1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
1UR9A 4D72A 2AMGA 3W82A 2V38A 5LA0A 4ZE5A 2PWGA 4BCEA 1WDSA 4PCSA 4M29A 1J01A 3SCQA 1CLVA 4C7FA 3A4AA 2VVSA 2WXDM 2E8ZA 2VO5A 3SCOA 4F8XA 2JEQA 2UY4A 2VX6A 1Q6FA 1R33A 1GOMA 3G6LA 1BGAA 3MKKA 3MUY1 4KRUA 3BUPA 1E40A 3MUZ1 5HDRA 2VCAA 4W7WA 4UFIA 4CD4A 4CVWA 2Z1KA 3GTNA 2VCBA 1E1EA 3PBGA 4DUVA 3CZGA 1HF6A 4OBRA 1X6NA 3NJ3A 3A23A 1UH4A 1EHNA 2WSKA 1WNOA 3A24A 3A4XA 2YA2A 2W62A 3CUGA 2YL8A 4CN4A 3A4WA 3BUIA 3WQ6A 4AIUA 3AMLA 3ZT7A 3VIFA 1SFSA 3WN6A 4PMOA 5TD4A 3WQVA 1OGSA 3AXHA 2YOCA 3HN3A 3WH7A 4GI9A 1PX3A 2EQDA 1QOXA 4PUDA 3VNZA 3VDBA 4OZOA 1E4MM 4U2ZA 1KXTA 4M1RA 4JFWA 3T08A 1JZ7A 4LX4A 1K9DA 3LX9A 1E6PA 1E4IA 3OA5A 1OT2A 2DSWA 1LG2A 2VZTA 2X2YA 2Y5EA 5E1QA 1QBBA 3SUTA 3TTQA 3B9DA 3NDZA 1GHSA 3NUKA 3SCPA 3WH9A 3A3HA 1WPCA 3DX2A 4W89A 1B1YA 2VZOA 1UA3A 1HNYA 3VX1A 2ZWYA 3O6AA 1ODUA 3VGEA 1A47A 3EMQA 1EOMA 1XSIA 2CCRA 3I3EA 5BXTA 1M7XA 3W25A 3QOMA 4F79A 1HP4A 1UR0A 3S2CA 3WUGA 1E6QM 3RIKA 4NRRA 1KCLA 4OBSA 3O2LA 4BQ5A 3SIMA 1BGGA 3BUQA 3OZOA 2ZICA 2VZUA 2ZXDA 3DHUA 1JXKA 3FNDA 1TQUA 1GJWA 4PTWA 2QHAA 1J9YA 1VBUA 3AI0A 1OD0A 2EPNA 1FH7A 1WKYA 1EA9C 4PMXA 2MANA 3LXCA 3LRMA 2J8FA 4L4PA 2V5DA 4QFUA 1ZBCA 2YA0A 2DT1A 4GZIA 3GM8A 3PZMA 1JYWA 1BFNA 5JBFA 1HXJA 2X0HA 3BAJA 2VL4A 4TX8A 3IAPA 2D0GA 1DTUA 1UG6A 4MJ2A 1BQCA 2JIEA 3QHOA 1MW1A 1QI5A 4PMVA 1R34A 4PSRA 2VC9A 3AS3A 4LYRA 2WBGA 3WMBA 1JDCA 1RH9A 2E40A 3OBAA 5CGTA 3W27A 1E6ZA 4HZ7A 1XH2A 2G3NA 2OSWA 1K6AA 2EPKX 1QNQA 3BH4A 3BVTA 3SURA 2FDMA 1SMDA 2ALWA 1CENA 2QPUA 4B16A 3WQ8A 4UQAA 2WWCA 2OWCA 2QLYA 2Y24A 4U3CA 4AD4A 4WKHA 1KGWA 4PN2A 3LMYA 4V27A 3U7VA 2D0HA 2VOTA 1T0OA 3A22A 3T2PA 4AZGA 3K8MA 4GKLA 3PZQA 1OINA 3PHAA 1JF5A 1CNVA 4NZFA 5D9OA 4CKQA 4CCDA 4E8CA 3BVXA 1V02A 2IXVA 4ZENA 3DC0A 3W37A 3MUIA 4XZWA 4UFKA 1PX4A 1GVIA 3T09A 4MPKA 2EXOA 2WLZA 