1JEKA

Visna tm core structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
40
structure length
40
Chain Sequence
QSLANATAAQQEVLEASYAMVQHIAKGIRILEARVARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENV POLYPROTEIN
publication title The trimer-of-hairpins motif in membrane fusion: Visna virus.
pubmed doi rcsb
molecule tags Viral protein
total genus 18
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1jekA00
2JDIH 1E79H 4QMAA 1IFPA 2CK3H 1AQTA 2QE7H 4TLFA 4YXWH 2V7QH 1BSNA 2WSSH 4WVZA 3PJSK 1FS0E 4DJGA 1BSHA 2XNDH 3EFFK 2E5TA 2E5YA 3USSA 2W6JH 1JEKA
chains in the Genus database with same CATH superfamily
1S5LH 3IAOA 1IFDA 4D6TD 3M9BA 2ZT9B 1ZRTE 2WPSA 3RL0g 3T97A 3L73D 1NHLA 3BCCD 1SFCC 5B5EH 1LT9B 2RKLA 1L2PA 3PTZA 1RQVA 1M1JC 1DH3A 5GTIE 3Q5PA 2O01H 1D7MA 1ZR2A 1NU1J 2D2CB 3BASA 5KJ7A 1PFIA 3H1IG 2QJKC 1PL5A 4O9BA 4EYYQ 2W6JH 5KLVJ 1JEKA 2AXCA 1KB9H 2FFDC 3NXSA 3MD0A 1BDCA 5CCGD 1BCCE 3F89A 2BASA 1BDDA 1EXJA 3MP7B 1PPJG 5APYA 4W7YA 3V6IA 1GL2B 1KFMA 1YJNP 3C1LA 3AEEC 4WY4C 1CI6A 5APSA 2IFMA 2W6BA 1SQXG 1QLED 1IFMA 2WTYA 1RH5B 1UIXA 4BRYB 2ZXEB 1A02J 3H1KE 2XKMA 3O8ZA 3D6ZA 2B88A 1S9KD 3H1LJ 2QEXP 3TDKA 4QMAA 5GTIH 1Q7YQ 2Y0EA 1VQ4P 1S3JA 1GZLA 1Q2NA 2B87B 1SQPK 3LIDA 4YXDC 4PJ0H 3L72J 2YNYA 2H7HA 1FOSF 1N8RQ 2FYUK 1N73C 1HGVA 3II6A 3L72G 2Q7CA 3VMZA 2HPCB 2VRSA 2N9BA 2BCCJ 2PAJA 1IO4A 2M5AA 3CCMP 4LGDE 2ITAA 3G3ZA 4ASVA 3GF7A 2NZ2A 1Q82Q 3B5NA 2ZT9C 2WVRA 1SFCD 4PV1B 2W90A 3H32A 4ASWA 1ZP0C 3FWNA 3GF3A 3CCLP 4KJMA 3L75E 3E1RA 3H6PA 1LT9C 4RKUJ 2JR8A 2JKVA 1J1EB 2Q1KA 1N7SB 4H44B 4PD4D 3R2PA 1KD1Q 1SQBG 3BVHA 1DEBA 3TGUG 3A2AA 1WT6A 2D2CC 3VMXA 1PP9D 4L73A 3AE6C 3BATA 1K04A 1GDTA 3AE3C 3TSIA 1YITP 5CCGA 3O6QA 1BE3G 2Y0CA 3L71D 5H2FE 2FXMA 3L70J 2A45G 1NU1E 1L4AB 3LIEA 4R4LA 4WY4D 2WSCH 3G71P 1GMJA 5KLVE 2FBWC 2K88A 5CJ4A 2OTJP 5AVVB 3A3YB 3PLNA 3V2PA 2C0XA 2XU6A 4Z1MH 1M57D 1NTKK 3L35A 3PHLA 2OQQA 4ZNCA 5BU5A 1VQMP 3V4QA 1AQTA 3CXHI 1RF1A 2G8YA 4HKZH 2K9YA 2HODA 3CC7P 3L74J 1M1KQ 2YO2A 1X8YA 1NYHA 3L74G 3CXHE 3M06A 3KZIH 3H1LE 3P8CE 5AVQB 4JF7A 2KNCA 3NMDA 2ZT9D 4JPZB 3MUDC 3CWBD 3L72E 1NTMJ 3H1HJ 2XV5A 1KILE 4PV1C 1T3JA 2LXCB 1M1JA 1NTMG 3HE5A 2G3AA 5AVUB 3D6YA 1EZVD 2ZJSE 2BCCE 3LW5H 4YTPC 2IBZI 2A06E 1VQ5P 1MZ9A 1H8AA 1J1EC 3H1JG 4W80A 3G9RA 1HJ0A 1N7SC 4H44C 3TF5A 4IFFA 1P84D 2D2CD 2OYOA 3KXDA 1NVOA 5APQA 2IBZE 2FFDA 2CK3H 3G4SP 2OYIB 1GW3A 5AVXB 3RBZA 1NKZB 2P1JA 3L71J 1Y8AA 4OWFA 3USSA 2N1TA 4JQ0D 5CHXA 1SQVK 1E79H 1JO5A 2YKPA 1RY3A 2YXQB 3CXHH 1L4AC 1MKMA 3CCQP 4WY4A 2UWJE 3WUVA 2KK7A 1M56D 1OVUA 2XDJA 2Y0DA 3S1KA 2H88C 4AYCA 2FY8A 1KQGB 4I6MC 2ZVNB 3L70E 4WVZA 3NTNA 3PJSK 3EQ2A 2XZRA 2AXTH 4U3FD 5EFWB 3V2QA 2CPBA 3SWYA 1HF9A 2MJZA 1VQ9P 1R8EA 4HH2A 4N78E 4RESB 3OAKA 2B9BA 4YXWH 