1JEGA

Solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
SGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE CSK
publication title A novel, specific interaction involving the Csk SH3 domain and its natural ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/hydrolase
total genus 10
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jegA00
1YWPA 3EG3A 1CKAA 3VS7A 1RI9A 1PWTA 1U06A 2KRSA 3C0CA 5IXBA 2K7AA 2V1RA 2DBMA 4OMNA 4F14A 5IH2A 1H8KA 1KJWA 2A37A 2LX7A 2MIOA 2RQRA 1W70A 3THKA 2FEIA 2K9GA 4LUDA 1K76A 1AOJA 1X6BA 2LJ3A 4OMMA 1UGVA 1X2QA 2M0YA 2AZVA 3M0TA 1FYNA 2GTOA 2HSPA 3TSZA 2C0IA 3TSWA 2LZ6B 2L3SA 4JJDA 2PZ1A 2ED1A 1GFCA 3EG0A 2CT4A 1TUDA 2YSQA 3LH5A 2FRYA 3KFVA 1ABOA 2AKLA 2EYZA 4CC7A 2D1XA 1VA7A 2MCNA 2KROA 1CSKA 2SRCA 4E6RA 1RUWA 2GBQA 2DYBA 2EGCA 4AFQC 2RF0A 3M0QA 3EG2A 2YUNA 2JM9A 2YDLA 3EGUA 3QWXX 4OMOA 1I0CA 3R6NA 1MV3A 1Z9QA 2HDAA 4HXJA 2C0TA 4RTWA 1UECA 2QDLA 2J06A 2PTKA 3QWYA 2EPDA 2FO0A 2XMFA 1X43A 2CT3A 1OEBA 1PRMC 1SHGA 2DBKA 2DL8A 2E5KA 1UHCA 2MOXA 4IIOA 5I22A 1B07A 2CH4A 2JW4A 1PRLC 2O31A 1QKWA 4J9FA 1WYXA 1UDLA 2PNIA 2LP5A 5ECAA 1RLPC 2CSIA 3CQTA 1OV3A 1T3LA 2V1QA 1K0XA 4EIKA 2K79A 2CDTA 2EGEA 1GCQA 2ROTA 3VRZA 2DL3A 1T0HA 1X69A 2EYWA 1Y0MA 2F2XA 1HSQA 1H92A 1GFDA 2K2MA 1WI7A 1ZX6A 2EKHA 2DA9A 1G2BA 1HJDA 4J9EA 1SSHA 1YCSB 2D0NA 2D8JA 1M3AA 1A0NB 2EYYA 4F17A 3VRYA 2RNAA 1PKTA 1V1CA 2CH4W 2L3PA 3EHQA 2NWMA 1SHFA 1ZBJA 2GQIA 2X3WD 4RTUA 4J9IA 4RTVA 3RBBB 3NGPA 1AD5A 2H8HA 4Z8AA 5GJVB 4GBQA 1CKBA 1S1NA 1YP5A 1ZUUA 4R0KA 2RQUA 3H0HA 2FPDA 1T3SA 4JPBW 1KFZA 2C0OA 4AFSC 1AZGB 2A28A 1U3OA 4RTTA 3FJ5A 2RQWA 5IHKA 1AVZC 4Z89A 2D8HA 1K9AA 1WIEA 3VS5A 2EGAA 1RLQC 1W6XA 3U23A 3NPFA 4HVWA 3I35A 4ESRA 3ULRB 1GL5A 2VVKA 1GCQC 2DL5A 2KGTA 2J7IA 2ROLA 1UJYA 1ZUKA 4GLMA 1NEBA 1JXOA 2KYBA 4DEXA 4WCIA 5GJWB 5IHNA 3VS1A 3EG1A 4Z88A 2YUOA 1PHTA 1J3TA 2K6DA 4AFZC 2W10A 1E6HA 1IO6A 3PE0A 2EQIA 4AFUC 2DRMA 2CUBA 2OJ2A 1OOTA 1X6GA 2DX1A 2L3QA 1NYGA 1JXMA 4CC2A 5FWBA 3H0FA 4JZ4A 2P4RA 4AG2C 4RUGA 5I11A 2FRWA 2F2WA 1TG0A 1QCFA 1XOVA 4CC3A 2AZSA 1MUZA 1UTIA 2JS0A 2DNUA 2L0AA 2BZ8A 2GGRA 5FWCA 2J6FA 1ZUYA 2FPEA 3UA6A 2DVJA 1PNJA 1AWXA 4LNPA 3TVTA 1W1FA 2SEMA 1NLPC 3M0RA 3VS6A 1SPKA 2RN8A 2KNBB 5FW9A 4J9DA 2FG0A 2J6KA 4JJBA 4F16A 2KXCA 4CC4B 1VYTA 2K3BA 2HEQA 2NUZA 4HVUA 3UF4A 1Z9ZA 2B86A 1NLOC 1AWJA 2O88A 1UHFA 1X27A 3I5SA 2RMOA 4RTZA 3ZL7C 2LNHB 1GRIA 3SEMA 4X1VA 2EBPA 1KIKA 5IHIA 2RPNA 4OMLA 2AK5A 2KRNA 2LJ0A 2CREA 2LCSA 2A36A 3I5RA 1AEYA 1M3CA 2ABLA 3PVQA 2FPFA 2JXBA 2EYXA 1B3QA 3GBQA 2GTJA 1WDXA 1UG1A 2EW3A 2EVRA 1NYFA 1NM7A 1GBQA 1WLPB 3NMZC 3A98A 2F2VA 2G6FX 4ZNXA 1HD3A 1QWEA 2DRKA 3M0SA 1MV0B 1OPKA 4D8DA 4FSSA 1SEMA 2HBWA 1BB9A 3VS3A 1ABQA 1BK2A 2DL4A 2LQWA 1H3HA 2J6OA 4LE9A 1K0SA 2LJ1A 2RQTA 1TUCA 1VYUA 1QWFA 1E7OA 3H0IA 3RNJA 4LUEA 1ZSGA 4OMPA 2YUQA 4D8KA 1N5ZA 1WXTA 1JU5C 1NG2A 2JT4A 2DM1A 1K1ZA 2YUPA 4RTXA 3PVLA 2I0NA 1WXUA 1K4US 3REAB 2KT1A 2IIMA 1SRMA 1WXBA 1WA7A 2O9SA 2BZXA 3M0PA 1KSWA 2RQVA 1GCPA 1WX6A 1BBZA 1UE9A 1FMKA 2O9VA 4DEYA 2KEAA 4HVVA 3VS4A 2CUDA 2CSQA 3EHRA 2A08A 1M8MA 1AWOA 2KXDA 2W0ZA 2ECZA 1WFWA 2DILA 1GBRA 1SRLA 2VWFA 2AKKA 2X3XD 4JJCA 1M30A 1T0JA 1QKXA 2LQNA 1M3BA 3SHWA 2JM8A 2YT6A 2L2PA 4Y92A 4QT7A 5L23A 1ZLMA 4M4ZA 3UA7A 2ESWA 1Y57A 1YNZA 1I1JA 1JQQA 4K11A 2OAWA 2O2OA 2KYMA 1UJ0A 2GNCA 2DJQA 5EC7A 4A63B 2BTTA 1UUEA 3VS0A 3JV3A 4KRTA 2BZYA 4AG1C 1ARKA 4J9HA 2HCKA 1PKSA 2OI3A 1YN8A 1EFNA 3NHNA 3I9QA 1X2KA 1I07A 4HCKA 1AWWA 4IIMA 5IXFA 2KBTA 3H41A 3VS2A 3M0UA 2JS2A 4OMQA 3O5ZA 1OPLA 4J9BA 1AZEA 2KT8A 4JZ3A 4LN2A 2LMJA 2KRMA 2JMCA 2DMOA 5HCKA 3UATA 4J9CA 2KR3A 2JTEA 1M27C 1JO8A 1LCKA 3REBB 2DL7A 2JMAA 4J9GA 1NEGA 2ENMA 1U5SA 2J05A 2M51A 2DE0X 1YWOA 1BU1A 1JEGA 2DF6A 2ED0A 2DLPA 3IQLA 1E6GA 1VYVA 2KE9A 4ORZA 1G83A 2VKNA 1QLYA 1UFFA 4RTYA
chains in the Genus database with same CATH superfamily
3CXCS 1YWPA 3EG3A 1BI1A 1RI9A 3BW1A 4JRKA 4PK4A 1XTDA 2K7AA 3JB9I 4F14A 5IH2A 1H8KA 1KJWA 1MGQA 3PMTA 2A37A 2QA4Q 1IRXA 3THKA 1MMGA 2FEIA 4M78E 4M75A 2DTHA 1UGVA 3JB9J 2M0YA 2VC8A 1VQ4Q 2M02A 1IB8A 1Y71A 4IUQA 3P8HA 2XI9A 1F1BB 4O5VA 1ZSZC 1SG5A 4M75F 3TSZA 5GMKi 3TSWA 1BI3A 2RJDA 4JJDA 2PZ1A 1GFCA 4KUIA 2CT4A 1TUDA 2M16A 2DEQA 2FRYA 3OQ5A 4C5IA 2A7YA 1G8XA 2D1XA 4C92E 2XIDA 5LJ5h 2SRCA 2QEXT 2GBQA 2LNVA 3G6ET 3M0QA 5GANg 4LDVA 3LGLA 4AT1B 3BDUA 1I0CA 3TU4K 1FWZA 3G71Q 4HXJA 4RTWA 3CCEQ 3QWYA 2L8DA 2XMFA 1X43A 2DL8A 3RUXA 1GXIE 3JB9D 7AT1B 1Q82R 1RADB 4QVZA 2CZ0B 1WJQA 4J9FA 2DD5A 3S3NA 2CZ7B 3M4GA 3I56A 1RLPC 3QKJA 2CSIA 4OB2B 1N27A 2V1QA 2CDTA 2ROTA 1XJWB 1X69A 2EYWA 2KI7A 1H92A 2DIQA 2HD0A 1WI7A 1ZX6A 2RHUA 2DA9A 1HJDA 1SSHA 3PIOA 3QXEB 4FYXB 4F17A 1O9SA 2RNAA 3V8LA 2K2VA 3HRUA 4QVDA 5KYYB 3M56A 1KQSS 3OYNA 3EHQA 1G3WA 1UB4A 2QGFB 5GAOq 3QDRB 3CCMQ 2QTXA 3CMEA 5AYFA 2WSEE 3JCMV 1B34B 3F70A 2XDDA 1CKBA 1YP5A 2M0OA 4R0KA 1KD1U 2RB6A 2FPDA 3LYIA 5CQXA 2C0OA 2CP3A 4RCBA 2HMAA 3PMIA 3DB3A 1M2VA 1VQPA 1D0ZA 3VJPA 3OYYA 5GANh 2L3RA 4JLGA 3CD6T 3NPFA 4M7DA 5LJ3f 2YLCA 3ULRB 1UGQB 1RAHB 1VQ5T 4EPCA 2GFAA 2QYZA 4IUVA 1KD1R 2QK0A 2VVKA 3L2ZA 2DL5A 2J7IA 3KBGA 3OYJA 4GLMA 4DEXA 1JXOA 3RR6A 4M7DF 4WCIA 5M9OA 5GJWB 4M75B 4MZTA 1R77A 2QASA 4FT2A 5EG2A 2BIVA 2KAFA 2XDBA 1NPRA 1YIJT 3CC2Q 3MP8A 1RAGB 1MMAA 3CCQA 1IO6A 1YITQ 4FYWB 2CUBA 1RAIB 2E4HA 5CKBA 4HCBA 2ZPBB 3BFMA 4CC2A 5FWBA 5KCHA 4KH1B 1MMDA 3UWNA 3CCJA 4AG2C 4RUGA 2CKKA 3URGA 3OS0A 1OU8A 2QA4T 2F2WA 1VQLQ 2JS0A 2DNUA 2EJ9A 4F7UF 1VQNQ 1VQ4T 1W2BS 3L2QA 1H641 3JB9H 2KMTA 1IREB 1LNXA 2FPEA 2RM4A 2A0FB 2RI5A 2ZPEB 2DVJA 4A4KA 1AWXA 3ME9A 2EQMA 2SEMA 1NLPC 5GAMd 3OYBA 2KNBB 3CCRQ 3JCMf 4M75G 2FG0A 2J6KA 3CPWP 3RESA 4CC4B 2K3BA 1ZSZA 2QEXA 4HVUA 1MNDA 4C8QA 3JCMQ 5CCAA 1X27A 4RTZA 4KT0E 2RMOA 5L8RE 2XHCA 3J7AF 1VQ8T 1GRIA 4X1VA 2OX7A 3H6ZA 4M77A 2LJ0A 5GMKl 2QDYB 1AEYA 4J7FA 2V8IA 2EAYA 2G3RA 4M77F 3ER0A 1KC8R 2RI3A 1Q82C 3A8HB 1UG1A 2EW3A 2E1HA 4XTYA 1NYFA 3JCMP 3J80E 1QVFS 2G6FX 3OMGA 1OPKA 4D8DA 2WSFE 1SEMA 3VS3A 1VQ7Q 3FEOA 1ABQA 2DL4A 3MEAA 1VIFA 3WVEB 4NS5A 1YJ9A 1H3HA 2OTJQ 1HXDA 3HL8A 2J6OA 1K0SA 3HPWA 4FL6A 1TUCA 