3DECA 3A21A 4H8VA 1NQ6A 5E9AA 4LYQA 3DX3A 2WPGA 1ISWA 5CGMA 2ZUUA 3DX0A 2G3JA 1QI2A 4H2CA 1BVNP 2Y8VA 1HIZA 4CD8A 1JG9A 1BYCA 3AXXA 3OLGA 1CDGA 2QMJA 4P7OA 3AOFA 3MS8A 1H3GA 2J7GA 1CYGA 1JZ4A 4CU8A 4P7QA 3EJPA 3VIJA 1WB0A 4AIEA 1OSEA 2YDRA 3PTMA 2DIJA 3II1A 4D6HA 3OLIA 1E4LA 3KE0A 2BHYA 2XPKA 3B9EA 1K9FA 1ZBKA 3DX4A 3UESA 3VMPA 4AZ6A 2PWHA 3DDFA 3N1AA 2CESA 1KCKA 1B30A 1MFUA 1XHGA 2XSAA 3CHDA 4H04A 1KBBA 1OBAA 3TTSA 3VDHA 2JF7A 1HL8A 2C7FA 1HVQA 3I3BA 3IGUA 2WM0A 2V3EA 1E1FA 4IPLA 3VIOA 2YL9A 3L4WA 5BXSA 1OB0A 1UR2A 2ZX6A 4D6DA 4HU8A 3WNNA 1W9DM 4NSBA 3ARSA 3A47A 3N18A 5E0CA 4GZEA 4JHZA 1JDAA 4J3XA 3ZQ9A 2G41A 1G94A 4PMYA 3VD5A 4Z2GA 3UG4A 3QGVA 5A1AA 3GXNA 2EABA 4AY1A 4TOQA 2GK1A 4F9JA 1ODZA 1B31A 1GZJA 2Y8KA 2JEPA 3PZGA 2XVPA 2YFNA 4ATLA 3CZLA 3D52A 3L2LA 2J79A 1KQYA 2ESCA 2WHJA 3CZJA 3PZTA 2OWWA 3BC9A 3D5HA 2YBTA 2V5CA 5HPCA 2V3FA 2XFYA 3MSDA 4M56A 3ARQA 3WMSA 3CV5A 2DDXA 3WKZA 4JL1A 3AISA 3TV8A 2JIWA 2WHLA 1C7TA 1KR0A 3GYCA 2EPMX 2BS9A 5E09A 1V0NA 3CMGA 1YHTA 2X2HA 5D9MA 2DSKA 3VMOA 1Q6EA 2YA1A 4AMXA 2X1IA 2BV9A 2A3CA 3VSTA 4CN1A 2WC3A 1H1NA 5ABFB 5GNZA 5DT5A 3ZJKA 2DPEA 3U7BA 3GNOA 3WH5A 1W1YA 2VR5A 1B3XA 4PMUA 3ZT6A 4MB3A 5IXEA 3BMVA 2QPSA 2XWDA 4PMZA 4U5IA 4MNJA 2BXZA 5AY7A 5I79A 3AMKA 2O9PA 7A3HA 1HJVA 2WKLA 3W38A 2OLHA 2O92A 4ZEPA 5A69A 4H8UA 1QWNA 2ZWZA 1CXFA 5JBDA 4AZ7A 5ABFA 3WEZA 1NARA 1J0YA 1RD6A 3BMWA 1DWFM 3UEQA 3OGSA 2EEXA 4WF7A 1LLOA 1UD8A 1TA3B 3B8SA 2OYMA 2GFTA 3WDJA 2XVNA 2VR4A 3VIGA 3DYMA 1EIBA 3M46A 3PZ9A 5BYWA 5JIPA 1H0IA 1GOQA 2WVUA 3ZJ6A 2HVMA 5ECUA 1TZ7A 3WELA 5BROA 2WMKA 2WYSA 3NSXA 2WMHA 4W88A 1US3A 4MNLA 1JAEA 4JFVA 1JI2A 1EO5A 2X8RA 1TQTA 3A6OA 2EO7A 2WB5A 1QI3A 2WK2A 2F2HA 1UD2A 3W6MA 1B3YA 4W8AA 1XCWA 4PUEA 5C71A 1E6RA 1TUXA 4P8VA 3BCDA 2ZXAA 1JNDA 1PPIA 4M80A 4JFTA 3E1F1 1BF2A 3ECQA 1V6UA 3RO8A 4GQRA 3QOKA 4MDOA 3GBDA 