4AQRD 5KLVK 3OJAB 1BCCG 1S9KE 1L0LJ 2QJPB 1VPCA 5DJUB 3TNUA 1OX3A 3AEDC 1HGZA 2YO3A 2P67A 3CWBJ 4IL6X 1SQXK 3H1ID 1MV8A 4PV1D 3H1KJ 3M91A 3L74E 3VYIA 4C46A 4L76A 3Q5RA 3H1KG 2NPSA 3A0HE 2LXBA 1N7SD 1YYCA 2A45H 4H44D 1ZR4A 1NTZD 1YBKA 1LTGC 1PPJD 3AEGC 3HTKB 1NTME 2M8RA 3H1HE 2POHA 5B66E 1L0ND 1SQXD 3CX5D 2GUVA 5GTHE 1LTTC 2OYIC 1AJYA 3S9OA 2KSJA 1BGYJ 1H0TB 3M9QA 1RE4C 2HFED 2O1JA 2IYOA 3GMAA 1LTJB 1L4AD 3V5BA 5KAFE 1FZFA 1JY2O 3WUUA 3ABVC 1S72P 1HH0A 2QE7H 1XTGB 1IK7A 1PV3A 5E79E 1KQFB 3FXEA 3V2NA 3EFFK 1JY2P 2E75B 3L71E 5AW3B 1YJWP 1S2EA 2QJYB 2RN0A 1HJBA 4A7PA 1VDFA 1SQBK 2WT7B 3A0HH 1SQQJ 3I56P 2O1KA 4Y99C 3CCRP 1X0TA 3MTUE 1SQQG 1KYOI 2CPSA 1K05A 1GD2E 1URQD 1AA0A 4JBZA 2WITA 3RBXA 2WZ7A 4BXLA 3GHGC 2Z5IA 1VQNP 2OYHB 1JY3P 3AECC 2HPCA 5B66H 1BSNA 1NWQA 1USDA 1FZGA 1KYOE 5GTHH 1NU1G 1EDJA 4IFMA 2K9JA 1SP4A 2KUBA 4WB4A 1VQ6P 2QJPC 1LTBC 3QWOC 3IR9A 3MUDA 2FKWB 5KLVG 1QGKB 5KAFH 1RE3C 1JCDA 5E79H 4UB6E 3AE2C 2V4HA 1LP1A 3M0AA 3A0BE 1DD3A 4GODA 2H8PD 1A02F 2SPZA 1L0LE 2P58A 1NTZJ 2H43A 1G1JA 4GT1A 1VQ8P 2R44A 4I2LC 3CWBE 3Q2YA 3HUSB 3IN6A 1LTSC 3SFDC 3K5BA 1JTHB 4WBAA 1OW8A 1MUUA 3AE9C 3WMM0 3PH0A 1JOCA 3I5CA 1OWAA 2J59M 1ZMEC 1JUNA 3H1LG 2WPRA 5AVWB 2WSFJ 3RGUA 3VMAA 1KYOH 4BWNA 1LTJC 1EQ7A 2KB7P 4KT0J 2ZXXA 3T97B 1PGQA 5AVZB 3R4YA 3FGAD 1H89A 1KFNA 1NTMK 1QL1A 1CZQA 2Z4EA 3AE8C 2BCCG 1BGYE 2E76B 4D6TJ 2E75C 3AEBC 3P8MC 2A06G 1U7MA 2KZJA 3M9HA 3L73J 4UB6H 3BCCJ 1J2JB 3JC22 2QJYC 3A0BH 1SQPD 1G2CA 3BCCG 4HYTB 3AE5C 3N7NA 2IBZG 1FBMA 1URQA 2KS1B 3IF4A 1S4XA 2FYUD 2B89A 1YIJP 3M0DA 3L4FA 1M90Q 1QEXA 2W27A 2OYHC 2ZFCA 1KC8Q 3RL0B 2OTKE 5AW8B 1M7LA 1EDKA 2W83C 1SQQE 1AQ5A 2Q6QA 3H1JD 1UIIA 1RF0C 2Q9IA 1USEA 2YMYA 1KB9D 1CI6B 1YHQP 3CC4P 1FAVA 1SLQA 5KTBA 3KYQA 3V4WA 1YJ9P 3OA7A 3CCVP 2PP6A 1QVFO 3L70G 1GL2C 3MIWA 3JSVC 2IZ1A 1JMBA 4H0LB 4ZKPA 4UB8E 3CPWO 3HE4B 1J1DB 1ZW0A 1ZRTD 3G6EP 1LWUA 4NPDA 1HUCA 3C8VA 3HUSC 1KILB 3Q1MA 4N3YB 2KLUA 3Q3DA 4JYCA 2HYNA 4H13B 1IK9A 1OW6A 1NTZE 3VP8A 5CBNA 1YQ3C 2K3RA 4I7ZB 5BVZA 3B5NB 3C9IA 3S4RA 4DT0A 2ZYGA 5M1BA 1LGHB 5K5GB 3GG2A 2KYVA 2KIKA 1G1IA 1OXZA 1NTKD 5H2FH 2YKQA 3AEFC 2E76C 2Y9YA 1SFCA 1SQPJ 2E42A 1VQ7P 3W68A 2FXPA 1IZNB 1LNQA 3H1HG 1U57A 3GHGA 4TT3H 1FC2C 2L91A 1FDIA 1VQPP 2OGUA 5BU8B 4EIJA 2C0WA 3B71A 4NPEA 4D6TE 3L73E 1JCCA 1NGMB 1PP9J 3BCCE 3RL0C 2FYNB 1PP9G 3AE4C 3U59A 3RK3B 1RE3A 2O3JA 5AW4B 2KSEA 2OTLP 1NKNA 2JP3A 1FJPA 3L71G 5AVSB 2IFNA 1GL2D 5AW2B 1Q90D 1X79B 2WPVB 2M3BA 1N86A 1T8ZA 4OH8B 3V2RA 3HTKA 4H0LC 1SQQK 2P2UA 1J1DC 2WSFH 1RF1B 3A5TA 1GU5A 1KILC 3JCUE 1BSHA 3L75D 2Q3IA 1SQVD 2P7JA 1Q86Q 1NU1K 3CMAP 4H13C 2W6AA 5KLIB 2E74B 1LTJA 4IL6E 2YIUB 4IOIH 1ZXGA 3CCJP 1N73A 3NFQA 1X9VA 3P32A 3CCSP 1NO4A 3BRTB 4I7ZC 3B5NC 1QVGO 1Z56A 1WMKA 5APWA 