1JEKA

Visna tm core structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
40
structure length
40
Chain Sequence
QSLANATAAQQEVLEASYAMVQHIAKGIRILEARVARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENV POLYPROTEIN
publication title The trimer-of-hairpins motif in membrane fusion: Visna virus.
pubmed doi rcsb
molecule tags Viral protein
total genus 18
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1jekA00
2XNDH 3PJSK 3EFFK 2V7QH 4TLFA 2CK3H 1AQTA 2E5TA 1E79H 4QMAA 1BSNA 4WVZA 4DJGA 4YXWH 2QE7H 2W6JH 1IFPA 3USSA 1BSHA 2WSSH 1FS0E 2E5YA 2JDIH 1JEKA
chains in the Genus database with same CATH superfamily
1YJWP 3HD7D 3RGUA 1T3JA 4PJ0H 2N1TB 3H1LD 1MUUA 1M1JC 5AW9B 2XDJA 3LIEA 3CCJP 3H1KE 3L72E 3FWLA 3H32A 3VOPA 2GUVA 1MZ9A 1URQB 2O01N 1NTKK 1ZLLA 3BASA 2JKVA 3SWFA 2FFDB 4JYBA 2IBZD 1JY2P 3VYIA 4UB8H 1KILD 1RY3A 5KJ7D 1LP1B 3HUSC 2YKQA 1N7LA 1LTIC 1W2BO 1SQPG 2O01H 1PGQA 2LXBA 3AE1C 2QJYC 5APYA 3H1JD 1YHQP 3VMZA 3H1JJ 3CCEP 2C0XA 3F89A 4LLHA 2NPSA 1A02J 2ZT9D 1FDIA 1R5SA 3AE7C 4GODA 3T97A 1CI6B 2P2UA 1NTZK 5AW4B 3KZIE 3L75E 1EQ7A 3CX5I 2IPPA 1SVFA 1EZVD 2R3CA 3E1RA 3MUDA 1OZHA 2O01J 1SFCC 2NRGA 1FC2C 4QMAA 3SFDC 3RL0g 5CBOA 1NU1K 1GL2B 2KK7A 4JF7A 4PV1C 2IYOA 3TNUA 3OW2O 1HJ0A 4IOIH 3RBZA 1NTKE 2YKPA 1RHZB 3JC22 1NOHA 3IAOA 3TK1A 2M0BA 3H1JG 4C46A 3Q3DA 1FJKA 2NPSB 1Q2NA 2WT7B 2O1JA 1SQVJ 5AVVB 2OYIC 2YMKA 1L4AB 1GK6A 1ZOYC 1R8EA 3H1ID 1JY3N 4GT1A 2W6BA 3H1IJ 2RMZA 3HE5B 3MHVA 2ZJSE 3B5NC 2R32A 2ZAEB 1KB9D 2N9YB 1QL2A 3HD7A 4LGDE 1KYOE 3AEGC 1FZCB 4H44B 1SQQK 3AE2C 2HLOA 1SQPK 3S9OA 1SQBD 1EXJA 1NTZE 1N7SB 2E5YA 1BCCD 2QEXP 1YITP 2XV5A 1BCCJ 3L71D 1SLQA 3L71J 1M90Q 3BRTB 1VQOP 5AW7B 1SQVG 1Y47A 3M0DC 1NU1E 2JP3A 1KILA 2QE7H 5KJ7A 1HVVA 4DOJA 4C7RA 1U57A 5KKZB 1NGMB 1SFCD 1J1DB 2ZVOB 2QA4P 2L5GB 1LT1A 1LTJB 1NWQA 2A06D 1IFJA 3SWKA 1NYHA 4PV1D 1PIXA 1HJBA 2HG5D 3L36A 3USSA 5CCHA 2Q3IA 3A0HE 4EI2A 4YXDC 3EQ2A 3D6ZA 3S1KA 3P8CE 1BCCG 2BCCE 2IX7C 2HODA 3KDPB 3CWBD 1LT9A 3L71G 3G9RA 2YO2A 2MKVA 3JCUE 2GM4A 1KILB 5TJHA 1K73Q 4IL6E 3V4QA 3BATA 1SQQE 1AJYA 3CL3D 1WRGA 3R4YA 2WWWA 3B5ND 5APWA 4HB1A 3B71A 1SQPE 4U3FJ 2YIUB 4WB4A 5AVTB 4D6TJ 4PD4E 3L74J 3QH9A 2FYZA 1WT6A 3TDKA 3A5TA 3IFMA 4YTPC 1S1CX 2B9BA 1QEXA 3FXEA 3A0BE 3L70D 2N9BA 1OXZA 1KV4A 3L70J 2Y0EA 5GTHE 1LWUA 3W68A 2ZT9B 2Y9YA 5BU8B 4HYTB 2R5BA 1BSHA 3I5CA 3BCCD 2NPSC 1PPJD 2WPQA 5K5GB 3BCCJ 1S72P 1PL5A 3VP9A 2QRXA 2Q6QA 3GW6A 1SQVK 3Q5PA 2JEEA 2E76D 2XU6A 3R2PA 1DEBA 3MUDC 4U3FG 1XTGB 4D6TG 3L74G 2B87B 3HTKA 3TF5A 1JY3P 4H44C 2QVAA 1IFIA 3H1JE 1M8OB 3EWKA 3I56P 2WZ7A 2IYPA 4UB8E 3MIWA 1M56D 1ZV8A 3CCRP 5AVYB 5BU5A 3BCCG 1G2CA 1S2EA 1PPJG 2PP6A 4ZKUA 2K1AA 1LTTC 2BASA 1RF0A 3HUSB 4XA4A 1W2EA 4NPDA 5KLVJ 3CXHH 1J1DC 4I7ZC 3V2PA 1ZP0C 1FBMA 