3GLXA 5FROA 1VYUA 2CP5A 1M90R 2K3XA 3M59A 4OMPA 4XTXA 4JDSA 4F04B 1WXTA 3MEVA 1M2VB 1WHJA 3JAME 1OQKA 2B8AA 8AT1B 4RTXA 4PJOA 1K4US 3M54A 1SRMA 2IIMA 2O9SA 2RHXA 1WA7A 1UGSB 1ZA1B 2COWA 1C1AA 1GCPA 1WX6A 3CBPA 2O9VA 1NJIR 4DEYA 2KQWA 4M7DB 3EHRA 4J5YA 3FLGA 2KXDA 3CCSA 2LT1A 2R58A 4NL2A 2DILA 3OB9A 3INZA 4XU1A 1K8AU 2VWFA 3FB9A 1TTHB 3HRSA 2KK4A 1T0JA 4HT9A 5D6XA 4BI3A 2LQNA 4J6YA 2VUBA 3P8DA 1RAAB 2VASA 2YWWA 3UA7A 3L2RA 2HQEA 2O2OA 2XICA 2KYMA 3EGDA 2DPPB 3KUFA 4F7UB 3CCLQ 1KD1C 3VS0A 3JV3A 3CCUQ 3HRTA 4AG1C 1ARKA 4J9HA 3EFOA 1D09B 2GQVA 4BY6C 3OYMA 4MDXA 4M7AD 3V7RA 4KGZB 4RG8A 1YN8A 2R5AA 3CC2T 3NHNA 1Q95G 4E7IA 1WJRA 4M7DG 4X9DA 1YITT 3OYDA 4Y91A 1VUBA 1YJWA 1S72Q 1HK9A 2MK5A 2RK1A 3O5ZA 1EIFA 1PSFA 4JZ3A 1WHMA 2E6ZA 1W4SA 3QYGB 1VQLT 3UT1A 4GLKA 3DKMA 4B6MA 5CIUA 5LJ3g 3OYFA 1VQNT 5LJ5d 1ZSZB 3REBB 2JMAA 4C8QB 3S3MA 3X28B 2JTFA 4HT8A 1YWOA 3CXCP 4F7UG 1AHJB 2F5TX 4M77B 4ORZA 4OB3B 5FU6B 4M78C 3G6EQ 1QLYA 1PSEA 5DLQE 2X51A 2CP0A 1M8VA 3SWNC 3S3OA 1K73U 2K9GA 1X6BA 5IT9E 4RMOA 5KYUA 2AZVA 2CGHA 2E70A 3G71A 3HTRA 3M4YA 4C92C 3M0TA 1FYNA 3GOXA 3CCEA 1WGSA 2HSPA 5CQYA 4N4GA 3CC4T 1N8RR 1Q81R 3E9FA 2LZ6B 2L3SA 1K9MU 1TWBA 2DYIA 3EG0A 2RHZA 3OYHA 3GIBA 1KC8C 2D9TA 1WHHA 1D1BA 4LDYA 3KFVA 3JCMg 3L42A 2DD4A 1JJ2P 1OYXA 4PJOB 3EGXA 5C0MA 2D6FA 4M77G 1VA7A 1EX4A 4C92D 1VQKA 2VYTA 1CSKA 1RUWA 2NYSA 2JUFA 2RF0A 5KCOA 3SB2A 1RI0A 2YUNA 4XU3A 4KH0B 4OMOA 1M90C 2C0TA 1UECA 4E7LA 2E3HA 1BIAA 1IXDA 2P84A 1OI1A 2FO0A 2CT3A 3JCMX 1SHGA 3VUBA 2MOXA 5GAMj 5I22A 4M7AE 5LJ3h 1QCNA 1PRLC 3CCMA 1Q7YU 1QKWA 3OSVA 1M2OA 5GANd 1NJIC 3JSCA 3CQTA 3EGDB 4HKEA 4ZGJB 2QTVA 1D0XA 5FRMA 2K79A 2H3JA 2FZGB 2Y90A 2E12A 2P0KA 2V26A 2DL3A 4FSXA 4EMKC 4PJOG 1Y0MA 1HSQA 3CD6Q 3GF5A 2EKHA 4A4HA 4PKCC 3CCVT 1VQ5Q 1KQSP 4J9EA 1YCSB 1I5OB 1A0NB 2EYYA 3HHTB 3A8GB 3M5AA 3Q1JA 2L3PA 2E6NA 2VXFA 2NWMA 4ZN1A 3QPHA 3X26B 2LVMA 2X3WD 1HYOA 4RTUA 4FCYA 4RTVA 3CCLT 3MKDA 1AD5A 3FIFA 3C12A 4GBQA 3CCUT 3MCAB 1S1NA 1ZUUA 1IHVA 1T3SA 3HFOA 1KFZA 5GAN5 4AFSC 2QQAA 2A28A 3M58A 2DFUA 3BY7A 4RTTA 3FJ5A 4X9CA 2RQWA 4II1A 3JCMh 4E47A 4E7ZA 1QVGS 2D8HA 3G4ST 1VQ6T 1S72T 3QIIA 2DEUA 2DETA 1ZQ1A 1WIEA 2E41A 4KULA 2MYSA 3CPWA 4ESRA 5GMKh 3GNGA 4C0DB 1VQNA 1GCQC 2KGTA 2ROLA 1ZUKA 1G3TA 2DZ9A 2ZPIB 3VS1A 3EG1A 2KVQG 2MMPA 3TREA 4FT4A 4Z88A 5KYUB 5GAOm 4ZGDB 4E7SA 1H3ZA 2LQ8A 2K6DA 4AFZC 2W10A 2X9HA 1E6HA 1RABB 2MWPA 3CCRA 2EQIA 1O75A 1M1GA 4OB0B 4IUPA 5A0GA 1OOTA 1X6GA 2L3QA 2IPOB 1VQ8Q 1TUGB 1W2BP 3N5BB 5I11A 4C8QD 3RMQA 2ATCB 3EGXB 4CC3A 4J8OA 3BE3A 3VUZA 5FWCA 4CI0C 2K3YA 4KGVB 3AHUA 1ZUYA 5KH6A 3UA6A 1KQ2A 2HL5C 4XU0A 4M78F 1VQOA 1PNJA 2R57A 1N8RC 1Q81C 2CP2A 4IURA 2E64A 4JJBA 5IN1A 2KDSA 3T9NA 2VXEA 4FYVB 2RA2A 5I2MA 2CZ6B 4OB1B 1VQ7A 1Z9ZA 2DO3A 8ATCB 3V7CA 1D1CA 5GAMf 2OTJA 4A54A 2M1HA 5LJ5j 1VQMT 4IKFA 4IUTA 1QW1A 1K9MC 4OMLA 2OTLT 2LCSA 2CYZB 3UPUA 1N9SA 1QVFP 2CP7A 1SF9A 2K5LA 3R6OA 2PUKB 4J7IA 2EVRA 3M53A 4NOYA 4QQDA 1NM7A 3A98A 1NPPA 2QQSA 1TH7A 3E19A 1YHQT 2RHYA 4UC4A 2LQWA 2RO0A 5GAMe 2LJ1A 3RIRA 1QWFA 2HNIA 1E7OA 3H0IA 2DXUA 2XU8A 4LUEA 1ZSGA 1WPYA 2Y4YA 4LDWA 1Q86U 4PL6A 1JU5C 2ZPFB 2JT4A 1K1ZA 3PVLA 1WXUA 1MNEA 2XD0A 3REAB 2KT1A 3FC3A 4N0AC 3HP9A 3M0PA 2MI6A 3ZEHA 3FDRA 1TSFA 4EMKA 1BBZA 1FMKA 1IZ6A 2LCCA 4LD6A 4XU2A 1VQ9T 4BY6B 2YRDA 4HVVA 3VS4A 3CCUA 1VOMA 1NE8A 1AWOA 2MAMA 2QAZA 3OS5A 3VV0A 3GPLA 1WQWA 1WFWA 3GP8A 2CP6A 4F7UA 2X3XD 3OS1A 4C8QE 2XK0A 3CXCA 1QKXA 1Y07A 2V8JA 1S72A 3LGFA 4Y92A 1ZLMA 4M4ZA 4M77E 2ESWA 2KSSA 2DXBA 2HQXA 4FYYB 4K11A 1KHIA 2F5KA 4A63B 2BTTA 5GANj 1UUEA 1IGUA 2FYKA 2BZYA 3CC7T 2HCKA 2Y4XA 2F69A 3L2UA 3WXMB 5DM7R 2HQHA 2L89A 2QG9B 2X35A 3G6EA 2FZCB 4JRQA 1ZHIA 5KYNA 5HKCA 4XTWA 2KBTA 3CEYA 3H41A 1DJ7B 3JCMc 1OPLA 4J9BA 1X6OA 2KT8A 1AZEA 4TVRA 2O01E 4BB7A 2JMCA 2DMOA 3UATA 3MEUA 3VKIA 1JJ2A 2NLUA 4J9CA 2KR3A 3CC4Q 2JTEA 1M27C 2LX9A 3L1AA 4MZMA 4PJOE 1QP3A 2ENMA 4LD9K 1YBYA 1OX8A 1QVPA 3CPFA 2PU9B 1BU1A 3M57A 4ZTJA 2ED0A 3PIPA 3JB9F 1E6GA 2KE9A 3C4SA 2VKNA 3I56Q 3META 1RACB 1KG1A 4RTYA 4QQGA 1CKAA 2FB7A 1U06A 3C0CA 4M78G 2V1RA 2L5QA 2DBMA 5DLOA 2HBPA 5LJ3d 4J83A 2EJFA 2VGNA 4LDXA 2RQRA 1W70A 4LUDA 2LJ3A 3CMAQ 3D7SB 4OMMA 1X2QA 2RH2A 3EFSA 2RI2A 3OW2S 4MZPA 1BCMA 2BUDA 2C0IA 1Y96A 4DOWA 2ZCFB 3NTKA 3PT9A 1KQSA 1RAEB 4BI8B 2YSQA 3RKYA 3LH5A 1ABOA 2DXTA 4BUGA 3QJ6A 1TU0B 4YTLA 3CCVQ 2HKNA 2MCNA 2KROA 2DYBA 4AFQC 4EMKB 2YLBA 1IHWA 1M9SA 4AMCA 4DBRA 4M7AC 2JM9A 2F1LA 3EGUA 5KE2A 1OULA 2DK3A 2I2LA 3V8KA 1PC0A 3CD6A 3MJXA 3R6NA 3A5ZB 1VQ5A 3MO8A 2QDLA 2J06A 2EPDA 2EYQA 1I5LA 1SKUB 4IIOA 1K8AR 3JCMd 4DBQA 1B07A 1XQHA 1LPLA 4XTUA 2HZYA 3UDCA 1RAFB 1YIJA 1TOVA 1WYXA 3RKXA 2LC4A 5HK3A 3OYKA 4ANJA 2DZCA 1IGQA 1T3LA 4XTVA 3G4SQ 4BD3A 1K0XA 3X20B 4EIKA 1VQ6Q 1D1AA 4RG2A 2RHIA 1M1FA 4RCCA 1Q86C 2F2XA 1VIEA 1I4K1 3NTHA 4LXCA 1GFDA 2JVVA 2K2MA 2QA4A 2QGGA 3FJPA 2FL7A 3CCJQ 2D0NA 1M3AA 4M75D 1VQ4A 4QW2A 5GAN2 3VRYA 1V1CA 2CH4W 3C94A 2BE7D 1M1KU 5C6SA 3QZ9B 1SHFA 2GQIA 2ZZDA 2P0QA 3RBBB 1W2BA 3NGPA 2H8HA 3I55Q 1QP2A 2RQUA 3H0HA 1KQ1A 2DAQA 1QVGP 5CKEA 2ZPHB 1U3OA 1YCYA 3RKWA 3M55A 1SSFA 5KE3A 4Z89A 4L5GA 2O4XA 4DQ2A 5A0DA 1K9AA 4WTOB 5GANe 1VQ8A 4QKUA 4A4FA 2EGAA 1N9RA 1QMCA 3OYAA 3BDLA 3H9NA 3U23A 3ZFJA 2C06A 2AT1B 3A8MB 1NEBA 2KYBA 2PUOB 5GMKm 3MPUB 2V8KA 3QG1A 1JBMA 2PVGB 1K73R 2Z0WA 4HCZA 2FHDA 1PHTA 3G1JA 3I56T 9ATCB 1Y96B 4Z02A 2RD1A 4AFUC 2DRMA 2OJ2A 1QVFA 1VQMQ 3JB9G 1YJ9Q 1JXMA 4L59A 1K9MR 2IG0A 1PM3A 1JB0E 2OTLQ 1ACMB 2DXCA 2FRWA 2XKOC 1TG0A 1QCFA 2E5QA 4PLIA 3RMSA 4C5EA 1MUZA 1RL2A 1UTIA 3CMAT 3OYEA 2GFUA 2H3EB 3ASKA 4B9XA 2RJEA 3E2UA 1ZA2B 4HCCA 1U1TA 1TXQA 5DY9A 2WSCE 1PG5B 3PFSA 4PLLA 4XTZA 3HFNA 4LNPA 3CMET 3VS6A 1YHQQ 5FW9A 2QQ9A 2JN0A 4A4EA 2PQWA 4M7DC 4FM4B 4E2FB 4F16A 1P92A 1VYTA 4BE1A 1X75C 2NUZA 1YI2Q 1FX7A 1QQJA 4M75E 5GAOr 1VQPT 4KUDK 1Q7YR 1AWJA 1UHFA 3ZL7C 2LNHB 1YJNQ 2MWOA 1WQ7A 2EBPA 2D0QB 4C5GA 4M7DD 2RPNA 4DBFA 3OYGA 3X25B 2A36A 2VV5A 1VQ9Q 3CBOA 3LWIA 2FPFA 4OP0A 2JXBA 1K8AC 1B3QA 2GTJA 2IVWA 3L2WA 2RJFA 3MHXA 3NTIA 3S6WA 4M7AA 3CC2A 1MMNA 3NMZC 3QHSA 4ZNXA 1HD3A 1QWEA 2YRVA 5LJ3j 3M0SA 1MV0B 1YITA 