3HE5B 3HD7B 1NTKJ 1GTWA 2E76D 1L0LG 1Y9BA 1LTAC 2LKMA 3PRJA 1NU1D 2WSEJ 2M0BA 2E5TA 3BRVB 3CWBG 1LT9A 2HLOA 1QX8A 1HVVA 2WPQA 1GW4A 3IFMA 5KLVD 1IFPA 2I8DA 2I1KA 1EZVG 2C9NY 5C39A 2N1TB 1GK4A 2FYZA 4XA4A 4OGQB 3RK2B 5AW5B 3JCUH 3RL0D 2QM8A 1SQPE 3GLMA 4PD4I 2FYNC 2E43A 4WY4B 1KZUB 2J58A 1AFOA 3AE7C 3D71A 4IL6H 3RK3C 2WQYC 2BEQD 1FZAA 1EC5A 1KB9I 4PD4E 1BGYG 1VF5B 1S5LX 3CLQA 1GL2A 2L5GB 1PP9E 1FDMA 3CXHD 4C7NB 2JWDA 4H0LD 1KB9E 1FS0E 4GDOA 2KOGA 3HUSA 4BRYA 4RJTA 5APUA 3CCUP 3FWLA 1JB0J 1H88A 1RF1C 5CCHC 3L72D 1IFNA 1EDLA 1KILD 1K9MQ 4XFJA 4U3FJ 5AW1B 4L74A 1X22A 4K3AA 2ZVOB 2GA1A 4H13D 1JY3O 2B87A 4U3FG 4K35A 3TNUB 3KHUA 3L37A 2KXPB 2V7QJ 5KLIC 2E74C 2YIUC 3WU2E 3VOPA 3B5ND 1FJKA 4M3LA 2IBZD 3A7OA 1T2KC 2W8ZA 5CJ0A 2C9LY 2YKOA 2NPSB 1OIPA 1E5WA 3HD7C 1FZCB 1KV4A 5TJHA 4PD4H 1U7JA 1SQBD 4EOTA 2GM4A 3H1IJ 3TGUD 4PJ0E 2K1AA 3AEAC 3SSUA 2KS1A 3LW5J 1N7SA 1BE3D 3MHVA 1NTKE 4DZOA 1HTLC 1EZVI 3E7KA 3CL3D 2AEMA 2N1TC 1NTZG 2LR2A 4OGQC 1SVFA 4N6JA 3L70D 3RK2C 4DCKA 4GIFA 5TISE 2AEJA 3WUTA 1L0NJ 2YMKA 1SQXJ 1P84I 1EZVE 1L0NG 2K37A 3RK3D 2R5BA 3KQGA 4HJGH 2Z5HA 4N78D 2IPPA 3WU2H 1NH4A 5AVTB 1OFCX 1L4AA 1P84E 2R32A 2JEEA 3FX0A 1VF5C 5DJTB 3HE4A 1WRGA 1DIPA 2IDBA 4GOFA 4I1LA 2WWWA 1OVRA 5CCHD 1KILA 1KQLA 3H25A 2RMZA 3E1IA 1QL2A 3L74D 3VTPC 4D6TG 1JY2N 4YPCA 1GU4A 1IC2A 1KTMA 3L73G 1N7LA 4AUWA 1R5LA 3SWKA 2K9JB 1W5CE 2E74D 2Y9ZA 2JDIH 5TISH 2MKVA 2WSEH 1T2KD 1NTMD 3H1HD 5KAIE 3N4XA 4U7JA 1M8OB 3SFEC 4U3FE 1SQVE 1JY3N 1LP1B 3HD7D 1PGOA 2NPSC 2XNXA 1SQBJ 1YTZI 4Y28J 5APVA 1PGPA 3TGUJ 1FZCC 3EWKA 1VQKP 1FE6A 1W2EA 2OARA 1P84H 5AW6B 4HB1A 2O01N 2H89C 1EDIA 1EXIA 1K8AQ 3CMEP 4IFDK 3CD6P 1BE3J 3W67A 3KZIE 3QH9A 5AVRB 4LC1A 4XE5B 1AVYA 4CPGA 2N1TD 4OGQD 1OW7A 1KN7A 3RK2D 3H1IE 2M3EA 4WWIA 1K73Q 2KP8A 2OYIA 4W7ZA 3CC2P 1NAYA 2NRGA 1RE4A 5AVYB 2M5AB 2WMMA 3CX5I 1PPJE 2IZ0A 3KPEA 1VF5D 1L0LK 5KAIH 2KLVA 1VQOP 1LTIC 1KYOD 1L0NE 1SQXE 1AVOA 3H32B 1G2CB 3CX5E 4RO0A 2QIWA 1NJIQ 1LJ2A 1URQB 5CCHA 1KQSO 2V7QH 3SWFA 2E75D 1BCCD 2HG5D 1XTCC 3FXDA 1R5SA 3MGNA 3VP9A 1NOHA 2KI7B 3TK1A 5CBOA 3B8EB 1MFZA 1SQPG 1L0LD 5KJ7C 2FYUJ 4UB8H 4R4MA 2O01J 2GUSA 2J5UA 2FYUG 3B4SA 3U1CA 1YQ4C 3O6QB 1W2BO 2BEZF 3UIAA 1FZBA 4GOEA 1LT1A 3H1KD 2PRRA 1PZQA 4KHXA 3HD7A 2Q5UA 3H1JJ 2AXTE 4TLFA 2NPSD 4OVNF 1OZHA 1SS1A 4EDFA 1IJDB 1KORA 1ZLLA 2XNDH 2JO1A 1FOSE 1FZEA 2YXRB 2ZYAA 2QM7A 3VN0A 1LWUB 1YI2P 2P10A 1RHZB 1N2DC 1T6AA 3CX5H 3L36A 2DW3A 1DD4A 2KZIA 3OW2O 3Q5SA 5KKZB 2QRXA 1SQBE 1BGYD 1NAFA 3TGUE 4L75A 4EI2A 3TYYA 3PP5A 4JYBA 1ZN5A 2A45I 1JMMA 2HODB 1S1CX 2QA4P 2QG4A 5L8RJ 3P7KA 1TU3F 2FXOA 4ZMDA 1BE3E 1H0TA 2IYPA 5APTA 2N9YB 5CMZA 4GKGA 2KNCB 1YTZT 2IX7C 1SFCB 1JM0A 4Y99B 4C7NA 2AEFA 2R3CA 1DX7A 2QSIA 1CW5A 1SQQD 4B86A 3RK3E 1MFTA 1M1JB 1FDOA 1IFJA 