1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
4J27A 1W1TA 4D6DA 1JZ8A 3II1A 1G0CA 3WBAA 2ZXAA 2UY2A 4U3AA 1PZ3A 1TUXA 2EPOA 3DX3A 2Y2WA 3VIJA 3W24A 3VDHA 1KCKA 2EPNA 1PEZA 1JYVA 2WVVA 4M1RA 1XCXA 4GI9A 5A8NA 3WN6A 4XZWA 2X0YA 3VD3A 2ZE0A 4HOWA 3WNNA 1LG1A 2W63A 1NOWA 3AI0A 3IJ9A 5BRQA 1XGZA 1OGBA 4AMCA 4DM2A 2QMKA 3IAPA 4YHEA 1H41A 2D1ZA 2D22A 4JL1A 2ZXBA 3LXCA 3WEZA 1UD8A 1EO5A 2FH8A 2X2YA 3K8LA 3CHEA 3VD7A 2ZUTA 1A47A 3RILA 4C7FA 5CGMA 3OG2A 2V3EA 5CG0A 1JZ5A 3OLIA 1R85A 4PRWA 2QF8A 1XC6A 2Z1KA 3VD9A 2ALWA 1BHGA 3OGVA 5JIPA 3WNOA 3VMPA 4UFJA 4W89A 2XWDA 3K8MA 2XN2A 2DT1A 3AHVA 2ESCA 2E9BA 1VFFA 1WDRA 4IISA 1V6WA 4AIEA 1IT0A 3APGA 2BV9A 3ZQ9A 4FLSA 1UWQA 2NW0A 2BVYA 1QI4A 1EDQA 2GVYA 1GOKA 4B3LA 3B9EA 3BUBA 4LX4A 2VX7A 3TP4A 2J7GA 2EXOA 1JYXA 3OZOA 1PBGA 3MV01 3L4VA 1M04A 2QLYA 5HNNA 1E3ZA 4M29A 3ZT7A 4JKMA 3BUDA 4UNIA 1FH7A 4A3HA 3BLKA 1R47A 2D23A 1JNDA 4PMZA 5FL1A 2YKKA 2CKSA 4WKAA 2G3MA 4TTGA 1PX8A 1UUQA 5LA1A 1G9HA 4OJYA 5E70A 2OW7A 1V3MA 3VMOA 1SFSA 5AYBA 2WB5A 3VIKA 2YIHA 4PTXA 3W37A 1Q6GA 4H41A 2EPMX 2XVLA 2DIEA 2PBGA 5CLTA 1ISWA 2ZX7A 3ZO9A 2DSKA 7CGTA 5C71A 4FNRA 3AROA 2VC9A 1WZAA 2VCAA 2VCBA 4W8BA 2F1BA 2VI0A 1DWGM 1GOWA 3RO8A 5A6BA 1CXKA 2OSXA 1E6ZA 1VIWA 1LL4A 1JDCA 2ZXDA 3DX0A 4ACYA 2XM1A 4M82A 2WWDA 3DX2A 4CGTA 4Z2IA 4JKLA 1GCYA 1ZS2A 3VKKA 2XJ7A 1V6UA 3FAWA 3GBEA 1CXFA 3UG4A 3EJSA 3SIMA 1XSJA 1YQ2A 2XTKA 2F7QA 3ZT5A 4PBGA 1Q6FA 1GZJA 5DMYA 4FLOA 5A2BA 4C7DA 4UFHA 2E40A 1R86A 3IAQA 3TONA 1MVYA 1OB0A 1EQPA 4BF7A 5A3HA 1KXQA 2WMKA 4B15A 1R7OA 1AQHA 1BGAA 4QLKA 1QNSA 4PMQA 4X9YA 1E15A 2CESA 2G41A 1EXPA 5JUVA 3OGSA 1UQYA 1TVPA 1JZ4A 2WHJA 2VJXA 4CD7A 1V6VA 4YPJA 3I3EA 2YBUA 3T2QA 5JBDA 2ZUWA 1IZKA 3CHDA 3TA9A 1I1XA 1SYTA 4NZCA 3AS0A 3QOKA 1XH0A 4KWUA 4ACZA 1ECEA 4B16A 1XSKA 1IZJA 1X1NA 2J79A 1SZNA 2VUYA 3QGVA 2ZUUA 3D51A 4QFUA 1WKYA 5CGTA 9CGTA 5BCAA 1M53A 3VGGA 1WPCA 4E2OA 2CETA 3DX1A 3POCA 4MNJA 4FLQA 4P8XA 3BC9A 4GQQA 3WNLA 1LF1A 1TG7A 3SCVA 2D24A 3QHOA 3ARXA 4AMXA 4HU8A 4DUXA 3RM4A 4PEEA 4GINA 3UR8A 4AIOA 2ZWZA 3O6AA 3WH8A 4NI3A 1B2YA 4QAWA 1ISVA 1BYDA 4JFVA 3CO4A 3HN3A 4D1JA 4AIUA 3T0DA 2O9RA 3WUFA 4GI8A 2J4GA 2WZHA 1K9DA 3AFBA 2E8YA 1MW0A 4U5IA 3NSXA 1D7FA 3WDIA 1KQZA 5CPQA 1UKQA 2V3GA 1MW3A 5D8ZA 1US3A 3EMZA 4S3JA 2QHAA 3F4VA 1ZBWA 3H53A 1B0IA 2DSWA 3F5KA 2OW6A 4UOZA 3WNMA 3VIFA 2VT0A 2PF0A 5DO8A 2WVTA 1R8LA 5A94A 2DDXA 4W87A 5IHRA 4GZEA 5I77A 3ZSTA 4UFKA 5JBFA 2J77A 5BYWA 4E8CA 3BCFA 1GOOA 5E6YA 1HJSA 3B9AA 3AYRA 3CZLA 1BLIA 1H5VA 2UWFA 1UD2A 1TCMA 3HG3A 2VRKA 2ZX8A 2JFEX 1XV8A 3ZJ8A 3RIKA 2XIIA 3FW6A 3EBVA 4GPNA 1XD1A 3WL0A 4AZCB 4A4AA 3HMCA 1UYQA 5ECUA 3WD3A 3AHYA 3F5LA 1GPFA 3KL0A 5A2CA 1ZBKA 3T2PA 1LQ0A 2VRQA 3H54A 4LYRA 4FF5A 1PX4A 4QCEA 2O9PA 3OIHA 2VOTA 2E8ZA 5KEZA 5M3WA 1C93A 4HOZA 2XHYA 2WVVB 4GIAA 1B90A 3A22A 3B9DA 3HU7A 1L0PA 1SMDA 4WSJA 3W6LA 1UWIA 3VSUA 2D2OA 4LXFA 1UD3A 1TQSA 4F66A 1X6NA 4F8XA 2J7DA 1UH3A 2BY1A 4S3KA 5BRPA 1CPUA 3VUPA 1M03A 3CZ8A 1XD0A 4NZJA 2J25A 3VIHA 4HZ7A 5A2AA 4PYSA 1IV8A 3WQ4A 1EQCA 3ARUA 3ARWA 4R27A 3MU7A 4AY1A 4W8AA 1W32A 1GJUA 1TR1A 1E70M 2WVUA 3N15A 4J3WA 1B30A 4JFTA 1W9DM 4AD4A 4P7NA 2J62A 5D4YA 3I3DA 1HTYA 4NX0A 1B3YA 2VZTA 7A3HA 2GFTA 4U2YA 4MB3A 2OWXA 3BLBA 4UQCA 3L4WA 2QV4A 1JFHA 1H3GA 4NXSA 4HMDA 3AMCA 3FHQA 1R87A 4MNKA 2CEQA 2HISA 4MDPA 1TMQA 2A3CA 2OLHA 3VGFA 2CCRA 2WZEA 5A8OA 3WBEA 2NSXA 2ZX5A 1JL8A 3VIMA 4NZFA 3ARRA 4P8WA 2XGIA 1OT1A 1GOMA 3GXFA 5HDRA 1CBGA 3BGAA 1W2PA 3VD5A 1ISXA 3VSVA 1V6XA 4JHOA 1VBUA 4Z2JA 3MUAA 1V02E 1DP0A 4DWSA 3FHAA 1TVNA 3GH4A 5A6KA 3MSDA 1JXJA 1EHNA 3PZMA 2CHOA 3L2MA 1H0IA 3MMWA 1QX1A 3ZJ7A 1JF6A 5GPRA 1E4NA 2EAEA 1FOBA 3PZOA 1B3WA 3ZJKA 1U33A 3CUIA 1BYBA 1UR1A 1ODUA 4DUWA 4XUYA 4AISA 1VJSA 1ODZA 3LPOA 4UQEA 1W9XA 2GDUA 2VTFA 1CIUA 2GDVA 2VL4A 4AZBA 4BS0A 4PTWA 2PC8A 4BZYA 1QHOA 4BCEA 2PWDA 1UASA 4WK9A 4GO9A 2WK2A 1KGXA 3AMGA 1UD4A 1UOKA 4OUEA 4HA1A 1K9TA 4IUGA 4ML4A 1H49A 2UY5A 1WAWA 5BWFA 3OB8A 4TVDA 2BY0A 2FGLA 1XH1A 3CUGA 4TTUA 2VR4A 2CYGA 4W7WA 3PTQA 1NP2A 4GI6A 3SCWA 1V6YA 2OWWA 2RGMA 4V28A 4W84A 4CN1A 1JI1A 1ZU8A 3WH7A 5I2UA 2EQDA 1VAHA 1Y7VA 3OA5A 4JFWA 2BXZA 3OZPA 1CGUA 2JE8A 3WQVA 3CUHA 2AAAA 4FNPA 2F1AA 4AD1A 4LYQA 2BFGA 1SR0A 2IXVA 3KL3A 1JAEA 2XSBA 4TOQA 2X0HA 4KGLA 1W3KA 3VM7A 3WKZA 1UR8A 2EPLX 5GQBA 5I5RA 1UA7A 4CD8A 3TTSA 3WY4A 3BAKA 3HG5A 3KZSA 2G3NA 4UZUA 2BS9A 4EE9A 2J7CA 5BROA 1UH2A 5GNZA 3WUGA 4FNUA 2VVSA 4ACZB 4J28A 3BAYA 4KRTA 4UQAA 1LG2A 4Z2LA 4KMQA 3CIVA 4M80A 3WDHA 2XVGA 4DO6A 4OBSA 3VGEA 4PMRA 4PMDA 4AD5A 1LWJA 2WKLA 5I24A 2XYLA 2C0HA 3MUIA 2VX4A 3DHUA 1UH4A 4GQRA 2WMIB 3MKKA 2F61A 3SCPA 2BY2A 3SUTA 2WCSA 2DPEA 5IFPA 1VEMA 5I79A 3H55A 1TA3A 3MSGA 1NWRA 1HKJA 3PZTA 2X8RA 1S46A 1JG9A 1XYZA 1BF2A 1RD6A 4NRSA 2J7FA 3WH9A 1QWUA 4OOUA 2FYVA 3UETA 1NWTA 4JCLA 4HMCA 2PB1A 1TQWA 2TAAA 5A6LA 3WY2A 1JZ2A 1E0VA 2WPGA 5AC4A 4RE3A 1DWFM 3W28A 1NWSA 3VGDA 1FFQA 3VINA 1ZBCA 2Y8VA 1Q4NX 1J11A 3NYDA 1O6IA 3N9KA 3DHPA 2EADA 1HXJA 1XSIA 3ZOAA 4CKQA 1CLXA 3WENA 3W6MA 