4ZXOA 1PEZA 3CLWA 1ECEA 1R75A 3RJXA 4AWEA 1OIMA 5BRQA 2WC4A 3MU7A 2QV4A 1TVPA 1J0JA 3OLEA 4Z2IA 4PMDA 4WKAA 2F7RA 3AQUA 3MV11 1GW1A 2WVSA 3EDKA 3WNLA 2OSXA 1NOFA 3AZTA 3N15A 1C91A 5A6BD 2GUYA 4WK9A 4A4AA 3VIPA 3GBEA 1JD7A 3VD3A 3WD4A 3VU2A 4P7RA 4CU7A 3ZR6A 1LL4A 4TVUA 5GQBA 3N04A 2FHFA 1W3HA 4AEEA 4DWSA 2XWEA 1U30A 2BVTA 4ATWA 1W9UA 3WQ5A 1G5AA 3BLBA 2DT2A 1UH3A 4J3VA 4JCMA 3T0DA 1KGXA 3HG3A 1XC6A 1J18A 1BPLB 2XM2A 1R7AA 3NYDA 2YJQA 4WKFA 3T0AA 4DO4A 2DGAA 2CBIA 1A3HA 3WY3A 1CLXA 1FOBA 4WIWA 1R46A 3NDYA 5A6JA 3W28A 4Q22A 1UH2A 1WDPA 3GH5A 3WF3A 1UKSA 1NP0A 2X0YA 5C8BB 3ARXA 1VFUA 3GXMA 3L4TA 4HTYA 3VKKA 4D1JA 1E0WA 5BWFA 2WZIA 1ITCA 3VM5A 4P7NA 3THDA 3AIRA 1C8XA 5AYBA 1V6XA 1W9VA 5EBAA 2X2IA 1TE1A 1WZAA 3AMGA 3CHCA 1S46A 2XTKA 3ZR5A 3SUUA 1QNSA 1G1YA 2EPLX 2CEQA 1VF8A 3F5JA 1WZKA 4U33A 1O7AA 1NWUA 1TFVA 1MVYA 1H09A 5A6KA 3WFZA 3S5ZA 4EANA 4CGTA 1R7OA 3CUIA 2WANA 4J3UA 2ZXQA 3ARUA 3QHNA 3KL5A 1HT6A 2O9OA 4V28A 3NCOA 1B2YA 1E72M 3WDIA 1VENA 2GDUA 3EMZA 3VM7A 2PWEA 3W53A 3BCFA 3WD0A 2CHOA 1QW8A 1QVBA 4AXNA 1JZ2A 2IGTA 4FMVA 1V3HA 1SMAA 1WZLA 1BYBA 5F7UA 3GH7A 1PJ9A 3W4RA 3AS0A 3EYPA 4PCTA 2J77A 1E15A 1PZ2A 4JCLA 5M17A 5LYRA 4D6IA 2WCAA 1SYTA 1M53A 2CHNA 2A3HA 2WAGA 2EPOA 1UD3A 4DUWA 1OD8A 1C8YA 2J74A 4KMQA 2VTFA 2Z1SA 1J10A 4UFHA 3POCA 4W93A 5I23A 5A8NA 4CD5A 2VRKA 2W5FA 1NOWA 1W1PA 1NP2A 4UFMA 1XCXA 3FAXA 3WD2A 3J7HA 4Z2JA 3D3AA 3IANA 4ZE4A 1R87A 2XGIA 2ZE0A 2GSJA 4ML4A 1JFHA 4QLLA 4BZYA 2PBOA 1B3ZA 3ARTA 3W81A 5E70A 3VVGA 1SR0A 3HG2A 2J25A 1Y7VA 3NSMA 3VUPA 3CIVA 1C93A 1VAHA 1JZ3A 2F18A 3UR7A 4YN5A 4ACYA 2D2OA 2O9TA 2RGMA 4IISA 1CXEA 1HTYA 3SCTA 5M5DA 2CIPA 5KEZA 4FLSA 1UQYA 4TVDA 3WBAA 3AS2A 4W86A 1KTCA 1CXLA 3BUDA 2QMKA 4AZIA 2FGLA 1V3LA 9CGTA 4GO9A 5D8ZA 2FHCA 5I5RA 3SCSA 4GQQA 2W66A 1WAWA 8A3HA 3THCA 2WMIA 4B9YA 5IDIA 3RM4A 3QR3A 1E3ZA 2YFOA 