1JEKA

Visna tm core structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
40
structure length
40
Chain Sequence
QSLANATAAQQEVLEASYAMVQHIAKGIRILEARVARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The trimer-of-hairpins motif in membrane fusion: Visna virus.
pubmed doi rcsb
molecule keywords ENV POLYPROTEIN
molecule tags Viral protein
total genus 18
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1jekA00
1IFPA 1E79H 3EFFK 3PJSK 3USSA 2WSSH 1BSNA 4YXWH 2CK3H 2XNDH 2W6JH 2E5TA 1AQTA 1JEKA 4QMAA 4TLFA 2QE7H 1BSHA 2E5YA 4DJGA 2JDIH 1FS0E 4WVZA 2V7QH
chains in the Genus database with same CATH superfamily
1FAVA 2P10A 3WU2E 4OVNF 1U7JA 3W67A 5H2FH 3SFDC 3I55P 3BATA 1YHQP 4H0LC 3CCRP 3HE5B 2Y9YA 4PD4I 2KLUA 4WY4D 3CPWO 4IFMA 5AW6B 1AFOA 5M1BA 2XDJA 3LIDA 1BGYE 3AE7C 1YYCA 1NGMB 2KUBA 3RL0g 3AEGC 3TGUE 4IOIH 2QVAA 2Q7CA 3KQGA 2IZ1A 1SQBG 4WY4C 1YJWP 1FOSF 2IBZG 3AEEC 4RO0A 1S1CX 1KB9I 4DZOA 1T2KC 2XNXA 2WSEH 3SFEC 2AXTH 2V7QH 3V2NA 3FXDA 1N73B 3CCEP 1OVVA 1GW3A 1LTGC 2VRSA 1SQXE 1LWUB 1M56D 2O1JA 1YIJP 3H1KG 1LTIC 1SQBJ 2OYIC 3L74E 5KAIE 4L76A 2NRGA 2E74B 1KYOH 1Y47A 2NPSB 3MTUE 4I7ZB 2MKVA 2WPSA 2YMKA 1HF9A 2LR2A 4PJ0E 3V2QA 5GTIH 1SFCC 1RE4A 2N1TD 3RK3B 3H1KJ 2ZYDA 1KB9D 3L36A 1PIXA 4GKGA 1FBMA 2D2CD 5AW2B 3LW5J 4W80A 3L70G 4GDOA 4Y28J 1LTJB 3MP7B 1L4AA 2V4HA 3TSIA 4QMAA 2R5BA 2Q1KA 1BE3D 1VQ4P 4H44D 2FYNC 4KT0J 2W8ZA 2G8YA 2C9LY 1N7SD 1OXZA 2KS1B 1USDA 3CC4P 2YIUB 3Q5PA 4C46A 1GU5A 5CCHA 5AVQB 4K35A 5TISH 2D2CC 5KKZC 2P67A 1JY2N 2P2UA 1XTGB 1NH4A 3HTKB 1R8EA 3L70J 1A02F 4AUWA 4Z1MH 3HE4A 1N7SC 3L71G 1CI6B 2A45I 2WVRA 1WRGA 5B5EH 3VN0A 2KK7A 2FYUJ 5AVXB 4B86A 1HVVA 4OGQD 3V2PA 4EIJA 1PGOA 1NAYA 1PGJA 3H1HD 3H1JG 3V6IA 3B5NA 1LGHB 5KAFE 3WU2H 1MFTA 1NTME 1ZRTD 2POHA 1PGQA 2Y0CA 1SQPK 1Q81Q 3L71J 4TT3H 3AE6C 4CPGA 4DJGA 3CXHE 2IPPA 1LP1A 1YI2P 1FZGA 3H1IJ 1SS1A 2YXRB 5DJTB 3PJSK 1KQFB 1RF0C 1URQD 2O3JA 3H1JJ 1M1JB 5APQA 3L73G 1HBWA 3G6EP 1X9VA 3A0BH 2Z4EA 2WSCJ 4H13D 1SQVE 4EDFA 1NTKG 2E75B 3GHGC 2WSCH 1URQC 4HKZH 4ZKPA 2QJKB 3OJAB 4YXDC 2ZJSE 3CCVP 1KILA 3HUSB 2YXQB 5APXA 4D6TG 2FKWB 1LT9A 3L74D 1K04A 2OTLP 3L73J 1SQPD 3E1RA 4H13C 2HODB 2GM4A 1VQ5P 1HH0A 3CWBD 2WT7B 1DEBA 3HUSA 1NTKJ 1L0NE 3CI9A 1SQQD 1BCCG 5KAIH 1NKNA 4WY4A 3S4RA 2WSSH 4D6TJ 3NXSA 4U3FG 1FZEA 3T97A 3AE2C 2R32A 1VDFA 2M5AB 2E5YA 2QIWA 3PH0A 2R3CA 1W2BO 4IL6H 2B89A 5KLVK 1DX7A 3Q3DA 3E7KA 5H2FE 4GT1A 1BDCA 1EXJA 3CXHI 3Q2YA 5AVZB 1U7MA 3ABVC 1JOCA 2KNCA 3P8MC 4U3FJ 2XZRA 2IYPA 3H1LD 3CCJP 1AV1A 2E74D 1S5LH 3EWKA 2NPSD 3NMDA 2ZFCA 1GZLA 1ZP0C 3BCCG 4BRYA 5K5GB 3KHUA 1LWUC 4L73A 1IZNB 3CCMP 1AVYA 3L75D 3RL0B 5CJ4A 3WMM0 1VQPP 2E74C 3FX0A 3RK3D 2NPSC 1PP9G 3BASA 1MUUA 1P84D 3AE5C 1H0TA 3P8CE 4I7ZC 5KLVG 4WVZA 1PL5A 5KJ7D 2WPVB 