1URQC 3GHGB 1BCCJ 3EFGA 2WSSH 1NTKG 3M0DC 2WT7A 2R3SA 1CSBA 2R5DA 1VL2A 1HBWA 4LLHA 2QJKB 1NTZK 3F5HA 1IFIA 2Q3EA 5KJ7D 1JNMA 4MN4C 2FFDB 1RQUA 3KDPB 2PGDA 1T3UA 5APXA 1L0NK 2HR3A 2OYHA 1AV1A 5CCGC 1S5LE 1PGJA 1ZOYC 2JJLA 2JWAA 1GK6A 3AE1C 3VMYA 5AW0B 1RF0A 1FZCA 3ZDMA 5B5EE 3CI9A 4ZKUA 2I1JA 4C7RA 1KMIZ 2RH0A 1OVVA 2FYUE 3D70A 1Y47A 1OMIA 3I55P 1PIXA 2E5YA 4NPFX 1ZV8A 3GW6A 1HWTC 5AW7B 1LWUC 3U1AA 2ZAEB 3H1JE 2WSCJ 3H1LD 3P8CD 2PFXA 4DJGA 3ITKA 5KKZC 3HRNA 4DOJA 2QVAA 1JTHA 3MZWB 1Q81Q 1DEEG 1N73B 5AW9B 3L75J 1FU1A 1SQVJ 1VQLP 2ZYDA 2BCCD 3L75G 1SQVG 2A06D 3CCEP
chains in the Genus database with same CATH topology
2JDIH 1E79H 4QMAA 1IFPA 2CK3H 1AQTA 2QE7H 4TLFA 4YXWH 2V7QH 1BSNA 2WSSH 4WVZA 3PJSK 1FS0E 4DJGA 1BSHA 2XNDH 3EFFK 2E5TA 2E5YA 3USSA 2W6JH 1JEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDI H;  1E79 H;  4QMA A;  1IFP A;  2CK3 H;  1AQT A;  2QE7 H;  4TLF A;  4YXW H;  2V7Q H;  1BSN A;  2WSS H;  4WVZ A;  3PJS K;  1FS0 E;  4DJG A;  1BSH A;  2XND H;  3EFF K;  2E5T A;  2E5Y A;  3USS A;  2W6J H;  1JEK A; 
#chains in the Genus database with same CATH topology
 1S5L H;  3IAO A;  1IFD A;  4D6T D;  3M9B A;  2ZT9 B;  1ZRT E;  2WPS A;  3RL0 g;  3T97 A;  3L73 D;  1NHL A;  3BCC D;  1SFC C;  5B5E H;  1LT9 B;  2RKL A;  1L2P A;  3PTZ A;  1RQV A;  1M1J C;  1DH3 A;  5GTI E;  3Q5P A;  2O01 H;  1D7M A;  1ZR2 A;  1NU1 J;  2D2C B;  3BAS A;  5KJ7 A;  1PFI A;  3H1I G;  2QJK C;  1PL5 A;  4O9B A;  4EYY Q;  2W6J H;  5KLV J;  1JEK A;  2AXC A;  1KB9 H;  2FFD C;  3NXS A;  3MD0 A;  1BDC A;  5CCG D;  1BCC E;  3F89 A;  2BAS A;  1BDD A;  1EXJ A;  3MP7 B;  1PPJ G;  5APY A;  4W7Y A;  3V6I A;  1GL2 B;  1KFM A;  1YJN P;  3C1L A;  3AEE C;  4WY4 C;  1CI6 A;  5APS A;  2IFM A;  2W6B A;  1SQX G;  1QLE D;  1IFM A;  2WTY A;  1RH5 B;  1UIX A;  4BRY B;  2ZXE B;  1A02 J;  3H1K E;  2XKM A;  3O8Z A;  3D6Z A;  2B88 A;  1S9K D;  3H1L J;  2QEX P;  3TDK A;  4QMA A;  5GTI H;  1Q7Y Q;  2Y0E A;  1VQ4 P;  1S3J A;  1GZL A;  1Q2N A;  2B87 B;  1SQP K;  3LID A;  4YXD C;  4PJ0 H;  3L72 J;  2YNY A;  2H7H A;  1FOS F;  1N8R Q;  2FYU K;  1N73 C;  1HGV A;  3II6 A;  3L72 G;  2Q7C A;  3VMZ A;  2HPC B;  2VRS A;  2N9B A;  2BCC J;  2PAJ A;  1IO4 A;  2M5A A;  3CCM P;  4LGD E;  2ITA A;  3G3Z A;  4ASV A;  3GF7 A;  2NZ2 A;  1Q82 Q;  3B5N A;  2ZT9 C;  2WVR A;  1SFC D;  4PV1 B;  2W90 A;  3H32 A;  4ASW A;  1ZP0 C;  3FWN A;  3GF3 A;  3CCL P;  4KJM A;  3L75 E;  3E1R A;  3H6P A;  1LT9 C;  4RKU J;  2JR8 A;  2JKV A;  1J1E B;  2Q1K A;  1N7S B;  4H44 B;  4PD4 D;  3R2P A;  1KD1 Q;  1SQB G;  3BVH A;  1DEB A;  3TGU G;  3A2A A;  1WT6 A;  2D2C C;  3VMX A;  1PP9 D;  4L73 A;  3AE6 C;  3BAT A;  1K04 A;  1GDT A;  3AE3 C;  3TSI A;  1YIT P;  5CCG A;  3O6Q A;  1BE3 G;  2Y0C A;  