1WZMA 5A94A 1GOIA 3AIEA 5I3DA 3O9NA 1KWGA 5DFAA 1QI4A 3ARVA 2A3BA 3CZ8A 2FH8A 1UHVA 2EBNA 3WNOA 1NM9A 2YDSA 4A3YA 1GVYA 2ZXBA 1JDDA 3W29A 1W9XA 1EQCA 2GVYA 1J11A 2Q8XA 1GCYA 2VX5A 1GORA 4JFSA 3N17A 1LJYA 4P8WA 3MSGA 3VGFA 1Z32X 2CPUA 1GOKA 4UCFA 1UD6A 5DMYA 2UWFA 3EBVA 2BHUA 1TQWA 3WUEA 5CXPA 1J0KA 3WNPA 2E9BA 3AIWA 5A8QA 1E43A 3WSUA 1F4HA 3FXYA 1EHAA 1WDQA 2W67A 3GNPA 2ZUWA 3ZT5A 4K68A 4N42A 3WNKA 4L4OA 2WMFA 2VX4A 5DEZA 5CPQA 4V2XA 4RE3A 3IAQA 4U3AA 4D6FA 3LPFA 1BTCA 2CETA 2J7BA 1BYAA 2X2JA 3AJ7A 1HP5A 3EJSA 1O7DC 2WVVB 3D51A 2DSUA 1VFOA 3ZJ8A 1LWHA 2CNCA 3N11A 7CGTA 2DQXA 4RL3A 3BSGA 1FHDA 2J62A 2WMGA 3K46A 4HP5A 1QHOA 2VI0A 2WKGA 1E71M 2CBUA 5HXMA 3UG5A 1ZJBA 2YL6A 3VD9A 3RJYA 3IJ7A 2VT0A 4PBGA 1U33A 4UFLA 2YDQA 2WVVA 4UTFA 1G0CA 5IFPA 4QCFA 1HX0A 1DWIM 1JYNA 4M8UA 2VZSA 4GINA 4W8BA 1V6YA 4Y7EA 5I78A 1V3KA 1I1WA 3CBWA 2VJXA 3QHMA 1XD1A 1W32A 4AISA 3KLKA 3UCQA 3SCRA 2DH2A 3UETA 4PTMA 1V08A 3BAIA 1V3MA 2XIIA 5A6SA 2WW5A 1Q6CA 1OM0A 3ARPA 2BFGA 2JFEX 1CXKA 4HOXA 3CZSA 3GZAA 3WD3A 2GK1B 2PF0A 2YKKA 3WY2A 3K4DA 1R47A 3AZSA 4CCEA 5E6YA 1B3WA 1W1VA 3EDEA 3KLLA 3F4VA 1UOKA 4MNKA 3CPUA 3TA9A 1DWHM 1QI0A 2A3EA 2IUZA 5FL1A 4UFJA 3W0KA 3ARRA 2W63A 4EAMA 3L4YA 1IZJA 1V02E 3WH6A 1HVXA 1UWSA 1XD0A 4OGZA 3UERA 1RP9A 4FNTA 2G4FA 1HXKA 1D3CA 1PIFA 1CZ1A 4RE4A 3SUVA 2CBVA 4Z2HA 1JZ8A 1FH8A 2ZUSA 1W3KA 4TXEA 3OIHA 1WO2A 3FW6A 1M04A 4PMRA 3RM8A 1QNOA 1PAMA 1GNXA 1UYQA 4FF5A 1JAKA 3U57A 2O9RA 3WDPP 3MO4A 1H2JA 4C7GA 2VZVA 2J7CA 1QWUA 1UZ4A 3K8LA 4BF7A 3LRLA 1I75A 3LPGA 1FHLA 1PBGA 1EH9A 4YHEA 4F9DA 1TG7A 2DT3A 4MAZA 3OG2A 2VQUA 5I24A 1ISZA 3AROA 2FH6A 4DM2A 3CUJA 3GXIA 4NRSA 1VB9A 3OGRA 4NF7A 1E6XM 3L4XA 3SUSA 5D8WA 4NZCA 4DM1A 1CGUA 4IPNB 2YIHA 1OGGA 1UZ1A 1CIUA 3DHPA 2BNJA 3SCWA 1JGIA 3L4VA 4UNIA 3CO4A 4XUYA 4OUEA 4DWSC 1ISXA 1W2PA 3FY1A 1HKJA 3WFLA 1SZNA 3ZM8A 2OW7A 