2PVOB 4FSSA 2HBWA 1BB9A 2VGMA 5HY6A 4M7AF 1BK2A 4ZGEB 1PD0A 3L2VA 4PJMA 1YJWQ 2RQTA 3QZ5B 2AIRB 1VQLA 3RNJA 3CCJT 2CS7A 2QQRA 2YUQA 4D8KA 1N5ZA 1NG2A 4DBHA 3CC7Q 2O4XB 4OVAA 5J3BA 4XQ3A 1WXBA 4LDUA 4L6V5 1KSWA 3OMCA 4C8QC 2BE9B 1UE9A 2KEAA 2MPXC 2CUDA 3WVDB 3I55T 3TEEA 2X4YA 4FW2A 4M77C 5FU6C 5CR2A 5D6YA 4WF2A 1SRLA 5CAIA 2RJCA 4BE2A 2AKKA 3SD4A 2HKQB 2XDPA 1Q82U 4VUBA 1M30A 3O8VA 1M3BA 3SHWA 1M1KC 2YT6A 2EKOA 1JJ2S 1OU9A 1C6VX 4M78A 1M5Q1 1Y57A 4M77D 2JNGA 1I1JA 1B7TA 3CC4A 4JS4A 1UJ0A 2GNCA 5EC7A 3LW5E 4OGCA 2FZKB 2OAUA 4KRTA 3SWNA 2HL3A 2LTOA 5GMKj 3X24B 1PKSA 4KBMB 2QI2A 4BACA 2EQUA 2JTMA 3OBYA 4BE0A 1K73C 1OX9A 4E7HA 1EFNA 2EFIA 4C92A 1I07A 1UGPB 1VQKQ 4PJOC 1AWWA 3HSBA 4J6WA 5IXFA 1YJ9T 4C92F 3M0UA 5AT1B 4M7DE 1WHLA 4LN2A 3PGGA 2LMJA 5FLXE 5HCKA 2KY9A 3VYGA 4RKUE 5FU7C 3CMAA 1LCKA 2P4TA 5J26A 4QQ6A 4JS5A 2DL7A 5CO7A 3QBYA 4PJOD 1NEGA 1R0CB 1U5SA 2J05A 4JRIA 4EDUA 2DTOA 1JEGA 3SDZA 1YFNA 2P0PA 2DF6A 2DIGA 5CKFA 3C95A 2DLPA 3IQLA 1U8RA 5J39A 3EG9A 1UFFA 2X4WA 3VS7A 5LL6S 3CCST 1PWTA 2KRSA 2QQBA 5IXBA 2EIFA 4F7UE 4OMNA 3CCVA 1WHKA 1YI2T 1FMVA 2HSEB 4M7AB 4C0FA 2LX7A 2MIOA 2CZ1B 3OW2P 1QCOA 1K76A 4ZTFA 1AOJA 1Q7YC 4JRPA 1YJNT 2JOYA 3V8JA 1V29B 3AT1B 2GTOA 3V7SA 1LOJA 5HK0A 3CCLA 2DERA 2ED1A 1D0YA 1WNLA 4FU6A 3H8ZA 1WZOA 1Q86R 2AKLA 2EYZA 4ME7A 2RK2A 4C0GA 4CC7A 3P8BB 4E6RA 3EH2A 3G4SA 2EGCA 1VQ6A 1FMWA 3EG2A 4N4HA 3DLMA 2YDLA 1YJWT 3QWXX 1MV3A 1Z9QA 2COZA 2HDAA 4M7AG 3GNFB 1QVGA 1N6AA 2PTKA 2DBKA 1OEBA 1PRMC 2E5KA 5LJ3e 1UHCA 4Y28E 4D6WA 4C0DC 4R55A 3LLRA 2NUPA 2CH4A 4ELYC 2JW4A 3SFMA 4PNOA 4P5NA 2EQJA 2O31A 4B9WA 4M78B 5KYXA 1EZZB 1LVKA 1UDLA 2PNIA 1NBEB 1ZBXA 2LP5A 3EH1A 5ECAA 5GAOp 2PVDB 3I55A 3QYHB 1OV3A 3PNWC 3VU3C 2EGEA 2E65A 1GCQA 3VRZA 3E9GA 1T0HA 3SWNB 4XAXB 2LT4A 2AHJB 1KC8U 3JCMW 2LCLA 4V2SA 2DJZA 1G2BA 2D8JA 3NFCA 2BKDN 2ZGWA 4C92B 1PKTA 1BI2A 2EQKA 2NUTA 2XG8D 1PD1A 4C8QF 5GAN3 1C0MA 3G71T 1ZBJA 5A0LA 3CCET 4KGXB 3QUIA 4J9IA 3OS2A 1M90U 1VQOQ 2GCXA 4Z8AA 5GJVB 4X34A 1BCOA 5LJ5f 2YHTA 4JPBW 2DTIA 1AZGB 3JCMe 4XK8E 1R0BG 3OYIA 1OZ3A 5IHKA 1BKBA 1AVZC 3OBWA 1VQKT 1LJOA 2GF7A 3A1PA 4JJNK 1PCXA 1NJIU 4PFOA 1VQMA 3EG9B 3MP1A 1KK7A 3VS5A 1RLQC 3PTAA 2QXFA 5GMKe 2YXYA 3TCJA 1W6XA 2OTLA 1WHGA 2X4XA 1XNIA 4HVWA 3I35A 1GL5A 4DOVA 3CMEQ 4C92G 1UJYA 4OF1A 2ZPGB 5IHNA 5LJ5e 4PFZA 2YUOA 3CCMT 3MEWA 1MHNA 1J3TA 4PJOF 5IAYA 1YHQA 4FW1A 1VQPQ 3PE0A 3G7ZA 1BYMA 5D6WA 5GAMg 2DX1A 2JJ9A 1NYGA 3H0FA 3A8OB 1YI2A 4JZ4A 2P4RA 1UGRB 2E3IA 1XOVA 2AZSA 4PJLA 2L0AA 2BZ8A 3QO3A 2GGRA 1YJNA 4ELZC 2K5FA 5D7UA 3OY9A 2J6FA 4ATOA 5I21A 1AT1B 2EJGA 3KXTA 2E10A 1VQ9A 4M75C 3J81E 5A2QE 5CKHA 3TVTA 1W1FA 1D3BA 1X01A 3M0RA 1SPKA 1TS9A 4PJJA 2RN8A 3CCQQ 3LX7A 4J9DA 6AT1B 3DB4A 2NUPB 2KXCA 3JCMJ 2EWNA 3LH0A 2HEQA 4Q5WA 5GANf 3A8LB 4N0AA 5KYXB 3JRZA 3CPWS 2YRCA 3UF4A 5KYWA 4R56A 2B86A 1NLOC 4OMFB 2HAXA 4E7JA 2O88A 4QVCA 3I5SA 3OA6A 3FRNA 3SEMA 5GAN4 3OYCA 2MF2A 1KIKA 5IHIA 2AK5A 2KRNA 1G3YA 4N4IA 2CREA 1WJSA 1I8FA 3I5RA 2K5IA 1M3CA 2ABLA 1I81A 3PVQA 3CC7A 2EYXA 3E1SA 3GBQA 5GAOl 1WDXA 2COYA 1GBQA 1WLPB 2NUTB 3MP6A 1M4ZA 2F2VA 4C0ZA 2DRKA 4FIBA 5GAN7 4DA4A 3QDFA 3JCMb 2QEXQ 1M1KR 2LQKA 3CCRT 2K57A 1N8RU 1Q81U 1UEBA 2X4JA 4BDZA 4LE9A 4A4GA 2DKGA 5CKDA 1JRIA 1NZ9A 5GAMh 3EFRA 1U1SA 3HKSA 2DM1A 2VB6A 2YUPA 4M78D 3VYHB 2I0NA 4E7KA 4MMKA 4MDWA 2BZXA 2RQVA 2M9UA 2WACA 4EMHA 3ZBDA 1VQOT 3RERA 2CSQA 4C8QG 2A08A 1M8MA 2W0ZA 2ECZA 1R8OB 4ZN3A 1GBRA 1G3SA 4JJCA 4GY5A 3LWHA 4PFPA 1VQ7T 2JM8A 2L2PA 2K4YA 2JZ2A 4BI4A 4QT7A 4PJNA 5L23A 2OTJT 1KHCA 4JUVA 1BI0A 1YNZA 5FU7B 1JQQA 2DVEA 2OAWA 4NL3A 3DLLA 2ZAEA 2DJQA 3RDVA 3OW2A 3CCSQ 2R5MA 2OI3A 5LJ5g 1Y7XA 5CVIA 3CBMA 5FRNA 2LDMA 2A3LA 5GAOn 3I9QA 4EMGA 2LRQA 1X2KA 4MMLA 1G5VA 5KYYA 4HA8A 4HCKA 3QSUA 5CK9A 3QJYA 4CRIA 4IIMA 1D3BB 3VS2A 4A53A 1BIBA 2JS2A 4OMQA 5GAN6 3EFOB 1B34A 3OYLA 2KRMA 3OSSC 1JO8A 1FXXA 4J6XA 4BDYA 5GAN8 3M9QA 4JLIA 4O6JA 4J9GA 5KYWB 2FVUA 2M51A 5I2SA 2DE0X 4IUUA 3TQ7P 1V76A 3EAEA 1OZ2A 1YIJQ 1VYVA 4OGEA 3CCQT 1G83A 4C5HA
chains in the Genus database with same CATH topology
1YWPA 3EG3A 1CKAA 3VS7A 1RI9A 1PWTA 1U06A 2KRSA 3C0CA 5IXBA 2K7AA 2V1RA 2DBMA 4OMNA 4F14A 5IH2A 1H8KA 1KJWA 2A37A 2LX7A 2MIOA 2RQRA 1W70A 3THKA 2FEIA 2K9GA 4LUDA 1K76A 1AOJA 1X6BA 2LJ3A 4OMMA 1UGVA 1X2QA 2M0YA 2AZVA 3M0TA 1FYNA 2GTOA 2HSPA 3TSZA 2C0IA 3TSWA 2LZ6B 2L3SA 4JJDA 2PZ1A 2ED1A 1GFCA 3EG0A 2CT4A 1TUDA 2YSQA 3LH5A 2FRYA 3KFVA 1ABOA 2AKLA 2EYZA 4CC7A 2D1XA 1VA7A 2MCNA 2KROA 1CSKA 2SRCA 4E6RA 1RUWA 2GBQA 2DYBA 2EGCA 4AFQC 2RF0A 3M0QA 3EG2A 2YUNA 2JM9A 2YDLA 3EGUA 3QWXX 4OMOA 1I0CA 3R6NA 1MV3A 1Z9QA 2HDAA 4HXJA 2C0TA 4RTWA 1UECA 2QDLA 2J06A 2PTKA 3QWYA 2EPDA 2FO0A 2XMFA 1X43A 2CT3A 1OEBA 1PRMC 1SHGA 2DBKA 2DL8A 2E5KA 1UHCA 2MOXA 4IIOA 5I22A 1B07A 2CH4A 2JW4A 1PRLC 2O31A 1QKWA 4J9FA 1WYXA 1UDLA 2PNIA 2LP5A 5ECAA 1RLPC 2CSIA 3CQTA 1OV3A 1T3LA 2V1QA 1K0XA 4EIKA 2K79A 2CDTA 2EGEA 1GCQA 2ROTA 3VRZA 2DL3A 1T0HA 1X69A 2EYWA 1Y0MA 2F2XA 1HSQA 1H92A 1GFDA 2K2MA 1WI7A 1ZX6A 2EKHA 2DA9A 1G2BA 1HJDA 4J9EA 1SSHA 1YCSB 2D0NA 2D8JA 1M3AA 1A0NB 2EYYA 4F17A 3VRYA 2RNAA 1PKTA 1V1CA 2CH4W 2L3PA 3EHQA 2NWMA 1SHFA 1ZBJA 2GQIA 2X3WD 4RTUA 4J9IA 4RTVA 3RBBB 3NGPA 1AD5A 2H8HA 4Z8AA 5GJVB 4GBQA 1CKBA 1S1NA 1YP5A 1ZUUA 4R0KA 2RQUA 3H0HA 2FPDA 1T3SA 4JPBW 1KFZA 2C0OA 4AFSC 1AZGB 2A28A 1U3OA 4RTTA 3FJ5A 2RQWA 5IHKA 1AVZC 4Z89A 2D8HA 1K9AA 1WIEA 3VS5A 2EGAA 1RLQC 1W6XA 3U23A 3NPFA 4HVWA 3I35A 4ESRA 3ULRB 1GL5A 2VVKA 1GCQC 2DL5A 2KGTA 2J7IA 2ROLA 1UJYA 1ZUKA 4GLMA 1NEBA 1JXOA 2KYBA 4DEXA 4WCIA 5GJWB 5IHNA 3VS1A 3EG1A 4Z88A 2YUOA 1PHTA 1J3TA 2K6DA 4AFZC 2W10A 1E6HA 1IO6A 3PE0A 2EQIA 4AFUC 2DRMA 2CUBA 2OJ2A 1OOTA 1X6GA 2DX1A 2L3QA 1NYGA 1JXMA 4CC2A 5FWBA 3H0FA 4JZ4A 2P4RA 4AG2C 4RUGA 5I11A 2FRWA 2F2WA 1TG0A 1QCFA 1XOVA 4CC3A 2AZSA 1MUZA 1UTIA 2JS0A 2DNUA 2L0AA 2BZ8A 2GGRA 5FWCA 2J6FA 1ZUYA 2FPEA 3UA6A 2DVJA 1PNJA 1AWXA 4LNPA 3TVTA 1W1FA 2SEMA 1NLPC 3M0RA 3VS6A 1SPKA 2RN8A 2KNBB 5FW9A 4J9DA 2FG0A 2J6KA 4JJBA 4F16A 2KXCA 4CC4B 1VYTA 2K3BA 2HEQA 2NUZA 4HVUA 3UF4A 1Z9ZA 2B86A 1NLOC 1AWJA 2O88A 1UHFA 1X27A 3I5SA 2RMOA 4RTZA 