2N9BA 3CXHD 2HLOA 3BCCJ 4I2LC 2YKPA 2O1KA 2N1TA 2C9NY 1VF5C 3CX5I 3WUVA 2RN0A 3FWLA 1J1DB 1NHLA 1NJIQ 3RK3C 1VQOP 3A7OA 1SQBE 3AEAC 2IBZE 2QJYC 2E76B 1OZHA 2IDBA 1RF1B 1G1JA 1M57D 2Q3EA 1PP9J 3SWYA 1LTJC 4HJGH 1EDLA 2ZXXA 1N7SA 1VQMP 3CC7P 3KYQA 1LT1A 2QJPB 5GTIE 2FFDA 2YIUC 4O9BA 2RKLA 3QH9A 4KJMA 1OX3A 3H1KE 1R5LA 1FC2C 1JMMA 3VMYA 4GOEA 1NTZG 5KLIB 1MV8A 4R4MA 2RH0A 4UB6E 1SVFA 1AQTA 1TU3F 2JEEA 2OYHB 1EZVD 1RE3C 2NZ2A 2JDIH 1KORA 1DH3A 2A06G 4NPDA 3CX5D 5TISE 1J1EC 2O01J 4C7NB 1RF0A 1N7LA 2O01H 4ZKUA 4TLFA 1PPJG 1X79B 1FU1A 1NTZJ 3L70E 3UIAA 5B5EE 1HGVA 1LNQA 3MHVA 3AE9C 1AA0A 1Q86Q 3V5BA 1S2EA 1NVOA 1URQA 3MUDC 2G3AA 2Y9ZA 2E75D 4DOJA 1M90Q 1NOHA 2KSJA 4AYCA 1L0LD 4W7YA 4EOTA 3JSVC 1H88A 1KYOI 2KZJA 2IBZI 2AEJA 2BEQD 4N78E 3ZDMA 1HTLC 1KILC 1S72P 1LT9C 3L71E 1N8RQ 2WSFJ 4DCKA 3HD7B 3CCUP 2E75C 2AEMA 1GW4A 3H1IE 3VMZA 4I6MC 2QJKC 4RKUJ 2XKMA 5APWA 1G2CB 1MKMA 1L2PA 3HUSC 1EDKA 3OAKA 3G71P 3N7NA 2HPCB 3H1JE 2BCCD 3A0BE 1GL2D 2BASA 3HE5A 1LTSC 1ZR2A 1CSBA 1KQLA 1JY3O 2W83C 5AVSB 4BWNA 1IC2A 3G4SP 1G1IA 3IAOA 2ITAA 1QVGO 4R4LA 3N4XA 2HG5D 2AXCA 1KYOD 2IBZD 4AQRD 3L73E 3AEBC 2B88A 1T3JA 3CMEP 1D7MA 1ZOYC 4PD4D 1U57A 1NTKE 2KXPB 1N73A 3FXEA 2WITA 1LWUA 2K37A 3GF3A 5CBNA 2W6JH 4D6TE 5APVA 2E43A 2QA4P 2HFED 4IL6E 2NPSA 5AW4B 3MIWA 3B71A 3RL0D 4JPZB 3PTZA 3LW5H 1BE3G 4UB6H 4JYBA 3M9QA 1KFNA 2WZ7A 2KI7B 3RL0C 1FZCB 2N1TC 4U3FE 4Y99B 1YJNP 2IX7C 1ZMEC 1S5LE 3SWFA 3AEDC 5KJ7A 1LTJA 2E76D 2GUSA 3JCUE 3A0HH 2PFXA 4PV1B 1EXIA 4H44C 2KS1A 2K9JB 2FYUD 3L72D 2H43A 1E79H 2Q5UA 2R44A 3PRJA 1NU1D 1J1DC 2H7HA 3RBXA 1BE3J 1LTBC 2AEFA 3U59A 4JBZA 1FZFA 2FFDC 3M9HA 3HTKA 3G3ZA 1OW7A 5AVWB 3VP8A 1RE3A 3H1HG 1CI6A 3BCCE 2YO3A 3H1ID 4GIFA 2HR3A 1BGYD 4OGQC 5APSA 2J59M 1Y8AA 3TGUD 5KLIC 4HYTB 1QL1A 1PP9E 3AECC 1KMIZ 5APYA 2OYHC 2KSEA 1SQQK 5KLVE 3H1HJ 3MZWB 1GMJA 4ASVA 1VL2A 2OARA 3GLMA 1YITP 2A45G 3I5CA 4N3YB 1GU4A 3MUDA 3VP9A 1HUCA 3EFFK 4ZNCA 3H25A 4L75A 1M1JA 4BXLA 1MZ9A 3H32B 1AJYA 1SQXD 3KPEA 2LKMA 4H0LB 3CCLP 2B9BA 1SQPG 3L35A 1EDIA 2GA1A 3P32A 2K3RA 2OGUA 3HD7D 1S9KE 3C8VA 2ZT9B 3CWBG 1JEKA 4YTPC 1BSHA 2I8DA 3O8ZA 4JQ0D 1USEA 1SQQG 3M91A 3BVHA 2GUVA 1NTZE 1NAFA 2P1JA 1GL2B 2HODA 2UWJE 1VQLP 1IK7A 1H8AA 3B4SA 3PLNA 2WT7A 2A06E 3KZIH 1YQ3C 1SQPJ 1VQKP 1QGKB 1JCDA 3V2RA 3CC2P 1VQ6P 1GL2A 1OIPA 3CWBJ 4I1LA 1W5CE 3JC22 1JTHB 1PPJE 1SQQJ 1JY2O 1BCCJ 2M5AA 2E42A 3L37A 5AW7B 2OTJP 2IYOA 4IFFA 3CLQA 5DJUB 5CCGD 2LXCB 2OYIB 1RH5B 3GF7A 1KILE 3H1LG 4IFDK 1RHZB 1VQ8P 2KZIA 2JP3A 2MJZA 5CJ0A 1NKZB 4ZMDA 1N73C 3JCUH 2KIKA 1JO5A 1N2DC 1W2EA 3KXDA 1SFCB 1AVOA 2K88A 3USSA 5AVUB 1FDIA 3L75G 4YXWH 1YJ9P 3BRVB 2IFNA 3H1LJ 3RBZA 1NTMD 2K9YA 1PZQA 2FYNB 2W6BA 2C0XA 5AVVB 1L0NK 1H89A 4N6JA 4DT0A 1KV4A 1RQUA 2JJLA 3L75J 4MN4C 5KJ7C 