3L71 D;  5H2F E;  2FXM A;  3L70 J;  2A45 G;  1NU1 E;  1L4A B;  3LIE A;  4R4L A;  4WY4 D;  2WSC H;  3G71 P;  1GMJ A;  5KLV E;  2FBW C;  2K88 A;  5CJ4 A;  2OTJ P;  5AVV B;  3A3Y B;  3PLN A;  3V2P A;  2C0X A;  2XU6 A;  4Z1M H;  1M57 D;  1NTK K;  3L35 A;  3PHL A;  2OQQ A;  4ZNC A;  5BU5 A;  1VQM P;  3V4Q A;  1AQT A;  3CXH I;  1RF1 A;  2G8Y A;  4HKZ H;  2K9Y A;  2HOD A;  3CC7 P;  3L74 J;  1M1K Q;  2YO2 A;  1X8Y A;  1NYH A;  3L74 G;  3CXH E;  3M06 A;  3KZI H;  3H1L E;  3P8C E;  5AVQ B;  4JF7 A;  2KNC A;  3NMD A;  2ZT9 D;  4JPZ B;  3MUD C;  3CWB D;  3L72 E;  1NTM J;  3H1H J;  2XV5 A;  1KIL E;  4PV1 C;  1T3J A;  2LXC B;  1M1J A;  1NTM G;  3HE5 A;  2G3A A;  5AVU B;  3D6Y A;  1EZV D;  2ZJS E;  2BCC E;  3LW5 H;  4YTP C;  2IBZ I;  2A06 E;  1VQ5 P;  1MZ9 A;  1H8A A;  1J1E C;  3H1J G;  4W80 A;  3G9R A;  1HJ0 A;  1N7S C;  4H44 C;  3TF5 A;  4IFF A;  1P84 D;  2D2C D;  2OYO A;  3KXD A;  1NVO A;  5APQ A;  2IBZ E;  2FFD A;  2CK3 H;  3G4S P;  2OYI B;  1GW3 A;  5AVX B;  3RBZ A;  1NKZ B;  2P1J A;  3L71 J;  1Y8A A;  4OWF A;  3USS A;  2N1T A;  4JQ0 D;  5CHX A;  1SQV K;  1E79 H;  1JO5 A;  2YKP A;  1RY3 A;  2YXQ B;  3CXH H;  1L4A C;  1MKM A;  3CCQ P;  4WY4 A;  2UWJ E;  3WUV A;  2KK7 A;  1M56 D;  1OVU A;  2XDJ A;  2Y0D A;  3S1K A;  2H88 C;  4AYC A;  2FY8 A;  1KQG B;  4I6M C;  2ZVN B;  3L70 E;  4WVZ A;  3NTN A;  3PJS K;  3EQ2 A;  2XZR A;  2AXT H;  4U3F D;  5EFW B;  3V2Q A;  2CPB A;  3SWY A;  1HF9 A;  2MJZ A;  1VQ9 P;  1R8E A;  4HH2 A;  4N78 E;  4RES B;  3OAK A;  2B9B A;  4YXW H;  4AQR D;  5KLV K;  3OJA B;  1BCC G;  1S9K E;  1L0L J;  2QJP B;  1VPC A;  5DJU B;  3TNU A;  1OX3 A;  3AED C;  1HGZ A;  2YO3 A;  2P67 A;  3CWB J;  4IL6 X;  1SQX K;  3H1I D;  1MV8 A;  4PV1 D;  3H1K J;  3M91 A;  3L74 E;  3VYI A;  4C46 A;  4L76 A;  3Q5R A;  3H1K G;  2NPS A;  3A0H E;  2LXB A;  1N7S D;  1YYC A;  2A45 H;  4H44 D;  1ZR4 A;  1NTZ D;  1YBK A;  1LTG C;  1PPJ D;  3AEG C;  3HTK B;  1NTM E;  2M8R A;  3H1H E;  2POH A;  5B66 E;  1L0N D;  1SQX D;  3CX5 D;  2GUV A;  5GTH E;  1LTT C;  2OYI C;  1AJY A;  3S9O A;  2KSJ A;  1BGY J;  1H0T B;  3M9Q A;  1RE4 C;  2HFE D;  2O1J A;  2IYO A;  3GMA A;  1LTJ B;  1L4A D;  3V5B A;  5KAF E;  1FZF A;  1JY2 O;  3WUU A;  3ABV C;  1S72 P;  1HH0 A;  2QE7 H;  1XTG B;  1IK7 A;  1PV3 A;  5E79 E;  1KQF B;  3FXE A;  3V2N A;  3EFF K;  1JY2 P;  2E75 B;  3L71 E;  5AW3 B;  1YJW P;  1S2E A;  2QJY B;  2RN0 A;  1HJB A;  4A7P A;  1VDF A;  1SQB K;  2WT7 B;  3A0H H;  1SQQ J;  3I56 P;  2O1K A;  4Y99 C;  3CCR P;  1X0T A;  3MTU E;  1SQQ G;  1KYO I;  2CPS A;  1K05 A;  1GD2 E;  1URQ D;  1AA0 A;  4JBZ A;  2WIT A;  3RBX A;  2WZ7 A;  4BXL A;  3GHG C;  2Z5I A;  1VQN P;  2OYH B;  1JY3 P;  3AEC C;  2HPC A;  5B66 H;  1BSN A;  1NWQ A;  1USD A;  1FZG A;  