1JEKA

Visna tm core structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
40
structure length
40
Chain Sequence
b'QSLANATAAQQEVLEASYAMVQHIAKGIRILEARVARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENV POLYPROTEIN
publication title The trimer-of-hairpins motif in membrane fusion: Visna virus.
pubmed doi rcsb
molecule tags Viral protein
total genus 18
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1jekA00
3PJSK 2JDIH 2CK3H 4WVZA 2QE7H 2V7QH 2E5TA 3EFFK 4DJGA 2WSSH 1JEKA 1AQTA 4QMAA 2W6JH 2E5YA 4TLFA 1BSNA 1E79H 4YXWH 3USSA 1FS0E 2XNDH 1BSHA 1IFPA
chains in the Genus database with same CATH superfamily
1VQ4P 5APSA 3WU2E 1NJIQ 2WZ7A 1OFCX 1WRGA 4WB4A 3G9RA 1EZVG 4D6TG 3GG2A 3A7OA 2I8DA 1KYOD 3H1JD 4ASWA 3L71J 1KV4A 1URQC 3CXHI 2ZYGA 2FFDC 3B5ND 2N9YB 2P1JA 3I5CA 5AW4B 5H2FH 1M1JA 2PGDA 3KZIH 3GW6A 1YJWP 2M0BA 3H1LD 1PGPA 1T3JA 3H6PA 3L75E 3PLNA 3CCRP 1GZLA 1SQQK 2AEJA 3CCSP 1PP9J 2D2CD 5GTHH 3LW5J 4GKGA 2WSCH 1LTSC 1S9KD 2KLUA 2HR3A 1JEKA 1URQA 1NTKE 4OGQD 3H32B 4EIJA 3L71G 1SQXE 1KILD 2FFDA 2OYIB 3USSA 2QSIA 3BCCE 2N9BA 3L70E 2NPSB 4EOTA 4AYCA 3SFEC 2QE7H 4OWFA 1IFMA 5H2FE 1H88A 3KZIE 4NPFX 1LJ2A 3D71A 1P84E 1HGVA 3M06A 1LWUC 5AVUB 1JTHA 2OQQA 3P32A 3C9IA 4H0LB 1PP9G 5AW1B 5GTHE 1AQTA 1OWAA 1VQNP 3GHGB 5K5GB 1ZV8A 2QJPC 3AE3C 3FXEA 1G1IA 4I6MC 3VMXA 2QIWA 3BRTB 1FZBA 1BE3E 2WSFH 3HRNA 1PZQA 1LTIC 1N86A 2O1KA 3L74E 1JMBA 3B5NB 1M1KQ 2OYOA 1QL1A 1S5LH 3S4RA 2FXPA 2BEQD 1OVRA 2P58A 3V6IA 1YJNP 1N2DC 4BRYB 2Q7CA 5CJ4A 1NTZD 4DJGA 2XV5A 4DT0A 1QX8A 1KZUB 3AE2C 2W8ZA 1EXJA 1ZW0A 2D2CB 1VQ9P 1QL2A 4RJTA 3GF7A 2G3AA 3RK2C 5CBNA 1FZCA 3EFFK 1FE6A 3G3ZA 3D6YA 1G2CB 1QEXA 4U3FD 3LIEA 1L0LD 1GL2B 4OVNF 3G4SP 2E74D 4RESB 1HJ0A 1RY3A 2LXCB 2YKQA 2XNXA 1DX7A 3GLMA 1SQBD 1KORA 2AEMA 1KFMA 3G6EP 1MZ9A 4GOFA 1S5LE 1EZVE 3WUVA 2W6BA 1HJBA 2XZRA 2QRXA 3PP5A 5KLIB 1UIXA 2Q5UA 1LTBC 2OYHC 3WUUA 3O8ZA 3TGUE 3CCQP 4HB1A 3U59A 2MKVA 3EFGA 1KFNA 1LNQA 3VP8A 4PV1C 1LT9C 5AW3B 1YHQP 4ZKUA 3MUDC 5DJUB 1NGMB 1W2EA 5KTBA 3CWBD 3AEEC 2XNDH 4PD4D 1SQPD 2IBZI 4WVZA 1GK4A 4K35A 3OJAB 3HUSB 3ABVC 1RF1B 4WY4D 1NU1D 1SFCD 3L72D 2H7HA 1PIXA 1BCCJ 4HH2A 1VQLP 2W6AA 1NO4A 1QGKB 2OYHA 1YQ4C 3L36A 4IL6X 4XFJA 2QJKB 1IFJA 2WPVB 5BU8B 5AW2B 3C8VA 1SP4A 2WT7A 4EYYQ 3V4QA 3M91A 3MUDA 1DD4A 1W5CE 2ZXXA 1PPJE 1NYHA 2HPCB 1N7SB 1SS1A 1FAVA 2KS1B 1NAYA 1FJPA 2M5AA 2Q3EA 3TF5A 3AEBC 2Y0EA 4AUWA 3CD6P 3AECC 2VRSA 1T3UA 3AE1C 1WT6A 1IFDA 5CJ0A 1BCCG 4KT0J 3AE9C 2K9JA 5APUA 4GODA 3L75D 3JSVC 1HH0A 1H8AA 1RQVA 2PRRA 1JOCA 1JO5A 2YMYA 3HE4B 1IFNA 3RK3E 2JO1A 1LTJB 1GMJA 3I55P 3CCMP 2Y0CA 2KSJA 1FJKA 2WTYA 1NTKD 5APWA 5AVWB 3A3YB 1YTZI 3O6QB 3TNUB 1SQXD 1SQVJ 3Q2YA 3B4SA 2YXRB 3BCCD 3L70D 2B88A 2ZAEB 2E43A 3L35A 4HKZH 2E76C 1L0NJ 3CCEP 