1JF3A

Crystal structure of component iii glycera dibranchiata monomeric hemoglobin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
GLSAAQRQVVASTWKDIAGADNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Unligated and CN-Ligated Glycera dibranchiata Monomer Ferric Hemoglobin Components III and IV
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords monomer hemoglobin component III
total genus 58
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1jf3A00
5AB8A 4U8UB 1NWNA 3ZH0A 1AJGA 1MYIA 2ZT1A 3VREB 1YIHA 7HBIA 1O1IA 1Y4QA 1NS6A 1SDKB 1A6NA 102MA 2O5OX 4C44A 4FWZA 1LFLA 3UH7A 1TESA 3ECXA 3WCVD 1V75B 1BBBA 5EUIA 3GOUB 2D5XB 5HLXA 3HRWB 4U8UA 2MB5A 2ZFOB 3VRFB 1NIHB 1QI8B 5EOHA 5JOMA 2BMMA 1DUOA 5JGGB 1XZVA 1C7DB 2BK9A 3K8BB 4B3WA 1LFLB 1YFFB 1MYHA 3GQRB 5CNEA 5ILEA 2VEEA 1GCWA 4N8TA 3OZUA 1LH2A 2BNLA 1NGKA 1Y7DA 1YZIB 1HCOA 1ECNA 2D5ZB 1MDNA 2ZT0A 1XQ5A 1OBMA 1C7BA 1BZPA 2H35B 1CH1A 3TM9A 1MBNA 3GQGA 3A5AA 1CH7A 3GQRA 1MLMA 1T1NB 2LHBA 2W72A 1EBCA 1J3ZA 1FLPA 3HHBA 1QSIB 3HF4B 1MCYA 2HCOA 1MOAA 2HHBA 1IRCA 2DN1A 1C7BB 1X9FC 2ZFOD 106MA 2HBSB 1G0AA 2R4YA 4BJAA 1HBSB 3TLDA 1G09B 1T1NA 1HGAA 2W72B 3R5IA 1HRMA 4MQCA 2D2NC 3NFEA 3UH5A 1J7SA 3E55A 2ZS1C 1JF4A 1MLKA 1CP5A 2HBDA 2AV0A 1HHOB 3TM3A 3UHDA 3ZJJA 2AUPA 5SW7A 4FC3B 1YEVA 1HGAB 3HEPA 3NMLA 3OVUC 3R5IB 2O58X 4MQCB 2O5TX 3PI8B 1MLJA 2MGEA 4YU4A 1O1NB 3RJNB 1A3OB 3P5QB 1GLIB 1QXDB 3WI8A 2GTLD 5CN5A 4NI0A 4XS0B 1K0YA 4WJG1 1C40B 5CN6A 1Y8KB 2V1HA 4WCHD 1HBAB 4ROMB 2D2MD 2GRZA 3MKBB 3QMAA 1LH1A 3R0GA 1GLIA 1HJTA 1G9VA 4ROLB 3H57A 2RI4B 1OR6A 1ABWA 3GDJB 1Y8KA 4PQ6A 2HBFB 3S66B 3D4XB 2AUQA 3QZZA 1HV4B 2LH6A 5E83B 1Y5JA 1VXCA 4MQHA 5CHRA 4DWUA 1G9VB 5ILPA 4ESAA 2C0KA 5CN9A 1IBEA 3BCQB 1MTJA 3A59A 1HLMA 1LA6A 1IDRA 5JDOF 2ZSSA 1IWHB 3G53A 1YEOB 4N7NB 4AVEA 1MYGA 1Y46A 1HDAB 1V4XB 4ESAB 1ECOA 2M6ZB 1COHA 3G4UA 2ZSTA 1Y5FA 2GL3A 1BIJA 4XDIA 1A6MA 1A0ZB 1NZ2A 2VLYA 4H07A 1GJNA 1SPGA 1DWRA 1NAZA 1VXFA 4X0LB 2NSSA 1Y4GB 4N7NA 3GKTA 2ZS0C 3PI4A 2BW9M 3IC0A 1Y8IB 2MGLA 2ZSQA 1MLUA 3S65B 1CBMA 1COHB 1UIWB 4F6BA 3M38A 1YENB 2VLZA 1X9FD 1JW8A 1J40A 1FN3B 1XCHA 1H1XA 3ARJA 3ECLA 2MHBA 1SPGB 1YHEB 3D1AA 3LR7A 2XKHA 1DTMA 1MLFA 1XYEA 3M3AA 1Y8IA 3WCWB 1RQAA 1CPWA 1UIWA 1YMBA 2EB9A 3OO5A 4TWUA 1HBHB 112MA 2W31A 1X3KA 1V75A 2MGKA 3CY5B 1UVXA 5HY8B 1S5XB 1M6CA 1YH9A 2MHBB 3ZJHA 1UFPA 2DXMA 1JDOA 1VREA 1MLGA 1JEBB 1J41A 2ZS0B 2QSPB 2MGFA 2ZSOA 1XXTA 3K8BA 3OO5B 1YFFA 1QPWA 3UHKA 3AT5B 2HHEB 1O1LA 2MBWA 3GYSB 3CY5A 4YU3B 4N8TB 2FALA 5ILRA 1Y01B 3G4VA 1WVPA 2DXMB 3IC2A 1O1IB 1Y4QB 1MBAA 1JY7B 1SDKA 2ZS0A 3MN0A 5CN8A 4KMVA 3VRGA 4O4ZA 4NXAA 3S1IA 3AT5A 3BJ3A 2HZ3A 1JP6A 3ED9A 3GYSA 3HHBB 1B0BA 1SHRB 1Y7ZB 2HHBB 1X9FA 3QJDA 3VRFA 1J3FA 2EKTA 1YMAA 1V5HA 3MJUB 3UHIA 3V2ZA 3WR1B 3A9MA 3ORDA 4M4BA 2W72C 3BJ3B 1GCWB 1YE2A 3PELB 1MWDA 1J7SB 1O16A 1VXDA 2V1JA 2HBGA 3G4QA 1Y7ZA 3DHRA 1MYZA 1DWTA 3FS4B 3M3BA 1YE0B 4L2MA 105MA 1LJWB 1JZKA 3SDHA 2SPMA 2G12A 2EF2A 2MYEA 3PI9B 4MAXA 4KJTA 1NWIA 1BJEA 2FRJX 1Y4FA 3D17B 4MQKB 3HF4A 1W92A 1Y5KA 1A6GA 2FRKX 5EE4C 4QAUA 4F6JA 1OJ6A 1CH3A 4MQJB 2VRYA 2RAOA 2OHBA 2Z85A 3UHZA 1G0AB 2ZWJA 1DXUB 4ILZA 2DC3A 2WTGA 4AVDA 4N7OA 1NEJA 1HLBA 3M39A 2XYKA 3HC9A 1BABB 4ROLA 1MBOA 4IT8A 1MNIA 3UHWA 2HBFA 3S66A 1URYA 1DXUA 2QRWA 3ECZA 1MODA 4FH7A 5KERA 1Y0TB 5B85A 1YIEB 3D1KA 3U3EA 1MNOA 2D2MB 1QXDA 4NI0B 3WFUA 2ZSYA 3BCQA 2MGJA 1V07A 2D2NA 2GDMA 6HBWB 1YCAA 5KERB 1OUUB 2MGMA 2HZ1A 3QM9A 1MKOB 1BZZB 1CG5B 1Y46B 1HDAA 111MA 2AA1A 1LH3A 1HBBB 1Y5FB 4JACA 1MYFA 1K1KB 2YRSA 2FRIX 2HBEB 1YCBA 3BA2A 3KUOA 1RQ4A 1FAWB 1YDZA 2ZSNA 1G08A 1Y8HA 4X0LA 2W6YA 1Y4RA 2QU0A 1MKOA 1BZZA 1O1OA 2HBCA 1KD2A 3S1JA 2NSRA 4PNJA 4HRTA 1DLYA 2V1IA 3MYMA 1LH7A 1FAWA 1F63A 1Y0WA 1O1PB 1Y4RB 3WFWA 2B7HB 1O1OB 4MBAA 1CQ2A 3BJ2B 2GNWA 5EYSA 5CN4A 1A4FB 2LH3A 1BUWA 1BIJB 1M9PA 1DTIA 1LFTB 1N9HA 3ONZB 1Y45A 1A0ZA 1YHRA 2DN2A 1Y31B 1JP8A 5CNFA 2NRLA 3QJBB 1O1PA 3AG0A 1YIHB 3BOMB 2B7HA 2BLHA 1J41B 1N9IA 3RJ6A 4H0BA 5CNBA 3PT8A 3NMMB 1I3EA 2VM0A 4MXKA 1MTIA 4VHBA 1YOGA 2DN2B 1YHEA 3D1AB 1NZ5A 3QJBA 4TWVA 4G1BA 3IC2B 1Y0AB 2G14A 1DKEA 2H8DB 3UHHA 1QXEA 4ZVAA 3WCWA 1C7DA 1Z8UB 3PT8B 1CIKA 3ZJOA 2GKNA 3SZKA 1CH2A 3UHYA 1HBHA 2ZS0D 3IA3B 1YH9B 4LPIA 2OH8A 4FWYA 1CO8A 1MLQA 3GKVB 2ZFOC 1Q1FA 2QSPA 3OGBA 1CH4A 2H35A 1Y85A 4HRRA 1MNJA 3SZKB 1JL7A 1QPWB 1ABYB 4F4OA 2GTLA 4YU3A 2G0VA 3GKVA 3WCPA 4MXLA 1PBXB 3DHRB 3FS4A 1LFQB 5C6YA 1JY7A 2LH1A 2W6XA 4G51B 1YE0A 1LUEA 2HBSA 3VRGB 1XY0B 1N9FA 1MLSA 3PI9A 5EE4D 1LHSA 2GTLB 4HSXA 3K3UA 1A6KA 2EB8A 1O1KA 4MQKA 1O1JB 3WCPB 2NRMA 3B75A 1S69A 3MOUA 1GBUA 2XKIA 1AJHA 1VXEA 3OJ1A 1AJ9A 3WFTA 1J7YB 3WCTC 2D60B 2DN3B 1MYJA 4F6DA 3E5IA 1YE2B 1YG5B 1S5YA 1O1NA 1A3OA 3P5QA 1NEJB 3LB1A 3B75B 1ABSA 1BABA 2VLXA 3QM5A 1D8UA 1K0YB 1OFKA 4O2GA 1AJ9B 1GZXA 1XZ7B 1Y4VA 3K9ZA 1V4UA 1MBSA 2D60A 2DN3A 4F6FA 3WTGB 3PT7A 3MVCA 2G0SA 1S5YB 2OLPA 3OK5A 2G10A 1WMUB 3EU1A 1VXBA 1QSHB 4MQJA 1G0BB 2VYYA 4IROB 2RI4A 2OH9A 2VEBA 1EMYA 1ABWB 5KKKA 3KUNA 1GDIA 3HYUB 4F6IA 1J3YB 4DWTA 2PEGA 1CMYA 3ZJLA 2G0RA 1RVWB 1OUUA 3PT7B 1DXTA 1IT3A 3LB2A 2ZS1B 1XZUA 3EU1B 2MYAA 5CMVA 1HBRA 2ZT4A 1NS9B 1VXGA 4O4TA 3DR9A 1DXVA 3CIUA 1KR7A 3UHNA 4NZIA 5E29A 1NQPA 1Y0TA 1CO9A 1DXTB 2IG3A 1XZUB 1YEOA 3QM6A 2D2MA 1O1MA 1HBRB 2MGAA 2M6ZA 3WCUC 1JL6A 3EOKA 1DXVB 3CIUB 1DM1A 1Y4PA 4UURA 2AUOA 2GRFA 2W6WA 3WCWD 5E29B 1XZ5B 1NQPB 3A5BA 3UGYA 3QQQA 4M4AA 1A9WE 1HDSA 5JDOC 4OODA 2ZSXA 1NXFA 3AT6B 1MOCA 1CG5A 2R50A 3LR9A 3A2GA 2Z6TA 3AQ6A 1DO1A 3BJ2A 3FH9B 1FN3A 1A00B 107MA 1LFTA 3WCUB 1JZLA 1GDKA 2V1KA 2HBEA 5HLUA 3WCWC 1VXAA 1FDHA 4MU5A 2MYCA 1RQ4B 3AT6A 1JF3A 1Y8WA 4F69A 2QU0B 1A01A 1A0UA 2HBCB 2R4WA 1CH5A 3NMMA 1CH9A 1BZ1A 1DWSA 1N9XA 3G4YA 3WCUA 5E6EA 1WLAA 3MJPB 4ODCB 4HSWA 3LQDB 3MYNA 2SPOA 3H58A 3UGZA 1A01B 4MQGB 5MBNA 1CBLA 3RGKA 2G11A 3O7NA 1DO3A 1XXTB 4DC7A 1MZ0A 1XZ2B 1BINA 2QLSA 2V1EA 5M3SA 4PQCA 3LQDA 2NX0A 3BOMA 1CIOA 2VYWA 3G46A 1B86B 3QJEB 1Y85B 4HRRB 2OHAA 2QLSB 3OO4A 2E2YA 2HHDB 1OFJA 1EW6A 5F2AA 1YVTB 1X9FB 1PBXA 3QJDB 1RQ3B 1Y0AA 3A5GA 1DKEB 1UX8A 2H8DA 4G51A 5HAVA 1Y7GA 1B86A 4N7PA 4HHBA 1THBB 3WCVB 3A0GA 1Y2ZB 1X46A 1HGCA 3BJ1B 1LH6A 2MYBA 1YVQB 2QFKA 5EETA 3UHEA 1YGFA 1Y83A 4F68A 4ZVBA 1J7WB 3ZJIA 2VYZA 1CLSA 1SPEA 2G0ZA 1LJWA 5HU6A 2ZSZA 1THBA 3WCVA 1Y0DB 4L7YA 1ABYA 4F4OB 2MGIA 1Y4FB 2JHOA 2QMBB 1Y5KB 2CMMA 1MYTA 1CLSB 5JDOD 3NG6B 1LFQA 2BWHA 2RAOB 4G1VA 2QSSB 3W4UA 1BZ0B 1YEQB 1GZXB 3UHUA 1UMOA 1R1XB 1XY0A 3KMFA 3DHTB 1Y0DA 3HXNB 5EV5A 1JPBA 3DUTA 2WTHA 1YGDA 2R4ZA 1O1JA 1GCVB 2AV3A 1R1YA 4N7OB 5JDOE 2ZLUA 5EYJA 1GBUB 4FWXA 2KSCA 1G0BA 4NS2A 2QSSA 1BZ0A 1NPGA 4U8UC 1R1XA 3AQ5A 3DHTA 4F6GA 1MLNA 1J3YA 5EQMA 2PEGB 2ZSPA 5KDQA 3DUTB 3ZJQA 1YG5A 1GCVA 1Y35A 1YIEA 5D1VA 2MYDA 3UHVA 1GVHA 2R80B 3ZJPA 1MWCA 2G0XA 2OIFA 2ZLXA 3D7OA 1V4UB 3HRWA 2D6CA 1MBCA 2MGCA 6HBWA 3UH6A 4UIQA 2ZT3A 3ZOLA 2GKMA 1XZVB 1Y22B 3HENA 1BZRA 4IROA 1YHUB 3UHGA 110MA 1V4WB 3S48C 3HYUA 3E4NA 1LFVB 4U8UD 2GLNA 2YRSB 1YZIA 1SI4B 4M4AB 5D5RA 1YHUC 4SDHA 103MA 1RPSA 1XQ5B 1Y22A 1FDHG 2MGDA 4NK1A 1HDBA 3WCTB 1YHUA 1KD2B 1NS9A 4GZGA 1HABB 1M6MA 1J3ZB 3ODQB 1IOPA 4UZVA 1A00A 2BLIA 3VHBA 3UI0A 2HCOB 1BVDA 1MBDA 2DN1B 1YMCA 1RPSB 1Y0WB 1VXHA 2G3HA 2ZLVB 1O1MB 1HDBB 5CNGA 3GQPB 1G09A 1HABA 1OUTA 3EOKB 3WHMA 2IN4A 1M9PB 3QM7A 1L2KA 1RTXA 3ONZA 2PGHA 104MA 1Y45B 4O35A 1XZ5A 1GBVA 3LHBA 3MJPA 1Y31A 1HDSB 3UH3A 4MQGA 1NZ3A 3UHSA 1UFJA 1U7SA 3ZHWA 3WCVC 1DXDA 3WCTD 3FH9A 1C7CA 1GDLA 1KFRA 1UVYA 4YU4B 5AZQA 1LFYA 3G4WA 5MBAA 4XS0A 2QFNA 1A0UB 1MOHA 3PI1A 1QXEB 2O5SX 3EDAA 3QJEA 3QJCB 1HACB 1DO7A 4ROMA 1BZ1B 1Y7CB 2Z6NB 1FSXB 2BLJM 3OO4B 1LFYB 3UHTA 4ODCA 3ARKA 1MTKA 1RSEA 3UHQA 2ZFBA 1DXCA 1F5PA 1FHJB 5CN7A 5IKSA 3D4XA 3QJCA 3A0GB 1DLWA 1Y2ZA 5E83A 1FSXA 1Y5JB 3BJ1A 2GNVA 1IT2A 1YVQA 1MNHA 1I3DA 1JZMA 1BVCA 1ECDA 2MGHA 1FHJA 1UT0A 1CG8B 5HU6B 4PQBA 1F5OA 4MQIB 2H8FA 1IWHA 3QM8A 2EVKA 2O5BX 1O1KB 1MLOA 3V2VA 1HBGA 1XZ4A 3AQ7A 3WCUD 4KN3A 1Y7GB 2GRHA 1CG8A 4N7PB 1J7YA 1Y0CA 5HLQA 2H8FB 2FRFA 1NS6B 2WY4A 1HBIA 1YGFB 1R1YB 4DC8A 3ZJRA 2LH2A 1LFZB 2VHBA 3VAUA 1MYMA 1BBBB 5EUIB 1XZ7A 1Y4VB 3GOUA 1Y0CB 2D5XA 2V1FA 1XYEB 1HGBA 5HBIA 3WTGA 1RQAB 2QMBA 1F65A 1S0HB 5JGGA 1WMUA 2ZLWB 6HBIA 2SPNA 1YOHA 1QSHA 3NG6A 1H97A 1S56A 1LHTA 5CNCA 1YEQA 3ZJMA 1MLHA 2W6VB 5CHQA 1S5XA 5EU2A 4JYQA 1CMYB 3PI3A 3VREA 1YGDB 3QZXA 1J52A 3ZJNA 2D5ZA 1RVWA 1ASHA 1MLLA 1NZ4A 2R4XA 2ZS1A 3WFXA 1UX9A 1JWNA 2ZLWA 3ZJSA 1GDJA 2BKMA 1EWAA 2O5LX 2HHEA 1A3NA 109MA 1LFVA 2XKGA 3UBCA 2ZFOA 3MBAA 5KDQB 2R1HA 4NK2A 1NIHA 1QI8A 1SI4A 1Y35B 1BZ6A 5C6EA 1OR4A 3LB4A 1MOBA 2R80A 1A3NB 2ZLXB 1Y4PB 3D7OB 3UHBA 1Y7DB 1YHUD 4C0NA 1SHRA 2R1HB 1HSYA 3UHCA 1HCOB 2HBDB 2V1GA 1HHOA 1MBIA 1PMBA 2D2MC 3MJUA 5SW7B 4FH6A 3SDNA 3G52A 3WR1A 2ZLVA 5C6EB 2ZT2A 3GQGB 2O5MX 3GQPA 4M4BB 1OUTB 2GTLC 1V4WA 2AURA 3WHMB 1QSIA 3PELA 2SPLA 1MWBA 3PI8A 2PGHB 1AZIA 1Y09A 108MA 3E5OA 4WJGA 1TU9A 4MPMA 4H2LA 1Y8WB 4NXCA 1ECAA 1DUKA 1HBSA 1CQXA 3PI2A 3WCTA 3NL7B 4KMWA 3O89A 1RTEA 4MBNA 3ODQA 3D17A 3NFEB 3MKBA 2LH5A 1Y09B 5E6EB 2Z8AA 5ILMA 2ZLTB 3OZWA 2MGBA 2D2ND 4H2LB 1VWTA 3AQ9A 3PIAB 4FC3A 1YEVB 3G4RA 3GK9A 3NL7A 4TYXA 1FCSA 1HV4A 1XZ2A 4NI1A 5CNDA 1GBVB 1VHBA 1NPFA 2ZLTA 1A9WA 1U7RA 1ITHA 1VWTB 3PIAA 1C40A 2EKUA 3ARLA 1SWMA 3AQ8A 1HBAA 2ZSRA 2LH7A 1C7CB 1LH5A 3OZVA 4NI1B 3D1KB 2HHDA 1S61A 1FSLA 1V4XA 1YVTA 1SDLB 1JP9A 1RQ3A 3GDJA 1VRFA 2D2NB 4HHBB 1URVA 3HEOA 1HACA 2DHBA 3GLNA 1Y7CA 1MGNA 2Z6NA 5B84A 1Y4BB 3ZOMA 2O5QX 1HGCB 3UBVA 1Y4GA 4MQHB 3UHRA 5AZRA 2AA1B 1SDLA 1Y83B 1J7WA 1IBEB 1XZ4B 4O1TA 1HBBA 1EBTA 2ZFBB 1LTWA 1YOIA 3A59B 1K1KA 1IRDA 2DHBB 1LA6B 2ZS1D 4L7YB 1Y4BA 1YDZB 1G08B 1Y8HB 3IXFA 1CP0A 3ASEA 3LB3A 4HBIA 1MLRA 4OF9A 1YEUA 1MNKA 1LFZA 3QQRA 1UC3A 1DO4A 3W4UB 1IRDB 5HY8A 4HRTB 2Z6SA 4MQIA 2MGGA 3HXNA 101MA 2FAMA 1HGBB 1JEBA 2EVPA 1S6AA 3IC0B 3S65A 1S0HA 3EDBA 1YEUB 5F0BA 1V9QA 1A4FA 2ZLUB 1YENA 4B4YA 1BUWB 3UHXA 1J40B 2HZ2A 3KMFC 1O1LB 1YHRB 2W6VA