2QJYB 4L75A 3HD7C 2KUBA 4OVNF 1YIJP 1NH4A 4O9BA 3SFEC 3CCLP 1P84H 4HKZH 1QVFO 4I1LA 5B5EH 1SQVE 2RN0A 4XE5B 3I55P 4UB6H 2JWAA 1N73A 2AEMA 2Y0DA 4Y99C 2JO1A 1KYOI 3PJSK 1KILC 1SFCB 2E5TA 1U7MA 5KJ7C 2K9YA 1BSNA 5KLVG 1ZW0A 2KS1A 5AVSB 1KORA 4PV1B 4EOTA 2WSSH 2OTJP 2XNDH 1FZBA 4L76A 1AQTA 1BDDA 3NTNA 2W6AA 5CCHC 1BCCE 3TGUD 4YXWH 4WWIA 3A2AA 3TGUJ 3L71E 2OYIB 4BRYA 2J58A 2V4HA 2ZT9C 4H0LD 2KSJA 2O1KA 3CCSP 2Q9IA 1LT9C 3RBXA 2KI7B 3KPEA 2WSFJ 3B5NB 2FXPA 4DCKA 5M1BA 2W6JH 2H7HA 1VQ7P 1FS0E 2PGDA 1JCDA 2KB7P 2WITA 1IC2A 5KAFH 2C0WA 1IO4A 1EDKA 2K9JA 1OW8A 1T3UA 4N78D 1LTSC 2ITAA 3H1LJ 1DD4A 1QLED 1JTHB 2FKWB 3KQGA 3AE9C 2ZYDA 1LWUC 3TGUG 3NFQA 2P67A 2HYNA 2WVRA 3CC2P 2Z5HA 3G3ZA 1DH3A 3O6QB 2J59M 2MJZA 3AECC 4PD4I 1NAYA 1A02F 2E76B 1IJDB 2GA1A 4IFFA 1CZQA 4U3FE 4D6TE 3L74E 2WMMA 1NJIQ 1BE3D 2E75D 3LIDA 2CPSA 1BE3J 1Q7YQ 3GHGA 4TT3H 2KNCA 1Y9BA 5CMZA 5L8RJ 5KLVK 2QSIA 2VRSA 3NXSA 1S5LH 5AW2B 3CCVP 5CCHD 3PH0A 3H1LG 2IBZI 1TU3F 2W83C 3H32B 2K3RA 4JBZA 1LTAC 2Y0CA 4A7PA 3BCCE 2I1JA 1AV1A 1PPJE 3ITKA 1H0TA 3H1HD 3P7KA 3H1HJ 1ZR2A 1SP4A 3U59A 2CK3H 1QVGO 2E74D 5AW8B 2IBZG 3II6A 1RF0C 1BGYD 1VF5D 5KTBA 1BGYJ 1IFMA 3HE4A 2KOGA 2A45H 1MFTA 1HBWA 2JWDA 1FE6A 3QWOC 2QIWA 1BE3G 3GHGB 2KP8A 4Z1MH 4I2LC 1KB9H 1KD1Q 3EFGA 2SPZA 5APSA 3VTPC 3AEEC 2PFXA 4AUWA 1EZVI 2FYNB 3RK3C 3T97B 1RQVA 1N73C 3N4XA 1L0LD 1SS1A 3H1HG 1L0LJ 3A7OA 1HWTC 1T6AA 3VN0A 1SQXD 3WUUA 5KLVE 2K88A 1EZVG 1BDCA 2JR8A 3HE4B 1BGYG 3E7KA 1OWAA 2XNXA 5AW5B 3KHUA 3TNUB 1QGKB 3RL0C 2HPCA 1L0ND 4U7JA 1PP9D 1YYCA 1L0NJ 1GMJA 5B66E 5EFWB 3WU2H 1OVVA 1SQBJ 1Q86Q 2LR2A 3AEBC 4H0LB 4ZMDA 4RO0A 1VQ8P 3IF4A 3CXHE 2KZJA 4JQ0D 1AVYA 2RKLA 3TSIA 1IK9A 1OVUA 1EXIA 3H1IG 2A45G 5AVUB 4I7ZB 2E76C 2BEZF 1YTZI 3C8VA 2K37A 3RK2D 3HD7B 1OIPA 5H2FH 1P84E 2IZ0A 3ABVC 2YNYA 1S4XA 5B5EE 2DW3A 2KLVA 2W27A 1Q82Q 1FOSF 4UB6E 1K04A 3AE3C 1J2JB 1ZN5A 1AA0A 3GF3A 1L0NG 3TGUE 2KIKA 2QJKC 1SQBG 4IL6X 3V2RA 2JJLA 2C9LY 2WPVB 4Y99B 3RK3D 1T2KD 1LTGC 5DJUB 3CWBJ 3MGNA 2D2CC 1OMIA 2WSEH 1R5LA 3IN6A 4MN4C 2IFMA 3U1AA 4WBAA 2E75B 3CD6P 5BVZA 4W7YA 4KT0J 1G1IA 4B86A 4AQRD 2A06G 5TISH 3RL0D 1NHLA 2QM8A 2Z5IA 3GHGC 3H1LE 3MZWB 5CCGA 4GOEA 2WQYC 3KZIH 1ZXGA 1JO5A 3Q1MA 3KXDA 2WSEJ 5CBNA 3FGAD 2HODB 1MKMA 2FYNC 1LT9B 1JM0A 2N1TD 5GTIE 3CWBG 2IBZE 2E74B 1KILE 2M8RA 2Y9ZA 4W80A 1VF5B 1LTBC 1UIXA 2AXCA 3MTUE 4PJ0E 3AEFC 1OFCX 3FX0A 1URQD 1BE3E 2KZIA 2B89A 5APVA 3L75D 4RKUJ 3L75J 1GZLA 3M0AA 2OTKE 3ZDMA 1T8ZA 5C39A 4I6MC 1LWUB 3L70G 5AVXB 1L0NK 4H0LC 3HRNA 3H1HE 4BXLA 2D2CD 1SQBK 3PHLA 3MD0A 4C7NA 3H6PA 1EZVE 2R5DA 1VQNP 3KYQA 2QG4A 3L35A 3M9BA 1YQ4C 3U1CA 1RE3A 1BGYE 1Q90D 3M06A 3W67A 1S5LE 3FXDA 3GMAA 2M5AA 2YKOA 3GG2A 2QJPC 1X0TA 3G71P 3HTKB 1ZRTD 4EYYQ 2H8PD 3D6YA 4WY4A 5AVWB 1HH0A 1YQ3C 