1H0TA 1E79H 5L8RJ 3ZDMA 1AV1A 2WITA 2P67A 2H88C 2CPBA 3AEFC 1P84D 5KKZB 1KQGB 3RL0g 2A45I 2KK7A 3JCUE 3Q3DA 1BGYJ 1E5WA 3A2AA 3NTNA 1WMKA 2YO2A 4IFFA 1ZLLA 2P2UA 1BE3D 1L2PA 2N1TC 1J1DB 3KPEA 1DEBA 2R44A 2RKLA 1SQVG 3L74D 5M1BA 1OX3A 4H13B 1RH5B 2A06E 1FZAA 2QJYC 1VQKP 2HG5D 3RL0C 1L0NG 3S1KA 1J1EB 2KUBA 1KQSO 3VP9A 4Y99C 3CL3D 1DEEG 2M3BA 4N6JA 3M0AA 4A7PA 1RE4C 5B66H 2NPSD 5AVYB 3CCJP 1W2BO 1IK7A 4DOJA 3M9QA 3L37A 1K05A 2P10A 1EXIA 2OYIC 3V2NA 1M1JC 1BGYG 2ITAA 3UIAA 4NPEA 1Q82Q 5CCGC 2BCCJ 4C46A 4YPCA 1EQ7A 2LKMA 2HLOA 4H0LD 2KZJA 4YXDC 3TK1A 1VQ8P 2L91A 3H25A 3SWYA 1EZVD 3FGAD 3CMEP 2WPQA 3HTKB 3VN0A 1KTMA 3PH0A 1RE4A 4Y28J 1QLED 3VOPA 3KHUA 1NTMK 3AE8C 3TGUD 3H32A 1G1JA 3T97B 2KB7P 3AEAC 5B66E 3L73J 4DZOA 3CXHH 3W67A 2OYIA 2KOGA 2JP3A 3QWOC 2NPSA 4W7ZA 3IAOA 2Z4EA 1R5SA 5KJ7A 4W7YA 1SQVK 3KDPB 5CCGA 1A02J 3U1CA 4GT1A 2G8YA 3HE5A 2W6JH 1P84I 1U7MA 1LTAC 2AEFA 2RN0A 3H1IE 1M57D 3GF3A 1BSNA 2FYNB 1L0NK 2BCCG 3CCLP 3FWLA 2I1JA 1Q81Q 3V4WA 1HWTC 2C9NY 1ZN5A 2Z5HA 2E42A 3A0BH 4OH8B 3GHGA 1GL2D 4L75A 2PAJA 2KLVA 2WPSA 2K1AA 3Q1MA 4OGQC 4I7ZC 2K37A 3AE6C 3L73G 1CSBA 3CXHE 1KILC 2HODA 3B5NA 1PPJD 2GUVA 3HD7B 3S9OA 5TISH 4YXWH 1K73Q 4L74A 3H1HE 3K5BA 4Z1MH 2IDBA 5BVZA 1N7LA 3AE4C 2Q9IA 2V4HA 1KB9I 2J59M 3RBXA 2IBZG 5AVSB 1JUNA 1Z56A 1CI6B 2IYPA 1FS0E 1MUUA 3BASA 1T2KD 2ZT9D 3BRVB 1FZCC 3A0BE 3MGNA 3TDKA 2QVAA 4XE5B 3BVHA 2OTLP 1AVOA 4U3FJ 2FFDB 1L0LJ 1OIPA 1KILA 3KYQA 1SQQE 1KYOI 3RK3D 1SQBJ 3VYIA 1OZHA 3MHVA 3CC2P 1GDTA 4PJ0H 4H44C 5TISE 1VQ7P 3NMDA 2ZJSE 2O01J 2KNCB 3IFMA 1YQ3C 2E75D 1YJ9P 3EQ2A 1Q90D 2YIUC 5CHXA 1JY2N 4CPGA 3H1KE 1OW6A 5CMZA 1EDKA 4JPZB 4RO0A 2P7JA 2XDJA 1GU4A 1N7SD 1JCDA 3E1RA 2V7QJ 2Q1KA 4LGDE 2WSEJ 3RK2D 2Q3IA 3CLQA 2J58A 3VMYA 1YI2P 4I1LA 3CWBJ 5CCHD 1BSHA 4GOEA 1Y47A 3WMM0 1SQPJ 1GD2E 1GK6A 3A5TA 4U3FG 1L0LG 5APTA 2Q6QA 3R4YA 4D6TE 1RF1A 1NU1J 5AW9B 3L72J 2E74C 5AVXB 1SQBG 3II6A 4PJ0E 2BASA 1LWUB 3CI9A 2OGUA 2E5TA 3M9HA 1X79B 3R2PA 5AVQB 1U57A 3MTUE 1OVVA 2A06D 1LGHB 3L4FA 2B87B 2QJPB 2ZT9B 1JCCA 2JWDA 3P8CE 2WMMA 3CWBG 1LTTC 1FZEA 2KS1A 3VMAA 2BCCE 2KIKA 2M8RA 1SQPG 3LW5H 2C0XA 4AQRD 1DD3A 3VTPC 3JC22 2IYOA 3RK3B 2YMKA 2A45G 1YBKA 1NU1G 1R5LA 3L72G 1MFTA 2QA4P 4WY4C 1SFCC 4BWNA 1NTZK 3E1IA 2WSSH 3L71E 2OTJP 3CX5H 2E75B 2ZFCA 1MFZA 3MZWB 5APYA 3BATA 1FU1A 5AW8B 2JDIH 5APVA 3L73E 1N73C 3M0DC 3SFDC 3OA7A 3RK2B 2FYZA 1MKMA 2WQYC 1S4XA 1L0LK 5GTIH 2ZYAA 1GU5A 1PGOA 1NTKJ 4H13D 1SQBK 1AQ5A 1PP9E 2IBZE 1Y9BA 3BCCJ 1VF5C 4WY4A 1EC5A 1SFCA 3CCUP 2IX7C 4GDOA 1SVFA 3H1ID 3CX5E 1BDCA 1NHLA 1S5LX 1NTMJ 1LTGC 1M8OB 1N73A 1LT9B 3M0DA 3LIDA 2FYUJ 5KLVJ 2RH0A 1AFOA 4RKUJ 1AA0A 2ZVNB 1SQPK 5AW7B 1RHZB 1L4AD 1NU1K 1NTKG 3QH9A 3D70A 1VQ5P 3L74J 3CXHD 1SLQA 2AXTH 2KSEA 3BCCG 3F5HA 2JR8A 1KN7A 1MV8A 