1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
1H3GA 1HJUA 4EKJA 1C7TA 1D3CA 2XN2A 3T2QA 4NRSA 3D51A 3MU7A 1M53A 1KBKA 4HU0A 1Y7VA 1MQRA 1F4HA 4CVUA 1HJXA 3EDJA 3AMKA 3WQVA 1W9PA 2FDMA 1SFSA 3AI0A 1UASA 2ZUUA 1DWIM 3AS2A 3QHOA 1GJWA 2BY2A 1ZL1A 1UA7A 2FYVA 2DT0A 4BCEA 1QW9A 1E3XA 3LPGA 1LWHA 2JF6A 2A3CA 2QPUA 4OZOA 4TX8A 2UY3A 3A22A 2X1IA 3AIRA 1CZ1A 3W37A 2ZXQA 2JFEX 2IGTA 2DPEA 4H2CA 3PZUA 4E8DA 2WW5A 4HP5A 4OOUA 2ALWA 4AEFA 1CENA 2EBNA 1X6NA 3KLLA 1U2YA 3VMOA 3TTYA 4D1IA 3VNYA 4UCFA 1DWGM 1ISVA 3RJYA 4ZFMA 3DYOA 1MFUA 2ZUNA 1E72M 2EPLX 1WCGA 3VSTA 4DWSA 4Z2JA 1V3IA 1JD7A 1EHNA 5DO8A 3BAKA 3BVXA 1FFRA 3WDIA 2E40A 4KRTA 2YL8A 1XD0A 3WBAA 1E5JA 3WNLA 1Q6DA 3CZGA 2J74A 2DQXA 4HTYA 4GXPA 3ARSA 1TVNA 1W3HA 3J7HA 4RE4A 1E4MM 1D2KA 2EACA 3WF4A 4AD0A 4D6FA 2MANA 1GUVA 3ZJ8A 1JYNA 3AOFA 5D9MA 2V3DA 1V0NA 3WF1A 2FHCA 3OB8A 2W63A 4NX0A 4FLOA 1E55A 2BVDA 1JYVA 5JIPA 3BUIA 1W9VA 2J8FA 1VFOA 1D7FA 5A6LA 4W86A 2V3EA 2OLHA 2WWCA 3GYCA 4WKAA 1UWIA 2ZX6A 3GDBA 1XSIA 5CGMA 2D0FA 1ZBVA 2ZX9A 1M03A 1CPUA 2Q8XA 1GNXA 4ZEPA 4CD5A 3IAQA 4QAWA 3IK2A 1GHRA 3CZSA 1EGZA 3OA5A 2VC9A 3FXYA 3NCOA 3EJPA 3OLEA 3TONA 1PX3A 2CESA 3GNOA 3MSGA 3GBEA 1MVYA 5CLWA 2NT0A 2VZTA 4D6DA 3BH4A 1JZ4A 2XG9A 2WLYA 4B3LA 4W8AA 2C0HA 3G6LA 4D6EA 1J0KA 3GNRA 4LYRA 4KGJA 2NSXA 2V38A 4CD4A 2YKKA 3NJ3A 2CEQA 3N04A 4WLCA 1U30A 4W5UA 2VI0A 1K9EA 3UETA 4E2OA 2YOCA 3BSHA 1QNRA 1AQMA 2RGLA 1GOKA 1W1TA 5HPOA 4PUDA 1NH6A 2XJ7A 3VGBA 3CTTA 3DDGA 4R27A 3BVWA 1G9HA 1UKSA 5DT5A 3RILA 1EOKA 5A3HA 3GH4A 1EQCA 4PMOA 3GXIA 2ZWZA 2XUCA 3UERA 1ZJAA 4V2XA 4F66A 2GJRA 5E6YA 2DSZA 1QPKA 2C8NA 4F9DA 3WDQA 4AIOA 4QFUA 4Z2IA 5A95A 1HX0A 2CERA 4OBSA 4J3XA 4CU7A 3L4ZA 4QCEA 1E6PA 1B0IA 1HWWA 2VRKA 5CPQA 1GORA 1LLOA 5A94A 1FHDA 1LJYA 4TVDA 2VZOA 5A2CA 1CGXA 1PIFA 5CLTA 5CG0A 4CN4A 1SR0A 1MW1A 3PZOA 1UD4A 3D4YA 4B9YA 4D72A 1UKQA 1HN1A 2WB5A 1E40A 1C91A 1RD6A 1CXFA 3WY3A 5I2UA 2CHNA 3FHAA 1GW1A 3CC1A 2J7HA 3GNPA 3AS3A 1E1EA 4AMCA 2ZUVA 3WY2A 2OWCA 2VUYA 1CGUA 4AW7A 3L4VA 2NW0A 1UR8A 4QLJA 4AYSA 3U5YA 4L4OA 1JZ7A 1V6WA 2VR4A 5HDRA 4NSBA 3AIWA 1VAHA 4JFSA 3A24A 4UQAA 1J10A 5FD0A 3SCWA 2XYLA 3A3HA 4ZE4A 1QW8A 3AYSA 2HVMA 2VTFA 3BMWA 2WSKA 2EAEA 1A3HA 2YIHA 3T0BA 3ARZA 2D1ZA 1C7SA 2O9PA 2CBVA 2IUZA 3PZMA 1PJ9A 4YN5A 1ZBCA 1VRXA 3W53A 1KXVA 1V02E 4V28A 1E0VA 4J28A 5FIPA 4B16A 4V27A 1E5NA 1AMYA 4QDMA 3KEHA 3K8LA 3CZEA 4M82A 1WZKA 3ARWA 4AZHA 1ZBWA 4D71A 1LWJA 3HG4A 3OLDA 3LXCA 3L4TA 5A8OA 1KTBA 3O6AA 4U33A 1VEMA 1HJQA 3F5JA 1E6NA 5M03A 4ATWA 5A6KA 3DDFA 2JEPA 4M81A 2D23A 1V6XA 1U33A 3AJ7A 5CSYA 1KWKA 3VD3A 3EJUA 1R7AA 3EBVA 7TAAA 1EH9A 3I3DA 3CHCA 3SCTA 1TA3A 3D5HA 1XH2A 1JZ6A 4DUWA 3RJXA 1NOWA 4NZJA 3CHEA 3D4ZA 1IV8A 1CGVA 1HL8A 5A6BD 2YLLA 4CCCA 3DX1A 3GBDA 2PI6A 4XZBA 4AY1A 4Q7NA 4J3VA 4C7GA 2C7FA 2CHOA 5E0FA 1VEOA 4HA1A 4RE2A 5BWFA 3VDAA 3WNOA 1G1YA 1LL4A 4D1JA 1GVYA 1J0JA 3BUQA 2ZXBA 5DMYA 4HOWA 3BVUA 1WAWA 5GNXA 1PEZA 1FH9A 3IANA 1JDCA 1NQ6A 2CITA 1QI5A 2Y5EA 1JFXA 2XIIA 1OB0A 4LPCA 4ACYA 4GZEA 2XGBA 3TTOA 4MNLA 3SCRA 1B3XA 3QOMA 4IUGA 4XB3A 4BQ2A 1UA3A 3WEOA 4CU6A 2VVSA 2BY1A 3BLKA 2XWDA 4L4PA 1FP8A 1V02A 1OD0A 3LRKA 5GNYA 2X2IA 2DT1A 5HNNA 3WUGA 1W2VA 3W27A 3BAJA 4W85A 3OGRA 1JZ8A 2DT2A 5CSUA 4WIWA 1BHGA 4DUXA 5A8MA 4P8WA 3THDA 8A3HA 4NZCA 1VB9A 4IM4A 2F61A 1UG6A 4AZGA 3GXTA 1EDTA 3DYMA 2F1AA 4OKDA 2VZUA 2J4GA 1I75A 2BHYA 1JYXA 5DEZA 4HMCA 4A3YA 4QCFA 1J0HA 2IXVA 3ALGA 3RO8A 4C7DA 4H8UA 4XV0A 2D24A 4GO8A 3UG4A 2CXGA 4C7FA 1ODUA 1UWUA 4E8CA 4AD3A 3VPLA 1H41A 3MS8A 5BXSA 5I23A 4FNPA 1GOIA 3GTNA 2XSBA 4Y7EA 2WANA 1NWUA 2E9MA 3AFBA 2XVLA 3WDRA 3MO4A 1XD1A 2G41A 5EMYA 3AMDA 2CYGA 3W6MA 4UOJA 3VDHA 5E6ZA 1UD6A 1PAMA 2WBGA 3MV11 1Q4NX 4F9JA 2VMFA 2WVVA 4DWSD 4PEEA 4K68A 2WVUA 4BZYA 3CZNA 3WQ4A 3WD4A 4PCSA 5AY7A 3B9DA 3WF0A 3SCVA 4DM2A 2BV9A 4Z2HA 2Z1KA 4J3TA 1US2A 1JXKA 4GQRA 1NWRA 2CBUA 2O92A 3RPMA 3ARYA 3WF3A 1BVZA 3GXNA 1DWHM 3CBWA 4W7UA 3WEZA 3CHDA 5E09A 5A6SA 3NSMA 1DWFM 1OGSA 3CZ8A 1KGUA 3CUFA 4JKLA 2QHAA 4PMRA 4UTFA 1XH1A 1E3ZA 3UEQA 4UOQA 1AQHA 3UR8A 4JHZA 5M17A 3CUJA 1LG2A 3BLBA 1Q6FA 3GM8A 3HU7A 4B15A 3VIKA 3MANA 4U3AA 3RM8A 3WD0A 4HOZA 2VJXA 1QX1A 1V08A 1EDQA 1OSEA 3DHPA 2J7GA 4AZBA 2EADA 2X05A 1TQTA 5A1AA 2WAGA 4PMUA 3S2CA 3OBAA 2WMHA 2D73A 4PMQA 3VIMA 1I1WA 1E0XA 3AQUA 2FE0A 4URIA 3DX3A 2X0HA 1DWAM 2ZUSA 2XTKA 3D3AA 4MB5A 3LXBA 1R86A 3AS0A 1CXEA 3PBGA 1TR1A 2OWWA 1WDQA 2WCSA 4GQQA 2E0PA 4ZXLA 5IFPA 1WP6A 1I1XA 5BCAA 2ZUMA 1W9XA 4MNMA 4FNRA 4CN6A 1H0IA 1TA3B 2EPNA 2DSVA 4GKLA 1WDRA 1IZJA 3AIBA 5GPRA 1BGGA 1B30A 1BG4A 2YDSA 2GDUA 5E0CA 2XWEA 4P7RA 1QWNA 1WNOA 4YHGA 1UWRA 3KLKA 4F8XA 6TAAA 4W89A 1BYCA 2WMKA 1UH3A 3ZQ9A 4ZENA 1C92A 2FHBA 1GQKA 5FL0A 1A47A 2O9OA 1BYDA 1O7DC 3BAIA 3N18A 3EJQA 3LPOA 4AYGA 3FAWA 1B3WA 1WB0A 5IHSA 1SYTA 4W5ZA 3W81A 4A4AA 7CGTA 5I79A 4JFUA 1ISZA 1H1NA 2XM2A 3BAXA 1RP9A 1JZ3A 2GJPA 4PRWA 1V3MA 1NP0A 3VIJA 5I3DA 1FHLA 4FNTA 4TTUA 3EDEA 3AHVA 2CETA 2J7FA 4H04A 3WNNA 1BSIA 1LL6A 1UOKA 1ITXA 4WSJA 4KH2A 2J8GA 2O9TA 2CNCA 