1KYO E;  5GTH H;  1NU1 G;  1EDJ A;  4IFM A;  2K9J A;  1SP4 A;  2KUB A;  4WB4 A;  1VQ6 P;  2QJP C;  1LTB C;  3QWO C;  3IR9 A;  3MUD A;  2FKW B;  5KLV G;  1QGK B;  5KAF H;  1RE3 C;  1JCD A;  5E79 H;  4UB6 E;  3AE2 C;  2V4H A;  1LP1 A;  3M0A A;  3A0B E;  1DD3 A;  4GOD A;  2H8P D;  1A02 F;  2SPZ A;  1L0L E;  2P58 A;  1NTZ J;  2H43 A;  1G1J A;  4GT1 A;  1VQ8 P;  2R44 A;  4I2L C;  3CWB E;  3Q2Y A;  3HUS B;  3IN6 A;  1LTS C;  3SFD C;  3K5B A;  1JTH B;  4WBA A;  1OW8 A;  1MUU A;  3AE9 C;  3WMM 0;  3PH0 A;  1JOC A;  3I5C A;  1OWA A;  2J59 M;  1ZME C;  1JUN A;  3H1L G;  2WPR A;  5AVW B;  2WSF J;  3RGU A;  3VMA A;  1KYO H;  4BWN A;  1LTJ C;  1EQ7 A;  2KB7 P;  4KT0 J;  2ZXX A;  3T97 B;  1PGQ A;  5AVZ B;  3R4Y A;  3FGA D;  1H89 A;  1KFN A;  1NTM K;  1QL1 A;  1CZQ A;  2Z4E A;  3AE8 C;  2BCC G;  1BGY E;  2E76 B;  4D6T J;  2E75 C;  3AEB C;  3P8M C;  2A06 G;  1U7M A;  2KZJ A;  3M9H A;  3L73 J;  4UB6 H;  3BCC J;  1J2J B;  3JC2 2;  2QJY C;  3A0B H;  1SQP D;  1G2C A;  3BCC G;  4HYT B;  3AE5 C;  3N7N A;  2IBZ G;  1FBM A;  1URQ A;  2KS1 B;  3IF4 A;  1S4X A;  2FYU D;  2B89 A;  1YIJ P;  3M0D A;  3L4F A;  1M90 Q;  1QEX A;  2W27 A;  2OYH C;  2ZFC A;  1KC8 Q;  3RL0 B;  2OTK E;  5AW8 B;  1M7L A;  1EDK A;  2W83 C;  1SQQ E;  1AQ5 A;  2Q6Q A;  3H1J D;  1UII A;  1RF0 C;  2Q9I A;  1USE A;  2YMY A;  1KB9 D;  1CI6 B;  1YHQ P;  3CC4 P;  1FAV A;  1SLQ A;  5KTB A;  3KYQ A;  3V4W A;  1YJ9 P;  3OA7 A;  3CCV P;  2PP6 A;  1QVF O;  3L70 G;  1GL2 C;  3MIW A;  3JSV C;  2IZ1 A;  1JMB A;  4H0L B;  4ZKP A;  4UB8 E;  3CPW O;  3HE4 B;  1J1D B;  1ZW0 A;  1ZRT D;  3G6E P;  1LWU A;  4NPD A;  1HUC A;  3C8V A;  3HUS C;  1KIL B;  3Q1M A;  4N3Y B;  2KLU A;  3Q3D A;  4JYC A;  2HYN A;  4H13 B;  1IK9 A;  1OW6 A;  1NTZ E;  3VP8 A;  5CBN A;  1YQ3 C;  2K3R A;  4I7Z B;  5BVZ A;  3B5N B;  3C9I A;  3S4R A;  4DT0 A;  2ZYG A;  5M1B A;  1LGH B;  5K5G B;  3GG2 A;  2KYV A;  2KIK A;  1G1I A;  1OXZ A;  1NTK D;  5H2F H;  2YKQ A;  3AEF C;  2E76 C;  2Y9Y A;  1SFC A;  1SQP J;  2E42 A;  1VQ7 P;  3W68 A;  2FXP A;  1IZN B;  1LNQ A;  3H1H G;  1U57 A;  3GHG A;  4TT3 H;  1FC2 C;  2L91 A;  1FDI A;  1VQP P;  2OGU A;  5BU8 B;  4EIJ A;  2C0W A;  3B71 A;  4NPE A;  4D6T E;  3L73 E;  1JCC A;  1NGM B;  1PP9 J;  3BCC E;  3RL0 C;  2FYN B;  1PP9 G;  3AE4 C;  3U59 A;  3RK3 B;  1RE3 A;  2O3J A;  5AW4 B;  2KSE A;  2OTL P;  1NKN A;  2JP3 A;  1FJP A;  3L71 G;  5AVS B;  2IFN A;  1GL2 D;  5AW2 B;  1Q90 D;  1X79 B;  2WPV B;  2M3B A;  1N86 A;  1T8Z A;  4OH8 B;  3V2R A;  3HTK A;  4H0L C;  1SQQ K;  2P2U A;  1J1D C;  2WSF H;  1RF1 B;  3A5T A;  1GU5 A;  1KIL C;  3JCU E;  1BSH A;  3L75 D;  2Q3I A;  1SQV D;  2P7J A;  1Q86 Q;  1NU1 K;  3CMA P;  4H13 C;  2W6A A;  5KLI B;  2E74 B;  1LTJ A;  4IL6 E;  2YIU B;  