1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
1HJSA 2EXOA 4P8XA 2WWCA 4TOQA 1UKQA 3OBAA 3GXPA 2DPEA 4QLLA 5ABGA 5FL1A 4P8UA 2WBGA 5DEZA 1UQYA 1ISXA 1JZ3A 3UG3A 1G01A 2YIHA 5E1QA 4XB3A 3ARTA 2CIPA 3W82A 2QPSA 3AS3A 2Q8XA 2V3FA 2WMJA 3OIHA 1E6PA 4PMXA 1KCKA 3SCPA 3BUDA 4M81A 3KL0A 2XTKA 3AISA 1RH9A 4MAVA 5FKYA 3WNOA 1B30A 3AXIA 1JZ8A 2EJ1A 3BCFA 1EGZA 2XM2A 5DF0A 3VD4A 4J3XA 3BVUA 2BY1A 3WEZA 3WNNA 3IANA 1GHRA 1R7AA 3K46A 3ZOAA 5LA1A 3TOPA 3BAXA 1EHAA 1ZU8A 5FD0A 2GJXA 1JI2A 1J0ZA 3APGA 1XV8A 1VF8A 5BXPA 2F7QA 3O9NA 2XVNA 3FNDA 4C7DA 1NOFA 4Z2GA 3E1F1 3GH5A 1R33A 3VGFA 4U31A 2W92A 2D2OA 4PTXA 1A47A 4J3WA 3UG4A 2VZVA 1NQ6A 1W2VA 1IZJA 4JHZA 1UZ4A 5E09A 3O2LA 3VTRA 3EMZA 5IXEA 4AMWA 2OWCA 3AS2A 3RO8A 4GZEA 3WELA 1JYVA 4FNPA 3EJPA 3ZR6A 2GDVA 3AIQA 4WK9A 1GONA 3KWXA 1A3HA 1Q6DA 3POHA 5JIWA 3OZOA 3VX0A 2WVTA 4TXEA 1CGUA 3W6LA 3VU2A 3A3HA 3SUWA 1FH9A 2X0HA 1DTUA 4TTUA 3L4WA 3WUFA 3A5VA 2YKKA 3WY4A 4FK9A 4L4PA 1CIUA 4S3KA 1W3KA 3SCQA 1UH3A 1JZ4A 5A6JA 4MTVA 5I3DA 5A8QA 1AQMA 4AEEA 1C92A 5ABFA 3ZJ6A 2WKGA 5HNNA 3NSXA 4H8UA 2F18A 4MB4A 3RJYA 6A3HA 1KQYA 1WZLA 4CD8A 4W85A 3W0KA 3CTTA 2YA0A 2YDQA 4JFVA 3G6LA 4Z2HA 1LG1A 3EJSA 5I6SA 1JZ2A 4KRUA 4PMVA 1H1NA 5I5RA 4UOQA 1SYTA 3WH6A 1VENA 3TONA 1LL6A 2D20A 3A24A 4JZ5A 4IISA 3W29A 4GINA 2JIWA 3WMSA 2YDRA 1WZAA 1J18A 4JFSA 2Y8VA 3GXNA 2J75A 3H55A 1D7FA 2A3HA 5M17A 4IPNB 3GNRA 3NUKA 4UZSA 1US2A 1C91A 1QHPA 3F4VA 3DX2A 1W9BM 1GQLA 1E6XM 4PUDA 4XV0A 2DIEA 3WD0A 1MVYA 3BMWA 4JFTA 2CHNA 2YFNA 2F1BA 5IFPA 1GCYA 5I0DA 1ECEA 2NW0A 4DM1A 3AIBA 3NSNA 3MUIA 2OSYA 3IK2A 1SMDA 2VOTA 1UKSA 1WDRA 4OZOA 1J12A 2W66A 1XGZA 3VM5A 3AHYA 1TA3A 5AYBA 1DP0A 4KGJA 1WDSA 1CGTA 3AXHA 2JIEA 3I3EA 4HZ6A 4GXPA 1KCLA 1MW3A 5M5DA 4UQAA 1TFVA 3O6AA 3VINA 2G3JA 3ARZA 4R27A 1BFNA 4UCFA 1OIFA 4NX0A 3AHVA 1BF2A 1ZBVA 2XHYA 3MMUA 4W7UA 1UR2A 1E0XA 1MW2A 3VILA 2X8RA 4UQ9A 1YHTA 4AZCB 4UTFA 1JD9A 1CENA 1H09A 5CSUA 3NCOA 1DWJM 1CNVA 1KQZA 1J0YA 8A3HA 1FFRA 4CD6A 4J3SA 4F9DA 2JEPA 1FH7A 1NOWA 3CUGA 1C7SA 3SUVA 1OD0A 5DO8A 2DSVA 4XX6A 1NWTA 3D50A 2FGLA 3VIIA 1N82A 1J0KA 2WANA 1Q6FA 3K4AA 1M01A 5ABHA 5A2CA 1XC6A 1MYRA 1E5JA 3PZQA 4CD4A 4P7NA 3IAQA 3PN8A 2EADA 2XM1A 4HU0A 1JGIA 4AIOA 3MMWA 4M56A 3EJUA 3WQ8A 3L2MA 1UWRA 1JFHA 1E6ZA 1CXKA 4TX8A 4X0VA 1UH2A 4PMDA 4WSKA 2GJPA 3S2CA 3EMCA 1CGWA 1QI2A 1L8NA 1JZ6A 3KLKA 5I79A 4C7FA 1K9EA 2VURA 2DT0A 2C0HA 1UWUA 1XSJA 2ZUTA 1HTYA 3SCOA 4BQ5A 1MXGA 1OD8A 2JALA 1KXVA 3ARWA 1TQVA 1ODUA 4JKLA 3WMBA 3WNPA 1VEOA 2EABA 3GYCA 1DEDA 3MU7A 1WDPA 2QLYA 1ITXA 1V03A 1H11A 2CBIA 4LYPA 2JF6A 4H41A 4BCEA 1JIBA 1CXFA 1PEZA 4UFHA 3D4ZA 4W87A 5TD4A 3N1AA 3TV8A 2J8FA 2ZWZA 2WCGA 4TVUA 1E4LA 2EPMX 1VAHA 1RD6A 4AZBA 4BA0A 3W26A 2GK1A 3WQ4A 3DDFA 2WMFA 3U5YA 2NT1A 2XYLA 1HVXA 3M7SA 3AZRA 1M03A 1BYAA 1HKMA 2BVTA 3CUHA 1BPLB 4NI3A 2XN1A 1R86A 2BFGA 2D24A 2W63A 1V0KA 3DDGA 3LXCA 3ARQA 1CGYA 3TTYA 3VX1A 4URIA 1E4IA 4PTVA 3UG5A 1JNEA 1E3XA 1QNQA 2E40A 3EDFA 1WP6A 1B3YA 3VSTA 4TTGA 3PTMA 1K9FA 3BLKA 2J7GA 5A69A 3HG2A 4PRWA 1KXHA 3D5HA 2WZHA 3A47A 2CCRA 3FHAA 1C8QA 4K68A 5C71A 5JBEA 4HZ8A 1XSIA 4ZE4A 4P8WA 5HXMA 2GSJA 4ZXLA 5D8ZA 1CZ1A 4JL1A 1AMYA 2DDXA 2C7FA 3QOMA 3VGDA 2CBVA 4TUFA 3ZO9A 1GQIA 2WVSA 1H5VA 4GQRA 2G3NA 3BUQA 1EDQA 4FMVA 4F8XA 2VVSA 2WC7A 2XFFA 2HVMA 2J25A 3WN6A 1EO7A 1WNOA 4AISA 1KR0A 4WLCA 2CITA 3LMYA 1V3KA 4PMOA 1BLIA 5A1AA 4YHGA 3WDQA 1VFFA 1BYCA 1V0LA 3ZJ8A 4U3CA 2J7FA 1R47A 1E0WA 3AI0A 2UWFA 3FY1A 1TR1A 1ZB5A 2EO7A 1ISZA 1B3XA 1B90A 3VMPA 1B9ZA 3JUGA 1TVNA 4PMYA 4C7GA 2Y5EA 1WKYA 3EDKA 1EA9C 2UY3A 1UQZA 2XFYA 2IUZA 2ZX8A 3RM4A 1XCWA 2F1AA 1CTNA 2YLLA 1DWGM 4FNSA 3M46A 1PBGA 3CHEA 2JF7A 3GDBA 2WHMA 4BQ2A 2WZEA 4D6GA 2Z1SA 4P7QA 2VX5A 4JCMA 2X2JA 2VTFA 1U33A 4WKAA 3DYMA 3SUSA 3WY3A 4H2CA 1R87A 1WZMA 3VVGA 1K6AA 3ZSTA 3VIMA 5A8PA 2MANA 1HWWA 4AC1X 3WEMA 4MB3A 2OLHA 3WF1A 3TTSA 1MXDA 1L0PA 1H0IA 4AD4A 1NM9A 1E4NA 1UR0A 1EIBA 2ZXAA 5E70A 3W27A 2XIIA 2WMKA 2D73A 3KZSA 5E0CA 4HA1A 1W3HA 5EMYA 4J28A 4W8LA 2E0PA 3CZLA 3WF2A 3BAKA 1JZ5A 3EDEA 5LA0A 4U33A 5LA2A 4AMCA 3UEQA 4NXSA 3RIKA 1E15A 3T2PA 1CDGA 1E72M 3UR7A 2J79A 2VQUA 3HG3A 1NP2A 4TVDA 1F4AA 3BLBA 5IHSA 3S6TA 4LPCA 3MV01 2J62A 3BVWA 1BYDA 2ESCA 1E9LA 4HTYA 5CSYA 2WBKA 2WYSA 2NSXA 1CBGA 1E6NA 1ZBWA 1UUQA 4V27A 3RPMA 5A95A 1KTCA 1TG7A 4GQQA 5D9OA 3ARPA 1JNDA 4RE2A 1HIZA 1SZNA 2F7RA 3BUPA 1PJ9A 4WKFA 5LYRA 3KL5A 4CGTA 3CZSA 4D71A 5AYIA 3OGSA 2CXGA 3CUIA 3LXBA 1ISWA 4GPNA 5I24A 4AZCA 5CGTA 4DO4A 3OZPA 3VM7A 4BF7A 1QHZA 1FHDA 2WKLA 1S46A 3PZ9A 2F7OA 3N04A 1IV8A 2ZUUA 4HMDA 4X0NA 3AS0A 1BVZA 3T08A 1UA7A 3VGGA 2QMJA 2X2IA 4WSJA 4AD0A 1BYBA 3WIJA 1CYGA 1JI1A 3RJXA 3AMCA 1JAKA 2FDMA 3KEHA 4DM2A 4CUCA 2O92A 4HZ7A 2J78A 4ACZB 1W9DM 3CZEA 4M80A 4PBGA 3AXXA 2B31A 2DH3A 3T0BA 1D3CA 3BAJA 4H04A 1XHGA 4UQDA 4BQ4A 4A3HA 3ZIZA 3N11A 1HT6A 1UD3A 3CHCA 3BAWA 4H8VA 4Z2IA 4UFIA 2VX6A 3VMOA 1H3GA 3OA5A 1GOWA 5IDIA 4QCEA 1ESWA 1Q6GA 3FAXA 1C93A 1GVIA 2WHKA 1FH8A 1OM0A 1BSIA 3AIVA 2PWGA 2VO5A 1R85A 3WH7A 4QAWA 3WNMA 1LWJA 