4PV1D 2ZVNB 3W68A 5KLVJ 1P84H 4XE5B 2RMZA 1SQVD 2XV5A 3NTNA 2WTYA 1FDMA 1FZCC 4WWIA 1VPCA 1RF1A 1IFDA 1SP4A 1RY3A 2BEZF 1GD2E 1IFPA 3O6QB 1Q90D 1KD1Q 2ZYGA 2J5UA 4PV1C 3K5BA 4IL6X 4OWFA 2JR8A 1L0LK 1DEEG 1A02J 3TYYA 1EZVG 1S9KD 4WB4A 1Q82Q 4W7ZA 1L0ND 3AEFC 3M9BA 3A0HE 1BSNA 2ZXEB 5CBOA 3CCQP 1FE6A 2OYHA 1KB9E 2B87B 3SSUA 5AVYB 1BDDA 3MGNA 1OW6A 2QSIA 1IFNA 1S5LX 3HRNA 5GTHH 1KQSO 3EQ2A 2L5GB 1BE3E 2QG4A 4C7NA 1X22A 1ZV8A 3TNUB 3SWKA 3CX5H 1YTZI 3VYIA 1T8ZA 2KB7P 3FGAD 1L0LG 5AVRB 1J2JB 1M1JC 2WMMA 2OQQA 2FYZA 4UB8E 1ZR4A 1YTZT 4H0LD 3Q5SA 1KC8Q 1PFIA 2YKOA 1OW8A 2R3SA 3Q5RA 2ZT9D 2WSFH 1Z56A 1KTMA 3M0DC 2P7JA 4LC1A 5C39A 1JB0J 1EQ7A 3C9IA 1L0LJ 3H1HE 2BCCG 4GODA 3HD7A 2K1AA 1K73Q 2QM8A 1ZXGA 3P8CD 5B66E 2JWDA 3D6ZA 1ZRTE 1VQNP 2ZT9C 1S3JA 1KZUB 1G2CA 1OWAA 1T2KD 2HPCA 5AW8B 1GL2C 5E79H 3G9RA 1SQBD 2QRXA 4A7PA 2BCCJ 5L8RJ 1RQVA 2WSEJ 4L74A 2ZVOB 2V7QJ 1Q2NA 1CW5A 3L4FA 2N9YB 5CCGA 2FYUK 2Y0DA 3KZIE 3H1KD 2FY8A 2J58A 1NU1K 3RK2B 1SFCD 1SLQA 3AE1C 1SQPE 3M0AA 3II6A 3H6PA 1GDTA 4U7JA 3IFMA 1T3UA 2CPBA 3CWBE 1OMIA 1HJ0A 1QX8A 3B8EB 4PD4H 1HWTC 3R4YA 1JMBA 3S9OA 1SQQE 1OVRA 1BCCE 2FXOA 1L4AB 1VF5B 3TK1A 2IZ0A 1PV3A 1FOSE 2QJYB 5CMZA 1ZW0A 4RESB 1PGPA 3L70D 3GG2A 2DW3A 2E5TA 2M0BA 2QE7H 2Q9IA 2ZAEB 1EDJA 1DIPA 1KB9H 1FZCA 2FYUG 3L72G 3RGUA 2WPQA 3HE4B 1NU1G 2JWAA 2JKVA 3ITKA 2E76C 3P7KA 1RF1C 2FBWC 3H1LE 2K9JA 3OA7A 1GTWA 1AQ5A 4N78D 1NYHA 2SPZA 1HJBA 3L71D 1SQXK 3GMAA 1FJKA 3B5NB 1WT6A 2QJPC 2KOGA 1S4XA 3H1IG 3L72J 2KYVA 2P58A 1J1EB 1NTKK 1BGYG 4UB8H 2O01N 1NU1J 3MD0A 2LXBA 1LP1B 3TDKA 3H1JD 3L75E 3TGUG 1Y9BA 3RK3E 1T6AA 1P84E 3OW2O 2W27A 2XNDH 1ZN5A 2ZYAA 1JY3P 2Q3IA 4HB1A 2OTKE 4EYYQ 1BGYJ 2HYNA 4WBAA 5B66H 2JO1A 4EI2A 2CK3H 2W90A 3TGUJ 3L73D 1E5WA 1ZLLA 4LLHA 4ASWA 2PGDA 1SQXG 2C0WA 1WMKA 2Q6QA 1QVFO 2Z5HA 5AW3B 1M1KQ 1QEXA 1KILB 5KTBA 1LT9B 3L74G 1KFMA 1JUNA 1K9MQ 3IF4A 1NTKD 3V4QA 3CL3D 2KP8A 5AW0B 1FJPA 2XU6A 3H32A 3M0DA 2H89C 4K3AA 2A45H 1GK6A 1K05A 5GTHE 1M7LA 4XFJA 1X0TA 4D6TD 1FS0E 4GOFA 1IO4A 5CHXA 5BU5A 1LJ2A 1SQXJ 4NPEA 1EZVE 3AE3C 3D6YA 4WY4B 5BU8B 4OH8B 3L74J 3HD7C 3T97B 3CX5E 3AE8C 3F89A 1DD3A 3VMAA 2PAJA 1BCCD 2H8PD 1R5SA 2Y0EA 5BVZA 3S1KA 3F5HA 1NTMK 2PP6A 4XA4A 1IFIA 4U3FD 3CMAP 1QL2A 1DD4A 5APTA 4KHXA 1KQGB 2Z5IA 4PJ0H 3KDPB 1Q7YQ 1GK4A 3WUUA 2M8RA 1P84I 2KNCB 1X8YA 3Q1MA 2W6AA 3A2AA 1JTHA 5AW5B 3D71A 4C7RA 3U1CA 3VOPA 3M06A 1K8AQ 1L0LE 2OYIA 3GW6A 4BRYB 3PP5A 1SQVK 5CCGC 2WQYC 3WUTA 3RK2D 1KN7A 3VMXA 5AVTB 1NWQA 3BCCD 1FZAA 1JNMA 5E79E 1H0TB 1NTMG 3EFGA 3QWOC 2FXMA 1SFCA 3A5TA 3LIEA 5EFWB 1M8OB 1L4AD 4RJTA 5TJHA 1VF5D 2BCCE 3RK2C 4NPFX 5AW1B 2N1TB 3E1IA 1PP9D 2AXTE 1RE4C 1OFCX 5KLVD 1OVUA 2D2CB 1NTZK 3D70A 5KKZB 1IFJA 5CCHD 1JY3N 1EZVI 1EC5A 3TF5A 2OYOA 3PHLA 4H44B 1JM0A 2H88C 1L4AC 