3Q5SA 2M3EA 3SWYA 2WSCH 1HGVA 3M9HA 1LGHB 1PGOA 1M7LA 1FAVA 1FZFA 5CJ0A 1G2CB 3H1IE 2OYHA 1KTMA 3Q2YA 1JOCA 1G1JA 3WUTA 1FU1A 4GKGA 3BVHA 1KB9E 3RK2B 2KXPB 2IZ1A 2E75C 3JSVC 3VMAA 1NU1D 1JY2O 1L0NE 1H88A 2WSCJ 1E5WA 1GU4A 3AE5C 1IZNB 4EDFA 3CMEP 2Q5UA 4M3LA 1SQBE 3CXHI 1S9KD 4WVZA 5CHXA 2P7JA 1RQUA 1N86A 5E79H 1JB0J 3RK3B 1L2PA 1N73B 1NKNA 2N1TA 2FY8A 1KQLA 2WPSA 4OWFA 4PD4H 2HFED 1FZAA 1P84I 2YMYA 1YTZT 3GLMA 2FYUD 2CPBA 3E1IA 1N7SD 2E74C 2FYUJ 2H43A 1OX3A 1URQA 2BCCD 1VF5C 1OW7A 1IFDA 2BCCJ 2A06E 2KS1B 2FFDA 3K5BA 4HH2A 3WU2E 3RL0B 2G8YA 2P10A 2ZFCA 4ASVA 1SQQD 1LP1A 1Z56A 1SQQJ 1FDOA 1SQPD 1J1EC 1AQ5A 5CCGC 5KAIH 4H13C 4PD4D 3CMAP 1H8AA 1MV8A 4BRYB 3RK3E 3CWBE 1D7MA 2Q3EA 5AW1B 3UIAA 4OGQC 3L37A 2LXCB 3CX5H 2WPRA 5H2FE 3B4SA 3OAKA 1NKZB 2B88A 4NPFX 1FOSE 3CC7P 3S4RA 2FYUG 1HUCA 3VMYA 3WUVA 1CI6A 2BEQD 2AXTH 2BCCG 2LKMA 4DJGA 2K9JB 3AE4C 2PAJA 4RESB 4N6JA 3O8ZA 2KSEA 3L70E 1SQQG 2QJKB 3CPWO 2POHA 1GL2A 1CW5A 3MP7B 2M3BA 1VPCA 3WMM0 1RF1A 3CX5D 2D2CB 2FBWC 2G3AA 1U7JA 1ZMEC 1DD3A 2R44A 1YBKA 5TISE 2WT7A 1USDA 3IR9A 1RE3C 1LNQA 4N3YB 2P58A 1IFPA 2I1KA 1L4AA 3RK2C 2KNCB 3CCUP 4Y28J 4R4MA 1NTMD 3HE5A 5APTA 1NTMJ 2IFNA 1X22A 3CC4P 4WY4C 5CCGD 1VQKP 3H25A 1VQ9P 4H13D 3VMXA 1DEEG 4DT0A 1FZCA 1RF1B 3L73D 1W5CE 4XFJA 3L73J 3EFFK 1GU5A 1T2KC 1JMBA 2ZYGA 1H0TB 3OA7A 2NZ2A 4OGQD 1AFOA 1N7SA 2RH0A 5AW6B 2OQQA 1K9MQ 2OYHC 1SQVD 2XZRA 1YJ9P 1SQXJ 4ASWA 4ZNCA 3V2QA 1H89A 4GIFA 1KQSO 1E79H 3BRVB 2FYUK 1PGJA 1DX7A 1ZRTE 2YO3A 3AE8C 5AVRB 1NTMG 1PP9J 1LTJA 2W8ZA 1Y8AA 2A45I 5KLIC 1M1KQ 4TLFA 1GK4A 2ZXXA 2YXQB 1KB9I 3L73G 2FXOA 2N1TC 1VQLP 3SSUA 1FJPA 1QX8A 2IDBA 1L0LG 2H88C 2QM7A 2ZXEB 2Q1KA 3AEDC 1SQXG 3A3YB 2QJPB 4NPEA 5APXA 1GW3A 1URQC 1RE4A 2FFDC 1USEA 3G6EP 3CI9A 3V2NA 3G4SP 2L91A 2HPCB 1S9KE 4WY4D 5DJTB 1PP9G 1FZEA 3PP5A 1CSBA 1RH5B 1LJ2A 1JY3O 3P8MC 2OTLP 1N2DC 4YPCA 3H1KD 3L72D 2FYUE 1JCCA 2FXMA 3H1KJ 3L72J 1OW6A 3TYYA 4BWNA 1NAFA 2E42A 1N8RQ 3M91A 3D70A 1DIPA 1M57D 1Q81Q 1KQGB 3B8EB 2WTYA 4N78E 5E79E 1K8AQ 3AE6C 3VP8A 2Q7CA 4U3FD 4EIJA 1GTWA 3D71A 1KC8Q 1XTCC 4D6TD 3L74D 4ZKPA 3M9QA 1QL1A 1X79B 2B87A 3Q5RA 1GDTA 2XKMA 1GL2C 1NTMK 3F5HA 3N7NA 1M1JA 1RF1C 5APQA 2GUSA 1HTLC 1HGZA 3P32A 3OJAB 4GDOA 2R3SA 1VL2A 2Z4EA 5KAFE 3H1KG 3L72G 1EC5A 4JPZB 2OARA 4IFDK 1VQ6P 1YJNP 3LW5H 1X8YA 1L0LK 2UWJE 3PLNA 1YI2P 1L4AC 5KAIE 1SQXK 2AEFA 2OGUA 3HUSA 4JYCA 1JNMA 1KFNA 5AW3B 1ZR4A 1J1EB 3FWNA 4DZOA 4H13B 3L4FA 1PFIA 4LC1A 1EDJA 1KMIZ 2C9NY 3V6IA 3CX5E 2O3JA 1FZCC 1M1JB 3V5BA 4OGQB 4R4LA 4W7ZA 1NTKD 1AVOA 1GD2E 1JY2N 3AEAC 1NTKJ 4AYCA 1S5LX 2AXTE 1VQPP 1KYOH 1GW4A 3LW5J 2P1JA 1OVRA 1N7SC 5AW0B 4RJTA 1EDLA 3V4WA 4IFMA 5B66H 5AVQB 3CCMP 1FDMA 1NVOA 1MFZA 2ZYAA 1NTME 1SFCA 5KLVD 2I8DA 3L75G 1VDFA 4K3AA 1VQ5P 5KKZC 2YXRB 1LTJC 