2WSEH 4PD4I 4R4LA 2ZVOB 3H1HD 1RF0C 3RBZA 1OW7A 3I56P 2H8PD 2LXBA 2NZ2A 1VDFA 1YYCA 1NTMG 1Q7YQ 3MP7B 2A45H 2FYUG 3V2PA 1LP1B 2YKOA 2CPSA 5KLVG 1ZR4A 1GW4A 4C7NB 1EDLA 4KJMA 3OW2O 3Q5RA 1T6AA 5BU5A 1NH4A 1JNMA 2K9YA 3PJSK 1H89A 2O1JA 1NVOA 1KQLA 1JB0J 5AW0B 1SQQD 2SPZA 3CMAP 3L74G 2AXTE 3FX0A 3FXDA 3H1JJ 1X0TA 4JYBA 1RF0A 3HTKA 1JMMA 2ZXEB 4N78E 3ITKA 2QEXP 3H1KD 1VL2A 3TGUJ 1PL5A 1OMIA 1JY3P 3HD7D 2NPSC 1HUCA 5KJ7C 4WBAA 3SWFA 1NTKK 2QG4A 5E79H 3GMAA 3C1LA 1SQXK 1EDIA 3H1LJ 2JWAA 1L4AB 1RE3C 2IFNA 1D7MA 3EWKA 2H89C 2IZ1A 2E76B 4D6TD 1YTZT 1JY3N 4H0LC 2HFED 1IO4A 2LR2A 4LLHA 1URQD 2XKMA 3H1JG 3GHGC 3B71A 1ZRTE 2W90A 2FYUK 1KD1Q 5KLVK 1GW3A 2RMZA 5APXA 3U1AA 4U7JA 2FKWB 3TGUG 3B5NC 1BCCE 5AVZB 1DH3A 4UB6H 1HBWA 4TLFA 3HD7A 5E79E 1RE3A 3P8CD 1VQMP 2N1TB 1K9MQ 3H1LG 3W68A 2IZ0A 2BCCD 2IFMA 3G71P 1P84H 2L5GB 2QJYB 2KZIA 1DIPA 2D2CC 3RL0B 2GM4A 1S1CX 1OVUA 3Q5PA 4JQ0D 1XTCC 4Y99B 1CI6A 4XA4A 4GIFA 3V5BA 3CCVP 3L71D 3D6ZA 4TT3H 2CK3H 1NWQA 4B86A 1CZQA 1GL2C 3OAKA 4IL6H 3L73D 1IZNB 1M1JB 2R5DA 1PGJA 2YKPA 4L73A 4HJGH 4BRYA 4UB6E 3SWKA 1PPJG 2XU6A 1ZXGA 4O9BA 1NTZJ 5KLIC 4I2LC 1OXZA 4R4MA 3P7KA 3HE5B 2KNCA 3KXDA 2QM7A 1PP9D 2IBZD 1NTME 1KB9H 5TJHA 2WPRA 4ZKPA 4L76A 2FYUE 1KMIZ 5KLVE 1JY2P 1URQB 4JF7A 2K3RA 1G2CA 1JY2O 3CX5D 1T2KC 1SQVE 4EDFA 2ZT9C 1VQ6P 1GL2A 2HYNA 3HUSC 1EZVI 2B89A 2R5BA 1RF1C 1ZP0C 1L0NE 4IL6E 1HF9A 2HODB 4H44D 1KYOH 3RK3C 4UB8H 3TSIA 2Y0DA 4NPDA 1EDJA 3M9BA 1HVVA 1S3JA 1NTZG 1JTHB 1IJDB 3AEGC 4YTPC 2R32A 2QJKC 1LWUA 2E75C 2GA1A 1JM0A 1IC2A 1BGYE 1Y8AA 1KB9E 1FDMA 3E7KA 2B87A 4C7RA 3IF4A 1N7SC 3V2RA 2W27A 2KYVA 3HUSA 1S2EA 4IFDK 4OGQB 4I7ZB 5AW6B 3Q5SA 2K88A 4BXLA 5CCHC 1YITP 1KILB 3FWNA 1FOSE 3IR9A 3VMZA 1YIJP 1ZOYC 2OTKE 1TU3F 4DCKA 1KC8Q 2UWJE 5B5EH 1FDOA 1KYOE 3H1JE 2ZYDA 1PV3A 4UB8E 5APQA 2FBWC 4PV1D 2OARA 5EFWB 1IFIA 1USEA 2Z5IA 3AEDC 2A06G 1NKZB 3MIWA 2HPCA 1FZCB 1FC2C 1M90Q 1N7SA 1AVYA 1LTJC 2KI7B 5KAFH 2WVRA 3NXSA 1FZFA 4N78D 3H1LE 5CCHA 3V2QA 3B8EB 3AE5C 2R3SA 1PGQA 1XTGB 4IOIH 3SSUA 2B9BA 1R8EA 2QM8A 1IK9A 1HGZA 4H44B 1S9KE 1Q2NA 3PHLA 2KP8A 5B5EE 2FXOA 3L75J 1J2JB 3F89A 1BDDA 2JEEA 3CX5I 2YIUB 1UIIA 5KAIH 3H1IJ 5AVVB 2BEZF 5KKZC 1KILE 2PFXA 4ZMDA 2AXCA 3HE4A 4ASVA 3A0HH 1LT9A 2I1KA 1LTJA 1CW5A 3AE7C 2R3CA 1QVFO 1M7LA 1X9VA 4IFMA 4LC1A 1ZRTD 5KAFE 3O6QA 3TNUA 2YNYA 1SQXJ 1Q86Q 1J1DC 3L70J 1NKNA 1VF5D 1FZGA 1BCCD 2E74B 1USDA 3N7NA 4H13C 4EI2A 4KHXA 1NOHA 2H43A 3KQGA 1T8ZA 2OYHB 1J1EC 3CC4P 4M3LA 1FOSF 4MN4C 1LT1A 2C9LY 4WWIA 2PP6A 3L75G 3H1HJ 4QMAA 4JBZA 5KAIE 1VQPP 4PV1B 3H1IG 2WT7B 3P8MC 4JYCA 4K3AA 1M56D 5AVRB 5C39A 2KXPB 2WSCJ 3JCUH 3PTZA 3A0HE 3PRJA 2NRGA 2O01H 1LP1A 2WWWA 5GTIE 1HTLC 5CBOA 1BE3J 2M5AB 4N3YB 4C7NA 1NTZE 2JKVA 1RQUA 3MD0A 1SQXG 2E76D 3RGUA 2JJLA 3L70G 1L4AC 