1E5NA 4CCCA 3EDFA 4QAWA 1DEDA 4OKDA 2ZUTA 4GI8A 1H5VA 4B3KA 3M07A 4M82A 1L0PA 3BVVA 3LXBA 1WDRA 1R85A 5A2CA 1B9ZA 2DSVA 2D0FA 1UWTA 4YHGA 2BVYA 3WH8A 4EKJA 3VIHA 4UZSA 4JAWA 1V0MA 2OSYA 5I2UA 5BXRA 1LG1A 4B3LA 1E6NA 1UKQA 4WSKA 3T2QA 2WMJA 4XB3A 4ACZA 1V3IA 4E8DA 2AAAA 3D4YA 4FNPA 2QF8A 3VMNA 1KQZA 4W8LA 4PTXA 3CUFA 5EMYA 1OT1A 3WQ4A 3ZOAA 4H7VA 3WF2A 4HZ8A 4J7RA 1ITXA 4FK9A 4HOWA 1K9EA 1VEMA 2JE8A 4UR9A 4AC1X 2D3NA 1RP8A 2HISA 4D6EA 2NSXA 3KL3A 3KZSA 3EJUA 2E8YA 4GO8A 1W9BM 4CU6A 4MADA 2J47A 1AVAA 3RCNA 4W7VA 2YLLA 2C0HA 4MAVA 3PZNA 1UUQA 2VQTA 3ZMRA 4BQ4A 1C90A 2WC7A 2GJRA 1ZB5A 3RMEA 2CITA 1LL7A 2XVLA 2ZX8A 3W6LA 2J7EA 3H54A 5E0FA 4HMCA 5CPTA 4AD5A 1M03A 1HJQA 2A3AA 3ZIZA 1QW9A 3MUAA 4J27A 3WEOA 8CGTA 1E6SM 3OB8A 3WY1A 3SCUA 2XFRA 1V6VA 2C8NA 4W5UA 1J0IA 4CUCA 1N82A 3K4AA 2J78A 4TUFA 1G9HA 2YL5A 4AD1A 2E0PA 3HZ3A 3BVUA 1KR1A 4URIA 5M3WA 4DWSB 2D23A 2X09A 3BSHA 1C8QA 4FNUA 4HPGA 2VMFA 3IJ9A 1E73M 3GXTA 1Q4NX 4AYSA 4U5KA 4F66A 2G3MA 3K1DA 1V0KA 2XFFA 1NH6A 3F5KA 4W7UA 1H49A 3ALFA 4FLRA 4HZ6A 2B31A 2ZUNA 4NZJA 1BSIA 3BAKA 1W1TA 1NWSA 5CQ1A 2DT0A 2UY3A 1E55A 4P8UA 1H0GA 2WBKA 5CZKA 1XH1A 3LRKA 2V3GA 1UKTA 3ARWA 1UASA 1QHZA 1E4NA 2D1ZA 4UQCA 4W87A 2E3ZA 2E4TA 2DH3A 3HMCA 6A3HA 1GQKA 2DEPA 2EJ1A 4IM4A 2D3LA 5D9NA 1H11A 5AC5A 5JUVA 1UD4A 3KEHA 1GOWA 4MJ4A 3T0BA 5BXPA 4HU0A 1E0VA 3L4UA 1FA2A 3JUGA 5A8OA 4P7LA 3GNRA 3D4ZA 4UZUA 1W3JA 2W92A 5AYIA 1GHRA 5D4YA 4CD7A 4TVCA 2CXGA 5M03A 1KGUA 2BHZA 2J7FA 4ZXLA 2F61A 1IZKA 3RM9A 3WIJA 2VVNA 4M24A 4D6GA 1AMYA 1VIWA 4FNSA 2XGBA 3PZVA 2XN2A 1MQQA 2DIEA 2IXUA 4HMEA 2D24A 2ZUMA 1W9PA 4JHOA 1HKKA 3H55A 3VOCA 1MW0A 1V6WA 3TTYA 3AHTA 3U5UA 3EMCA 5FOOA 3VGBA 4JKMA 1P6WA 1NWRA 1MYRA 5FKYA 4J28A 3OZPA 5HBFA 5EB8A 5A2BA 1W2VA 3W26A 6TAAA 4KH2A 3PN8A 1UWRA 3FHQA 5FL0A 3M7SA 3WNMA 3RDKA 1MW2A 1ZJAA 2WZEA 3WL1A 4P8XA 1EGZA 