2YA0A 5FKYA 3TV8A 2CBJA 3SURA 3SUUA 1MQPA 3AHXA 1OWQA 2VZOA 3WDQA 2CPUA 1UD6A 3GNRA 3VDCA 3L4UA 1W3LA 3WEMA 1E6SM 5CQ1A 3WQ5A 4WSKA 3DECA 1R33A 4H8HA 1AMYA 5A8MA 3S2CA 4W7VA 3PZGA 1CZ1A 5AC5A 2F18A 4GZIA 2XFFA 1V02A 6TAAA 3BVVA 1HN1A 3AICA 2QPUA 3BSGA 1UWSA 1E73M 3CPUA 3I3BA 1J0YA 4Y7EA 5M17A 4ZFMA 1V3LA 4AWEA 2YL9A 3O2LA 2BNJA 4AC1X 4OBRA 2BVTA 5ABEA 1HJWA 2WWCA 3AS1A 3TTOA 2DT2A 3NDYA 3AHZA 3LRLA 3WUEA 1W9VA 1BG9A 3GXNA 2CBVA 5A8PA 2A3BA 3GTNA 4TUFA 1TZ7A 4AMWA 1OM0A 3SCQA 1E4IA 5IHSA 1KTCA 2VRJA 5DF0A 4P7RA 1RPKA 3VU2A 3RJYA 4AZHA 4CU6A 1ESWA 2YFNA 2X2JA 1J9YA 1VEPA 1PIFA 1K9FA 2GJRA 1ZL1A 3MI6A 3GNOA 3L4YA 4PMVA 3AIVA 3AMKA 2F7PA 3NIYA 2WVSA 3EJPA 4GKLA 2CBUA 4PMXA 5E6ZA 3A5VA 1MWOA 3PZVA 1E0WA 4C7GA 2BXYA 1NQ6A 5CZKA 2V5CA 3DDFA 3W53A 1UR2A 4Q7NA 5FL0A 2IGTA 2VO5A 1E72M 1HX0A 2EO7A 1Z32X 1WB0A 4QP0A 3RCNA 3EDEA 1RP9A 3AIBA 2GK1A 2J47A 4QLLA 1MW2A 2Q8XA 1M01A 1GUVA 2GJXA 3D5HA 1DTUA 1UR0A 2IUZA 1MFVA 1E4LA 5AYIA 3D3AA 5HXMA 1J0HA 2VX5A 4E8DA 5D8WA 5BXTA 2XVKA 1JD9A 4V2XA 3BUIA 4D71A 1G1YA 1P6WA 2XVPA 3VPLA 3W38A 1NARA 4CCDA 3SUVA 4LGXA 3CZGA 1GQJA 4J3TA 1XRVA 1X6LA 2YL8A 3PN8A 2WNWA 1GOIA 1HJXA 5A6BD 4CN4A 1CLVA 1T0OA 1DHKA 1QOXA 3EJUA 3EJRA 1MXGA 2F7RA 4QLJA 4HTYA 4MB1A 2V3DA 4WKFA 4EAMA 5I0DA 4XB3A 4W88A 1I75A 3KEHA 4B9ZA 1QBBA 1HP4A 1B3XA 3QOMA 1WZLA 1GOQA 4LYPA 2ZUSA 1CGYA 1ZJAA 4FNQA 1JIBA 2Y8KA 2X05A 1E9LA 2J8GA 5A6MA 3WF1A 4YHGA 3VMNA 3LXAA 1KXVA 4JFUA 3SCNA 3VX0A 1BQCA 1BYAA 4GXPA 3BVUA 2OSYA 3GXMA 2IXUA 1WDSA 4WIWA 2FH6A 4J3UA 3ZT6A 5A6JA 2A3AA 5FOOA 4NRRA 4N0RA 1JDAA 4CCEA 3ECQA 3AHTA 4RE2A 3U7BA 1V03A 3AXHA 3T0BA 2OWCA 3GNPA 4D6JA 1HXKA 2VQUA 4CU7A 4TVUA 1XH2A 3W4RA 2B31A 3BMWA 3CZJA 2FHFA 4WLCA 2CKRA 3AZTA 4L4OA 1QNQA 5D9PA 4UR9A 3EMCA 5CSUA 2YDRA 2WSPA 5EBAA 1C8XA 2ZIDA 2W61A 1TQUA 3NJ3A 2WHKA 2OYLA 4JIEA 3E1F1 1PAMA 2XSAA 3M6DA 3FAXA 2WBKA 3KWXA 1C8QA 2VCCA 2J74A 2DIJA 5GNXA 3UG3A 2O92A 3AS2A 4AEFA 2W4XA 3N13A 5E09A 1KBBA 7TAAA 1EIBA 4JFSA 1HJUA 4CVUA 1VFMA 3M07A 4ZENA 3HG4A 4M24A 3WQWA 1QWNA 3SCTA 3EDKA 1VF8A 1GHRA 3GXTA 1CGWA 1V0KA 3GH5A 5F7UA 1LWHA 3PZUA 4HA3A 5D9OA 1OSEA 3WQ8A 2J8FA 3WF4A 1UHVA 3UERA 1F4AA 1BG4A 4LQ1A 1CECA 2GSJA 3N04A 5IFTA 1WZKA 4U31A 1XCWA 2YA2A 1HP5A 2VZUA 3MMUA 1JYNA 1K6AA 4URIA 1GVYA 1UG6A 3OLGA 5CPTA 5A95A 2DH3A 3KLLA 4OOZA 1TA3B 3G6LA 3K46A 3VIGA 2YFOA 2WMFA 3VX1A 4BQ4A 2ZUNA 1Q6DA 4NF7A 5A8QA 4GO8A 4ATDA 1L8NA 4J7RA 2FHBA 4U33A 3T0AA 2W91A 1V3JA 5CPSA 1K9EA 2YJQA 3VDBA 5LYRA 1MFUA 1CXLA 2VR5A 4J3XA 2WCAA 4QCFA 4KRUA 1B3ZA 4W8LA 4J3SA 1RH9A 4BQ2A 4UQDA 3KLKA 1E1FA 1UR4A 1V0LA 2QMJA 4HP5A 3RMEA 4PCSA 2W92A 3AIWA 3PBGA 2DH2A 1QNPA 5EB8A 1E6RA 2VVNA 1PX3A 1WO2A 3ALGA 4XX6A 3A21A 3TTYA 3WUBA 5ABFA 1CGVA 2D73A 3A23A 1H4PA 2X2IA 2WHLA 3U7VA 4D6GA 5E0FA 3OLDA 2JIEA 2DGAA 4MAVA 2V5DA 4CCCA 3AMLA 4TXEA 4MJ2A 3PZNA 4AD2A 4W7UA 4OKDA 3THDA 2FE0A 1UKTA 1H09A 5C8BB 1E0XA 2J7HA 5DT7A 4UQ9A 4EANA 2A3EA 3WH5A 3OGRA 1GORA 2G4FA 3D52A 1JNEA 2YL5A 2V38A 1KBKA 1UWTA 5IXEA 5TD4A 2WLZA 4D6IA 2EJ1A 2YLLA 3F5JA 3HJEA 5CXPA 4CD4A 4ATWA 2VURA 1J01A 3WDRA 1PZ2A 1YHTA 5DT5A 3BVTA 2FGZA 3CC1A 2XUCA 1ISYA 4Z2KA 2BVDA 4CUCA 2EPKX 1TQVA 4M8UA 3T2OA 1ISZA 8CGTA 1W9BM 3WIJA 1AQ0A 4MJ4A 2YOCA 2XGBA 1J12A 4MB5A 3MO4A 3L4XA 1EDGA 2WW5A 2ZX6A 3WQ6A 2EACA 4U2ZA 3D4ZA 1BFNA 2E9LA 2E3ZA 2AOSA 1HT6A 1JDDA 2XIBA 2JEPA 3WFZA 1C92A 4Z2HA 3CZEA 2OYKA 2WBGA 4PSRA 1ITXA 4JCMA 4QDMA 2NT0A 3AISA 1VEOA 3W82A 1CXHA 2CERA 3S5YA 4D1IA 3AXIA 2WLYA 1GQKA 1HJVA 3PZQA 4H8VA 3M7SA 2VZSA 1GONA 2BHZA 1FFRA 4H7VA 1QI0A 4W5UA 4UOJA 5LA2A 4DM1A 3WEOA 4PCTA 1PIGA 3GXPA 2GK1B 1B1YA 1OBAA 2OSWA 4UZSA 3A47A 2GJXB 3U57A 3AXXA 4PMNA 3DDGA 3ARPA 3NSMA 2OYMA 3BMVA 3VIPA 2D0FA 2D3LA 3RM9A 3CZNA 3PZIA 3MANA 4DWSC 3T09A 2ZWYA 3QR3A 4NXKA 3N11A 4F79A 1VB9A 1HF6A 1NP0A 3DC0A 1Q6CA 4RE4A 4D6HA 2CITA 3AQUA 1GNXA 3A4AA 1BVNP 5BXSA 3W0KA 2CIPA 1E56A 4NSBA 3TTQA 4A3YA 1UWUA 3GZAA 3LPGA 1GHSA 1FH8A 1VENA 4FNTA 2XPKA 8A3HA 1E43A 5EMYA 3QHMA 1HIZA 1CNVA 1QPKA 1JZ7A 2Y24A 4D6FA 3AIEA 2D0GA 2ZUVA 3VTRA 4FLRA 4ATLA 3GDBA 2BY3A 3EDFA 3CTTA 1EGZA 3MUZ1 3WMBA 3VO0A 1C90A 4B9YA 1KR1A 1J0ZA 1ITCA 3EYPA 3MV11 2XFRA 3BAWA 1KXHA 1VRXA 4HMEA 6CGTA 1M7XA 1R46A 1W9UA 1KR0A 1WCGA 4AXNA 4KGJA 4XV0A 2Y5EA 2J78A 1MQRA 3D4YA 2E0PA 2W62A 2F7OA 4MTVA 2CBIA 3DYPA 5IDIA 1J18A 4CN6A 3CMJA 4DUVA 3BH4A 4D6EA 3WF0A 4D72A 3CUJA 3IK2A 1V08A 4HZ8A 3IGUA 2WYSA 1QBAA 3ARVA 1H0GA 1BGGA 1WE5A 5D9NA 4IPLA 1R34A 3FNDA 3L2LA 2FDMA 2F8QA 3N18A 5BXPA 3EDJA 4PTVA 3GXDA 1WNOA 4PMOA 4AYGA 1GJWA 3UG5A 3WDJA 5M03A 4CD5A 4X0VA 5AY7A 1AVAA 4W93A 1LJYA 4IM4A 4LPCA 3WMSA 4MADA 4P7OA 3LX9A 1VFUA 2XFYA 1NM9A 1H1NA 3K4DA 4AZGA 4PSPA 4ZE5A 3PTMA 3SCSA 1OD8A 4HU0A 1KTBA 3KL5A 4MB4A 3NCOA 1C8YA 3VD4A 3NUKA 1BVZA 5FIPA 2PWHA 1W3HA 3K8KA 3ZR5A 1OIMA 3ARTA 2VNCA 3A4WA 1D3CA 3RDKA 1O7DC 3UEQA 4DO5A 2WKGA 1EHAA 1V3IA 5EFFA 5I23A 3PZ9A 4JAWA 1QW8A 1E55A 2NT1A 1CWYA 1BPLB 4ZE4A 5KZ6A 1QNRA 5CJ5A 1PPIA 1MQQA 4F9JA 2D3NA 2F2HA 2WC3A 2WMGA 3WELA 1UZ4A 1NOUA 2O9OA 1B3VA 1ZB5A 