3CPWO 2V7QH 1ZMEC 1SQQJ 4WY4B 1SFCB 2K9JB 2E5YA 5DJTB 2O3JA 2Y9ZA 2M3EA 1X8YA 5AW5B 4PD4H 2J5UA 3CC7P 1ZR2A 3IN6A 2Y9YA 4U3FE 3H1HG 1L0LE 2FY8A 3H1KJ 1NAFA 4W80A 1NTMD 1N73B 1SQBE 4HYTB 2FYUD 5KLVD 4ZNCA 1K8AQ 2N1TD 2DW3A 3N4XA 2IPPA 1SQVD 1BE3G 2WSFJ 2POHA 3NFQA 5AVTB 3TYYA 1L4AA 2FYNC 1A02F 1K04A 3RL0D 1L0ND 1H0TB 3WU2H 1VF5B 1AJYA 1U7JA 2W83C 4D6TJ 2MJZA 1N8RQ 1SQQG 2YXQB 3CWBE 1QVGO 4PD4E 3WUTA 1SQPE 3T97A 1FDIA 1OW8A 1PFIA 3H1KG 1BGYD 1IFPA 1JY3O 1NU1E 3L72E 2C0WA 5KJ7D 1KB9D 1GTWA 1VPCA 2GUSA 1VQOP 2YO3A 3HD7C 5CCGD 1KQFB 1FBMA 1S72P 2N1TA 2O01N 2FXMA 1X22A
chains in the Genus database with same CATH topology
3PJSK 2JDIH 2CK3H 4WVZA 2QE7H 2V7QH 2E5TA 3EFFK 4DJGA 2WSSH 1JEKA 1AQTA 4QMAA 2W6JH 2E5YA 4TLFA 1BSNA 1E79H 4YXWH 3USSA 1FS0E 2XNDH 1BSHA 1IFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJS K;  2JDI H;  2CK3 H;  4WVZ A;  2QE7 H;  2V7Q H;  2E5T A;  3EFF K;  4DJG A;  2WSS H;  1JEK A;  1AQT A;  4QMA A;  2W6J H;  2E5Y A;  4TLF A;  1BSN A;  1E79 H;  4YXW H;  3USS A;  1FS0 E;  2XND H;  1BSH A;  1IFP A; 
#chains in the Genus database with same CATH topology
 1VQ4 P;  5APS A;  3WU2 E;  1NJI Q;  2WZ7 A;  1OFC X;  1WRG A;  4WB4 A;  3G9R A;  1EZV G;  4D6T G;  3GG2 A;  3A7O A;  2I8D A;  1KYO D;  3H1J D;  4ASW A;  3L71 J;  1KV4 A;  1URQ C;  3CXH I;  2ZYG A;  2FFD C;  3B5N D;  2N9Y B;  2P1J A;  3I5C A;  5AW4 B;  5H2F H;  1M1J A;  2PGD A;  3KZI H;  3GW6 A;  1YJW P;  2M0B A;  3H1L D;  1PGP A;  1T3J A;  3H6P A;  3L75 E;  3PLN A;  3CCR P;  1GZL A;  1SQQ K;  2AEJ A;  3CCS P;  1PP9 J;  2D2C D;  5GTH H;  3LW5 J;  4GKG A;  2WSC H;  1LTS C;  1S9K D;  2KLU A;  2HR3 A;  1JEK A;  1URQ A;  1NTK E;  4OGQ D;  3H32 B;  4EIJ A;  3L71 G;  1SQX E;  1KIL D;  2FFD A;  2OYI B;  3USS A;  2QSI A;  3BCC E;  2N9B A;  3L70 E;  2NPS B;  4EOT A;  4AYC A;  3SFE C;  2QE7 H;  4OWF A;  1IFM A;  5H2F E;  1H88 A;  3KZI E;  4NPF X;  1LJ2 A;  3D71 A;  1P84 E;  1HGV A;  3M06 A;  1LWU C;  5AVU B;  1JTH A;  2OQQ A;  3P32 A;  3C9I A;  4H0L B;  1PP9 G;  5AW1 B;  5GTH E;  1AQT A;  1OWA A;  1VQN P;  3GHG B;  5K5G B;  1ZV8 A;  2QJP C;  3AE3 C;  3FXE A;  1G1I A;  4I6M C;  3VMX A;  2QIW A;  3BRT B;  1FZB A;  1BE3 E;  2WSF H;  3HRN A;  1PZQ A;  1LTI C;  1N86 A;  2O1K A;  3L74 E;  1JMB A;  3B5N B;  1M1K Q;  2OYO A;  1QL1 A;  1S5L H;  3S4R A;  2FXP A;  2BEQ D;  1OVR A;  2P58 A;  3V6I A;  1YJN P;  1N2D C;  4BRY B;  2Q7C A;  5CJ4 A;  1NTZ D;  4DJG A;  2XV5 A;  4DT0 A;  1QX8 A;  1KZU B;  3AE2 C;  2W8Z A;  1EXJ A;  1ZW0 A;  2D2C B;  1VQ9 P;  1QL2 A;  4RJT A;  3GF7 A;  2G3A A;  3RK2 C;  5CBN A;  1FZC A;  3EFF K;  1FE6 A;  3G3Z A;  3D6Y A;  1G2C B;  1QEX A;  4U3F D;  3LIE A;  1L0L D;  1GL2 B;  4OVN F;  3G4S P;  2E74 D;  4RES B;  1HJ0 A;  1RY3 A;  