2VL4A 5E6YA 4DO5A 5CLWA 3VDAA 1E1FA 3A6OA 3OLEA 1V6UA 2WMIB 3DYOA 4IM4A 5A6BD 4UOJA 4UNIA 3AMKA 2XN2A 5BCAA 5ABEA 4W86A 3CZKA 3MI6A 3WEOA 3PHAA 3CHFA 3WQ5A 2WMGA 3GNOA 4WF7A 3K8KA 1VRXA 4LQ1A 1QNOA 4U3AA 2CEQA 3AHXA 1CXLA 1QNPA 2G4FA 4IUGA 2BY0A 1NOUA 1X6NA 3TP4A 1LG2A 2ZXBA 1H49A 1PPIA 3LPGA 4OOZA 3A4XA 2OSXA 3WF4A 4XUYA 4GZIA 2YFOA 5F7UA 3I3DA 4QLKA 3VIHA 4NZJA 1B0IA 4LXFA 1VFOA 4FLQA 3T09A 1HF6A 4HA4A 3WSUA 2WHJA 3LRMA 3FN9A 3AMDA 3AHZA 5I77A 2ZX6A 1W1TA 2O9PA 1JL8A 1H0GA 4QFUA 4D1IA 1B3WA 5A6AA 4J7RA 1SFSA 3WD4A 3A4WA 2PI6A 1MQQA 2X09A 1GHSA 5CPSA 4H8HA 1EDTA 4HA3A 3II1A 4CVUA 4PTWA 3AQUA 4B3LA 1TE1A 3D52A 4NZCA 2GFTA 5BYWA 3TA9A 2J7HA 2FHFA 1OBAA 3ZJ7A 3W37A 4MPKA 3WENA 5CPQA 3WDPP 2YA1A 4ATDA 4MDOA 1WB0A 1JF5A 4V28A 2XUCA 1CPUA 4FF5A 2J7CA 1KXTA 3L4UA 2WM0A 2O9TA 1V02E 3PZTA 1F4HA 2D0FA 4MNJA 1FHLA 2D0GA 4GI6A 3WBEA 4HP5A 2VVNA 3VGBA 3PTQA 1JXJA 1B3VA 2V38A 2VJXA 4AD5A 4W88A 1OSEA 1Q6CA 4KH2A 1R8LA 2WXDM 3CZJA 3WD3A 3ZJKA 3B9EA 2F61A 3BVTA 4EKJA 3T2QA 4ML4A 3ZQ9A 3RM9A 2BHYA 3WNKA 1OGBA 4Z2LA 1GORA 4AMXA 1VIWA 4PMRA 5EFDA 3ZT5A 1XH0A 3BSGA 3WF0A 1ZJAA 3WDIA 2WLZA 4W8BA 1JFXA 3W81A 2XN0A 2RGMA 1MW0A 3VIFA 5AC5A 4R5EA 2EQDA 2IXVA 1Q6EA 3RCNA 3A4AA 3WFZA 1D2KA 2VCCA 3L4VA 4F66A 1UH4A 2J74A 4PCTA 1HVQA 2PWEA 5A8OA 1GPFA 4W8AA 2ZWYA 4PSPA 2PWHA 1UR1A 4BS0A 4W7WA 4UOZA 4D72A 3VO0A 3ARYA 1NARA 4CN6A 4D6HA 3IJ7A 3ZR5A 2PBOA 1QX1A 4LYQA 3CIVA 1VFMA 1EOKA 1W9PA 1EQPA 3A22A 2EAEA 3HZ3A 3N15A 1E5NA 1CXIA 3H54A 1QI3A 4U5KA 1PAMA 1JDCA 4FNRA 4HMEA 2VZTA 1O7AA 2V5DA 2D3LA 4MNLA 4CCEA 1G94A 1TQWA 2VCBA 3OB8A 1U30A 1BVNP 1QW9A 1MFVA 1NWRA 1HXKA 3LRKA 3I3BA 5AY7A 3ZSSA 2Y24A 4J3VA 3CV5A 1HXJA 3B9DA 2CNCA 5A6SA 2W67A 2DH2A 3VGEA 4M8UA 1R46A 1GOIA 3TTOA 1QNRA 1CEOA 4OJYA 4EAMA 2VMFA 1HJQA 2XSAA 2CBUA 2XIBA 3CMJA 1I1XA 3NDYA 1I1WA 4N42A 5BWFA 1P6WA 1E6SM 1LQ0A 1E6RA 4KGLA 2XVPA 4AD3A 5A6MA 2PWDA 3BUBA 4X9YA 2BS9A 4JL2A 1KWGA 4OGZA 2V3DA 2A3BA 3DX1A 1UD5A 3LRLA 1ISVA 5IFTA 1H4PA 1LF1A 3WDJA 1VFUA 4FLRA 3GNPA 1NH6A 1B2YA 3BH4A 5I23A 2ZXDA 2ZUVA 1E1EA 1TQTA 2CYGA 4GI8A 4OBSA 3W6MA 1R34A 1FA2A 1RPKA 3VIKA 5GNYA 3OLDA 3VDBA 2Z1KA 4N0RA 3AZTA 1J0JA 1MQRA 3GBEA 4UFMA 4KMQA 2EEXA 1TZ7A 3SURA 1HJUA 5GNXA 3IJ9A 1HX0A 3HG4A 3RMEA 2J4GA 3F5KA 5CLTA 2GJRA 2UY2A 2O9OA 3GZAA 1XD0A 1J10A 5A6BA 1KGUA 2VX7A 3WKZA 4CU7A 1G9HA 3K8MA 5A94A 3OLIA 3ZT7A 3FHQA 4LYRA 5M03A 4JCLA 5A6KA 3PZVA 2AMGA 3G6MA 4PMZA 2VRJA 2DT3A 3OGRA 3VD7A 1ZBCA 5A2AA 1G0CA 5A3HA 1V0NA 3BLPX 1C90A 3OLGA 1NP0A 2W61A 2GVYA 4MNKA 4ACZA 3J7HA 2VC9A 1TCMA 2X05A 4AW7A 7A3HA 1TMQA 1E71M 1UR9A 1BTCA 2J77A 1C3FA 1V3IA 3S5ZA 2XGBA 4ATWA 3WBAA 3WH8A 3SCRA 1V08A 1GVYA 3T2OA 2OWWA 2YDSA 3PTKA 4PMNA 4AXNA 3DX0A 2ZUWA 3BAIA 3WUEA 2GUYA 1M53A 4UQEA 2WSKA 3VD9A 2WVUA 2OYMA 4OUEA 2E8ZA 2IXUA 1UD2A 4B15A 1W1YA 2JFEX 1AVAA 3THDA 2WMIA 1XCXA 3W28A 4M29A 1PZ3A 1FP9A 3VKKA 3BXWA 3VIGA 3U7BA 3SCUA 3W53A 4W7VA 2YOCA 4HPHA 3MANA 5E6ZA 1I75A 1TVPA 2E9MA 3L4XA 5FL0A 4MNMA 3SCTA 4UQCA 3NSMA 3ALFA 2EPNA 3T0AA 1DWFM 4HU8A 3L4TA 2DEPA 3IGUA 3MSDA 1TQUA 4DWSB 2Y4SA 3H53A 2EPLX 1BAGA 1LLOA 3LPPA 3DYPA 2J7EA 3W38A 4NRSA 3CZNA 5FCZA 4PTMA 2DSUA 1K9DA 1SMAA 2ZX7A 1LL4A 2QHAA 3KLLA 1E6QM 3SCSA 1UR8A 5I78A 5A6LA 3EJQA 2G3MA 3N17A 2ZOXA 3NJ3A 1EH9A 3HG5A 4PN2A 4CVWA 4AZ6A 1RP8A 4U2ZA 2WVVB 3WQ6A 4DUXA 4E4PA 2Y2WA 4AD1A 4P7LA 1VBUA 3GBDA 2WK2A 4J3UA 4U5IA 2FYVA 1Q4NX 4CD5A 1FOBA 1WCGA 5KEZA 1QI0A 3F5LA 2FHBA 1EQCA 1W3LA 1J0IA 3AROA 5M3WA 3CBWA 1WZKA 3WMCA 3GXFA 2XVLA 2QMKA 5D8WA 4DWSD 1QI4A 4OIFA 4W5UA 2EPKX 4ZFMA 4DUWA 4MB1A 1E55A 4ZXOA 3MUAA 1OWQA 3QGVA 3SUTA 2OW6A 2DSWA 2ZX9A 3N18A 5IHRA 4M82A 2O9RA 1LWHA 1TQSA 3QHOA 4P7OA 4PMQA 4AZ7A 3MUY1 2CKRA 2XG9A 3ZM8A 4CD7A 4M1RA 1G1YA 5D9PA 3AYRA 2BVYA 1UWQA 1B3ZA 5KZ6A 3U5UA 2VZSA 1GJWA 1CXEA 4FNQA 4DWSC 3BVVA 4AY1A 4J27A 5D9NA 3HN3A 3WD2A 3AOFA 1IT0A 3ZMRA 1AQHA 1ZJBA 1XRVA 4F9JA 2OYLA 4XZWA 3VSVA 1UYQA 3VMNA 2WAGA 4ATLA 3N9KA 3AMLA 4FNTA 5FOOA 2WNWA 3POCA 2YLAA 1W32A 3ARVA 1VBRA 1V02A 1IZKA 1UZ1A 2WCAA 4QP0A 3OG2A 5BRPA 2E4TA 4MJ2A 2WC3A 2DT2A 2VZOA 3WD1A 1OGGA 1KXQA 4NSBA 3GH7A 5FIPA 1XSKA 1WDQA 4YN5A 2D1ZA 1C7TA 5A8NA 2ZXQA 2PWFA 4AZGA 1GQKA 1W9UA 4HOZA 1E56A 2AOSA 1UKPA 5HDRA 5A2BA 4E2OA 4HOXA 1ITCA 4HPGA 3SEPA 4Y7EA 1DWIM 3WDRA 3K4DA 1JAEA 6CGTA 2PC8A 3AIWA 3L2LA 1DWHM 2YL8A 5BXTA 1QW8A 1DHKA 3GXIA 1GOQA 3CH9A 2CBJA 3K8LA 2YL9A 1XYFA 4XZBA 2YL6A 1CXHA 3D51A 2E9LA 3EJRA 3VIJA 2DT1A 1X1NA 1QOXA 1HP4A 1O7DC 1QBAA 3ZT6A 4HOWA 4MJ4A 4LX4A 2UY4A 2V3GA 1UKOA 3NYDA 4JAWA 2YBUA 1Z32X 4EE9A 1XH2A 2VUYA 3EYPA 3EDJA 3QOKA 1H41A 1V6XA 4RE3A 1EO5A 5CGMA 5E0FA 4CKQA 1QWUA 2A3AA 2WLYA 3AIEA 3HU7A 1VEPA 4B9YA 3GM8A 3THCA 2JE8A 5A8MA 4QLJA 2YL5A 1PIGA 1JYWA 1GOMA 2D0HA 1E73M 3VD3A 2Y8KA 1NWUA 3CUJA 2VCAA 2WC4A 1KBKA 5CXPA 3B8SA 2ZICA 5EFFA 1BG9A 2OW7A 2BHUA 1E4MM 1XYZA 4ZEPA 1TUXA 3D3AA 5DT5A 2E3ZA 3PZIA 2F8QA 1BGAA 4JHOA 1V6WA 3UETA 1V3LA 1UWSA 3AFBA 1E3ZA 4LGXA 4MAZA 4UR9A 3VIOA 3AS1A 3EBVA 2A3CA 2WW5A 3WQVA 2XFRA 1OINA 3GH4A 5CG0A 3DX3A 3FXYA 