2LX7 A;  1UHC A;  1K0S A;  1NLO C;  2A36 A;  5L23 A;  1W1F A;  3SEM A;  2ROL A;  2RN8 A;  1SRM A;  1NG2 A;  1WXT A;  2K7A A;  1ZLM A;  4JJD A;  2JS2 A;  1ZSG A;  2LNH B;  1YP5 A;  3NHN A;  1ARK A;  2CSI A;  1UEC A;  4F16 A;  1G83 A;  3TSW A;  5IH2 A;  2ED0 A;  1K9A A;  3VS7 A;  2MOX A;  1ABO A;  3H41 A;  2CH4 W;  3KFV A;  5I22 A;  2KR3 A;  4OMN A;  1TG0 A;  1JEG A;  2JW4 A;  2NUZ A;  2YUO A;  2AK5 A;  1SEM A;  2DF6 A;  5EC7 A;  2RQT A;  1PKT A;  4RTX A;  2DVJ A;  1AWO A;  2CT4 A;  2EGE A;  3I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...