2LXC B;  2YKQ A;  2XNX A;  1DX7 A;  3GLM A;  1SQB D;  1KOR A;  2AEM A;  1KFM A;  3G6E P;  1MZ9 A;  4GOF A;  1S5L E;  1EZV E;  3WUV A;  2W6B A;  1HJB A;  2XZR A;  2QRX A;  3PP5 A;  5KLI B;  1UIX A;  2Q5U A;  1LTB C;  2OYH C;  3WUU A;  3O8Z A;  3TGU E;  3CCQ P;  4HB1 A;  3U59 A;  2MKV A;  3EFG A;  1KFN A;  1LNQ A;  3VP8 A;  4PV1 C;  1LT9 C;  5AW3 B;  1YHQ P;  4ZKU A;  3MUD C;  5DJU B;  1NGM B;  1W2E A;  5KTB A;  3CWB D;  3AEE C;  2XND H;  4PD4 D;  1SQP D;  2IBZ I;  4WVZ A;  1GK4 A;  4K35 A;  3OJA B;  3HUS B;  3ABV C;  1RF1 B;  4WY4 D;  1NU1 D;  1SFC D;  3L72 D;  2H7H A;  1PIX A;  1BCC J;  4HH2 A;  1VQL P;  2W6A A;  1NO4 A;  1QGK B;  2OYH A;  1YQ4 C;  3L36 A;  4IL6 X;  4XFJ A;  2QJK B;  1IFJ A;  2WPV B;  5BU8 B;  5AW2 B;  3C8V A;  1SP4 A;  2WT7 A;  4EYY Q;  3V4Q A;  3M91 A;  3MUD A;  1DD4 A;  1W5C E;  2ZXX A;  1PPJ E;  1NYH A;  2HPC B;  1N7S B;  1SS1 A;  1FAV A;  2KS1 B;  1NAY A;  1FJP A;  2M5A A;  2Q3E A;  3TF5 A;  3AEB C;  2Y0E A;  4AUW A;  3CD6 P;  3AEC C;  2VRS A;  1T3U A;  3AE1 C;  1WT6 A;  1IFD A;  5CJ0 A;  1BCC G;  4KT0 J;  3AE9 C;  2K9J A;  5APU A;  4GOD A;  3L75 D;  3JSV C;  1HH0 A;  1H8A A;  1RQV A;  2PRR A;  1JOC A;  1JO5 A;  2YMY A;  3HE4 B;  1IFN A;  3RK3 E;  2JO1 A;  1LTJ B;  1GMJ A;  3I55 P;  3CCM P;  2Y0C A;  2KSJ A;  1FJK A;  2WTY A;  1NTK D;  5APW A;  5AVW B;  3A3Y B;  1YTZ I;  3O6Q B;  3TNU B;  1SQX D;  1SQV J;  3Q2Y A;  3B4S A;  2YXR B;  3BCC D;  3L70 D;  2B88 A;  2ZAE B;  2E43 A;  3L35 A;  4HKZ H;  2E76 C;  1L0N J;  3CCE P;  1H0T A;  1E79 H;  5L8R J;  3ZDM A;  1AV1 A;  2WIT A;  2P67 A;  2H88 C;  2CPB A;  3AEF C;  1P84 D;  5KKZ B;  1KQG B;  3RL0 g;  2A45 I;  2KK7 A;  3JCU E;  3Q3D A;  1BGY J;  1E5W A;  3A2A A;  3NTN A;  1WMK A;  2YO2 A;  4IFF A;  1ZLL A;  2P2U A;  1BE3 D;  1L2P A;  2N1T C;  1J1D B;  3KPE A;  1DEB A;  2R44 A;  2RKL A;  1SQV G;  3L74 D;  5M1B A;  1OX3 A;  4H13 B;  1RH5 B;  2A06 E;  1FZA A;  2QJY C;  1VQK P;  2HG5 D;  3RL0 C;  1L0N G;  3S1K A;  1J1E B;  2KUB A;  1KQS O;  3VP9 A;  4Y99 C;  3CL3 D;  1DEE G;  2M3B A;  4N6J A;  3M0A A;  4A7P A;  1RE4 C;  5B66 H;  2NPS D;  5AVY B;  3CCJ P;  1W2B O;  1IK7 A;  4DOJ A;  3M9Q A;  3L37 A;  1K05 A;  2P10 A;  1EXI A;  2OYI C;  3V2N A;  1M1J C;  1BGY G;  2ITA A;  3UIA A;  4NPE A;  1Q82 Q;  5CCG C;  2BCC J;  4C46 A;  4YPC A;  1EQ7 A;  2LKM A;  2HLO A;  4H0L D;  2KZJ A;  4YXD C;  3TK1 A;  1VQ8 P;  2L91 A;  3H25 A;  3SWY A;  1EZV D;  3FGA D;  3CME P;  2WPQ A;  3HTK B;  3VN0 A;  1KTM A;  3PH0 A;  1RE4 A;  4Y28 J;  1QLE D;  3VOP A;  3KHU A;  1NTM K;  3AE8 C;  3TGU D;  3H32 A;  1G1J A;  3T97 B;  2KB7 P;  3AEA C;  5B66 E;  3L73 J;  4DZO A;  3CXH H;  3W67 A;  2OYI A;  2KOG A;  2JP3 A;  3QWO C;  2NPS A;  4W7Z A;  3IAO A;  2Z4E A;  1R5S A;  