4MJ4A 2VL4A 1NWTA 2ZWYA 2V5CA 1MXGA 3W28A 2NT1A 1BF2A 4CGTA 4LQ1A 3ZR6A 3WY1A 2EEXA 3AZSA 1VJZA 1KQYA 1XHGA 3S6TA 1CXKA 2AOSA 2DIJA 4P8XA 5CXPA 5ABGA 1GCYA 3W24A 3SCUA 1QBBA 4D6JA 4JFTA 2G3IA 3T0DA 2DGAA 3A6OA 1K9TA 4X9YA 4M1RA 2Y24A 3TTQA 3THCA 4NXSA 2GFTA 2G4FA 1E6RA 3FHQA 1HVXA 1HIZA 3SCOA 3HMCA 2VT0A 3MUAA 1KGXA 2VX5A 3BGAA 3OG2A 1EOMA 1HL9A 1ZBKA 4OJYA 1HF6A 3K4DA 3M7SA 2WZIA 1J0IA 1FH7A 3HN3A 1Q6GA 3KWXA 3AHZA 3AICA 2VO5A 1W1VA 2W62A 2WVVB 4AIEA 2YA0A 1H11A 1GQIA 3BUPA 1QHOA 1UR2A 2YDRA 1CLXA 2J75A 5D9PA 3VDCA 1MFVA 4AZCA 4PMXA 3HJEA 2W66A 3MMDA 2JALA 3EYPA 3AZRA 1C8QA 3WDPP 5I6SA 1QI4A 1DTUA 3II1A 1Z32X 3A4XA 2UY5A 1MQPA 1HP5A 3N17A 4RL3A 1H2JA 5CJ5A 5A6MA 2QLYA 4H8VA 5A2BA 4P7OA 4EE9A 1XC6A 2A3EA 2XPKA 5I5RA 4ATLA 5FOOA 4X0NA 1R75A 3VNZA 1ITCA 5EBAA 5E70A 2FGLA 1C8XA 2J7BA 3VM5A 4AMXA 2XHYA 2BVTA 4LGXA 1W2PA 2WVTA 2CKRA 1L0PA 3OLIA 3U7BA 2DDXA 4P7LA 1MYRA 2AMGA 1JF5A 1TG7A 4IPLA 2GDVA 1F4AA 5LA0A 4BF7A 3PTQA 5D4YA 3WMSA 4MTVA 1N82A 4MNJA 1W9BM 3PZGA 3OIHA 3W25A 4LXFA 4X0VA 4PN2A 3VVGA 4QP0A 3EMCA 1HNYA 4NF7A 1KR1A 2OSXA 1C8YA 4P7QA 2F8QA 2VZVA 1EO5A 3CUIA 1UH2A 1V6YA 3WEMA 4D6IA 2D3LA 4HZ7A 4GIAA 2QMJA 1KWGA 2Y8KA 1TQSA 3ZJ6A 2XN1A 1JL8A 3AHXA 3FY1A 1XSKA 3GH7A 1QI3A 1CBGA 2J7DA 3WNPA 2VNCA 1RPKA 1GOWA 1XCWA 3KL0A 3VOCA 4UFMA 1ZJBA 2VCAA 2XIBA 3WUBA 1X1NA 5A8PA 1UZ1A 4MADA 1BGAA 3B9EA 5BROA 1W1YA 4U5IA 4UFJA 2F7RA 1H5VA 3AYRA 1GJUA 1UR1A 3WBEA 4TVUA 2GVYA 3VSVA 2QF8A 1GQJA 3HZ3A 5I0DA 4WK9A 3WN6A 2VQUA 4U3CA 5E9AA 3EJSA 1UD2A 3PTKA 2JEQA 1E15A 3D50A 3QR3A 1QNQA 1OD8A 5ECUA 2EXOA 1HKKA 3CZJA 2ZXDA 5ABHA 4JKKA 1B1YA 4W87A 4HMDA 2W61A 5CPSA 3WH9A 7A3HA 2EABA 3CV5A 4CD8A 1QOXA 1PBGA 3WSUA 1TQWA 2E8YA 2FGZA 1ISYA 2VOTA 4W88A 4F79A 1BTCA 2YL5A 4TTGA 1W3LA 2FH8A 1JDDA 3ALFA 5F7UA 3BUBA 2DSWA 4A3HA 3MUIA 5HOSA 4OUEA 3W38A 3LRMA 3TOPA 1ISXA 2V3GA 1JZ2A 3F5LA 3TTSA 5KEZA 3VIPA 5JBEA 1SMDA 5C71A 1B9ZA 5A8QA 1HJWA 1Q6CA 1VBRA 1JZ5A 2BXZA 2JF7A 1J12A 3ARVA 2VR5A 3ZM8A 3BLPX 3HG2A 3AIQA 4KRUA 3OLGA 3FN9A 4PBGA 1GOOA 4BQ5A 1SZNA 2PC8A 2O9RA 3WQ6A 5BXRA 5C8BB 2OSWA 6A3HA 2PBGA 1JF6A 3JUGA 1BYBA 5HBFA 5EB8A 2YL6A 3F5KA 3MUY1 1V3KA 1B90A 1BVNP 1J11A 1UH4A 1CWYA 1BAGA 1EA9C 4TVCA 3QGVA 4N42A 2VRJA 1XGZA 1QWUA 3ZIZA 3QHMA 1OT2A 2WNWA 4AZCB 4PSRA 1Q6EA 2D0HA 2ESCA 2XVNA 2PWHA 1NWSA 3VD9A 1W3KA 3EJRA 4UFIA 5CGTA 3UCQA 4W7WA 3GXPA 3WQ8A 3VGHA 3CMGA 2J79A 2VURA 2F7OA 2WWDA 3LPPA 1OGGA 2YLAA 2PB1A 2VCCA 1OM0A 4PUEA 1WZAA 5JUVA 4Z2LA 3S5ZA 5IDIA 4BQ4A 4PSPA 3BAWA 4QLLA 1B3ZA 3K46A 1CNVA 3F4VA 1QI2A 4JFWA 2GUYA 4GI9A 4UFHA 4LYPA 4WKFA 2FH6A 2OYKA 3WIJA 1HJVA 2YJQA 4PTXA 1E4LA 1VENA 1B3YA 1NM9A 3APGA 3U7VA 1XYFA 2EJ1A 3VD5A 3B9AA 2XFFA 2WKGA 3RIKA 1PS3A 4GINA 5AC4A 3W82A 4AXNA 3WL1A 3WKZA 1CTNA 1C90A 2WVSA 3BVVA 2CPUA 1VF8A 5M3WA 1GPFA 1WDPA 4UNIA 2VX4A 1FFQA 1JI2A 2PBOA 5BXPA 5JIWA 3AXXA 1HJSA 4NXKA 2BVYA 1OIMA 1JYWA 3G6MA 3VX1A 2WHKA 2E9LA 3DX2A 3PZVA 4ACZB 3CZKA 5JBFA 1UR0A 4HMEA 1R34A 3VTRA 1K9FA 1CXLA 3N12A 4M24A 1UQYA 2V5DA 1KGWA 3I3BA 3NIYA 4PMDA 4FNUA 3WMCA 3T0AA 4KMQA 1UWSA 1KTCA 1M7XA 1WPCA 5LA2A 2WCGA 2WKLA 3NDZA 3WQWA 1HKJA 3CIVA 4YHEA 3T09A 4ML4A 3BAYA 3WH6A 4JFVA 5IHRA 1UQZA 4LX4A 2DT3A 2BHUA 1VJSA 5AC5A 3AHTA 4J27A 1H09A 1GOQA 1R87A 3FNDA 3OGSA 4D6CA 1E4NA 3CHFA 1KXQA 3LMYA 2YDQA 1QBAA 3ZJKA 3VO0A 8CGTA 3WD2A 3AXHA 3QOKA 3VM7A 3GXMA 2DH2A 1NOFA 1EIBA 3BSGA 4WF7A 1CLVA 3U57A 3AHYA 6CGTA 5HPCA 1DWJM 4MB3A 3M07A 5AYIA 5A8NA 3IAPA 3T08A 2E8ZA 3MV01 2W67A 1BFNA 1WKYA 1HKMA 2GSJA 1XCXA 1JD9A 4CCDA 3WMBA 1JGIA 3RM9A 5ABFB 1EXPA 1GQLA 5IXEA 2VRQA 2YFOA 4N0RA 4J3SA 4B3KA 2EPKX 1MQQA 1PZ2A 4D6GA 2XVGA 1LF1A 3AISA 2VVNA 2D2OA 1RH9A 1JG9A 3DC0A 3WL0A 1XYZA 2A3AA 1TFVA 3SUVA 3GXDA 1V0LA 4TX6A 5CZKA 2J62A 4MB1A 2YA2A 1EDGA 3AMGA 4DO6A 1E56A 3VUPA 2UWFA 3WUEA 3MI6A 1QNPA 2J77A 1GONA 2D0GA 3CUGA 3NSXA 1E6ZA 3WNKA 1B31A 3K8KA 4HZ8A 2VQTA 4KWUA 3CLWA 1UKTA 3OZOA 1DHKA 2YBTA 2YL9A 4J3WA 3RM4A 3VGDA 1JAKA 2AAAA 1J9YA 2EPMX 9CGTA 2JIWA 3DX0A 2X0YA 4ZE5A 5BRPA 5I24A 4MDPA 2J7CA 1JIBA 1UD3A 2E3ZA 3WDHA 1H49A 2WZEA 4XUYA 2J47A 1E1FA 1VEPA 2IXUA 2WMJA 1O6IA 3WH8A 1E71M 2F7QA 3ZT6A 3BXWA 1BYAA 4ATDA 2UY2A 1V3HA 5BYWA 3SCSA 1HXKA 4R5EA 4BQ3A 1KCKA 4DUVA 1PX8A 3BUDA 4EANA 3BVTA 2ZX7A 3UG3A 3LX9A 2WMIB 1RP8A 3BC9A 3HG5A 3CZLA 2ZUTA 1V0KA 3GZAA 5KZ6A 1KXTA 3A21A 3T2PA 2WM0A 3SCPA 5EFFA 1CDGA 3H54A 2QV4A 3K8MA 3WENA 3ZSTA 4MPKA 3SCQA 4PTVA 1WZLA 1TE1A 2EQDA 4JCLA 4HOXA 3AROA 5HXMA 4J7RA 4OOZA 3PHAA 1XRVA 1E0WA 2J25A 1LL7A 1BQCA 1R47A 1E9LA 3W0KA 3CO4A 4H41A 2QPSA 1JXJA 3CGTA 4HPGA 3DYPA 4W84A 1ZU8A 5GNZA 3VSUA 3HG3A 1E6SM 5I78A 1TZ7A 5DFAA 1FP9A 2WC4A 2A3HA 1CYGA 2BY0A 5M5DA 3H53A 1JNDA 3VIHA 1J18A 3AIUA 1SMAA 3ZSSA 4PCTA 1OCQA 5FL1A 3K4AA 1W91A 4AZ7A 3WUFA 3PZNA 2BY3A 3WELA 3WH5A 2CBJA 1WDSA 4AEEA 3A4WA 1OGBA 2BFGA 1UR9A 3SUWA 2WBKA 4FLSA 2WMGA 2ZIDA 4UQDA 1GHSA 1P6WA 2F1BA 1UR4A 4OBRA 4TXEA 3VKKA 5A69A 1QI0A 3KL5A 3EMZA 2BHZA 3WFLA 4RE3A 3AS1A 3PTMA 1WE5A 3EDFA 1R85A 3L4YA 3SIMA 3CPUA 4S3JA 4CVWA 1H0GA 3AIVA 