chains in the Genus database with same CATH superfamily
5AB8A 2BV8A 4U8UB 1NWNA 3ZH0A 1AJGA 1MYIA 2ZT1A 3VREB 1YIHA 7HBIA 1O1IA 1Y4QA 4F0UA 1NS6A 4A8OA 3L0FB 1SDKB 1A6NA 102MA 2O5OX 4C44A 4A8QA 4FWZA 1LFLA 3UH7A 1TESA 3ECXA 3WCVD 1V75B 1BBBA 5EUIA 3GOUB 2D5XB 5HLXA 3HRWB 4U8UA 2MB5A 2ZFOB 3VRFB 1NIHB 1QI8B 1B8DB 1KN1B 5EOHA 5JOMA 2BMMA 1DUOA 5JGGB 1XZVA 1C7DB 2BK9A 3K8BB 4B3WA 1LFLB 1YFFB 1MYHA 5AQDM 3GQRB 1CIIA 5CNEA 5ILEA 2VEEA 1GCWA 4N8TA 3OZUA 1LH2A 2BNLA 5AQDA 1NGKA 1Y7DA 2UUNB 1YZIB 1HCOA 1ECNA 2D5ZB 1MDNA 4AE1A 2ZT0A 1XQ5A 1OBMA 1C7BA 1BZPA 2H35B 1CH1A 3TM9A 1MBNA 3GQGA 3A5AA 1CH7A 3GQRA 1MLMA 1T1NB 3V57B 2LHBA 2W72A 1EBCA 1J3ZA 1FLPA 3HHBA 1QSIB 3HF4B 1MCYA 2HCOA 1MOAA 2HHBA 1IRCA 1HI8A 2DN1A 1C7BB 1X9FC 2ZFOD 106MA 2HBSB 1G0AA 2R4YA 4BJAA 1HBSB 3TLDA 1G09B 3PMDA 1T1NA 1HGAA 3V57A 2W72B 3R5IA 1HRMA 4MQCA 2D2NC 4RMPB 3NFEA 3UH5A 1J7SA 3E55A 2ZS1C 1JF4A 1MLKA 4A8WA 1CP5A 2HBDA 2AV0A 4YJJB 1HHOB 3TM3A 3UHDA 3ZJJA 2AUPA 5SW7A 4FC3B 1YEVA 1HGAB 3HEPA 3NMLA 3OVUC 3R5IB 2O58X 4MQCB 2O5TX 3PI8B 1MLJA 2MGEA 4YU4A 1O1NB 3RJNB 1A3OB 3P5QB 1GLIB 1QXDB 3WI8A 2GTLD 1RH1A 5CN5A 4NI0A 4XS0B 2VJRA 1K0YA 4WJG1 1C40B 1UVMA 5CN6A 1Y8KB 2V1HA 4WCHD 1HBAB 4ROMB 2D2MD 2GRZA 3MKBB 3QMAA 1LH1A 3R0GA 1GLIA 1HJTA 1G9VA 4ROLB 3H57A 2J96A 2RI4B 1OR6A 1ABWA 3GDJB 1Y8KA 4PQ6A 2HBFB 3S66B 3D4XB 2AUQA 3QZZA 1HV4B 4LMXB 2LH6A 5E83B 1Y5JA 1VXCA 4MQHA 5CHRA 4DWUA 1G9VB 5ILPA 4ESAA 2C0KA 5CN9A 1IBEA 3BCQB 1MTJA 3A59A 1HLMA 1LA6A 1IDRA 5JDOF 2ZSSA 1IWHB 3G53A 1UVNA 1YEOB 4N7NB 2UUMA 4AVEA 1MYGA 1Y46A 1HDAB 1V4XB 4ESAB 1ECOA 2M6ZB 1COHA 1GH0B 3G4UA 2ZSTA 1Y5FA 2GL3A 1BIJA 4H0MA 4XDIA 1A6MA 1A0ZB 1NZ2A 2VLYA 4H07A 2VMLB 1GJNA 1SPGA 1DWRA 1NAZA 1VXFA 3GUQA 4X0LB 2NSSA 1Y4GB 4N7NA 3GKTA 2ZS0C 3PI4A 2BW9M 3IC0A 1Y8IB 2MGLA 2ZSQA 1MLUA 3S65B 1CBMA 1COHB 1GH0A 1UIWB 4F6BA 3M38A 1YENB 2VLZA 1X9FD 1JW8A 1J40A 1FN3B 1XCHA 1H1XA 3ARJA 3ECLA 2UULC 2BV8B 2MHBA 1SPGB 1YHEB 3LR7A 3D1AA 2XKHA 1HHTP 1LIAB 1DTMA 1MLFA 1XF6C 1XYEA 3M3AA 1Y8IA 3WCWB 1RQAA 1CPWA 2UULH 1UIWA 1YMBA 2EB9A 3OO5A 4TWUA 1HBHB 1CPCA 112MA 2W31A 1X3KA 1V75A 2MGKA 3CY5B 1UVXA 5HY8B 1S5XB 1M6CA 1YH9A 2MHBB 3ZJHA 1UFPA 2DXMA 1JDOA 1LIAA 1VREA 1MLGA 1JEBB 1B8DA 1J41A 2ZS0B 2QSPB 2MGFA 2ZSOA 1XXTA 3K8BA 3OO5B 1YFFA 1QPWA 3UHKA 3AT5B 2HHEB 1O1LA 2MBWA 3GYSB 3CY5A 4YU3B 4N8TB 4ESUA 2FALA 4TMAB 5ILRA 2VJHB 1Y01B 3G4VA 1WVPA 2DXMB 3IC2A 1O1IB 1Y4QB 1MBAA 1JY7B 3L0FA 1SDKA 2ZS0A 3MN0A 5CN8A 4KMVA 3VRGA 4O4ZA 2C7KA 4NXAA 3S1IA 3AT5A 3BJ3A 2HZ3A 1JP6A 3ED9A 3GYSA 3HHBB 1B0BA 1SHRB 1UVKA 1Y7ZB 2HHBB 1X9FA 3QJDA 3VRFA 1J3FA 2EKTA 1YMAA 1V5HA 3MJUB 3UHIA 3V2ZA 3WR1B 3A9MA 1PHNB 3ORDA 4M4BA 2W72C 3BJ3B 1GCWB 1YE2A 3PELB 1MWDA 1J7SB 1O16A 1VXDA 2V1JA 2HBGA 3G4QA 1Y7ZA 4GY3B 3DHRA 1MYZA 1DWTA 3FS4B 4YJJA 3M3BA 1YE0B 4L2MA 105MA 1LJWB 1JZKA 3SDHA 2SPMA 2G12A 1XG0C 2EF2A 2MYEA 3PI9B 4MAXA 4KJTA 1NWIA 1BJEA 2FRJX 1Y4FA 3D17B 4MQKB 3HF4A 1W92A 1Y5KA 1A6GA 2FRKX 5EE4C 4QAUA 4F6JA 1OJ6A 2I88A 1CH3A 4MQJB 1F99B 2VRYA 2RAOA 2OHBA 2Z85A 3UHZA 4ETTA 5FVBA 1G0AB 2ZWJA 1DXUB 4ILZA 2DC3A 2WTGA 4RMPA 4AVDA 4N7OA 3V58A 1NEJA 1HLBA 3M39A 2XYKA 3HC9A 1BABB 4ROLA 1MBOA 4IT8A 1MNIA 3UHWA 2HBFA 3S66A 1URYA 1DXUA 2QRWA 1COLA 3ECZA 1MODA 4FH7A 5KERA 1Y0TB 5B85A 1YIEB 3D1KA 3U3EA 3V58B 1MNOA 3DBJB 2D2MB 1QXDA 4NI0B 3WFUA 2ZSYA 3BCQA 2MGJA 1V07A 2D2NA 2GDMA 6HBWB 1YCAA 5KERB 1OUUB 1EYXB 2MGMA 2HZ1A 3QM9A 1JBOB 1MKOB 1BZZB 1CG5B 1Y46B 1HDAA 111MA 4HH1A 2AA1A 1LH3A 1HBBB 1Y5FB 4JACA 1MYFA 3ZTAA 2UUMX 1K1KB 2YRSA 2FRIX 2HBEB 1YCBA 3BA2A 3KUOA 1RQ4A 1FAWB 1YDZA 2ZSNA 1G08A 1Y8HA 4X0LA 2W6YA 1Y4RA 2QU0A 1MKOA 1BZZA 1O1OA 2HBCA 1KD2A 4F0TB 3S1JA 2NSRA 4PNJA 4HRTA 1DLYA 2V1IA 3MYMA 1LH7A 1FAWA 1F63A 1Y0WA 1O1PB 1Y4RB 3WFWA 2B7HB 1O1OB 4MBAA 1CQ2A 3BJ2B 2GNWA 5EYSA 5CN4A 1A4FB 2LH3A 1BUWA 1BIJB 1M9PA 1DTIA 1LFTB 1N9HA 3ONZB 1Y45A 1A0ZA 1YHRA 2DN2A 1Y31B 1JP8A 5CNFA 2NRLA 3QJBB 1O1PA 3AG0A 4HH0A 1YIHB 3BOMB 4F0UB 2B7HA 2BLHA 1J41B 1N9IA 3RJ6A 4H0BA 5CNBA 3PT8A 3NMMB 1I3EA 3NUHB 2VM0A 1HI1A 4MXKA 1MTIA 4VHBA 1YOGA 2DN2B 1YHEA 3D1AB 1NZ5A 3QJBA 3RQRA 4TWVA 4G1BA 3IC2B 1Y0AB 2G14A 1DKEA 2H8DB 3UHHA 1QXEA 4ZVAA 3WCWA 3BRPB 1C7DA 1Z8UB 3PT8B 1CIKA 3ZJOA 2GKNA 3SZKA 1CH2A 3UHYA 1HBHA 2ZS0D 3GIOA 3IA3B 1YH9B 4LPIA 2OH8A 4FWYA 1CO8A 1MLQA 3GKVB 2ZFOC 1Q1FA 4L1EA 3VNCA 3BRPA 2QSPA 3OGBA 1CH4A 2H35A 1Y85A 4HRRA 1MNJA 3SZKB 1PHNA 1JL7A 1QPWB 1ABYB 4F4OA 2GTLA 4YU3A 1TOXA 2G0VA 2VJHA 3GKVA 4ETUA 3WCPA 4MXLA 1PBXB 3DHRB 3FS4A 1LFQB 5C6YA 1JY7A 2LH1A 2W6XA 4G51B 1YE0A 1LUEA 2HBSA 3VRGB 1XY0B 1N9FA 1MLSA 3PI9A 5EE4D 1LHSA 2GTLB 4HSXA 2YSKA 3K3UA 1A6KA 2EB8A 1O1KA 4MQKA 2X49A 1O1JB 3WCPB 2NRMA 3B75A 1S69A 3MOUA 1GBUA 2XKIA 1F99A 1AJHA 1VXEA 3OJ1A 1ALLA 1AJ9A 3WFTA 1J7YB 2VJTA 3WCTC 2D60B 2DN3B 2DKDA 1MYJA 1UVIA 4F6DA 3E5IA 1YE2B 1YG5B 1S5YA 1O1NA 1A3OA 3P5QA 1NEJB 4GY3A 3LB1A 3B75B 1ABSA 1BABA 3QM5A 2VLXA 1D8UA 1K0YB 1OFKA 4O2GA 4Q70B 1AJ9B 1GZXA 1XZ7B 1Y4VA 3K9ZA 1V4UA 1MBSA 2D60A 2DN3A 4F6FA 3WTGB 3PT7A 3MVCA 2G0SA 1S5YB 2OLPA 3OK5A 2G10A 1WMUB 3EU1A 1VXBA 1QSHB 4MQJA 1G0BB 2VYYA 4IROB 2RI4A 2OH9A 2VEBA 1EMYA 4Q70A 1ABWB 5KKKA 3KUNA 1GDIA 3HYUB 4F6IA 1J3YB 2X4AA 4DWTA 2PEGA 1CMYA 3ZJLA 1HHSA 2G0RA 1RVWB 1OUUA 3PT7B 1DXTA 1IT3A 3LB2A 2ZS1B 1XZUA 3EU1B 2MYAA 4A8SA 5CMVA 1HBRA 2ZT4A 1NS9B 1VXGA 4O4TA 3DR9A 1DXVA 3CIUA 1KR7A 3UHNA 4NZIA 5E29A 1NQPA 1F0LA 1Y0TA 1CO9A 1DXTB 2IG3A 1XZUB 1YEOA 3QM6A 2D2MA 1O1MA 1HBRB 2MGAA 2M6ZA 3WCUC 1JL6A 3EOKA 1DXVB 3CIUB 1DM1A 1Y4PA 3PMCA 4UURA 2AUOA 2GRFA 2W6WA 3WCWD 5E29B 1XZ5B 1NQPB 3A5BA 3UGYA 3QQQA 4M4AA 1A9WE 1HDSA 5JDOC 2WCQA 4OODA 2ZSXA 1NXFA 1JBOA 3AT6B 1MOCA 1CG5A 2R50A 3LR9A 3A2GA 2Z6TA 3AQ6A 1DO1A 3O2CA 3BJ2A 4XXIA 3FH9B 1FN3A 1A00B 107MA 1LFTA 3WCUB 1JZLA 1GDKA 2V1KA 2HBEA 5HLUA 3WCWC 1VXAA 1FDHA 4MU5A 2MYCA 4ERVA 1RQ4B 4N6SA 3AT6A 1JF3A 4GXEA 1Y8WA 4F69A 2DKAA 1A01A 2QU0B 1A0UA 1QGWC 1SGKA 2HBCB 2R4WA 3O2CB 1CH5A 3NMMA 1CH9A 1BZ1A 1DWSA 1N9XA 3G4YA 2C7JA 3WCUA 5E6EA 1WLAA 3MJPB 4ODCB 4HSWA 3LQDB 1B33A 3MYNA 2SPOA 3H58A 3UGZA 1A01B 4BJUA 4MQGB 5MBNA 1CBLA 1ON7A 3RGKA 2G11A 3O7NA 1DO3A 1XXTB 4DC7A 1MZ0A 1XZ2B 1BINA 1DDTA 2QLSA 1I7YA 2V1EA 5M3SA 4PQCA 3LQDA 2NX0A 3BOMA 4A8FA 1ON7B 1CIOA 4L1EB 2VYWA 3G46A 1B86B 3QJEB 1Y85B 4HRRB 2OHAA 2QLSB 3OO4A 2E2YA 2HHDB 1OFJA 1EW6A 1A87A 5F2AA 1YVTB 1X9FB 1PBXA 3QJDB 1UVLA 1RQ3B 1Y0AA 3A5GA 1DKEB 1UX8A 2H8DA 4G51A 5HAVA 1Y7GA 1B86A 4N7PA 4HHBA 1THBB 3WCVB 3A0GA 1Y2ZB 1X46A 1HGCA 3BJ1B 1LH6A 2MYBA 1YVQB 2QFKA 5EETA 3UHEA 1YGFA 1Y83A 4F68A 4ZVBA 1J7WB 3ZJIA 2VYZA 1CLSA 1SPEA 4A8YA 2G0ZA 4B02A 1LJWA 5HU6A 2ZSZA 1THBA 3WCVA 1Y0DB 4L7YA 1ABYA 4F4OB 2MGIA 1Y4FB 2JHOA 2QMBB 1Y5KB 2CMMA 1MYTA 1CLSB 5JDOD 3NG6B 1LFQA 4LM6B 1HA7A 2BWHA 2RAOB 4G1VA 2QSSB 3W4UA 1BZ0B 1YEQB 1GZXB 3UHUA 1UMOA 1R1XB 1XY0A 3KMFA 3DHTB 1Y0DA 3HXNB 5EV5A 4AE0A 1JPBA 3DUTA 2WTHA 1YGDA 2R4ZA 1O1JA 1GCVB 2AV3A 1R1YA 4N7OB 5JDOE 2ZLUA 5EYJA 1GBUB 4FWXA 2KSCA 1G0BA 4NS2A 2QSSA 1ALLB 1BZ0A 1NPGA 4U8UC 1R1XA 3AQ5A 3DHTA 4F6GA 1MLNA 1J3YA 5EQMA 2PEGB 2ZSPA 5KDQA 3DUTB 3ZJQA 1YG5A 1GCVA 1Y35A 1YIEA 3DBJA 5D1VA 5B13G 2MYDA 3UHVA 1GVHA 2R80B 3ZJPA 3MWNA 1MWCA 2G0XA 2OIFA 2ZLXA 3D7OA 1V4UB 3HRWA 2D6CA 1MBCA 2MGCA 4Z8KA 6HBWA 3UH6A 4UIQA 1EYXA 2ZT3A 3ZOLA 2GKMA 1XZVB 1Y22B 3HENA 1BZRA 4IROA 1YHUB 3UHGA 110MA 1V4WB 3S48C 3HYUA 4XXKA 3E4NA 1LFVB 4U8UD 2UUNA 2GLNA 2YRSB 1YZIA 1SI4B 4M4AB 5D5RA 1YHUC 4SDHA 103MA 1RPSA 1XQ5B 1Y22A 1FDHG 2MGDA 4NK1A 1HDBA 3WCTB 1YHUA 1KD2B 1NS9A 4GZGA 1HABB 1M6MA 1J3ZB 3ODQB 1IOPA 4UZVA 1A00A 2BLIA 3VHBA 3UI0A 2HCOB 1BVDA 1MBDA 3KVSB 2DN1B 1YMCA 1RPSB 1Y0WB 1VXHA 4GXEB 2G3HA 2ZLVB 1O1MB 1HDBB 5CNGA 3GQPB 1G09A 2UULB 1HABA 1OUTA 5B13A 3EOKB 3WHMA 2IN4A 1M9PB 3QM7A 1L2KA 1RTXA 1WACA 3ONZA 2PGHA 104MA 1Y45B 4O35A 1XZ5A 1GBVA 3LHBA 3MJPA 1Y31A 1HDSB 3UH3A 4MQGA 1MDTA 4ZIZB 1NZ3A 3UHSA 1UFJA 1U7SA 3ZHWA 3WCVC 1DXDA 3WCTD 3FH9A 1C7CA 4LMSB 1XDTT 1GDLA 1KFRA 1UVYA 4YU4B 5AZQA 1KTPA 1LFYA 3G4WA 5MBAA 4XS0A 2QFNA 1A0UB 1MOHA 3PI1A 1QXEB 2O5SX 3EDAA 3QJEA 3QJCB 1HACB 1DO7A 4ETVA 4ROMA 1BZ1B 1Y7CB 2Z6NB 1FSXB 2BLJM 3OO4B 1LFYB 3UHTA 4ODCA 3ARKA 1MTKA 1RSEA 1B33B 3UHQA 2ZFBA 1DXCA 1F5PA 1FHJB 5CN7A 5IKSA 3D4XA 3QJCA 3A0GB 1DLWA 1Y2ZA 5E83A 1FSXA 1Y5JB 3BJ1A 2GNVA 1I7YB 1IT2A 1YVQA 1MNHA 1I3DA 1JZMA 1BVCA 1ECDA 2MGHA 1FHJA 1UT0A 1CG8B 5HU6B 4PQBA 1F5OA 4MQIB 2H8FA 1IWHA 3QM8A 2EVKA 2O5BX 1O1KB 1UVJA 1MLOA 3V2VA 1HBGA 2V8AA 1XZ4A 4A8MP 3AQ7A 3WCUD 4KN3A 1Y7GB 2GRHA 1CG8A 4N7PB 1J7YA 2VJTB 1Y0CA 2C7LB 5HLQA 2H8FB 2FRFA 5FVBM 1NS6B 2WY4A 1HBIA 1YGFB 1R1YB 4DC8A 3ZJRA 2LH2A 1LFZB 3O18A 2VHBA 3VAUA 1MYMA 1BBBB 5EUIB 1XZ7A 1Y4VB 3GOUA 1Y0CB 2C7LA 2D5XA 2V1FA 2JLGA 1XYEB 1HGBA 1KN1A 5HBIA 2JL9A 3WTGA 1RQAB 