1KYOD 3L73E 1GL2D 3C1LA 1NO4A 4KHXA 1PZQA 1X9VA 1VQ4P 1JEKA 2KLUA 1L0LE 2PRRA 1WMKA 4K35A 1NTKG 1NTZD 2W90A 1SQXE 4C7NB 1NTZJ 1JMMA 2OYIA 2H89C 5CJ4A 2NPSD 4KJMA 3A0HH 3GF7A 1JUNA 2M5AB 3CXHD 2OYOA 1L4AD 3CLQA 2J5UA 1VQMP 1NU1J 3B5NA 1RE4C 1PP9E 1KFMA 4WY4B 4L73A 3PTZA 3JCUH 4CPGA 3PRJA 2WSFH 5AVZB 4IL6H 2YIUC 1P84D 1IK7A 1EDIA 4H44D 2V7QH 2E43A 2OYHB 1S3JA 1JTHA 3C9IA 1K05A 2HR3A 1UIIA 3CCQP 1NTZG 3P8CD 1FZGA 3NMDA 1KZUB 5APUA 3M0DA 3A0BH 4L74A 3O6QA 1KN7A 5GTHH 2KYVA 1PV3A 2AEJA 1NU1G 1HF9A 4OH8B 4GOFA 1KQFB 5KLIB 1PGPA 1IFNA 5GTIH 2JDIH 4HJGH 2ZVNB 2V7QJ 1SQPJ
chains in the Genus database with same CATH topology
2XNDH 3PJSK 3EFFK 2V7QH 4TLFA 2CK3H 1AQTA 2E5TA 1E79H 4QMAA 1BSNA 4WVZA 4DJGA 4YXWH 2QE7H 2W6JH 1IFPA 3USSA 1BSHA 2WSSH 1FS0E 2E5YA 2JDIH 1JEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XND H;  3PJS K;  3EFF K;  2V7Q H;  4TLF A;  2CK3 H;  1AQT A;  2E5T A;  1E79 H;  4QMA A;  1BSN A;  4WVZ A;  4DJG A;  4YXW H;  2QE7 H;  2W6J H;  1IFP A;  3USS A;  1BSH A;  2WSS H;  1FS0 E;  2E5Y A;  2JDI H;  1JEK A; 
#chains in the Genus database with same CATH topology
 1YJW P;  3HD7 D;  3RGU A;  1T3J A;  4PJ0 H;  2N1T B;  3H1L D;  1MUU A;  1M1J C;  5AW9 B;  2XDJ A;  3LIE A;  3CCJ P;  3H1K E;  3L72 E;  3FWL A;  3H32 A;  3VOP A;  2GUV A;  1MZ9 A;  1URQ B;  2O01 N;  1NTK K;  1ZLL A;  3BAS A;  2JKV A;  3SWF A;  2FFD B;  4JYB A;  2IBZ D;  1JY2 P;  3VYI A;  4UB8 H;  1KIL D;  1RY3 A;  5KJ7 D;  1LP1 B;  3HUS C;  2YKQ A;  1N7L A;  1LTI C;  1W2B O;  1SQP G;  2O01 H;  1PGQ A;  2LXB A;  3AE1 C;  2QJY C;  5APY A;  3H1J D;  1YHQ P;  3VMZ A;  3H1J J;  3CCE P;  2C0X A;  3F89 A;  4LLH A;  2NPS A;  1A02 J;  2ZT9 D;  1FDI A;  1R5S A;  3AE7 C;  4GOD A;  3T97 A;  1CI6 B;  2P2U A;  1NTZ K;  5AW4 B;  3KZI E;  3L75 E;  1EQ7 A;  3CX5 I;  2IPP A;  1SVF A;  1EZV D;  2R3C A;  3E1R A;  3MUD A;  1OZH A;  2O01 J;  1SFC C;  2NRG A;  1FC2 C;  4QMA A;  3SFD C;  3RL0 g;  5CBO A;  1NU1 K;  1GL2 B;  2KK7 A;  4JF7 A;  4PV1 C;  2IYO A;  3TNU A;  3OW2 O;  1HJ0 A;  4IOI H;  3RBZ A;  1NTK E;  2YKP A;  1RHZ B;  3JC2 2;  1NOH A;  3IAO A;  3TK1 A;  2M0B A;  3H1J G;  4C46 A;  3Q3D A;  1FJK A;  2NPS B;  1Q2N A;  2WT7 B;  2O1J A;  1SQV J;  5AVV B;  2OYI C;  2YMK A;  1L4A B;  1GK6 A;  1ZOY C;  1R8E A;  3H1I D;  1JY3 N;  4GT1 A;  2W6B A;  3H1I J;  2RMZ A;  3HE5 B;  3MHV A;  2ZJS E;  3B5N C;  2R32 A;  2ZAE B;  1KB9 D;  2N9Y B;  1QL2 A;  3HD7 A;  4LGD E;  1KYO E;  3AEG C;  1FZC B;  4H44 B;  1SQQ K;  3AE2 C;  2HLO A;  1SQP K;  3S9O A;  1SQB D;  1EXJ A;  1NTZ E;  1N7S B;  2E5Y A;  1BCC D;  2QEX P;  1YIT P;  2XV5 A;  1BCC J;  3L71 D;  1SLQ A;  3L71 J;  1M90 Q;  3BRT B;  1VQO P;  5AW7 B;  1SQV G;  1Y47 A;  3M0D C;  1NU1 E;  2JP3 A;  1KIL A;  2QE7 H;  