4EK7A 3PZTA 4AD4A 2BXYA 1EO7A 4JZ5A 2WCAA 1EQPA 1FA2A 1R7OA 4UQCA 3CMJA 1HTYA 2X2HA 2G3MA 1TCMA 2GK1A 4LYQA 4FLRA 1DP0A 3UESA 1QHPA 4CD6A 4CCEA 1X6LA 3UR7A 2XSAA 2XVPA 5E1QA 2J7EA 1KCLA 1MW0A 1K9DA 2X8RA 2DSKA 4JCMA 1VFFA 1TUXA 3AMCA 4UQBA 1HKIA 4PMYA 2WLZA 3RCNA 4P8VA 1ODZA 2YFNA 4JIEA 3O9NA 4PMVA 3VINA 2WC3A 4UQ9A 1ZS2A 3KE0A 2OWXA 4UFKA 2OSYA 1DEDA 2W92A 3BMVA 3N9KA 2WHLA 1CEOA 4DM1A 2OW7A 4GI8A 4YPJA 4UOZA 4WKHA 3NYDA 1KB3A 2DIEA 4JL1A 3ZOAA 1UD8A 5IFTA 2OYLA 3M46A 4ZXOA 4FMVA 1ECEA 2VX7A 5GQBA 3WFZA 1QNOA 3H55A 5BXTA 1ISWA 2VZSA 2Y8VA 1V03A 4UFLA 4NI3A 1K6AA 4H7VA 1G94A 5DF0A 4PTMA 2BNJA 4HA4A 2ZE0A 3VIFA 3VDBA 1PIGA 3WNMA 4PTWA 4AZIA 2XFRA 5CQ1A 2UY4A 1GZJA 3O2LA 2W5FA 4ACZA 3L4WA 3ZMRA 3NDYA 2CCRA 1WO2A 4M56A 4GPNA 1W3JA 1US3A 3IJ8A 2GJXB 1XSJA 3ARTA 1E73M 4PMZA 3VD4A 1MW2A 4XZWA 3N1AA 2CKSA 1XH0A 2XM1A 3OGVA 3N15A 3TP4A 1KFWA 1FOBA 2XN0A 1AVAA 1OBAA 1HVQA 1R8LA 2G3NA 2DH3A 2Y4SA 2X2YA 5CPTA 3LPFA 2YBUA 1TMQA 5BRQA 3ZJ7A 2FHFA 2WSPA 5A2AA 4D6HA 1M04A 2E9BA 5DT7A 3L4UA 5EFDA 4H8HA 4UZUA 3A47A 1V0MA 3U5UA 3EDKA 1L8NA 4EAMA 2WYSA 3ARQA 4CUCA 5AYBA 1MXDA 2WHMA 1CXHA 1JNEA 4E4PA 4M80A 3ZT7A 4MAVA 2WXDM 3A23A 2F2HA 3ARRA 5A6AA 4S3KA 4CN1A 4GZJA 5LA1A 4IPNB 5FCZA 3EMQA 3UG5A 3N13A 3ZR5A 3SCNA 3VGEA 3W26A 4AZ6A 1V6UA 1B2YA 4AIUA 2Z1SA 1UYQA 1V3JA 2D20A 3CH9A 4BS0A 3FW6A 3KL3A 4MAZA 4WSKA 2J78A 2PF0A 4NZFA 3VGFA 1YHTA 2ZX5A 5ABFA 1M01A 3MMUA 3DHUA 3PZQA 4AD1A 3WD1A 4DWSB 4U2ZA 2XVKA 1OWQA 3I3EA 2PWDA 2DSUA 4MDOA 3SURA 3WY4A 4P8UA 5C70A 2V3FA 4UQEA 4HA3A 1R33A 4J3UA 1OT1A 4P7NA 1CXIA 1B3VA 2X2JA 1J0ZA 1OINA 1BG9A 2ZICA 2YA1A 4CU8A 4M29A 1JFHA 4W7VA 4PYSA 1PZ3A 1J0YA 1E6QM 4AMWA 1BLIA 1UD5A 3GH5A 2ZX8A 4XX6A 3PZIA 3SUUA 4TOQA 4JHOA 3T2OA 2D3NA 1IZKA 1E4IA 4FF5A 3TV8A 3VU2A 3VD7A 3S5YA 3MMWA 3SUSA 1S46A 1G01A 3POCA 4Z2KA 1JDAA 1JAEA 3NUKA 1W32A 4AD5A 1LQ0A 3TA9A 3GXFA 3MSDA 2X09A 4GZIA 3AXIA 1UZ4A 2GK1B 3A5VA 2E4TA 1XV8A 1VIWA 4CD7A 5I77A 4Q22A 4DWSC 2W91A 1CGYA 3DX4A 3LXAA 2VX6A 1KBBA 4FNQA 3QHNA 4W8LA 5TD4A 4FLQA 3K1DA 2WZHA 1OIFA 4OGZA 3POHA 4DO4A 1VFMA 1CGTA 3N11A 2JIEA 4JAWA 5JBDA 3SEPA 1O7AA 1PPIA 2WMIA 4U31A 2G3JA 1VBUA 1ESWA 4GI6A 4HPHA 3VX0A 3AZTA 2WHJA 3EJTA 2BS9A 3IGUA 4W8BA 5LYRA 1E43A 4MB4A 3VILA 3ARUA 2F7PA 1C3FA 2WMFA 5D9OA 1E70M 4HU8A 2HISA 2PWFA 3IJ9A 3KZSA 2DEPA 3DECA 1H4PA 3VMNA 4U2YA 4OIFA 1UUQA 2ZUWA 3WDJA 3CUHA 1R46A 2D22A 4CKQA 3AMLA 1KR0A 4PMNA 1T0OA 5D9NA 1AQ0A 1GOMA 2TAAA 1V3LA 3EDDA 3W4RA 1KQZA 4GO9A 1J01A 4AZ5A 3IJ7A 3W29A 3VIIA 3BCDA 3MUZ1 1G0CA 4UZSA 2EPOA 1MW3A 3PN8A 1HP4A 3LRLA 3RMEA 3L2MA 2PWGA 1TQUA 3VIOA 2ZOXA 1PX4A 1KXHA 2B31A 2A3BA 1UHVA 3B8SA 3AIEA 2OYMA 2F18A 4B9ZA 3SUTA 2WC7A 3ZO9A 2W4XA 2CBIA 2ZXAA 1TVPA 5FKYA 4AISA 1FH8A 4AWEA 4FNSA 3L4XA 4W93A 4BA0A 3D52A 1HXJA 2XGIA 3ECQA 1VFUA 3OZPA 2WK2A 4MNKA 4FK9A 2WPGA 4U5KA 1GVIA 4AD2A 1CIUA 4IISA 3PZ9A 1JI1A 3VGGA 4DO5A 3L2LA 1NARA 1QNSA 3RDKA 1QHZA 2VCBA 5A6BA 4Z2GA 2XFYA 3NSNA 5D8WA 1LG1A 1W9UA 5A6JA 4KGLA 4WJXA 4AC1X 4UR9A 4JL2A 1BPLB 1HT6A 1CECA 5D8ZA 3WQ5A 1UWQA 3MKKA 2EO7A 2CIPA 3WD3A 2Y2WA 1UKPA 1EHAA 3BCFA 4MJ2A 3E1F1 3WF2A 1IT0A 3ARPA 1UKOA 4HZ6A 2RGMA 3A4AA 1TQVA 1MWOA 1WZMA 3VMPA 4NRRA 3WH7A 2PWEA 1W1PA 2G8ZA 4M8UA 1NP2A 1NOUA 2GJXA 3M6DA 1C93A 4TUFA 1CGWA 1W9DM 1V6VA 1ZB5A 5ABEA 1UWTA 1E6XM 3W6LA 3ARXA 4QLKA 4JKMA 1G5AA 3ZT5A 1YQ2A 3FAXA 2JE8A 3VIGA 2QMKA 1QVBA 2OW6A
chains in the Genus database with same CATH superfamily
4TN9A 1U41A 5HWMA 3T55A 3UFIA 4O10A 2AJXH 1HJXA 2PXYC 3M64A 3AS2A 4XO6A 3QG7H 2FQFA 4ORMA 2IH1A 4IPIA 5F7BA 5EIIG 4HAFA 1SW7A 3LSBA 4R3UA 3K80A 1WCBB 3X3GL 4LUTA 2VERA 4KAQH 3KPTA 2Z31B 3K2IA 3DI0A 2BERA 4FQLH 4HPOH 2F8OA 1SJHB 4MBRA 3RUGA 3PBWA 3OQEA 1DZ0A 1NFIA 5DSCA 4Z2JA 5GRJH 1AS6A 4GBXA 1NINA 1PXGA 3OZLA 2P0OA 2NTFB 4FE9A 2J74A 1LK3L 5LSMA 4KTEL 4JG9A 1E4MM 2XTJE 3VKCA 3AOFA 2V3DA 1K6QH 2EEAA 5EZLB 4XX5A 1PD6A 1KT2A 2DWXA 2LLNA 3B3BA 3P3BA 4XCEA 2ZX9A 5T3ZL 3ETBF 1ZJHA 1NFDE 4QAWA 2YSWA 1DUYA 1F3RB 1DPMA 1EAOA 1Q8JA 4PRBB 3CPLA 4FS9A 4JHVA 1PSKL 1R3QA 5DURB 1YHPA 3GNOA 1RSFA 4F1ZA 3MHZA 5F3FA 4R0LB 2WLYA 2DQEL 5F71A 4NQSA 2G95A 2DQTL 4ZX4A 3T1GA 1B4RA 2IDTA 2YKKA 3EX3A 4D3CH 2CDGB 2WKOF 1XF5B 4E2OA 3CN1A 4PUDA 4IOIA 2J5WA 2XJ7A 3HOJA 4HSOA 2CLZB 4F4RA 1UKSA 1ERNA 1YC8A 3WEXA 3F4CA 5DJ8A 5EU5B 4RFEB 4OBSA 4PFMA 2V9QA 4JFEE 2P80A 3EH4B 4ZUSB 5C2BH 1JVOA 3XIMA 4N9OB 2VUKA 2B15A 1FHDA 3ROOB 5CG0A 3MNMA 4B9YA 3IV8A 4DP8X 5EA9A 4ERIA 2WB5A 4I18A 2P9RA 1ADQH 2QQQA 3VYPA 1J9CT 4NUGL 3VXGA 4PMFA 2Z8WC 3R58A 3CNYA 3G5VA 2A6IA 5B38A 2GQ8A 1X39A 4AW7A 1DUZB 4AYSA 4AHPA 1JZ7A 5FUZH 5K69A 3RVXC 2CWXA 4IRJB 1AOZA 2UYLB 3U4EB 4QEEA 2ZRVA 2HVMA 1LO3L 5I0XA 3QFEA 1WKEA 5AW0B 3EF4A 3O4LB 1G4EA 2ZC8A 4HK7A 5IFAH 3T04D 5D2WA 2LFGA 3C5SA 1J1OH 3WFEL 4M7KL 3NA4A 1SHWA 2SEBB 4HPJA 3WTSA 3L1EA 3CK5A 1PMYA 1WAAA 2AVGA 4KUCF 4N4PA 4EN3A 3PP7A 1NGWA 2P8CA 4YDIL 3EYQC 3L3OC 1D6EB 2CZ5A 6XIAA 4ATWA 4Y19B 2X4UA 4HIIB 2ZDRA 5DQJB 2B14A 43CAB 1KLFB 2ISWA 1R7AA 7TAAA 3EYFB 1XH2A 3RJXA 2XZ9A 5IESL 