4L4OA 3TTQA 2RGLA 2FE0A 3CZGA 1W3JA 3DHUA 2WHLA 1J0HA 2BV9A 4AIUA 1KGXA 3WDHA 3EJTA 4YPJA 3WNLA 1E70M 3CC1A 1OT1A 1KTBA 1HNYA 4TX6A 1OIMA 3NIYA 4Q7NA 4S3JA 3BCDA 1W91A 4FNUA 4CU6A 4B16A 1UHVA 3IJ8A 1J11A 1UR4A 2WCSA 3VPLA 3SIMA 3SCNA 1OB0A 3AYSA 4D1JA 3A23A 2VRKA 1UKTA 2XVGA 2YJQA 3PZMA 1GQJA 2CKSA 1CGVA 3ARRA 3WY2A 1B1YA 5EB8A 3F5JA 5CZKA 5JBFA 1O6IA 3DC0A 7CGTA 3MKKA 1V3MA 2J7BA 5GNZA 1HJWA 3M07A 1MW1A 2ZX5A 4D6IA 2X2HA 2EACA 2J7DA 1GOOA 1E0VA 2BY2A 4JFWA 4D6DA 5GQBA 1OCQA 2WZIA 3RILA 4QDMA 3DX4A 1UWIA 4WJXA 1E43A 4NRRA 2E9BA 2X0YA 1XH1A 2VNCA 3ARUA 1WPCA 2BHZA 2J8GA 2WSPA 2VR4A 5D4YA 2YBTA 4HMCA 2VI0A 4DWSA 1W1VA 4Q22A 4FLOA 3IAPA 1W9XA 3EMQA 2A3EA 2DSKA 2ZE0A 1UA3A 1ISYA 4RL3A 2D23A 1MFUA 4AZIA 3MV11 1JYXA 4BZYA 1JYNA 3LPFA 4JKMA 1HL8A 1PZ2A 5C8BB 2CETA 2W91A 1EXPA 4DUVA 3AIRA 4AWEA 2G3IA 1V3HA 1GZJA 1CWYA 1X6LA 3PBGA 3QHNA 3EDDA 3AICA 2OSWA 2W5FA 4IPLA 1SR0A 2W62A 4D6CA 1WAWA 2WVVA 3VDHA 2TAAA 3VGHA 3WH9A 3CHDA 2FH8A 2VT0A 4NF7A 5DMYA 3U7VA 2V5CA 4U2YA 2ALWA 2ZIDA 2GJXB 4WKHA 1FP8A 4DO6A 2C8NA 3RDKA 1LJYA 4JKKA 1BHGA 1HJXA 3ARXA 2AAAA 3PZUA 1HKJA 5E9AA 4CU8A 3AJ7A 3MS8A 1XD1A 4W93A 4RE4A 1QBBA 4AEFA 4OKDA 2NT0A 4P7RA 2V3EA 2PF0A 4PCSA 3UR8A 4QCFA 3DECA 4F79A 3WUBA 2BY3A 5BXSA 2YA2A 1J9YA 3QR3A 2G41A 4UFJA 1NWSA 1V0MA 2ZUMA 1OT2A 1GW1A 2G8ZA 3WL0A 5HPOA 4NZFA 5D9MA 3WFLA 3VIPA 1T0OA 5CPTA 1GNXA 2WWDA 1KBBA 2FH6A 6TAAA 2ZUNA 1QI5A 1PX3A 4ZE5A 4EK7A 1WO2A 7TAAA 3CMGA 4TVCA 1BGGA 4CCCA 5GPRA 1RP9A 2E8YA 1GJUA 3BMVA 1J01A 2QF8A 3MO4A 2DQXA 5ABFB 4Z2KA 1UWTA 5JBDA 3WL1A 5I2UA 3HMCA 3ECQA 1ZS2A 1Y7VA 3AHTA 2CPUA 1BG4A 2DIJA 3BC9A 5BRQA 3W25A 4ACYA 1R75A 1LL7A 1W2PA 2DSZA 1E40A 3LX9A 4YHEA 3L4YA 3UCQA 4MADA 2X2YA 1MQPA 1YQ2A 4JFUA 4A4AA 2PB1A 1VJZA 1JZ7A 3VOCA 2XWEA 1W1PA 3VNYA 1DWAM 4Z2JA 1CGXA 1GUVA 3WQWA 4GO9A 1QNSA 3KE0A 5DT7A 3CGTA 2PBGA 1WE5A 4GZJA 1V6VA 4PEEA 4MDPA 1C8YA 2XSBA 4B3KA 5AC4A 1HL9A 4KRTA 2IGTA 2EPOA 2FGZA 3D4YA 3FAWA 4CN1A 4GKLA 1ZL1A 2XVKA 4W84A 3UERA 5JUVA 3WY1A 1HN1A 3AIUA 3CLWA 1KFWA 4GI9A 3GXTA 1CLXA 1U2YA 1V3JA 3N13A 2XWDA 3AZSA 3CO4A 4D6JA 4BQ3A 2QV4A 1G5AA 2F7PA 1FFQA 5CJ5A 1W9VA 3W4RA 1TA3B 1QWNA 4E8DA 4J3TA 3MSGA 4D6FA 3GXMA 4H7VA 5BXRA 3HJEA 2GDUA 2VR5A 4UQBA 1BQCA 1VB9A 1PIFA 1PS3A 3CPUA 2EBNA 2ZUSA 5DFAA 9CGTA 4UFLA 1GOKA 1EDGA 5ECUA 1UASA 3M6DA 1QPKA 4WIWA 3KL3A 3MUZ1 1KR1A 3L4ZA 2CERA 2XPKA 3VD5A 4P8VA 3BUIA 4KWUA 2J47A 4OOUA 1EHNA 1PX4A 4UZUA 2CESA 2XJ7A 4AYGA 2BNJA 4A3YA 3FW6A 3VSUA 2VX4A 1KB3A 4AD2A 2D3NA 4PYSA 2WMHA 2HISA 3LPOA 4V2XA 1H2JA 1AQ0A 1HKIA 3BAYA 2CHOA 4PMUA 3K1DA 2BXZA 1ZBKA 3SUUA 2D22A 4M24A 3LXAA 3WH5A 4W5ZA 3N12A 3AMGA 4GIAA 1QHOA 1M7XA 1JD7A 4AZHA 3WUGA 3DHPA 8CGTA 1HJVA 1JDDA 5BROA 1HP5A 2VRQA 4MB5A 2BXYA 4PSRA 3A21A 1KWKA 2UY5A 1JF6A 3UESA 1UD6A 4FLSA 4GO8A 4AIEA 5HOSA 1MWOA 2F2HA 2QPUA 2BVDA 1VEMA 1QVBA 4NXKA 5HBFA 5HPCA 5CQ1A 1US3A 2X1IA 3VUPA 1UD4A 3W24A 5EBAA 4EANA 1JG9A 4AYSA 3VDCA 1V6YA 2VZUA 1JDAA 3PZGA 4CN4A 2WB5A 4D6EA 3GXDA 3PZNA 3VNZA 2W4XA 1B31A 3WF3A 1UOKA 4W89A 3ALGA 2XGIA 3BGAA 3NDZA 4JIEA 3T0DA 1OGSA 1JXKA 1CECA 3PZOA 2VQTA 1M04A 2JEQA 2OWXA 1KGWA 3SCWA 1UD8A 3S5YA 3BSHA 5C70A 1PX8A 4CCDA 4OBRA 3OGVA 3BVXA 4UFKA 3QHMA 2GK1B 1CLVA 2DGAA 1HKKA 1R7OA 3CUFA 2FHCA 4PUEA 1VJSA 4ZENA 1EOMA 1UG6A 3U57A 4AZ5A 3MMDA 1ODZA 2WPGA 1K9TA 3ARSA 3B9AA 5JIPA 2OYKA 1C8XA 3CZ8A 4E8CA 3SCVA 3GTNA 4B9ZA 3RM8A
chains in the Genus database with same CATH superfamily
4XZUB 1PS9A 1C08A 4AGLA 3D4CA 2DQHH 4KKAC 2WXOA 3KPNB 3TXZA 3GR4A 1AGEA 3IB4A 1UM6L 5FYKE 2I7SA 4LSTL 4N5UA 2OQYA 3PL6D 2FIKB 1V55B 3OC8A 3KGSA 1JF1B 1BMGA 2G95A 2X12A 1JK9A 4DBUA 1FORL 4XZ9A 1ZCCA 3JS3A 5LVEA 1GHRA 4QOKA 2Z6FA 3O8XB 3W7LA 4XZHA 1ZU8A 2GJXA 1OC5A 1Q7MA 2J8OA 2HKAA 4F7PB 3UY8A 1F45A 4RSVA 4PB9H 5E8DH 1N7MH 3UXAA 5I73B 4U0QB 4TRPL 3MRLA 4KO6A 2OWCA 2RUSA 5F7EH 1RSCA 5E8NB 1NJJA 1EFXA 5REQB 4FXKA 3OZOA 4KW2A 4HS8L 1H7NA 2BGQA 4BH8A 8RUCA 3MJ9L 1TWWA 4X7FC 1O68A 4FK9A 1YNTF 5AYZA 4FR6A 2NNXA 5A8QA 5J9PB 1RU9H 2BCKB 1UYWL 1XDJA 4H0HB 4LIQE 2OSLA 3NSXA 4H8UA 1KTLA 5E99L 4AMAA 2BGSA 1IRAY 4FG4A 4G7YL 1QRQA 5FK9A 4GQPH 5AYTA 3DRTA 4I2XE 5DC0A 4S0SD 4AQLA 4IISA 2H2PC 3BGMB 5I1DA 3CXOA 2PF6A 4PZVA 2VM4A 2A3HA 4P5TD 4IPNB 4NO0D 2ZDRA 4BELD 3RFZA 1BQUA 2ISFA 2YPVH 1H3WM 4GVHA 4AGPA 3UMTA 3TQ0A 3HMWH 4S1RH 1CZ8H 5HYJB 5J5DA 2LLGA 4PS8A 4LVBA 4PIBA 1FL5A 4S1DC 5BVJB 5HMDA 1BECA 3SY0A 1L7IH 3TZNA 4LRNH 5EZJB 4KVNL 1K4GA 1X98A 3AQYA 4NX0A 3TL5A 1ZBVA 4N25A 3BARA 4YE4H 1JHTB 2Z4QB 4BZ1L 4YFDB 4JTEA 3CHQA 4PL1A 4JDEB 3L3KB 5CJQH 3QA3B 4B5UA 2RDWA 1D7KA 4YO0A 2FX9H 5D7HA 4UNLA 5A2CA 2GQ9A 3NJGA 3C6LC 3QGKC 3WLQA 4I3RL 2J88L 3EWZA 2N7BA 1ET7A 3HB9A 4PMDA 2NYZA 3CIWA 5CEYB 3S36X 2R2EA 3IDYB 3PVFA 5F7MC 3SCOA 3I6LE 3R8GA 2AXJA 4ZBJA 1TQVA 3OKMB 3U6XS 1AD9B 3GYCA 4L4VE 2CBIA 3LQGA 1VHNA 3BZFA 2G5BA 4GG6E 4XCCL 3BW9B 2AJZB 1Q0XL 3LYRA 4GYPC 1PU0A 1E67A 4WUUA 2XZQH 4AZBA 4QSFA 3N1PC 3GJFB 4G7VL 4OI8A 4HJUA 5IHBA 3KWWB 4ZDHA 4MJHA 4AVKA 2XV2A 3LH2H 3G24A 2ZZ4A 3IJLA 3N40F 5GGSY 