5KJ7 A;  1HVV A;  4DOJ A;  4C7R A;  1U57 A;  5KKZ B;  1NGM B;  1SFC D;  1J1D B;  2ZVO B;  2QA4 P;  2L5G B;  1LT1 A;  1LTJ B;  1NWQ A;  2A06 D;  1IFJ A;  3SWK A;  1NYH A;  4PV1 D;  1PIX A;  1HJB A;  2HG5 D;  3L36 A;  3USS A;  5CCH A;  2Q3I A;  3A0H E;  4EI2 A;  4YXD C;  3EQ2 A;  3D6Z A;  3S1K A;  3P8C E;  1BCC G;  2BCC E;  2IX7 C;  2HOD A;  3KDP B;  3CWB D;  1LT9 A;  3L71 G;  3G9R A;  2YO2 A;  2MKV A;  3JCU E;  2GM4 A;  1KIL B;  5TJH A;  1K73 Q;  4IL6 E;  3V4Q A;  3BAT A;  1SQQ E;  1AJY A;  3CL3 D;  1WRG A;  3R4Y A;  2WWW A;  3B5N D;  5APW A;  4HB1 A;  3B71 A;  1SQP E;  4U3F J;  2YIU B;  4WB4 A;  5AVT B;  4D6T J;  4PD4 E;  3L74 J;  3QH9 A;  2FYZ A;  1WT6 A;  3TDK A;  3A5T A;  3IFM A;  4YTP C;  1S1C X;  2B9B A;  1QEX A;  3FXE A;  3A0B E;  3L70 D;  2N9B A;  1OXZ A;  1KV4 A;  3L70 J;  2Y0E A;  5GTH E;  1LWU A;  3W68 A;  2ZT9 B;  2Y9Y A;  5BU8 B;  4HYT B;  2R5B A;  1BSH A;  3I5C A;  3BCC D;  2NPS C;  1PPJ D;  2WPQ A;  5K5G B;  3BCC J;  1S72 P;  1PL5 A;  3VP9 A;  2QRX A;  2Q6Q A;  3GW6 A;  1SQV K;  3Q5P A;  2JEE A;  2E76 D;  2XU6 A;  3R2P A;  1DEB A;  3MUD C;  4U3F G;  1XTG B;  4D6T G;  3L74 G;  2B87 B;  3HTK A;  3TF5 A;  1JY3 P;  4H44 C;  2QVA A;  1IFI A;  3H1J E;  1M8O B;  3EWK A;  3I56 P;  2WZ7 A;  2IYP A;  4UB8 E;  3MIW A;  1M56 D;  1ZV8 A;  3CCR P;  5AVY B;  5BU5 A;  3BCC G;  1G2C A;  1S2E A;  1PPJ G;  2PP6 A;  4ZKU A;  2K1A A;  1LTT C;  2BAS A;  1RF0 A;  3HUS B;  4XA4 A;  1W2E A;  4NPD A;  5KLV J;  3CXH H;  1J1D C;  4I7Z C;  3V2P A;  1ZP0 C;  1FBM A;  2QJY B;  4L75 A;  3HD7 C;  2KUB A;  4OVN F;  1YIJ P;  1NH4 A;  4O9B A;  3SFE C;  3CCL P;  1P84 H;  4HKZ H;  1QVF O;  4I1L A;  5B5E H;  1SQV E;  2RN0 A;  4XE5 B;  3I55 P;  4UB6 H;  2JWA A;  1N73 A;  2AEM A;  2Y0D A;  4Y99 C;  2JO1 A;  1KYO I;  3PJS K;  1KIL C;  1SFC B;  2E5T A;  1U7M A;  5KJ7 C;  2K9Y A;  1BSN A;  5KLV G;  1ZW0 A;  2KS1 A;  5AVS B;  1KOR A;  4PV1 B;  4EOT A;  2WSS H;  2OTJ P;  2XND H;  1FZB A;  4L76 A;  1AQT A;  1BDD A;  3NTN A;  2W6A A;  5CCH C;  1BCC E;  3TGU D;  4YXW H;  4WWI A;  3A2A A;  3TGU J;  3L71 E;  2OYI B;  4BRY A;  2J58 A;  2V4H A;  2ZT9 C;  4H0L D;  2KSJ A;  2O1K A;  3CCS P;  2Q9I A;  1LT9 C;  3RBX A;  2KI7 B;  3KPE A;  2WSF J;  3B5N B;  2FXP A;  4DCK A;  5M1B A;  2W6J H;  2H7H A;  1VQ7 P;  1FS0 E;  2PGD A;  1JCD A;  2KB7 P;  2WIT A;  1IC2 A;  5KAF H;  2C0W A;  1IO4 A;  1EDK A;  2K9J A;  1OW8 A;  1T3U A;  4N78 D;  1LTS C;  2ITA A;  3H1L J;  1DD4 A;  1QLE D;  1JTH B;  2FKW B;  3KQG A;  3AE9 C;  2ZYD A;  1LWU C;  3TGU G;  3NFQ A;  2P67 A;  2HYN A;  2WVR A;  3CC2 P;  2Z5H A;  3G3Z A;  1DH3 A;  3O6Q B;  2J59 M;  2MJZ A;  3AEC C;  4PD4 I;  1NAY A;  1A02 F;  2E76 B;  1IJD B;  2GA1 A;  4IFF A;  1CZQ A;  4U3F E;  4D6T E;  3L74 E;  