2QMBA 1F65A 1S0HB 5JGGA 1WMUA 2ZLWB 6HBIA 2SPNA 1YOHA 1QSHA 3NG6A 1HA7B 1H97A 1S56A 1CPCB 1LHTA 5CNCA 1YEQA 3ZJMA 1MLHA 2W6VB 5CHQA 1S5XA 5EU2A 4JYQA 1CMYB 3PI3A 3VREA 3FEWX 1YGDB 3QZXA 1J52A 3ZJNA 2D5ZA 1RVWA 1ASHA 1MLLA 1NZ4A 2R4XA 2ZS1A 3WFXA 1UX9A 1JWNA 2ZLWA 3ZJSA 1GDJA 2BKMA 1EWAA 2O5LX 2HHEA 2UUND 1A3NA 109MA 1LFVA 2XKGA 3UBCA 2ZFOA 3MBAA 5KDQB 2R1HA 4NK2A 1NIHA 1QI8A 1SI4A 1Y35B 1BZ6A 1OR4A 2C7KB 5C6EA 3LB4A 1MOBA 2R80A 2DKCA 1HI0P 1A3NB 2ZLXB 1Y4PB 3D7OB 3UHBA 1Y7DB 1YHUD 4C0NA 1SHRA 4Z8KB 2R1HB 1HSYA 3UHCA 1HCOB 2HBDB 2V1GA 1HHOA 1MBIA 1PMBA 2D2MC 3MJUA 5SW7B 4FH6A 3SDNA 2JLFA 3G52A 3WR1A 2ZLVA 5C6EB 2ZT2A 3GQGB 2O5MX 3GQPA 4M4BB 1OUTB 2GTLC 1V4WA 2AURA 3WHMB 1QSIA 3PELA 2SPLA 1MWBA 3PI8A 2PGHB 1AZIA 1Y09A 108MA 3E5OA 3LQ9A 4WJGA 1TU9A 4MPMA 4N6SB 4H2LA 1Y8WB 4NXCA 1ECAA 1NY9A 1DUKA 1HBSA 1CQXA 3PI2A 3WCTA 3NL7B 4KMWA 3O89A 1RTEA 4MBNA 3ODQA 3D17A 3NFEB 3MKBA 2C7JB 2LH5A 1Y09B 5E6EB 4ERTA 2UULD 2Z8AA 3KVSA 5ILMA 2ZLTB 3OZWA 2MGBA 2D2ND 4H2LB 1VWTA 3AQ9A 3PIAB 4FC3A 1YEVB 3G4RA 3GK9A 3NL7A 4TYXA 2UULA 1FCSA 1HV4A 1XZ2A 4NI1A 5CNDA 1GBVB 1VHBA 1NPFA 2ZLTA 1A9WA 1U7RA 2VJRB 1ITHA 1VWTB 3PIAA 1C40A 2EKUA 4ZIZA 3ARLA 1SWMA 3AQ8A 1HBAA 2ZSRA 2LH7A 1C7CB 1LH5A 3OZVA 4NI1B 3D1KB 2UUMB 1KTPB 2HHDA 1S61A 1FSLA 1V4XA 1YVTA 1SDLB 1JP9A 4A8KA 1RQ3A 3GDJA 4BS9A 4H0MB 1VRFA 2D2NB 4HHBB 1URVA 3HEOA 1HACA 2DHBA 3GLNA 2WCRA 2VMLA 1Y7CA 1MGNA 2Z6NA 5B84A 1Y4BB 3ZOMA 2O5QX 1HGCB 3UBVA 1Y4GA 4MQHB 3UHRA 5AZRA 2AA1B 1SDLA 1Y83B 1J7WA 1IBEB 1XZ4B 4O1TA 1HBBA 1EBTA 2ZFBB 1LTWA 1YOIA 3A59B 1K1KA 1IRDA 2DHBB 1LA6B 2ZS1D 4L7YB 1Y4BA 1YDZB 1G08B 1Y8HB 3IXFA 1CP0A 3ASEA 3LB3A 4HBIA 1MLRA 4OF9A 4F0TA 1YEUA 1MNKA 1LFZA 3QQRA 1UC3A 1DO4A 3O18B 3W4UB 4PO5A 1IRDB 5HY8A 4HRTB 2Z6SA 4MQIA 2MGGA 3HXNA 101MA 2FAMA 1HGBB 1JEBA 2EVPA 1S6AA 3IC0B 2V8AB 3S65A 1S0HA 3EDBA 1YEUB 5F0BA 1V9QA 1A4FA 2ZLUB 1YENA 4B4YA 1BUWB 3UHXA 1J40B 2HZ2A 3KMFC 1O1LB 4PO5B 1YHRB 2W6VA
chains in the Genus database with same CATH topology
5AB8A 4U8UB 1NWNA 3ZH0A 1AJGA 1MYIA 2ZT1A 3VREB 1YIHA 7HBIA 1O1IA 1Y4QA 1NS6A 1SDKB 1A6NA 102MA 2O5OX 4C44A 4FWZA 1LFLA 3UH7A 1TESA 3ECXA 3WCVD 1V75B 1BBBA 5EUIA 3GOUB 2D5XB 5HLXA 3HRWB 4U8UA 2MB5A 2ZFOB 3VRFB 1NIHB 1QI8B 5EOHA 5JOMA 2BMMA 1DUOA 5JGGB 1XZVA 1C7DB 2BK9A 3K8BB 4B3WA 1LFLB 1YFFB 1MYHA 3GQRB 5CNEA 5ILEA 2VEEA 1GCWA 4N8TA 3OZUA 1LH2A 2BNLA 1NGKA 1Y7DA 1YZIB 1HCOA 1ECNA 2D5ZB 1MDNA 2ZT0A 1XQ5A 1OBMA 1C7BA 1BZPA 2H35B 1CH1A 3TM9A 1MBNA 3GQGA 3A5AA 1CH7A 3GQRA 1MLMA 1T1NB 2LHBA 2W72A 1EBCA 1J3ZA 1FLPA 3HHBA 1QSIB 3HF4B 1MCYA 2HCOA 1MOAA 2HHBA 1IRCA 2DN1A 1C7BB 1X9FC 2ZFOD 106MA 2HBSB 1G0AA 2R4YA 4BJAA 1HBSB 3TLDA 1G09B 1T1NA 1HGAA 2W72B 3R5IA 1HRMA 4MQCA 2D2NC 3NFEA 3UH5A 1J7SA 3E55A 2ZS1C 1JF4A 1MLKA 1CP5A 2HBDA 2AV0A 1HHOB 3TM3A 3UHDA 3ZJJA 2AUPA 5SW7A 4FC3B 1YEVA 1HGAB 3HEPA 3NMLA 3OVUC 3R5IB 2O58X 4MQCB 2O5TX 3PI8B 1MLJA 2MGEA 4YU4A 1O1NB 3RJNB 1A3OB 3P5QB 1GLIB 1QXDB 3WI8A 2GTLD 5CN5A 4NI0A 4XS0B 1K0YA 4WJG1 1C40B 5CN6A 1Y8KB 2V1HA 4WCHD 1HBAB 4ROMB 2D2MD 2GRZA 3MKBB 3QMAA 1LH1A 3R0GA 1GLIA 1HJTA 1G9VA 4ROLB 3H57A 2RI4B 1OR6A 1ABWA 3GDJB 1Y8KA 4PQ6A 2HBFB 3S66B 3D4XB 2AUQA 3QZZA 1HV4B 2LH6A 5E83B 1Y5JA 1VXCA 4MQHA 5CHRA 4DWUA 1G9VB 5ILPA 4ESAA 2C0KA 5CN9A 1IBEA 3BCQB 1MTJA 3A59A 1HLMA 1LA6A 1IDRA 5JDOF 2ZSSA 1IWHB 3G53A 1YEOB 4N7NB 4AVEA 1MYGA 1Y46A 1HDAB 1V4XB 4ESAB 1ECOA 2M6ZB 1COHA 3G4UA 2ZSTA 1Y5FA 2GL3A 1BIJA 4XDIA 1A6MA 1A0ZB 1NZ2A 2VLYA 4H07A 1GJNA 1SPGA 1DWRA 1NAZA 1VXFA 4X0LB 2NSSA 1Y4GB 4N7NA 3GKTA 2ZS0C 3PI4A 2BW9M 3IC0A 1Y8IB 2MGLA 2ZSQA 1MLUA 3S65B 1CBMA 1COHB 1UIWB 4F6BA 3M38A 1YENB 2VLZA 1X9FD 1JW8A 1J40A 1FN3B 1XCHA 1H1XA 3ARJA 3ECLA 2MHBA 1SPGB 1YHEB 3D1AA 3LR7A 2XKHA 1DTMA 1MLFA 1XYEA 3M3AA 1Y8IA 3WCWB 1RQAA 1CPWA 1UIWA 1YMBA 2EB9A 3OO5A 4TWUA 1HBHB 112MA 2W31A 1X3KA 1V75A 2MGKA 3CY5B 1UVXA 5HY8B 1S5XB 1M6CA 1YH9A 2MHBB 3ZJHA 1UFPA 2DXMA 1JDOA 1VREA 1MLGA 1JEBB 1J41A 2ZS0B 2QSPB 2MGFA 2ZSOA 1XXTA 3K8BA 3OO5B 1YFFA 1QPWA 3UHKA 3AT5B 2HHEB 1O1LA 2MBWA 3GYSB 3CY5A 4YU3B 4N8TB 2FALA 5ILRA 1Y01B 3G4VA 1WVPA 2DXMB 3IC2A 1O1IB 1Y4QB 1MBAA 1JY7B 1SDKA 2ZS0A 3MN0A 5CN8A 4KMVA 3VRGA 4O4ZA 4NXAA 3S1IA 3AT5A 3BJ3A 2HZ3A 1JP6A 3ED9A 3GYSA 3HHBB 1B0BA 1SHRB 1Y7ZB 2HHBB 1X9FA 3QJDA 3VRFA 1J3FA 2EKTA 1YMAA 1V5HA 3MJUB 3UHIA 3V2ZA 3WR1B 3A9MA 3ORDA 4M4BA 2W72C 3BJ3B 1GCWB 1YE2A 3PELB 1MWDA 1J7SB 1O16A 1VXDA 2V1JA 2HBGA 3G4QA 1Y7ZA 3DHRA 1MYZA 1DWTA 3FS4B 3M3BA 1YE0B 4L2MA 105MA 1LJWB 1JZKA 3SDHA 2SPMA 2G12A 2EF2A 2MYEA 3PI9B 4MAXA 4KJTA 1NWIA 1BJEA 2FRJX 1Y4FA 3D17B 4MQKB 3HF4A 1W92A 1Y5KA 1A6GA 2FRKX 5EE4C 4QAUA 4F6JA 1OJ6A 1CH3A 4MQJB 2VRYA 2RAOA 2OHBA 2Z85A 3UHZA 1G0AB 2ZWJA 1DXUB 4ILZA 2DC3A 2WTGA 4AVDA 4N7OA 1NEJA 1HLBA 3M39A 2XYKA 3HC9A 1BABB 4ROLA 1MBOA 4IT8A 1MNIA 3UHWA 2HBFA 3S66A 1URYA 1DXUA 2QRWA 3ECZA 1MODA 4FH7A 5KERA 1Y0TB 5B85A 1YIEB 3D1KA 3U3EA 1MNOA 2D2MB 1QXDA 4NI0B 3WFUA 2ZSYA 3BCQA 2MGJA 1V07A 2D2NA 2GDMA 6HBWB 1YCAA 5KERB 1OUUB 2MGMA 2HZ1A 3QM9A 1MKOB 1BZZB 1CG5B 1Y46B 1HDAA 111MA 2AA1A 1LH3A 1HBBB 1Y5FB 4JACA 1MYFA 1K1KB 2YRSA 2FRIX 2HBEB 1YCBA 3BA2A 3KUOA 1RQ4A 1FAWB 1YDZA 2ZSNA 1G08A 1Y8HA 4X0LA 2W6YA 1Y4RA 2QU0A 1MKOA 1BZZA 1O1OA 2HBCA 1KD2A 3S1JA 2NSRA 4PNJA 4HRTA 1DLYA 2V1IA 3MYMA 1LH7A 1FAWA 1F63A 1Y0WA 1O1PB 1Y4RB 3WFWA 2B7HB 1O1OB 4MBAA 1CQ2A 3BJ2B 2GNWA 5EYSA 5CN4A 1A4FB 2LH3A 1BUWA 1BIJB 1M9PA 1DTIA 1LFTB 1N9HA 3ONZB 1Y45A 1A0ZA 1YHRA 2DN2A 1Y31B 1JP8A 5CNFA 2NRLA 3QJBB 1O1PA 3AG0A 1YIHB 3BOMB 2B7HA 2BLHA 1J41B 1N9IA 3RJ6A 4H0BA 5CNBA 3PT8A 3NMMB 1I3EA 2VM0A 4MXKA 1MTIA 4VHBA 1YOGA 2DN2B 1YHEA 3D1AB 1NZ5A 3QJBA 4TWVA 4G1BA 3IC2B 1Y0AB 2G14A 1DKEA 2H8DB 3UHHA 1QXEA 4ZVAA 3WCWA 1C7DA 1Z8UB 3PT8B 1CIKA 3ZJOA 2GKNA 3SZKA 1CH2A 3UHYA 1HBHA 2ZS0D 3IA3B 1YH9B 4LPIA 2OH8A 4FWYA 1CO8A 1MLQA 3GKVB 2ZFOC 1Q1FA 2QSPA 3OGBA 1CH4A 2H35A 1Y85A 4HRRA 1MNJA 3SZKB 1JL7A 1QPWB 1ABYB 4F4OA 2GTLA 4YU3A 2G0VA 3GKVA 3WCPA 4MXLA 1PBXB 3DHRB 3FS4A 1LFQB 5C6YA 1JY7A 2LH1A 2W6XA 4G51B 1YE0A 1LUEA 2HBSA 3VRGB 1XY0B 1N9FA 1MLSA 3PI9A 5EE4D 1LHSA 2GTLB 4HSXA 3K3UA 1A6KA 2EB8A 1O1KA 4MQKA 1O1JB 3WCPB 2NRMA 3B75A 1S69A 3MOUA 1GBUA 2XKIA 1AJHA 1VXEA 3OJ1A 1AJ9A 3WFTA 1J7YB 3WCTC 2D60B 2DN3B 1MYJA 4F6DA 3E5IA 1YE2B 1YG5B 1S5YA 1O1NA 1A3OA 3P5QA 1NEJB 3LB1A 3B75B 1ABSA 1BABA 2VLXA 3QM5A 1D8UA 1K0YB 1OFKA 4O2GA 1AJ9B 1GZXA 1XZ7B 1Y4VA 3K9ZA 1V4UA 1MBSA 2D60A 2DN3A 4F6FA 3WTGB 3PT7A 3MVCA 2G0SA 1S5YB 2OLPA 3OK5A 2G10A 1WMUB 3EU1A 1VXBA 1QSHB 4MQJA 1G0BB 2VYYA 4IROB 2RI4A 2OH9A 2VEBA 1EMYA 1ABWB 5KKKA 3KUNA 1GDIA 3HYUB 4F6IA 1J3YB 4DWTA 2PEGA 1CMYA 3ZJLA 2G0RA 1RVWB 1OUUA 3PT7B 1DXTA 1IT3A 3LB2A 2ZS1B 1XZUA 3EU1B 2MYAA 5CMVA 1HBRA 2ZT4A 1NS9B 1VXGA 4O4TA 3DR9A 1DXVA 3CIUA 1KR7A 3UHNA 4NZIA 5E29A 1NQPA 1Y0TA 1CO9A 1DXTB 2IG3A 1XZUB 1YEOA 3QM6A 2D2MA 1O1MA 1HBRB 2MGAA 2M6ZA 3WCUC 1JL6A 3EOKA 1DXVB 3CIUB 1DM1A 1Y4PA 4UURA 2AUOA 2GRFA 2W6WA 3WCWD 5E29B 1XZ5B 1NQPB 3A5BA 3UGYA 3QQQA 4M4AA 1A9WE 1HDSA 5JDOC 4OODA 2ZSXA 1NXFA 3AT6B 1MOCA 1CG5A 2R50A 3LR9A 3A2GA 2Z6TA 3AQ6A 1DO1A 3BJ2A 3FH9B 1FN3A 1A00B 107MA 1LFTA 3WCUB 1JZLA 1GDKA 2V1KA 2HBEA 5HLUA 3WCWC 1VXAA 1FDHA 4MU5A 2MYCA 1RQ4B 3AT6A 1JF3A 1Y8WA 4F69A 2QU0B 1A01A 1A0UA 2HBCB 2R4WA 1CH5A 3NMMA 1CH9A 1BZ1A 1DWSA 1N9XA 3G4YA 3WCUA 5E6EA 1WLAA 3MJPB 4ODCB 4HSWA 3LQDB 3MYNA 2SPOA 3H58A 3UGZA 1A01B 4MQGB 5MBNA 1CBLA 3RGKA 2G11A 3O7NA 1DO3A 1XXTB 4DC7A 1MZ0A 1XZ2B 1BINA 2QLSA 2V1EA 5M3SA 4PQCA 3LQDA 2NX0A 3BOMA 1CIOA 2VYWA 3G46A 1B86B 3QJEB 1Y85B 4HRRB 2OHAA 2QLSB 3OO4A 2E2YA 2HHDB 1OFJA 1EW6A 5F2AA 1YVTB 1X9FB 1PBXA 3QJDB 1RQ3B 1Y0AA 3A5GA 1DKEB 1UX8A 2H8DA 4G51A 5HAVA 1Y7GA 1B86A 4N7PA 4HHBA 1THBB 3WCVB 3A0GA 1Y2ZB 1X46A 1HGCA 3BJ1B 1LH6A 2MYBA 1YVQB 2QFKA 5EETA 3UHEA 1YGFA 1Y83A 4F68A 4ZVBA 1J7WB 3ZJIA 2VYZA 1CLSA 1SPEA 2G0ZA 1LJWA 5HU6A 2ZSZA 1THBA 3WCVA 1Y0DB 4L7YA 1ABYA 4F4OB 2MGIA 1Y4FB 2JHOA 2QMBB 1Y5KB 2CMMA 1MYTA 1CLSB 5JDOD 3NG6B 1LFQA 2BWHA 2RAOB 4G1VA 2QSSB 3W4UA 1BZ0B 1YEQB 1GZXB 3UHUA 1UMOA 1R1XB 1XY0A 3KMFA 3DHTB 1Y0DA 3HXNB 5EV5A 1JPBA 3DUTA 2WTHA 1YGDA 2R4ZA 1O1JA 1GCVB 2AV3A 1R1YA 4N7OB 5JDOE 2ZLUA 5EYJA 1GBUB 4FWXA 2KSCA 1G0BA 4NS2A 2QSSA 1BZ0A 1NPGA 4U8UC 1R1XA 3AQ5A 3DHTA 4F6GA 1MLNA 1J3YA 5EQMA 2PEGB 2ZSPA 5KDQA 3DUTB 3ZJQA 1YG5A 1GCVA 1Y35A 1YIEA 5D1VA 2MYDA 3UHVA 1GVHA 2R80B 3ZJPA 1MWCA 2G0XA 2OIFA 2ZLXA 3D7OA 1V4UB 3HRWA 2D6CA 1MBCA 2MGCA 6HBWA 3UH6A 4UIQA 2ZT3A 3ZOLA 2GKMA 1XZVB 1Y22B 3HENA 1BZRA 4IROA 1YHUB 3UHGA 110MA 1V4WB 3S48C 3HYUA 3E4NA 1LFVB 4U8UD 2GLNA 2YRSB 1YZIA 1SI4B 4M4AB 5D5RA 1YHUC 4SDHA 103MA 1RPSA 1XQ5B 1Y22A 1FDHG 2MGDA 4NK1A 1HDBA 3WCTB 1YHUA 1KD2B 1NS9A 4GZGA 1HABB 1M6MA 1J3ZB 3ODQB 1IOPA 4UZVA 1A00A 2BLIA 3VHBA 3UI0A 2HCOB 1BVDA 1MBDA 2DN1B 1YMCA 1RPSB 1Y0WB 1VXHA 2G3HA 2ZLVB 1O1MB 1HDBB 5CNGA 3GQPB 1G09A 1HABA 1OUTA 3EOKB 3WHMA 2IN4A 1M9PB 3QM7A 1L2KA 1RTXA 3ONZA 2PGHA 104MA 1Y45B 4O35A 1XZ5A 1GBVA 3LHBA 3MJPA 1Y31A 1HDSB 3UH3A 4MQGA 1NZ3A 3UHSA 1UFJA 1U7SA 3ZHWA 3WCVC 1DXDA 3WCTD 3FH9A 1C7CA 1GDLA 1KFRA 1UVYA 4YU4B 5AZQA 1LFYA 3G4WA 5MBAA 4XS0A 2QFNA 1A0UB 1MOHA 3PI1A 1QXEB 2O5SX 3EDAA 3QJEA 3QJCB 1HACB 1DO7A 4ROMA 1BZ1B 1Y7CB 2Z6NB 1FSXB 2BLJM 3OO4B 1LFYB 3UHTA 4ODCA 3ARKA 1MTKA 1RSEA 3UHQA 2ZFBA 1DXCA 1F5PA 1FHJB 5CN7A 5IKSA 3D4XA 3QJCA 3A0GB 1DLWA 1Y2ZA 5E83A 1FSXA 1Y5JB 3BJ1A 2GNVA 1IT2A 1YVQA 