1V03A 1W91A 2J75A 2FHBA 3N12A 1ZU8A 1KXHA 2E9LA 5LA1A 4QLJA 4X0VA 2CKSA 4OOZA 1E56A 5DF0A 3VX0A 4AEFA 2BY2A 4AZ5A 1NWTA 1UR8A 1ZBWA 3TTOA 1CGYA 2VURA 4XV0A 1CEOA 1JXJA 4DO5A 4B15A 2DSZA 1TR1A 1HL9A 3PTKA 5CJ5A 3POHA 1CXHA 2Y2WA 1PZ3A 4J3SA 2CKRA 3WQWA 1EDGA 2G3IA 3TONA 4BS0A 1JZ6A 4JZ5A 3VNYA 3VDAA 4W84A 4AZBA 1F4AA 1BG9A 2EAEA 5I0DA 3A5VA 2D22A 1QNPA 1CWYA 4UQ9A 3MMDA 1UKOA 3BAXA 4MTVA 3VIMA 5ABHA 3VPLA 1MQRA 4AYGA 3IK2A 2JF6A 2ZX7A 3BGAA 3GDBA 5HPOA 1IV8A 1GQIA 3WENA 4UQEA 1ZL1A 1EOKA 1MQPA 3EJQA 1HJUA 4QLKA 3BAWA 4BA0A 1GQLA 2YBUA 3WF1A 1E0XA 4H8HA 3BLKA 1ISYA 1HKMA 4W85A 5IHSA 1C7SA 1X6LA 2WMIB 2XJ7A 2NW0A 4LYPA 1UWQA 2OYKA 2D20A 4N0RA 1VFFA 4JKKA 2WZHA 4NX0A 4Z2KA 3WL0A 2VNCA 2ZUVA 3W24A 4GI6A 3AHXA 3KWXA 4U2YA 3WUBA 1GONA 2EADA 4AD2A 1JIBA 1JL8A 3PZUA 5A8PA 2FGZA 3MI6A 1C92A 1JYXA 2GJXB 3AHZA 3S5YA 2NT0A 3S6TA 1I1XA 1KB3A 2PB1A 3AICA 1HJXA 2XVGA 2XHYA 1UKPA 3TOPA 1G01A 2Y4SA 4E2OA 2G8ZA 3WUFA 3CMJA 3I3DA 2XIBA 4B9ZA 2VX7A 3FHAA 2VUYA 2PBGA 1B90A 2J7HA 2GJXA 4ZFMA 1EDQA 2CYGA 2XUCA 5GNYA 1MXDA 1BHGA 1HWWA 2AOSA 1FP8A 4PYSA 4UOJA 1PIGA 1TCMA 2XVKA 3VGDA 4CVUA 3KL0A 4OJYA 5CLTA 1QX1A 2V3DA 1D7FA 3U5YA 3AFBA 2RGLA 2D73A 3VSVA 2EACA 2J4GA 3AXIA 1GPFA 1JNEA 5CSYA 4GXPA 1GOOA 4UQBA 3F5LA 3GXPA 4X9YA 1MW3A 3VO0A 2W91A 1GUVA 5FD0A 4Z2LA 4GIAA 3M6DA 3CUHA 3RILA 1XH0A 4LPCA 5A6BA 3VSUA 2OYLA 1VRXA 1MXGA 3VIIA 1AQ0A 3AMDA 1O6IA 4AZHA 1V3JA 1CGVA 1EO7A 2F1AA 3VD7A 2TAAA 3AIBA 1NOUA 1MWOA 1AQMA 5A8MA 4S3KA 3BVWA 2J7DA 2BY3A 4C7DA 4ATDA 5FIPA 4DWSD 4LGXA 3H53A 2PWDA 3WDQA 3ZO9A 4UOQA 3WY4A 4NXKA 1EQPA 1UR4A 4DO6A 4HA3A 3WEMA 1UD5A 1OCQA 1DWAM 1W3LA 5AC4A 1JD9A 3CZNA 4RE2A 1DP0A 3ZSSA 3EJTA 3CTTA 1XSKA 3PZOA 5JBEA 1L8NA 1OGBA 3PZIA 4FLOA 3BAYA 3FAWA 1Q6GA 3LPPA 2XG9A 1V0LA 3BUBA 1QPKA 3CHFA 2OWXA 3MMUA 5CLWA 2W61A 5I6SA 5IHRA 2BXYA 3WDHA 1CTNA 5DT7A 3TP4A 5A2AA 