2WMM A;  1NJI Q;  1BE3 D;  2E75 D;  3LID A;  2CPS A;  1BE3 J;  1Q7Y Q;  3GHG A;  4TT3 H;  2KNC A;  1Y9B A;  5CMZ A;  5L8R J;  5KLV K;  2QSI A;  2VRS A;  3NXS A;  1S5L H;  5AW2 B;  3CCV P;  5CCH D;  3PH0 A;  3H1L G;  2IBZ I;  1TU3 F;  2W83 C;  3H32 B;  2K3R A;  4JBZ A;  1LTA C;  2Y0C A;  4A7P A;  3BCC E;  2I1J A;  1AV1 A;  1PPJ E;  3ITK A;  1H0T A;  3H1H D;  3P7K A;  3H1H J;  1ZR2 A;  1SP4 A;  3U59 A;  2CK3 H;  1QVG O;  2E74 D;  5AW8 B;  2IBZ G;  3II6 A;  1RF0 C;  1BGY D;  1VF5 D;  5KTB A;  1BGY J;  1IFM A;  3HE4 A;  2KOG A;  2A45 H;  1MFT A;  1HBW A;  2JWD A;  1FE6 A;  3QWO C;  2QIW A;  1BE3 G;  3GHG B;  2KP8 A;  4Z1M H;  4I2L C;  1KB9 H;  1KD1 Q;  3EFG A;  2SPZ A;  5APS A;  3VTP C;  3AEE C;  2PFX A;  4AUW A;  1EZV I;  2FYN B;  3RK3 C;  3T97 B;  1RQV A;  1N73 C;  3N4X A;  1L0L D;  1SS1 A;  3H1H G;  1L0L J;  3A7O A;  1HWT C;  1T6A A;  3VN0 A;  1SQX D;  3WUU A;  5KLV E;  2K88 A;  1EZV G;  1BDC A;  2JR8 A;  3HE4 B;  1BGY G;  3E7K A;  1OWA A;  2XNX A;  5AW5 B;  3KHU A;  3TNU B;  1QGK B;  3RL0 C;  2HPC A;  1L0N D;  4U7J A;  1PP9 D;  1YYC A;  1L0N J;  1GMJ A;  5B66 E;  5EFW B;  3WU2 H;  1OVV A;  1SQB J;  1Q86 Q;  2LR2 A;  3AEB C;  4H0L B;  4ZMD A;  4RO0 A;  1VQ8 P;  3IF4 A;  3CXH E;  2KZJ A;  4JQ0 D;  1AVY A;  2RKL A;  3TSI A;  1IK9 A;  1OVU A;  1EXI A;  3H1I G;  2A45 G;  5AVU B;  4I7Z B;  2E76 C;  2BEZ F;  1YTZ I;  3C8V A;  2K37 A;  3RK2 D;  3HD7 B;  1OIP A;  5H2F H;  1P84 E;  2IZ0 A;  3ABV C;  2YNY A;  1S4X A;  5B5E E;  2DW3 A;  2KLV A;  2W27 A;  1Q82 Q;  1FOS F;  4UB6 E;  1K04 A;  3AE3 C;  1J2J B;  1ZN5 A;  1AA0 A;  3GF3 A;  1L0N G;  3TGU E;  2KIK A;  2QJK C;  1SQB G;  4IL6 X;  3V2R A;  2JJL A;  2C9L Y;  2WPV B;  4Y99 B;  3RK3 D;  1T2K D;  1LTG C;  5DJU B;  3CWB J;  3MGN A;  2D2C C;  1OMI A;  2WSE H;  1R5L A;  3IN6 A;  4MN4 C;  2IFM A;  3U1A A;  4WBA A;  2E75 B;  3CD6 P;  5BVZ A;  4W7Y A;  4KT0 J;  1G1I A;  4B86 A;  4AQR D;  2A06 G;  5TIS H;  3RL0 D;  1NHL A;  2QM8 A;  2Z5I A;  3GHG C;  3H1L E;  3MZW B;  5CCG A;  4GOE A;  2WQY C;  3KZI H;  1ZXG A;  1JO5 A;  3Q1M A;  3KXD A;  2WSE J;  5CBN A;  3FGA D;  2HOD B;  1MKM A;  2FYN C;  1LT9 B;  1JM0 A;  2N1T D;  5GTI E;  3CWB G;  2IBZ E;  2E74 B;  1KIL E;  2M8R A;  2Y9Z A;  4W80 A;  1VF5 B;  1LTB C;  1UIX A;  2AXC A;  3MTU E;  4PJ0 E;  3AEF C;  1OFC X;  3FX0 A;  1URQ D;  1BE3 E;  2KZI A;  2B89 A;  5APV A;  3L75 D;  4RKU J;  3L75 J;  1GZL A;  3M0A A;  2OTK E;  3ZDM A;  1T8Z A;  5C39 A;  4I6M C;  1LWU B;  3L70 G;  5AVX B;  1L0N K;  4H0L C;  3HRN A;  3H1H E;  4BXL A;  2D2C D;  1SQB K;  3PHL A;  3MD0 A;  4C7N A;  3H6P A;  1EZV E;  2R5D A;  1VQN P;  3KYQ A;  2QG4 A;  3L35 A;  3M9B A;  1YQ4 C;  3U1C A;  1RE3 A;  1BGY E;  1Q90 D;  3M06 A;  3W67 A;  1S5L E;  3FXD A;  