5E0CA 1WZMA 1R75A 1HVQA 3A24A 1QW9A 1WP6A 2BHYA 4MDOA 3DX4A 1HKMA 3VILA 1UKPA 3LXBA 2JALA 3ARSA 4N42A 3SUSA 1OT2A 5LA0A 4TVCA 4AD3A 1GW1A 2WCGA 3CUFA 5JBEA 4U5KA 4WKHA 3WL1A 1HNYA 4W86A 1E1EA 3T08A 5I3DA 3AZRA 2ZICA 3D50A 1EA9C 1UD5A 2BHUA 3RM8A 3FY1A 4WJXA 3LMYA 1LLOA 1UKOA 3LPFA 2G3JA 3EJQA 2G8ZA 1JAKA 2EABA 3LRKA 4ZXOA 2YLAA 1E5JA 4MNMA 5I78A 3W29A 4HZ6A 4EKJA 4OZOA 1I1WA 1F4HA 1KCLA 2QPSA 2G3IA 4CVWA 2ZX9A 2YDSA 1W2VA 3ARZA 5ABFB 4PTMA 2ZUMA 4PN2A 1LL7A 3SCUA 4L4PA 3DYMA 1V0NA 4UQBA 3UESA 2RGLA 3KE0A 4GZJA 3L4ZA 2XN1A 5E9AA 2X2HA 3CZKA 4J3VA 1JZ3A 3A6OA 3AZSA 1V3HA 5FD0A 5DEZA 1OIFA 4ZXLA 4PUEA 3VIIA 2J7EA 3RPMA 2AMGA 1C91A 1MYRA 4DWSB 1FP8A 5GNYA 4AZ6A 2WAGA 1QHZA 4PUDA 4P7LA 1E5NA 1TQTA 3AJ7A 3BAJA 3WF3A 3CMGA 4DO4A 1BTCA 5ABHA 1E40A 1W3JA 3AS3A 1SMAA 1JD7A 3PHAA 3ZMRA 1C3FA 4XZBA 5EFDA 2WSKA 4MNLA 2VX6A 1OGGA 2CNCA 3W26A 1KQYA 3IANA 1HL9A 1U2YA 4P7QA 4H2CA 2VMFA 4HPGA 2WHMA 2WMIA 2VQTA 2V3FA 5FCZA 1O7AA 3SCOA 3BVXA 3ALFA 4BQ3A 1G94A 1B31A 1B9ZA 1J10A 2DT3A 1JF5A 3EDDA 1NH6A 4R5EA 1E71M 2JEQA 2WC4A 3BAIA 3VGHA 2E9MA 4FK9A 3N1AA 4D6CA 1UKSA 2WMHA 5HPCA 3GM8A 4P8UA 1UQZA 4AW7A 3RJXA 3DYOA 1FA2A 1QI2A 3GXIA 3A4XA 3O9NA 1HWWA 2X1IA 1E6QM 1GVIA 3A3HA 1EOMA 3IJ7A 3SEPA 4AZ5A 3SCRA 1H11A 1DWIM 3WFLA 2PI6A 2VZVA 3HG2A 5HPOA 1FH9A 3VSTA 3GH7A 4YN5A 1J0KA 3OBAA 1W9PA 3WF2A 3WH6A 2HVMA 1EH9A 4IPNB 1KGUA 4WF7A 3FXYA 5HBFA 2FHCA 4M81A 5A6AA 2PBOA 3WMCA 1QHPA 3IJ8A 1HKIA 4KH2A 3WD2A 1LL6A 1KGWA 3W27A 5CLWA 3EJTA 4W5ZA 1KWGA 1JI2A 1JXKA 1XHGA 2XWEA 1OGSA 1V3KA 1GQLA 1U30A 2WXDM 2MANA 3VGBA 3BUQA 4UFMA 1V0MA 1W1YA 1TE1A 1CXIA 2C8NA 6A3HA 3CV5A 4JHZA 1J0IA 4W85A 1HJQA 1W1PA 1UA3A 4BA0A 3WNKA 2DSZA 3BUPA 3THCA 3VM5A 3U5UA 3AOFA 1HL8A 4OIFA 1Q6EA 3BLPX 1QVBA 2YBTA 3CHCA 1MXDA 2O9TA 1QI5A 1KXTA 5A1AA 4AD0A 2PWFA 4Q22A 3AMDA 2CHNA 2YL6A 2DEPA 3CGTA 2ZXQA 2YA1A 2DQXA 2PWGA 1XYFA 2W5FA 1GQIA 2GUYA 1JGIA 2YDQA 4BQ5A 3BAXA 5E1QA 3CHFA 3B8SA 1KB3A 4H8UA 1TFVA 3NSNA 2XG9A 1DWJM 3AIUA 1NOFA 3M46A 3VNYA 1ZBVA 1DWAM 2JIWA 1CEOA 3EMQA 3WD1A 5HOSA 2XN0A 3AIQA 4HOXA 3PTKA 1JFXA 4UFIA 3N17A 4JKKA 1EO7A 3G6MA 3NDZA 1KWKA 3K1DA 2UY3A 1J0JA 1E6PA 1UWRA 1C7TA 5M5DA 2WMJA 1NWUA 5ABGA 1UZ1A 1DEDA 3AYSA 3VOCA 3MS8A 3UCQA 3ZR6A 4PMUA 1G01A 4FMVA 1G5AA 3BVWA 4CD6A 3GYCA 4ZEPA 3MUY1 1DWHM 3QHNA 1PS3A 3LRMA 3WD4A 2ZOXA 3BXWA 1FHDA 2Y4SA 4HA4A 1E6NA 3ZJ6A 3S6TA 3MMDA 3CBWA 3L4TA 1W1VA 2DSVA 1MW1A 3WNPA 5I6SA 2XM2A 3VVGA 1RP8A 4EK7A 4E4PA 1E6XM 5JIWA 4RL3A 2EEXA 1E4MM 1R7AA 3GBDA 1JYWA 1OD0A 2Z1SA 4V27A 2J75A 1JZ6A 4AZ7A 2WM0A 2C7FA 2WANA 1WDPA 2W66A 4CU8A 1QNOA 4JZ5A 3W81A 1US2A 1CTNA 4X0NA 2EBNA 4AZIA 4H04A 3UR7A 1BYCA 1EOKA 3VDAA 2PWEA 3ARYA 4UFLA 2JF6A 3ARQA 2D0HA 3WDPP 1AQMA 4AEEA 1EDTA 1CGXA 4FNSA 3VIOA 1HVXA 3CLWA 1WDQA 3ZM8A 3U5YA 4MPKA 3ZIZA 3LPPA 4F9DA 1VFOA 3ZSSA 2CXGA 3N12A 1OINA 1FHLA 1CENA 1KFWA 4M56A 3VNZA 1CGTA 4PMYA 4DWSD 4B3KA 5A6SA 1OCQA 1UR9A 2DT0A 3AIRA 3CZSA 4P8VA 3OLEA 4OGZA 1CYGA 4UCFA 2A3HA 1VJZA 4HPHA 1D2KA 1QI3A 3S5ZA 5D9MA 4UOQA 4UTFA 4U3CA 5CSYA 3FN9A 3BSHA 2UY4A 3W25A 1N82A 3J7HA 1ZJBA 1W91A 2E4TA 3WY1A 2D20A 1FP9A 3SUWA 2WZIA 3CH9A 4Z2GA 3K4AA 1PJ9A 3WSUA 2JF7A 3TOPA 4MAZA 4TX8A 5C70A 3POHA 1VBRA 1H2JA 5A69A 1CXEA 2X09A 1CDGA 4JL2A 1C7SA 1BSIA 1E3XA 3HZ3A 2DSUA 2W67A 1HKKA 1BAGA 3WD0A 5BXRA 2XVNA 4TX6A 5DFAA 1A3HA 3JUGA 3BCDA 4K68A 2WC7A 4AZCA 3WY3A 2GJPA 4AYSA 2J7BA
chains in the Genus database with same CATH superfamily
2HT2C 1KOAA 5JHDD 4M8RA 1QO2A 2WQRA 1R3KB 1XQLA 5D1QE 4TPRL 1A3QA 4L3EE 3W01A 5C6PB 3ESOA 4K4KA 5J7CC 1AHKA 5B8CC 2H1LM 1NOWA 3WJXA 2PPAA 2EEFA 2FBOJ 1N5YH 4ADUA 5C86A 3MRIA 4M43L 2D1ZA 4YC2B 2ZXBA 2F15A 4BGLA 3FN3A 2CRMA 2H0JA 4IOSD 1NSNH 4TL4A 4ZB0A 4HDIA 5CN1A 1LK3H 5HDWA 3LS4L 1OM3H 3SM0A 3JT2A 1KM4A 4L5FE 4GRWH 5CCJA 4FS9A 3HQ1A 4UT9A 2NXGA 1EAJA 2C3HA 3OKMB 5FUCC 2B1OA 2YRZA 1F90L 1NC2D 1XTMA 3QXAB 5DS8A 5I03A 3WNJA 3OHIA 1EDQA 1TEFA 3UGVA 3GKZA 1NLBL 1OTTD 3NZ8B 1PBGA 3KEDA 3L4VA 3BUYB 2XQ0A 4PRIB 3P9MA 3UJ2A 2R56H 1PSKL 5AZ2H 2G3MA 1PX8A 3NFNA 1X8CA 3PFUA 4L6HA 4G6KL 2ITCA 4OJYA 4OAWA 1GL4B 3VMOA 1HINH 1QLEL 3TSMA 5CLTA 1O6VA 2VC9A 4YVUA 2OR9L 4CEUC 4ERGA 1HHJA 2AJZB 1ETZA 4LHQB 4HC1A 2ZXDA 4Z9KB 2D3JA 4H9XA 2B9BA 3DX2A 4OGAC 3ZT5A 3QUKB 3T6XA 3A6CH 4ILSA 1AS6A 4FQXD 3UFIA 2OPCA 1T89A 1WBXB 5ADPL 4PULA 4N9OB 4N26A 3N1PC 1L6FA 2DQHL 2FZ3A 5JHBA 1UQYA 1OV8A 4C4BA 3B9OA 5EZIL 1T5KA 4X50A 4ECNA 3T8QA 4H3DA 4B16A 2NY1B 1X1NA 4CW1A 1QMLA 4PJIB 5BS0B 5F0LB 4OHQA 3UJJL 1BX2B 2IQ9L 3MRGA 2CO1A 3FB5B 4GQQA 3WFDL 4AT6B 2VEKA 4IJTA 1WBYA 4DUXA 3P3SA 4O17A 3ABZA 5KYYB 3IACA 3APCA 4KAQL 2WBXA 5LHFA 1GTFA 2F08A 2O9RA 2Z35A 1KIRA 1K9DA 4DF2A 3AJXA 4LCSA 1ZBWA 4L1WA 2I07A 2Y22A 4KEZA 4QEGA 3B8DA 4PI2A 1GZ1A 3OP2A 3VIFA 1U8LA 1T04B 1D7DA 1D8CA 4LLWB 1K5NB 1CZ8L 1Q63A 1JNNH 5E6YA 1OLZA 5D1QC 2YYTA 3C09C 1FZJA 4QXTB 2VLKA 3S1XA 3F6LA 5C0CD 3GFZA 1HL2A 1P5UB 3NZUA 3K0WA 3V8CA 2BSSA 4FFYA 4R0LB 3ITTA 1N7MH 2ZKMX 4J1UA 4XE5B 4F7CA 2VRQA 4IU3A 3ZIMA 2C9XA 4RMQA 3D18B 4MS8C 3WLIA 2JI1A 