5DXWA 2EXYD 5AAMA 5E8OA 1QAWA 3S36L 3G6JA 4XZBA 1F58H 4MJHA 5FJJA 1KRAC 1NCTA 3VCRA 3BUVA 1E4KA 4BKSC 2UX7A 4BFIA 5EN2B 2MSPA 2GJNA 4N8VA 3O0LA 5SX5H 2QCDB 5JLZA 2XGBA 5BU9A 3BURA 4Q52A 3DG6A 1EUAA 3N42B 5DEGA 4W4QA 1QK2A 3GLDA 1W2VA 4Y2OB 2GY7B 2DT2A 5I07A 1OARH 4G8EA 3PQYD 4ILSA 1RIHL 2GSIA 4P4KD 4WUIA 4GIOA 5AW7B 3NSYA 1C5BH 2RDXA 2DWEB 3M7FB 1ZGLB 4BA8A 4B5VA 4DPBX 1I8MA 2GPTA 3WL9B 4A3YA 2RHGA 1J0HA 1B5TA 2D24A 5FUOH 3NFPB 1H41A 3MLUL 4H7ZA 1GOIA 1S9WB 4XVDA 3RDTC 1XL9A 1F3WA 1NWUA 2XKNB 4TUUA 3HC2A 1A3WA 4QGCA 3MO4A 5F89B 2VN5A 3CB8A 5HHMB 1E9PB 4XPBH 4B9IA 3VDHA 4I8DA 2WVVA 4GRWE 3LZPA 3A3YB 2B0SL 4NNYB 2B9AA 2CHRA 5AKVA 3SCVA 1SZRA 4ODVH 4QE1A 3WS3B 2Z1KA 5T1MA 2O92A 2VDQL 4KRMB 4NHUB 1SFHA 2A9AA 1EGJH 4UTFA 3OKYA 5JXED 3EO1A 1GWJA 2WCPA 3UEQA 4JHZA 6PAZA 1QLFB 2I27N 3CQHA 3W7NA 3RM8A 3WD0A 1JUEA 1MG3C 4OFYD 4DTGH 4QLWA 4F80A 1G4SA 3MXWL 4Z1YA 4AZBA 2ZSWB 1LOSA 5LGHH 1M41A 1E0XA 1IT9H 3OPZL 3TBTB 4URIA 4D8PA 3C6SB 3MT1A 2EYTB 1UB5A 4MB5A 4B5EA 1U3NA 4RETB 5FUCE 5JPNA 3TCSA 2NY3B 4P9HC 4X98B 4L05A 3EA3A 1XYBA 2B7QA 5ERWA 1VPOH 1L9MA 1TVBB 2A83A 3UWVA 3KLKA 1RBOB 4W89A 4GOSA 1EJ6A 5CS7A 4LMQE 2HTKD 1QACA 1U8KB 2G4EA 1ZT1B 2J73A 4NP9A 3VFVA 4HC1H 3DSFL 1U8LA 1LXMA 2C1PB 1DQLH 5JIMA 5I9QB 3EJYC 4RSYA 5HYQA 3B37A 4JY9A 2O0TA 1G7MA 2V5CA 1MXGA 3UXKA 4FP8H 1SLXA 4GG6F 1KLUA 1JPTH 3WY1A 2R4RL 2GAZA 4P5SA 4DIAA 1S3TC 4P2OA 2EDBA 3T0DA 3IIXA 4U3SA 4ETYA 3HR5B 1S7VA 4RRPM 5DWPA 1H5BA 4FOKA 4U1MB 3K4DA 4DEPB 4DZAA 2YN3A 2VXQH 4A63A 1H11A 1XH3B 2MTAA 4X8GA 4O1DA 3BUPA 2DVUA 2DQDH 3RZCA 3BH9A 1CD0A 1TIWA 3NIDE 1YMMB 1WFMA 3DETD 2CSPA 4RL3A 4G9FB 3UAJD 2V30A 5A2BA 1A3RH 1XC6A 5I1DB 2XPKA 3II3A 1UUMA 3O8XD 3RWJA 3VM5A 4XNUL 3BHBB 3CFEB 1L0PA 1OT4A 4GP8B 1XIJA 3S3DB 3X12A 2JV6A 5EO0A 4MTVA 2RIKA 2K3HA 3B1TA 3ABMB 5JQ9A 3NN8B 2HLAB 3TYGH 2AVFA 3L95A 1HCYA 3RA7H 1XGDA 2PTXA 1XXFC 3GUTA 4U6HB 4XOBA 3G08A 4X7SH 1VLXA 4YO0A 2XC8A 1F41A 1JL8A 3SRHA 4KY2A 4JM0A 2Y6SC 5JH1A 3HPXA 1SEBA 3ONBA 3MLTA 4YBLC 3KL0A 4FKKA 3MV9D 5FO2A 1VH7A 2ZZ1A 4AQZA 5IB2A 1U3ZA 3MHFA 4DBUA 3ROLA 4A7QA 3EOTL 5XIAA 2R1XB 3V4VA 3RWEA 1EHLH 1RCYA 5IJVB 1UD2A 2OG9A 2XZAL 2JEQA 4OQ1A 3D50A 3QR3A 5BRZE 1ITBB 4P5TB 4K9EH 1MAJA 4OFCA 4XCYB 5TK2A 4NN5C 2DOCA 3CV7A 5SWZA 4RAHA 4M7ZC 5BQ7B 3ARDD 2RJGA 1UJ3B 3FT3B 4F79A 3E8UL 1BWVA 1N10A 4E9RA 3R8GA 1MREL 4R96B 2JELH 5F3BB 5KSVA 3MUIA 4OGXH 3FS2A 4L2LA 1M5WA 2V81A 1QATA 2V2WA 2HFEA 4OGQC 2YKLL 3IRZA 1ECQA 4L4VE 1GPWA 2X0WA 3HG2A 3VTMA 1FSKB 4BQ5A 2PC8A 4N2CA 1FWAC 5FLUA 2JSFA 2VDPB 2P47B 1E4XH 3KCJA 4LPUA 1RZKL 4MZ2A 3V4VL 3UGUA 1CL7H 3BDYH 5BPPA 3P11L 4Q6KA 5ITBH 5E08L 1YTKA 3LHWA 1CT8B 3E3HA 1A66A 4W9EC 1FL3B 3VKJA 3B03A 2FB4L 3QXAB 4LB8A 3BAWA 3C5QA 3ZRCC 4IBQA 3IVKA 4W9LC 4FFZL 2IADB 2ERJC 4LYPA 1IEVA 4RKAA 1JHLH 5F1IA 5CINH 5B1KA 4WU5A 4IIQA 3E0GA 3B9AA 2EDQA 3JWOH 2CK0L 3NL2A 1AZBA 2PRMA 4NPJA 4ZZFA 3RJDA 5M3WA 1WDPA 3NTYA 2G60H 3IRDA 2G5WA 1X8CA 3QNXB 1A7RH 1UP2A 4WK0B 3N50A 1NGXB 3TDFA 1DVQA 3H2MA 1W0MA 1NQBA 1NA8A 4NQCD 4O15A 4I3RH 3BO8A 1GGCL 4HSNA 2QCMA 1AANA 4W9JC 1XFBA 2PPDA 4LX4A 3RE0A 3T71A 3BEWA 4WEBL 4WNJA 4NG3A 4DT2A 4JFFD 5K9DA 1H0DA 1ZENA 1R3KB 2GB2A 1DLHB 5I66B 4ODXB 1TZ9A 1S5IH 5CPNA 1DXFA 4FI6A 4XQ6A 4ZVJA 4KF1A 2R0LH 1OK0A 5DD0H 4NZTL 3D0VA 4MXQC 1BF6A 1Q9WA 5IJKA 5HGHB 1XCXA 3KW3A 3TA3B 2VGFA 3APTA 1JZFA 3ZKMC 2XNAB 3BIKA 1JGIA 4RMRA 3OKOA 4N0RA 4JIRA 5F8RC 3SECA 1OC5A 1T6WA 3HFTA 3QZMA 5DY2A 2W65B 3GXDA 3ALWA 4UTLA 2X4RA 4KI5C 4PUUA 4PV8B 2X2GA 4GT0A 4KHXL 3AMGA 4H0GA 5DZLA 1MQ8A 3WNKA 4PP2A 3W7OA 1P7KA 1L9PA 8XIAA 2IXQA 1O6SA 4DHGA 3VOJA 2VYOA 1OCBA 3MY9A 4KWWA 2XFWA 4G8TA 1SFTA 4X5WA 2D7TH 5HGAB 2OZ4H 1IWAA 3D85D 1Q3NA 5CN3A 3QUXA 4XVTH 1LWIA 3NQMA 4ZPVA 4OKVB 2IANB 2QZ5A 2UWEA 1EGMA 2ONEA 3SGJA 1D5ZA 3OKKB 4GG6B 1TR7A 2QBWA 3QUMA 1JZGA 1X7IA 1MRCL 4OF5A 1B6DA 1A2YB 2ZCKL 5CR8A 1I1AD 3K5RA 1R3HA 1GAFL 3BN9D 1EEXA 3GMPB 4XWOC 1QRQA 4PCTA 3GB7B 3F58H 3DUSA 1WDSA 4D9RE 3BP5B 1U2HA 3THQA 1GHSA 5EO1B 2MNRA 2A6JA 3WSQL 4IHBA 5A69A 1OP4A 1O5XA 4XWUA 1JFQL 2BXYA 3NJGA 2Z31C 4BQCA 5C0DA 2X2HA 1WIUA 2PS2A 2FLRT 1YNQA 1FWRA 4WOZA 5CNHA 2ICWB 3ZIYA 5A2LH 1Z9AA 4N2IA 1K9DA 3AW5A 1LCOA 2WLZA 1P0DA 4GG9A 4JIEA 2WC3A 1NCBL 3KE0A 2OWXA 2Y1VA 4QXUH 1H8NA 3I6KB 3D07A 1HQRA 4YE4L 5FFGA 4LARH 3LEVH 1JPSH 4A8RA 5CD3A 2J6EH 1UC6A 5EIIB 3LMZA 5D37A 2LR4A 3GFUA 2XICA 2CR3A 2JK5B 1KF9B 3LH8A 3ZDWA 4CNOA 4EO5A 1ML1A 4NNPL 2FR4B 4XZWA 2ZSVA 3I50L 4R0LC 5CCJA 4XP6L 2BZCA 3MROA 4MSWB 2XIOA 5FF6B 5KS9F 5ADPH 2Z2AA 5CIPB 1WIPA 1FJ1A 4Y4KD 2W88A 2YBUA 9XIAA 1AW2A 4JNZA 3DV4B 1PZ5A 3U5UA 3ZR4A 4ZQOA 5E6RB 4BSWA 3ZT7A 5I3FA 3GW3A 4N90D 3TFXA 4S3KA 1YXCA 5U7SA 3KDNA 1DL3A 3NT0A 4NO0A 3M1BA 5FCZA 3E74A 1OAKH 2EUZA 3FA5A 3TH2T 1N59B 2HYMA 3L0GA 1C1EH 2JTDA 4J2QA 5TH2B 3FBKA 4FJ6A 1KCVL 3BRDA 3LNPA 4KK6C 3CJJA 3WCYA 3HRZB 3NO1A 4H0IA 4O5LL 4NCC2 4N8PA 1T5XA 4XE0A 3NZSA 2EZ0C 1B3VA 3FB7B 5TDPB 5E00B 1MCQA 3CS2A 2A4EA 3V3WA 4QRRE 2P44B 4QQ3A 3GH5A 5I6MA 1IVLA 1HEJC 4S3BA 5IEKA 1IM3D 5ESQA 