2IOIA 3F5WA 1S7QA 1E4IA 4HCDA 1J7VR 4PTVA 3TWCH 3TBYB 4DKFL 5JHDE 4FMFA 4RMQA 1K9FA 1ZOXA 3FSTA 2YZRA 4PRWA 1KXHA 1OKEA 5I18H 1YG9A 2AEPL 3IPEA 4B4FA 2WJ5A 2QADD 2MQ3A 3FQUB 2OJ1A 1R0MA 2H47C 2F9BT 4WO4D 1I4NA 1VF5C 2QT6A 3JW7A 2PTDA 4ZAKC 3GG8A 4Y8AA 3TA3D 1TU2A 1WNOA 3QGAC 2GBUA 1YNLH 1RJCA 1AJ2A 5JIQA 2ODHA 3C87A 1KIQA 3RWJB 4PRBA 3BIBX 3WTUA 1J2BA 1TR1A 2VWSA 2H0FA 1FXQA 1RKRA 1I2OA 3QUMA 1XYLA 3HN8A 1WAEA 5B8CB 2WBXA 3LIZL 5FCSH 2UY3A 1UQZA 4KCUA 4NQEB 2ZX8A 1QPQA 4B9JA 4IOTA 3P9LA 1B0RA 4UNKA 4PJDE 5RUBA 2EEAA 4WXZA 3VWKD 3R4DA 1WZ1L 4EPEC 3GRWL 4UMAA 2Y06H 4AQ1A 4YMPA 5TE7L 3ZE2E 5I66A 4PUJA 1TPXB 3MNWA 3IGKA 3M0HA 1DTNA 4JTDA 4YPGB 5K9JH 2ZXAA 3SJVA 5E70A 2XIIA 4B9PA 3LKSA 1OQXA 3T40A 5TIMA 3QEQA 3BAKA 2QUUA 4L9LC 3EX3A 3AW5A 4G2DA 5A2KH 1SRDA 1UOWA 3S9ZA 4B5EA 1GGIL 3RAJL 4LHJB 4W68A 1AXTH 2YGPA 5DVOA 3PP3K 4PJHA 2WZAA 5AOZA 3BE1L 2FTPA 2AQVA 2QKIB 3ESNA 4UF7C 4KITB 3PPEA 2IH1B 4F7EA 4ROQA 1PTAA 2PP9A 2YJLA 3CZSA 3EJZD 5I6XB 5HANA 3DBPA 2AV1A 5DK3A 4GKNB 3RLGA 5D1ZD 4H8WH 1GZPB 5D1XD 3A9BA 3NFNA 3MLZH 5I2IA 5AZUA 1MCDA 4DPPA 5CG7A 3FVMA 4JREC 3NFPA 4AVIA 2XWCA 1NCIA 4DI8A 5FM4A 4JNZA 1XQ4A 1C12A 3VKCA 2AQ1A 1EK3A 4J8RA 4JDZB 4FQLH 1K7EA 1W9DM 1FWWA 4PBGA 4TVPD 4N90D 4ZFOB 3R8QA 3UZXA 1HT6A 4GVGA 3HV9A 1H3GA 3MLVL 1AFSA 1GOWA 5AZ0A 5FA4B 5HY9B 1LWJA 4DO5A 1K70A 3BP5B 4ANKA 2H32H 3GI8H 4LU5H 3TQVA 3C8KB 5BCAA 3WEOA 4ZQKB 3LEXB 4IRSB 4HSHA 1MLCB 3GNOA 4DJEA 3KYNB 1IBBA 1CXLA 2NYYD 5CIPH 3DPBA 3GMLA 3TP4A 2ZXBA 4HLZG 1WBXB 4KWWA 5L6YL 2YR1A 1TIMA 3CQQA 2GIMA 4DP7X 3KVMA 3L1OH 3A4XA 2MPAH 4NKIL 1SXZA 4Y9NA 3I3DA 4QLKA 3HKFA 1B0IA 3WIIL 2VN7A 4FLQA 3QZWB 3KD4A 4MZ3A 3U7AA 3FN9A 2E46A 4D1IA 1KFLA 2F6AA 5I1EL 3WD4A 2QXWA 3H2FA 4GMSH 1QR7A 3MLWL 2BWGA 1FRGH 3MW7A 4E8GA 3G04B 4DP2X 1ZE3C 4PTWA 3NVTA 4A39A 4UT6L 4LP8A 2C1PA 3MUXA 4PRPA 1UWGH 4WGKA 4KK5C 4J6IA 5BV7H 2PDWA 5J6HB 3U2OA 1H5BB 1N9PA 3HAEB 5F8RC 3WBEA 1YEDB 2XZAL 5CS7A 4JYEA 4LBAA 2WWNA 1UZDA 4RRPG 1O60A 2JV6A 5AVHA 3PP4L 5C07A 3WFHA 4R83A 1U5HA 1R3KB 3QV9A 5F44A 2QQ6A 3DTXA 4J6RH 1NIFA 1XH0A 4BCXA 4KT2A 1ZGLP 4Y2OB 1PTZA 2R0ZH 3SDCC 3BN3B 3NM3A 4NQTA 4ZTPL 3I02A 1OSPL 4GGBA 2BSBA 2PWEA 4PGJA 4W8AA 1MFAL 1I60A 1L3WA 1UR1A 4UOZA 2A4AA 3VO0A 3U9WA 2PCEA 2PBOA 4C6CA 1V5XA 1MLBB 4IOIA 1W9PA 4RXGA 4FNRA 4Z7OB 1MDRA 3LJ3A 5IMLA 1ACXA 4L2YA 4I0PA 4AJ0A 3QG7H 4F5CA 1S5MA 3GSNA 3CZUB 3DX6B 4F7KA 5JUEH 3FKKA 4Z1AA 1KG0B 3UTSA 3VXMD 3W5MA 1MQ8A 1OO2A 2VW7A 1P6WA 3DI0A 1J8RA 1MCRA 2H1XA 2G5RA 4DSYA 4FFYA 3O11B 1ROWA 4AMKH 1FZKB 2QGCA 2JB5H 3GNPA 2X6MA 1ZT4A 4L1XA 1MZZA 1E1EA 1W8OA 1E65A 5F1NB 5IW6A 3UZZA 5B7MA 5KYXB 1PKMA 3PBMA 2DQWA 3F3HA 1PAZA 4PW9A 3S35L 4X83A 2Q09A 3PGFL 3DIFB 1QUNA 4KK6D 1G9HA 3NA9L 1KY6A 6PAZA 3HURA 2ZZ6A 4Z7UB 5BW7C 3VUAA 2I5IA 4Q9RH 4D8AA 3WL9A 3SCRA 5HNUA 1BQ5A 1YC8A 3IK4A 1ZA3B 3H22A 4AXNA 3DX9B 4HFUH 4AGMA 1HSBA 2LVEA 3L5IA 2GUYA 4UQEA 5DT1L 4LB4A 1CFQB 1W1YA 2MHAA 4C6NA 4KKPA 4C6QA 3GO1L 4G6KH 1EEQA 4ERSL 3US9A 1MIEL 2YMXH 5L0QB 3NZHL 3NSMA 4J9JA 4HT3A 1I0DA 3HBLA 1YEHL 4IX2A 4XMKL 3LK6A 4NNCA 4W9LC 4BDVA 3RIAF 5CGQA 3B9KD 2FWOA 1LLOA 5HUPA 3F4WA 3LPPA 2PCXA 2R56L 2Q7YA 2Q71A 1VKFA 4XBMA 5AD0A 3FJLA 1GGBH 1MJJB 1S9YB 5LBSH 2BODX 3AWEA 2QHAA 1MH5B 3KLLA 1EH9A 1O7DE 1R5WA 1OL0A 2VHLA 3KR3L 1RQ5A 2ZTJA 2P5ED 4AD1A 4OCWH 3P62A 1FFOB 2NLJB 3T65A 3TR2A 3IU4L 4NQED 1Q4NX 1N6QH 2FFCA 2NDGA 3UIZA 1F41A 3TWAA 4MY1A 1A0EA 1MJUH 1QI4A 3MBEC 3MKCA 2WNZA 3M0ZA 1C5DB 4JG0L 4AUJA 5IHRA 4YK4B 4DHGA 4O4YL 4OF5A 3SSJA 3OTTA 3PWAA 3ELFA 5AVWB 3MV9E 3QRHA 3GSXA 3GDMA 4RZ4A 4KPHL 1K3IA 3E3QE 3H6JA 1Q9KB 3D1MC 4JLRA 4WI8A 2D7QA 3HN3A 1A7RL 2VDLH 4XPTH 1TCDA 4PUWA 3ULUC 4JW3A 3W39B 5IFJB 4KUCD 3VNDA 4OECA 3FYYA 3EO1A 4BQ8A 1IKNA 3BRGC 1SJEB 1PVNA 2B1HL 3KTSA 3FVDA 2QZRA 1S3TC 1A5UA 4NSBA 3GH7A 1W6WA 4C83B 4LJ3A 1GQKA 5FYLE 4PJCF 5MENA 4HPGA 1M2VA 4YBLB 1J96A 1DHKA 3PNWA 3LNGA 3T4AB 4JUSA 4N8VA 4LLYA 4B3VA 1J9TA 4OF8A 2OOFA 2PO6C 4P2YA 5L2KD 1JVNA 1XGRA 1UP2A 3QDGA 2HFEB 4UTWC 4TOYH 5KSAD 2WV8A 3HLAA 1DJIA 3S96B 3IM1A 4G70B 1JYWA 4OZHF 3PE9A 3D18A 3GVRA 3FN0L 2A9CA 5DHDA 2YBVA 3IIVA 3DFSA 4AE0A 2WTOA 5LGHL 4JFFD 3AS1A 2CLVB 1V51A 5BZWA 3LERA 2H0EA 1URLA 3GQFA 5SWZA 2ISVA 1YBQA 4GPVA 2XISA 1N8ZB 4HJJL 3CHVA 4AG4L 4M1DL 2LTQB 3WNLA 4YC2C 1FYTD 1MCJA 3FPXA 1T1ZB 4BH7B 2RB8A 2HRWA 1UHVA 3EOEA 4EP8C 4PFEA 1J11A 1UOLA 5BRZB 5ESQB 1GQJA 5DMKB 5HA7A 4C6EA 3UBXB 2JJVA 1QRNE 3H2EA 4KCTA 3Q06A 2DLTA 4Z3GA 1GOOA 4HH9A 3LQAC 5JYMA 5A3ID 5AAMA 3WMPA 3KS6A 4RISH 3IMUA 3ES6B 1P5VA 1YMMD 1JFQL 3SB3A 4EOUA 3NCBB 2VDQB 2V30A 3IAPA 4I48A 3FJ6A 1JPTL 2DQIH 1OARH 4OGAD 1OB1B 4FL4C 2B7OA 4WGHA 3QNZB 9XIAA 4ZYKB 1F86A 3G5WA 3LPFA 4M3JA 2HFTA 1CWYA 4NP9A 3LGDA 1F6KA 1XDLA 4HSCX 5GGTL 5G4NA 5DQ9A 2CIIB 1XIWB 5JVLA 4XQ6A 3T81A 2G9HB 5K9CA 1SBBA 4MWAC 4HWZB 4ZQCA 5FF2A 1T0NB 2NPLX 1ZCRA 3FUHA 4QCFA 3OHMB 5G2IA 4W9KC 4EXAA 5CJXC 5IROA 3BKML 3WL0A 2CGRH 1BM3L 5HSFA 2XRAL 3GKAA 4X8XA 4DZBA 3RNDA 1ZVHA 3WOVA 4YTUA 4PJ5A 3S6DA 5GPRA 1QWHA 2E8YA 3BMVA 4LMQE 