3FJNA 5EA0H 4YGVA 4ODTH 3VSUA 2KZHA 2NUXA 3O6FC 1UD3A 5JQ6L 4FJZA 3ZVHA 4QOKD 1BZ9A 1GH7A 3WN5B 3MLRL 4QO1B 4D3CL 2ZAHA 3RTQB 3E0GA 1XUZA 3P8IA 4FFYL 4G8TA 4WHTA 3T3MB 3QYSA 4JFTA 4DVRL 1B3YA 3FDKA 2CLKA 2ZCGA 3X3GH 4MJIE 3L4WA 3S8GB 1EAPB 3VKBA 2QVTA 4NUJA 5LNRA 1ZA6B 1AZ2A 1B5TA 1KIQA 1GOMA 1LD9B 1POKA 3FRPG 5DA4A 3VSVA 4YIQA 3MUAA 1X7FA 4MMZC 2IH1A 2EDEA 5C0GA 1J8SA 4K07A 2DB8A 3FOMA 3NFPB 1JF6A 2I5IA 3LQGA 2W0PA 1E4NA 1T4WA 4LLMA 3PF2A 4IF2A 2CLZB 1KRAC 3C8HA 1HG3A 1HL4A 3RVWC 4LBSA 4W9EC 1QHOA 3U6RA 4Q8QA 1TJGH 3MMEA 1CFSB 5EU5A 3SAZA 3HFFA 2A74A 3OOQA 4E42A 4A55A 3HC0B 1NP2A 3EA2A 2Z6IA 3QZEA 1KIPB 5TQ0L 5I2UA 1VAHA 1FYTB 2Y63A 3LSOB 1Q7ZA 2JE8A 3VYLA 2APBA 5AVTB 1XLIA 2F1AA 1FFTB 4P5TB 3Q05A 1JGEB 4LRIC 4QX4A 2FWSA 4X6DF 3L13A 4N0UA 3WKYA 1XIFA 3HG5A 3GBNH 1YECL 1CLZL 4NAEA 3VCNA 4L9LA 1U8CB 2VVSA 3MZGB 4WDIB 4EZJA 4Z2LA 3DDMA 4ASTA 2MTPA 1RSFA 4OBSA 5DK2B 2WKLA 3QUMA 1MCRA 1AXSA 3TVMA 2EIMB 1VGAA 4OGYH 2AV7A 3UYRH 2JF1A 4PS4H 5L2KA 4DBEA 4NNYA 3WQDA 2EXWC 3CQHA 4LTSA 1R9FA 4Z0JA 1XKYA 3WJYA 1FKXA 2PGEA 1DJXA 1AP2A 1X96A 2W5PA 1DWFM 4XCCH 2QADD 1I9JH 3QVQA 2Z65C 2PXYA 3S83A 1E30A 5FKYA 2P5WA 4FTVD 3LQAC 1WC7B 3FRUA 1OT4A 5I3JA 2R69A 3IFLH 3QA3A 4W7VA 1H60A 4XVTH 4KWVA 1YY8B 1J1XH 4C6IA 5ESAB 5M17A 3KRBA 4ZFMA 2WUBL 3J07A 1WGOA 3KM2A 3L23A 1AH4A 3GF8A 3JZYA 1TIMA 5I82A 2CBVA 4NKOB 5F9OL 2A3BA 1TZ7A 4MWAD 3W9EB 3H2NA 3VFGH 4X2UA 2YWYA 3VI4B 5AVUB 1ZL1A 4KHXL 4PB3A 4RSVA 2FUTA 3L4YA 4M3PA 2F7PA 2G4JA 4PMXA 2J56A 3EOBA 2EDLA 2YMXH 2V5CA 1GOFA 5C5YA 1SXBA 2WXOA 1U93B 4ZFFA 3EDEA 4RCAA 5A40E 3KAOA 3B7UX 2Y8UA 1HZHL 3NZHH 3U7YH 5D7LE 2LGNA 3MP4A 2HWGA 4KZEL 4NKCA 3I9IA 4HD5A 1T3FA 2ICWJ 3QUZA 1KIUA 1LP9E 1THCA 2XWJA 4NJAH 5J12B 3CE1A 3NA4A 4PGDB 1VZIA 1CU4L 3S34L 1QABA 1CLVA 4WY0A 3GC3A 5AUMB 3LA4A 4JFDE 2ICCA 3LAFA 2QGEA 4W1TA 1ZHBB 2IAMD 2HKHL 1ZTXH 2HBXA 3F85A 1B3XA 4PBFA 4IZGA 3OKKA 4PCPA 4YWGL 2EDYA 1JIBA 3Q8EA 1ETJA 4XP6H 4R7DB 3LNIA 7FABL 4UTAH 4L1BA 2IXUA 4MA1B 3SY5A 1CDUA 4M7LL 4CCEA 4GYJA 1FCQA 1LCOA 4RE2A 4LYKA 2HFTA 1ZT4B 1XIHA 3NCWA 1HYRC 3U25A 2NNRA 5LHEA 2PRHA 2WSPA 4ONFL 4ZD3L 3APDA 3QDJA 1H19A 1U8QB 4EWJA 1TQUA 2CWXA 4DT2A 1CFVH 3F3HA 3UG3A 2OZTA 2NLYA 3IAGC 5JHDE 2AK1L 3MX0B 3R06B 1F58H 3IRPX 1IAIL 3CC5A 4QXWA 2B0SH 4YXHH 4IK7A 4PJEF 1EGMA 3GS6A 4MKMA 4ZZ9A 1YXDA 5IROA 5I18L 3C5XA 3SQOL 1MJUL 1WZKA 2WWMD 3WEAA 4QG6A 1MAKA 4M5ZH 5HVFB 3OKNB 2VZUA 1CX9A 2ZRYA 3RUBL 1KBLA 1XB3A 4O2EA 5K33A 3GD1C 4WGKA 3K46A 4Y4FD 2Y25A 5JO5A 2VUOA 1TPXC 1Q6DA 1KZYA 5MKGB 3VH8A 4F92B 3H3KA 1I9RL 2RQEA 4B5VA 3AG2B 3BZJA 1O7DE 3KBWA 1JRCA 5DD0H 3G6JF 1QR1A 1RPXA 4QCFA 1NAKH 4KRUA 3VXQB 3B8WA 4W8LA 4N02A 4NAFA 2H3DA 3AT8A 4LAKA 4Z7WE 2W92A 5IFHL 4ACTA 1OX6A 2P47B 2HN7B 4D6GA 1C08B 2GK0B 3IGKA 6XIAA 4HIIA 4MJ2A 1KYOK 1YPZE 5C0DB 5FJPA 5LCVA 3QW4B 2HVJB 4L1TA 3WH5A 4P46C 5CXPA 4ATWA 5HHMB 3QQ9C 3WLRA 3H6JA 3WX7A 1E5BA 4IX0A 1CG9B 5I0ZA 1SSGA 4M5TA 4BK5A 4NO3A 3GC4A 4OZGB 2EDBA 1B0GA 2HKFH 1QSVA 1OLLA 2FVMA 1MCOH 2IEPA 35C8H 1JWSA 5GZNA 2O93L 4D1IA 1I7ZB 2C5DC 1G7MA 1GQKA 4CSPA 2YUZA 2Y2YA 1HZYA 3PHSA 4HBCL 1FRGH 1X5AA 1WAPA 4I0CC 2HJPA 1MUWA 7PTDA 3A47A 1V7ML 1ET7A 2BO0A 3AXXA 3KPNA 1WKEA 3G5YB 3HE7A 4BH7B 5C0NC 1K7FA 3QR3A 4NZ4A 4Y9AA 5G4OA 4BSJA 4WFED 4D6HA 2HT3D 1LQAA 1A5NC 1A8JH 1XB6A 5EBLB 3G1FA 1HEZB 3TA3C 2CIPA 2IFFL 3MODL 4CC1A 1O9ZA 5DD3H 1CNVA 4HG4J 1U3HA 5IREA 1RUPH 3AIEA 4IJ3B 2ACRA 3SE4C 1XZ0B 2AV1A 2FO1A 2ZUVA 3VTRA 3DIFA 3AYVA 4K23H 2CO3A 3M0KA 3PDOA 4RGNC 5IGXL 5FYJD 4QG9A 1YNKH 3PGCB 1MLCB 3B05A 1QOPA 4WI8A 3TXAA 3VXRD 1M7IB 4MTVA 4M3HA 1FORL 1A6UL 4WY7H 3HI1B 4DUVA 4FP1A 1HSBB 1NCWH 3IGUA 3VFRA 2WYSA 4HIBA 1FA4A 5I6XC 1BGGA 4UT6A 3EA1A 5C0CE 4HIHA 4MAUH 3NURA 2QHRH 4LS2A 3WDJA 3ID7A 2WJFA 4GG8A 1W0VA 4W93A 3BXNB 4QHMB 3OJDB 1BJ8A 3TYFB 3PFQA 4CAGA 4W9GC 4G7VH 1XBDA 4HCDA 3ZKSD 4EQ2A 1OD8A 2ZJSL 5ILTL 3PNZA 4NVTA 3BURA 2EIZA 2C16A 4ZUTA 4HT1L 1ZLEA 5CGYD 2Q10A 1XI3A 3KBPA 1O7DC 1OGAD 1RUSA 3WEXA 4CSZA 4QOKE 4DJEA 1FG9C 4QRTA 3ISRA 1PPIA 3SBRA 3GNNA 1OTTC 3EGXA 3D1MC 4AYFA 4NI8A 1G87A 3VKDA 1HVQA 3UMNA 2VEGA 3AQYA 4XX1G 5K1VA 2DZSA 1OFAA 2HPIA 1GKOA 3VJ6B 1XDMA 1FWHC 4L1HA 3WLNA 2CO6B 1WEJL 3B83A 1XLGA 2E27L 3F1QA 1KFEA 3BARA 4JX0A 1JHKH 5ISZD 2I24N 1L2QA 2GWGA 1XGPA 2DM7A 3MRMA 3W29A 1BQSA 3T6CA 2QPSA 3UU0A 1XGRB 1OANA 4KU1A 1NFGA 2H8XA 3UESA 4HMNA 3D3VB 4LGRB 1A1NB 1E6JL 1W0MA 5KVDH 4FQXC 1V3HA 2Z3FA 1LO3L 1SVCP 1KLUB 5IK3A 4DWSB 4RAVB 2FWLB 1FP8A 2O1AA 4WJ8A 4E9SA 3QGKC 4AZ6A 1U8JB 4G11A 4QS6A 2R8SH 4KXBA 1KPRA 1R3IL 3O0KA 4NZTH 4PGEA 2YEZA 3IDNA 2OX5B 1N3NA 3NQ8A 1RJPA 2R29H 1L9MA 4DP7X 2QJGA 2V5SA 2E7HA 2XWRA 5B39A 1Q9KA 3WCYA 4H01A 3GHPA 1CCWB 3O0RL 3DBXB 2X87A 1J10A 2TYSA 4AEOA 4OU3A 2ESVB 4IFKB 5GZOD 1XL4A 5HPCA 4ZSTA 4MMWA 2GUBA 4HH9A 3OSVA 2PI6A 1HO1A 4X6FA 3OBAA 4IGMA 4X7CC 2XXMB 1NCUA 4XN7A 4Y9BA 5C0FA 3JZ7A 3S2JA 3F5WB 4NO2B 1JOIA 4AX7A 1M6UA 4HCLA 5TDNB 3H9SD 3V0WL 4BELD 1YYAA 3CNYA 5EF2A 4JKPL 1KT2A 1JCJA 4JR5A 2B08A 3OR7A 3U4AA 4CL7A 2IS7A 3DEQA 4YS1A 