1W72H 2HE8A 5T3XE 3TFCA 1ETA1 3FQRA 4ODWB 5D2NB 4XTDA 1JS4A 4L3EB 1UZ4A 1EO8H 4GAYB 3WLBA 1XGPB 1FAIL 4L37A 4KC3B 5EF2A 4OV6F 4WWKB 1BGXH 4OGZA 4DO4A 2VW7A 1VFMA 1TB3A 4CADA 4M4RB 1JCTA 3WJMA 3SEPA 3EJZC 4GMEA 2XGZA 4U31A 1KJVB 2F8IA 3QDGE 1D5IH 4JQIA 5IB3A 2L4OA 1CB2A 4P23A 3QZ6A 4N1EA 1ZANH 4JFYA 3A5FA 4KQ3L 4E41D 4XOEA 4MYPA 2VFIA 4NT6A 3JZEA 5AVVB 3VAVA 1IAKB 1OALA 3US9A 3G22A 2R2HA 2HFGH 3EO9L 4F92B 3AACA 1OZTG 5HHQA 5FECB 1RMFL 4JO5A 4Y1AE 4L1BA 1QLRB 1CB7B 4RK8A 2EPOA 4LGPB 2CJSA 5C0RH 4D9QE 5DLMH 3ABSA 2Y06L 3O6FD 1PX4A 3IEBA 1JNHA 1OAZH 1UHVA 2PLKA 4O16A 5BV7B 3BL3A 1GGTA 2WC7A 3BVNB 3W1ZA 2W4XA 1XBYA 5AKTA 3KGSA 2MPAL 2YW4A 3TBSA 4DP5X 4PBEA 4J6IA 1VCFA 1HXJA 4ORIA 3PPFA 2WK2A 5CLZA 1FWXA 1ZWIB 3DVIA 2CBOA 5ID1A 5FYJL 4O12A 5JORA 1O0VA 3IJYA 3NOYA 2VDOL 4G3YH 1ASQA 3RLVA 3TBYB 2XTSA 5JOEA 3P77A 3CN0A 3O3BA 4GXVH 1FXPA 3OB0H 3V0GA 1AGBA 1UKOA 3CMOL 5HBBA 4IOSA 4PRID 1U8MB 4WHTB 4H9UA 3OP2A 3M6DA 3OZ9H 3AY4C 4ICXA 3MWAA 1UWGH 3RKDD 4MZYA 4TVPE 4ZI8A 1HJUA 4LRTA 3BUYA 2QHLA 4G7EB 1DN0A 5REQB 1PAZA 2WLIA 1EJ8A 2R6OA 3MDUA 2BNQE 5F7HA 1DBKH 3LKOB 1I82A 1VFAB 5I1JH 3WQVA 1W9PA 1INQA 1TSIA 2OXHB 3QHOA 1TEYA 3HG1A 3H12A 3G5XA 2FYVA 2EP6A 1MCIA 2X1IA 5J06A 3QDMA 2ENSA 1GS7A 2V33A 4HP5A 2FWUA 4IFKA 2NY3C 3QORA 4HJSA 1E72M 2ESVD 3KXFE 3QEHB 1TWIA 1LO5A 3K1GA 1LQBC 3IS0X 2EVFA 1FL6B 2E40A 1J1PH 3SZ8A 4MIMA 3GSVB 5ANMA 2Z64C 1W3HA 4ZQKA 4IS6B 1AL8A 2NUXA 4LOVA 1J8VA 4FAMA 3NJXA 4LIQE 2DQHH 3NPVA 4GY4A 3RX4A 4WUUD 4HUVA 4PJGE 5DWUH 1R5WB 3V6FB 1XIIA 3T1FB 4LUSB 5A6LA 2ZNXA 3PWVA 2BRQA 1BZOA 2NR6C 3HNSH 1TOXA 3VFTB 3FJLA 2C19A 1R6VA 1DJIA 2E86A 1JPFB 4BBWA 4ZEPA 4G6JH 5T5FL 4L8SA 3WEBA 3IAQA 4B2DD 2LU7A 2CUIA 3RL1A 1AD1A 5CC5A 2DV6A 1KBVA 4ZMVA 4F0HA 4X4ZA 2A73A 3MSGA 3ATYA 3SY8A 4HUXB 3H7BA 1PSCA 5LBSL 1VACA 2HVBA 2JI2A 2FATL 1YY9C 1AO7D 5DY3A 4NBXB 4LYRA 3QHFH 3OQ8A 3HMXL 3EGSB 1BQLH 3KBMA 2A99A 5MP6H 2C7UB 1A6PA 4N0FB 4WLCA 2K1MA 4ZX5A 3VXTB 1TJRA 2BX7A 1A6VH 2KL6A 4G9DB 4FR6A 2QGHA 4DEPC 1MHEA 2WTPA 3KPSB 3VGBA 1UJPA 4C6OA 3WN5A 5HGBA 4LSQH 4ODHL 3BVJA 2NY1D 1EOKA 4KXAA 1XBVA 5EV7A 3GH4A 2R56L 5KS9B 4L8CA 2GJRA 5E6YA 1XF3A 4Z2IA 4F7TB 1IB5A 2PRLA 1IBBA 3MCLH 1HOCB 4MVBD 4DJDC 1LLOA 1XWYA 2YZ8A 3FUJA 4EXAA 2Z24A 2W27A 1A4KB 5EU4A 1XGUB 1FZKB 3W00A 3APDA 3DX6B 5I2UA 4QT5A 1Z5YD 3F7YB 5DZJA 2NY5L 1YUHB 1LLZA 1LNUA 4ZTXA 2VR4A 2IG2L 1L6XA 1I8KB 4N5ED 4BZ1A 2ARJQ 3VXNA 3MCKA 4YBHA 4PGEB 3NXFA 1WFJA 1WV2A 3BMWA 2WUBH 1BOYA 1DCLA 2YQ3A 3MRKA 4ZFOA 5TDOB 5IM7B 2CBVA 3SQOL 5HPMA 3I68A 2HNHA 5ACLA 1PJ9A 1DSWA 2MCG1 2GABA 4IU2A 2H0JA 1E9YB 3FFCE 4FQIH 4PJCF 5ACMA 2BLFA 1CC3A 1ZVNA 1LEIA 4OLXL 1GRWA 3L4TA 4X8CA 4LSTH 2E9GA 4HWBH 1NMAL 4UAOB 3L23A 3T4YB 4H44C 1KY6A 5ISZE 2E09A 2NUPB 1FV1A 1EH9A 3EEZA 3I3DA 4P5TC 3QQ4B 3SCTA 1KB5B 1TA3A 3AYTA 4FFWD 1MUJA 4EPKA 1UOVA 4WXYA 1HSAB 4P0DA 1DQQB 1UJ3C 2AZUA 3C09C 2PZNA 5I15L 4TQEL 3NCEB 2CHOA 4NYYA 4WI9A 3WNOA 3UYCA 1K70A 3LBMA 3EYVA 5BOEA 1LLAA 1X9RA 3VE7A 1IEAA 5T1JA 2P5WE 4R5VA 3TTOA 4ANVA 2C13A 5F8QC 3JUYA 4P2RE 5E2UL 5EPMB 2J57A 3I9PA 1FSKC 2DT1A 4XWGH 3IRSA 5IB4B 4O00A 1D5XB 4O2FB 3B04A 4HKJA 1H7OA 3MVIA 4I9AA 3IBOA 3UXAA 4M62H 3PGCB 3H7RA 1JRBA 5K39A 3ZE2E 4GLRH 5J8OA 5HR6A 5SX4I 3PY2A 4QHUA 2NSOA 5H91A 4KDVA 3OVQA 4PJ8A 1E8ZA 2OMWA 4UQ2A 1UWUA 4FNPA 2QDDA 4RGOL 5DQDL 3CIXA 2HJKB 4G71B 5J1SC 4MA8L 2CYGA 5EBMB 1SHMA 4LWWA 4K3ZA 1T5KA 2YPIA 3LEXB 4N68A 4K68A 3WQ4A 4EJ1C 3H4FA 3WD4A 4PCSA 2D7QA 2MCPH 4DQWA 3OSVA 3BKYL 1JPIA 2GJ6A 4LV9A 3K4ZA 4DCQB 2KZBA 2LVEA 1KJ3H 4UU9B 4G8FB 4YIQA 3QISA 1A7OH 5C92A 5LAPA 2CKBH 4LHUD 1CTMA 4JEJA 1BZEA 3TR9A 3UAAA 3ENLA 3DX9A 5TPWH 1RFDH 4KI5F 3M0MA 1YPZF 2OA9A 1V08A 1EEYA 1TIMA 1J93A 4DQAA 4K8RC 2A4ZA 3Q37A 4LU5L 4ZAKD 3U6RB 4UTTA 4JFEB 4E9LA 1J5TA 5DXYA 3S1GA 2UZXB 3HLKA 5TGBB 1CDJA 1DWAM 2OMYB 2Q86A 4XVOA 4RFNB 3MLSH 2Y5TA 4UIOA 3UBGA 2YPKA 4XB8A 3O3AA 5J7CC 2EPNA 1AIFA 3BZ4B 4JAMB 1MCKA 1IZJA 3B9NA 1CVSC 4GFXA 5D6DA 5L88H 2XWEA 1KO0A 3TA3C 1UWRA 3RTQC 3TBWA 2CLVB 4O02A 1ADSA 5DVPA 5EMKA 1VZWA 4DUOA 1RA5A 3AFLA 4LBUA 1L9QA 4XP5H 3CIQA 2ZA3A 4YHOL 3EKLA 1U8NA 2FO8A 3NJFA 5D7SL 4NQED 2AQTA 3VNIA 1ISZA 2Q71A 1SJCA 4U7MA 3VXRD 1YJDL 1V3MA 5F88A 1U8QB 4M1GL 3C60A 5I02A 1G5GA 1WS8A 2WZ0A 5LNDA 3N5AA 3GWJA 1QG3A 3JWDL 1WV7T 2VL4A 3KCOA 4EPBC 5JPMB 4KY1H 5E5RB 1VJZA 4J3OC 2J6WA 2OM5A 4M7JH 4ZMGA 4H1ZA 3R19A 2G3IA 5IHZB 1QNZH 5DMIL 3PJXA 5GRVL 3HMCA 3MUAA 5DD5L 1EOMA 4IMGA 2OTPA 1U93B 3H9HB 4YHKH 4TNWK 2AKRB 3GHEL 3HN3A 1KFKA 3AHZA 4YZFF 3SKOB 3AICA 2VO5A 3C8DA 1FDLL 4AIEA 4C59B 5JW3H 1KJMA 1GPOL 2WZ5A 4P9HH 5DDHB 4F48A 4PMXA 3ECVA 1X3DA 2FBOJ 4QI3A 5EIVA 1TTJA 2VEFA 5DT1L 3KTSA 1H2JA 2A3EA 4XAWH 3W07A 2Z1XA 4XPTL 3FSOA 1G67A 4ZSOB 1MFCL 4RMWA 3PWJB 5LGYA 4YBLB 4AUUA 2BVTA 5FM5M 1BVNT 3OBKA 2CKRA 4P7LA 4Y2DA 4IRSB 1CFQA 5E94A 2GDVA 1OPGH 1F4AA 5LA0A 2CBPA 3AXMA 3U1SH 1CYXA 4DW2H 4I13B 4ODBD 1FVDB 2X1RA 4WGKA 2CDFA 4LL1A 2O6PA 3EX2A 2BVWA 3ATBA 4PJBA 3E6EA 3VG0H 1EO5A 1KJ2B 4D6IA 3LOWA 4U1SA 1GVFA 2QSVA 2J7DA 2EE9A 