1KWKA 2CERA 2WCGA 2ZX9A 3LPOA 4KGLA 5GPRA 4D1IA 1XV8A 1VJZA 3SCNA 4PMQA 1BYDA 1TQVA 1WCGA 5KZ6A 5FCZA 3EJRA 5IFTA 4AZCB 4OOUA 1WP6A 4AW7A 1QHPA 4H41A 3SCVA 4KWUA 1HN1A 1MFVA 1XRVA 1XSJA 4Q7NA 4QDMA 1BLIA 3AZRA 3IJ8A 3FN9A 3CC1A 1EDTA 1BG4A 4FNQA 1VEOA 4AMWA 4IUGA 2FYVA 2BY0A 2VCCA 6CGTA 4J3TA 5GNXA 2GDVA 5HNNA 4W5ZA 1GJUA 1TQSA 2PC8A 4X0NA 4XX6A 5D9PA 1VEPA 4JFUA 4R5EA 4AZCA 4MB4A 3DDGA 1LQ0A 2BY1A 4WSJA 2WCSA 3WMCA 3MV01 1ZS2A 4MNMA 1UWUA 1CXIA 1KFWA 1FH9A 2F8QA 2XSBA 1DWJM 1R86A 3G6MA 5CSUA 3DYOA 3CH9A 2JALA 3WF0A 4LXFA 1CGXA 5E6ZA 3GH4A 1JZ5A 3BLPX 3L2MA 4D6JA 1XGZA 2X05A 1CGTA 3VGHA 4YPJA 3BXWA 4S3JA 2UY5A 4AD3A 3NIYA 1LWJA 2YLAA 3HG5A 3ARYA 5BRPA 2ZIDA 4WJXA 3LXAA 1ZBVA 5A6LA 7TAAA 3SUWA 1DWGM 4FNRA 2ZOXA 5A6AA 4GZJA 3EDJA 1FFQA 2VRQA 5HOSA 3MANA 3HU7A 4ACZB 5A95A 3ZJ7A 4BQ3A 2WHKA 3VILA 4GPNA 1R8LA 2ZX5A 3VGGA 4UOZA 4D6CA 1WE5A 3AS1A 3L4ZA 4U31A 4M81A 1JYVA 1FFRA 3VINA 3DX1A 2XM1A 2CBJA 3GXFA 4OIFA 5I77A 5JIWA 4QCEA 3VDCA 3PTQA 2BVDA 3EDDA 1B0IA 3UR8A 1DHKA 2WHMA 3VTRA 4PEEA 4PRWA 4NXSA 1BVZA 4FLQA 2WWDA 1E5JA 5BCAA 1GQJA 2OW6A 1U2YA 4JL2A 1EXPA 2J8GA 1J0HA 3WF4A 5A6MA 3T2OA 4MB1A 1E3XA 1AQHA 1QNRA 3N9KA 4J3WA 4NI3A 2XN0A 3ARZA 2WSPA 1IT0A 3AIUA 1JI1A 1YQ2A 1J0ZA 5EFFA 1HJSA 2F1BA 3ZSTA 3WBEA 5EFDA 1QBAA 3OLDA 3AYSA 4TX6A 4WLCA 4AD0A 2F7PA 1KXQA 4JIEA 3RPMA 1HKIA 2GJPA 1TMQA 4HOZA 4KGJA 4A3HA 1LF1A 2F7QA 1UQZA 4MB5A 1TA3A 4PMNA 2E9MA 1E9LA 4AMCA 3NSNA 4AIOA 4XZBA 3WD1A 1FP9A 2WNWA 1E70M 3DYPA 1UR1A 4EK7A 1TVNA 3HJEA 4QP0A 4HMDA 3MMWA 5DO8A 4CN6A 1PS3A 2VRJA 3CHEA 3HG4A 3AMCA 4PSPA 2XN1A 1K9TA 3UG3A 3CZEA 3SEPA 1Q6DA 1RPKA 1XYZA 1KBKA 4TTGA 3AYRA 4EE9A 4TTUA 3ALGA 3WDRA 4HPHA 3AIVA 3B9AA 3APGA 4JKLA 3VD4A 3AHVA 4HA1A 5LA2A 5ABGA 4E4PA 1JFXA 1HJWA 1KTBA 3CGTA 1M01A 5C70A 1D2KA 1B3VA 2PI6A 1X1NA 5A3HA 2PWFA 4DUXA 1XYFA 4CD6A 5CPSA 2NT1A 1CPUA 