4IOI H;  1ZXG A;  3CCJ P;  1N73 A;  3NFQ A;  1X9V A;  3P32 A;  3CCS P;  1NO4 A;  3BRT B;  4I7Z C;  3B5N C;  1QVG O;  1Z56 A;  1WMK A;  5APW A;  3HE5 B;  3HD7 B;  1NTK J;  1GTW A;  2E76 D;  1L0L G;  1Y9B A;  1LTA C;  2LKM A;  3PRJ A;  1NU1 D;  2WSE J;  2M0B A;  2E5T A;  3BRV B;  3CWB G;  1LT9 A;  2HLO A;  1QX8 A;  1HVV A;  2WPQ A;  1GW4 A;  3IFM A;  5KLV D;  1IFP A;  2I8D A;  2I1K A;  1EZV G;  2C9N Y;  5C39 A;  2N1T B;  1GK4 A;  2FYZ A;  4XA4 A;  4OGQ B;  3RK2 B;  5AW5 B;  3JCU H;  3RL0 D;  2QM8 A;  1SQP E;  3GLM A;  4PD4 I;  2FYN C;  2E43 A;  4WY4 B;  1KZU B;  2J58 A;  1AFO A;  3AE7 C;  3D71 A;  4IL6 H;  3RK3 C;  2WQY C;  2BEQ D;  1FZA A;  1EC5 A;  1KB9 I;  4PD4 E;  1BGY G;  1VF5 B;  1S5L X;  3CLQ A;  1GL2 A;  2L5G B;  1PP9 E;  1FDM A;  3CXH D;  4C7N B;  2JWD A;  4H0L D;  1KB9 E;  1FS0 E;  4GDO A;  2KOG A;  3HUS A;  4BRY A;  4RJT A;  5APU A;  3CCU P;  3FWL A;  1JB0 J;  1H88 A;  1RF1 C;  5CCH C;  3L72 D;  1IFN A;  1EDL A;  1KIL D;  1K9M Q;  4XFJ A;  4U3F J;  5AW1 B;  4L74 A;  1X22 A;  4K3A A;  2ZVO B;  2GA1 A;  4H13 D;  1JY3 O;  2B87 A;  4U3F G;  4K35 A;  3TNU B;  3KHU A;  3L37 A;  2KXP B;  2V7Q J;  5KLI C;  2E74 C;  2YIU C;  3WU2 E;  3VOP A;  3B5N D;  1FJK A;  4M3L A;  2IBZ D;  3A7O A;  1T2K C;  2W8Z A;  5CJ0 A;  2C9L Y;  2YKO A;  2NPS B;  1OIP A;  1E5W A;  3HD7 C;  1FZC B;  1KV4 A;  5TJH A;  4PD4 H;  1U7J A;  1SQB D;  4EOT A;  2GM4 A;  3H1I J;  3TGU D;  4PJ0 E;  2K1A A;  3AEA C;  3SSU A;  2KS1 A;  3LW5 J;  1N7S A;  1BE3 D;  3MHV A;  1NTK E;  4DZO A;  1HTL C;  1EZV I;  3E7K A;  3CL3 D;  2AEM A;  2N1T C;  1NTZ G;  2LR2 A;  4OGQ C;  1SVF A;  4N6J A;  3L70 D;  3RK2 C;  4DCK A;  4GIF A;  5TIS E;  2AEJ A;  3WUT A;  1L0N J;  2YMK A;  1SQX J;  1P84 I;  1EZV E;  1L0N G;  2K37 A;  3RK3 D;  2R5B A;  3KQG A;  4HJG H;  2Z5H A;  4N78 D;  2IPP A;  3WU2 H;  1NH4 A;  5AVT B;  1OFC X;  1L4A A;  1P84 E;  2R32 A;  2JEE A;  3FX0 A;  1VF5 C;  5DJT B;  3HE4 A;  1WRG A;  1DIP A;  2IDB A;  4GOF A;  4I1L A;  2WWW A;  1OVR A;  5CCH D;  1KIL A;  1KQL A;  3H25 A;  2RMZ A;  3E1I A;  1QL2 A;  3L74 D;  3VTP C;  4D6T G;  1JY2 N;  4YPC A;  1GU4 A;  1IC2 A;  1KTM A;  3L73 G;  1N7L A;  4AUW A;  1R5L A;  3SWK A;  2K9J B;  1W5C E;  2E74 D;  2Y9Z A;  2JDI H;  5TIS H;  2MKV A;  2WSE H;  1T2K D;  1NTM D;  3H1H D;  5KAI E;  3N4X A;  4U7J A;  1M8O B;  3SFE C;  4U3F E;  1SQV E;  1JY3 N;  1LP1 B;  3HD7 D;  1PGO A;  2NPS C;  2XNX A;  1SQB J;  1YTZ I;  4Y28 J;  5APV A;  1PGP A;  3TGU J;  1FZC C;  3EWK A;  1VQK P;  1FE6 A;  1W2E A;  2OAR A;  1P84 H;  5AW6 B;  4HB1 A;  2O01 N;  2H89 C;  1EDI A;  1EXI A;  1K8A Q;  3CME P;  4IFD K;  3CD6 P;  1BE3 J;  3W67 A;  3KZI E;  3QH9 A;  5AVR B;  4LC1 A;  4XE5 B;  1AVY A;  4CPG A;  2N1T D;  4OGQ D;  1OW7 A;  