4XPHH 1D5RA 4M51A 4BKLB 2EE3A 3HMCA 4HVBA 4XN4A 4KKNA 3BC9A 1R75A 5A7EA 3HRPA 3O3EB 4MDJA 1SXBA 4C6LA 1AZZC 5CM1A 1E4KA 4M62L 2PAJA 2YBRB 3AREA 4NKOB 4X7TA 1RK0A 2YD8A 4JZOA 1N4XH 3DLQR 2FGZA 1FL3A 4E9QA 3G1DA 5I8EA 3JXAA 4Q3MA 1XSOA 5IKCA 3ARGD 1AGBA 1F4WL 1SLVA 2VDPH 5ESAA 2Y1VA 1R3WA 4IYKA 1QWNA 1XBDA 2JSFA 1H7PA 2AQWA 3NQDA 3PWJA 4BE6A 5JOPE 5C9ZA 1A5SA 3VNMA 2GDUA 3WS3B 1PS3A 4OVVA 2EBNA 4XC1H 3ULVF 2CCVA 1Y5XA 1P7KB 2NY2B 1GSKA 3MUZ1 2EICA 3H0TA 1N5AB 1OF2B 1KFAL 3FW6A 3JWDH 2F19L 4AD2A 3IIZA 2POZA 2QCDB 1NANI 1BQHG 4YJZL 1FZOA 4PL2A 3W1NA 5IMMA 2CRZA 4UXDA 1XF4A 2P4AB 3RITA 3S7GA 5DMGD 4FXGC 3WUWA 3ECUA 4PSRA 3KBHE 1HW6A 5JPMA 1QZNA 3VI3F 2XWXA 3L3JB 1OGAA 3O6LL 4EE2A 3KCWA 4LASL 4C65A 1QDSA 1UD4A 5FM5O 3FJNA 1HOCB 1JDAA 1MFBH 4Z7NF 4G7RB 1B31A 4G8GB 1A6ZB 1PQZA 3HQNA 4HKXA 2HK0A 1JXKA 4WVXA 2DPKA 1BYNA 1YYCA 3HG0A 4RA0C 1KC5L 5CUSL 4GLRI 3T3ME 2VZ3A 1N55A 3BVXA 3DOHA 2MSPA 1WOAA 4S3CA 4FQJH 4L18A 2D3JA 3FTWA 4MIMA 3RTQA 2YCEA 1OPGL 1WG3A 5EWIL 3LXUX 4OFYA 4PRHB 3WV0A 5L88L 1DQLH 2EXOA 1T21B 3W2DL 3SE9L 4XIMA 3LZ5A 5I74B 4PHXA 1ZZMA 1YC7A 1HAWA 2GI7A 2V3FA 3GU9A 3VWJB 4BKTC 2XBZA 3W2KA 4MVAA 1D3GA 1FZMA 1F8MA 4HPJA 4BSJA 3UBPC 3BCFA 4JFEE 3MQIA 4WR3A 2IANB 4ONHA 4S0TD 3DFHA 4UCGA 1JI2A 1QPPA 1HS6A 5EZIL 4GJJA 4PVMA 1I7UB 5ES4B 1OY3B 3PL6C 2FVLA 4RZ5A 2CQVA 1JGLL 3KPTA 1W2VA 3SDXA 3CLFL 3JT0A 1ZHLA 3QV8A 3TX4A 1W37A 3VXGA 2NW2A 1TO4A 1IQDB 1UMYA 2AJVL 4O2EA 4S3KA 3GIQA 1CDJA 1JWUA 3SCQA 1V7AA 2HMID 1DIEA 4UINL 5B7YA 2R6OA 2PGRA 1PYMA 3UL4A 1L9QA 4U6VH 3CTTA 2NV1A 1CMOA 3KCLA 4JFVA 2B81A 2VDKB 2PXYD 2NVAA 3SDAD 2ZTBA 5IB4B 4R5TA 3SPHA 1V4YA 7PTDA 4RFOH 4MZ2A 1NKGA 4FP1A 2R27A 2P5NA 3NZQA 3DO4A 3HFML 5CU9A 1I1CA 2Z6IA 3RUGA 1QHPA 2MJWA 2ZOWA 1YPZA 4B7IA 4B2DD 3N25A 1MVYA 4XMLH 1T5WB 2YFNA 4FN0A 1ZDSA 4LPVA 2IG2H 2BNQA 3S83A 2XWJA 5EOCH 1YRRA 4JTCA 4GFTB 1BGXH 4FJYA 5EC2A 1NSNH 1NWOA 1DP0A 1UT1A 3UYIA 2FIQA 1H7OA 2FIRT 4IBSA 4JO1H 4GFSA 5J1AB 3HZKB 3W72A 5L6UA 1TPB1 3THAA 1BXAA 3FPYA 3K7UA 1S38A 5E8EB 1Z41A 2DZVA 1UT9A 3ES8A 3PWLB 1INQB 4Q58C 5FLUA 4ZUVA 4EN3A 3EPMA 3FU6A 2AJ3B 5C0CD 5IV2A 3LAFA 1CNVA 2Z27A 1MFDH 4TNGA 3QVAA 3UC0L 4CD6A 2JEPA 3CUGA 5DLLA 1C7SA 3OG3A 1P0KA 1Q9OA 3FH7A 4FZ8L 1SHMA 4N2CA 1JUKA 1Q6FA 3K72A 1ZUAX 5LNEA 3Q58A 5FECA 1M2OA 3LTSA 3L2MA 4NY2A 4JFZL 3O4LD 1QI2A 3W11D 4GIRA 5I79A 3HC2A 2J1WA 2WNNA 1CU4L 4AENA 4XP9L 3TT3L 2AFNA 4HUWB 4MQTB 3BQ6A 3U4EB 1V03A 2PURA 3MJWA 2QV5A 3WJWA 4M4PA 2BX7A 3WKPA 3R0NA 4MJIA 1EMTL 3JV6B 2CRIA 4AUBA 4O11A 5LAXA 2BP3A 4QHUA 3BDKA 3BJLA 1XAKA 2UZPA 2DD8L 4GW5B 3DDFA 4MAYA 1YYML 3M7SA 4LCSA 3SZ8A 4NI3A 3BIAX 3ITVA 1RLBA 4XN8A 1QNQA 1CYWA 3WTTA 1T4WA 1B3YA 3TN6A 5EU6A 4JRYE 4XAKE 1P7TB 2JQMA 1IEQA 3O15A 1ANUA 4DEPC 4X5WA 2H3XC 1FWHC 4PA8A 3ILPB 4RZ6A 4NBXB 1FA4A 1OJXA 2X0UA 3EADA 4JPIA 3NK3A 2F5BL 1H50A 3M0IA 1XF2A 2HVMA 3QRGL 2J25A 3DO7B 3H70A 3E80A 4IOSA 3HM7A 2VC2H 5HGAB 1V3KA 3KPLA 1AG1O 3H3BC 4WFGE 3VG0H 2ZCLH 2BDNH 3PQYE 1R47A 2C9RA 3TIEA 2CKBB 2AGTA 2ATKB 2QADC 1EWEA 1HHIB 3H85A 5CD5C 4LFYA 1BXCA 2VEIA 3SKJL 2Y1YA 4PMYA 2DDQL 2X70A 2HXTA 4KZEH 3HTWA 2B08A 1BZDA 2F58L 1B0WA 2RA1A 3TA3C 3NTYA 4FNSA 1TVBB 3QIUD 3S46A 2JF7A 2W88A 4LLUB 3OL2A 3V0IA 1X38A 3GWQA 1XBRA 4JCMA 2GJ6E 1AC6A 2X0VA 1N26A 1U33A 3GR7A 3GHEH 4HWBH 3ZHFA 1TTAA 3W73A 4YDNA 3GRGA 1J8SA 1CDHA 1YN6A 4ABUA 4AC1X 1SMOA 3L12A 5I15L 1SM3H 2NY2D 2J7LA 4X4YA 2VFHA 2WBWB 1E4NA 1YE4A 1XMWA 3D39A 5HATA 1JHKL 4K4KA 3KLQA 3VWKC 1P1VA 1QYGL 3FONA 1WGVA 3U2ZA 1AJ7L 5FUZH 5IW1B 4XP5H 1E72M 4ZNEE 1XCTB 1UA6H 1F6PA 1NP2A 1Q66A 1N3NA 1UFGA 1BQKA 2OZ4A 5KJ7E 1BYDA 1R9YA 4X4ZA 3QYQA 3QAZB 2ED8A 2GK2A 1SEQH 3L6FB 1E6NA 2P8CA 1CI1A 4L8BB 2F7RA 3M1BA 3AWFA 3OPSA 4FX7A 4OU3A 1A5KC 3ORJA 2PDIA 1INEL 4KX8A 1ISWA 4H6QA 3GVWA 4G8GD 3T9PA 1MCSA 2YYTA 4E4UA 2G0KA 1E0UA 3REQB 5AECA 4CNTA 3RU6A 4PGDA 1K03A 1XF3B 3EX2A 3T6VA 4AQ8C 1QT1A 2ZQKA 1BYBA 3WIJA 4NEHB 3UTTA 4GAYA 3QEHA 4YTQA 3D08A 3LMJH 1PNDA 2WGXA 1J8HE 1X9QA 3G3MA 4TSAH 4Y1AA 4PRHD 1SXAA 2A9NL 4WD0A 3N11A 1JCLA 3WUZA 4G3YH 3F04A 1FO0H 4WY7L 4Z2IA 1W1A1 1GVIA 3THUA 2DZSA 4MCZA 2VO5A 4AWSA 4MSWB 1CTOA 3B97A 5E6YA 3VWJD 1IAII 1E1FA 3V5HB 2E67A 1XMEB 3DYOA 4LBEA 1JVOA 1E4WL 5ABEA 1QOKA 4GKZB 4IIBA 5KZCD 2QULA 1IEAB 2IAND 1FKXA 2O55A 3HMXL 2XKNB 3PIQA 4PJ8C 1ECZA 5FDWB 2FB2A 4NHUA 4YZFE 1L0QA 3CNYA 3KZPA 1P7QA 4I9TA 4B5SA 3VRJA 1ZSXA 3DI1A 4GUHA 3LS4L 1RJZB 1Z2KA 3MRIB 5A6AA 1RZQA 2CO4A 3E3QC 4NAEA 2PTXA 1NAKL 2A0LC 1YY9D 2H0PA 5I76A 4Q0XH 3WS6A 4JM2B 4TULH 4DCQB 5IHLB 2QZ5A 4JO5A 2MCPL 5I1AB 4ZO8A 4JANA 5LHFA 2GTWB 1NIAA 2R8WA 4LC6A 2WXGA 2XUCA 3RMJA 1HH9B 5I19L 3EGDB 4GW4B 1IGIH 5HDLA 2Y7EA 1QFOA 1WWAX 5LN8A 3VA2C 5IHHA 4UYQA 4WGXA 3ERXA 3UJFA 2ICSA 1OX6A 2VJXA 4H7CA 5F71A 3MRFB 1AQDB 3MRJA 5CFAA 5KTLA 3PDOB 1BZQK 1YNQA 3QY7A 5B1KA 3T0VA 4GIOA 3FT2B 2CPCA 3CX5J 2IGFH 3W7EA 1KIRA 3B0XA 1A14L 1AS7A 2ICES 1SFLA 3P9WB 1BWWA 1JP5A 3IDJA 3ZT5A 4KROB 1YDOA 1WAAF 5EU3B 2V5TA 3PBUA 4P5RA 1H9VA 3FQYA 4XAWH 2ZWYA 2DZBA 1MAML 3ABSA 4CN6A 5ABAA 