1MNHA 1I3DA 1JZMA 1BVCA 1ECDA 2MGHA 1FHJA 1UT0A 1CG8B 5HU6B 4PQBA 1F5OA 4MQIB 2H8FA 1IWHA 3QM8A 2EVKA 2O5BX 1O1KB 1MLOA 3V2VA 1HBGA 1XZ4A 3AQ7A 3WCUD 4KN3A 1Y7GB 2GRHA 1CG8A 4N7PB 1J7YA 1Y0CA 5HLQA 2H8FB 2FRFA 1NS6B 2WY4A 1HBIA 1YGFB 1R1YB 4DC8A 3ZJRA 2LH2A 1LFZB 2VHBA 3VAUA 1MYMA 1BBBB 5EUIB 1XZ7A 1Y4VB 3GOUA 1Y0CB 2D5XA 2V1FA 1XYEB 1HGBA 5HBIA 3WTGA 1RQAB 2QMBA 1F65A 1S0HB 5JGGA 1WMUA 2ZLWB 6HBIA 2SPNA 1YOHA 1QSHA 3NG6A 1H97A 1S56A 1LHTA 5CNCA 1YEQA 3ZJMA 1MLHA 2W6VB 5CHQA 1S5XA 5EU2A 4JYQA 1CMYB 3PI3A 3VREA 1YGDB 3QZXA 1J52A 3ZJNA 2D5ZA 1RVWA 1ASHA 1MLLA 1NZ4A 2R4XA 2ZS1A 3WFXA 1UX9A 1JWNA 2ZLWA 3ZJSA 1GDJA 2BKMA 1EWAA 2O5LX 2HHEA 1A3NA 109MA 1LFVA 2XKGA 3UBCA 2ZFOA 3MBAA 5KDQB 2R1HA 4NK2A 1NIHA 1QI8A 1SI4A 1Y35B 1BZ6A 5C6EA 1OR4A 3LB4A 1MOBA 2R80A 1A3NB 2ZLXB 1Y4PB 3D7OB 3UHBA 1Y7DB 1YHUD 4C0NA 1SHRA 2R1HB 1HSYA 3UHCA 1HCOB 2HBDB 2V1GA 1HHOA 1MBIA 1PMBA 2D2MC 3MJUA 5SW7B 4FH6A 3SDNA 3G52A 3WR1A 2ZLVA 5C6EB 2ZT2A 3GQGB 2O5MX 3GQPA 4M4BB 1OUTB 2GTLC 1V4WA 2AURA 3WHMB 1QSIA 3PELA 2SPLA 1MWBA 3PI8A 2PGHB 1AZIA 1Y09A 108MA 3E5OA 4WJGA 1TU9A 4MPMA 4H2LA 1Y8WB 4NXCA 1ECAA 1DUKA 1HBSA 1CQXA 3PI2A 3WCTA 3NL7B 4KMWA 3O89A 1RTEA 4MBNA 3ODQA 3D17A 3NFEB 3MKBA 2LH5A 1Y09B 5E6EB 2Z8AA 5ILMA 2ZLTB 3OZWA 2MGBA 2D2ND 4H2LB 1VWTA 3AQ9A 3PIAB 4FC3A 1YEVB 3G4RA 3GK9A 3NL7A 4TYXA 1FCSA 1HV4A 1XZ2A 4NI1A 5CNDA 1GBVB 1VHBA 1NPFA 2ZLTA 1A9WA 1U7RA 1ITHA 1VWTB 3PIAA 1C40A 2EKUA 3ARLA 1SWMA 3AQ8A 1HBAA 2ZSRA 2LH7A 1C7CB 1LH5A 3OZVA 4NI1B 3D1KB 2HHDA 1S61A 1FSLA 1V4XA 1YVTA 1SDLB 1JP9A 1RQ3A 3GDJA 1VRFA 2D2NB 4HHBB 1URVA 3HEOA 1HACA 2DHBA 3GLNA 1Y7CA 1MGNA 2Z6NA 5B84A 1Y4BB 3ZOMA 2O5QX 1HGCB 3UBVA 1Y4GA 4MQHB 3UHRA 5AZRA 2AA1B 1SDLA 1Y83B 1J7WA 1IBEB 1XZ4B 4O1TA 1HBBA 1EBTA 2ZFBB 1LTWA 1YOIA 3A59B 1K1KA 1IRDA 2DHBB 1LA6B 2ZS1D 4L7YB 1Y4BA 1YDZB 1G08B 1Y8HB 3IXFA 1CP0A 3ASEA 3LB3A 4HBIA 1MLRA 4OF9A 1YEUA 1MNKA 1LFZA 3QQRA 1UC3A 1DO4A 3W4UB 1IRDB 5HY8A 4HRTB 2Z6SA 4MQIA 2MGGA 3HXNA 101MA 2FAMA 1HGBB 1JEBA 2EVPA 1S6AA 3IC0B 3S65A 1S0HA 3EDBA 1YEUB 5F0BA 1V9QA 1A4FA 2ZLUB 1YENA 4B4YA 1BUWB 3UHXA 1J40B 2HZ2A 3KMFC 1O1LB 1YHRB 2W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AB8 A;  4U8U B;  1NWN A;  3ZH0 A;  1AJG A;  1MYI A;  2ZT1 A;  3VRE B;  1YIH A;  7HBI A;  1O1I A;  1Y4Q A;  1NS6 A;  1SDK B;  1A6N A;  102M A;  2O5O X;  4C44 A;  4FWZ A;  1LFL A;  3UH7 A;  1TES A;  3ECX A;  3WCV D;  1V75 B;  1BBB A;  5EUI A;  3GOU B;  2D5X B;  5HLX A;  3HRW B;  4U8U A;  2MB5 A;  2ZFO B;  3VRF B;  1NIH B;  1QI8 B;  5EOH A;  5JOM A;  2BMM A;  1DUO A;  5JGG B;  1XZV A;  1C7D B;  2BK9 A;  3K8B B;  4B3W A;  1LFL B;  1YFF B;  1MYH A;  3GQR B;  5CNE A;  5ILE A;  2VEE A;  1GCW A;  4N8T A;  3OZU A;  1LH2 A;  2BNL A;  1NGK A;  1Y7D A;  1YZI B;  1HCO A;  1ECN A;  2D5Z B;  1MDN A;  2ZT0 A;  1XQ5 A;  1OBM A;  1C7B A;  1BZP A;  2H35 B;  1CH1 A;  3TM9 A;  1MBN A;  3GQG A;  3A5A A;  1CH7 A;  3GQR A;  1MLM A;  1T1N B;  2LHB A;  2W72 A;  1EBC A;  1J3Z A;  1FLP A;  3HHB A;  1QSI B;  3HF4 B;  1MCY A;  2HCO A;  1MOA A;  2HHB A;  1IRC A;  2DN1 A;  1C7B B;  1X9F C;  2ZFO D;  106M A;  2HBS B;  1G0A A;  2R4Y A;  4BJA A;  1HBS B;  3TLD A;  1G09 B;  1T1N A;  1HGA A;  2W72 B;  3R5I A;  1HRM A;  4MQC A;  2D2N C;  3NFE A;  3UH5 A;  1J7S A;  3E55 A;  2ZS1 C;  1JF4 A;  1MLK A;  1CP5 A;  2HBD A;  2AV0 A;  1HHO B;  3TM3 A;  3UHD A;  3ZJJ A;  2AUP A;  5SW7 A;  4FC3 B;  1YEV A;  1HGA B;  3HEP A;  3NML A;  3OVU C;  3R5I B;  2O58 X;  4MQC B;  2O5T X;  3PI8 B;  1MLJ A;  2MGE A;  4YU4 A;  1O1N B;  3RJN B;  1A3O B;  3P5Q B;  1GLI B;  1QXD B;  3WI8 A;  2GTL D;  5CN5 A;  4NI0 A;  4XS0 B;  1K0Y A;  4WJG 1;  1C40 B;  5CN6 A;  1Y8K B;  2V1H A;  4WCH D;  1HBA B;  4ROM B;  2D2M D;  2GRZ A;  3MKB B;  3QMA A;  1LH1 A;  3R0G A;  1GLI A;  1HJT A;  1G9V A;  4ROL B;  3H57 A;  2RI4 B;  1OR6 A;  1ABW A;  3GDJ B;  1Y8K A;  4PQ6 A;  2HBF B;  3S66 B;  3D4X B;  2AUQ A;  3QZZ A;  1HV4 B;  2LH6 A;  5E83 B;  1Y5J A;  1VXC A;  4MQH A;  5CHR A;  4DWU A;  1G9V B;  5ILP A;  4ESA A;  2C0K A;  5CN9 A;  1IBE A;  3BCQ B;  1MTJ A;  3A59 A;  1HLM A;  1LA6 A;  1IDR A;  5JDO F;  2ZSS A;  1IWH B;  3G53 A;  1YEO B;  4N7N B;  4AVE A;  1MYG A;  1Y46 A;  1HDA B;  1V4X B;  4ESA B;  1ECO A;  2M6Z B;  1COH A;  3G4U A;  2ZST A;  1Y5F A;  2GL3 A;  1BIJ A;  4XDI A;  1A6M A;  1A0Z B;  1NZ2 A;  2VLY A;  4H07 A;  1GJN A;  1SPG A;  1DWR A;  1NAZ A;  1VXF A;  4X0L B;  2NSS A;  1Y4G B;  4N7N A;  3GKT A;  2ZS0 C;  3PI4 A;  2BW9 M;  3IC0 A;  1Y8I B;  2MGL A;  2ZSQ A;  1MLU A;  3S65 B;  1CBM A;  1COH B;  1UIW B;  4F6B A;  3M38 A;  1YEN B;  2VLZ A;  1X9F D;  1JW8 A;  1J40 A;  1FN3 B;  1XCH A;  1H1X A;  3ARJ A;  3ECL A;  2MHB A;  1SPG B;  1YHE B;  3D1A A;  3LR7 A;  2XKH A;  1DTM A;  1MLF A;  1XYE A;  3M3A A;  1Y8I A;  3WCW B;  1RQA A;  1CPW A;  1UIW A;  1YMB A;  2EB9 A;  3OO5 A;  4TWU A;  1HBH B;  112M A;  2W31 A;  1X3K A;  1V75 A;  2MGK A;  3CY5 B;  1UVX A;  5HY8 B;  1S5X B;  1M6C A;  1YH9 A;  2MHB B;  3ZJH A;  1UFP A;  2DXM A;  1JDO A;  1VRE A;  1MLG A;  1JEB B;  1J41 A;  2ZS0 B;  2QSP B;  2MGF A;  2ZSO A;  1XXT A;  3K8B A;  3OO5 B;  1YFF A;  1QPW A;  3UHK A;  3AT5 B;  2HHE B;  1O1L A;  2MBW A;  3GYS B;  3CY5 A;  4YU3 B;  4N8T B;  2FAL A;  5ILR A;  1Y01 B;  3G4V A;  1WVP A;  2DXM B;  3IC2 A;  1O1I B;  1Y4Q B;  1MBA A;  1JY7 B;  1SDK A;  2ZS0 A;  3MN0 A;  5CN8 A;  4KMV A;  3VRG A;  4O4Z A;  4NXA A;  3S1I A;  3AT5 A;  3BJ3 A;  2HZ3 A;  1JP6 A;  3ED9 A;  3GYS A;  3HHB B;  1B0B A;  1SHR B;  1Y7Z B;  2HHB B;  1X9F A;  3QJD A;  3VRF A;  1J3F A;  2EKT A;  1YMA A;  1V5H A;  3MJU B;  3UHI A;  3V2Z A;  3WR1 B;  3A9M A;  3ORD A;  4M4B A;  2W72 C;  3BJ3 B;  1GCW B;  1YE2 A;  3PEL B;  1MWD A;  1J7S B;  1O16 A;  1VXD A;  2V1J A;  2HBG A;  3G4Q A;  1Y7Z A;  3DHR A;  1MYZ A;  1DWT A;  3FS4 B;  3M3B A;  1YE0 B;  4L2M A;  105M A;  1LJW B;  1JZK A;  3SDH A;  2SPM A;  2G12 A;  2EF2 A;  2MYE A;  3PI9 B;  4MAX A;  4KJT A;  1NWI A;  1BJE A;  2FRJ X;  1Y4F A;  3D17 B;  4MQK B;  3HF4 A;  1W92 A;  1Y5K A;  1A6G A;  2FRK X;  5EE4 C;  4QAU A;  4F6J A;  1OJ6 A;  1CH3 A;  4MQJ B;  2VRY A;  2RAO A;  2OHB A;  2Z85 A;  3UHZ A;  1G0A B;  2ZWJ A;  1DXU B;  4ILZ A;  2DC3 A;  2WTG A;  4AVD A;  4N7O A;  1NEJ A;  1HLB A;  3M39 A;  2XYK A;  3HC9 A;  1BAB B;  4ROL A;  1MBO A;  4IT8 A;  1MNI A;  3UHW A;  2HBF A;  3S66 A;  1URY A;  1DXU A;  2QRW A;  3ECZ A;  1MOD A;  4FH7 A;  5KER A;  1Y0T B;  5B85 A;  1YIE B;  3D1K A;  3U3E A;  1MNO A;  2D2M B;  1QXD A;  4NI0 B;  3WFU A;  2ZSY A;  3BCQ A;  2MGJ A;  1V07 A;  2D2N A;  2GDM A;  6HBW B;  1YCA A;  5KER B;  1OUU B;  2MGM A;  2HZ1 A;  3QM9 A;  1MKO B;  1BZZ B;  1CG5 B;  1Y46 B;  1HDA A;  111M A;  2AA1 A;  1LH3 A;  1HBB B;  1Y5F B;  4JAC A;  1MYF A;  1K1K B;  2YRS A;  2FRI X;  2HBE B;  1YCB A;  3BA2 A;  3KUO A;  1RQ4 A;  1FAW B;  1YDZ A;  2ZSN A;  1G08 A;  1Y8H A;  4X0L A;  2W6Y A;  1Y4R A;  2QU0 A;  1MKO A;  1BZZ A;  1O1O A;  2HBC A;  1KD2 A;  3S1J A;  2NSR A;  4PNJ A;  4HRT A;  1DLY A;  2V1I A;  3MYM A;  1LH7 A;  1FAW A;  1F63 A;  1Y0W A;  1O1P B;  1Y4R B;  3WFW A;  2B7H B;  1O1O B;  4MBA A;  1CQ2 A;  3BJ2 B;  2GNW A;  5EYS A;  5CN4 A;  1A4F B;  2LH3 A;  1BUW A;  1BIJ B;  1M9P A;  1DTI A;  1LFT B;  1N9H A;  3ONZ B;  1Y45 A;  1A0Z A;  1YHR A;  2DN2 A;  1Y31 B;  1JP8 A;  5CNF A;  2NRL A;  3QJB B;  1O1P A;  3AG0 A;  1YIH B;  3BOM B;  2B7H A;  2BLH A;  1J41 B;  1N9I A;  3RJ6 A;  4H0B A;  5CNB A;  3PT8 A;  3NMM B;  1I3E A;  2VM0 A;  4MXK A;  1MTI A;  4VHB A;  1YOG A;  2DN2 B;  1YHE A;  3D1A B;  1NZ5 A;  3QJB A;  4TWV A;  4G1B A;  3IC2 B;  1Y0A B;  2G14 A;  1DKE A;  2H8D B;  3UHH A;  1QXE A;  4ZVA A;  3WCW A;  1C7D A;  1Z8U B;  3PT8 B;  1CIK A;  3ZJO A;  2GKN A;  3SZK A;  1CH2 A;  3UHY A;  1HBH A;  2ZS0 D;  3IA3 B;  1YH9 B;  4LPI A;  2OH8 A;  4FWY A;  1CO8 A;  1MLQ A;  3GKV B;  2ZFO C;  1Q1F A;  2QSP A;  3OGB A;  1CH4 A;  2H35 A;  1Y85 A;  4HRR A;  1MNJ A;  3SZK B;  1JL7 A;  1QPW B;  1ABY B;  4F4O A;  2GTL A;  4YU3 A;  2G0V A;  3GKV A;  3WCP A;  4MXL A;  1PBX B;  3DHR B;  3FS4 A;  1LFQ B;  5C6Y A;  1JY7 A;  2LH1 A;  2W6X A;  4G51 B;  1YE0 A;  1LUE A;  2HBS A;  3VRG B;  1XY0 B;  1N9F A;  1MLS A;  3PI9 A;  5EE4 D;  1LHS A;  2GTL B;  4HSX A;  3K3U A;  1A6K A;  2EB8 A;  1O1K A;  4MQK A;  1O1J B;  3WCP B;  2NRM A;  3B75 A;  1S69 A;  3MOU A;  1GBU A;  2XKI A;  1AJH A;  1VXE A;  3OJ1 A;  1AJ9 A;  3WFT A;  1J7Y B;  3WCT C;  2D60 B;  2DN3 B;  1MYJ A;  4F6D A;  3E5I A;  1YE2 B;  1YG5 B;  1S5Y A;  1O1N A;  1A3O A;  3P5Q A;  1NEJ B;  3LB1 A;  3B75 B;  1ABS A;  1BAB A;  2VLX A;  3QM5 A;  1D8U A;  1K0Y B;  1OFK A;  4O2G A;  1AJ9 B;  1GZX A;  1XZ7 B;  1Y4V A;  3K9Z A;  1V4U A;  1MBS A;  2D60 A;  2DN3 A;  4F6F A;  3WTG B;  3PT7 A;  3MVC A;  2G0S A;  1S5Y B;  2OLP A;  3OK5 A;  2G10 A;  1WMU B;  3EU1 A;  1VXB A;  1QSH B;  4MQJ A;  1G0B B;  2VYY A;  4IRO B;  2RI4 A;  2OH9 A;  2VEB A;  1EMY A;  1ABW B;  5KKK A;  3KUN A;  1GDI A;  3HYU B;  4F6I A;  1J3Y B;  4DWT A;  2PEG A;  1CMY A;  3ZJL A;  2G0R A;  1RVW B;  1OUU A;  3PT7 B;  1DXT A;  1IT3 A;  3LB2 A;  2ZS1 B;  1XZU A;  3EU1 B;  2MYA A;  5CMV A;  1HBR A;  2ZT4 A;  1NS9 B;  1VXG A;  4O4T A;  3DR9 A;  1DXV A;  3CIU A;  1KR7 A;  3UHN A;  4NZI A;  5E29 A;  1NQP A;  1Y0T A;  1CO9 A;  1DXT B;  