1KN7 A;  3RK2 D;  3H1I E;  2M3E A;  4WWI A;  1K73 Q;  2KP8 A;  2OYI A;  4W7Z A;  3CC2 P;  1NAY A;  2NRG A;  1RE4 A;  5AVY B;  2M5A B;  2WMM A;  3CX5 I;  1PPJ E;  2IZ0 A;  3KPE A;  1VF5 D;  1L0L K;  5KAI H;  2KLV A;  1VQO P;  1LTI C;  1KYO D;  1L0N E;  1SQX E;  1AVO A;  3H32 B;  1G2C B;  3CX5 E;  4RO0 A;  2QIW A;  1NJI Q;  1LJ2 A;  1URQ B;  5CCH A;  1KQS O;  2V7Q H;  3SWF A;  2E75 D;  1BCC D;  2HG5 D;  1XTC C;  3FXD A;  1R5S A;  3MGN A;  3VP9 A;  1NOH A;  2KI7 B;  3TK1 A;  5CBO A;  3B8E B;  1MFZ A;  1SQP G;  1L0L D;  5KJ7 C;  2FYU J;  4UB8 H;  4R4M A;  2O01 J;  2GUS A;  2J5U A;  2FYU G;  3B4S A;  3U1C A;  1YQ4 C;  3O6Q B;  1W2B O;  2BEZ F;  3UIA A;  1FZB A;  4GOE A;  1LT1 A;  3H1K D;  2PRR A;  1PZQ A;  4KHX A;  3HD7 A;  2Q5U A;  3H1J J;  2AXT E;  4TLF A;  2NPS D;  4OVN F;  1OZH A;  1SS1 A;  4EDF A;  1IJD B;  1KOR A;  1ZLL A;  2XND H;  2JO1 A;  1FOS E;  1FZE A;  2YXR B;  2ZYA A;  2QM7 A;  3VN0 A;  1LWU B;  1YI2 P;  2P10 A;  1RHZ B;  1N2D C;  1T6A A;  3CX5 H;  3L36 A;  2DW3 A;  1DD4 A;  2KZI A;  3OW2 O;  3Q5S A;  5KKZ B;  2QRX A;  1SQB E;  1BGY D;  1NAF A;  3TGU E;  4L75 A;  4EI2 A;  3TYY A;  3PP5 A;  4JYB A;  1ZN5 A;  2A45 I;  1JMM A;  2HOD B;  1S1C X;  2QA4 P;  2QG4 A;  5L8R J;  3P7K A;  1TU3 F;  2FXO A;  4ZMD A;  1BE3 E;  1H0T A;  2IYP A;  5APT A;  2N9Y B;  5CMZ A;  4GKG A;  2KNC B;  1YTZ T;  2IX7 C;  1SFC B;  1JM0 A;  4Y99 B;  4C7N A;  2AEF A;  2R3C A;  1DX7 A;  2QSI A;  1CW5 A;  1SQQ D;  4B86 A;  3RK3 E;  1MFT A;  1M1J B;  1FDO A;  1IFJ A;  1URQ C;  3GHG B;  1BCC J;  3EFG A;  2WSS H;  1NTK G;  3M0D C;  2WT7 A;  2R3S A;  1CSB A;  2R5D A;  1VL2 A;  1HBW A;  4LLH A;  2QJK B;  1NTZ K;  3F5H A;  1IFI A;  2Q3E A;  5KJ7 D;  1JNM A;  4MN4 C;  2FFD B;  1RQU A;  3KDP B;  2PGD A;  1T3U A;  5APX A;  1L0N K;  2HR3 A;  2OYH A;  1AV1 A;  5CCG C;  1S5L E;  1PGJ A;  1ZOY C;  2JJL A;  2JWA A;  1GK6 A;  3AE1 C;  3VMY A;  5AW0 B;  1RF0 A;  1FZC A;  3ZDM A;  5B5E E;  3CI9 A;  4ZKU A;  2I1J A;  4C7R A;  1KMI Z;  2RH0 A;  1OVV A;  2FYU E;  3D70 A;  1Y47 A;  1OMI A;  3I55 P;  1PIX A;  2E5Y A;  4NPF X;  1ZV8 A;  3GW6 A;  1HWT C;  5AW7 B;  1LWU C;  3U1A A;  2ZAE B;  3H1J E;  2WSC J;  3H1L D;  3P8C D;  2PFX A;  4DJG A;  3ITK A;  5KKZ C;  3HRN A;  4DOJ A;  2QVA A;  1JTH A;  3MZW B;  1Q81 Q;  1DEE G;  1N73 B;  5AW9 B;  3L75 J;  1FU1 A;  1SQV J;  1VQL P;  2ZYD A;  2BCC D;  3L75 G;  1SQV G;  2A06 D;  3CCE P; 
#chains in the Genus database with same CATH homology
 2JDI H;  1E79 H;  4QMA A;  1IFP A;  2CK3 H;  1AQT A;  2QE7 H;  4TLF A;  4YXW H;  2V7Q H;  1BSN A;  2WSS H;  4WVZ A;  3PJS K;  1FS0 E;  4DJG A;  1BSH A;  2XND H;  3EFF K;  2E5T A;  2E5Y A;  3USS A;  2W6J H;  1JEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...