3ZL7C 2LNHB 1GRIA 3SEMA 4X1VA 2EBPA 1KIKA 5IHIA 2RPNA 4OMLA 2AK5A 2KRNA 2LJ0A 2CREA 2LCSA 2A36A 3I5RA 1AEYA 1M3CA 2ABLA 3PVQA 2FPFA 2JXBA 2EYXA 1B3QA 3GBQA 2GTJA 1WDXA 1UG1A 2EW3A 2EVRA 1NYFA 1NM7A 1GBQA 1WLPB 3NMZC 3A98A 2F2VA 2G6FX 4ZNXA 1HD3A 1QWEA 2DRKA 3M0SA 1MV0B 1OPKA 4D8DA 4FSSA 1SEMA 2HBWA 1BB9A 3VS3A 1ABQA 1BK2A 2DL4A 2LQWA 1H3HA 2J6OA 4LE9A 1K0SA 2LJ1A 2RQTA 1TUCA 1VYUA 1QWFA 1E7OA 3H0IA 3RNJA 4LUEA 1ZSGA 4OMPA 2YUQA 4D8KA 1N5ZA 1WXTA 1JU5C 1NG2A 2JT4A 2DM1A 1K1ZA 2YUPA 4RTXA 3PVLA 2I0NA 1WXUA 1K4US 3REAB 2KT1A 2IIMA 1SRMA 1WXBA 1WA7A 2O9SA 2BZXA 3M0PA 1KSWA 2RQVA 1GCPA 1WX6A 1BBZA 1UE9A 1FMKA 2O9VA 4DEYA 2KEAA 4HVVA 3VS4A 2CUDA 2CSQA 3EHRA 2A08A 1M8MA 1AWOA 2KXDA 2W0ZA 2ECZA 1WFWA 2DILA 1GBRA 1SRLA 2VWFA 2AKKA 2X3XD 4JJCA 1M30A 1T0JA 1QKXA 2LQNA 1M3BA 3SHWA 2JM8A 2YT6A 2L2PA 4Y92A 4QT7A 5L23A 1ZLMA 4M4ZA 3UA7A 2ESWA 1Y57A 1YNZA 1I1JA 1JQQA 4K11A 2OAWA 2O2OA 2KYMA 1UJ0A 2GNCA 2DJQA 5EC7A 4A63B 2BTTA 1UUEA 3VS0A 3JV3A 4KRTA 2BZYA 4AG1C 1ARKA 4J9HA 2HCKA 1PKSA 2OI3A 1YN8A 1EFNA 3NHNA 3I9QA 1X2KA 1I07A 4HCKA 1AWWA 4IIMA 5IXFA 2KBTA 3H41A 3VS2A 3M0UA 2JS2A 4OMQA 3O5ZA 1OPLA 4J9BA 1AZEA 2KT8A 4JZ3A 4LN2A 2LMJA 2KRMA 2JMCA 2DMOA 5HCKA 3UATA 4J9CA 2KR3A 2JTEA 1M27C 1JO8A 1LCKA 3REBB 2DL7A 2JMAA 4J9GA 1NEGA 2ENMA 1U5SA 2J05A 2M51A 2DE0X 1YWOA 1BU1A 1JEGA 2DF6A 2ED0A 2DLPA 3IQLA 1E6GA 1VYVA 2KE9A 4ORZA 1G83A 2VKNA 1QLYA 1UFFA 4RTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWP A;  3EG3 A;  1CKA A;  3VS7 A;  1RI9 A;  1PWT A;  1U06 A;  2KRS A;  3C0C A;  5IXB A;  2K7A A;  2V1R A;  2DBM A;  4OMN A;  4F14 A;  5IH2 A;  1H8K A;  1KJW A;  2A37 A;  2LX7 A;  2MIO A;  2RQR A;  1W70 A;  3THK A;  2FEI A;  2K9G A;  4LUD A;  1K76 A;  1AOJ A;  1X6B A;  2LJ3 A;  4OMM A;  1UGV A;  1X2Q A;  2M0Y A;  2AZV A;  3M0T A;  1FYN A;  2GTO A;  2HSP A;  3TSZ A;  2C0I A;  3TSW A;  2LZ6 B;  2L3S A;  4JJD A;  2PZ1 A;  2ED1 A;  1GFC A;  3EG0 A;  2CT4 A;  1TUD A;  2YSQ A;  3LH5 A;  2FRY A;  3KFV A;  1ABO A;  2AKL A;  2EYZ A;  4CC7 A;  2D1X A;  1VA7 A;  2MCN A;  2KRO A;  1CSK A;  2SRC A;  4E6R A;  1RUW A;  2GBQ A;  2DYB A;  2EGC A;  4AFQ C;  2RF0 A;  3M0Q A;  3EG2 A;  2YUN A;  2JM9 A;  2YDL A;  3EGU A;  3QWX X;  4OMO A;  1I0C A;  3R6N A;  1MV3 A;  1Z9Q A;  2HDA A;  4HXJ A;  2C0T A;  4RTW A;  1UEC A;  2QDL A;  2J06 A;  2PTK A;  3QWY A;  2EPD A;  2FO0 A;  2XMF A;  1X43 A;  2CT3 A;  1OEB A;  1PRM C;  1SHG A;  2DBK A;  2DL8 A;  2E5K A;  1UHC A;  2MOX A;  4IIO A;  5I22 A;  1B07 A;  2CH4 A;  2JW4 A;  1PRL C;  2O31 A;  1QKW A;  4J9F A;  1WYX A;  1UDL A;  2PNI A;  2LP5 A;  5ECA A;  1RLP C;  2CSI A;  3CQT A;  1OV3 A;  1T3L A;  2V1Q A;  1K0X A;  4EIK A;  2K79 A;  2CDT A;  2EGE A;  1GCQ A;  2ROT A;  3VRZ A;  2DL3 A;  1T0H A;  1X69 A;  2EYW A;  1Y0M A;  2F2X A;  1HSQ A;  1H92 A;  1GFD A;  2K2M A;  1WI7 A;  1ZX6 A;  2EKH A;  2DA9 A;  1G2B A;  1HJD A;  4J9E A;  1SSH A;  1YCS B;  2D0N A;  2D8J A;  1M3A A;  1A0N B;  2EYY A;  4F17 A;  3VRY A;  2RNA A;  1PKT A;  1V1C A;  2CH4 W;  2L3P A;  3EHQ A;  2NWM A;  1SHF A;  1ZBJ A;  2GQI A;  2X3W D;  4RTU A;  4J9I A;  4RTV A;  3RBB B;  3NGP A;  1AD5 A;  2H8H A;  4Z8A A;  5GJV B;  4GBQ A;  1CKB A;  1S1N A;  1YP5 A;  1ZUU A;  4R0K A;  2RQU A;  3H0H A;  2FPD A;  1T3S A;  4JPB W;  1KFZ A;  2C0O A;  4AFS C;  1AZG B;  2A28 A;  1U3O A;  4RTT A;  3FJ5 A;  2RQW A;  5IHK A;  1AVZ C;  4Z89 A;  2D8H A;  1K9A A;  1WIE A;  3VS5 A;  2EGA A;  1RLQ C;  1W6X A;  3U23 A;  3NPF A;  4HVW A;  3I35 A;  4ESR A;  3ULR B;  1GL5 A;  2VVK A;  1GCQ C;  2DL5 A;  2KGT A;  2J7I A;  2ROL A;  1UJY A;  1ZUK A;  4GLM A;  1NEB A;  1JXO A;  2KYB A;  4DEX A;  4WCI A;  5GJW B;  5IHN A;  3VS1 A;  3EG1 A;  4Z88 A;  2YUO A;  1PHT A;  1J3T A;  2K6D A;  4AFZ C;  2W10 A;  1E6H A;  1IO6 A;  3PE0 A;  2EQI A;  4AFU C;  2DRM A;  2CUB A;  2OJ2 A;  1OOT A;  1X6G A;  2DX1 A;  2L3Q A;  1NYG A;  1JXM A;  4CC2 A;  5FWB A;  3H0F A;  4JZ4 A;  2P4R A;  4AG2 C;  4RUG A;  5I11 A;  2FRW A;  2F2W A;  1TG0 A;  1QCF A;  1XOV A;  4CC3 A;  2AZS A;  1MUZ A;  1UTI A;  2JS0 A;  2DNU A;  2L0A A;  2BZ8 A;  2GGR A;  5FWC A;  2J6F A;  1ZUY A;  2FPE A;  3UA6 A;  2DVJ A;  1PNJ A;  1AWX A;  4LNP A;  3TVT A;  1W1F A;  2SEM A;  1NLP C;  3M0R A;  3VS6 A;  1SPK A;  2RN8 A;  2KNB B;  5FW9 A;  4J9D A;  2FG0 A;  2J6K A;  4JJB A;  4F16 A;  2KXC A;  4CC4 B;  1VYT A;  2K3B A;  2HEQ A;  2NUZ A;  4HVU A;  3UF4 A;  1Z9Z A;  2B86 A;  1NLO C;  1AWJ A;  2O88 A;  1UHF A;  1X27 A;  3I5S A;  2RMO A;  4RTZ A;  3ZL7 C;  2LNH B;  1GRI A;  3SEM A;  4X1V A;  2EBP A;  1KIK A;  5IHI A;  2RPN A;  4OML A;  2AK5 A;  2KRN A;  2LJ0 A;  2CRE A;  2LCS A;  2A36 A;  3I5R A;  1AEY A;  1M3C A;  2ABL A;  3PVQ A;  2FPF A;  2JXB A;  2EYX A;  1B3Q A;  3GBQ A;  2GTJ A;  1WDX A;  1UG1 A;  2EW3 A;  2EVR A;  1NYF A;  1NM7 A;  1GBQ A;  1WLP B;  3NMZ C;  3A98 A;  2F2V A;  2G6F X;  4ZNX A;  1HD3 A;  1QWE A;  2DRK A;  3M0S A;  1MV0 B;  1OPK A;  4D8D A;  4FSS A;  1SEM A;  2HBW A;  1BB9 A;  3VS3 A;  1ABQ A;  1BK2 A;  2DL4 A;  2LQW A;  1H3H A;  2J6O A;  4LE9 A;  1K0S A;  2LJ1 A;  2RQT A;  1TUC A;  1VYU A;  1QWF A;  1E7O A;  3H0I A;  3RNJ A;  4LUE A;  1ZSG A;  4OMP A;  2YUQ A;  4D8K A;  1N5Z A;  1WXT A;  1JU5 C;  1NG2 A;  2JT4 A;  2DM1 A;  1K1Z A;  2YUP A;  4RTX A;  3PVL A;  2I0N A;  1WXU A;  1K4U S;  3REA B;  2KT1 A;  2IIM A;  1SRM A;  1WXB A;  1WA7 A;  2O9S A;  2BZX A;  3M0P A;  1KSW A;  2RQV A;  1GCP A;  1WX6 A;  1BBZ A;  1UE9 A;  1FMK A;  2O9V A;  4DEY A;  2KEA A;  4HVV A;  3VS4 A;  2CUD A;  2CSQ A;  3EHR A;  2A08 A;  1M8M A;  1AWO A;  2KXD A;  2W0Z A;  2ECZ A;  1WFW A;  2DIL A;  1GBR A;  1SRL A;  2VWF A;  2AKK A;  2X3X D;  4JJC A;  1M30 A;  1T0J A;  1QKX A;  2LQN A;  1M3B A;  3SHW A;  2JM8 A;  2YT6 A;  2L2P A;  4Y92 A;  4QT7 A;  5L23 A;  1ZLM A;  4M4Z A;  3UA7 A;  2ESW A;  1Y57 A;  1YNZ A;  1I1J A;  1JQQ A;  4K11 A;  2OAW A;  2O2O A;  2KYM A;  1UJ0 A;  2GNC A;  2DJQ A;  5EC7 A;  4A63 B;  2BTT A;  1UUE A;  3VS0 A;  3JV3 A;  4KRT A;  2BZY A;  4AG1 C;  1ARK A;  4J9H A;  2HCK A;  1PKS A;  2OI3 A;  1YN8 A;  1EFN A;  3NHN A;  3I9Q A;  1X2K A;  1I07 A;  4HCK A;  1AWW A;  4IIM A;  5IXF A;  2KBT A;  3H41 A;  3VS2 A;  3M0U A;  2JS2 A;  4OMQ A;  3O5Z A;  1OPL A;  4J9B A;  1AZE A;  2KT8 A;  4JZ3 A;  4LN2 A;  2LMJ A;  2KRM A;  2JMC A;  2DMO A;  5HCK A;  3UAT A;  4J9C A;  2KR3 A;  2JTE A;  1M27 C;  1JO8 A;  1LCK A;  3REB B;  2DL7 A;  2JMA A;  4J9G A;  1NEG A;  2ENM A;  1U5S A;  2J05 A;  2M51 A;  2DE0 X;  1YWO A;  1BU1 A;  1JEG A;  2DF6 A;  2ED0 A;  2DLP A;  3IQL A;  1E6G A;  1VYV A;  2KE9 A;  4ORZ A;  1G83 A;  2VKN A;  1QLY A;  1UFF A;  4RTY A; 