1FZBA 1HGZA 1NO4A 1NTMJ 1N7SB 1YBKA 4LGDE 1VQ7P 5KAFH 1KYOE 1SQVG 3IR9A 4Y99C 2WPRA 2FFDB 3CXHH 5CCHC 4YPCA 2M3EA 1VQ9P 1QLED 1MFZA 4PD4E 1UIIA 2KLVA 2QM7A 2WWWA 3IN6A 3R2PA 3B5ND 3AE4C 1LTTC 3O6QA 3CD6P 2YMYA 2QEXP 2CPSA 1SQVJ 4OGQB 2PRRA 1L0NG 2R5DA 5AW9B 3C1LA 1N86A 1NTZD 5APUA 2FXPA 3B5NC 1IJDB 3I56P 4M3LA 2A06D 2L91A 2YO2A 3V4WA 2M3BA 1IK9A 3VTPC 2I1KA 3CCSP 3A3YB 2IFMA 1CZQA 2B87A 3FWNA 1L0NJ 1PPJD 3GHGB 1URQB 1FDOA 3NFQA 2I1JA 2YKQA 1YQ4C 4JYCA 1XTCC 1JY2P 4HH2A 1SQBK 3U1AA 1LTAC 3BRTB 1KILD 1IFMA 4H13B 2FYUE 3GHGA 2YNYA 3L72E 3TNUA 4JF7A 1UIXA 1JCCA 1NU1E
chains in the Genus database with same CATH topology
1IFPA 1E79H 3EFFK 3PJSK 3USSA 2WSSH 1BSNA 4YXWH 2CK3H 2XNDH 2W6JH 2E5TA 1AQTA 1JEKA 4QMAA 4TLFA 2QE7H 1BSHA 2E5YA 4DJGA 2JDIH 1FS0E 4WVZA 2V7QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFP A;  1E79 H;  3EFF K;  3PJS K;  3USS A;  2WSS H;  1BSN A;  4YXW H;  2CK3 H;  2XND H;  2W6J H;  2E5T A;  1AQT A;  1JEK A;  4QMA A;  4TLF A;  2QE7 H;  1BSH A;  2E5Y A;  4DJG A;  2JDI H;  1FS0 E;  4WVZ A;  2V7Q H; 
#chains in the Genus database with same CATH topology
 1FAV A;  2P10 A;  3WU2 E;  4OVN F;  1U7J A;  3W67 A;  5H2F H;  3SFD C;  3I55 P;  3BAT A;  1YHQ P;  4H0L C;  3CCR P;  3HE5 B;  2Y9Y A;  4PD4 I;  2KLU A;  4WY4 D;  3CPW O;  4IFM A;  5AW6 B;  1AFO A;  5M1B A;  2XDJ A;  3LID A;  1BGY E;  3AE7 C;  1YYC A;  1NGM B;  2KUB A;  3RL0 g;  3AEG C;  3TGU E;  4IOI H;  2QVA A;  2Q7C A;  3KQG A;  2IZ1 A;  1SQB G;  4WY4 C;  1YJW P;  1FOS F;  2IBZ G;  3AEE C;  4RO0 A;  1S1C X;  1KB9 I;  4DZO A;  1T2K C;  2XNX A;  2WSE H;  3SFE C;  2AXT H;  2V7Q H;  3V2N A;  3FXD A;  1N73 B;  3CCE P;  1OVV A;  1GW3 A;  1LTG C;  2VRS A;  1SQX E;  1LWU B;  1M56 D;  2O1J A;  1YIJ P;  3H1K G;  1LTI C;  1SQB J;  2OYI C;  3L74 E;  5KAI E;  4L76 A;  2NRG A;  2E74 B;  1KYO H;  1Y47 A;  2NPS B;  3MTU E;  4I7Z B;  2MKV A;  2WPS A;  2YMK A;  1HF9 A;  2LR2 A;  4PJ0 E;  3V2Q A;  5GTI H;  1SFC C;  1RE4 A;  2N1T D;  3RK3 B;  3H1K J;  2ZYD A;  1KB9 D;  3L36 A;  1PIX A;  4GKG A;  1FBM A;  2D2C D;  5AW2 B;  3LW5 J;  4W80 A;  3L70 G;  4GDO A;  4Y28 J;  1LTJ B;  3MP7 B;  1L4A A;  2V4H A;  3TSI A;  4QMA A;  2R5B A;  2Q1K A;  1BE3 D;  1VQ4 P;  4H44 D;  2FYN C;  4KT0 J;  2W8Z A;  2G8Y A;  2C9L Y;  1N7S D;  1OXZ A;  2KS1 B;  1USD A;  3CC4 P;  2YIU B;  3Q5P A;  4C46 A;  1GU5 A;  5CCH A;  5AVQ B;  4K35 A;  5TIS H;  2D2C C;  5KKZ C;  2P67 A;  1JY2 N;  2P2U A;  1XTG B;  1NH4 A;  3HTK B;  1R8E A;  3L70 J;  1A02 F;  4AUW A;  4Z1M H;  3HE4 A;  1N7S C;  3L71 G;  1CI6 B;  2A45 I;  2WVR A;  1WRG A;  5B5E H;  3VN0 A;  2KK7 A;  2FYU J;  5AVX B;  4B86 A;  1HVV A;  4OGQ D;  3V2P A;  4EIJ A;  1PGO A;  1NAY A;  1PGJ A;  3H1H D;  3H1J G;  3V6I A;  3B5N A;  