4YO0B 2DFAA 4XAPA 8PAZA 3PWAA 4KXZH 5EZJB 3VXMA 3T3PB 2OLSA 2YDQA 1XGUB 5I0WA 4FTVE 1CT8A 1TWDA 4Q8OA 3PP3K 1I53A 4X4XA 1ZBVA 3F65A 3E2QA 3PTKA 5BV7C 1OHQA 1DJWA 1G9NH 3G6MA 1QFWL 1KWKA 4OF6A 3AU6A 5D1XA 5ABGA 1UZ1A 4XP1L 3K5SA 4XZ4A 5J9PB 3MCMA 4XPGL 9RUBA 2GCYA 3MRLA 3UCQA 3M5XA 5CBBA 4H9TA 3B7RL 5I1IL 3CQQA 4O54A 1DLHA 3BXWA 1UT1A 1DBKL 4MWAE 4S3AA 5DJ0A 1E6NA 4A29A 3WLTA 3PAYA 2AAMA 5E6IB 2FO8A 5KANG 2G9HB 2WN2A 4B0MM 5LBSA 1R7AA 1OWRM 3D25B 1KG0A 4JRWA 1JCKA 3BGFB 5GGTH 4JTGA 3EUDA 4YYCA 1WBJA 4IM8A 4GOSA 3O81A 4ORGB 4GAGL 1AQMA 5ITFA 3IV8A 3U5YA 4O58L 3IDIA 4LB8A 1R5YA 1RBAA 1XVSA 4NUMA 2Q8BL 3IMWA 1SDYA 3TCXA 1AD0B 2RIKA 2UXTA 3CVIH 3AIRA 5SWSD 3TJLA 4DNLA 4U6YA 3M0XA 5LBSL 1VJZA 2LT9A 1OAZH 2UBPC 2I5QA 1MREL 1Z6KA 4X7SL 3CFKB 4W4OA 5IUSA 3VXUB 3N1MC 1CR9H 3KR3L 1M9SA 1MWAL 4MAZA 4E9RA 5MENB 2E74C 1H2JA 4QGTA 1H3PH 2DSUA 2G60L 4MA3A 5IVOA 5BXRA 2ZKYA 1AS7A 3DSFH 2GJ6A 2ZQKA 2YBVA 3EZ4A 4J3OH 2PN5A 1BVLB 2RKXA 2M83A 4N87A 4WIQA 1U8IB 1U22A 3THAA 2Y2WA 1R3SA 4Y1AA 2QYGA 4G8IB 4YTSA 4JG5A 4U6XB 1HHKB 3DOSA 3QHZH 2EDTA 2VDIA 3LKSB 5DUBA 3BP5B 3UJEA 3DI2B 1F3TA 2A9CA 2HQAA 2QR6A 1N68A 1A6PA 1TO4A 3ELAT 5HINA 2CMRH 3FNKA 3HVNA 3QJUB 2DVXA 5EFIA 5EYWA 4QRPB 4E9TA 3M7FB 3CHEA 1EYEA 1FVCA 1S9VB 4EAYA 3OGVA 5JIPA 1A5OC 4Z7VE 4HEMA 4YDLC 1O6SA 5EEVA 3K8MA 4C6KA 3DSNA 5T1KB 1RZGA 3DXAA 4FRWA 4AIEA 1XF3B 2QADC 2OO6A 3U30C 4MTMA 2NW0A 3VE9A 3Q37A 1UXMA 1NC4A 1MF2H 4NRYB 4PEKA 4JRYA 3DO3A 1FH7A 3KPTA 4QRUB 3B03A 3L65A 3I9PA 3O45A 4TTGA 1KXTB 2Z0IA 5ANMB 1TNMA 3QRGH 2OW7A 3F2CA 1HQTA 5KAQG 3AG1B 4PTXA 6ENLA 5GS1A 4X2PA 3SE8L 2ZRUA 2DSKA 1DZBA 4Q6KA 4MIMA 1G9EA 4HYRA 2RBLA 1OTUD 3SHSA 3VXPA 1A7RH 4L3CA 4XPAL 4DN3L 2IPTL 2XQBH 3NDOA 2X1PA 3ARDA 4RZ6A 1OW0C 3DX0A 4MWAC 2OT1A 2C9RA 4OCRL 3VFTB 2XM1A 3F04A 1GCYA 2RTTA 2J2ZB 1BZ7A 3C2AL 4R9OA 5C55A 5AVVB 1MFEH 5DRCA 1KJ3H 2E40A 5IHUL 1F4YH 1KYAA 4NBZB 4HALA 3MOAL 4QRRD 4K7FA 5CEXB 1XLDA 5BO1L 2WHJA 1V6VA 3GB7A 1XQKA 4DYKA 5AW5B 1T7ZA 4N8VG 2ZT9C 1R9XA 4ELDA 5J13B 1IZJA 4PLOB 3DUHA 3C86A 3NPVA 3FU5A 1JVOA 2YAQA 4P9HC 2BSRB 2AEQL 2VMDA 3IJYA 4E6MA 4IIQA 1LF1A 1MFNA 3QHOA 4O19A 2IAMC 2IALA 5E2WH 3W2NA 3QJQB 4GINA 5FB8B 5I73B 1FWTA 3MLYL 4S3CA 2IAND 1T0NB 1J1OL 2F53A 4HW6A 1DQQB 4Z7NF 4N2EA 4NAMA 1TZZA 1MZZA 1YYML 3P6LA 4DGIH 4GXFA 1NIUA 5M95B 5DC0A 2V3GA 1MW3A 1CLCA 5D8ZA 2C3ZA 3T44A 3QDMD 3F4VA 3WLHA 4IRSA 3QZAA 5LJYH 4M5SA 3LEYL 1FWFC 3SGUA 3OAZH 1VFAB 4F80A 3KWWA 1A02N 4E5XB 1KBWA 4W87A 1S7VA 1YMME 5H2BA 2XFWA 4NB7A 5D2NB 2MCG1 1V77A 2B4CH 2OMXA 1Q3NA 1MNSA 3QEUB 1YTEA 2OCFD 1J05A 1UD2A 1RUKL 4Y19D 2CUHA 2VRKA 4OZHA 3VXRE 2JJSA 1ASPA 1AE6H 3V5CA 2VITA 1V79A 3F5LA 2JKEA 2E6FA 1NAML 3UVIA 1N0LB 3QNYA 3TN0D 4F3FA 1A6ZB 3P73B 4Y9NA 2IDFA 3OIHA 5F7LB 5KEZA 2E47A 3NGBC 3QCUL 2V5JA 3Q01A 1QQDA 2D2OA 4LXFA 3BLDA 4NC1E 2HVKB 2WWMC 1JGMA 4WEUD 2VC7A 4XN1A 4P2YA 5FECA 4Y9GA 4EMZA 1LQBC 1IR1A 1UCTA 4AW4A 1E70M 5ADOH 3C8KB 4Y4FC 2ASHA 3MNZA 2Q86A 1QSED 2VZTA 2P8CA 4B4FA 4EEEA 1OGAE 4L1GA 2OLHA 2DJSA 2WZEA 3IEAA 4DGYH 4P2OB 4AH2B 2NSXA 1H3TA 2H47C 1ONXA 4M7ZC 3MZNA 3DFOA 2DBLH 3QS2A 3FDGA 5JYLA 2DW7A 4B9PA 3MO1A 4XMWA 5EEYA 4G7YH 1A64A 1RA5A 4RVBA 2CU0A 4XVSH 2J27A 1H0IA 1XF1A 4ZYKA 3B40A 2Q76B 5TK4A 4JEJA 3MLVH 1A9BB 5ISZE 1XAUA 1PO9A 1ODZA 3QUXB 4FA6A 2F8IA 2X4SB 4U1GB 3G5ZA 4QDGA 2ZSVA 2ZNWA 1NGQL 4L05A 3H8NA 4GNKB 2CLRA 2EGZA 4K2SA 5J6SA 3V6OA 3TNBA 5CBAA 2A77H 3OB8A 3C5JA 1FWIC 3LNFA 1GGIH 4OT7A 2VR4A 3PTQA 5K39B 1BF5A 2GPZA 1ZU8A 2HFEA 3Q8BA 3SKNA 4JM2F 3N6YA 3S2LA 2AAAA 5D5ME 5TFSH 2PRMA 1GGCH 1GYWA 1GJIA 1Q0XL 3GK8H 5T1LA 1XF4A 2OI9C 3TCLB 4MFDA 1EUNA 3IDUA 4MMXB 1I8IB 2FZNA 3ZHLA 2JCWA 3GMMB 1ME8A 3CHOA 1I1FA 2FJGA 4K15A 2X28A 1MVUB 3QPKA 4JKWA 1OAQH 4YNYB 3I75A 2HT3C 4M80A 2MQGA 1JPGA 4KUCF 4WW2B 2DOCA 1A0DA 1RZ7H 5TJWK 3UYOD 4O14A 3RGVB 4H83A 3IF1B 4XAWH 2JIXD 2PDGA 3C2VA 1FO0B 4Z3HA 3G1AA 3PZTA 1JG9A 2ID5A 1Y5XA 4I8DA 4ANWA 3B34A 3UETA 3Q7JA 4K9EH 5A6LA 1ZA3B 4M5YH 1B0RB 3BDBA 3APYA 4J1OA 4PV1C 2BH0A 1ONQA 2RFXB 4U1IB 3OC5A 3B37A 4M93B 1JGLH 3SURA 4A22A 3H9SE 3RNQB 1T5AA 3IUDA 4FOMA 1KLFB 3HUJA 12E8L 1SXAA 2RACA 3W5NA 3NJMA 3ME0A 5E03A 3I02B 2E77A 2ZVRA 9XIMA 4GZIA 1MCJA 2Z1VA 1HN1A 1INDL 3AICA 3SFWA 3W83A 5EMKA 1E7UA 5LNDA 4OD2B 1N19A 3SRKA 3W70A 3UZEC 1INQA 1HXMB 3DTXB 1IEHA 4LBAA 3IFPB 1OM0A 2AGJL 2PCPB 5CGYC 3ZE2E 4DJDA 3AYTA 1FNSH 4O9HH 4A6YA 2HPTA 1VEPA 1OYCA 4NQ1A 2DYPA 2VLJB 4OH2A 4HAFA 4PTUB 3B0XA 3PPEA 3PZVA 3DUUB 3FU9A 4R4BA 5B1CA 1JWMB 3QFJD 5DRIA 2Y36H 5MF5A 2VE6A 2JJWA 1VZHA 3VNDA 1MW2A 5I3FA 3F4DA 3PPHA 3G5XB 3QZPA 4NX5A 3BVDB 3Q94A 3R58A 1BDYA 3M0MA 3BZFA 4OCLC 1MCKA 1P6WA 5BQDA 2XXFA 4ODVH 4EXPX 4H40A 4NO5A 1XYCA 4LVOB 1QO5A 1F74A 3IGAA 3VFNB 4U0RB 1JPSL 3ME3A 4PBXA 1ZHKA 4MB1A 3Q8CA 4GY1A 4JQVA 3UG8A 3U46B 4ZAKB 3ML8A 1YAIA 1OEZW 3REWA 3QOMA 5DTFA 3MSPA 4ZO7A 2R7EA 5SWSE 2P5ED 1DJNA 2JH2A 4Y5XC 3V5KA 1UP0A 4XBJA 3DRTB 1K72A 1J5SA 5TQ2H 1DXIA 3JWOH 2GVEA 3TDFA 2GJZB 3RHWF 3NH7H 2AK4D 2BOEX 3MJYA 1HXKA 3IGLA 3GVWA 2F1EA 3LENA 