#chains in the Genus database with same CATH topology
 3CXC S;  1YWP A;  3EG3 A;  1BI1 A;  1RI9 A;  3BW1 A;  4JRK A;  4PK4 A;  1XTD A;  2K7A A;  3JB9 I;  4F14 A;  5IH2 A;  1H8K A;  1KJW A;  1MGQ A;  3PMT A;  2A37 A;  2QA4 Q;  1IRX A;  3THK A;  1MMG A;  2FEI A;  4M78 E;  4M75 A;  2DTH A;  1UGV A;  3JB9 J;  2M0Y A;  2VC8 A;  1VQ4 Q;  2M02 A;  1IB8 A;  1Y71 A;  4IUQ A;  3P8H A;  2XI9 A;  1F1B B;  4O5V A;  1ZSZ C;  1SG5 A;  4M75 F;  3TSZ A;  5GMK i;  3TSW A;  1BI3 A;  2RJD A;  4JJD A;  2PZ1 A;  1GFC A;  4KUI A;  2CT4 A;  1TUD A;  2M16 A;  2DEQ A;  2FRY A;  3OQ5 A;  4C5I A;  2A7Y A;  1G8X A;  2D1X A;  4C92 E;  2XID A;  5LJ5 h;  2SRC A;  2QEX T;  2GBQ A;  2LNV A;  3G6E T;  3M0Q A;  5GAN g;  4LDV A;  3LGL A;  4AT1 B;  3BDU A;  1I0C A;  3TU4 K;  1FWZ A;  3G71 Q;  4HXJ A;  4RTW A;  3CCE Q;  3QWY A;  2L8D A;  2XMF A;  1X43 A;  2DL8 A;  3RUX A;  1GXI E;  3JB9 D;  7AT1 B;  1Q82 R;  1RAD B;  4QVZ A;  2CZ0 B;  1WJQ A;  4J9F A;  2DD5 A;  3S3N A;  2CZ7 B;  3M4G A;  3I56 A;  1RLP C;  3QKJ A;  2CSI A;  4OB2 B;  1N27 A;  2V1Q A;  2CDT A;  2ROT A;  1XJW B;  1X69 A;  2EYW A;  2KI7 A;  1H92 A;  2DIQ A;  2HD0 A;  1WI7 A;  1ZX6 A;  2RHU A;  2DA9 A;  1HJD A;  1SSH A;  3PIO A;  3QXE B;  4FYX B;  4F17 A;  1O9S A;  2RNA A;  3V8L A;  2K2V A;  3HRU A;  4QVD A;  5KYY B;  3M56 A;  1KQS S;  3OYN A;  3EHQ A;  1G3W A;  1UB4 A;  2QGF B;  5GAO q;  3QDR B;  3CCM Q;  2QTX A;  3CME A;  5AYF A;  2WSE E;  3JCM V;  1B34 B;  3F70 A;  2XDD A;  1CKB A;  1YP5 A;  2M0O A;  4R0K A;  1KD1 U;  2RB6 A;  2FPD A;  3LYI A;  5CQX A;  2C0O A;  2CP3 A;  4RCB A;  2HMA A;  3PMI A;  3DB3 A;  1M2V A;  1VQP A;  1D0Z A;  3VJP A;  3OYY A;  5GAN h;  2L3R A;  4JLG A;  3CD6 T;  3NPF A;  4M7D A;  5LJ3 f;  2YLC A;  3ULR B;  1UGQ B;  1RAH B;  1VQ5 T;  4EPC A;  2GFA A;  2QYZ A;  4IUV A;  1KD1 R;  2QK0 A;  2VVK A;  3L2Z A;  2DL5 A;  2J7I A;  3KBG A;  3OYJ A;  4GLM A;  4DEX A;  1JXO A;  3RR6 A;  4M7D F;  4WCI A;  5M9O A;  5GJW B;  4M75 B;  4MZT A;  1R77 A;  2QAS A;  4FT2 A;  5EG2 A;  2BIV A;  2KAF A;  2XDB A;  1NPR A;  1YIJ T;  3CC2 Q;  3MP8 A;  1RAG B;  1MMA A;  3CCQ A;  1IO6 A;  1YIT Q;  4FYW B;  2CUB A;  1RAI B;  2E4H A;  5CKB A;  4HCB A;  2ZPB B;  3BFM A;  4CC2 A;  5FWB A;  5KCH A;  4KH1 B;  1MMD A;  3UWN A;  3CCJ A;  4AG2 C;  4RUG A;  2CKK A;  3URG A;  3OS0 A;  1OU8 A;  2QA4 T;  2F2W A;  1VQL Q;  2JS0 A;  2DNU A;  2EJ9 A;  4F7U F;  1VQN Q;  1VQ4 T;  1W2B S;  3L2Q A;  1H64 1;  3JB9 H;  2KMT A;  1IRE B;  1LNX A;  2FPE A;  2RM4 A;  2A0F B;  2RI5 A;  2ZPE B;  2DVJ A;  4A4K A;  1AWX A;  3ME9 A;  2EQM A;  2SEM A;  1NLP C;  5GAM d;  3OYB A;  2KNB B;  3CCR Q;  3JCM f;  4M75 G;  2FG0 A;  2J6K A;  3CPW P;  3RES A;  4CC4 B;  2K3B A;  1ZSZ A;  2QEX A;  4HVU A;  1MND A;  4C8Q A;  3JCM Q;  5CCA A;  1X27 A;  4RTZ A;  4KT0 E;  2RMO A;  5L8R E;  2XHC A;  3J7A F;  1VQ8 T;  1GRI A;  4X1V A;  2OX7 A;  3H6Z A;  4M77 A;  2LJ0 A;  5GMK l;  2QDY B;  1AEY A;  4J7F A;  2V8I A;  2EAY A;  2G3R A;  4M77 F;  3ER0 A;  1KC8 R;  2RI3 A;  1Q82 C;  3A8H B;  1UG1 A;  2EW3 A;  2E1H A;  4XTY A;  1NYF A;  3JCM P;  3J80 E;  1QVF S;  2G6F X;  3OMG A;  1OPK A;  4D8D A;  2WSF E;  1SEM A;  3VS3 A;  1VQ7 Q;  3FEO A;  1ABQ A;  2DL4 A;  3MEA A;  1VIF A;  3WVE B;  4NS5 A;  1YJ9 A;  1H3H A;  2OTJ Q;  1HXD A;  3HL8 A;  2J6O A;  1K0S A;  3HPW A;  4FL6 A;  1TUC A;  3GLX A;  5FRO A;  1VYU A;  2CP5 A;  1M90 R;  2K3X A;  3M59 A;  4OMP A;  4XTX A;  4JDS A;  4F04 B;  1WXT A;  3MEV A;  1M2V B;  1WHJ A;  3JAM E;  1OQK A;  2B8A A;  8AT1 B;  4RTX A;  4PJO A;  1K4U S;  3M54 A;  1SRM A;  2IIM A;  2O9S A;  2RHX A;  1WA7 A;  1UGS B;  1ZA1 B;  2COW A;  1C1A A;  1GCP A;  1WX6 A;  3CBP A;  2O9V A;  1NJI R;  4DEY A;  2KQW A;  4M7D B;  3EHR A;  4J5Y A;  3FLG A;  2KXD A;  3CCS A;  2LT1 A;  2R58 A;  4NL2 A;  2DIL A;  3OB9 A;  3INZ A;  4XU1 A;  1K8A U;  2VWF A;  3FB9 A;  1TTH B;  3HRS A;  2KK4 A;  1T0J A;  4HT9 A;  5D6X A;  4BI3 A;  2LQN A;  4J6Y A;  2VUB A;  3P8D A;  1RAA B;  2VAS A;  2YWW A;  3UA7 A;  3L2R A;  2HQE A;  2O2O A;  2XIC A;  2KYM A;  3EGD A;  2DPP B;  3KUF A;  4F7U B;  3CCL Q;  1KD1 C;  3VS0 A;  3JV3 A;  3CCU Q;  3HRT A;  4AG1 C;  1ARK A;  4J9H A;  3EFO A;  1D09 B;  2GQV A;  4BY6 C;  3OYM A;  4MDX A;  4M7A D;  3V7R A;  4KGZ B;  4RG8 A;  1YN8 A;  2R5A A;  3CC2 T;  3NHN A;  1Q95 G;  4E7I A;  1WJR A;  4M7D G;  4X9D A;  1YIT T;  3OYD A;  4Y91 A;  1VUB A;  1YJW A;  1S72 Q;  1HK9 A;  2MK5 A;  2RK1 A;  3O5Z A;  1EIF A;  1PSF A;  4JZ3 A;  1WHM A;  2E6Z A;  1W4S A;  3QYG B;  1VQL T;  3UT1 A;  4GLK A;  3DKM A;  4B6M A;  5CIU A;  5LJ3 g;  3OYF A;  1VQN T;  5LJ5 d;  1ZSZ B;  3REB B;  2JMA A;  4C8Q B;  3S3M A;  3X28 B;  2JTF A;  4HT8 A;  1YWO A;  3CXC P;  4F7U G;  1AHJ B;  2F5T X;  4M77 B;  4ORZ A;  4OB3 B;  5FU6 B;  4M78 C;  3G6E Q;  1QLY A;  1PSE A;  5DLQ E;  2X51 A;  2CP0 A;  1M8V A;  3SWN C;  3S3O A;  1K73 U;  2K9G A;  1X6B A;  5IT9 E;  4RMO A;  5KYU A;  2AZV A;  2CGH A;  2E70 A;  3G71 A;  3HTR A;  3M4Y A;  4C92 C;  3M0T A;  1FYN A;  3GOX A;  3CCE A;  1WGS A;  2HSP A;  5CQY A;  4N4G A;  3CC4 T;  1N8R R;  1Q81 R;  3E9F A;  2LZ6 B;  2L3S A;  1K9M U;  1TWB A;  2DYI A;  3EG0 A;  2RHZ A;  3OYH A;  3GIB A;  1KC8 C;  2D9T A;  1WHH A;  1D1B A;  4LDY A;  3KFV A;  3JCM g;  3L42 A;  2DD4 A;  1JJ2 P;  1OYX A;  4PJO B;  3EGX A;  5C0M A;  2D6F A;  4M77 G;  1VA7 A;  1EX4 A;  4C92 D;  1VQK A;  2VYT A;  1CSK A;  1RUW A;  2NYS A;  2JUF A;  2RF0 A;  5KCO A;  3SB2 A;  1RI0 A;  2YUN A;  4XU3 A;  4KH0 B;  4OMO A;  1M90 C;  