1LGH B;  5KAF E;  3WU2 H;  1MFT A;  1NTM E;  1ZRT D;  2POH A;  1PGQ A;  2Y0C A;  1SQP K;  1Q81 Q;  3L71 J;  4TT3 H;  3AE6 C;  4CPG A;  4DJG A;  3CXH E;  2IPP A;  1LP1 A;  1YI2 P;  1FZG A;  3H1I J;  1SS1 A;  2YXR B;  5DJT B;  3PJS K;  1KQF B;  1RF0 C;  1URQ D;  2O3J A;  3H1J J;  1M1J B;  5APQ A;  3L73 G;  1HBW A;  3G6E P;  1X9V A;  3A0B H;  2Z4E A;  2WSC J;  4H13 D;  1SQV E;  4EDF A;  1NTK G;  2E75 B;  3GHG C;  2WSC H;  1URQ C;  4HKZ H;  4ZKP A;  2QJK B;  3OJA B;  4YXD C;  2ZJS E;  3CCV P;  1KIL A;  3HUS B;  2YXQ B;  5APX A;  4D6T G;  2FKW B;  1LT9 A;  3L74 D;  1K04 A;  2OTL P;  3L73 J;  1SQP D;  3E1R A;  4H13 C;  2HOD B;  2GM4 A;  1VQ5 P;  1HH0 A;  3CWB D;  2WT7 B;  1DEB A;  3HUS A;  1NTK J;  1L0N E;  3CI9 A;  1SQQ D;  1BCC G;  5KAI H;  1NKN A;  4WY4 A;  3S4R A;  2WSS H;  4D6T J;  3NXS A;  4U3F G;  1FZE A;  3T97 A;  3AE2 C;  2R32 A;  1VDF A;  2M5A B;  2E5Y A;  2QIW A;  3PH0 A;  2R3C A;  1W2B O;  4IL6 H;  2B89 A;  5KLV K;  1DX7 A;  3Q3D A;  3E7K A;  5H2F E;  4GT1 A;  1BDC A;  1EXJ A;  3CXH I;  3Q2Y A;  5AVZ B;  1U7M A;  3ABV C;  1JOC A;  2KNC A;  3P8M C;  4U3F J;  2XZR A;  2IYP A;  3H1L D;  3CCJ P;  1AV1 A;  2E74 D;  1S5L H;  3EWK A;  2NPS D;  3NMD A;  2ZFC A;  1GZL A;  1ZP0 C;  3BCC G;  4BRY A;  5K5G B;  3KHU A;  1LWU C;  4L73 A;  1IZN B;  3CCM P;  1AVY A;  3L75 D;  3RL0 B;  5CJ4 A;  3WMM 0;  1VQP P;  2E74 C;  3FX0 A;  3RK3 D;  2NPS C;  1PP9 G;  3BAS A;  1MUU A;  1P84 D;  3AE5 C;  1H0T A;  3P8C E;  4I7Z C;  5KLV G;  4WVZ A;  1PL5 A;  5KJ7 D;  2WPV B;  2N9B A;  3CXH D;  2HLO A;  3BCC J;  4I2L C;  2YKP A;  2O1K A;  2N1T A;  2C9N Y;  1VF5 C;  3CX5 I;  3WUV A;  2RN0 A;  3FWL A;  1J1D B;  1NHL A;  1NJI Q;  3RK3 C;  1VQO P;  3A7O A;  1SQB E;  3AEA C;  2IBZ E;  2QJY C;  2E76 B;  1OZH A;  2IDB A;  1RF1 B;  1G1J A;  1M57 D;  2Q3E A;  1PP9 J;  3SWY A;  1LTJ C;  4HJG H;  1EDL A;  2ZXX A;  1N7S A;  1VQM P;  3CC7 P;  3KYQ A;  1LT1 A;  2QJP B;  5GTI E;  2FFD A;  2YIU C;  4O9B A;  2RKL A;  3QH9 A;  4KJM A;  1OX3 A;  3H1K E;  1R5L A;  1FC2 C;  1JMM A;  3VMY A;  4GOE A;  1NTZ G;  5KLI B;  1MV8 A;  4R4M A;  2RH0 A;  4UB6 E;  1SVF A;  1AQT A;  1TU3 F;  2JEE A;  2OYH B;  1EZV D;  1RE3 C;  2NZ2 A;  2JDI H;  1KOR A;  1DH3 A;  2A06 G;  4NPD A;  3CX5 D;  5TIS E;  1J1E C;  2O01 J;  4C7N B;  1RF0 A;  1N7L A;  2O01 H;  4ZKU A;  4TLF A;  1PPJ G;  1X79 B;  1FU1 A;  1NTZ J;  3L70 E;  3UIA A;  5B5E E;  1HGV A;  1LNQ A;  3MHV A;  3AE9 C;  1AA0 A;  1Q86 Q;  3V5B A;  1S2E A;  1NVO A;  1URQ A;  3MUD C;  2G3A A;  2Y9Z A;  2E75 D;  4DOJ A;  1M90 Q;  1NOH A;  2KSJ A;  4AYC A;  1L0L D;  4W7Y A;  4EOT A;  3JSV C;  1H88 A;  1KYO I;  2KZJ A;  2IBZ I;  2AEJ A;  2BEQ D;  4N78 E;  3ZDM A;  1HTL C;  1KIL C;  1S72 P;  1LT9 C;  3L71 E;  1N8R Q;  