2IG3 A;  1XZU B;  1YEO A;  3QM6 A;  2D2M A;  1O1M A;  1HBR B;  2MGA A;  2M6Z A;  3WCU C;  1JL6 A;  3EOK A;  1DXV B;  3CIU B;  1DM1 A;  1Y4P A;  4UUR A;  2AUO A;  2GRF A;  2W6W A;  3WCW D;  5E29 B;  1XZ5 B;  1NQP B;  3A5B A;  3UGY A;  3QQQ A;  4M4A A;  1A9W E;  1HDS A;  5JDO C;  4OOD A;  2ZSX A;  1NXF A;  3AT6 B;  1MOC A;  1CG5 A;  2R50 A;  3LR9 A;  3A2G A;  2Z6T A;  3AQ6 A;  1DO1 A;  3BJ2 A;  3FH9 B;  1FN3 A;  1A00 B;  107M A;  1LFT A;  3WCU B;  1JZL A;  1GDK A;  2V1K A;  2HBE A;  5HLU A;  3WCW C;  1VXA A;  1FDH A;  4MU5 A;  2MYC A;  1RQ4 B;  3AT6 A;  1JF3 A;  1Y8W A;  4F69 A;  2QU0 B;  1A01 A;  1A0U A;  2HBC B;  2R4W A;  1CH5 A;  3NMM A;  1CH9 A;  1BZ1 A;  1DWS A;  1N9X A;  3G4Y A;  3WCU A;  5E6E A;  1WLA A;  3MJP B;  4ODC B;  4HSW A;  3LQD B;  3MYN A;  2SPO A;  3H58 A;  3UGZ A;  1A01 B;  4MQG B;  5MBN A;  1CBL A;  3RGK A;  2G11 A;  3O7N A;  1DO3 A;  1XXT B;  4DC7 A;  1MZ0 A;  1XZ2 B;  1BIN A;  2QLS A;  2V1E A;  5M3S A;  4PQC A;  3LQD A;  2NX0 A;  3BOM A;  1CIO A;  2VYW A;  3G46 A;  1B86 B;  3QJE B;  1Y85 B;  4HRR B;  2OHA A;  2QLS B;  3OO4 A;  2E2Y A;  2HHD B;  1OFJ A;  1EW6 A;  5F2A A;  1YVT B;  1X9F B;  1PBX A;  3QJD B;  1RQ3 B;  1Y0A A;  3A5G A;  1DKE B;  1UX8 A;  2H8D A;  4G51 A;  5HAV A;  1Y7G A;  1B86 A;  4N7P A;  4HHB A;  1THB B;  3WCV B;  3A0G A;  1Y2Z B;  1X46 A;  1HGC A;  3BJ1 B;  1LH6 A;  2MYB A;  1YVQ B;  2QFK A;  5EET A;  3UHE A;  1YGF A;  1Y83 A;  4F68 A;  4ZVB A;  1J7W B;  3ZJI A;  2VYZ A;  1CLS A;  1SPE A;  2G0Z A;  1LJW A;  5HU6 A;  2ZSZ A;  1THB A;  3WCV A;  1Y0D B;  4L7Y A;  1ABY A;  4F4O B;  2MGI A;  1Y4F B;  2JHO A;  2QMB B;  1Y5K B;  2CMM A;  1MYT A;  1CLS B;  5JDO D;  3NG6 B;  1LFQ A;  2BWH A;  2RAO B;  4G1V A;  2QSS B;  3W4U A;  1BZ0 B;  1YEQ B;  1GZX B;  3UHU A;  1UMO A;  1R1X B;  1XY0 A;  3KMF A;  3DHT B;  1Y0D A;  3HXN B;  5EV5 A;  1JPB A;  3DUT A;  2WTH A;  1YGD A;  2R4Z A;  1O1J A;  1GCV B;  2AV3 A;  1R1Y A;  4N7O B;  5JDO E;  2ZLU A;  5EYJ A;  1GBU B;  4FWX A;  2KSC A;  1G0B A;  4NS2 A;  2QSS A;  1BZ0 A;  1NPG A;  4U8U C;  1R1X A;  3AQ5 A;  3DHT A;  4F6G A;  1MLN A;  1J3Y A;  5EQM A;  2PEG B;  2ZSP A;  5KDQ A;  3DUT B;  3ZJQ A;  1YG5 A;  1GCV A;  1Y35 A;  1YIE A;  5D1V A;  2MYD A;  3UHV A;  1GVH A;  2R80 B;  3ZJP A;  1MWC A;  2G0X A;  2OIF A;  2ZLX A;  3D7O A;  1V4U B;  3HRW A;  2D6C A;  1MBC A;  2MGC A;  6HBW A;  3UH6 A;  4UIQ A;  2ZT3 A;  3ZOL A;  2GKM A;  1XZV B;  1Y22 B;  3HEN A;  1BZR A;  4IRO A;  1YHU B;  3UHG A;  110M A;  1V4W B;  3S48 C;  3HYU A;  3E4N A;  1LFV B;  4U8U D;  2GLN A;  2YRS B;  1YZI A;  1SI4 B;  4M4A B;  5D5R A;  1YHU C;  4SDH A;  103M A;  1RPS A;  1XQ5 B;  1Y22 A;  1FDH G;  2MGD A;  4NK1 A;  1HDB A;  3WCT B;  1YHU A;  1KD2 B;  1NS9 A;  4GZG A;  1HAB B;  1M6M A;  1J3Z B;  3ODQ B;  1IOP A;  4UZV A;  1A00 A;  2BLI A;  3VHB A;  3UI0 A;  2HCO B;  1BVD A;  1MBD A;  2DN1 B;  1YMC A;  1RPS B;  1Y0W B;  1VXH A;  2G3H A;  2ZLV B;  1O1M B;  1HDB B;  5CNG A;  3GQP B;  1G09 A;  1HAB A;  1OUT A;  3EOK B;  3WHM A;  2IN4 A;  1M9P B;  3QM7 A;  1L2K A;  1RTX A;  3ONZ A;  2PGH A;  104M A;  1Y45 B;  4O35 A;  1XZ5 A;  1GBV A;  3LHB A;  3MJP A;  1Y31 A;  1HDS B;  3UH3 A;  4MQG A;  1NZ3 A;  3UHS A;  1UFJ A;  1U7S A;  3ZHW A;  3WCV C;  1DXD A;  3WCT D;  3FH9 A;  1C7C A;  1GDL A;  1KFR A;  1UVY A;  4YU4 B;  5AZQ A;  1LFY A;  3G4W A;  5MBA A;  4XS0 A;  2QFN A;  1A0U B;  1MOH A;  3PI1 A;  1QXE B;  2O5S X;  3EDA A;  3QJE A;  3QJC B;  1HAC B;  1DO7 A;  4ROM A;  1BZ1 B;  1Y7C B;  2Z6N B;  1FSX B;  2BLJ M;  3OO4 B;  1LFY B;  3UHT A;  4ODC A;  3ARK A;  1MTK A;  1RSE A;  3UHQ A;  2ZFB A;  1DXC A;  1F5P A;  1FHJ B;  5CN7 A;  5IKS A;  3D4X A;  3QJC A;  3A0G B;  1DLW A;  1Y2Z A;  5E83 A;  1FSX A;  1Y5J B;  3BJ1 A;  2GNV A;  1IT2 A;  1YVQ A;  1MNH A;  1I3D A;  1JZM A;  1BVC A;  1ECD A;  2MGH A;  1FHJ A;  1UT0 A;  1CG8 B;  5HU6 B;  4PQB A;  1F5O A;  4MQI B;  2H8F A;  1IWH A;  3QM8 A;  2EVK A;  2O5B X;  1O1K B;  1MLO A;  3V2V A;  1HBG A;  1XZ4 A;  3AQ7 A;  3WCU D;  4KN3 A;  1Y7G B;  2GRH A;  1CG8 A;  4N7P B;  1J7Y A;  1Y0C A;  5HLQ A;  2H8F B;  2FRF A;  1NS6 B;  2WY4 A;  1HBI A;  1YGF B;  1R1Y B;  4DC8 A;  3ZJR A;  2LH2 A;  1LFZ B;  2VHB A;  3VAU A;  1MYM A;  1BBB B;  5EUI B;  1XZ7 A;  1Y4V B;  3GOU A;  1Y0C B;  2D5X A;  2V1F A;  1XYE B;  1HGB A;  5HBI A;  3WTG A;  1RQA B;  2QMB A;  1F65 A;  1S0H B;  5JGG A;  1WMU A;  2ZLW B;  6HBI A;  2SPN A;  1YOH A;  1QSH A;  3NG6 A;  1H97 A;  1S56 A;  1LHT A;  5CNC A;  1YEQ A;  3ZJM A;  1MLH A;  2W6V B;  5CHQ A;  1S5X A;  5EU2 A;  4JYQ A;  1CMY B;  3PI3 A;  3VRE A;  1YGD B;  3QZX A;  1J52 A;  3ZJN A;  2D5Z A;  1RVW A;  1ASH A;  1MLL A;  1NZ4 A;  2R4X A;  2ZS1 A;  3WFX A;  1UX9 A;  1JWN A;  2ZLW A;  3ZJS A;  1GDJ A;  2BKM A;  1EWA A;  2O5L X;  2HHE A;  1A3N A;  109M A;  1LFV A;  2XKG A;  3UBC A;  2ZFO A;  3MBA A;  5KDQ B;  2R1H A;  4NK2 A;  1NIH A;  1QI8 A;  1SI4 A;  1Y35 B;  1BZ6 A;  5C6E A;  1OR4 A;  3LB4 A;  1MOB A;  2R80 A;  1A3N B;  2ZLX B;  1Y4P B;  3D7O B;  3UHB A;  1Y7D B;  1YHU D;  4C0N A;  1SHR A;  2R1H B;  1HSY A;  3UHC A;  1HCO B;  2HBD B;  2V1G A;  1HHO A;  1MBI A;  1PMB A;  2D2M C;  3MJU A;  5SW7 B;  4FH6 A;  3SDN A;  3G52 A;  3WR1 A;  2ZLV A;  5C6E B;  2ZT2 A;  3GQG B;  2O5M X;  3GQP A;  4M4B B;  1OUT B;  2GTL C;  1V4W A;  2AUR A;  3WHM B;  1QSI A;  3PEL A;  2SPL A;  1MWB A;  3PI8 A;  2PGH B;  1AZI A;  1Y09 A;  108M A;  3E5O A;  4WJG A;  1TU9 A;  4MPM A;  4H2L A;  1Y8W B;  4NXC A;  1ECA A;  1DUK A;  1HBS A;  1CQX A;  3PI2 A;  3WCT A;  3NL7 B;  4KMW A;  3O89 A;  1RTE A;  4MBN A;  3ODQ A;  3D17 A;  3NFE B;  3MKB A;  2LH5 A;  1Y09 B;  5E6E B;  2Z8A A;  5ILM A;  2ZLT B;  3OZW A;  2MGB A;  2D2N D;  4H2L B;  1VWT A;  3AQ9 A;  3PIA B;  4FC3 A;  1YEV B;  3G4R A;  3GK9 A;  3NL7 A;  4TYX A;  1FCS A;  1HV4 A;  1XZ2 A;  4NI1 A;  5CND A;  1GBV B;  1VHB A;  1NPF A;  2ZLT A;  1A9W A;  1U7R A;  1ITH A;  1VWT B;  3PIA A;  1C40 A;  2EKU A;  3ARL A;  1SWM A;  3AQ8 A;  1HBA A;  2ZSR A;  2LH7 A;  1C7C B;  1LH5 A;  3OZV A;  4NI1 B;  3D1K B;  2HHD A;  1S61 A;  1FSL A;  1V4X A;  1YVT A;  1SDL B;  1JP9 A;  1RQ3 A;  3GDJ A;  1VRF A;  2D2N B;  4HHB B;  1URV A;  3HEO A;  1HAC A;  2DHB A;  3GLN A;  1Y7C A;  1MGN A;  2Z6N A;  5B84 A;  1Y4B B;  3ZOM A;  2O5Q X;  1HGC B;  3UBV A;  1Y4G A;  4MQH B;  3UHR A;  5AZR A;  2AA1 B;  1SDL A;  1Y83 B;  1J7W A;  1IBE B;  1XZ4 B;  4O1T A;  1HBB A;  1EBT A;  2ZFB B;  1LTW A;  1YOI A;  3A59 B;  1K1K A;  1IRD A;  2DHB B;  1LA6 B;  2ZS1 D;  4L7Y B;  1Y4B A;  1YDZ B;  1G08 B;  1Y8H B;  3IXF A;  1CP0 A;  3ASE A;  3LB3 A;  4HBI A;  1MLR A;  4OF9 A;  1YEU A;  1MNK A;  1LFZ A;  3QQR A;  1UC3 A;  1DO4 A;  3W4U B;  1IRD B;  5HY8 A;  4HRT B;  2Z6S A;  4MQI A;  2MGG A;  3HXN A;  101M A;  2FAM A;  1HGB B;  1JEB A;  2EVP A;  1S6A A;  3IC0 B;  3S65 A;  1S0H A;  3EDB A;  1YEU B;  5F0B A;  1V9Q A;  1A4F A;  2ZLU B;  1YEN A;  4B4Y A;  1BUW B;  3UHX A;  1J40 B;  2HZ2 A;  3KMF C;  1O1L B;  1YHR B;  2W6V A; 
#chains in the Genus database with same CATH topology
 5AB8 A;  2BV8 A;  4U8U B;  1NWN A;  3ZH0 A;  1AJG A;  1MYI A;  2ZT1 A;  3VRE B;  1YIH A;  7HBI A;  1O1I A;  1Y4Q A;  4F0U A;  1NS6 A;  4A8O A;  3L0F B;  1SDK B;  1A6N A;  102M A;  2O5O X;  4C44 A;  4A8Q A;  4FWZ A;  1LFL A;  3UH7 A;  1TES A;  3ECX A;  3WCV D;  1V75 B;  1BBB A;  5EUI A;  3GOU B;  2D5X B;  5HLX A;  3HRW B;  4U8U A;  2MB5 A;  2ZFO B;  3VRF B;  1NIH B;  1QI8 B;  1B8D B;  1KN1 B;  5EOH A;  5JOM A;  2BMM A;  1DUO A;  5JGG B;  1XZV A;  1C7D B;  2BK9 A;  3K8B B;  4B3W A;  1LFL B;  1YFF B;  1MYH A;  5AQD M;  3GQR B;  1CII A;  5CNE A;  5ILE A;  2VEE A;  1GCW A;  4N8T A;  3OZU A;  1LH2 A;  2BNL A;  5AQD A;  1NGK A;  1Y7D A;  2UUN B;  1YZI B;  1HCO A;  1ECN A;  2D5Z B;  1MDN A;  4AE1 A;  2ZT0 A;  1XQ5 A;  1OBM A;  1C7B A;  1BZP A;  2H35 B;  1CH1 A;  3TM9 A;  1MBN A;  3GQG A;  3A5A A;  1CH7 A;  3GQR A;  1MLM A;  1T1N B;  3V57 B;  2LHB A;  2W72 A;  1EBC A;  1J3Z A;  1FLP A;  3HHB A;  1QSI B;  3HF4 B;  1MCY A;  2HCO A;  1MOA A;  2HHB A;  1IRC A;  1HI8 A;  2DN1 A;  1C7B B;  1X9F C;  2ZFO D;  106M A;  2HBS B;  1G0A A;  2R4Y A;  4BJA A;  1HBS B;  3TLD A;  1G09 B;  3PMD A;  1T1N A;  1HGA A;  3V57 A;  2W72 B;  3R5I A;  1HRM A;  4MQC A;  2D2N C;  4RMP B;  3NFE A;  3UH5 A;  1J7S A;  3E55 A;  2ZS1 C;  1JF4 A;  1MLK A;  4A8W A;  1CP5 A;  2HBD A;  2AV0 A;  4YJJ B;  1HHO B;  3TM3 A;  3UHD A;  3ZJJ A;  2AUP A;  5SW7 A;  4FC3 B;  1YEV A;  1HGA B;  3HEP A;  3NML A;  3OVU C;  3R5I B;  2O58 X;  4MQC B;  2O5T X;  3PI8 B;  1MLJ A;  2MGE A;  4YU4 A;  1O1N B;  3RJN B;  1A3O B;  3P5Q B;  1GLI B;  1QXD B;  3WI8 A;  2GTL D;  1RH1 A;  5CN5 A;  4NI0 A;  4XS0 B;  2VJR A;  1K0Y A;  4WJG 1;  1C40 B;  1UVM A;  5CN6 A;  1Y8K B;  2V1H A;  4WCH D;  1HBA B;  4ROM B;  2D2M D;  2GRZ A;  3MKB B;  3QMA A;  1LH1 A;  3R0G A;  1GLI A;  1HJT A;  1G9V A;  4ROL B;  3H57 A;  2J96 A;  2RI4 B;  1OR6 A;  1ABW A;  3GDJ B;  1Y8K A;  4PQ6 A;  2HBF B;  3S66 B;  3D4X B;  2AUQ A;  3QZZ A;  1HV4 B;  4LMX B;  2LH6 A;  5E83 B;  1Y5J A;  1VXC A;  4MQH A;  5CHR A;  4DWU A;  1G9V B;  5ILP A;  4ESA A;  2C0K A;  5CN9 A;  1IBE A;  3BCQ B;  1MTJ A;  3A59 A;  1HLM A;  1LA6 A;  1IDR A;  5JDO F;  2ZSS A;  1IWH B;  3G53 A;  1UVN A;  1YEO