3VRJB 1UYWH 5D7LD 4Z6AT 2HS6A 4M7LH 4QRSB 1TRIA 4LAMA 1NGYA 2ICEA 4U5IA 4H26A 4DF0A 1GJUA 5DR5H 1KIUB 2BP8B 3HM7A 5MEQA 5I1HH 1XZ0A 1YAIA 4U3CA 3CX5K 4JHUA 3W23A 3FJNA 3PNWB 4F91B 3RY5A 3T0EA 2R83A 4YIWA 3KBFA 1HKKA 4W81A 4M6AA 2H26B 1EZLA 4QYAA 3OJDA 5CPSA 4D8AA 4PJCB 1U8PB 4ZNEA 4K3DL 2Z91A 5H94A 1U8HB 1MDTA 3TJHC 5AFDA 2VSKB 3V7MA 4I5RA 4KK5D 2NNAB 3LRMA 1HSBB 2BVOB 4E68A 1HHGA 4W9HC 4F7EA 4YDVB 4ZXBD 1R3JA 3PPCA 5DD3L 4GQ9H 2V6AA 3W87A 2C16A 3ARVA 2I24N 4U1NB 4M48L 4OZGE 2ERJB 4UT6H 4QO1A 1SZNA 2VCOA 4NUMA 4O0KA 4HS6A 3STZB 4PBDA 4FNLH 1CWYA 1MSPA 3ZIZA 4IGBA 3WLPA 2ESCA 3EJRA 4RR4A 3WQ8A 2WWDA 1PCKA 2Y85A 3HFYA 2GJZA 3QO0A 1OM0A 4YUEL 3W7CA 4HUKB 1CLYH 2GUYA 2OYKA 2Z35B 1Q72H 2LE9A 4FERA 2ZWKA 3K81A 4MS8D 4NKQB 2VR2A 5KZCD 4QJ4B 4NFDA 1J2BA 3IU3A 2C1OB 4UINL 3RIKA 2E4FA 5AHNA 5D7JD 5AC4A 2LTQB 1N0XH 3F8UB 5AG8A 3WL1A 2YZ5A 1C90A 2DZAA 4G6KH 4ZZ9A 1XIWD 5D2NC 2I9TA 2FZ3B 4CDHA 1BVKB 1A9VA 1ACYL 3N42F 3IJSB 2HKHH 3PZVA 3FUHA 3N73A 1B0RA 3NIYA 5EZPA 4A55A 4PMDA 2NQ3A 5ILTH 1ZHLB 1YVLA 1P0KA 3W7PA 3WKPA 3QDJD 5G4EA 3ATDA 1AXTH 1KCWA 5IHRA 1U3HB 2B1OA 2JKNA 3C9NB 5AC5A 4N25A 3SBRA 1GOQA 4NENA 3S8HA 3FNDA 4PUBL 4JRYE 2P5NA 1QBAA 4JQXC 1ESOA 1FDJA 3GVRA 3VM7A 4WF7A 4UWMA 3PRZA 4P5KB 3PLYA 1JNLL 3H3PH 1OE3A 2DBJA 4R26H 5FM5O 1LDPL 2CGRL 1WKYA 3SQBB 5HYSG 2NY4B 1P1VA 1P9MA 4XR8C 2I07B 5BW6A 4A8NA 1VCAA 2R1LA 5BWAA 4DKEH 3RGVA 2GSHA 5ICXB 2EPKX 3D2UA 3V2AR 4XXCC 3DX7B 1VCVA 2A21A 3KPLB 5BV7C 4ECNA 4NU7A 3E1ZA 2PE4A 3UGXA 1E56A 1W0VA 3ELQA 2D0GA 1A7PL 3G5ZA 3WFHA 3GDRA 1B4TA 2R1MA 4N3UA 3HF3A 3K5XA 1K8XA 2JKEA 2FDBP 1TKWA 4YHPB 5D1QE 4LESA 4BZ2A 4PLOB 3IDMA 1MFBL 4JGMA 1GHFL 4NZ1A 3RVUD 4Z76B 5EMMA 3M45A 3FO1B 1GH7A 1A4JA 5TJWK 3OF6D 2DQJH 4HWUA 2VUOA 2AANA 3IB4A 1ZT7B 3NCBB 2J4WH 4H6EA 4QRPA 1U5HA 1KM3A 1HO4A 3BVTA 1VLIA 1UPPA 4UT9H 3EOLA 3HG5A 2P5PA 1FQ9C 1SU5A 1ZSHA 2QV4A 4FCHA 2OMVA 4HCLA 4RMUA 2HWZL 1EGJA 5K2ZA 2H47C 4EVZA 1F11B 3VSUA 4XO9A 2OCCB 5DFAA 2OMTA 3RU8H 1A0CA 5M5DA 4DAFA 1S5MA 3ZQXA 4Y7OC 3QV9A 1UCBH 1J18A 2J8UA 1JPEA 1HAUA 5B7FA 3BP4B 1SQ7A 1HH6A 3TYBA 3MV7D 3IWPA 5IKCB 4HZLB 6REQB 3MAWA 2BSSB 5KYYB 4AHOA 3R0UA 5KYXB 1CG9A 3WFLA 3E0VA 4U6YB 3C86A 3LQAC 1OAQH 2YD8A 4S3JA 1BQGA 2B2XH 4JNXA 1MI5E 1KYFA 4LPYA 1VD6A 3E02A 1RPUA 2G3MA 1E2WA 1YRRA 2GK1A 4N0UE 1Y6NR 1NANH 2IPUG 1X6LA 1Q63A 3TN6A 3HZVA 3MXVH 2J7EA 2INZA 4DB7A 5E6IA 1A14H 3O9NA 5HD8C 4RNJA 4UFKA 2XOTA 4CKVX 1EHXA 1QSFE 4LUIA 3V0FA 4ML9A 1AG6A 4JL1A 4XHJD 1D6VH 1JZHA 4HC1A 1WK0A 5EOCH 5C6WH 2AC0A 3NH7L 5CUSH 1WITA 4UFLA 2C91A 1AJ7L 4I77H 2O30A 2XIMA 1A65A 4KRPD 4RRPG 5DLLA 2PGEA 4X4ME 4W4NA 4X5XA 2CRZA 3QFJA 4GPNA 1A9BA 3IJ8A 3EYOA 4OLYL 1C9WA 1E73M 5AOMA 1YY8A 3RWDB 3HCVB 3AQYA 5IR1B 5INDB 3HW7A 3GFYA 4L1SA 4JFZL 3BLIA 4RAUB 2IF7A 4WUKL 4RDBA 4AIZB 2HRGA 3ZJ7A 1MRDL 5BOZG 1ZEAL 1R3LB 5KVGE 4GVGA 4M6PA 2FT7A 3FT0A 3MRLA 4ZTOH 1JNEA 3LEYL 2VXQA 4FZIA 4RDYA 1A0EA 4EXQA 3MA9L 4YU1A 4N7QA 5CEZE 2RJMA 3G5WA 3GI9H 5M2FX 5IP4A 1IGCH 4PE8A 3L7EB 4GYKA 1VFTA 1J9RA 3MKGA 4A1RA 4O17A 5ESAB 2OLSA 1TJIL 2AJZB 1J8HE 3WXWH 1V7NL 2DWDA 1NLBH 1E4WL 4TRPL 4JJ5A 1HIML 1CXIA 3PWPA 3HB9A 4LDLB 3DGGA 3OAYK 4W9ZA 4XP9L 4APXB 2PDMA 4NQ1A 4E4FA 5MEPA 1J0YA 4JYEA 4EDXA 3MO7A 4PL2A 4NJAH 1TJ1A 2H9GB 2QR0A 4TOQA 4S1QL 3I6LE 3P54A 5A7EA 2VIRA 4QRAA 1W32A 5DGRA 1FFPB 3RNQB 1ALDA 5I77A 4QS5A 3DXIA 3IGAB 4Y9MA 1IEIA 2WZHA 1DVTA 1M57B 2DQMA 3QS3A 3HI1B 4MNQA 3S35L 1KKOA 4J1UA 5CPMA 3FXIC 5HHVL 3MYPA 2J71A 5D02A 5DZPA 2YD2A 1NGQH 2VLLA 4UAOC 3MRDB 3N85L 5A7BA 2YN5A 2FX9H 4H3DA 1XBDA 2DI8A 3KZSA 5DCBA 4OF7A 3RHGA 3LLDA 4PRPB 4Z5RA 2IBBA 2D31A 2MKWA 5I16B 4M03A 2OXGA 2XXFA 3BPOB 1MFAH 3FCTA 2HT2C 3W7KA 3RMEA 3FB8A 4DWDA 2ZOXA 3MTRA 4PPTA 1NEPA 1NU5A 4JX4A 1NCAL 3ZZQA 5IUCA 1M1XA 4Q4PA 3L45A 3DFHA 1QP1A 2Y2YA 3LJ3A 5HWNA 2JJTA 3QZLA 4S3CA 2V5JA 1IE5A 1FKXA 3OW1A 1GVIA 4Y5VB 4MD4B 4M61B 1J5OL 1MPAL 2CGZA 3AREB 1ZLWH 5C0BE 5DFTA 2BIMA 2CJ3A 3H1ZA 1JGDB 4ZMQA 4FQ1L 5FEPA 4NNXA 2J13A 3DX8B 2XACC 4PFEA 3Q44A 2AQ1A 5EC2B 4X8XA 4I9TA 4DEFA 3LNDA 2RR3A 3GBML 3L5XH 4J8RA 4WDTA 5FO9A 2BGQA 5LXXA 3K7UA 3GMLB 1XUZA 1FX6A 1OAYH 3VA6A 3H26A 2E7HA 4F33B 4JRXA 1CR9H 3SJVB 3RAOA 4R4ND 2YGNA 4ELDA 4IIHA 4P3CL 1BMWA 4EKJA 3LTPA 3UXIA 1YCSA 5CJXC 4K73A 1T99A 4PIBA 5E8DL 1NDTA 4ZS6D 1HGYA 4HYTB 1WBXB 2JQAA 3CFTA 4OCRH 4B7LA 2BY2A 2XN9D 3RUBL 3EBAA 3E38A 2GIYA 2CRYA 4BY3A 4ZFFA 4J9JA 4PVBA 3IMVA 3QLDA 4J3OF 3VI4E 4RFNC 4HSHA 2GOUA 1D9KD 2WW5A 3I75A 5F1OB 3VI3F 1E28A 3LLXA 3TTYA 2HT4D 2X4OA 2F38A 2E7BA 3DYOA 4JZJA 4DWSA 5GS1A 3W02A 1MFNA 3RB7A 4A2HA 2DRUA 3BVXA 5SWSD 1U9KA 4QRRB 3SDCC 1KC5H 4E9WA 3L7FB 3RGBA 3RVVC 4Z78B 3QEQE 2PETA 2HMID 2MANA 1GUVA 1S3RA 1JYNA 4HCRH 4HUWA 4LAZA 2FHCA 3TAKA 2CUMA 1TLKA 1ILSA 5DMLA 4KK8C 3MP5A 5EGRA 2UZYA 3DVGA 2OLHA 2WWCA 2QULA 3PL6A 3KVDD 1UWIA 2PW2A 2ZX6A 1N8IA 1S8DB 4BWLA 1H3UA 4PLJD 2PUQT 3U2OA 3IBEA 1S7TA 3HE7D 5LNRA 5JPMC 1P7TA 4IGNA 1ET8A 2QCEA 3EJPA 3QDGB 4YK4C 1PX3A 4C5YA 2CESA 2NT0A 4F7MB 4RCXA 2PGWA 1YNPA 2YC1A 4BKNA 1G9ML 