1RVKA 3AZTA 2CQVA 3OJMB 5DMIL 2HRPL 3O6ML 4HNLA 3US1A 3B43A 4JTKA 4Q8BA 1UA6L 3HBQA 1TPWA 5GZOC 3M6DA 3R8HA 1OK4A 3FAXA 2WBKA 2YAEA 1AFVL 1EFXB 1N0XL 2A6KA 2OXHA 1LP6A 1QO3B 2XV6B 4U4BA 2OMWA 3MLSH 2YXVA 4E5TA 2G95A 3W7JA 1JV2B 5H4YA 2KC0A 3E9TA 3L3OC 3E7JA 5MI0C 4DAIA 3GMNA 1SVZA 4IHOA 1ZSHA 5J1AA 4CVXA 3WV0A 4BQ8A 2CIIA 4N2AA 5FHBH 1CB2A 1CC3A 4URIA 5A16B 1AY1L 4AGLA 1VZWA 4K71C 3S36H 2YBGA 2UWEE 3G6LA 4FQPA 2FX8H 4ZX3A 1X6UA 3QKEA 3MPCA 3DRQB 1NM4A 5DJDB 3LMJL 1Z3GL 3VFLA 1WH0A 3N2MA 3V0AC 1K9EA 3QORB 3G3DA 2ADGA 4L29A 3SGDI 1CXLA 3AUVA 3DIPA 4RK8A 1NFDF 2L7QA 4GRWE 2QPFA 2YPLA 4TVSa 3PRZA 2H0PA 2ITFA 1P7KA 4M7LT 2EIBA 3WLLA 2JIEA 4AWUA 2Q8LA 1ZHNA 2Y7QB 4KJYB 5K9KA 5C09D 3WSQH 3HNTL 4EANA 3INUL 5MEQA 2XJKA 2IOMA 4MKSA 5IXEA 2G75A 5CJXA 1MCPL 5IB2A 2VURA 5E4EC 4J35A 2GY5A 4TVPL 5DT5A 2L04A 2Q3ZA 4MD5B 3O4LD 2EPKX 3DO7A 2AKZA 1AQ0A 1P9MC 3FK4A 1EDGA 1JHTB 3KPQA 1UB6A 5FM8A 3VW3L 3BD4A 3VG0L 1BFNA 4R90L 3REQA 1E5AA 4EOUA 5GRUH 4XWGH 4ODSH 1CXHA 4Q9RL 1JVNA 3BVJA 3SZKC 5FIEA 2N59A 4QRRE 3KPSE 4HCGA 1VPOL 4PJDB 2H6UA 1CMOA 1RAMA 1F6AA 4XMLH 4QG8A 3PZIA 2VHLA 3FCSB 1RJLA 4HUXB 3OAUH 5BZWA 3HPFA 5HI5D 2R0KL 2X6BA 4MQ7B 2NTSP 1WCQA 2VDRB 1E56A 4FP8L 1XLHA 4K7YA 5TAOA 5KSAD 4YIWA 4A3YA 3R1GL 3GU2A 3QYQA 2BS71 3LD8C 4QNPF 2IANE 4RGND 1FSKB 4D6FA 4J39A 3WO8A 5AVRB 4ATLA 5FX3A 3FJ6A 1FNLA 4FMKA 1EGZA 1TENA 2VGLM 3IDYC 3MUZ1 1NCNA 3EFDL 5I3HA 2R2CA 4IBWA 1N6UA 1SXZA 3IT8D 3MRHA 3O3EA 3MFFB 3QDME 1R46A 3O8XD 3BZ4A 4TSBH 5BMFL 2A9DA 3LPWA 1TJ1A 2WYIA 2G2RA 1PNCA 3B8VA 5RUBA 2EE9A 3PLYA 3IETB 4PTVA 4OGXH 1WNOA 3WKMH 3HLAB 3GTXA 5DCDA 4IJBA 1R17A 4L8SA 3W1RA 5AZ0A 4XR8C 4MADA 4P7OA 5H8UA 4QY8A 3CAKA 5B4MC 1A80A 2Y7GA 3QHFL 3MLZL 1SJXA 2C1OB 4H6RA 4MJHA 3BANA 3LS9A 2X89D 1W3HA 3A4WA 1S9WA 1MZYA 3C6LA 4C1NB 3RDKA 3UEQA 3C2RA 1RUQH 2CU9A 1WKDA 3ITOA 3KGRA 2VENA 5DZPA 1M6OB 3QAZB 2AERT 3OB0K 4K3EL 2YAHA 4F37F 1KNWA 1NOUA 4Q9CA 3QIWB 1ZJIA 4UT9L 1SYVA 3O3AB 1QSEE 1YCSA 3L54A 2JALA 4N42A 1IC4L 4JD4A 3V0TA 1GW1A 4TSAL 1K8ZA 2I32A 1QFPA 1S8DB 1JMZA 1H7XA 1FL6A 3RVUD 4AL8L 1AS8A 3QF0A 2QQ6A 1G7HB 3FY1A 4UTBH 1OTUC 2NXYC 1HOCA 1Z41A 1KC5H 2NV1A 1V27A 3NCYS 4NQDA 3D2UB 3DAQA 4MNMA 5CG7A 1F4HA 1KCLA 2NY4D 2ZX9A 2Y07H 4PN2A 5IOBA 3QC5X 1QR4A 4HD9A 2HVOA 2NR6A 2OPJA 2QULA 3H6AA 3GO2A 5I15H 3PXLA 1JZ3A 1BECA 1YNLH 4WVRA 2CIKA 4XHJD 3QEQA 4A2SA 4HC1L 4IIZA 3LEVL 4AENB 3V95A 3F58H 1GKQA 2G3ZA 2ACQA 3ZMRA 3HZKA 1N64L 3HC3L 2AJ3A 1CWVA 43C9A 4P4KD 1E8WA 4HLEA 2IGFL 2HVBA 1GHFH 3W0WB 1VF5C 3V6ZA 3BVXA 3IJSA 5EPMA 1B9ZA 3UTZB 3I7SA 1FO0H 3UPMA 3VGHA 2J9XA 3SY8A 4D6CA 3HBLA 3GNMH 2WMHA 3KHOA 2R23A 1NMBH 4GY0A 2OMTB 1UP2A 4IIHA 4NHCL 3UFYA 1DE4B 1LLWA 2R1MA 4LH8A 2AI0L 2PSNA 4UBPC 5TPWH 4OKVB 1MAJA 1J0KA 3UW6A 3EJJX 1XLLA 3CPGA 1A5UA 3FXYA 1S3KL 1G7JA 4Z7OB 2XTLA 3I6TA 2K3HA 4KH2A 5LZLA 4QRSA 2P8BA 4NQVA 2YQ3A 4Y4HB 1GQLA 2HRLA 2WXDM 5AVNA 2OTDA 3GQFA 2IBZY 1U4EA 4X6CF 5EF1A 1A7QL 3O3UN 4LCUB 1ZDSA 3CHCA 4LF1A 5ID0B 1MXDA 5DR5H 3WKNA 3LM3A 3H8AA 2YZRA 5FF6A 3TEYA 2CHNA 2Q3XA 1AKJB 2C1IA 5U4NA 2R4RH 2PLTA 3KBFA 5I0YA 4AQ1A 1KB9K 1EF3A 2V7HB 5E1QA 2VM8A 1LNUB 2YXOA 1C5CH 1B2WH 2D03H 3TN0C 3OKLB 4LNVA 5DFTA 1I1RA 4G8FA 3CEUA 3WD1A 1IVLA 1Z8AA 1T7VA 4TQIA 4OLYH 1J96A 1KV7A 1UWRA 1NBVL 1DEDA 4NUQA 3AYSA 4WKZA 2E25A 1GIGH 2I7SA 1REQA 4CD6A 4ZEPA 4R5VA 2PPCA 2EIEA 3X1FA 3U0WH 4DKDC 1FHDA 4GKNA 4J6IA 1OYBA 1A8ZA 4AYEC 4PCFA 1W1VA 5FAGA 4JY4A 4XWOD 5I6SA 2CNYA 3GYRA 1GW6A 4FXGA 1TQBC 3TNMA 1JYWA 2BSCA 2CRIA 3ZY7A 2ZOWA 1E9OB 1CE1H 2B5IC 3IN0A 4AZ7A 2WM0A 4A2DA 3FCTA 3QFJE 4YE4L 1TFHA 3ROLB 2QR0B 2IPGA 1P84J 5LLIC 2DD8H 2EXYD 2GAZB 1ALDA 3ARYA 3BRFA 2JF6A 2GDQA 3VFUB 5B80A 2EF9A 3BD3A 4GYBA 1PZAA 1SGKA 2Z93B 3KAAA 3DHMA 4K36A 4NHUA 3DX5A 1FAIH 1UBSA 5D9MA 1D2KA 4QKTA 4W9ZA 2GTWA 1OOAA 4U3CA 5CMAB 5KG9A 3SPVA 5T8GA 4N0YL 4FFTA 4PRPB 5IUCA 1AH1A 4DAGH 4G83A 4Z2GA 1AJ7L 3TEUA 3RN6A 3POHA 5B1JC 2GSHA 2OP4H 2P5EE 1CXEA 4KKBD 3TBSA 1T0PB 3QPEA 3GAYA 4CBZA 1SXNA 1C1EL 5F2IA 3WE6A 1L9SA 4POZD 3KOWA 1M7JA 4PJAF 5AEAA 1WDDA 1BXCA 4KDTA 2J7BA 1NCAL 2AK4E 5DHEA 3L0NA 3LK6A 4DI9A 2EECA 4U3AA 2R1PA 2WP3T 3MUCA 1BTMA 1ITQA 4C6JA 4RISL 5KINA 3F7JA 3G1YA 1NL0L 4R8WH 5IKCA 4M1RA 3R1ZA 4GW4A 2ZE0A 3QIUC 5BZXA 4IBSA 3ERPA 1EX0A 4EXKA 4J3OD 5E8NA 4DM2A 4GUPB 2QMKA 3F7VB 5AHIA 3BH9B 4XO7A 1PCKA 3SSGA 2D22A 3S42A 3LXCA 1T03H 3FA5A 4Q8UA 5IOPA 2RJMA 4S3DA 5ALCH 1LE9B 2LTQC 5T3ZD 4G2DA 3MKCA 4LEOB 1DSFL 1IC5L 4S1SH 3VKAA 2Z1KA 3VD9A 4PTDA 2XN9D 5JW4Q 2JKPA 4Y96A 4UFJA 1JGDB 1J5HA 3QUML 2XWDA 3LZRA 5AL8A 2C14A 4LAQL 1U8PA 1V6WA 1J1PH 4EI6A 4ENED 4ODHL 4ZPTA 4YFLI 5BUGA 1J5OH 4WWPA 3KVPA 1TZGH 3OZOA 1UZ6F 2WSRA 2XYCA 4HZLA 4XNAA 3ZT7A 4Q4OA 1JNDA 4F0HA 2O5XH 1GG0A 4QE5A 5C7HA 1GVEA 1SFSA 1F05A 1XX9C 3VRLF 3WYRA 5DHYB 1K8CA 3OPZH 4MNGE 3I9GL 1QEXA 2B7OA 3D06A 4MOZA 4P57A 4L4JA 2Y1HA 4B27A 4IDJH 2R69L 2VI0A 4LSTL 2F6AA 1M5WA 2DF3A 2E6YA 4O1CA 4HK0B 4JKLA 5B3JE 3EJSA 1YJDC 3VUSA 3HI6H 5DMYA 1PGRB 4PS7A 2OMUA 1BZOA 3RBGA 1N59A 4NJGA 2X12A 2XZQH 4XKYB 