3GMA A;  2M5A A;  2YKO A;  3GG2 A;  2QJP C;  1X0T A;  3G71 P;  3HTK B;  1ZRT D;  4EYY Q;  2H8P D;  3D6Y A;  4WY4 A;  5AVW B;  1HH0 A;  1YQ3 C;  3Q5S A;  2M3E A;  3SWY A;  2WSC H;  1HGV A;  3M9H A;  1LGH B;  1PGO A;  1M7L A;  1FAV A;  1FZF A;  5CJ0 A;  1G2C B;  3H1I E;  2OYH A;  1KTM A;  3Q2Y A;  1JOC A;  1G1J A;  3WUT A;  1FU1 A;  4GKG A;  3BVH A;  1KB9 E;  3RK2 B;  2KXP B;  2IZ1 A;  2E75 C;  3JSV C;  3VMA A;  1NU1 D;  1JY2 O;  1L0N E;  1H88 A;  2WSC J;  1E5W A;  1GU4 A;  3AE5 C;  1IZN B;  4EDF A;  3CME P;  2Q5U A;  4M3L A;  1SQB E;  3CXH I;  1S9K D;  4WVZ A;  5CHX A;  2P7J A;  1RQU A;  1N86 A;  5E79 H;  1JB0 J;  3RK3 B;  1L2P A;  1N73 B;  1NKN A;  2N1T A;  2FY8 A;  1KQL A;  2WPS A;  4OWF A;  4PD4 H;  2HFE D;  1FZA A;  1P84 I;  2YMY A;  1YTZ T;  3GLM A;  2FYU D;  2CPB A;  3E1I A;  1N7S D;  2E74 C;  2FYU J;  2H43 A;  1OX3 A;  1URQ A;  2BCC D;  1VF5 C;  1OW7 A;  1IFD A;  2BCC J;  2A06 E;  2KS1 B;  2FFD A;  3K5B A;  4HH2 A;  3WU2 E;  3RL0 B;  2G8Y A;  2P10 A;  2ZFC A;  4ASV A;  1SQQ D;  1LP1 A;  1Z56 A;  1SQQ J;  1FDO A;  1SQP D;  1J1E C;  1AQ5 A;  5CCG C;  5KAI H;  4H13 C;  4PD4 D;  3CMA P;  1H8A A;  1MV8 A;  4BRY B;  3RK3 E;  3CWB E;  1D7M A;  2Q3E A;  5AW1 B;  3UIA A;  4OGQ C;  3L37 A;  2LXC B;  3CX5 H;  2WPR A;  5H2F E;  3B4S A;  3OAK A;  1NKZ B;  2B88 A;  4NPF X;  1FOS E;  3CC7 P;  3S4R A;  2FYU G;  1HUC A;  3VMY A;  3WUV A;  1CI6 A;  2BEQ D;  2AXT H;  2BCC G;  2LKM A;  4DJG A;  2K9J B;  3AE4 C;  2PAJ A;  4RES B;  4N6J A;  3O8Z A;  2KSE A;  3L70 E;  1SQQ G;  2QJK B;  3CPW O;  2POH A;  1GL2 A;  1CW5 A;  3MP7 B;  2M3B A;  1VPC A;  3WMM 0;  1RF1 A;  3CX5 D;  2D2C B;  2FBW C;  2G3A A;  1U7J A;  1ZME C;  1DD3 A;  2R44 A;  1YBK A;  5TIS E;  2WT7 A;  1USD A;  3IR9 A;  1RE3 C;  1LNQ A;  4N3Y B;  2P58 A;  1IFP A;  2I1K A;  1L4A A;  3RK2 C;  2KNC B;  3CCU P;  4Y28 J;  4R4M A;  1NTM D;  3HE5 A;  5APT A;  1NTM J;  2IFN A;  1X22 A;  3CC4 P;  4WY4 C;  5CCG D;  1VQK P;  3H25 A;  1VQ9 P;  4H13 D;  3VMX A;  1DEE G;  4DT0 A;  1FZC A;  1RF1 B;  3L73 D;  1W5C E;  4XFJ A;  3L73 J;  3EFF K;  1GU5 A;  1T2K C;  1JMB A;  2ZYG A;  1H0T B;  3OA7 A;  2NZ2 A;  4OGQ D;  1AFO A;  1N7S A;  2RH0 A;  5AW6 B;  2OQQ A;  1K9M Q;  2OYH C;  1SQV D;  2XZR A;  1YJ9 P;  1SQX J;  4ASW A;  4ZNC A;  3V2Q A;  1H89 A;  4GIF A;  1KQS O;  1E79 H;  3BRV B;  2FYU K;  1PGJ A;  1DX7 A;  1ZRT E;  2YO3 A;  3AE8 C;  5AVR B;  1NTM G;  1PP9 J;  1LTJ A;  2W8Z A;  1Y8A A;  2A45 I;  5KLI C;  1M1K Q;  4TLF A;  1GK4 A;  2ZXX A;  2YXQ B;  1KB9 I;  3L73 G;  2FXO A;  2N1T C;  1VQL P;  3SSU A;  1FJP A;  1QX8 A;  2IDB A;  1L0L G;  2H88 C;  2QM7 A;  2ZXE B;  2Q1K A;  3AED C;  1SQX G;  3A3Y B;  2QJP B;  4NPE A;  5APX A;  1GW3 A;  1URQ C;  1RE4 A;  2FFD C;  1USE A;  