B;  4N7N B;  2UUM A;  4AVE A;  1MYG A;  1Y46 A;  1HDA B;  1V4X B;  4ESA B;  1ECO A;  2M6Z B;  1COH A;  1GH0 B;  3G4U A;  2ZST A;  1Y5F A;  2GL3 A;  1BIJ A;  4H0M A;  4XDI A;  1A6M A;  1A0Z B;  1NZ2 A;  2VLY A;  4H07 A;  2VML B;  1GJN A;  1SPG A;  1DWR A;  1NAZ A;  1VXF A;  3GUQ A;  4X0L B;  2NSS A;  1Y4G B;  4N7N A;  3GKT A;  2ZS0 C;  3PI4 A;  2BW9 M;  3IC0 A;  1Y8I B;  2MGL A;  2ZSQ A;  1MLU A;  3S65 B;  1CBM A;  1COH B;  1GH0 A;  1UIW B;  4F6B A;  3M38 A;  1YEN B;  2VLZ A;  1X9F D;  1JW8 A;  1J40 A;  1FN3 B;  1XCH A;  1H1X A;  3ARJ A;  3ECL A;  2UUL C;  2BV8 B;  2MHB A;  1SPG B;  1YHE B;  3LR7 A;  3D1A A;  2XKH A;  1HHT P;  1LIA B;  1DTM A;  1MLF A;  1XF6 C;  1XYE A;  3M3A A;  1Y8I A;  3WCW B;  1RQA A;  1CPW A;  2UUL H;  1UIW A;  1YMB A;  2EB9 A;  3OO5 A;  4TWU A;  1HBH B;  1CPC A;  112M A;  2W31 A;  1X3K A;  1V75 A;  2MGK A;  3CY5 B;  1UVX A;  5HY8 B;  1S5X B;  1M6C A;  1YH9 A;  2MHB B;  3ZJH A;  1UFP A;  2DXM A;  1JDO A;  1LIA A;  1VRE A;  1MLG A;  1JEB B;  1B8D A;  1J41 A;  2ZS0 B;  2QSP B;  2MGF A;  2ZSO A;  1XXT A;  3K8B A;  3OO5 B;  1YFF A;  1QPW A;  3UHK A;  3AT5 B;  2HHE B;  1O1L A;  2MBW A;  3GYS B;  3CY5 A;  4YU3 B;  4N8T B;  4ESU A;  2FAL A;  4TMA B;  5ILR A;  2VJH B;  1Y01 B;  3G4V A;  1WVP A;  2DXM B;  3IC2 A;  1O1I B;  1Y4Q B;  1MBA A;  1JY7 B;  3L0F A;  1SDK A;  2ZS0 A;  3MN0 A;  5CN8 A;  4KMV A;  3VRG A;  4O4Z A;  2C7K A;  4NXA A;  3S1I A;  3AT5 A;  3BJ3 A;  2HZ3 A;  1JP6 A;  3ED9 A;  3GYS A;  3HHB B;  1B0B A;  1SHR B;  1UVK A;  1Y7Z B;  2HHB B;  1X9F A;  3QJD A;  3VRF A;  1J3F A;  2EKT A;  1YMA A;  1V5H A;  3MJU B;  3UHI A;  3V2Z A;  3WR1 B;  3A9M A;  1PHN B;  3ORD A;  4M4B A;  2W72 C;  3BJ3 B;  1GCW B;  1YE2 A;  3PEL B;  1MWD A;  1J7S B;  1O16 A;  1VXD A;  2V1J A;  2HBG A;  3G4Q A;  1Y7Z A;  4GY3 B;  3DHR A;  1MYZ A;  1DWT A;  3FS4 B;  4YJJ A;  3M3B A;  1YE0 B;  4L2M A;  105M A;  1LJW B;  1JZK A;  3SDH A;  2SPM A;  2G12 A;  1XG0 C;  2EF2 A;  2MYE A;  3PI9 B;  4MAX A;  4KJT A;  1NWI A;  1BJE A;  2FRJ X;  1Y4F A;  3D17 B;  4MQK B;  3HF4 A;  1W92 A;  1Y5K A;  1A6G A;  2FRK X;  5EE4 C;  4QAU A;  4F6J A;  1OJ6 A;  2I88 A;  1CH3 A;  4MQJ B;  1F99 B;  2VRY A;  2RAO A;  2OHB A;  2Z85 A;  3UHZ A;  4ETT A;  5FVB A;  1G0A B;  2ZWJ A;  1DXU B;  4ILZ A;  2DC3 A;  2WTG A;  4RMP A;  4AVD A;  4N7O A;  3V58 A;  1NEJ A;  1HLB A;  3M39 A;  2XYK A;  3HC9 A;  1BAB B;  4ROL A;  1MBO A;  4IT8 A;  1MNI A;  3UHW A;  2HBF A;  3S66 A;  1URY A;  1DXU A;  2QRW A;  1COL A;  3ECZ A;  1MOD A;  4FH7 A;  5KER A;  1Y0T B;  5B85 A;  1YIE B;  3D1K A;  3U3E A;  3V58 B;  1MNO A;  3DBJ B;  2D2M B;  1QXD A;  4NI0 B;  3WFU A;  2ZSY A;  3BCQ A;  2MGJ A;  1V07 A;  2D2N A;  2GDM A;  6HBW B;  1YCA A;  5KER B;  1OUU B;  1EYX B;  2MGM A;  2HZ1 A;  3QM9 A;  1JBO B;  1MKO B;  1BZZ B;  1CG5 B;  1Y46 B;  1HDA A;  111M A;  4HH1 A;  2AA1 A;  1LH3 A;  1HBB B;  1Y5F B;  4JAC A;  1MYF A;  3ZTA A;  2UUM X;  1K1K B;  2YRS A;  2FRI X;  2HBE B;  1YCB A;  3BA2 A;  3KUO A;  1RQ4 A;  1FAW B;  1YDZ A;  2ZSN A;  1G08 A;  1Y8H A;  4X0L A;  2W6Y A;  1Y4R A;  2QU0 A;  1MKO A;  1BZZ A;  1O1O A;  2HBC A;  1KD2 A;  4F0T B;  3S1J A;  2NSR A;  4PNJ A;  4HRT A;  1DLY A;  2V1I A;  3MYM A;  1LH7 A;  1FAW A;  1F63 A;  1Y0W A;  1O1P B;  1Y4R B;  3WFW A;  2B7H B;  1O1O B;  4MBA A;  1CQ2 A;  3BJ2 B;  2GNW A;  5EYS A;  5CN4 A;  1A4F B;  2LH3 A;  1BUW A;  1BIJ B;  1M9P A;  1DTI A;  1LFT B;  1N9H A;  3ONZ B;  1Y45 A;  1A0Z A;  1YHR A;  2DN2 A;  1Y31 B;  1JP8 A;  5CNF A;  2NRL A;  3QJB B;  1O1P A;  3AG0 A;  4HH0 A;  1YIH B;  3BOM B;  4F0U B;  2B7H A;  2BLH A;  1J41 B;  1N9I A;  3RJ6 A;  4H0B A;  5CNB A;  3PT8 A;  3NMM B;  1I3E A;  3NUH B;  2VM0 A;  1HI1 A;  4MXK A;  1MTI A;  4VHB A;  1YOG A;  2DN2 B;  1YHE A;  3D1A B;  1NZ5 A;  3QJB A;  3RQR A;  4TWV A;  4G1B A;  3IC2 B;  1Y0A B;  2G14 A;  1DKE A;  2H8D B;  3UHH A;  1QXE A;  4ZVA A;  3WCW A;  3BRP B;  1C7D A;  1Z8U B;  3PT8 B;  1CIK A;  3ZJO A;  2GKN A;  3SZK A;  1CH2 A;  3UHY A;  1HBH A;  2ZS0 D;  3GIO A;  3IA3 B;  1YH9 B;  4LPI A;  2OH8 A;  4FWY A;  1CO8 A;  1MLQ A;  3GKV B;  2ZFO C;  1Q1F A;  4L1E A;  3VNC A;  3BRP A;  2QSP A;  3OGB A;  1CH4 A;  2H35 A;  1Y85 A;  4HRR A;  1MNJ A;  3SZK B;  1PHN A;  1JL7 A;  1QPW B;  1ABY B;  4F4O A;  2GTL A;  4YU3 A;  1TOX A;  2G0V A;  2VJH A;  3GKV A;  4ETU A;  3WCP A;  4MXL A;  1PBX B;  3DHR B;  3FS4 A;  1LFQ B;  5C6Y A;  1JY7 A;  2LH1 A;  2W6X A;  4G51 B;  1YE0 A;  1LUE A;  2HBS A;  3VRG B;  1XY0 B;  1N9F A;  1MLS A;  3PI9 A;  5EE4 D;  1LHS A;  2GTL B;  4HSX A;  2YSK A;  3K3U A;  1A6K A;  2EB8 A;  1O1K A;  4MQK A;  2X49 A;  1O1J B;  3WCP B;  2NRM A;  3B75 A;  1S69 A;  3MOU A;  1GBU A;  2XKI A;  1F99 A;  1AJH A;  1VXE A;  3OJ1 A;  1ALL A;  1AJ9 A;  3WFT A;  1J7Y B;  2VJT A;  3WCT C;  2D60 B;  2DN3 B;  2DKD A;  1MYJ A;  1UVI A;  4F6D A;  3E5I A;  1YE2 B;  1YG5 B;  1S5Y A;  1O1N A;  1A3O A;  3P5Q A;  1NEJ B;  4GY3 A;  3LB1 A;  3B75 B;  1ABS A;  1BAB A;  3QM5 A;  2VLX A;  1D8U A;  1K0Y B;  1OFK A;  4O2G A;  4Q70 B;  1AJ9 B;  1GZX A;  1XZ7 B;  1Y4V A;  3K9Z A;  1V4U A;  1MBS A;  2D60 A;  2DN3 A;  4F6F A;  3WTG B;  3PT7 A;  3MVC A;  2G0S A;  1S5Y B;  2OLP A;  3OK5 A;  2G10 A;  1WMU B;  3EU1 A;  1VXB A;  1QSH B;  4MQJ A;  1G0B B;  2VYY A;  4IRO B;  2RI4 A;  2OH9 A;  2VEB A;  1EMY A;  4Q70 A;  1ABW B;  5KKK A;  3KUN A;  1GDI A;  3HYU B;  4F6I A;  1J3Y B;  2X4A A;  4DWT A;  2PEG A;  1CMY A;  3ZJL A;  1HHS A;  2G0R A;  1RVW B;  1OUU A;  3PT7 B;  1DXT A;  1IT3 A;  3LB2 A;  2ZS1 B;  1XZU A;  3EU1 B;  2MYA A;  4A8S A;  5CMV A;  1HBR A;  2ZT4 A;  1NS9 B;  1VXG A;  4O4T A;  3DR9 A;  1DXV A;  3CIU A;  1KR7 A;  3UHN A;  4NZI A;  5E29 A;  1NQP A;  1F0L A;  1Y0T A;  1CO9 A;  1DXT B;  2IG3 A;  1XZU B;  1YEO A;  3QM6 A;  2D2M A;  1O1M A;  1HBR B;  2MGA A;  2M6Z A;  3WCU C;  1JL6 A;  3EOK A;  1DXV B;  3CIU B;  1DM1 A;  1Y4P A;  3PMC A;  4UUR A;  2AUO A;  2GRF A;  2W6W A;  3WCW D;  5E29 B;  1XZ5 B;  1NQP B;  3A5B A;  3UGY A;  3QQQ A;  4M4A A;  1A9W E;  1HDS A;  5JDO C;  2WCQ A;  4OOD A;  2ZSX A;  1NXF A;  1JBO A;  3AT6 B;  1MOC A;  1CG5 A;  2R50 A;  3LR9 A;  3A2G A;  2Z6T A;  3AQ6 A;  1DO1 A;  3O2C A;  3BJ2 A;  4XXI A;  3FH9 B;  1FN3 A;  1A00 B;  107M A;  1LFT A;  3WCU B;  1JZL A;  1GDK A;  2V1K A;  2HBE A;  5HLU A;  3WCW C;  1VXA A;  1FDH A;  4MU5 A;  2MYC A;  4ERV A;  1RQ4 B;  4N6S A;  3AT6 A;  1JF3 A;  4GXE A;  1Y8W A;  4F69 A;  2DKA A;  1A01 A;  2QU0 B;  1A0U A;  1QGW C;  1SGK A;  2HBC B;  2R4W A;  3O2C B;  1CH5 A;  3NMM A;  1CH9 A;  1BZ1 A;  1DWS A;  1N9X A;  3G4Y A;  2C7J A;  3WCU A;  5E6E A;  1WLA A;  3MJP B;  4ODC B;  4HSW A;  3LQD B;  1B33 A;  3MYN A;  2SPO A;  3H58 A;  3UGZ A;  1A01 B;  4BJU A;  4MQG B;  5MBN A;  1CBL A;  1ON7 A;  3RGK A;  2G11 A;  3O7N A;  1DO3 A;  1XXT B;  4DC7 A;  1MZ0 A;  1XZ2 B;  1BIN A;  1DDT A;  2QLS A;  1I7Y A;  2V1E A;  5M3S A;  4PQC A;  3LQD A;  2NX0 A;  3BOM A;  4A8F A;  1ON7 B;  1CIO A;  4L1E B;  2VYW A;  3G46 A;  1B86 B;  3QJE B;  1Y85 B;  4HRR B;  2OHA A;  2QLS B;  3OO4 A;  2E2Y A;  2HHD B;  1OFJ A;  1EW6 A;  1A87 A;  5F2A A;  1YVT B;  1X9F B;  1PBX A;  3QJD B;  1UVL A;  1RQ3 B;  1Y0A A;  3A5G A;  1DKE B;  1UX8 A;  2H8D A;  4G51 A;  5HAV A;  1Y7G A;  1B86 A;  4N7P A;  4HHB A;  1THB B;  3WCV B;  3A0G A;  1Y2Z B;  1X46 A;  1HGC A;  3BJ1 B;  1LH6 A;  2MYB A;  1YVQ B;  2QFK A;  5EET A;  3UHE A;  1YGF A;  1Y83 A;  4F68 A;  4ZVB A;  1J7W B;  3ZJI A;  2VYZ A;  1CLS A;  1SPE A;  4A8Y A;  2G0Z A;  4B02 A;  1LJW A;  5HU6 A;  2ZSZ A;  1THB A;  3WCV A;  1Y0D B;  4L7Y A;  1ABY A;  4F4O B;  2MGI A;  1Y4F B;  2JHO A;  2QMB B;  1Y5K B;  2CMM A;  1MYT A;  1CLS B;  5JDO D;  3NG6 B;  1LFQ A;  4LM6 B;  1HA7 A;  2BWH A;  2RAO B;  4G1V A;  2QSS B;  3W4U A;  1BZ0 B;  1YEQ B;  1GZX B;  3UHU A;  1UMO A;  1R1X B;  1XY0 A;  3KMF A;  3DHT B;  1Y0D A;  3HXN B;  5EV5 A;  4AE0 A;  1JPB A;  3DUT A;  2WTH A;  1YGD A;  2R4Z A;  1O1J A;  1GCV B;  2AV3 A;  1R1Y A;  4N7O B;  5JDO E;  2ZLU A;  5EYJ A;  1GBU B;  4FWX A;  2KSC A;  1G0B A;  4NS2 A;  2QSS A;  1ALL B;  1BZ0 A;  1NPG A;  4U8U C;  1R1X A;  3AQ5 A;  3DHT A;  4F6G A;  1MLN A;  1J3Y A;  5EQM A;  2PEG B;  2ZSP A;  5KDQ A;  3DUT B;  3ZJQ A;  1YG5 A;  1GCV A;  1Y35 A;  1YIE A;  3DBJ A;  5D1V A;  5B13 G;  2MYD A;  3UHV A;  1GVH A;  2R80 B;  3ZJP A;  3MWN A;  1MWC A;  2G0X A;  2OIF A;  2ZLX A;  3D7O A;  1V4U B;  3HRW A;  2D6C A;  1MBC A;  2MGC A;  4Z8K A;  6HBW A;  3UH6 A;  4UIQ A;  1EYX A;  2ZT3 A;  3ZOL A;  2GKM A;  1XZV B;  1Y22 B;  3HEN A;  1BZR A;  4IRO A;  1YHU B;  3UHG A;  110M A;  1V4W B;  3S48 C;  3HYU A;  4XXK A;  3E4N A;  1LFV B;  4U8U D;  2UUN A;  2GLN A;  2YRS B;  1YZI A;  1SI4 B;  4M4A B;  5D5R A;  1YHU C;  4SDH A;  103M A;  1RPS A;  1XQ5 B;  1Y22 A;  1FDH G;  2MGD A;  4NK1 A;  1HDB A;  3WCT B;  1YHU A;  1KD2 B;  1NS9 A;  4GZG A;  1HAB B;  1M6M A;  1J3Z B;  3ODQ B;  1IOP A;  4UZV A;  1A00 A;  2BLI A;  3VHB A;  3UI0 A;  2HCO B;  1BVD A;  1MBD A;  3KVS B;  2DN1 B;  1YMC A;  1RPS B;  1Y0W B;  1VXH A;  4GXE B;  2G3H A;  2ZLV B;  1O1M B;  1HDB B;  5CNG A;  3GQP B;  1G09 A;  2UUL B;  1HAB A;  1OUT A;  5B13 A;  3EOK B;  3WHM A;  2IN4 A;  1M9P B;  3QM7 A;  1L2K A;  1RTX A;  1WAC A;  3ONZ A;  2PGH A;  104M A;  1Y45 B;  