5KJ7 A;  4W7Y A;  1SQV K;  3KDP B;  5CCG A;  1A02 J;  3U1C A;  4GT1 A;  2G8Y A;  3HE5 A;  2W6J H;  1P84 I;  1U7M A;  1LTA C;  2AEF A;  2RN0 A;  3H1I E;  1M57 D;  3GF3 A;  1BSN A;  2FYN B;  1L0N K;  2BCC G;  3CCL P;  3FWL A;  2I1J A;  1Q81 Q;  3V4W A;  1HWT C;  2C9N Y;  1ZN5 A;  2Z5H A;  2E42 A;  3A0B H;  4OH8 B;  3GHG A;  1GL2 D;  4L75 A;  2PAJ A;  2KLV A;  2WPS A;  2K1A A;  3Q1M A;  4OGQ C;  4I7Z C;  2K37 A;  3AE6 C;  3L73 G;  1CSB A;  3CXH E;  1KIL C;  2HOD A;  3B5N A;  1PPJ D;  2GUV A;  3HD7 B;  3S9O A;  5TIS H;  4YXW H;  1K73 Q;  4L74 A;  3H1H E;  3K5B A;  4Z1M H;  2IDB A;  5BVZ A;  1N7L A;  3AE4 C;  2Q9I A;  2V4H A;  1KB9 I;  2J59 M;  3RBX A;  2IBZ G;  5AVS B;  1JUN A;  1Z56 A;  1CI6 B;  2IYP A;  1FS0 E;  1MUU A;  3BAS A;  1T2K D;  2ZT9 D;  3BRV B;  1FZC C;  3A0B E;  3MGN A;  3TDK A;  2QVA A;  4XE5 B;  3BVH A;  2OTL P;  1AVO A;  4U3F J;  2FFD B;  1L0L J;  1OIP A;  1KIL A;  3KYQ A;  1SQQ E;  1KYO I;  3RK3 D;  1SQB J;  3VYI A;  1OZH A;  3MHV A;  3CC2 P;  1GDT A;  4PJ0 H;  4H44 C;  5TIS E;  1VQ7 P;  3NMD A;  2ZJS E;  2O01 J;  2KNC B;  3IFM A;  1YQ3 C;  2E75 D;  1YJ9 P;  3EQ2 A;  1Q90 D;  2YIU C;  5CHX A;  1JY2 N;  4CPG A;  3H1K E;  1OW6 A;  5CMZ A;  1EDK A;  4JPZ B;  4RO0 A;  2P7J A;  2XDJ A;  1GU4 A;  1N7S D;  1JCD A;  3E1R A;  2V7Q J;  2Q1K A;  4LGD E;  2WSE J;  3RK2 D;  2Q3I A;  3CLQ A;  2J58 A;  3VMY A;  1YI2 P;  4I1L A;  3CWB J;  5CCH D;  1BSH A;  4GOE A;  1Y47 A;  3WMM 0;  1SQP J;  1GD2 E;  1GK6 A;  3A5T A;  4U3F G;  1L0L G;  5APT A;  2Q6Q A;  3R4Y A;  4D6T E;  1RF1 A;  1NU1 J;  5AW9 B;  3L72 J;  2E74 C;  5AVX B;  1SQB G;  3II6 A;  4PJ0 E;  2BAS A;  1LWU B;  3CI9 A;  2OGU A;  2E5T A;  3M9H A;  1X79 B;  3R2P A;  5AVQ B;  1U57 A;  3MTU E;  1OVV A;  2A06 D;  1LGH B;  3L4F A;  2B87 B;  2QJP B;  2ZT9 B;  1JCC A;  2JWD A;  3P8C E;  2WMM A;  3CWB G;  1LTT C;  1FZE A;  2KS1 A;  3VMA A;  2BCC E;  2KIK A;  2M8R A;  1SQP G;  3LW5 H;  2C0X A;  4AQR D;  1DD3 A;  3VTP C;  3JC2 2;  2IYO A;  3RK3 B;  2YMK A;  2A45 G;  1YBK A;  1NU1 G;  1R5L A;  3L72 G;  1MFT A;  2QA4 P;  4WY4 C;  1SFC C;  4BWN A;  1NTZ K;  3E1I A;  2WSS H;  3L71 E;  2OTJ P;  3CX5 H;  2E75 B;  2ZFC A;  1MFZ A;  3MZW B;  5APY A;  3BAT A;  1FU1 A;  5AW8 B;  2JDI H;  5APV A;  3L73 E;  1N73 C;  3M0D C;  3SFD C;  3OA7 A;  3RK2 B;  2FYZ A;  1MKM A;  2WQY C;  1S4X A;  1L0L K;  5GTI H;  2ZYA A;  1GU5 A;  1PGO A;  1NTK J;  4H13 D;  1SQB K;  1AQ5 A;  1PP9 E;  2IBZ E;  1Y9B A;  3BCC J;  1VF5 C;  4WY4 A;  1EC5 A;  1SFC A;  3CCU P;  2IX7 C;  4GDO A;  1SVF A;  3H1I D;  3CX5 E;  1BDC A;  1NHL A;  1S5L X;  1NTM J;  1LTG C;  1M8O B;  1N73 A;  1LT9 B;  3M0D A;  3LID A;  2FYU J;  5KLV J;  2RH0 A;  1AFO A;  4RKU J;  1AA0 A;  2ZVN B;  1SQP K;  5AW7 B;  1RHZ B;  