2ZOKB 1RIVL 4Y5YC 1A7QL 3OX8B 4RV3A 1KJ2L 4C54A 4Y9OA 2DLGA 5CCZA 2GWGA 4XBPB 1UFUA 1ZANL 1R2TA 3RWFB 1MFVA 1NWRA 4POZD 2NW3A 1PL9A 2VZ1A 4PJFA 5CFHA 3ECWA 4JTFA 3L5JA 2P7TA 2Y07H 2OGJA 1TQBB 1CEOA 4Q7IA 4NJKA 2IFFL 1N64L 1U92A 2DUAA 1T04A 3PG9A 3TNMA 1A4LA 4AD3A 4X6CE 4FTVB 5MERB 1NAMA 1O12A 5I6NA 3DX1A 4XIAA 4ZMXA 3P54A 4KRPC 12E8H 3TIDB 2G4EA 1YIXA 4KXDA 1KLFB 5GGRB 3FKRA 1I2RA 4DZ5A 3ZKQD 4CMMB 3U9PH 1J0JA 3ARBB 3OGCB 3IJ9A 4A63A 5E94B 2VEMA 2X1QA 3F7JA 1W6LA 4EBQH 3NN8A 3IRPX 4N0YL 1J10A 5DXWA 3JU2A 4KQ4H 1BD2A 5GHWL 5F1OB 5A6KA 4WUKH 3IS4A 2BRRH 4GE8A 1AR2A 3DCPA 3QPQD 2WOBA 5CN1A 2YCLA 4YDMA 5HAOA 1VBHA 4X6FB 3GF8A 1C3FA 4C6KA 1K3ZA 1EEZB 3AXLB 1N5YH 2VUKA 5EF0A 1VGKA 3VA6A 2QS8A 1VH7A 3BLEA 4ZMVA 4S2CA 4OUEA 4ZO6A 2IXUA 3MRRB 3DTUB 4M29A 4DP4X 5DHYA 5I6PA 5E6ZA 4Y9PA 3ZDZF 2TODA 3VI4A 2HVBA 1OSZB 1AKJA 2XBTA 4L4LA 4O17A 3N6HA 4NRSA 2DSUA 4LPXA 3NJXA 4H9XA 4OE7A 2ZCZA 2G3MA 4HNVA 3VGAC 3GUFA 4AZ6A 3RGVC 1WBZA 3PWPD 3C6LA 4HUVB 3L4CA 4MQSB 4N2BA 4KKBD 4U7MA 2WK2A 2EH7L 2E25A 3B9KC 1L4IA 1LBMA 1RMFH 1LVEA 2XVLA 1PKQB 5D8WA 4DWSD 5AYXA 1Z69A 1G7HA 1ACCA 5BS0B 4NNXB 1E55A 5SX4H 4PGEB 3ITOA 5FF6B 1QASA 1IAIM 5TE4H 1MEXH 2OYPA 3D9AL 4N2IA 5JLZB 2P5WA 3DJ9A 3NIFF 1I3GH 2XG9A 1OTUD 3D2TA 3C75A 4IMKC 4DZHA 3LBMA 5IR1A 3TYCA 2X40A 4G59C 1X7TA 4JN1H 4LHUB 1MWAH 3K80A 3Q2NA 3OQRA 3WD2A 5EEVA 1OGTA 5FV2A 3BQUC 1HL5A 2HV5A 1X5XA 1LO5B 1LRTA 3SKOB 4NLAA 3SECA 4XZWA 1L6ZA 5IFAL 1B57A 1RVFH 2ZOTA 3VMNA 5IBTH 4AYFA 4OZIE 2WNWA 4LC8A 4PRIA 3ARVA 3OKEA 5BO1H 4H00A 3MRKA 1RQBA 1GPWA 3AB0C 4Q6IC 2X1RA 3G6JA 1BFVL 1E7UA 1ITCA 5C5YA 3SEPA 2IPUK 2EIZA 1T8XA 2EZ0D 5K4XA 1F2XK 3VXSB 1VKXB 2PLKA 5ITBL 3MLSH 3W74A 4M61A 1I8IA 3OHXA 4MS6A 5C08D 2XQYG 4ELMA 4MNQA 1PG7L 3NYDA 1UKOA 1CYXA 5I0YA 1YEKH 1I3RB 3SGUA 4WFED 3TC3A 2WLYA 4NN5B 2WIIB 4Y90A 4FE9A 4LCRA 4PJGF 3ERPA 4Y16C 1FZJA 4A2MA 3B8SA 5D93C 2E6PA 4HUCA 1CI3M 3N73A 3CK0L 1L6FA 3THMH 4R26L 1RBOB 5XINA 2QQNH 5LNUA 1IU1A 4J3OC 4MWAE 4M6NL 5H2BB 2C34A 3SN4A 5CG0A 3WQGA 1RK7A 4MY9A 5F7HA 3NSFA 3CSYA 5KSAC 4QXUH 4K8HA 3Q01A 1J0HA 1F90L 4IW4C 2CLFA 1TPVA 4Y4HB 5HYSB 5D33A 1DUZB 3GSRB 3QDMA 3CFDB 3LOWA 3NIYA 1EXUB 1HUVA 1YEYA 3GSUA 2HFFB 5ELIA 3BWAB 4CQAA 3A23A 3B5GA 4FFZL 3MCLL 4BF5A 4FFYH 3DO3A 5JBFA 3R8BB 5L4FA 1RURH 1IC5H 1XEUA 4D6IA 3W70A 2J7DA 1T3FB 5EYWA 4GO6B 4JG5A 4K3ZA 4D6DA 5FO2A 1F3WA 1VD6A 2BGNE 2DZWA 1DN0A 4PLKC 2WZIA 4QDMA 2SODB 3B0VC 4F1SA 5BVPL 5IOPA 5A8GA 5F72S 4NRRA 4GBXB 2E9BA 5AYYA 1Z42A 3ZYOA 2OEJA 2XV3A 1F3DJ 2XCMC 1PFOA 5IEKB 2A74C 2C5DC 2Q10A 2PTTB 3BWUF 4H13C 2X4RA 1RZJC 1YEIL 3X14B 3BANA 1U8KA 5EU4A 4AH2B 4ANVA 1QO5A 3ULVH 4BZYA 4F7TA 3AIRA 1X6LA 1GZJA 3QO0B 1BZ7B 3S5SA 2WLJA 3VYNA 1P4LB 2WZPA 1REQA 1Z89A 3MFFB 1HU8A 2E5DA 1FIGH 1U4EA 4JKKA 1E9QB 5C1MB 1XBXA 4IMEA 4FRWA 1DE4B 4KROD 4PJIE 2RJGA 4NQUA 2DMHA 4CGUB 1O5RA 2JK5B 4EF3A 2PF0A 3UAJD 5IG7A 1KRCC 2ZCHL 1LM1A 4FQXD 2BY3A 3OBKA 4X22A 4R7JA 2VQ4A 4M5YL 4NHCH 3GMOB 3HG1B 1VP5A 3VXPA 4LV4A 3AM8A 2WWDA 2YPKB 4HUMB 1HZLA 2ITCA 1TV2A 3PP3H 4LSSL 2DQCH 1MVUB 4IK6A 1HILA 1HFBA 1BF5A 4ODSH 2F54E 5EU5A 4Z2KA 2EDYA 4QM1A 3L21A 2PR4L 5JIHA 5KSBE 4LCCC 3I84A 1WC7A 2CDGA 1YEJH 3IT8D 3LX9A 2BOBA 2X2YA 4G42B 1SPQA 1F4YL 1YQ2A 2ZA1A 2O5XL 3NJVA 4ZPTA 5EBLA 4A4AA 3VOCA 4S3BA 4WXYA 4C90A 4NYUA 5KVDL 5CILL 3K30A 1IJ9A 3LSOA 5F7BA 1NMCB 4WEUD 1V6VA 4FTVD 1HXMB 6REQB 1KM0A 2IGTA 3D4YA 2PPDA 3LSCA 2OTUA 2MH4A 2NY3C 1VADA 4Y19D 1V3JA 1SNRA 3TNNB 1LWIA 1ETJA 1Q0YH 2PODA 3MBFA 2VLJD 3RL2B 1S1RA 2A4CA 2R1LA 3EEZA 1GYMA 1N70A 3E6FB 5AZEH 4UFLA 4UBPC 1EDGA 3M6DA 1O5DT 2RJMA 1Y65A 3EOYG 2XPKA 4O02A 1NELA 5H4ZA 3TVMA 3ARGC 3OKLB 1RZ8A 4PJEA 4LNRA 3Q48A 4F1ZA 1O95A 1TCRB 4P99A 4CEUC 1LHZA 2OMXB 1W3TA 5C09A 2ADYA 4RDVA 3TCEA 3ATEA 3K71B 4H9VA 2D22A 4MRCA 3M1CA 4M24A 2FDBP 3SDCA 1QHOA 1R2SA 2G2RA 1S78D 4XTIA 1DBBL 4NX5A 1Y0LB 1UD6A 4FLSA 4GO8A 1U91A 2WSQA 3BK0A 1P1MA 3WKML 2R0WH 1IBGH 2WZ6A 3S47A 3CFJA 3MRQA 2X3AA 3WK3A 1B0GA 1TTUA 5I5MA 3S34L 2R7EB 1TG8A 1UWAA 3WLOA 3NNTA 4NRZB 3B3IB 4P9HL 5G2NA 4UM9B 3GGWB 2V7HA 1MNNA 5FFGA 5CPOA 4EIBA 3SCWA 2E6YA 4PB3A 1TEFA 5IT2H 1CICA 3TAKA 4PUEA 3BZDA 3N41B 4XN7A 1YW1A 1HG3A 1OAYL 3CVHH 4L8SA 1W72L 3NR0A 1AD0A 1A8ZA 1HJSA 2DW6A 2K6ZA 3RB7A 3WG6A 1RCYA 5BS0D 1JZ3A 3AGVA 2CIPA 4G8IB 1I8MB 1D7DA 3OIHA 2X4SA 3AY4A 3L8QA 3CASA 4ERIA 5TH2A 1RH9A 1QBLL 5FKYA 4N1CA 3KM1A 5T5FH 4OCXH 3B37A 5CWSA 4LHUD 4MAUH 3UR5A 2V17H 1OHZA 1X5HA 2C15A 3H9HB 4U3SA 1KB5H 4TNVK 3FNDA 1AO7B 3EWBX 5FHBL 3V4BA 1VZHA 3F2BA 1WISA 2VZVA 3UZVB 3ZVHA 3OZ9H 3TQPA 2IDTA 5EZLA 3DSNB 3VTRA 2JQXA 3RBGA 3EMZA 4H5SB 4XNQB 3EWWA 4GXUN 3D87B 3FRUB 4QR6A 4AXKA 2AXFA 1MRFH 2VR7A 4WNSA 4O12A 5T3ZE 1CW2A 4TTUA 1DQKA 5AKTA 1CIUA 3W9DB 3E96A 5CJMA 5F0MB 3O8XD 2IWEA 1P84K 3OMNB 1O7VA 1A25A 4R96A 1W5OA 5G1YA 5FI8A 5ABFA 5D5MA 4RAUB 3IFLL 4O1BA 2WKGA 3KPMB 1IM9A 4JO3L 3QBTB 4YDIH 1DLFL 2DTSA 4YL2A 5DJCB 1E4XL 3L3GA 1G1OA 5B4MC 5TJWK 3RNKB 1NICA 5IP4A 4Z17A 1SO4A 1DIKA 1Z3GL 3GXNA 3IFOA 1RJPA 4LBRA 2HMIC 3GDRA 5EUOB 