3G6E P;  3CI9 A;  3V2N A;  3G4S P;  2L91 A;  2HPC B;  1S9K E;  4WY4 D;  5DJT B;  1PP9 G;  1FZE A;  3PP5 A;  1CSB A;  1RH5 B;  1LJ2 A;  1JY3 O;  3P8M C;  2OTL P;  1N2D C;  4YPC A;  3H1K D;  3L72 D;  2FYU E;  1JCC A;  2FXM A;  3H1K J;  3L72 J;  1OW6 A;  3TYY A;  4BWN A;  1NAF A;  2E42 A;  1N8R Q;  3M91 A;  3D70 A;  1DIP A;  1M57 D;  1Q81 Q;  1KQG B;  3B8E B;  2WTY A;  4N78 E;  5E79 E;  1K8A Q;  3AE6 C;  3VP8 A;  2Q7C A;  4U3F D;  4EIJ A;  1GTW A;  3D71 A;  1KC8 Q;  1XTC C;  4D6T D;  3L74 D;  4ZKP A;  3M9Q A;  1QL1 A;  1X79 B;  2B87 A;  3Q5R A;  1GDT A;  2XKM A;  1GL2 C;  1NTM K;  3F5H A;  3N7N A;  1M1J A;  1RF1 C;  5APQ A;  2GUS A;  1HTL C;  1HGZ A;  3P32 A;  3OJA B;  4GDO A;  2R3S A;  1VL2 A;  2Z4E A;  5KAF E;  3H1K G;  3L72 G;  1EC5 A;  4JPZ B;  2OAR A;  4IFD K;  1VQ6 P;  1YJN P;  3LW5 H;  1X8Y A;  1L0L K;  2UWJ E;  3PLN A;  1YI2 P;  1L4A C;  5KAI E;  1SQX K;  2AEF A;  2OGU A;  3HUS A;  4JYC A;  1JNM A;  1KFN A;  5AW3 B;  1ZR4 A;  1J1E B;  3FWN A;  4DZO A;  4H13 B;  3L4F A;  1PFI A;  4LC1 A;  1EDJ A;  1KMI Z;  2C9N Y;  3V6I A;  3CX5 E;  2O3J A;  1FZC C;  1M1J B;  3V5B A;  4OGQ B;  4R4L A;  4W7Z A;  1NTK D;  1AVO A;  1GD2 E;  1JY2 N;  3AEA C;  1NTK J;  4AYC A;  1S5L X;  2AXT E;  1VQP P;  1KYO H;  1GW4 A;  3LW5 J;  2P1J A;  1OVR A;  1N7S C;  5AW0 B;  4RJT A;  1EDL A;  3V4W A;  4IFM A;  5B66 H;  5AVQ B;  3CCM P;  1FDM A;  1NVO A;  1MFZ A;  2ZYA A;  1NTM E;  1SFC A;  5KLV D;  2I8D A;  3L75 G;  1VDF A;  4K3A A;  1VQ5 P;  5KKZ C;  2YXR B;  1LTJ C;  1KYO D;  3L73 E;  1GL2 D;  3C1L A;  1NO4 A;  4KHX A;  1PZQ A;  1X9V A;  1VQ4 P;  1JEK A;  2KLU A;  1L0L E;  2PRR A;  1WMK A;  4K35 A;  1NTK G;  1NTZ D;  2W90 A;  1SQX E;  4C7N B;  1NTZ J;  1JMM A;  2OYI A;  2H89 C;  5CJ4 A;  2NPS D;  4KJM A;  3A0H H;  3GF7 A;  1JUN A;  2M5A B;  3CXH D;  2OYO A;  1L4A D;  3CLQ A;  2J5U A;  1VQM P;  1NU1 J;  3B5N A;  1RE4 C;  1PP9 E;  1KFM A;  4WY4 B;  4L73 A;  3PTZ A;  3JCU H;  4CPG A;  3PRJ A;  2WSF H;  5AVZ B;  4IL6 H;  2YIU C;  1P84 D;  1IK7 A;  1EDI A;  4H44 D;  2V7Q H;  2E43 A;  2OYH B;  1S3J A;  1JTH A;  3C9I A;  1K05 A;  2HR3 A;  1UII A;  3CCQ P;  1NTZ G;  3P8C D;  1FZG A;  3NMD A;  1KZU B;  5APU A;  3M0D A;  3A0B H;  4L74 A;  3O6Q A;  1KN7 A;  5GTH H;  2KYV A;  1PV3 A;  2AEJ A;  1NU1 G;  1HF9 A;  4OH8 B;  4GOF A;  1KQF B;  5KLI B;  1PGP A;  1IFN A;  5GTI H;  2JDI H;  4HJG H;  2ZVN B;  2V7Q J;  1SQP J; 
#chains in the Genus database with same CATH homology
 2XND H;  3PJS K;  3EFF K;  2V7Q H;  4TLF A;  2CK3 H;  1AQT A;  2E5T A;  1E79 H;  4QMA A;  1BSN A;  4WVZ A;  4DJG A;  4YXW H;  2QE7 H;  2W6J H;  1IFP A;  3USS A;  1BSH A;  2WSS H;  1FS0 E;  2E5Y A;  2JDI H;  1JEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...