2WSF J;  4DCK A;  3HD7 B;  3CCU P;  2E75 C;  2AEM A;  1GW4 A;  3H1I E;  3VMZ A;  4I6M C;  2QJK C;  4RKU J;  2XKM A;  5APW A;  1G2C B;  1MKM A;  1L2P A;  3HUS C;  1EDK A;  3OAK A;  3G71 P;  3N7N A;  2HPC B;  3H1J E;  2BCC D;  3A0B E;  1GL2 D;  2BAS A;  3HE5 A;  1LTS C;  1ZR2 A;  1CSB A;  1KQL A;  1JY3 O;  2W83 C;  5AVS B;  4BWN A;  1IC2 A;  3G4S P;  1G1I A;  3IAO A;  2ITA A;  1QVG O;  4R4L A;  3N4X A;  2HG5 D;  2AXC A;  1KYO D;  2IBZ D;  4AQR D;  3L73 E;  3AEB C;  2B88 A;  1T3J A;  3CME P;  1D7M A;  1ZOY C;  4PD4 D;  1U57 A;  1NTK E;  2KXP B;  1N73 A;  3FXE A;  2WIT A;  1LWU A;  2K37 A;  3GF3 A;  5CBN A;  2W6J H;  4D6T E;  5APV A;  2E43 A;  2QA4 P;  2HFE D;  4IL6 E;  2NPS A;  5AW4 B;  3MIW A;  3B71 A;  3RL0 D;  4JPZ B;  3PTZ A;  3LW5 H;  1BE3 G;  4UB6 H;  4JYB A;  3M9Q A;  1KFN A;  2WZ7 A;  2KI7 B;  3RL0 C;  1FZC B;  2N1T C;  4U3F E;  4Y99 B;  1YJN P;  2IX7 C;  1ZME C;  1S5L E;  3SWF A;  3AED C;  5KJ7 A;  1LTJ A;  2E76 D;  2GUS A;  3JCU E;  3A0H H;  2PFX A;  4PV1 B;  1EXI A;  4H44 C;  2KS1 A;  2K9J B;  2FYU D;  3L72 D;  2H43 A;  1E79 H;  2Q5U A;  2R44 A;  3PRJ A;  1NU1 D;  1J1D C;  2H7H A;  3RBX A;  1BE3 J;  1LTB C;  2AEF A;  3U59 A;  4JBZ A;  1FZF A;  2FFD C;  3M9H A;  3HTK A;  3G3Z A;  1OW7 A;  5AVW B;  3VP8 A;  1RE3 A;  3H1H G;  1CI6 A;  3BCC E;  2YO3 A;  3H1I D;  4GIF A;  2HR3 A;  1BGY D;  4OGQ C;  5APS A;  2J59 M;  1Y8A A;  3TGU D;  5KLI C;  4HYT B;  1QL1 A;  1PP9 E;  3AEC C;  1KMI Z;  5APY A;  2OYH C;  2KSE A;  1SQQ K;  5KLV E;  3H1H J;  3MZW B;  1GMJ A;  4ASV A;  1VL2 A;  2OAR A;  3GLM A;  1YIT P;  2A45 G;  3I5C A;  4N3Y B;  1GU4 A;  3MUD A;  3VP9 A;  1HUC A;  3EFF K;  4ZNC A;  3H25 A;  4L75 A;  1M1J A;  4BXL A;  1MZ9 A;  3H32 B;  1AJY A;  1SQX D;  3KPE A;  2LKM A;  4H0L B;  3CCL P;  2B9B A;  1SQP G;  3L35 A;  1EDI A;  2GA1 A;  3P32 A;  2K3R A;  2OGU A;  3HD7 D;  1S9K E;  3C8V A;  2ZT9 B;  3CWB G;  1JEK A;  4YTP C;  1BSH A;  2I8D A;  3O8Z A;  4JQ0 D;  1USE A;  1SQQ G;  3M91 A;  3BVH A;  2GUV A;  1NTZ E;  1NAF A;  2P1J A;  1GL2 B;  2HOD A;  2UWJ E;  1VQL P;  1IK7 A;  1H8A A;  3B4S A;  3PLN A;  2WT7 A;  2A06 E;  3KZI H;  1YQ3 C;  1SQP J;  1VQK P;  1QGK B;  1JCD A;  3V2R A;  3CC2 P;  1VQ6 P;  1GL2 A;  1OIP A;  3CWB J;  4I1L A;  1W5C E;  3JC2 2;  1JTH B;  1PPJ E;  1SQQ J;  1JY2 O;  1BCC J;  2M5A A;  2E42 A;  3L37 A;  5AW7 B;  2OTJ P;  2IYO A;  4IFF A;  3CLQ A;  5DJU B;  5CCG D;  2LXC B;  2OYI B;  1RH5 B;  3GF7 A;  1KIL E;  3H1L G;  4IFD K;  1RHZ B;  1VQ8 P;  2KZI A;  2JP3 A;  2MJZ A;  5CJ0 A;  1NKZ B;  4ZMD A;  1N73 C;  3JCU H;  2KIK A;  1JO5 A;  1N2D C;  1W2E A;  3KXD A;  1SFC B;  1AVO A;  2K88 A;  3USS A;  5AVU B;  1FDI A;  3L75 G;  4YXW H;  1YJ9 P;  3BRV B;  2IFN A;  3H1L J;  3RBZ A;  1NTM D;  