2C0T A;  1UEC A;  4E7L A;  2E3H A;  1BIA A;  1IXD A;  2P84 A;  1OI1 A;  2FO0 A;  2CT3 A;  3JCM X;  1SHG A;  3VUB A;  2MOX A;  5GAM j;  5I22 A;  4M7A E;  5LJ3 h;  1QCN A;  1PRL C;  3CCM A;  1Q7Y U;  1QKW A;  3OSV A;  1M2O A;  5GAN d;  1NJI C;  3JSC A;  3CQT A;  3EGD B;  4HKE A;  4ZGJ B;  2QTV A;  1D0X A;  5FRM A;  2K79 A;  2H3J A;  2FZG B;  2Y90 A;  2E12 A;  2P0K A;  2V26 A;  2DL3 A;  4FSX A;  4EMK C;  4PJO G;  1Y0M A;  1HSQ A;  3CD6 Q;  3GF5 A;  2EKH A;  4A4H A;  4PKC C;  3CCV T;  1VQ5 Q;  1KQS P;  4J9E A;  1YCS B;  1I5O B;  1A0N B;  2EYY A;  3HHT B;  3A8G B;  3M5A A;  3Q1J A;  2L3P A;  2E6N A;  2VXF A;  2NWM A;  4ZN1 A;  3QPH A;  3X26 B;  2LVM A;  2X3W D;  1HYO A;  4RTU A;  4FCY A;  4RTV A;  3CCL T;  3MKD A;  1AD5 A;  3FIF A;  3C12 A;  4GBQ A;  3CCU T;  3MCA B;  1S1N A;  1ZUU A;  1IHV A;  1T3S A;  3HFO A;  1KFZ A;  5GAN 5;  4AFS C;  2QQA A;  2A28 A;  3M58 A;  2DFU A;  3BY7 A;  4RTT A;  3FJ5 A;  4X9C A;  2RQW A;  4II1 A;  3JCM h;  4E47 A;  4E7Z A;  1QVG S;  2D8H A;  3G4S T;  1VQ6 T;  1S72 T;  3QII A;  2DEU A;  2DET A;  1ZQ1 A;  1WIE A;  2E41 A;  4KUL A;  2MYS A;  3CPW A;  4ESR A;  5GMK h;  3GNG A;  4C0D B;  1VQN A;  1GCQ C;  2KGT A;  2ROL A;  1ZUK A;  1G3T A;  2DZ9 A;  2ZPI B;  3VS1 A;  3EG1 A;  2KVQ G;  2MMP A;  3TRE A;  4FT4 A;  4Z88 A;  5KYU B;  5GAO m;  4ZGD B;  4E7S A;  1H3Z A;  2LQ8 A;  2K6D A;  4AFZ C;  2W10 A;  2X9H A;  1E6H A;  1RAB B;  2MWP A;  3CCR A;  2EQI A;  1O75 A;  1M1G A;  4OB0 B;  4IUP A;  5A0G A;  1OOT A;  1X6G A;  2L3Q A;  2IPO B;  1VQ8 Q;  1TUG B;  1W2B P;  3N5B B;  5I11 A;  4C8Q D;  3RMQ A;  2ATC B;  3EGX B;  4CC3 A;  4J8O A;  3BE3 A;  3VUZ A;  5FWC A;  4CI0 C;  2K3Y A;  4KGV B;  3AHU A;  1ZUY A;  5KH6 A;  3UA6 A;  1KQ2 A;  2HL5 C;  4XU0 A;  4M78 F;  1VQO A;  1PNJ A;  2R57 A;  1N8R C;  1Q81 C;  2CP2 A;  4IUR A;  2E64 A;  4JJB A;  5IN1 A;  2KDS A;  3T9N A;  2VXE A;  4FYV B;  2RA2 A;  5I2M A;  2CZ6 B;  4OB1 B;  1VQ7 A;  1Z9Z A;  2DO3 A;  8ATC B;  3V7C A;  1D1C A;  5GAM f;  2OTJ A;  4A54 A;  2M1H A;  5LJ5 j;  1VQM T;  4IKF A;  4IUT A;  1QW1 A;  1K9M C;  4OML A;  2OTL T;  2LCS A;  2CYZ B;  3UPU A;  1N9S A;  1QVF P;  2CP7 A;  1SF9 A;  2K5L A;  3R6O A;  2PUK B;  4J7I A;  2EVR A;  3M53 A;  4NOY A;  4QQD A;  1NM7 A;  3A98 A;  1NPP A;  2QQS A;  1TH7 A;  3E19 A;  1YHQ T;  2RHY A;  4UC4 A;  2LQW A;  2RO0 A;  5GAM e;  2LJ1 A;  3RIR A;  1QWF A;  2HNI A;  1E7O A;  3H0I A;  2DXU A;  2XU8 A;  4LUE A;  1ZSG A;  1WPY A;  2Y4Y A;  4LDW A;  1Q86 U;  4PL6 A;  1JU5 C;  2ZPF B;  2JT4 A;  1K1Z A;  3PVL A;  1WXU A;  1MNE A;  2XD0 A;  3REA B;  2KT1 A;  3FC3 A;  4N0A C;  3HP9 A;  3M0P A;  2MI6 A;  3ZEH A;  3FDR A;  1TSF A;  4EMK A;  1BBZ A;  1FMK A;  1IZ6 A;  2LCC A;  4LD6 A;  4XU2 A;  1VQ9 T;  4BY6 B;  2YRD A;  4HVV A;  3VS4 A;  3CCU A;  1VOM A;  1NE8 A;  1AWO A;  2MAM A;  2QAZ A;  3OS5 A;  3VV0 A;  3GPL A;  1WQW A;  1WFW A;  3GP8 A;  2CP6 A;  4F7U A;  2X3X D;  3OS1 A;  4C8Q E;  2XK0 A;  3CXC A;  1QKX A;  1Y07 A;  2V8J A;  1S72 A;  3LGF A;  4Y92 A;  1ZLM A;  4M4Z A;  4M77 E;  2ESW A;  2KSS A;  2DXB A;  2HQX A;  4FYY B;  4K11 A;  1KHI A;  2F5K A;  4A63 B;  2BTT A;  5GAN j;  1UUE A;  1IGU A;  2FYK A;  2BZY A;  3CC7 T;  2HCK A;  2Y4X A;  2F69 A;  3L2U A;  3WXM B;  5DM7 R;  2HQH A;  2L89 A;  2QG9 B;  2X35 A;  3G6E A;  2FZC B;  4JRQ A;  1ZHI A;  5KYN A;  5HKC A;  4XTW A;  2KBT A;  3CEY A;  3H41 A;  1DJ7 B;  3JCM c;  1OPL A;  4J9B A;  1X6O A;  2KT8 A;  1AZE A;  4TVR A;  2O01 E;  4BB7 A;  2JMC A;  2DMO A;  3UAT A;  3MEU A;  3VKI A;  1JJ2 A;  2NLU A;  4J9C A;  2KR3 A;  3CC4 Q;  2JTE A;  1M27 C;  2LX9 A;  3L1A A;  4MZM A;  4PJO E;  1QP3 A;  2ENM A;  4LD9 K;  1YBY A;  1OX8 A;  1QVP A;  3CPF A;  2PU9 B;  1BU1 A;  3M57 A;  4ZTJ A;  2ED0 A;  3PIP A;  3JB9 F;  1E6G A;  2KE9 A;  3C4S A;  2VKN A;  3I56 Q;  3MET A;  1RAC B;  1KG1 A;  4RTY A;  4QQG A;  1CKA A;  2FB7 A;  1U06 A;  3C0C A;  4M78 G;  2V1R A;  2L5Q A;  2DBM A;  5DLO A;  2HBP A;  5LJ3 d;  4J83 A;  2EJF A;  2VGN A;  4LDX A;  2RQR A;  1W70 A;  4LUD A;  2LJ3 A;  3CMA Q;  3D7S B;  4OMM A;  1X2Q A;  2RH2 A;  3EFS A;  2RI2 A;  3OW2 S;  4MZP A;  1BCM A;  2BUD A;  2C0I A;  1Y96 A;  4DOW A;  2ZCF B;  3NTK A;  3PT9 A;  1KQS A;  1RAE B;  4BI8 B;  2YSQ A;  3RKY A;  3LH5 A;  1ABO A;  2DXT A;  4BUG A;  3QJ6 A;  1TU0 B;  4YTL A;  3CCV Q;  2HKN A;  2MCN A;  2KRO A;  2DYB A;  4AFQ C;  4EMK B;  2YLB A;  1IHW A;  1M9S A;  4AMC A;  4DBR A;  4M7A C;  2JM9 A;  2F1L A;  3EGU A;  5KE2 A;  1OUL A;  2DK3 A;  2I2L A;  3V8K A;  1PC0 A;  3CD6 A;  3MJX A;  3R6N A;  3A5Z B;  1VQ5 A;  3MO8 A;  2QDL A;  2J06 A;  2EPD A;  2EYQ A;  1I5L A;  1SKU B;  4IIO A;  1K8A R;  3JCM d;  4DBQ A;  1B07 A;  1XQH A;  1LPL A;  4XTU A;  2HZY A;  3UDC A;  1RAF B;  1YIJ A;  1TOV A;  1WYX A;  3RKX A;  2LC4 A;  5HK3 A;  3OYK A;  4ANJ A;  2DZC A;  1IGQ A;  1T3L A;  4XTV A;  3G4S Q;  4BD3 A;  1K0X A;  3X20 B;  4EIK A;  1VQ6 Q;  1D1A A;  4RG2 A;  2RHI A;  1M1F A;  4RCC A;  1Q86 C;  2F2X A;  1VIE A;  1I4K 1;  3NTH A;  4LXC A;  1GFD A;  2JVV A;  2K2M A;  2QA4 A;  2QGG A;  3FJP A;  2FL7 A;  3CCJ Q;  2D0N A;  1M3A A;  4M75 D;  1VQ4 A;  4QW2 A;  5GAN 2;  3VRY A;  1V1C A;  2CH4 W;  3C94 A;  2BE7 D;  1M1K U;  5C6S A;  3QZ9 B;  1SHF A;  2GQI A;  2ZZD A;  2P0Q A;  3RBB B;  1W2B A;  3NGP A;  2H8H A;  3I55 Q;  1QP2 A;  2RQU A;  3H0H A;  1KQ1 A;  2DAQ A;  1QVG P;  5CKE A;  2ZPH B;  1U3O A;  1YCY A;  3RKW A;  3M55 A;  1SSF A;  5KE3 A;  4Z89 A;  4L5G A;  2O4X A;  4DQ2 A;  5A0D A;  1K9A A;  4WTO B;  5GAN e;  1VQ8 A;  4QKU A;  4A4F A;  2EGA A;  1N9R A;  1QMC A;  3OYA A;  3BDL A;  3H9N A;  3U23 A;  3ZFJ A;  2C06 A;  2AT1 B;  3A8M B;  1NEB A;  2KYB A;  2PUO B;  5GMK m;  3MPU B;  2V8K A;  3QG1 A;  1JBM A;  2PVG B;  1K73 R;  2Z0W A;  4HCZ A;  2FHD A;  1PHT A;  3G1J A;  3I56 T;  9ATC B;  1Y96 B;  4Z02 A;  2RD1 A;  4AFU C;  2DRM A;  2OJ2 A;  1QVF A;  1VQM Q;  3JB9 G;  1YJ9 Q;  1JXM A;  4L59 A;  1K9M R;  2IG0 A;  1PM3 A;  1JB0 E;  2OTL Q;  1ACM B;  2DXC A;  2FRW A;  2XKO C;  1TG0 A;  1QCF A;  2E5Q A;  4PLI A;  3RMS A;  4C5E