4O35 A;  1XZ5 A;  1GBV A;  3LHB A;  3MJP A;  1Y31 A;  1HDS B;  3UH3 A;  4MQG A;  1MDT A;  4ZIZ B;  1NZ3 A;  3UHS A;  1UFJ A;  1U7S A;  3ZHW A;  3WCV C;  1DXD A;  3WCT D;  3FH9 A;  1C7C A;  4LMS B;  1XDT T;  1GDL A;  1KFR A;  1UVY A;  4YU4 B;  5AZQ A;  1KTP A;  1LFY A;  3G4W A;  5MBA A;  4XS0 A;  2QFN A;  1A0U B;  1MOH A;  3PI1 A;  1QXE B;  2O5S X;  3EDA A;  3QJE A;  3QJC B;  1HAC B;  1DO7 A;  4ETV A;  4ROM A;  1BZ1 B;  1Y7C B;  2Z6N B;  1FSX B;  2BLJ M;  3OO4 B;  1LFY B;  3UHT A;  4ODC A;  3ARK A;  1MTK A;  1RSE A;  1B33 B;  3UHQ A;  2ZFB A;  1DXC A;  1F5P A;  1FHJ B;  5CN7 A;  5IKS A;  3D4X A;  3QJC A;  3A0G B;  1DLW A;  1Y2Z A;  5E83 A;  1FSX A;  1Y5J B;  3BJ1 A;  2GNV A;  1I7Y B;  1IT2 A;  1YVQ A;  1MNH A;  1I3D A;  1JZM A;  1BVC A;  1ECD A;  2MGH A;  1FHJ A;  1UT0 A;  1CG8 B;  5HU6 B;  4PQB A;  1F5O A;  4MQI B;  2H8F A;  1IWH A;  3QM8 A;  2EVK A;  2O5B X;  1O1K B;  1UVJ A;  1MLO A;  3V2V A;  1HBG A;  2V8A A;  1XZ4 A;  4A8M P;  3AQ7 A;  3WCU D;  4KN3 A;  1Y7G B;  2GRH A;  1CG8 A;  4N7P B;  1J7Y A;  2VJT B;  1Y0C A;  2C7L B;  5HLQ A;  2H8F B;  2FRF A;  5FVB M;  1NS6 B;  2WY4 A;  1HBI A;  1YGF B;  1R1Y B;  4DC8 A;  3ZJR A;  2LH2 A;  1LFZ B;  3O18 A;  2VHB A;  3VAU A;  1MYM A;  1BBB B;  5EUI B;  1XZ7 A;  1Y4V B;  3GOU A;  1Y0C B;  2C7L A;  2D5X A;  2V1F A;  2JLG A;  1XYE B;  1HGB A;  1KN1 A;  5HBI A;  2JL9 A;  3WTG A;  1RQA B;  2QMB A;  1F65 A;  1S0H B;  5JGG A;  1WMU A;  2ZLW B;  6HBI A;  2SPN A;  1YOH A;  1QSH A;  3NG6 A;  1HA7 B;  1H97 A;  1S56 A;  1CPC B;  1LHT A;  5CNC A;  1YEQ A;  3ZJM A;  1MLH A;  2W6V B;  5CHQ A;  1S5X A;  5EU2 A;  4JYQ A;  1CMY B;  3PI3 A;  3VRE A;  3FEW X;  1YGD B;  3QZX A;  1J52 A;  3ZJN A;  2D5Z A;  1RVW A;  1ASH A;  1MLL A;  1NZ4 A;  2R4X A;  2ZS1 A;  3WFX A;  1UX9 A;  1JWN A;  2ZLW A;  3ZJS A;  1GDJ A;  2BKM A;  1EWA A;  2O5L X;  2HHE A;  2UUN D;  1A3N A;  109M A;  1LFV A;  2XKG A;  3UBC A;  2ZFO A;  3MBA A;  5KDQ B;  2R1H A;  4NK2 A;  1NIH A;  1QI8 A;  1SI4 A;  1Y35 B;  1BZ6 A;  1OR4 A;  2C7K B;  5C6E A;  3LB4 A;  1MOB A;  2R80 A;  2DKC A;  1HI0 P;  1A3N B;  2ZLX B;  1Y4P B;  3D7O B;  3UHB A;  1Y7D B;  1YHU D;  4C0N A;  1SHR A;  4Z8K B;  2R1H B;  1HSY A;  3UHC A;  1HCO B;  2HBD B;  2V1G A;  1HHO A;  1MBI A;  1PMB A;  2D2M C;  3MJU A;  5SW7 B;  4FH6 A;  3SDN A;  2JLF A;  3G52 A;  3WR1 A;  2ZLV A;  5C6E B;  2ZT2 A;  3GQG B;  2O5M X;  3GQP A;  4M4B B;  1OUT B;  2GTL C;  1V4W A;  2AUR A;  3WHM B;  1QSI A;  3PEL A;  2SPL A;  1MWB A;  3PI8 A;  2PGH B;  1AZI A;  1Y09 A;  108M A;  3E5O A;  3LQ9 A;  4WJG A;  1TU9 A;  4MPM A;  4N6S B;  4H2L A;  1Y8W B;  4NXC A;  1ECA A;  1NY9 A;  1DUK A;  1HBS A;  1CQX A;  3PI2 A;  3WCT A;  3NL7 B;  4KMW A;  3O89 A;  1RTE A;  4MBN A;  3ODQ A;  3D17 A;  3NFE B;  3MKB A;  2C7J B;  2LH5 A;  1Y09 B;  5E6E B;  4ERT A;  2UUL D;  2Z8A A;  3KVS A;  5ILM A;  2ZLT B;  3OZW A;  2MGB A;  2D2N D;  4H2L B;  1VWT A;  3AQ9 A;  3PIA B;  4FC3 A;  1YEV B;  3G4R A;  3GK9 A;  3NL7 A;  4TYX A;  2UUL A;  1FCS A;  1HV4 A;  1XZ2 A;  4NI1 A;  5CND A;  1GBV B;  1VHB A;  1NPF A;  2ZLT A;  1A9W A;  1U7R A;  2VJR B;  1ITH A;  1VWT B;  3PIA A;  1C40 A;  2EKU A;  4ZIZ A;  3ARL A;  1SWM A;  3AQ8 A;  1HBA A;  2ZSR A;  2LH7 A;  1C7C B;  1LH5 A;  3OZV A;  4NI1 B;  3D1K B;  2UUM B;  1KTP B;  2HHD A;  1S61 A;  1FSL A;  1V4X A;  1YVT A;  1SDL B;  1JP9 A;  4A8K A;  1RQ3 A;  3GDJ A;  4BS9 A;  4H0M B;  1VRF A;  2D2N B;  4HHB B;  1URV A;  3HEO A;  1HAC A;  2DHB A;  3GLN A;  2WCR A;  2VML A;  1Y7C A;  1MGN A;  2Z6N A;  5B84 A;  1Y4B B;  3ZOM A;  2O5Q X;  1HGC B;  3UBV A;  1Y4G A;  4MQH B;  3UHR A;  5AZR A;  2AA1 B;  1SDL A;  1Y83 B;  1J7W A;  1IBE B;  1XZ4 B;  4O1T A;  1HBB A;  1EBT A;  2ZFB B;  1LTW A;  1YOI A;  3A59 B;  1K1K A;  1IRD A;  2DHB B;  1LA6 B;  2ZS1 D;  4L7Y B;  1Y4B A;  1YDZ B;  1G08 B;  1Y8H B;  3IXF A;  1CP0 A;  3ASE A;  3LB3 A;  4HBI A;  1MLR A;  4OF9 A;  4F0T A;  1YEU A;  1MNK A;  1LFZ A;  3QQR A;  1UC3 A;  1DO4 A;  3O18 B;  3W4U B;  4PO5 A;  1IRD B;  5HY8 A;  4HRT B;  2Z6S A;  4MQI A;  2MGG A;  3HXN A;  101M A;  2FAM A;  1HGB B;  1JEB A;  2EVP A;  1S6A A;  3IC0 B;  2V8A B;  3S65 A;  1S0H A;  3EDB A;  1YEU B;  5F0B A;  1V9Q A;  1A4F A;  2ZLU B;  1YEN A;  4B4Y A;  1BUW B;  3UHX A;  1J40 B;  2HZ2 A;  3KMF C;  1O1L B;  4PO5 B;  1YHR B;  2W6V A; 
#chains in the Genus database with same CATH homology
 5AB8 A;  4U8U B;  1NWN A;  3ZH0 A;  1AJG A;  1MYI A;  2ZT1 A;  3VRE B;  1YIH A;  7HBI A;  1O1I A;  1Y4Q A;  1NS6 A;  1SDK B;  1A6N A;  102M A;  2O5O X;  4C44 A;  4FWZ A;  1LFL A;  3UH7 A;  1TES A;  3ECX A;  3WCV D;  1V75 B;  1BBB A;  5EUI A;  3GOU B;  2D5X B;  5HLX A;  3HRW B;  4U8U A;  2MB5 A;  2ZFO B;  3VRF B;  1NIH B;  1QI8 B;  5EOH A;  5JOM A;  2BMM A;  1DUO A;  5JGG B;  1XZV A;  1C7D B;  2BK9 A;  3K8B B;  4B3W A;  1LFL B;  1YFF B;  1MYH A;  3GQR B;  5CNE A;  5ILE A;  2VEE A;  1GCW A;  4N8T A;  3OZU A;  1LH2 A;  2BNL A;  1NGK A;  1Y7D A;  1YZI B;  1HCO A;  1ECN A;  2D5Z B;  1MDN A;  2ZT0 A;  1XQ5 A;  1OBM A;  1C7B A;  1BZP A;  2H35 B;  1CH1 A;  3TM9 A;  1MBN A;  3GQG A;  3A5A A;  1CH7 A;  3GQR A;  1MLM A;  1T1N B;  2LHB A;  2W72 A;  1EBC A;  1J3Z A;  1FLP A;  3HHB A;  1QSI B;  3HF4 B;  1MCY A;  2HCO A;  1MOA A;  2HHB A;  1IRC A;  2DN1 A;  1C7B B;  1X9F C;  2ZFO D;  106M A;  2HBS B;  1G0A A;  2R4Y A;  4BJA A;  1HBS B;  3TLD A;  1G09 B;  1T1N A;  1HGA A;  2W72 B;  3R5I A;  1HRM A;  4MQC A;  2D2N C;  3NFE A;  3UH5 A;  1J7S A;  3E55 A;  2ZS1 C;  1JF4 A;  1MLK A;  1CP5 A;  2HBD A;  2AV0 A;  1HHO B;  3TM3 A;  3UHD A;  3ZJJ A;  2AUP A;  5SW7 A;  4FC3 B;  1YEV A;  1HGA B;  3HEP A;  3NML A;  3OVU C;  3R5I B;  2O58 X;  4MQC B;  2O5T X;  3PI8 B;  1MLJ A;  2MGE A;  4YU4 A;  1O1N B;  3RJN B;  1A3O B;  3P5Q B;  1GLI B;  1QXD B;  3WI8 A;  2GTL D;  5CN5 A;  4NI0 A;  4XS0 B;  1K0Y A;  4WJG 1;  1C40 B;  5CN6 A;  1Y8K B;  2V1H A;  4WCH D;  1HBA B;  4ROM B;  2D2M D;  2GRZ A;  3MKB B;  3QMA A;  1LH1 A;  3R0G A;  1GLI A;  1HJT A;  1G9V A;  4ROL B;  3H57 A;  2RI4 B;  1OR6 A;  1ABW A;  3GDJ B;  1Y8K A;  4PQ6 A;  2HBF B;  3S66 B;  3D4X B;  2AUQ A;  3QZZ A;  1HV4 B;  2LH6 A;  5E83 B;  1Y5J A;  1VXC A;  4MQH A;  5CHR A;  4DWU A;  1G9V B;  5ILP A;  4ESA A;  2C0K A;  5CN9 A;  1IBE A;  3BCQ B;  1MTJ A;  3A59 A;  1HLM A;  1LA6 A;  1IDR A;  5JDO F;  2ZSS A;  1IWH B;  3G53 A;  1YEO B;  4N7N B;  4AVE A;  1MYG A;  1Y46 A;  1HDA B;  1V4X B;  4ESA B;  1ECO A;  2M6Z B;  1COH A;  3G4U A;  2ZST A;  1Y5F A;  2GL3 A;  1BIJ A;  4XDI A;  1A6M A;  1A0Z B;  1NZ2 A;  2VLY A;  4H07 A;  1GJN A;  1SPG A;  1DWR A;  1NAZ A;  1VXF A;  4X0L B;  2NSS A;  1Y4G B;  4N7N A;  3GKT A;  2ZS0 C;  3PI4 A;  2BW9 M;  3IC0 A;  1Y8I B;  2MGL A;  2ZSQ A;  1MLU A;  3S65 B;  1CBM A;  1COH B;  1UIW B;  4F6B A;  3M38 A;  1YEN B;  2VLZ A;  1X9F D;  1JW8 A;  1J40 A;  1FN3 B;  1XCH A;  1H1X A;  3ARJ A;  3ECL A;  2MHB A;  1SPG B;  1YHE B;  3D1A A;  3LR7 A;  2XKH A;  1DTM A;  1MLF A;  1XYE A;  3M3A A;  1Y8I A;  3WCW B;  1RQA A;  1CPW A;  1UIW A;  1YMB A;  2EB9 A;  3OO5 A;  4TWU A;  1HBH B;  112M A;  2W31 A;  1X3K A;  1V75 A;  2MGK A;  3CY5 B;  1UVX A;  5HY8 B;  1S5X B;  1M6C A;  1YH9 A;  2MHB B;  3ZJH A;  1UFP A;  2DXM A;  1JDO A;  1VRE A;  1MLG A;  1JEB B;  1J41 A;  2ZS0 B;  2QSP B;  2MGF A;  2ZSO A;  1XXT A;  3K8B A;  3OO5 B;  1YFF A;  1QPW A;  3UHK A;  3AT5 B;  2HHE B;  1O1L A;  2MBW A;  3GYS B;  3CY5 A;  4YU3 B;  4N8T B;  2FAL A;  5ILR A;  1Y01 B;  3G4V A;  1WVP A;  2DXM B;  3IC2 A;  1O1I B;  1Y4Q B;  1MBA A;  1JY7 B;  1SDK A;  2ZS0 A;  3MN0 A;  5CN8 A;  4KMV A;  3VRG A;  4O4Z A;  4NXA A;  3S1I A;  3AT5 A;  3BJ3 A;  2HZ3 A;  1JP6 A;  3ED9 A;  3GYS A;  3HHB B;  1B0B A;  1SHR B;  1Y7Z B;  2HHB B;  1X9F A;  3QJD A;  3VRF A;  1J3F A;  2EKT A;  1YMA A;  1V5H A;  3MJU B;  3UHI A;  3V2Z A;  3WR1 B;  3A9M A;  3ORD A;  4M4B A;  2W72 C;  3BJ3 B;  1GCW B;  1YE2 A;  3PEL B;  1MWD A;  1J7S B;  1O16 A;  1VXD A;  2V1J A;  2HBG A;  3G4Q A;  1Y7Z A;  3DHR A;  1MYZ A;  1DWT A;  3FS4 B;  3M3B A;  1YE0 B;  4L2M A;  105M A;  1LJW B;  1JZK A;  3SDH A;  2SPM A;  2G12 A;  2EF2 A;  2MYE A;  3PI9 B;  4MAX A;  4KJT A;  1NWI A;  1BJE A;  2FRJ X;  1Y4F A;  3D17 B;  4MQK B;  3HF4 A;  1W92 A;  1Y5K A;  1A6G A;  2FRK X;  5EE4 C;  4QAU A;  4F6J A;  1OJ6 A;  1CH3 A;  4MQJ B;  2VRY A;  2RAO A;  2OHB A;  2Z85 A;  3UHZ A;  1G0A B;  2ZWJ A;  1DXU B;  4ILZ A;  2DC3 A;  2WTG A;  4AVD A;  4N7O A;  1NEJ A;  1HLB A;  3M39 A;  2XYK A;  3HC9 A;  1BAB B;  4ROL A;  1MBO A;  4IT8 A;  1MNI A;  3UHW A;  2HBF A;  3S66 A;  1URY A;  1DXU A;  2QRW A;  3ECZ A;  1MOD A;  4FH7 A;  5KER A;  1Y0T B;  5B85 A;  1YIE B;  3D1K A;  3U3E A;  1MNO A;  2D2M B;  1QXD A;  4NI0 B;  3WFU A;  2ZSY A;  3BCQ A;  2MGJ A;  1V07 A;  2D2N A;  2GDM A;  6HBW B;  1YCA A;  5KER B;  1OUU B;  2MGM A;  2HZ1 A;  3QM9 A;  1MKO B;  1BZZ B;  1CG5 B;  1Y46 B;  1HDA A;  111M A;  2AA1 A;  1LH3 A;  1HBB B;  1Y5F B;  4JAC A;  1MYF A;  1K1K B;  2YRS A;  2FRI X;  2HBE B;  1YCB A;  3BA2 A;  3KUO A;  1RQ4 A;  1FAW B;  1YDZ A;  2ZSN A;  1G08 A;  1Y8H A;  4X0L A;  2W6Y A;  1Y4R A;  2QU0 A;  1MKO A;  1BZZ A;  1O1O A;  2HBC A;  1KD2 A;  3S1J A;  2NSR A;  4PNJ A;  4HRT A;  1DLY A;  2V1I A;  3MYM A;  1LH7 A;  1FAW A;  1F63 A;  1Y0W