2H0EA 1N67A 2OVLA 2QW5A 1I3VA 1QT1A 5IGXL 2EG7A 2Z00A 2FO1A 1NGPH 1O1HA 5TE6H 1OSYA 5C08E 4Q4QA 4Y1AB 5D4HA 3VCNA 3QIUB 3RPBA 1GGIH 3SQSA 1YBQA 1KFBA 3L5WA 2PSNA 4NGHH 1UWYA 3CXDH 1VADB 3FRPA 3O06A 4FQXD 4QTFA 5CJQH 2VZOA 4RA0C 4JO3L 2GL5A 2XZQH 1FWNA 1UD4A 3EH1A 1HN1A 4YXKH 1CXFA 1OOAA 4JVPA 4DFIA 4IRSC 1OVZA 4KCWA 4IP7A 3M6YA 3OXSA 3L4VA 2OR9H 2NW0A 1P7QA 4O53A 1GZQA 3VE9A 2CO2A 2B7DT 1P84K 5B8CC 3MI3A 3S48A 3T0BA 2DEXX 4FG0A 3BPNB 5DJYB 3C09B 1PCXA 3KP0A 1LD9A 3BZEA 4DQOH 2J9ZA 3X1BA 3DOHA 3NCYP 4KJPD 4D71A 1OFOA 5I8CB 2ROXA 4DVBA 3A9BA 4LDCA 3LTSA 4UBDC 5M03A 3TXVA 3O16A 3M7WA 2VL5B 2D23A 3K6SA 4NQQA 1EMTH 1ASPA 3EBVA 5L4IA 4F2BA 2IPTH 3B9KD 2YAEA 3TWCL 4B3EA 4ZPTB 3L3KB 2YB1A 1A1OB 2V7HA 3V0VA 5JA8B 3TSBA 3BVUA 3TJEH 5FM4A 5HWJA 1K6WA 5INCB 1HW6A 3RFRA 4ACYA 5AYQA 3O2WH 3HFMH 5IFHL 4WKXA 1DQJA 1TZGH 3WEOA 4AGMA 5HNNA 3QJHB 4TV3A 3UZVA 1NMCB 3SRDA 4AZGA 4Z95L 3V0WH 3GFZA 2G2RB 4L29B 2DORA 4PJGB 3EGXB 2OTDA 1JYXA 3UWWA 4KXZH 1IEXA 2ED6A 2C34A 3ABXA 2WLHA 3OEXA 1U91A 1IIKA 2AGJH 4PRTA 4I3SH 1VBGA 4JTCA 1S1PA 4CA4A 3BD3A 2XSBA 3RJQB 4KFOA 3WDRA 3Q45A 4PVMA 4I0PD 1RBLA 3DURB 3RURA 1UD6A 5LN4A 1M9WA 2P8LB 2Z7UA 3Q1SH 1HHJB 3QT2A 3N2CA 1KEMH 2LTQC 2FVKA 4FIQA 4L48A 3RNKA 1X5FA 3PFQA 1DWHM 2H1XA 3U46A 3FPYA 5A6SA 4LAQH 2IQAB 4IMKC 1KNWA 3JT0A 3NCMA 4NT0A 2PF6A 1ETZB 2XG4A 2YXVA 2FBJL 3UR8A 4AYBA 4AEIL 1T2QL 1WDAA 3ESVF 3ATAA 3RTQB 1QO3B 2J7GA 3B8TA 4K3JH 4PMUA 3DHMA 3F83A 3T9PA 1U3HC 3OVUB 2CMRH 2D73A 3UPAA 1XLFA 4JQ4A 2ZUSA 4Z7NE 3KPRB 1E5UI 3KM1A 2OWWA 2Q1EA 4GQQA 2HZHA 2VDPH 1Q8MA 5IFPA 3RY4A 3WTYA 5BCAA 3ARBD 2ZUMA 4JR9H 1JGEA 1CT5A 4ANKA 5C7ZA 4GA8A 2YGPA 2C3GA 1P4CA 4GFIA 4PBFA 2Z3FA 3SRFA 4MJID 3R4RA 2NY4C 1YZZA 3BQUA 4J35A 4PCPA 1CBJA 4DZHA 3BAIA 1KPRB 1BYPA 3VI3B 3HUJE 2W9DH 2CE6A 4XVJH 5FOBB 2W9MA 2APFA 2MPVA 2GJPA 1HQTA 3FSZA 1VA9A 3T6XA 4MDJA 1LBMA 4NP4L 1LL6A 1K2DB 1ITQA 1PTGA 4JGNA 4N6RA 4BD4A 3CK0L 3WK2A 3GSUA 3PB2A 1JN6B 3RWFB 3T3ME 1E8XA 3U2EA 3HMWL 4Q9QL 1Y0LA 3CPRA 4Z7WA 2GUOA 4M1RA 3FQNB 3HNVL 3IKKA 3CUZA 3I6TA 1E6RA 2Q7YA 3IXAB 5HYSB 4K8RH 3C5ZA 3VDGA 2OTUB 1L9RA 3PJUA 3FU9A 4UB0L 3U25A 2VLRD 3SE9L 3K2MC 1RUAH 3O6MH 3ZDXE 1VGKA 1PNDA 5HANA 4XMKL 1VRDA 2FX8H 3RPDA 5EU6A 4J3ZA 1TO5A 3VDCA 2PPGA 3X13B 3ZE1E 4UTMA 1OX5A 4Y5YB 1QI4A 1DTUA 1RVFL 3WTWA 3ULVL 4AU0A 1N68A 1IGML 3BP7B 4R6UA 3QUML 4NZDA 3IRCA 1JRHH 3HHSA 1K5NA 2FGBA 3UTSD 3IDXL 2ACQA 2ACSA 2ZOTA 1NDMA 4YWGL 1TG8A 4AQ8A 5EWIH 4G43A 2D03H 4DHLA 1E7VA 4GKNB 3HI5L 4W9DC 5DRWB 3RF9A 3B5TA 3P7YA 1F97A 2X4SB 4B5ZA 4NF7A 4A6GA 2GBTA 2VZVA 3W5MA 2CFFA 4A66A 4HZ7A 3E6HA 3AHXA 3IFOA 2FJFB 3QYNA 1UM4L 3Q06A 1RPKA 1GOWA 1XFCA 3I7RA 3UTTA 2EKCA 1PD0A 5DRXB 4AMKH 3E2VA 4MDIB 2AK4A 3D18B 2QF8A 3NSFA 2FJGA 1A1MA 2Z27A 3DROB 1N0LB 1F3EA 3UYRH 3TJPA 2MIZA 3QJFA 5I8OH 3KDMB 5E0KA 4Y8EA 1U58B 2N1KA 1ZAIA 5LHFA 3FFSA 2FEDC 1KXTB 1JZDC 2PYEB 5EOTB 3GQFA 5T1KB 3FQWB 5AYUL 4JDVB 2PXYA 3WFCL 1FH5L 3HAEG 3D46A 4FSAA 3W83A 3VIPA 1SMDA 2FZNA 4FFVD 1VBRA 4DZIA 1XL6A 4EXPX 1SBSL 4XG1A 5HBFA 2PDQA 2FYYA 1XDTT 3KNBB 4JM2A 3DGDA 4CNTA 1QOPA 3G1SA 3CXHK 1B4JH 4G8GA 1QTSA 1NAKH 1EYEA 3L1FA 4AZCB 4PRHD 1H19A 3VFRB 1RJZB 1PTZA 3MNZB 5AB1A 1FTXA 4F0SA 3AWOA 3VXSE 3W2DL 2H0FA 1C08B 1GGBH 4LLDA 1S39A 3QRGL 1K8YA 4NQVA 2WWOA 1SZFA 2IWEA 3W1NA 1Q9OB 4BHUI 4L18A 2X2UA 3IE4A 3DVNA 1BM7A 5F0LB 2Z26A 1EYWA 5C09B 4QHKJ 3DMMA 3R4DA 4L3CB 4PS4H 4O58H 3BGMB 2F2KA 3OMIB 4HNOA 2VDMB 2APBA 5EBWB 2Y7GA 5CIPH 2IQ9L 4OT1L 4KROB 3T0AA 3ZO0A 4DETA 3KYOA 1ZA3B 5LA2A 2XTLA 4WY7H 3X11A 1ID2A 3NDZA 3I9GH 5F1SA 1UP0A 4WRLA 3MPGA 5IOKA 2VDRL 1TJGL 3FVMA 3UYPA 4ZUUB 3S4SG 4D8LA 1FCCA 1P5BA 3S5SA 3II2A 3TX4A 5TF1L 4K5NA 1R87A 3U8GA 1U92A 2CLRB 2ZQKA 1NFPA 4XK2A 1NFDF 3AXHA 3QOKA 4DKFH 2DH2A 3DCPA 3R79A 4JQIL 1ZHBB 3AU6A 4FL4B 4JIQA 4XXWC 4X4XA 5C0AD 5EG6C 2W9LA 3IAPA 3BPOC 3ABRA 3GSOA 5IVNA 4KVNH 3L3HA 3T2LA 1R0AH 4AMAA 1CDBA 3ZYZA 1QVOB 2GZXA 4K0OA 4B97A 5JIIA 1LF1A 4KQ0A 1HH9A 1EFXB 4ZTEA 1JG9A 4L3AA 2ITFA 2WIIA 5CZKA 5IBLC 3WEAA 4O2CB 1YDVA 1QNPA 1GONA 3NSXA 3MC0A 1JPDX 3VYNA 1AE6L 5DJ0A 3TIDA 1QASA 4DPAX 4PN6A 1MRAA 1AGEA 2FGWH 1JGLL 5DS2A 4Y5VC 4R7DA 4KBXA 3MCG1 3EFOA 2IEPA 4MWAE 3DX0A 3AREC 4JHWL 3EWXA 1WUFA 3E7JA 4G6AD 1BD2A 1EEPA 3UTQB 1UACH 1DSYA 4LT9A 2XFGB 3RPTA 5GGQH 1P6BA 2OQYA 1F00I 4DUVA 3BUDA 4PGCB 3NSJA 1X8FA 4EANA 3TASA 3BQ6A 2H0PA 1QBLL 4PJHE 2VXVL 5C0JA 3RTLA 2CHXA 4GS7B 5EFFA 4X5QA 3INUL 4OOZA 1KBGL 4A04A 2J25A 3E0IA 3W0KA 4AGPA 1CBVL 3TNMB 3L5MA 4JBSA 3IJHB 5HGDB 3M5XA 5DCDA 3P4OB 2O6CA 1KGCD 4YHIB 2MQ0A 4LGRB 5FL1A 1MNSA 5C9KA 4LE8A 2DY2A 4PULA 1QRNE 4ONGL 3CXHJ 3D4GA 2CBJA 1OTUD 1IQ8A 1OGBA 1U95A 3V7AE 4XO8A 3KL5A 1GOGA 4R2GD 5BV7H 4MJZA 3RPKA 4MJ5A 4EK7A 4Q97A 2ZJSL 3DBXB 2AKMA 2HUEA 5DU7A 1J6OA 1GZHA 2OODA 4LYQA 5DZ9A 4CCEA 1HJBC 3ZW3A 2DSKA 4A05A 4N9EA 1GA2A 1HKIA 3KPMA 4GFTB 1DVFD 1CF8L 1ZS2A 1IVTA 4QHLA 2XX0A 3CT2A 2PP9A 1KN2L 4WY0A 3RWGB 1I1RA 3QRHA 4KPLA 3QWRA 3HGSA 4MMYB 4PCKA 4X6CE 3RZWA 2AXGB 3CNKA 1S9VA 2XFRA 3KZ8A 4XSLA 4PBVC 1RJYA 4GMTL 