1L4A D;  1NU1 K;  1NTK G;  3QH9 A;  3D70 A;  1VQ5 P;  3L74 J;  3CXH D;  1SLQ A;  2AXT H;  2KSE A;  3BCC G;  3F5H A;  2JR8 A;  1KN7 A;  1MV8 A;  2WSE H;  4PD4 I;  4R4L A;  2ZVO B;  3H1H D;  1RF0 C;  3RBZ A;  1OW7 A;  3I56 P;  2H8P D;  2LXB A;  2NZ2 A;  1VDF A;  1YYC A;  1NTM G;  1Q7Y Q;  3MP7 B;  2A45 H;  2FYU G;  3V2P A;  1LP1 B;  2YKO A;  2CPS A;  5KLV G;  1ZR4 A;  1GW4 A;  4C7N B;  1EDL A;  4KJM A;  3OW2 O;  3Q5R A;  1T6A A;  5BU5 A;  1NH4 A;  1JNM A;  2K9Y A;  3PJS K;  1H89 A;  2O1J A;  1NVO A;  1KQL A;  1JB0 J;  5AW0 B;  1SQQ D;  2SPZ A;  3CMA P;  3L74 G;  2AXT E;  3FX0 A;  3FXD A;  3H1J J;  1X0T A;  4JYB A;  1RF0 A;  3HTK A;  1JMM A;  2ZXE B;  4N78 E;  3ITK A;  2QEX P;  3H1K D;  1VL2 A;  3TGU J;  1PL5 A;  1OMI A;  1JY3 P;  3HD7 D;  2NPS C;  1HUC A;  5KJ7 C;  4WBA A;  3SWF A;  1NTK K;  2QG4 A;  5E79 H;  3GMA A;  3C1L A;  1SQX K;  1EDI A;  3H1L J;  2JWA A;  1L4A B;  1RE3 C;  2IFN A;  1D7M A;  3EWK A;  2H89 C;  2IZ1 A;  2E76 B;  4D6T D;  1YTZ T;  1JY3 N;  4H0L C;  2HFE D;  1IO4 A;  2LR2 A;  4LLH A;  1URQ D;  2XKM A;  3H1J G;  3GHG C;  3B71 A;  1ZRT E;  2W90 A;  2FYU K;  1KD1 Q;  5KLV K;  1GW3 A;  2RMZ A;  5APX A;  3U1A A;  4U7J A;  2FKW B;  3TGU G;  3B5N C;  1BCC E;  5AVZ B;  1DH3 A;  4UB6 H;  1HBW A;  4TLF A;  3HD7 A;  5E79 E;  1RE3 A;  3P8C D;  1VQM P;  2N1T B;  1K9M Q;  3H1L G;  3W68 A;  2IZ0 A;  2BCC D;  2IFM A;  3G71 P;  1P84 H;  2L5G B;  2QJY B;  2KZI A;  1DIP A;  2D2C C;  3RL0 B;  2GM4 A;  1S1C X;  1OVU A;  3Q5P A;  4JQ0 D;  1XTC C;  4Y99 B;  1CI6 A;  4XA4 A;  4GIF A;  3V5B A;  3CCV P;  3L71 D;  3D6Z A;  4TT3 H;  2CK3 H;  1NWQ A;  4B86 A;  1CZQ A;  1GL2 C;  3OAK A;  4IL6 H;  3L73 D;  1IZN B;  1M1J B;  2R5D A;  1PGJ A;  2YKP A;  4L73 A;  4HJG H;  4BRY A;  4UB6 E;  3SWK A;  1PPJ G;  2XU6 A;  1ZXG A;  4O9B A;  1NTZ J;  5KLI C;  4I2L C;  1OXZ A;  4R4M A;  3P7K A;  3HE5 B;  2KNC A;  3KXD A;  2QM7 A;  1PP9 D;  2IBZ D;  1NTM E;  1KB9 H;  5TJH A;  2WPR A;  4ZKP A;  4L76 A;  2FYU E;  1KMI Z;  5KLV E;  1JY2 P;  1URQ B;  4JF7 A;  2K3R A;  1G2C A;  1JY2 O;  3CX5 D;  1T2K C;  1SQV E;  4EDF A;  2ZT9 C;  1VQ6 P;  1GL2 A;  2HYN A;  3HUS C;  1EZV I;  2B89 A;  2R5B A;  1RF1 C;  1ZP0 C;  1L0N E;  4IL6 E;  1HF9 A;  2HOD B;  4H44 D;  1KYO H;  3RK3 C;  4UB8 H;  3TSI A;  2Y0D A;  4NPD A;  1EDJ A;  3M9B A;  1HVV A;  1S3J A;  1NTZ G;  1JTH B;  1IJD B;  3AEG C;  4YTP C;  2R32 A;  2QJK C;  1LWU A;  2E75 C;  2GA1 A;  1JM0 A;  1IC2 A;  1BGY E;  1Y8A A;  1KB9 E;  1FDM A;  3E7K A;  2B87 A;  4C7R A;  3IF4 A;  1N7S C;  3V2R A;  2W27 A;  2KYV A;  3HUS A;  1S2E A;  4IFD K;  4OGQ B;  4I7Z B;  5AW6 B;  3Q5S A;  2K88 A;  4BXL A;  5CCH C;  1YIT P;  1KIL B;  3FWN A;  1FOS E;  3IR9 A;  3VMZ A;  1YIJ P;  1ZOY C;  2OTK E;  1TU3 F;  