2K9Y A;  1PZQ A;  2FYN B;  2W6B A;  2C0X A;  5AVV B;  1L0N K;  1H89 A;  4N6J A;  4DT0 A;  1KV4 A;  1RQU A;  2JJL A;  3L75 J;  4MN4 C;  5KJ7 C;  4PV1 D;  2ZVN B;  3W68 A;  5KLV J;  1P84 H;  4XE5 B;  2RMZ A;  1SQV D;  2XV5 A;  3NTN A;  2WTY A;  1FDM A;  1FZC C;  4WWI A;  1VPC A;  1RF1 A;  1IFD A;  1SP4 A;  1RY3 A;  2BEZ F;  1GD2 E;  1IFP A;  3O6Q B;  1Q90 D;  1KD1 Q;  2ZYG A;  2J5U A;  4PV1 C;  3K5B A;  4IL6 X;  4OWF A;  2JR8 A;  1L0L K;  1DEE G;  1A02 J;  3TYY A;  1EZV G;  1S9K D;  4WB4 A;  1Q82 Q;  4W7Z A;  1L0N D;  3AEF C;  3M9B A;  3A0H E;  1BSN A;  2ZXE B;  5CBO A;  3CCQ P;  1FE6 A;  2OYH A;  1KB9 E;  2B87 B;  3SSU A;  5AVY B;  1BDD A;  3MGN A;  1OW6 A;  2QSI A;  1IFN A;  1S5L X;  3HRN A;  5GTH H;  1KQS O;  3EQ2 A;  2L5G B;  1BE3 E;  2QG4 A;  4C7N A;  1X22 A;  1ZV8 A;  3TNU B;  3SWK A;  3CX5 H;  1YTZ I;  3VYI A;  1T8Z A;  2KB7 P;  3FGA D;  1L0L G;  5AVR B;  1J2J B;  1M1J C;  2WMM A;  2OQQ A;  2FYZ A;  4UB8 E;  1ZR4 A;  1YTZ T;  4H0L D;  3Q5S A;  1KC8 Q;  1PFI A;  2YKO A;  1OW8 A;  2R3S A;  3Q5R A;  2ZT9 D;  2WSF H;  1Z56 A;  1KTM A;  3M0D C;  2P7J A;  4LC1 A;  5C39 A;  1JB0 J;  1EQ7 A;  3C9I A;  1L0L J;  3H1H E;  2BCC G;  4GOD A;  3HD7 A;  2K1A A;  1K73 Q;  2QM8 A;  1ZXG A;  3P8C D;  5B66 E;  2JWD A;  3D6Z A;  1ZRT E;  1VQN P;  2ZT9 C;  1S3J A;  1KZU B;  1G2C A;  1OWA A;  1T2K D;  2HPC A;  5AW8 B;  1GL2 C;  5E79 H;  3G9R A;  1SQB D;  2QRX A;  4A7P A;  2BCC J;  5L8R J;  1RQV A;  2WSE J;  4L74 A;  2ZVO B;  2V7Q J;  1Q2N A;  1CW5 A;  3L4F A;  2N9Y B;  5CCG A;  2FYU K;  2Y0D A;  3KZI E;  3H1K D;  2FY8 A;  2J58 A;  1NU1 K;  3RK2 B;  1SFC D;  1SLQ A;  3AE1 C;  1SQP E;  3M0A A;  3II6 A;  3H6P A;  1GDT A;  4U7J A;  3IFM A;  1T3U A;  2CPB A;  3CWB E;  1OMI A;  1HJ0 A;  1QX8 A;  3B8E B;  4PD4 H;  1HWT C;  3R4Y A;  1JMB A;  3S9O A;  1SQQ E;  1OVR A;  1BCC E;  2FXO A;  1L4A B;  1VF5 B;  3TK1 A;  2IZ0 A;  1PV3 A;  1FOS E;  2QJY B;  5CMZ A;  1ZW0 A;  4RES B;  1PGP A;  3L70 D;  3GG2 A;  2DW3 A;  2E5T A;  2M0B A;  2QE7 H;  2Q9I A;  2ZAE B;  1EDJ A;  1DIP A;  1KB9 H;  1FZC A;  2FYU G;  3L72 G;  3RGU A;  2WPQ A;  3HE4 B;  1NU1 G;  2JWA A;  2JKV A;  3ITK A;  2E76 C;  3P7K A;  1RF1 C;  2FBW C;  3H1L E;  2K9J A;  3OA7 A;  1GTW A;  1AQ5 A;  4N78 D;  1NYH A;  2SPZ A;  1HJB A;  3L71 D;  1SQX K;  3GMA A;  1FJK A;  3B5N B;  1WT6 A;  2QJP C;  2KOG A;  1S4X A;  3H1I G;  3L72 J;  2KYV A;  2P58 A;  1J1E B;  1NTK K;  1BGY G;  4UB8 H;  2O01 N;  1NU1 J;  3MD0 A;  2LXB A;  1LP1 B;  3TDK A;  3H1J D;  3L75 E;  3TGU G;  1Y9B A;  3RK3 E;  1T6A A;  1P84 E;  3OW2 O;  2W27 A;  2XND H;  1ZN5 A;  2ZYA A;  1JY3 P;  2Q3I A;  4HB1 A;  2OTK E;  4EYY Q;  1BGY J;  2HYN A;  4WBA A;  5B66 H;  2JO1 A;  4EI2 A;  2CK3 H;  2W90 A;  3TGU J;  3L73 D;  