2PWVA 4LF3A 3O4LE 1KXQA 3GSRB 5INCB 5DUJA 4Y4KD 1SU5A 1TCRA 4X5PA 1EXPA 2Z27A 4O28A 2VDRH 1WHOA 1KCUH 4OD1H 3UJIH 2BGQA 1YHPA 4KWUA 4DKEH 3WLKX 3N9RA 2YW3A 2DQCL 5C08A 3D51A 3O0FA 5BCAA 3DLQR 4ZO6A 4R88A 3DX1A 4L3AA 1B6DA 4XO9A 3NCMA 4RDZA 1G4MA 1OCBA 5I74B 2PLMA 3QUYD 5F7AA 3G0SA 1UB5B 5REQB 5AB3A 1FDLL 1DXEA 3I7QA 4PH8A 3SQSA 1YVLA 3PP3H 1GPWA 4M4RB 1DL3A 1P0SE 5CPQA 2DLFH 2H9AB 5LGKA 3Q6GL 1IQDB 4KVPA 3LBCA 1PLBA 5E08L 1UWGL 3SJ3A 4RGNE 4UOZA 4XXWA 1Z9NA 2GSGA 4JRXD 4UFKA 2NQCA 2YJLA 2G2PA 4MDJA 3RLUA 1QPXA 2DWSA 2WYHA 5KBMA 5DJYA 5ECUA 4APQA 3S3PA 3R0NA 1LQ0A 1XIMA 4Y7OC 2O9PA 4K7PH 2E9GA 4I18A 3I4EA 1B90A 3R8GA 4PJ8A 4I5BA 3HPLA 3FJ4A 3TPUA 5KN5A 2FKPA 3NIFF 4JY5H 2HPMA 2JELH 5L0QC 3QDGA 1O5QA 3FUJA 4PYSA 3TLLA 2EDJA 3S4SB 1AJ2A 4DN1A 4N85A 1GJUA 5I71C 1G84A 1TV5A 2J62A 3W7IA 3BVNB 2PDBA 4X6DA 3Q8AA 2VERA 3X11B 3OG4B 4DQOH 3AMCA 3H21A 5C9XA 1HJBC 4B6ZA 1PTGA 2ZX5A 4A2MA 1TWWA 4R9HA 3P4OA 4LSPL 2RHGA 5A2IH 4MJ5B 4MAYA 3DFSA 2R14A 3KPRA 2YPIA 2FSEA 1CBGA 5I3GA 4FL4B 4JQ2A 2Z92B 2FB4L 1OADA 2C0AA 3GINA 5E24E 2ERJC 5CPMA 3NO1A 3MMWA 3B8UA 4YBQD 4O0QA 4H1LB 4DUWA 1WOAA 5DJ6B 3LPOA 2DQIH 4H8WH 1E27B 4XTDA 2HG5A 3ARGD 4E0RA 4AWTA 2CKBA 2C4FU 3B8YA 3B2DC 4XNZB 3MUUA 1H49A 2QJJA 5LCVL 2UZ9A 3IVTA 4D8ZA 1DQJA 1KEGH 3W86A 4JLRB 2OWWA 1N2RA 3IK4A 4JFOA 2EDOA 5EOCJ 2DIKA 3TW7A 5BW6A 2WIIA 5CEZH 3O11A 1RFDH 5DUML 1ZPTA 3EGDB 5HHPB 4Z8FL 4AD1A 4K8RL 5C9KA 4HGXA 1C9WA 2E7BA 4HPXA 4PHZA 2GOUA 2CKBL 2IMMA 4JM4L 5I5RA 2OK0H 4YX2L 5KVDE 3UWEA 4RSYA 1CLOL 3C2SA 5HI5C 4LBEB 1RK5A 2YPVA 3LV6A 3N1FC 4UQAA 2XCMC 4I6VA 2X4OA 1MCFA 4MBRA 4KY1L 5KSAC 4BFIB 3KRZA 4LSDA 2WMIB 1OKEA 2IWFA 2C9PA 3FA4A 1PF3A 5J11C 4X2RA 2UXVA 4CADB 3QIBA 3PB0A 1RD6A 3LDBB 4RDBA 4ZMVA 2YD5A 4R2GD 2BDNH 5LG1A 3LKQA 1K02A 4YHPA 3O8XC 3TWAA 4Z0XA 3LKOB 3NYDA 2ICEB 3SCMB 4DB7A 3VYNA 5A8GA 1I3RA 3Q2NA 2YA0A 2V81A 2UX6A 3ZKMD 4NQCB 3S5LG 1N8FA 4QXIA 8FABA 3TT1H 3MHGA 5F88A 2OG9A 2IPKB 4MS6A 3FX4A 3PZGA 4C47A 1QUPA 1SUHA 1R3LA 5I1EH 3MWAA 1D7CA 4ABVA 1XC4A 2WHVA 1Q94B 3SRFA 3VCCA 4OBRA 1W72B 4ADJA 2OGYA 2LLNA 1U8NA 4UT6L 3GTNA 3WOVA 3TIEA 4KVCH 1QBML 1BQHG 2XGZA 4AV0A 2W27A 4JFEB 2WB7A 2XFXA 3NJIA 2OLAA 3RJYA 1FNEB 1NEZB 1VRSA 1ESWA 4MZ8A 3C75A 1E2VA 4J2PA 2XZCL 2X4QB 3KNBB 3F7KA 2BNRD 4KNQA 3OKEB 4JN2A 1DPMA 1XLBA 5KSWA 1BM3H 3SIZA 3LGEA 1ZVSA 1XGTA 2HX8A 5D4HA 4BFJA 4MF4A 3NXLA 4FF9A 1MFVA 1EMTH 3NIGB 3QZBA 4IP4A 1TSRA 4ZS7L 3RVUC 3LG3A 5AYQA 1UZ8B 4CCDA 2ZF9A 3V52L 1CICA 1CB7B 1WIOA 3L6FA 5A6BD 4U3SA 1ICQA 1TRDA 1A4JB 2NY4C 3FQTB 4QLJA 1RZ8A 1IGJA 3TH4T 4QXUL 4GFIA 3PIQB 3V4PA 4QHRA 1EHXA 3REVA 2QDVA 1O9VA 2ADJB 4FXKC 1XCQA 4KOCA 4YTUA 1ZSDA 3F7YB 3FJLA 4XHJC 2UZXB 4HNTA 1DQMH 2DQJL 2A3AA 4N0RA 1A65A 4OD3L 3K6IA 3H7RA 3VG9C 3AHTA 1X97A 5DMJB 5TE7H 3LKPA 3CBJB 3ULVF 5F9JA 4P4KC 1JK9A 1UC4A 4LSUH 4WX2A 2L8AA 4WJG3 4R26H 3KCPA 4JPKH 3NL2A 1USZA 3V9CA 5CD3B 1IVTA 4Y6GA 1MDLA 4MWFA 4HJWA 2BX5A 1IKNA 1TV7A 2J74A 3K6SA 4EI5D 2CLVA 1WUZA 5GSRA 1AH0A 5CZTA 3GUFA 3TC9A 4Y89A 1UYWL 1Z7JA 1BGXL 5IQLA 4TQ8A 5F7UA 1KXVC 2W07A 2F5AH 2R1YB 2Y6ZA 3NZPA 1I3GH 4A39A 4MKVA 3UYIA 4N6RA 4JFZL 3U9IA 1QPQA 1ZSXA 3UBFA 4GK8A 2CR3A 5T3ZE 2BWGA 1XIGA 2X2UA 4MUPA 4ZQTA 2JXMB 2XN9E 1FH5H 5EOQH 1JPST 4XOBA 4DQAA 4PRHD 2YD9A 4PM1A 1K8DA 3PL6B 4LEEA 2NY5H 4ATDA 4U33A 2I5YH 3CDZA 3Q3GB 3FFDB 1S6NA 5ICUA 4YK4B 2X4TB 4P5RA 2VR5A 5CGBA 1B3ZA 1RH9A 3NG5A 5AC7A 2Q6ZA 5GRXG 1OCCB 4PCSA 5LWYL 5CINL 2VVNA 1PX3A 2I14A 1TQCC 1WO2A 1KPUA 3TTYA 5BZDA 5ABFA 2EDXA 2Y5TA 2EDRA 5IVXE 1EWDA 2YRBA 2DI9A 1CTOA 4CCCA 4JZNA 3THDA 4U6TA 1H09A 4LPUA 1QSFB 3EW3B 1FL3A 1XG4A 2YL5A 5JPNB 3V5HA 3TJPA 2LU4A 3MBXH 3THML 5E94A 1OC5A 3SQBB 4GW5B 1MAMH 4I77L 4F58L 3QZNA 4BKLB 1HKLL 5CP3H 1G9NC 3QARA 4OAWB 1PWLA 2LAGB 2VW4A 4JFHD 1RI8A 4XWOC 2NDGA 4ODWB 4JFXB 4I0PB 1KEML 1RALA 3AQDA 1AD9B 1JUKA 1HHJB 1S5IH 3HRPA 3AISA 1VEOA 2J24A 1DBJL 2EXYC 2OODA 1FFRA 2AZAA 5AAWC 1NJ9B 5AW3B 4Q6IB 3RX4A 3D6NA 4KK6D 3MC0A 5AYTA 2PPFA 3EXRA 1U8OA 5L9DL 1BQKA 2OOGA 2D7PA 4N8CH 1JZFA 3DDGA 4HHLA 2J72A 4NUGH 2QGCA 3RKDD 4ADIA 5JIQA 2FJFB 2QSCL 2M1KA 3PB2A 2EO9A 2FZ3B 4C1KA 1GNXA 3NFUA 4M61B 2D7QA 4P49A 1ECYA 4ZNCD 3FYOA 1MQKH 4NWTH 1J8HA 5KS9E 1LXMA 4EN3B 1AHMA 1FC2D 1KYUA 2BY3A 2NSQA 4B9IA 4KKBC 2F2KA 2Z8VC 4N6FA 8XIAA 3L1OL 4PUWA 1DE5A 4GYPA 4YSEA 3GSNB 4POZC 5EBWA 5AD0B 4X5WB 3M7OA 1W80A 4A1RA 4BKSC 2YSWA 5C0IA 3UYPA 4BI6A 3D4YA 4GT0A 2CBIA 4JRXE 3QC3A 5IDIA 3CMJA 4CQAA 1IGWA 4QTHA 4HZ8A 4G8GD 4IRZH 3ITVA 1WE5A 4QGCA 3QSKB 1Z9MA 4HH8A 2I07B 2F8QA 3N18A 5FYLH 1K4DA 1MJ7L 4HYWA 4J3OC 5B4MD 1IQWH 3BSZA 3WD5L 4X5LA 3IE4A 2ZUQC 5LXGH 1F97A 2VLKB 1WA2X 4WUUA 3TBVB 4DK5A 3K4DA 1YN7B 1QYGH 4P59H 1M7UA 2FZBA 3EOSA 1KCRL 4M7JL 1EEYB 4LSQL 2X4RA 4WJ5B 3W7QA 2HS6A 1BWWA 2Y72A 4OSUL 4ENEC 4PV9A 3LN9A 3GDMA 3LCHA 1FZKA 5KZ6A 3CSGA 1TTFA 2VJ0A 3MRCA 3BSZL 1R75A 4ZI8A 1X5JA 4P3WA 3DX4A 1BYPA 4Q8MA 1A1OB 2FYMA 2A6JB 3PXJA 1AGDB 2F38A 2KZWA 1WX0A 2NXYD 3UDWA 4AD3A 4HWZB 4P0DA 4BUQA 1KENL 3L3HB 4HLJA 1A4MA 3BJFA 3FOLA 4WHTB 4JTUA 