2BWQA 5F1VA 5FWRA 2AEIT 3L12A 4NQDE 3CLMA 4EI5D 2XJKA 4BXVA 3WQCA 1M9SA 4IP5A 3EWBX 2G3NA 3GMNA 3V1PA 3TNNB 1MF2H 1XW8A 4AQEB 4ZOEA 4YX2L 1TENA 2VDHA 2WV3A 4AV5A 3F7VA 1IEBA 2X89A 2HVNA 3LQAH 3HIZA 2BNUB 1NM4A 1Q65A 4GRWF 4Q9RL 5D96C 4GZJA 1KFGA 4XAZA 12E8L 3QIUC 3P0VL 2B1AL 2YEVB 3SCNA 5E9DB 3VAEA 3OGCA 1RUQH 3TN0D 3CH9A 4BS0A 3V5DA 4QRBA 2HCVA 4JPQA 3MMUA 5IMKB 1P5UB 1IAIH 4FQQA 3URNA 1UJTA 5BVPL 4GRLC 1K8IB 4K3HA 35C8L 3PFMA 3W7HA 4CU8A 1AZRA 1PZ3A 2K8QA 4AF0A 4IF2A 3GJFB 3R0MA 1TSHA 3I02B 4HHLA 1F4WH 3NZHH 4JO1H 5KSBE 8PAZA 3QNFA 4X8JB 2BNRD 3LKSA 1G01A 3POCA 3VFGH 4Z2KA 3B7RL 2VFEA 1XP3A 5AVSB 4ODTL 2B77A 4LFYA 4XKMA 5ICUA 4HWEL 4Q22A 1EXUB 3UL4A 4ZFGH 4LEXL 1T0MA 3T6CA 3HC0A 3BPNC 3LXAA 3VW3L 1KBBA 3N4FA 4BZ1L 1IQDB 3ULUL 1NDYA 1IL1A 1JZJA 4U1IB 4X4KA 5EUKA 4ZFOL 2VM9A 2PCXA 1QSEA 4HFWA 3UJTL 4GI6A 4LCCA 4JN2B 3APYA 4M00A 3MHUA 3VI4F 1XBZA 4KZDH 3SR7A 4RISH 3U2SB 5D9OA 3O45B 5KG9A 2HISA 2MNUA 4EIUA 2X6CA 1HK6A 2E47A 3I65A 2XTJB 2PLJA 4Y8DC 4Y8FA 4AG4H 5EZIL 3B5HA 1EB3A 3KCLA 3D6GA 1DQDL 3HC4H 1AXSB 1MI5B 5LXVA 5LUMA 5E1GA 1EJUC 1TX2A 4GRSA 4N8CL 1XGYL 1XCFA 5ITFA 1RUML 1CD1B 3TQPA 2B31A 5CP7A 2E28A 4UT6A 1NFDB 2AXFA 3MNDA 1ES0A 4LCIL 3KPPB 1AUSL 4PJXE 3WE1A 2NVCA 4XNAA 4HULB 1NMCC 1BIHA 3GSNB 2CU0A 3LB0A 3NGBC 3NIDF 4U5KA 4AD2A 3PZ9A 4XPFL 3UFYA 3VGGA 1MRQA 1SJBA 1U0QA 2XXMB 3CYVA 3ISRA 1MG2C 2VQ1A 1BPLB 4QHMA 2PAJA 2ZRWA 4GQ0A 2NUYA 2XQYA 4JN1H 3QIWD 3VJ6B 4XT1C 2WWKO 4CVZB 1S2TA 4LFHD 3HS0A 4NRRA 2VC2L 1PYWB 2EEBA 1KB5H 2Y25A 1V6VA 4KKPA 2VQ4A 3V0JA 1PLGL 3ARXA 5FYKE 3I2CL 1JHTA 2W3ZA 3V5KA 4J2MA 4PTNA 1W17A 1XMEB 1KLZA 3MJ9A 4B92A 3DUUB 5F6HJ 1X4XA 2YMTA 3O6KH 5HVFB 2ZUQB 1AQFA 1M53A 5AHMA 2ZONA 4AJYV 4G2AA 3TFKC 3SDCB 2INFA 1S5WA 1T4KB 2IAMD 3V0HA 4W9FC 4ZR8A 2BJMH 1E3XA 3LPGA 2RAMA 1F3TA 4J2XA 1UXSA 3FN0H 4YEEA 1EXHA 5C0QA 4TVSa 5IB5A 1JPGB 3K2GA 3KR3H 4XN8A 3VSTA 3R1GH 3CLEH 1GYCA 1TWSA 4F9LA 1SJEB 4AQAB 1YEJL 3TURA 4YVVA 4YK4B 4KKLD 1TZZA 4GXPA 3KWUA 5JIQA 4AQOA 1TO3A 3WF4A 1WWAX 2PO6B 3SD2A 5DHEA 1HC1A 3MJ9L 5D9MA 4GRMB 4YLWA 3OB8A 3BQ5A 2W63A 4JTLA 5C7VA 3BUIA 1YKWA 4OM0L 4UDTA 5D2LA 4W86A 2M83A 3BGFB 1UATA 3S8FB 2DYPA 4O02L 3D39A 4Z42C 3ME3A 5F7EL 2JKIS 5GS0L 4XP1H 3CZSA 3T65B 4JTSA 3QA3A 3MOBH 5BXFA 4DP2X 4OV9A 1OZMA 4G2DA 1OC6A 4QSFA 4I0CC 3US0A 2HQAA 2Y7QA 1MDLA 1CX9A 4BIKA 3O41B 4UT9A 3IT8D 5JW4R 1U30A 3TVMA 4FLHA 4N0YL 5IK3A 1B3JA 5I73B 2HPOA 2L7EA 4NBZB 1NEUA 4I9WD 2VMJA 1X5ZA 4R27A 1I9JH 2ZP0T 4AEHL 3CPGA 5FCSH 1EBAA 2ZF8A 3PUEA 5DYOA 5ENWA 4O50A 2P8PB 1LO2H 5KVEH 3GLCA 2CERA 4NILA 4Y5YC 5I8EA 3IIPA 5B8CB 4LZKA 5F96H 1KCZA 3JVGC 4LOUC 1N26A 1DBTA 5L4JA 1LJYA 4X3ZA 3O3EB 4ALDA 1A5AA 4XOAA 3PZOA 2YXXA 4D72A 3C52A 4GRWB 4YFEA 1SHXA 5E23A 5JHDE 3GNPA 1Y5WA 4AMCA 2AJXL 1RULH 1CGUA 4MYXA 4PW9A 4M51A 1V6WA 3QG7L 3RIAF 3V7AG 2PD9A 2ZXCA 3QH3B 4K7FA 1N2VA 4ZBCA 2IGLA 5IQ9A 4WGXA 4PG9A 4L0YA 4KAQL 3LTVA 3S9ZA 2ZZ2A 1J05A 5CAKA 3EXJA 4FQLL 4HPOL 1WBYB 1ZBCA 4F3FA 3CVIL 3MJ6A 2Z1WA 4J28A 5GRJL 4RW3A 4KZEH 4B16A 1E5NA 4QDMA 3QARA 1GVEA 2IVFC 3P9MB 2ICSA 1LWJA 3HS9A 1HXYB 1DEEA 1EJVC 3ATFA 4YL9A 5HHOE 3EYUH 1TQBB 4Q74A 5CSYA 1C16B 4Y5XB 3VD3A 2HTMA 5DZVA 3GTVA 3W0WD 2UY7A 3T8MA 1HJCA 1JUFB 1W2KT 3NJLA 5D1ZI 2VEGA 1CGVA 3GPEA 3E49A 4W6XB 3FO9B 3ELAT 4B27A 2EYSA 1HG3A 5GSVB 3D69B 1ADQA 1DV7A 3VI4B 4UCGA 3IANA 1TTAA 1JDCA 3D47A 2X7VA 1QQDB 2XA8H 3QOMA 4LEBA 2Z31A 1SJHA 4U1LB 4D3CL 2V6HA 3FMGH 1XEDA 1BHGA 4P8WA 3LGDA 4IM4A 1KJ2H 3S88H 3OKEB 1EDTA 1MLBB 2NTFA 5T1LB 5K5YA 1Z1WA 2ZXGA 4OJCA 3C08H 5DEZA 4JMNA 4GO8A 4KKAC 1IRAY 1TYGA 2F54E 3OGOE 3SB3A 3MUJA 2A1YA 3C8FA 4XP4H 1JCMP 1LP9E 5HI5D 1PZBA 3NIDB 1JV2B 3MV11 3NZ8B 2F8VA 4WOQA 3UO8B 3UACA 3NG3A 2CLMA 1B6UA 5AY7A 1K3UA 4GY0A 5FUZL 1PYMA 5J0BA 1XXXA 4JXCA 5FFLA 1NSJA 3NSMA 3LN9A 5G55A 4KROC 5EMLA 2JJVA 2CDGA 4APQB 1XF5A 1V6TA 1M9HA 2ZYIA 2G9HB 1IGWA 3KWVA 1MCDA 4YSOA 4Q9BA 5IFAL 4NPKA 2CLZA 1P53A 4N2GA 5FYLE 3QO1B 4ZFZA 1J1OL 3G3DA 5IJBC 4PMQA 3AQUA 4M6MH 5I2IB 3EG9B 2VITA 4S1DC 3EA1A 5EU5A 3TW7A 3D3AA 4RFEA 1R86A 3PBGA 4JPSA 4ZUSA 2WCSA 5FO8A 4DO7A 3AGVA 5A2KH 4GEJA 2BWDA 3ROOA 4FL4C 1M7IA 1IC0A 5GPRA 3CX5J 2X4QA 3H70A 2YDSA 4HU2A 3S9YA 5E0CA 2CRMA 2MWCA 4C1LA 3S2JA 4G1MB 2GHWB 1PCWA 1F58L 1DTNA 3A4FA 1EXGA 3N18A 3SPGA 5BRZB 3G6AB 3IDGA 4IRJA 4E6MA 5AZ2H 4Q7DA 4AYMC 4QWWC 3U4EA 4U1HA 5L4FA 4ESKA 3QAQA 2UV8G 1XCQA 3MKCA 3H7UA 3S4SB 3LS4H 4JFHD 3O4LA 3GDCA 1BSIA 3MU3A 1ITXA 3VFOA 3MV8E 4TQIA 1NCCH 1PL3A 1NWTA 3ICJA 1MFMA 1OARL 2SEBA 5DMKB 3HBQA 5HNUA 3EOUA 1C5BL 2CO1A 5EL1A 2EKJA 4L4VB 4DFHA 4NL1A 2DGAA 2A7NA 3QGAC 2XBTA 4Y19A 4HIIA 4BZ2L 2ZC1A 1KGXA 3MMEB 2VX5A 5DQJA 4AYEC 1OHLA 5FUOL 4Z1DA 5AVWB 1FG2B 1SFDA 4GS7C 1J0IA 3SHSA 4XPBL 2JK2A 1YN7B 5A8GA 4AH2B 1WC7A 3R1ZA 1YNLH 4CNIB 4A22A 4X6DE 3WXVH 4EZMA 1BMZA 3R25A 3N6HA 2FTPA 5EN2A 4F9PC 3HNTH 4ODVL 1X5GA 2QCDA 3AC0A 2NYYD 5D33A 2GT9B 4PY8J 2WXOA 4LSVH 1MQKH 5EBAA 5C0EB 1EGJL 3KJ4B 2EDHA 3G77A 4YGAB 5GGUA 4YMPA 1T7YA 4DZBB 3T3PE 4Y2OA 4DTGL 4LS1A 5F2GA 2YGYA 4GW1A 3VXPB