5ACZB 4GJTB 5FA5A 2YAHA 2L3BA 5CGYC 4EIZC 3V0VA 2UZIL 5HD8C 1R3HB 1M41A 5EFIA 4AH7A 1XRTA 5CZSA 1M6UA 4Z7VE 2VOTA 2PXYC 1U8QB 4D0CA 2CLMA 3HI6H 2CXKA 4NLHA 3L3HA 2DI9A 4KGJA 4JFXB 2V9TA 2Y2YA 5EZOL 3UWWA 4PUUA 1U0QA 3QUZC 1WXJA 5CZVH 4XO6A 1VFHA 3VNIA 4XC3H 3WCYA 1ID2A 3M9YA 1EYWA 3NQIA 3GS4A 1SYVB 2UWEF 2DL9A 5HMEA 3WGUB 5JQIB 5ERWA 3G0XA 3RR4A 1FL6B 3CYVA 3SUVA 1OD0A 5DO8A 4ICWA 4QTIH 2B1AH 1WRFA 3W2MA 3W87A 5HYJD 3PN8A 2XM1A 4KHXL 2GGHA 3MGOA 1SHSA 2P45B 3FFCB 3B34A 1TZ9A 2KLTA 1XSJA 1K8DB 1A7PH 5B3JE 1FH2A 4QMEA 1JV5B 4Y2LA 1T2QL 3ULAB 3VCCA 2MEJB 2J8UA 1VEOA 3MLUH 2YRZA 4PRNB 1H11A 1PSKL 1EXHA 3SRFA 4H41A 3DX5A 2PO6A 3CSBA 2QPXA 3QIBA 4MYWB 2JKWA 3D4ZA 1HHKA 1DXEA 3TV8A 2J8FA 2ZWZA 1O7SA 4R5VA 5JMUA 4JY6B 3VCLA 2J8TA 1ME8A 1S5VA 1ELSA 1KBGH 2BSEA 1A3WA 4KKCD 2NT1A 2XYLA 3AZRA 2AEWA 1XXDC 3RDTC 5IHWA 2I32A 1JGEA 3BAEL 1GZHA 2QPFA 5H94A 4UIMA 6FABL 3TCSA 3LEVH 4U1JB 2CH8A 2G37A 4OZGA 3ZLGA 1L3NA 2V8MA 3AY2A 4JZNB 2BP0A 4L29B 1KRAC 5H37A 3FHAA 4K8RL 5I26A 2X89D 4EZKA 5PCYA 1LTXA 3MP4A 5CBJA 3K6IA 3A6BH 4ZS6C 4XP4L 4PWIA 1RJYA 5FKPA 1FFNA 1GQIA 3ZKND 3AU1B 4OZ4B 1EDQA 1W31A 3I7RA 4ANUA 5EORH 3LZLA 3SQOH 4ZFGH 3WN6A 1LEGA 3BSZH 4DPAX 4P46B 3G8RA 2ZSVB 4I18C 1KR0A 4ZSOB 3OM3B 4UIOA 1BLIA 4QRRB 4U4MA 1VFBA 4OIIL 1L0YA 3DFQA 2E7LC 3QCVL 3V6OE 1SY6L 1I0BA 4GC4A 4LVDA 5ICZA 2XUWA 3FS2A 2V5KA 3MX0A 3B83A 3W7NA 4WENB 7XIMA 4R33A 3GW3A 2WHMA 3GQYA 5D1XE 5AN7A 2H6UA 1KKRA 4DJMA 1RPQA 5A2FA 3FUJA 2NLYA 3MKGA 3DBXB 3ZSTA 5AW1B 4HIXL 1KBJA 5GZND 5ADOL 3QCTH 4NC2B 2QW5A 4IIDA 3CXFA 5IGXH 1U83A 4QG6A 2VXUL 4N90E 3OXSB 2IDUA 3FB5A 2HVKB 5ID0A 1B9BA 4MNGB 1NIUA 1E15A 4H26A 3UXLA 3WLBA 4H2HA 1F4AA 1T22B 2IQ0A 4WI6A 2BSTB 1RI8A 4LRIA 3BICA 1EC9A 1SJCA 2J62A 3FF8A 4HTYA 4I5XA 3MNZB 2A73A 5D71L 2NOYA 3UH8A 4JPWH 2L7UA 5CP7B 3T9WA 2DWXA 5ETUB 5HDQH 5LYRA 5CBEB 2AK1H 4CGTA 3SSZA 4GY4A 4X80H 4HG4K 2CXGA 4GSDH 5EBMA 2M83A 4LF1A 2Q8AH 2NQDA 5D04C 1RQEA 4B92A 1NLBH 2CO7B 3WIHL 3AG4B 3T08A 1UA7A 4EAYA 4AD0A 3ECBB 3NCFB 1CBVL 5K69A 1N18A 1WWWX 3AO0A 2HLAB 1P6CA 3B4UA 1ASPA 1GIGH 4X4ME 1LUCA 2Z34A 4YHLL 5AW6B 2OO6A 2JTDA 3BAWA 4P0DA 2Z9TA 3VMOA 4L5ZA 1BDYA 1BOYA 3MRDA 1C93A 2I9LA 5DUPL 3HPFA 1XZWA 5IVXB 4TLTA 4U1MA 4JFOA 4X98B 3OLEA 4L80A 3BCJA 4HK7A 4W86A 3AUJA 3CHFA 4L9XA 3WTXA 4LQ1A 4PJXF 3HFYA 1KUMA 1PPIA 4HJ0D 2QSCL 4W4OC 1DQDL 4XAZA 1AO7D 1RZIA 5ALBH 3SDDA 4L4VA 3IDXH 2QKFA 2Q6WA 5EF1A 8TIMA 4HK3J 2WINB 1YE6A 4GG6A 3AHZA 4GOAA 5I09A 3ZLHA 1JL8A 1T2XA 5C2BH 2A83B 2QHLA 4PRAA 5DC9B 3A4WA 5FWRA 2TPSA 2X44D 2Y7QB 4KVCL 4GAGH 4IRSD 2V5BA 3WLMA 4H20H 3QNYB 3R43A 1OFAA 1K7XA 1CD1B 2ZKMX 1IC1A 3LV3A 4CMHB 4EVNB 3GC4A 3WDPP 3S35X 4M6QA 4I3SL 2KI6A 5B7ZA 4V28A 3W2JA 4JGJA 3PHQA 4FF5A 5JHDA 4HF5L 4QYOA 5FAJA 4G43A 2HZHA 4GRWB 3C12A 4ECNA 3VXME 1BWLA 4IRZH 2J27A 3HJZA 2F1EA 4NM4H 3C6SA 5I1HL 1RK1A 1EXGA 4MJ5A 4M7LH 3M0VA 3A4FA 4Z2LA 4UTIA 2POTA 4DGVH 3N4EA 4LSUH 4MLSA 2IXVA 1YCSA 1Q6EA 3G1AA 2OCCB 4OQVA 3LRHA 2OQHA 3N1MC 2WQXA 3MRCA 5A8OA 4W9HC 2PWHA 4X5QA 2NSQA 5JHLA 4P59H 3NFSL 4QIUA 1NARA 2H9GA 1QZ1A 4J1OA 1B88A 1B2WH 2GUOA 4KK9C 2OLSA 5L8KB 4PJDA 4F7MA 2E28A 1JPSH 4E9RA 4HNNA 3H9SB 4M6AA 1TQWA 3WQPA 3NYKA 3IN2A 3OP2A 2Y24A 2PDUA 1K4DB 2ZKHH 4O50A 3SDYL 3U4BL 3F2DA 1X5FA 1QNRA 1PY4A 3WJJC 4LY8A 3C9NA 2BNUA 3IJSB 3ATYA 3OJ2C 4EDXB 5KMYA 2PW2A 1FNSH 2XVPA 2PWDA 2R1WB 2V3DA 1HKVA 3FFCD 3RTLA 3IFNL 4EXKA 2FZ9A 1R3SA 3FRPB 3RFAA 4Q4EA 4GI8A 3SGJC 3V7AG 1VS1A 1RPKA 4MY8A 5JO5A 3SURA 5DO2C 3RMEA 4I1NB 4PP1D 2UY2A 2O9OA 3D3VB 3P80A 4IX0A 3ZE1B 5KVFL 3MRNB 1K85A 4FFWC 4YHKL 2P5EE 2C3HA 3B2UD 3QC5X 3G6MA 5E6IC 3BO9A 2ZXCA 5FOBB 3U0WL 1OK0A 5DS8A 3SKMB 3OLGA 1NP0A 1JE6A 4KFNA 4BKSC 3WQDA 1AH4A 1QOQA 2WPBA 4JQXA 4DYKA 1VIZA 2W59A 1D7BA 3NH7L 3GDKA 2ICWJ 3EBAA 2YDSA 3S3SA 3ATDA 3EOBB 1YUHB 4KWOA 3BAIA 3KWSA 3H23A 3MLTB 2DI7A 4BXVA 1B4TA 5GRUL 2X4QB 1M42A 1KV8A 4HD9A 1XL4A 1Y5VA 5IFHL 3U7BA 3L5LA 4N9OB 3SCUA 4NJGA 2E9MA 2OL3A 1K8ZA 2YXGA 4U3XA 2EPLX 4UANA 1IAKB 4P46D 2FB3A 2J7EA 4PTMA 3ORWA 2QPDB 1A4JA 4GRLB 3W0WB 2ZOXA 4W70A 2EDXA 2P1YA 5C0AB 2FVKA 4PBWD 2CD0A 2YCKX 2D4DA 4IMLB 1QSVA 3KBPA 3LY6A 2PCFA 1YYAA 3W88A 1XS2A 1EQCA 5BXFB 3NGJA 3Q5TA 2EGZA 3VA8A 2EPKX 3PCYA 4XWOD 1SGJA 1DZ0A 3KG5A 2UBPC 1KPVB 4GXVL 1AKPA 5L2KE 3SQBA 4GC3A 4HISA 1TQSA 4MCMA 3MUY1 4HC1L 2B7NA 1G1YA 3BVJA 3OEXA 5D9PA 3UZYA 5T3XL 5MEPB 1Q1JH 1XYAA 2VZSA 2PTZA 3VRIA 1CXEA 4DWSC 1K6QH 4WWKA 3GI9H 4JIHA 4Z7AA 1D5BB 4AEIL 3GUGA 3G9VA 4LEBA 2OYLA 4JFFE 3APFA 3T77B 3EG9A 3WLHA 2N01B 3FSAA 2DYRB 1MUWA 3JQOB 1U3JA 4NB7A 3MLXH 2VZOA 3V1HA 2O4MA 3D0LA 1ITBB 2NV9A 1GHFH 2PWFA 3FT4A 3GWJA 2PNDA 1FYTE 4WFFD 1JAEA 1JPMA 1QBMH 2MOGA 1ORSB 2Z7GA 5KVGL 2OJEB 4P4KA 2GJNA 1ZDQA 2LLLA 1XBVA 2VENA 1LQSR 3K3QA 4KMTL 3ZT6A 2UY4A 2VDGA 2VWEC 4Q8OA 1OG6A 1WBYB 4JZJB 4RSYA 1QEWB 2EZ0C 1NKOA 3I6KB 5HVHC 1SYSB 2UYLA 1S2CA 5GJNA 5MI0B 3TF4A 2PYFA 2GQHA 3QJUB 5GISH 1BRLA 4M5ZH 1G9EA 5KTEL 3R89A 3KVKA 2DL2A 2X1UA 5AB3A 3WMQA 5EN2A 1YMME 2VDMH 4E5TA 2PCPA 2EP6A 3JV4B 4RMTA 3F85A 