1KN2H 1P4BH 1UD5A 3R2GA 3PAZA 1J9QA 1S5VA 2I26N 3EJQA 3PPGA 3MV8A 3N91A 1EPXA 4P3CH 2ORBH 3RA7H 1GEQA 1W2VA 3Q1SL 2QGBA 3UC0L 4MQXC 3TZVD 3GJEB 3UO1L 4B5EA 4FHBD 4X4ME 2A9NH 1OIFA 4KXDA 4FX8A 1BEXA 4XOCA 3QFDB 3T40A 4E4UA 1BEYH 3KDMA 1A6VH 2PF6A 4Y4KC 4NZUH 4JTCA 1LEGA 2ISVA 3B9VA 1QRNA 4U3HA 4MFEA 3AY2A 2Q6WB 4R97B 4GPVA 3P2DA 3BP4A 3S4TA 1KFJA 1F3RB 3FTGB 4LSBA 5HYIA 1GGBL 4JN1H 5F1VA 3BL3A 5FCZA 1TMLA 2I27N 4H20H 3CWHA 4Q32A 1FKWA 5KTLA 4HCHA 1JNHB 2BWDA 4G9FB 4WFEE 4JRFA 3RP1A 1QI2A 4LEXH 1JUEA 1Z9PA 2FCBA 1EOMA 2Q0ZX 3O41A 3AXKA 3QUYC 3QFWA 2GUOA 4CSTA 1OF8A 1DWIM 1A4KA 2VM4A 5H37H 2MCPL 4LU5H 4YN5A 4KCWA 1V54B 3IPEA 5C07B 1F3DJ 4Z7UA 4Z95H 2QQQA 3NM3A 3DVNA 4NAEB 5FYJE 3M1BB 1Q13A 4FQJH 2EIKB 3HFTA 4BY3A 1V3KA 3VGBA 1U1JA 3F6IA 4LKXA 1AXSB 3D09A 4OIFA 1W72H 2A5HA 2WTRB 5A7EA 3ZE0F 4ZSUA 5E99H 2QGDA 1B57A 4LC6A 3U2IA 5JU6A 2AV7B 4FX7A 3ULUL 1W3TA 3UTTA 3D48R 1VR6A 5D2LF 1NELA 3OMIB 3U1SH 3V7PA 15C8L 1JGIA 1YMHA 1FIGL 3ZUCA 1XLCA 3NACL 4H8UA 3M46A 1M41A 2B4CC 3RY6C 2VH5L 4WEEA 2ZC1A 3N17A 4U1KB 3NDZA 3QJRB 4Z7IA 3EFOA 3Q13A 5L7XL 5AOKA 4POUB 1SM3L 2NUPA 4QTFA 2A0NA 3R8RA 1Z9AA 4HS6A 3LHWA 2GIYA 4ZUUA 3LLXA 1KTLA 4FIQA 4OZIE 3QHNA 1NANI 1IGTA 3NA9L 1BBJA 3D85D 2Y6TE 3L4TA 3SBFA 3QWRA 2DSVA 3QQWA 4JTSA 3PC0A 3VVGA 2ENPA 5BNXD 3GLAA 2BNRE 1KCVL 4TNVK 3UPRA 4U0QB 4JZ5A 1IEIA 4UM8A 1US2A 2X44D 1R9YA 3WBXA 3W3OA 1NCCH 3ECBB 2XSKA 5IFAH 4NN5C 4YQXH 4JFYA 1M71B 3VIOA 3NDYE 4YXLH 3ZIZA 1JCMP 4RGOH 3BHBA 4IS6A 3BFWA 2CXGA 5CSSA 3QT2A 1U2HA 2HKAA 4YBQC 5K9OA 3NQFA 4B3KA 1BD2A 3Q43A 3B2VH 3CZSA 4PG2C 4XP4L 3OLEA 4HQVA 2WXRA 5EC2A 1QI3A 5JOPD 3ARGC 1ICSA 2OMAA 1T3FB 2WBJA 3QI9B 5D7HA 2E4TA 4TX9A 1FZOA 1PJ9A 3BPOB 4LOFA 2ZZUT 1QEWB 1NKRA 5A69A 3W1PA 2OR7A 1OG0A 4DHGA 4WQOA 3V0GA 4U4MA 1J4EA 3P2BA 4R6UA 3ZDYE 3I2CL 3BX7C 3P02A 4XB8A 1SLXA 3UXKA 5DFAA 3GIVA 1A3HA 4Y2DD 2D4DA 3FPYA 4KKXA 3OKKB 4ZTPH 5K4ZA 3LY6A 5EV7A 3K4ZA 4LVHB 3QIUD 3TYUA 1WS7A 1RY8A 2QKIB 1WFJA 4PJHE 3DN5A 1IR2A 2CBTA 5DHMC 1AQKH 1KCKA 2JCCB 1T6WA 3MV7B 3OB0H 1TELA 4J9JA 3JYBA 4LVEA 3CYVA 4YHEA 1NCJA 2A4EA 4GNJA 3Q58A 1TVDA 2EEDA 1EO5A 5FYKL 1BBDH 1GGOA 4C7FA 4KS0A 3OG2A 4ZMNA 4OVXA 3OLIA 3UF9A 2YBRB 1IBDA 4G43A 3DG7A 4R2GC 4W89A 5E23A 3BZ5A 4MXVF 1WDRA 2XBTA 3W73A 2H6RA 1SW3A 4GQ9L 1YA5A 2Z34A 5I66B 3WEBA 4FLSA 1E4KC 1YC7A 3CC5B 2PC4A 3BUBA 2XOTA 3SJVA 3TP4A 1YQVL 2BP8B 2BVPB 3ZKMC 2CGRH 2BZCA 4PRHE 5SWZA 3D05A 1HILA 4ABUA 4PFEA 4PMZA 1G7PB 1G9HA 3LXUX 3NRQA 1LBMA 3ZXAC 3S6DA 5HJ3B 4HWBH 4HZMA 3S9YA 1M05A 1I8LC 1ISWA 1VBHA 1UENA 5EWIL 3PBVA 4NQSA 5JO5B 4LASL 1DJGA 4W8BA 1MCEA 4V33A 1DWGM 3IXAA 2NZLA 4BFKA 5J06A 1A3LH 5FC9A 3AXLA 3TYBA 5G2HA 4M82A 3N42F 1AGEA 5FJIA 3L95B 2VFGA 4G5AA 4IXHA 3HBZA 3W1MA 4P2AA 4HJ1A 4R7VA 3MYPA 2V9TA 1OP9A 2XG4B 4PJ7A 3LN4B 1B4TA 3CHSA 3V4VA 4GMSL 3U9UB 1Q65A 4BSVA 3ALXA 4X98A 2BFVL 1BGAA 1D5XB 4WHBA 1A7OL 4JFHE 3X14A 3KYMB 3OGSA 1TVPA 3S3DB 3R79A 4OLEA 4A6YL 1IBHA 1ZGLB 2R2BB 5I8OL 1OY0A 1ULVA 4ACZA 1ORQB 2XBDA 3OW1A 4LFHD 1PD6A 2Q8AL 4MXWL 4WFHD 3GZOA 5HHOD 1M53A 1NDGA 4NO3B 5DQ9B 3P54A 5TE6H 1U91B 1RUML 4MNJA 5D9SA 3K71B 1TG7A 3FB7B 3FO1B 3V4VL 2D24A 2HE5A 4HU8A 3RM4A 2A4AA 2HUHA 2A7PA 2YXFA 3QK0A 2FX9H 3GSNH 2AMXA 5DURD 5AZ1A 3UP1A 1N8ZA 4XT1C 2AGTA 4M5PA 2BERA 1H6UA 3CO8A 3H4WA 1OCOB 2WZHA 1P4IL 3M0ZA 2CDEB 2E8YA 3C5ZB 5I6LA 4KW2A 4AG0A 1T1ZA 1GYUA 7PAZA 2DUXA 2OW6A 4GXUM 3W1QA 5F1NB 4WCJA 4L37B 2RCSL 3ZQXA 1CDHA 2C15A 3ZIYA 4QT5A 4ZSOA 3BT2L 3EOTH 1EA0A 5HGAB 1RLBA 3JWOC 4XNBA 1QTYT 2Z2AA 1HXYB 3DIFB 4EI5C 3HZVA 1SHXA 4QSFA 1DBBL 4OF3A 2GQ3A 2PETA 3TCSA 3G24A 1AZBA 4G8GE 1XDLA 2ALAA 3UD6A 3GSVA 1IILE 2X1TA 1FGNL 2OKTA 2NZ9D 3ENLA 4IICA 3KHQA 4BV1A 3MRKB 1MHHA 1UWIA 1I0DA 4RRPM 1FN4A 1OAKH 4PA8A 1OWWA 1Y6MR 5I8CB 1F5ZA 1N6VA 3ABMB 4WR3A 4B96A 2PCFA 2BTMA 4PRID 3MFGB 2ZZ1A 5C3IA 1QSZA 2GI0A 2BASA 4JM2A 3AUWB 2WVUA 4GKSA 1OAJA 1GYNA 1F3JA 5KZCB 3WCZA 1DUYA 1TZHA 2GFBA 4G5ZL 2OWXA 3T4YA 1B4LA 1MIEL 4JQ4A 1R87A 3HPAA 2HISA 2BNQA 5TE4H 1TJHH 1Q2RA 4HSOA 3CFDA 4KTGA 5AHNA 3OF6D 2EIZB 4ZUTB 3VFPA 4FI6A 2FK9A 3P0XA 4KMTL 1V02E 3RK8A 3GH4A 2D9QB 3MXVH 4EXQA 3CMOL 1YEHL 5JHMA 2Q71A 3PWUB 1NBZA 4AYFB 4AMKH 1B3WA 2HWZH 4PJXF 3STFA 4UNLA 2V33A 5I1CH 2R0WH 2VTFA 2H6OA 3B97A 4DZ5A 5C7VA 4E36A 4OUEA 3QY6A 3QR0A 2XV3A 3MJ8B 2E6PA 4WI4A 3QNXB 3FQYA 5BS0D 1F8MA 2V5TA 3EXLA 2J4WH 4NP9A 1L5GA 4ZTEA 2I9EA 4XPBL 1IKOP 2BJML 1Q90A 5GSVA 2A21A 4KK6C 1HHIA 5I6MA 3LKRA 3IS4A 3RRAA 2BOCB 2NX5B 4N0CD 4NLHA 1CF8L 3TQ0A 4JB9H 1VD6A 4CD8A 3RKDC 1PQZA 1ZT7B 3NAAH 2OTWB 1KPRB 4NDMA 1ZIBA 1I7RA 2YEZB 1ACXA 5EUOF 4AD5A 1FGVH 4L61A 2ADIA 1QFUH 1HI6A 1P7QA 4X9GA 4YU1A 5C0AB 2V2WA 3GI9L 1H6EA 2ZUYA 4L1XA 3FU0A 4OT1L 2H8PA 3QPXH 5ACZA 5IJVA 1OAUL 3VGAC 2J7FA 1QWUA 1EXBA 3DV6A 5AENA 3CFUA 3MBWA 5GJSH 1GYCA 1T0MB 2QTEA 1MIML 1JPHA 4GIPD 4N7QA 4NZDA 1II4E 4X6FB 4Y19E 4RAUA 2CA3A 3X1BA 1R3HA 3KOYA 4QIRA 1MPAH 1T2QL 3QCVH 1H0DA 4KTEL 2F18A 4L4LA 2FUQA 3RTQD 2RMNA 3I3BA 4Y7EA 4F7MA 4Q0XL 4MZRA 2YRPA 1ORSB 3I50H 1VKXA 3OR7B 3E6FA