1E5W A;  1ZLL A;  4LLH A;  4ASW A;  2PGD A;  1SQX G;  2C0W A;  1WMK A;  2Q6Q A;  1QVF O;  2Z5H A;  5AW3 B;  1M1K Q;  1QEX A;  1KIL B;  5KTB A;  1LT9 B;  3L74 G;  1KFM A;  1JUN A;  1K9M Q;  3IF4 A;  1NTK D;  3V4Q A;  3CL3 D;  2KP8 A;  5AW0 B;  1FJP A;  2XU6 A;  3H32 A;  3M0D A;  2H89 C;  4K3A A;  2A45 H;  1GK6 A;  1K05 A;  5GTH E;  1M7L A;  4XFJ A;  1X0T A;  4D6T D;  1FS0 E;  4GOF A;  1IO4 A;  5CHX A;  5BU5 A;  1LJ2 A;  1SQX J;  4NPE A;  1EZV E;  3AE3 C;  3D6Y A;  4WY4 B;  5BU8 B;  4OH8 B;  3L74 J;  3HD7 C;  3T97 B;  3CX5 E;  3AE8 C;  3F89 A;  1DD3 A;  3VMA A;  2PAJ A;  1BCC D;  2H8P D;  1R5S A;  2Y0E A;  5BVZ A;  3S1K A;  3F5H A;  1NTM K;  2PP6 A;  4XA4 A;  1IFI A;  4U3F D;  3CMA P;  1QL2 A;  1DD4 A;  5APT A;  4KHX A;  1KQG B;  2Z5I A;  4PJ0 H;  3KDP B;  1Q7Y Q;  1GK4 A;  3WUU A;  2M8R A;  1P84 I;  2KNC B;  1X8Y A;  3Q1M A;  2W6A A;  3A2A A;  1JTH A;  5AW5 B;  3D71 A;  4C7R A;  3U1C A;  3VOP A;  3M06 A;  1K8A Q;  1L0L E;  2OYI A;  3GW6 A;  4BRY B;  3PP5 A;  1SQV K;  5CCG C;  2WQY C;  3WUT A;  3RK2 D;  1KN7 A;  3VMX A;  5AVT B;  1NWQ A;  3BCC D;  1FZA A;  1JNM A;  5E79 E;  1H0T B;  1NTM G;  3EFG A;  3QWO C;  2FXM A;  1SFC A;  3A5T A;  3LIE A;  5EFW B;  1M8O B;  1L4A D;  4RJT A;  5TJH A;  1VF5 D;  2BCC E;  3RK2 C;  4NPF X;  5AW1 B;  2N1T B;  3E1I A;  1PP9 D;  2AXT E;  1RE4 C;  1OFC X;  5KLV D;  1OVU A;  2D2C B;  1NTZ K;  3D70 A;  5KKZ B;  1IFJ A;  5CCH D;  1JY3 N;  1EZV I;  1EC5 A;  3TF5 A;  2OYO A;  3PHL A;  4H44 B;  1JM0 A;  2H88 C;  1L4A C;  1FZB A;  1HGZ A;  1NO4 A;  1NTM J;  1N7S B;  1YBK A;  4LGD E;  1VQ7 P;  5KAF H;  1KYO E;  1SQV G;  3IR9 A;  4Y99 C;  2WPR A;  2FFD B;  3CXH H;  5CCH C;  4YPC A;  2M3E A;  1VQ9 P;  1QLE D;  1MFZ A;  4PD4 E;  1UII A;  2KLV A;  2QM7 A;  2WWW A;  3IN6 A;  3R2P A;  3B5N D;  3AE4 C;  1LTT C;  3O6Q A;  3CD6 P;  2YMY A;  2QEX P;  2CPS A;  1SQV J;  4OGQ B;  2PRR A;  1L0N G;  2R5D A;  5AW9 B;  3C1L A;  1N86 A;  1NTZ D;  5APU A;  2FXP A;  3B5N C;  1IJD B;  3I56 P;  4M3L A;  2A06 D;  2L91 A;  2YO2 A;  3V4W A;  2M3B A;  1IK9 A;  3VTP C;  2I1K A;  3CCS P;  3A3Y B;  2IFM A;  1CZQ A;  2B87 A;  3FWN A;  1L0N J;  1PPJ D;  3GHG B;  1URQ B;  1FDO A;  3NFQ A;  2I1J A;  2YKQ A;  1YQ4 C;  4JYC A;  1XTC C;  1JY2 P;  4HH2 A;  1SQB K;  3U1A A;  1LTA C;  3BRT B;  1KIL D;  1IFM A;  4H13 B;  2FYU E;  3GHG A;  2YNY A;  3L72 E;  3TNU A;  4JF7 A;  1UIX A;  1JCC A;  1NU1 E; 
#chains in the Genus database with same CATH homology
 1IFP A;  1E79 H;  3EFF K;  3PJS K;  3USS A;  2WSS H;  1BSN A;  4YXW H;  2CK3 H;  2XND H;  2W6J H;  2E5T A;  1AQT A;  1JEK A;  4QMA A;  4TLF A;  2QE7 H;  1BSH A;  2E5Y A;  4DJG A;  2JDI H;  1FS0 E;  4WVZ A;  2V7Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...