4FO4A 3ZYIA 3WQVA 3NIDB 5GJTL 1M7OA 2ERJB 4NI6A 1I8AA 4NQXB 2RGLA 1W3JA 3DNKA 1E70M 5IBUG 4LLVB 4NPJA 2OJZL 3FXIC 4N4QA 2GVGA 2JCCB 4S2SB 3MREB 2FT7A 1SF5A 4DP8X 1AMXA 4PVLA 4Z1PA 5AVTB 3KP1A 1KFKA 1CGVA 4X7SL 1A2YB 3VVVA 1FH5L 2BASA 4IOFD 2DMKA 2KPNA 5CZKA 3DC0A 5H8DA 2FZDA 1KEML 3CIAA 2GK0B 1BLNB 2AMXA 1E0VA 4IP4A 5GQBA 5F70A 3VFRB 4Y2DA 2XWTB 4KS0A 4TL4A 4P5TC 3C5SA 3ESMA 4K7PH 5CEXB 4WKZA 3FZUD 1E5ZA 2EDRA 2YBTA 5JPNA 5BRZD 3OKNB 4P4RA 2X1PA 1KTDA 4NBYB 1ADOA 3ISYA 4NPYB 3Q44A 2DW7A 4AZIA 5HJLA 3RWEB 4AWTA 3IRSA 3PBGA 4A1RA 4GLEA 3LNHA 5GGRY 1NOAA 4QHMA 2CJUL 3WH9A 3IXTB 1EX1A 4FOMA 3ITGA 4Y96A 3SPCA 1U8LA 4JBSA 2ALWA 2RAGA 3RDKA 1KM2A 4WI7A 4EI5B 4JM4L 1B9KA 2IALB 5GSRB 2P80D 4OZFH 2PU1A 1EWHA 3D0VA 4OD1H 2AVGA 4KY1H 2ZQ0A 3MMEA 2H8PB 1WIOA 1FC2D 3RIFK 3S5NA 2OFQA 3L5WA 1TJIH 4EMZA 3MACL 1QI5A 1PY9A 2OKOA 3N9GH 2ALRA 1L6XA 3O2DA 4CCCA 1XIWD 4OLZL 4PJ8A 3O16A 3S0PA 2OI9B 3RWHA 5CZ0A 1AXSB 3UAJC 5DRZA 2ZJSH 1AACA 3WJLA 2VERN 4Q4OA 4H0IA 3UJTH 5B1AB 3EX6A 4TMPA 4FF7A 3TJLA 5TF1H 1A1MA 3SD2A 4Z77A 1JNLL 4Z2JA 3APTA 4QCIA 4ZX5A 4DZ8A 3E2VA 4X6DF 3OBEA 4RUBA 1HL9A 1S7XA 1QVOA 3IGHX 3F83A 3SGKC 2BP8B 4R0LA 2ISSA 4JFPB 4NQDB 3Q6FA 4E41B 4KIRA 3NL3A 2WXLA 4ISVA 1BZEA 1F00I 1RJLB 1T2JA 1HHJA 1TA3B 3WHE1 1D5IH 2Q87A 5B39A 3GXMA 5BXRA 3BD4A 3KBSA 3MA8A 5KYYB 1VFLA 1R0AL 4OB5H 1ZVNA 2O7QA 4XVSH 4HJWA 1A7NH 3L4ZA 4A8LA 1KLGA 4WO4C 4P5MA 4ZUWA 1MEIA 1PSCA 5C0DB 3VSUA 1FIEA 5CEZL 1MNUL 2D9CA 3IGAB 3MVIA 4O2FA 1BQGA 2X53A 5DCBA 3HE6A 3C5JA 3SE8L 2XWRA 3WUGA 4PV9B 1KM4A 4AL8L 3NZGA 1HP5A 2R69A 5GJPA 4N4YB 3CHRA 1JF6A 3UYPB 1MDLA 5F9DC 4IJBA 2F2HA 1I53A 1U6AL 3L0KA 1CB2A 1DV7A 5CQ1A 1RULL 5D4JA 1XQKA 4Q6JA 4YHOL 1ZJHA 5ALCL 3QYSA 5IOKA 1OHQA 3QC6X 3MT1A 5LWYH 1CECA 2XTLA 1RA0A 3RX5A 2OWXA 3QQ3B 3CH1A 5LNDA 3LDBC 5E4EB 4QF1A 3GJEB 1HESA 4UU9A 2LV4A 3VFNB 4A7TA 4PJ7E 4AZ5A 4ZUUA 1TE6A 3ZDXB 1ZGLA 3OAZK 3RM8A 2YAFA 2DPEA 4QLLA 1YJDL 4QTFA 3EYOB 2Q20A 1ISXA 3NCXA 3I6GB 3QQ4A 5IF0A 4HX1B 3TBVA 2EKSA 3VRLE 2HJLB 1DPMA 3MBXL 1QK0A 1WHPA 4XMPL 1QRNA 3O41A 3VH8B 4HUUB 3V6OC 2ZUQC 3R4RA 1M7IB 4OM1L 3WNNA 3EJZC 3ZOAA 3Q13A 5LA1A 2FQFA 3RL1A 2A85A 2YD9A 5D1ZC 1S7VA 5D1XC 3NK4A 2Z35A 2CHWA 2R94A 2XVNA 2ZAGA 1F74A 2XA8H 4LS1A 4V1YA 2YRBA 4JHZA 3P11L 2CUIA 4P5KA 2AL2A 1QAPA 3RO8A 3T42A 2WM1A 4Y7MA 3HNTH 4WK9A 4K6AA 3POHA 2Q9OA 3ZKSD 5IQ7H 2PPGA 1GW6A 3EA3A 3W6LA 3JWNC 2DQHL 1BFOA 3QUXA 3RZCA 3HJ0A 5C0CE 1OZUA 4HXBL 1TZIA 5IB5B 2Z8SA 3LA4A 3ESPA 3LHUA 4NDMB 3SD5A 3URAA 3B9NA 3RX2A 1CT8A 2NUTB 1HAUA 4PY8I 2YDQA 1HI6B 5I6SA 4Z7QE 1KM6A 3L7RA 3UYRH 3WLRA 1PE1A 5I5RA 5CMAA 1O6VA 5F7DB 4A6YB 5L2JB 5DVMA 4FNLH 3EGXA 1BEYH 1TQCB 3C09C 1YMHB 4HJGA 5EBWB 3R7MA 4GINA 2HAZA 3O4LE 2NYYC 3KW3A 1G67A 3S2NA 3ZL2A 3O8XC 4XCFH 5I1IH 4JIRA 1N2VA 4LEOA 4UZSA 4G1MB 5E8DL 4M8RA 5GJSH 1A6WH 4ODXB 2QR6A 2GZXA 5IFPA 3ONBA 5F7EL 3NSNA 1C9SA 5I73C 2DQTH 3P0VL 3IKCB 5EPMB 3BPCB 3JTTA 2JIEA 1ZT1A 1RUMH 3VINA 4IMKA 4R27A 3UD6A 4MNHB 3H4GA 1ICSA 1RZMA 5JIIA 3AHVA 4OKVA 3W9ZA 4HIIA 4S3DA 1RU9L 2LFGA 3NMEA 7REQB 2HKFL 3QZ6A 3X1EA 1F3JA 5C0IB 3T4CA 2H0JA 5DFTA 3DI2B 4LUSB 3LQLA 1EJ7L 3DHMA 1TMLA 1FCCA 2BSCA 4ODBD 2EO9A 5DRNB 5EO9A 2EADA 3NJHA 2BIMA 2YPVL 4AVJA 4X0VA 1CL7H 3EYFA 1L8NA 3ZTCC 4NZ3A 2EJAA 3SGDI 3HMWL 3QBUA 4JN2B 5E9XA 4S1RL 1CZ8L 1J5OL 1EIXA 3BHBB 2CJTA 4N0FA 2ROYA 4LNCA 4UR7A 4DF0A 1XPYA 4JKLA 1CE6B 3QUMH 1MSPA 1MMFA 3HO8A 2ZYFA 4O02H 1A1OA 2PSNA 4UFHA 2ZOLA 2H1PH 4FQCH 4H88L 1FSKB 1JPGA 1RD6A 5CC6A 3U30B 4KZDL 3W26A 1XT5A 4EPBC 4DF1A 3P8JA 4JY5L 1AZCA 2IQAB 1M03A 5CJQL 3LKNB 1KYAA 3DBNA 2FX9L 1O1ZA 4GKSA 4PU2A 3EGSB 3RF9A 4IBTA 1NBVL 4URIA 2V2XA 4BFKA 2ZVRA 2I9EA 5JTWA 4Q8PA 3GHBL 3V0HA 1NCUA 1XSIA 2H2SD 4ZE4A 4IP7A 3L9RB 3IDYC 5ID1B 4QAMB 4MMYA 2WVSA 5LLIC 2ESVE 5C3LD 2R4SL 2VVSA 1KGYE 5L9FA 4Q9QH 3VE0B 1U8OA 5E6UB 4PMOA 3L16A 5A1AA 5A2LH 2E6JA 1A0QH 4AY0A 4KK6C 2PCQA 1OM9A 1EX0A 3RWCB 4TUOB 5HHPB 3OHIA 1BZ9B 4JFEA 3LH2L 3QKZA 1M7JA 4F9LC 5HHQB 1NJ9B 2WB1A 3LZOA 3TWCL 3BKJH 2IBBA 2MOVA 3U48A 3DENA 5JOFB 2X3CA 5ISZB 2BLEA 4G8GE 1MUJB 3TBWA 1EA0A 3K91A 4P7QA 1TNMA 1S5HA 5I18L 5D55A 4ZD3H 2NQZA 3L95B 1PZ0A 4O28A 2NY5C 1NMBH 1HWWA 3P30L 3LN4B 1BMWA 2NXHA 4LPWA 4CQCA 3RN6A 4KNUA 3IDGA 2PYEE 4PRHE 2V81A 4BRJA 1YNLL 2GGEA 2PW1A 2R1YB 2VL5A 2IW0A 1DVZA 3KM8A 1MAJA 5J1SC 3TXVA 4OLVH 3IJYA 4FZIA 1F02I 3GMQB 5B1CA 2VKXA 3QP3A 4LCVA 1ZPTA 4UQ3A 3OQ8A 5B8CC 1BQSA 3D0AA 2N7SA 3OVUB 4GYPA 4Y5VB 4QITA 2IANE 1XZ0A 3KPRE 2AHIA 3PXLA 1AQFA 5K9KA 4D71A 1FVDA 1HXYB 5DELA 2I07A 4QRTB 3IDMB 2Y06L 4GPNA 4AZCA 3O1NA 4DO4A 1IV8A 4X4XA 3K6FA 1SJHA 4NOBA 2PD5A 1FCGA 1TPXC 1JJUA 2AJUH 3GB7B 2QQLH 1A7OH 2GITA 1DXIA 2GBTA 3DFNA 2XG5B 1G6RL 3QYMA 9PCYA 5LGJB 5J6SA 3U83A 3V4VB 3FQXB 1E6JH 3R0MA 4MVBD 3T3PB 1D3CA 3FV9A 1TF4A 3RU8H 3NAVA 8PAZA 5E8OA 2BWQA 4ZI8A 1XLEA 4ZAKA 1Y8BA 4Z0BH 3TYAA 1DQXA 4L1WA 5KVMC 4QAWA 3GIZH 5KZDA 4JTSA 3T4WA 4JNYA 3HEIB 5CLWA 5FF7A 1E3FA 4AY8A 2QKIC 2WUBL 5C8JB 3CN1A 3T44A 4XT1C 5D7EA 4NZ5A 4GCAA 3MI6A 3PHAA 2CRMA 3DOSA 2BSRA <