A;  1MUZ A;  1RL2 A;  1UTI A;  3CMA T;  3OYE A;  2GFU A;  2H3E B;  3ASK A;  4B9X A;  2RJE A;  3E2U A;  1ZA2 B;  4HCC A;  1U1T A;  1TXQ A;  5DY9 A;  2WSC E;  1PG5 B;  3PFS A;  4PLL A;  4XTZ A;  3HFN A;  4LNP A;  3CME T;  3VS6 A;  1YHQ Q;  5FW9 A;  2QQ9 A;  2JN0 A;  4A4E A;  2PQW A;  4M7D C;  4FM4 B;  4E2F B;  4F16 A;  1P92 A;  1VYT A;  4BE1 A;  1X75 C;  2NUZ A;  1YI2 Q;  1FX7 A;  1QQJ A;  4M75 E;  5GAO r;  1VQP T;  4KUD K;  1Q7Y R;  1AWJ A;  1UHF A;  3ZL7 C;  2LNH B;  1YJN Q;  2MWO A;  1WQ7 A;  2EBP A;  2D0Q B;  4C5G A;  4M7D D;  2RPN A;  4DBF A;  3OYG A;  3X25 B;  2A36 A;  2VV5 A;  1VQ9 Q;  3CBO A;  3LWI A;  2FPF A;  4OP0 A;  2JXB A;  1K8A C;  1B3Q A;  2GTJ A;  2IVW A;  3L2W A;  2RJF A;  3MHX A;  3NTI A;  3S6W A;  4M7A A;  3CC2 A;  1MMN A;  3NMZ C;  3QHS A;  4ZNX A;  1HD3 A;  1QWE A;  2YRV A;  5LJ3 j;  3M0S A;  1MV0 B;  1YIT A;  2PVO B;  4FSS A;  2HBW A;  1BB9 A;  2VGM A;  5HY6 A;  4M7A F;  1BK2 A;  4ZGE B;  1PD0 A;  3L2V A;  4PJM A;  1YJW Q;  2RQT A;  3QZ5 B;  2AIR B;  1VQL A;  3RNJ A;  3CCJ T;  2CS7 A;  2QQR A;  2YUQ A;  4D8K A;  1N5Z A;  1NG2 A;  4DBH A;  3CC7 Q;  2O4X B;  4OVA A;  5J3B A;  4XQ3 A;  1WXB A;  4LDU A;  4L6V 5;  1KSW A;  3OMC A;  4C8Q C;  2BE9 B;  1UE9 A;  2KEA A;  2MPX C;  2CUD A;  3WVD B;  3I55 T;  3TEE A;  2X4Y A;  4FW2 A;  4M77 C;  5FU6 C;  5CR2 A;  5D6Y A;  4WF2 A;  1SRL A;  5CAI A;  2RJC A;  4BE2 A;  2AKK A;  3SD4 A;  2HKQ B;  2XDP A;  1Q82 U;  4VUB A;  1M30 A;  3O8V A;  1M3B A;  3SHW A;  1M1K C;  2YT6 A;  2EKO A;  1JJ2 S;  1OU9 A;  1C6V X;  4M78 A;  1M5Q 1;  1Y57 A;  4M77 D;  2JNG A;  1I1J A;  1B7T A;  3CC4 A;  4JS4 A;  1UJ0 A;  2GNC A;  5EC7 A;  3LW5 E;  4OGC A;  2FZK B;  2OAU A;  4KRT A;  3SWN A;  2HL3 A;  2LTO A;  5GMK j;  3X24 B;  1PKS A;  4KBM B;  2QI2 A;  4BAC A;  2EQU A;  2JTM A;  3OBY A;  4BE0 A;  1K73 C;  1OX9 A;  4E7H A;  1EFN A;  2EFI A;  4C92 A;  1I07 A;  1UGP B;  1VQK Q;  4PJO C;  1AWW A;  3HSB A;  4J6W A;  5IXF A;  1YJ9 T;  4C92 F;  3M0U A;  5AT1 B;  4M7D E;  1WHL A;  4LN2 A;  3PGG A;  2LMJ A;  5FLX E;  5HCK A;  2KY9 A;  3VYG A;  4RKU E;  5FU7 C;  3CMA A;  1LCK A;  2P4T A;  5J26 A;  4QQ6 A;  4JS5 A;  2DL7 A;  5CO7 A;  3QBY A;  4PJO D;  1NEG A;  1R0C B;  1U5S A;  2J05 A;  4JRI A;  4EDU A;  2DTO A;  1JEG A;  3SDZ A;  1YFN A;  2P0P A;  2DF6 A;  2DIG A;  5CKF A;  3C95 A;  2DLP A;  3IQL A;  1U8R A;  5J39 A;  3EG9 A;  1UFF A;  2X4W A;  3VS7 A;  5LL6 S;  3CCS T;  1PWT A;  2KRS A;  2QQB A;  5IXB A;  2EIF A;  4F7U E;  4OMN A;  3CCV A;  1WHK A;  1YI2 T;  1FMV A;  2HSE B;  4M7A B;  4C0F A;  2LX7 A;  2MIO A;  2CZ1 B;  3OW2 P;  1QCO A;  1K76 A;  4ZTF A;  1AOJ A;  1Q7Y C;  4JRP A;  1YJN T;  2JOY A;  3V8J A;  1V29 B;  3AT1 B;  2GTO A;  3V7S A;  1LOJ A;  5HK0 A;  3CCL A;  2DER A;  2ED1 A;  1D0Y A;  1WNL A;  4FU6 A;  3H8Z A;  1WZO A;  1Q86 R;  2AKL A;  2EYZ A;  4ME7 A;  2RK2 A;  4C0G A;  4CC7 A;  3P8B B;  4E6R A;  3EH2 A;  3G4S A;  2EGC A;  1VQ6 A;  1FMW A;  3EG2 A;  4N4H A;  3DLM A;  2YDL A;  1YJW T;  3QWX X;  1MV3 A;  1Z9Q A;  2COZ A;  2HDA A;  4M7A G;  3GNF B;  1QVG A;  1N6A A;  2PTK A;  2DBK A;  1OEB A;  1PRM C;  2E5K A;  5LJ3 e;  1UHC A;  4Y28 E;  4D6W A;  4C0D C;  4R55 A;  3LLR A;  2NUP A;  2CH4 A;  4ELY C;  2JW4 A;  3SFM A;  4PNO A;  4P5N A;  2EQJ A;  2O31 A;  4B9W A;  4M78 B;  5KYX A;  1EZZ B;  1LVK A;  1UDL A;  2PNI A;  1NBE B;  1ZBX A;  2LP5 A;  3EH1 A;  5ECA A;  5GAO p;  2PVD B;  3I55 A;  3QYH B;  1OV3 A;  3PNW C;  3VU3 C;  2EGE A;  2E65 A;  1GCQ A;  3VRZ A;  3E9G A;  1T0H A;  3SWN B;  4XAX B;  2LT4 A;  2AHJ B;  1KC8 U;  3JCM W;  2LCL A;  4V2S A;  2DJZ A;  1G2B A;  2D8J A;  3NFC A;  2BKD N;  2ZGW A;  4C92 B;  1PKT A;  1BI2 A;  2EQK A;  2NUT A;  2XG8 D;  1PD1 A;  4C8Q F;  5GAN 3;  1C0M A;  3G71 T;  1ZBJ A;  5A0L A;  3CCE T;  4KGX B;  3QUI A;  4J9I A;  3OS2 A;  1M90 U;  1VQO Q;  2GCX A;  4Z8A A;  5GJV B;  4X34 A;  1BCO A;  5LJ5 f;  2YHT A;  4JPB W;  2DTI A;  1AZG B;  3JCM e;  4XK8 E;  1R0B G;  3OYI A;  1OZ3 A;  5IHK A;  1BKB A;  1AVZ C;  3OBW A;  1VQK T;  1LJO A;  2GF7 A;  3A1P A;  4JJN K;  1PCX A;  1NJI U;  4PFO A;  1VQM A;  3EG9 B;  3MP1 A;  1KK7 A;  3VS5 A;  1RLQ C;  3PTA A;  2QXF A;  5GMK e;  2YXY A;  3TCJ A;  1W6X A;  2OTL A;  1WHG A;  2X4X A;  1XNI A;  4HVW A;  3I35 A;  1GL5 A;  4DOV A;  3CME Q;  4C92 G;  1UJY A;  4OF1 A;  2ZPG B;  5IHN A;  5LJ5 e;  4PFZ A;  2YUO A;  3CCM T;  3MEW A;  1MHN A;  1J3T A;  4PJO F;  5IAY A;  1YHQ A;  4FW1 A;  1VQP Q;  3PE0 A;  3G7Z A;  1BYM A;  5D6W A;  5GAM g;  2DX1 A;  2JJ9 A;  1NYG A;  3H0F A;  3A8O B;  1YI2 A;  4JZ4 A;  2P4R A;  1UGR B;  2E3I A;  1XOV A;  2AZS A;  4PJL A;  2L0A A;  2BZ8 A;  3QO3 A;  2GGR A;  1YJN A;  4ELZ C;  2K5F A;  5D7U A;  3OY9 A;  2J6F A;  4ATO A;  5I21 A;  1AT1 B;  2EJG A;  3KXT A;  2E10 A;  1VQ9 A;  4M75 C;  3J81 E;  5A2Q E;  5CKH A;  3TVT A;  1W1F A;  1D3B A;  1X01 A;  3M0R A;  1SPK A;  1TS9 A;  4PJJ A;  2RN8 A;  3CCQ Q;  3LX7 A;  4J9D A;  6AT1 B;  3DB4 A;  2NUP B;  2KXC A;  3JCM J;  2EWN A;  3LH0 A;  2HEQ A;  4Q5W A;  5GAN f;  3A8L B;  4N0A A;  5KYX B;  3JRZ A;  3CPW S;  2YRC A;  3UF4 A;  5KYW A;  4R56 A;  2B86 A;  1NLO C;  4OMF B;  2HAX A;  4E7J A;  2O88 A;  4QVC A;  3I5S A;  3OA6 A;  3FRN A;  3SEM A;  5GAN 4;  3OYC A;  2MF2 A;  1KIK A;  5IHI A;  2AK5 A;  2KRN A;  1G3Y A;  4N4I A;  2CRE A;  1WJS A;  1I8F A;  3I5R A;  2K5I A;  1M3C A;  2ABL A;  1I81 A;  3PVQ A;  3CC7 A;  2EYX A;  3E1S A;  3GBQ A;  5GAO l;  1WDX A;  2COY A;  1GBQ A;  1WLP B;  2NUT B;  3MP6 A;  1M4Z A;  2F2V A;  4C0Z A;  2DRK A;  4FIB A;  5GAN 7;  4DA4 A;  3QDF A;  3JCM b;  2QEX Q;  1M1K R;  2LQK A;  3CCR T;  2K57 A;  1N8R U;  1Q81 U;  1UEB A;  2X4J A;  4BDZ A;  4LE9 A;  4A4G A;  2DKG A;  5CKD A;  1JRI A;  1NZ9 A;  5GAM h;  3EFR A;  1U1S A;  3HKS A;  2DM1 A;  2VB6 A;  2YUP A;  4M78 D;  3VYH B;  2I0N A;  4E7K A;  4MMK A;  4MDW A;  2BZX A;  2RQV A;  2M9U A;  2WAC A;  4EMH A;  3ZBD A;  1VQO T;  3RER A;  2CSQ A;  4C8Q G;  2A08 A;  1M8M A;  2W0Z A;  2ECZ A;  1R8O B;  4ZN3 A;  1GBR A;  1G3S A;  4JJC A;  4GY5 A;  3LWH A;  4PFP A;  1VQ7 T;  2JM8 A;  2L2P A;  2K4Y A;  2JZ2 A;  4BI4 A;  4QT7 A;  4PJN A;  5L23 A;  2OTJ T;  1KHC A;  4JUV A;  1BI0 A;  1YNZ A;  5FU7 B;  1JQQ A;  2DVE A;  2OAW A;  4NL3 A;  3DLL A;  2ZAE A;  2DJQ A;  3RDV A;  3OW2 A;  3CCS Q;  2R5M A;  2OI3 A;  5LJ5 g;  1Y7X A;  5CVI A;  3CBM A;  5FRN A;  2LDM A;  2A3L A;  5GAO n;  3I9Q A;  4EMG A;  2LRQ A;  1X2K A;  4MML A;  1G5V A;  5KYY A;  4HA8 A;  4HCK A;  3QSU A;  5CK9 A;  3QJY A;  4CRI A;  4IIM A;  1D3B B;  3VS2 A;  4A53 A;  1BIB A;  2JS2 A;  4OMQ A;  5GAN 6;  3EFO B;  1B34 A;  3OYL A;  2KRM A;  3OSS C;  1JO8 A;  1FXX A;  4J6X A;  4BDY A;  5GAN 8;  3M9Q A;  4JLI A;  4O6J A;  4J9G A;  5KYW B;  2FVU A;  2M51 A;  5I2S A;  2DE0 X;  4IUU A;  3TQ7 P;  1V76 A;  3EAE A;  1OZ2 A;  1YIJ Q;  1VYV A;  4OGE A;  3CCQ T;  1G83 A;  4C5H A; 