A;  1O1P B;  1Y4R B;  3WFW A;  2B7H B;  1O1O B;  4MBA A;  1CQ2 A;  3BJ2 B;  2GNW A;  5EYS A;  5CN4 A;  1A4F B;  2LH3 A;  1BUW A;  1BIJ B;  1M9P A;  1DTI A;  1LFT B;  1N9H A;  3ONZ B;  1Y45 A;  1A0Z A;  1YHR A;  2DN2 A;  1Y31 B;  1JP8 A;  5CNF A;  2NRL A;  3QJB B;  1O1P A;  3AG0 A;  1YIH B;  3BOM B;  2B7H A;  2BLH A;  1J41 B;  1N9I A;  3RJ6 A;  4H0B A;  5CNB A;  3PT8 A;  3NMM B;  1I3E A;  2VM0 A;  4MXK A;  1MTI A;  4VHB A;  1YOG A;  2DN2 B;  1YHE A;  3D1A B;  1NZ5 A;  3QJB A;  4TWV A;  4G1B A;  3IC2 B;  1Y0A B;  2G14 A;  1DKE A;  2H8D B;  3UHH A;  1QXE A;  4ZVA A;  3WCW A;  1C7D A;  1Z8U B;  3PT8 B;  1CIK A;  3ZJO A;  2GKN A;  3SZK A;  1CH2 A;  3UHY A;  1HBH A;  2ZS0 D;  3IA3 B;  1YH9 B;  4LPI A;  2OH8 A;  4FWY A;  1CO8 A;  1MLQ A;  3GKV B;  2ZFO C;  1Q1F A;  2QSP A;  3OGB A;  1CH4 A;  2H35 A;  1Y85 A;  4HRR A;  1MNJ A;  3SZK B;  1JL7 A;  1QPW B;  1ABY B;  4F4O A;  2GTL A;  4YU3 A;  2G0V A;  3GKV A;  3WCP A;  4MXL A;  1PBX B;  3DHR B;  3FS4 A;  1LFQ B;  5C6Y A;  1JY7 A;  2LH1 A;  2W6X A;  4G51 B;  1YE0 A;  1LUE A;  2HBS A;  3VRG B;  1XY0 B;  1N9F A;  1MLS A;  3PI9 A;  5EE4 D;  1LHS A;  2GTL B;  4HSX A;  3K3U A;  1A6K A;  2EB8 A;  1O1K A;  4MQK A;  1O1J B;  3WCP B;  2NRM A;  3B75 A;  1S69 A;  3MOU A;  1GBU A;  2XKI A;  1AJH A;  1VXE A;  3OJ1 A;  1AJ9 A;  3WFT A;  1J7Y B;  3WCT C;  2D60 B;  2DN3 B;  1MYJ A;  4F6D A;  3E5I A;  1YE2 B;  1YG5 B;  1S5Y A;  1O1N A;  1A3O A;  3P5Q A;  1NEJ B;  3LB1 A;  3B75 B;  1ABS A;  1BAB A;  2VLX A;  3QM5 A;  1D8U A;  1K0Y B;  1OFK A;  4O2G A;  1AJ9 B;  1GZX A;  1XZ7 B;  1Y4V A;  3K9Z A;  1V4U A;  1MBS A;  2D60 A;  2DN3 A;  4F6F A;  3WTG B;  3PT7 A;  3MVC A;  2G0S A;  1S5Y B;  2OLP A;  3OK5 A;  2G10 A;  1WMU B;  3EU1 A;  1VXB A;  1QSH B;  4MQJ A;  1G0B B;  2VYY A;  4IRO B;  2RI4 A;  2OH9 A;  2VEB A;  1EMY A;  1ABW B;  5KKK A;  3KUN A;  1GDI A;  3HYU B;  4F6I A;  1J3Y B;  4DWT A;  2PEG A;  1CMY A;  3ZJL A;  2G0R A;  1RVW B;  1OUU A;  3PT7 B;  1DXT A;  1IT3 A;  3LB2 A;  2ZS1 B;  1XZU A;  3EU1 B;  2MYA A;  5CMV A;  1HBR A;  2ZT4 A;  1NS9 B;  1VXG A;  4O4T A;  3DR9 A;  1DXV A;  3CIU A;  1KR7 A;  3UHN A;  4NZI A;  5E29 A;  1NQP A;  1Y0T A;  1CO9 A;  1DXT B;  2IG3 A;  1XZU B;  1YEO A;  3QM6 A;  2D2M A;  1O1M A;  1HBR B;  2MGA A;  2M6Z A;  3WCU C;  1JL6 A;  3EOK A;  1DXV B;  3CIU B;  1DM1 A;  1Y4P A;  4UUR A;  2AUO A;  2GRF A;  2W6W A;  3WCW D;  5E29 B;  1XZ5 B;  1NQP B;  3A5B A;  3UGY A;  3QQQ A;  4M4A A;  1A9W E;  1HDS A;  5JDO C;  4OOD A;  2ZSX A;  1NXF A;  3AT6 B;  1MOC A;  1CG5 A;  2R50 A;  3LR9 A;  3A2G A;  2Z6T A;  3AQ6 A;  1DO1 A;  3BJ2 A;  3FH9 B;  1FN3 A;  1A00 B;  107M A;  1LFT A;  3WCU B;  1JZL A;  1GDK A;  2V1K A;  2HBE A;  5HLU A;  3WCW C;  1VXA A;  1FDH A;  4MU5 A;  2MYC A;  1RQ4 B;  3AT6 A;  1JF3 A;  1Y8W A;  4F69 A;  2QU0 B;  1A01 A;  1A0U A;  2HBC B;  2R4W A;  1CH5 A;  3NMM A;  1CH9 A;  1BZ1 A;  1DWS A;  1N9X A;  3G4Y A;  3WCU A;  5E6E A;  1WLA A;  3MJP B;  4ODC B;  4HSW A;  3LQD B;  3MYN A;  2SPO A;  3H58 A;  3UGZ A;  1A01 B;  4MQG B;  5MBN A;  1CBL A;  3RGK A;  2G11 A;  3O7N A;  1DO3 A;  1XXT B;  4DC7 A;  1MZ0 A;  1XZ2 B;  1BIN A;  2QLS A;  2V1E A;  5M3S A;  4PQC A;  3LQD A;  2NX0 A;  3BOM A;  1CIO A;  2VYW A;  3G46 A;  1B86 B;  3QJE B;  1Y85 B;  4HRR B;  2OHA A;  2QLS B;  3OO4 A;  2E2Y A;  2HHD B;  1OFJ A;  1EW6 A;  5F2A A;  1YVT B;  1X9F B;  1PBX A;  3QJD B;  1RQ3 B;  1Y0A A;  3A5G A;  1DKE B;  1UX8 A;  2H8D A;  4G51 A;  5HAV A;  1Y7G A;  1B86 A;  4N7P A;  4HHB A;  1THB B;  3WCV B;  3A0G A;  1Y2Z B;  1X46 A;  1HGC A;  3BJ1 B;  1LH6 A;  2MYB A;  1YVQ B;  2QFK A;  5EET A;  3UHE A;  1YGF A;  1Y83 A;  4F68 A;  4ZVB A;  1J7W B;  3ZJI A;  2VYZ A;  1CLS A;  1SPE A;  2G0Z A;  1LJW A;  5HU6 A;  2ZSZ A;  1THB A;  3WCV A;  1Y0D B;  4L7Y A;  1ABY A;  4F4O B;  2MGI A;  1Y4F B;  2JHO A;  2QMB B;  1Y5K B;  2CMM A;  1MYT A;  1CLS B;  5JDO D;  3NG6 B;  1LFQ A;  2BWH A;  2RAO B;  4G1V A;  2QSS B;  3W4U A;  1BZ0 B;  1YEQ B;  1GZX B;  3UHU A;  1UMO A;  1R1X B;  1XY0 A;  3KMF A;  3DHT B;  1Y0D A;  3HXN B;  5EV5 A;  1JPB A;  3DUT A;  2WTH A;  1YGD A;  2R4Z A;  1O1J A;  1GCV B;  2AV3 A;  1R1Y A;  4N7O B;  5JDO E;  2ZLU A;  5EYJ A;  1GBU B;  4FWX A;  2KSC A;  1G0B A;  4NS2 A;  2QSS A;  1BZ0 A;  1NPG A;  4U8U C;  1R1X A;  3AQ5 A;  3DHT A;  4F6G A;  1MLN A;  1J3Y A;  5EQM A;  2PEG B;  2ZSP A;  5KDQ A;  3DUT B;  3ZJQ A;  1YG5 A;  1GCV A;  1Y35 A;  1YIE A;  5D1V A;  2MYD A;  3UHV A;  1GVH A;  2R80 B;  3ZJP A;  1MWC A;  2G0X A;  2OIF A;  2ZLX A;  3D7O A;  1V4U B;  3HRW A;  2D6C A;  1MBC A;  2MGC A;  6HBW A;  3UH6 A;  4UIQ A;  2ZT3 A;  3ZOL A;  2GKM A;  1XZV B;  1Y22 B;  3HEN A;  1BZR A;  4IRO A;  1YHU B;  3UHG A;  110M A;  1V4W B;  3S48 C;  3HYU A;  3E4N A;  1LFV B;  4U8U D;  2GLN A;  2YRS B;  1YZI A;  1SI4 B;  4M4A B;  5D5R A;  1YHU C;  4SDH A;  103M A;  1RPS A;  1XQ5 B;  1Y22 A;  1FDH G;  2MGD A;  4NK1 A;  1HDB A;  3WCT B;  1YHU A;  1KD2 B;  1NS9 A;  4GZG A;  1HAB B;  1M6M A;  1J3Z B;  3ODQ B;  1IOP A;  4UZV A;  1A00 A;  2BLI A;  3VHB A;  3UI0 A;  2HCO B;  1BVD A;  1MBD A;  2DN1 B;  1YMC A;  1RPS B;  1Y0W B;  1VXH A;  2G3H A;  2ZLV B;  1O1M B;  1HDB B;  5CNG A;  3GQP B;  1G09 A;  1HAB A;  1OUT A;  3EOK B;  3WHM A;  2IN4 A;  1M9P B;  3QM7 A;  1L2K A;  1RTX A;  3ONZ A;  2PGH A;  104M A;  1Y45 B;  4O35 A;  1XZ5 A;  1GBV A;  3LHB A;  3MJP A;  1Y31 A;  1HDS B;  3UH3 A;  4MQG A;  1NZ3 A;  3UHS A;  1UFJ A;  1U7S A;  3ZHW A;  3WCV C;  1DXD A;  3WCT D;  3FH9 A;  1C7C A;  1GDL A;  1KFR A;  1UVY A;  4YU4 B;  5AZQ A;  1LFY A;  3G4W A;  5MBA A;  4XS0 A;  2QFN A;  1A0U B;  1MOH A;  3PI1 A;  1QXE B;  2O5S X;  3EDA A;  3QJE A;  3QJC B;  1HAC B;  1DO7 A;  4ROM A;  1BZ1 B;  1Y7C B;  2Z6N B;  1FSX B;  2BLJ M;  3OO4 B;  1LFY B;  3UHT A;  4ODC A;  3ARK A;  1MTK A;  1RSE A;  3UHQ A;  2ZFB A;  1DXC A;  1F5P A;  1FHJ B;  5CN7 A;  5IKS A;  3D4X A;  3QJC A;  3A0G B;  1DLW A;  1Y2Z A;  5E83 A;  1FSX A;  1Y5J B;  3BJ1 A;  2GNV A;  1IT2 A;  1YVQ A;  1MNH A;  1I3D A;  1JZM A;  1BVC A;  1ECD A;  2MGH A;  1FHJ A;  1UT0 A;  1CG8 B;  5HU6 B;  4PQB A;  1F5O A;  4MQI B;  2H8F A;  1IWH A;  3QM8 A;  2EVK A;  2O5B X;  1O1K B;  1MLO A;  3V2V A;  1HBG A;  1XZ4 A;  3AQ7 A;  3WCU D;  4KN3 A;  1Y7G B;  2GRH A;  1CG8 A;  4N7P B;  1J7Y A;  1Y0C A;  5HLQ A;  2H8F B;  2FRF A;  1NS6 B;  2WY4 A;  1HBI A;  1YGF B;  1R1Y B;  4DC8 A;  3ZJR A;  2LH2 A;  1LFZ B;  2VHB A;  3VAU A;  1MYM A;  1BBB B;  5EUI B;  1XZ7 A;  1Y4V B;  3GOU A;  1Y0C B;  2D5X A;  2V1F A;  1XYE B;  1HGB A;  5HBI A;  3WTG A;  1RQA B;  2QMB A;  1F65 A;  1S0H B;  5JGG A;  1WMU A;  2ZLW B;  6HBI A;  2SPN A;  1YOH A;  1QSH A;  3NG6 A;  1H97 A;  1S56 A;  1LHT A;  5CNC A;  1YEQ A;  3ZJM A;  1MLH A;  2W6V B;  5CHQ A;  1S5X A;  5EU2 A;  4JYQ A;  1CMY B;  3PI3 A;  3VRE A;  1YGD B;  3QZX A;  1J52 A;  3ZJN A;  2D5Z A;  1RVW A;  1ASH A;  1MLL A;  1NZ4 A;  2R4X A;  2ZS1 A;  3WFX A;  1UX9 A;  1JWN A;  2ZLW A;  3ZJS A;  1GDJ A;  2BKM A;  1EWA A;  2O5L X;  2HHE A;  1A3N A;  109M A;  1LFV A;  2XKG A;  3UBC A;  2ZFO A;  3MBA A;  5KDQ B;  2R1H A;  4NK2 A;  1NIH A;  1QI8 A;  1SI4 A;  1Y35 B;  1BZ6 A;  5C6E A;  1OR4 A;  3LB4 A;  1MOB A;  2R80 A;  1A3N B;  2ZLX B;  1Y4P B;  3D7O B;  3UHB A;  1Y7D B;  1YHU D;  4C0N A;  1SHR A;  2R1H B;  1HSY A;  3UHC A;  1HCO B;  2HBD B;  2V1G A;  1HHO A;  1MBI A;  1PMB A;  2D2M C;  3MJU A;  5SW7 B;  4FH6 A;  3SDN A;  3G52 A;  3WR1 A;  2ZLV A;  5C6E B;  2ZT2 A;  3GQG B;  2O5M X;  3GQP A;  4M4B B;  1OUT B;  2GTL C;  1V4W A;  2AUR A;  3WHM B;  1QSI A;  3PEL A;  2SPL A;  1MWB A;  3PI8 A;  2PGH B;  1AZI A;  1Y09 A;  108M A;  3E5O A;  4WJG A;  1TU9 A;  4MPM A;  4H2L A;  1Y8W B;  4NXC A;  1ECA A;  1DUK A;  1HBS A;  1CQX A;  3PI2 A;  3WCT A;  3NL7 B;  4KMW A;  3O89 A;  1RTE A;  4MBN A;  3ODQ A;  3D17 A;  3NFE B;  3MKB A;  2LH5 A;  1Y09 B;  5E6E B;  2Z8A A;  5ILM A;  2ZLT B;  3OZW A;  2MGB A;  2D2N D;  4H2L B;  1VWT A;  3AQ9 A;  3PIA B;  4FC3 A;  1YEV B;  3G4R A;  3GK9 A;  3NL7 A;  4TYX A;  1FCS A;  1HV4 A;  1XZ2 A;  4NI1 A;  5CND A;  1GBV B;  1VHB A;  1NPF A;  2ZLT A;  1A9W A;  1U7R A;  1ITH A;  1VWT B;  3PIA A;  1C40 A;  2EKU A;  3ARL A;  1SWM A;  3AQ8 A;  1HBA A;  2ZSR A;  2LH7 A;  1C7C B;  1LH5 A;  3OZV A;  4NI1 B;  3D1K B;  2HHD A;  1S61 A;  1FSL A;  1V4X A;  1YVT A;  1SDL B;  1JP9 A;  1RQ3 A;  3GDJ A;  1VRF A;  2D2N B;  4HHB B;  1URV A;  3HEO A;  1HAC A;  2DHB A;  3GLN A;  1Y7C A;  1MGN A;  2Z6N A;  5B84 A;  1Y4B B;  3ZOM A;  2O5Q X;  1HGC B;  3UBV A;  1Y4G A;  4MQH B;  3UHR A;  5AZR A;  2AA1 B;  1SDL A;  1Y83 B;  1J7W A;  1IBE B;  1XZ4 B;  4O1T A;  1HBB A;  1EBT A;  2ZFB B;  1LTW A;  1YOI A;  3A59 B;  1K1K A;  1IRD A;  2DHB B;  1LA6 B;  2ZS1 D;  4L7Y B;  1Y4B A;  1YDZ B;  1G08 B;  1Y8H B;  3IXF A;  1CP0 A;  3ASE A;  3LB3 A;  4HBI A;  1MLR A;  4OF9 A;  1YEU A;  1MNK A;  1LFZ A;  3QQR A;  1UC3 A;  1DO4 A;  3W4U B;  1IRD B;  5HY8 A;  4HRT B;  2Z6S A;  4MQI A;  2MGG A;  3HXN A;  101M A;  2FAM A;  1HGB B;  1JEB A;  2EVP A;  1S6A A;  3IC0 B;  3S65 A;  1S0H A;  3EDB A;  1YEU B;  5F0B A;  1V9Q A;  1A4F A;  2ZLU B;  1YEN A;  4B4Y A;  1BUW B;  3UHX A;  1J40 B;  2HZ2 A;  3KMF C;  1O1L B;  1YHR B;  2W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...