4DCK A;  1KC8 Q;  2UWJ E;  5B5E H;  1FDO A;  1KYO E;  3H1J E;  2ZYD A;  1PV3 A;  4UB8 E;  5APQ A;  2FBW C;  4PV1 D;  2OAR A;  5EFW B;  1IFI A;  1USE A;  2Z5I A;  3AED C;  2A06 G;  1NKZ B;  3MIW A;  2HPC A;  1FZC B;  1FC2 C;  1M90 Q;  1N7S A;  1AVY A;  1LTJ C;  2KI7 B;  5KAF H;  2WVR A;  3NXS A;  1FZF A;  4N78 D;  3H1L E;  5CCH A;  3V2Q A;  3B8E B;  3AE5 C;  2R3S A;  1PGQ A;  1XTG B;  4IOI H;  3SSU A;  2B9B A;  1R8E A;  2QM8 A;  1IK9 A;  1HGZ A;  4H44 B;  1S9K E;  1Q2N A;  3PHL A;  2KP8 A;  5B5E E;  2FXO A;  3L75 J;  1J2J B;  3F89 A;  1BDD A;  2JEE A;  3CX5 I;  2YIU B;  1UII A;  5KAI H;  3H1I J;  5AVV B;  2BEZ F;  5KKZ C;  1KIL E;  2PFX A;  4ZMD A;  2AXC A;  3HE4 A;  4ASV A;  3A0H H;  1LT9 A;  2I1K A;  1LTJ A;  1CW5 A;  3AE7 C;  2R3C A;  1QVF O;  1M7L A;  1X9V A;  4IFM A;  4LC1 A;  1ZRT D;  5KAF E;  3O6Q A;  3TNU A;  2YNY A;  1SQX J;  1Q86 Q;  1J1D C;  3L70 J;  1NKN A;  1VF5 D;  1FZG A;  1BCC D;  2E74 B;  1USD A;  3N7N A;  4H13 C;  4EI2 A;  4KHX A;  1NOH A;  2H43 A;  3KQG A;  1T8Z A;  2OYH B;  1J1E C;  3CC4 P;  4M3L A;  1FOS F;  4MN4 C;  1LT1 A;  2C9L Y;  4WWI A;  2PP6 A;  3L75 G;  3H1H J;  4QMA A;  4JBZ A;  5KAI E;  1VQP P;  4PV1 B;  3H1I G;  2WT7 B;  3P8M C;  4JYC A;  4K3A A;  1M56 D;  5AVR B;  5C39 A;  2KXP B;  2WSC J;  3JCU H;  3PTZ A;  3A0H E;  3PRJ A;  2NRG A;  2O01 H;  1LP1 A;  2WWW A;  5GTI E;  1HTL C;  5CBO A;  1BE3 J;  2M5A B;  4N3Y B;  4C7N A;  1NTZ E;  2JKV A;  1RQU A;  3MD0 A;  1SQX G;  2E76 D;  3RGU A;  2JJL A;  3L70 G;  1L4A C;  3CPW O;  2V7Q H;  1ZME C;  1SQQ J;  4WY4 B;  1SFC B;  2K9J B;  2E5Y A;  5DJT B;  2O3J A;  2Y9Z A;  2M3E A;  1X8Y A;  5AW5 B;  4PD4 H;  2J5U A;  3CC7 P;  1ZR2 A;  3IN6 A;  2Y9Y A;  4U3F E;  3H1H G;  1L0L E;  2FY8 A;  3H1K J;  1NAF A;  4W80 A;  1NTM D;  1N73 B;  1SQB E;  4HYT B;  2FYU D;  5KLV D;  4ZNC A;  1K8A Q;  2N1T D;  2DW3 A;  3N4X A;  2IPP A;  1SQV D;  1BE3 G;  2WSF J;  2POH A;  3NFQ A;  5AVT B;  3TYY A;  1L4A A;  2FYN C;  1A02 F;  1K04 A;  3RL0 D;  1L0N D;  1H0T B;  3WU2 H;  1VF5 B;  1AJY A;  1U7J A;  2W83 C;  4D6T J;  2MJZ A;  1N8R Q;  1SQQ G;  2YXQ B;  3CWB E;  1QVG O;  4PD4 E;  3WUT A;  1SQP E;  3T97 A;  1FDI A;  1OW8 A;  1PFI A;  3H1K G;  1BGY D;  1IFP A;  1JY3 O;  1NU1 E;  3L72 E;  2C0W A;  5KJ7 D;  1KB9 D;  1GTW A;  1VPC A;  2GUS A;  1VQO P;  2YO3 A;  3HD7 C;  5CCG D;  1KQF B;  1FBM A;  1S72 P;  2N1T A;  2O01 N;  2FXM A;  1X22 A; 
#chains in the Genus database with same CATH homology
 3PJS K;  2JDI H;  2CK3 H;  4WVZ A;  2QE7 H;  2V7Q H;  2E5T A;  3EFF K;  4DJG A;  2WSS H;  1JEK A;  1AQT A;  4QMA A;  2W6J H;  2E5Y A;  4TLF A;  1BSN A;  1E79 H;  4YXW H;  3USS A;  1FS0 E;  2XND H;  1BSH A;  1IFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...