#chains in the Genus database with same CATH homology
 1YWP A;  3EG3 A;  1CKA A;  3VS7 A;  1RI9 A;  1PWT A;  1U06 A;  2KRS A;  3C0C A;  5IXB A;  2K7A A;  2V1R A;  2DBM A;  4OMN A;  4F14 A;  5IH2 A;  1H8K A;  1KJW A;  2A37 A;  2LX7 A;  2MIO A;  2RQR A;  1W70 A;  3THK A;  2FEI A;  2K9G A;  4LUD A;  1K76 A;  1AOJ A;  1X6B A;  2LJ3 A;  4OMM A;  1UGV A;  1X2Q A;  2M0Y A;  2AZV A;  3M0T A;  1FYN A;  2GTO A;  2HSP A;  3TSZ A;  2C0I A;  3TSW A;  2LZ6 B;  2L3S A;  4JJD A;  2PZ1 A;  2ED1 A;  1GFC A;  3EG0 A;  2CT4 A;  1TUD A;  2YSQ A;  3LH5 A;  2FRY A;  3KFV A;  1ABO A;  2AKL A;  2EYZ A;  4CC7 A;  2D1X A;  1VA7 A;  2MCN A;  2KRO A;  1CSK A;  2SRC A;  4E6R A;  1RUW A;  2GBQ A;  2DYB A;  2EGC A;  4AFQ C;  2RF0 A;  3M0Q A;  3EG2 A;  2YUN A;  2JM9 A;  2YDL A;  3EGU A;  3QWX X;  4OMO A;  1I0C A;  3R6N A;  1MV3 A;  1Z9Q A;  2HDA A;  4HXJ A;  2C0T A;  4RTW A;  1UEC A;  2QDL A;  2J06 A;  2PTK A;  3QWY A;  2EPD A;  2FO0 A;  2XMF A;  1X43 A;  2CT3 A;  1OEB A;  1PRM C;  1SHG A;  2DBK A;  2DL8 A;  2E5K A;  1UHC A;  2MOX A;  4IIO A;  5I22 A;  1B07 A;  2CH4 A;  2JW4 A;  1PRL C;  2O31 A;  1QKW A;  4J9F A;  1WYX A;  1UDL A;  2PNI A;  2LP5 A;  5ECA A;  1RLP C;  2CSI A;  3CQT A;  1OV3 A;  1T3L A;  2V1Q A;  1K0X A;  4EIK A;  2K79 A;  2CDT A;  2EGE A;  1GCQ A;  2ROT A;  3VRZ A;  2DL3 A;  1T0H A;  1X69 A;  2EYW A;  1Y0M A;  2F2X A;  1HSQ A;  1H92 A;  1GFD A;  2K2M A;  1WI7 A;  1ZX6 A;  2EKH A;  2DA9 A;  1G2B A;  1HJD A;  4J9E A;  1SSH A;  1YCS B;  2D0N A;  2D8J A;  1M3A A;  1A0N B;  2EYY A;  4F17 A;  3VRY A;  2RNA A;  1PKT A;  1V1C A;  2CH4 W;  2L3P A;  3EHQ A;  2NWM A;  1SHF A;  1ZBJ A;  2GQI A;  2X3W D;  4RTU A;  4J9I A;  4RTV A;  3RBB B;  3NGP A;  1AD5 A;  2H8H A;  4Z8A A;  5GJV B;  4GBQ A;  1CKB A;  1S1N A;  1YP5 A;  1ZUU A;  4R0K A;  2RQU A;  3H0H A;  2FPD A;  1T3S A;  4JPB W;  1KFZ A;  2C0O A;  4AFS C;  1AZG B;  2A28 A;  1U3O A;  4RTT A;  3FJ5 A;  2RQW A;  5IHK A;  1AVZ C;  4Z89 A;  2D8H A;  1K9A A;  1WIE A;  3VS5 A;  2EGA A;  1RLQ C;  1W6X A;  3U23 A;  3NPF A;  4HVW A;  3I35 A;  4ESR A;  3ULR B;  1GL5 A;  2VVK A;  1GCQ C;  2DL5 A;  2KGT A;  2J7I A;  2ROL A;  1UJY A;  1ZUK A;  4GLM A;  1NEB A;  1JXO A;  2KYB A;  4DEX A;  4WCI A;  5GJW B;  5IHN A;  3VS1 A;  3EG1 A;  4Z88 A;  2YUO A;  1PHT A;  1J3T A;  2K6D A;  4AFZ C;  2W10 A;  1E6H A;  1IO6 A;  3PE0 A;  2EQI A;  4AFU C;  2DRM A;  2CUB A;  2OJ2 A;  1OOT A;  1X6G A;  2DX1 A;  2L3Q A;  1NYG A;  1JXM A;  4CC2 A;  5FWB A;  3H0F A;  4JZ4 A;  2P4R A;  4AG2 C;  4RUG A;  5I11 A;  2FRW A;  2F2W A;  1TG0 A;  1QCF A;  1XOV A;  4CC3 A;  2AZS A;  1MUZ A;  1UTI A;  2JS0 A;  2DNU A;  2L0A A;  2BZ8 A;  2GGR A;  5FWC A;  2J6F A;  1ZUY A;  2FPE A;  3UA6 A;  2DVJ A;  1PNJ A;  1AWX A;  4LNP A;  3TVT A;  1W1F A;  2SEM A;  1NLP C;  3M0R A;  3VS6 A;  1SPK A;  2RN8 A;  2KNB B;  5FW9 A;  4J9D A;  2FG0 A;  2J6K A;  4JJB A;  4F16 A;  2KXC A;  4CC4 B;  1VYT A;  2K3B A;  2HEQ A;  2NUZ A;  4HVU A;  3UF4 A;  1Z9Z A;  2B86 A;  1NLO C;  1AWJ A;  2O88 A;  1UHF A;  1X27 A;  3I5S A;  2RMO A;  4RTZ A;  3ZL7 C;  2LNH B;  1GRI A;  3SEM A;  4X1V A;  2EBP A;  1KIK A;  5IHI A;  2RPN A;  4OML A;  2AK5 A;  2KRN A;  2LJ0 A;  2CRE A;  2LCS A;  2A36 A;  3I5R A;  1AEY A;  1M3C A;  2ABL A;  3PVQ A;  2FPF A;  2JXB A;  2EYX A;  1B3Q A;  3GBQ A;  2GTJ A;  1WDX A;  1UG1 A;  2EW3 A;  2EVR A;  1NYF A;  1NM7 A;  1GBQ A;  1WLP B;  3NMZ C;  3A98 A;  2F2V A;  2G6F X;  4ZNX A;  1HD3 A;  1QWE A;  2DRK A;  3M0S A;  1MV0 B;  1OPK A;  4D8D A;  4FSS A;  1SEM A;  2HBW A;  1BB9 A;  3VS3 A;  1ABQ A;  1BK2 A;  2DL4 A;  2LQW A;  1H3H A;  2J6O A;  4LE9 A;  1K0S A;  2LJ1 A;  2RQT A;  1TUC A;  1VYU A;  1QWF A;  1E7O A;  3H0I A;  3RNJ A;  4LUE A;  1ZSG A;  4OMP A;  2YUQ A;  4D8K A;  1N5Z A;  1WXT A;  1JU5 C;  1NG2 A;  2JT4 A;  2DM1 A;  1K1Z A;  2YUP A;  4RTX A;  3PVL A;  2I0N A;  1WXU A;  1K4U S;  3REA B;  2KT1 A;  2IIM A;  1SRM A;  1WXB A;  1WA7 A;  2O9S A;  2BZX A;  3M0P A;  1KSW A;  2RQV A;  1GCP A;  1WX6 A;  1BBZ A;  1UE9 A;  1FMK A;  2O9V A;  4DEY A;  2KEA A;  4HVV A;  3VS4 A;  2CUD A;  2CSQ A;  3EHR A;  2A08 A;  1M8M A;  1AWO A;  2KXD A;  2W0Z A;  2ECZ A;  1WFW A;  2DIL A;  1GBR A;  1SRL A;  2VWF A;  2AKK A;  2X3X D;  4JJC A;  1M30 A;  1T0J A;  1QKX A;  2LQN A;  1M3B A;  3SHW A;  2JM8 A;  2YT6 A;  2L2P A;  4Y92 A;  4QT7 A;  5L23 A;  1ZLM A;  4M4Z A;  3UA7 A;  2ESW A;  1Y57 A;  1YNZ A;  1I1J A;  1JQQ A;  4K11 A;  2OAW A;  2O2O A;  2KYM A;  1UJ0 A;  2GNC A;  2DJQ A;  5EC7 A;  4A63 B;  2BTT A;  1UUE A;  3VS0 A;  3JV3 A;  4KRT A;  2BZY A;  4AG1 C;  1ARK A;  4J9H A;  2HCK A;  1PKS A;  2OI3 A;  1YN8 A;  1EFN A;  3NHN A;  3I9Q A;  1X2K A;  1I07 A;  4HCK A;  1AWW A;  4IIM A;  5IXF A;  2KBT A;  3H41 A;  3VS2 A;  3M0U A;  2JS2 A;  4OMQ A;  3O5Z A;  1OPL A;  4J9B A;  1AZE A;  2KT8 A;  4JZ3 A;  4LN2 A;  2LMJ A;  2KRM A;  2JMC A;  2DMO A;  5HCK A;  3UAT A;  4J9C A;  2KR3 A;  2JTE A;  1M27 C;  1JO8 A;  1LCK A;  3REB B;  2DL7 A;  2JMA A;  4J9G A;  1NEG A;  2ENM A;  1U5S A;  2J05 A;  2M51 A;  2DE0 X;  1YWO A;  1BU1 A;  1JEG A;  2DF6 A;  2ED0 A;  2DLP A;  3IQL A;  1E6G A;  1VYV A;  2KE9 A;  4ORZ A;  1G83 A;  2VKN A;  1QLY A;  1UFF A;  4RTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...