4LQ1A 1KXVA 1CECA 1ESWA 3K8KA 1CGWA 1J12A 1US2A 3CZKA 3OGVA 5ABEA 1VFMA 3GXDA 1LL6A 4MDPA 1VBRA 3N13A 1CBGA 1PX8A 1VJSA 2F7OA 2W4XA 4R27A 1C3FA 3VIKA 4UQDA 1UWIA 3AIQA 3D50A 4PTVA 1UA7A 4BQ2A 2WLYA 4HA4A 4D71A 2WVTA 1BAGA 1ISVA 4KRTA 1OWQA 1OIFA 2UY2A 5CG0A 2XYLA 1JF6A 1H4PA 3AHYA 2FE0A 1H41A
chains in the Genus database with same CATH superfamily
3FTYA 3GHBH 5DXWA 1I7ZB 2QDGA 2NNFA 5I6XC 3SCOA 1ED3A 2AMXA 2IOIA 1LXMA 3FJLA 2AGJH 3QUKB 2F1EA 3S3DB 2IANE 3KPNA 4OBRA 3BT2L 1WNOA 1BTMA 1XW8A 3QJUB 4GYJA 3C5QA 4XVJL 4B50A 3BT0A 4KH9A 4L8BB 1MAML 1ACXA 4AF0B 3D3VA 1RKRA 4QRAA 4NDMB 1QOXA 2I60L 5FEWA 3F7VA 3P9LA 1I1AB 4N68A 4DN4L 3HMWL 3P7YA 4AE1A 4YYFA 4BRVA 3GG8A 1V8HA 4QX4A 3TIEB 1CJYA 3SUTA 3O3BA 4X80H 1EX0A 2J13A 1LO0L 2B59B 1RULH 2GWNA 3QIWA 3VGEA 4NGHL 1T3FB 4F5CE 4AC2A 3I3EA 3JVAA 1IGJB 4JFDD 1RJQA 4AV4A 2ZICA 4DZBB 1TNNA 2DQDL 1W8EA 5C0ND 4G9DB 4JG5A 1VBUA 2AQSA 1K8IB 3V8CA 5DMIH 1A5CA 5B1JA 4PMXA 1ZIBA 4RPPA 1DCEA 1ZWIB 1DJHA 1Z8AA 4FI6A 3KLAA 1WRFA 3INUH 4DP2X 5FYJL 4MAYB 5LNVA 1HHGB 2CUAA 1VFHA 3LV6A 4XMUA 5CWSA 5AB3A 4ZXBA 5IOBA 1FNSL 2M26A 5E9DB 1KGWA 3VFPA 5HHPA 5E94B 3P3SA 6FABH 1DZ0A 4OCWL 3FU8A 3MNVB 4KC3B 5L4IA 1CNVA 4HEMA 4NZFA 2UZXB 4ZENA 1FAIH 3DC0A 3NZ8B 3S5OA 5DCEA 2ZUUA 5D5ME 3R0UA 4TUKH 4CD8A 1JG9A 5HJLA 4PCKA 1IIIA 5DZNA 3SE8H 5EU3B 2CLRB 4HKBB 1E8WA 3QO1A 1WFTA 5AOLA 5L2KE 1SY6A 3VRJB 3II1A 3QNXB 2E75C 4LVHC 5CO1A 1E4LA 3V0JA 4IIBA 2BHYA 2BMKB 5HWJA 2C9AA 3KHOA 4GY7A 3CFDA 4XVTL 4N85A 2JB6B 2BRRL 5DRWB 1V10A 5I1AB 1D5BB 5TE7L 2CDEB 1G6RL 1E1FA 5MEPA 5BJTA 4KY1L 2WWMD 2SFPA 3TL5A 2ALAA 4D6DA 4I77L 3DV6A 3A6CH 3HG0A 2OJEB 2F68X 1LBMA 4XO7A 3APMA 1OZMA 2Z1VA 3KOFA 3B2UC 3CXOA 1F5ZA 1NWOA 4J8QA 3KDOA 3QGVA 4XPGL 3X1NA 4IPIA 3SE3A 4Y9GA 5AB9A 1F8IA 4F9JA 5AW2B 3MLWL 4X7EC 4PTUA 3JUZA 4ZNEA 3SFKA 3D52A 4JFQA 1RMFH 2QIIA 2OWWA 3BC9A 3IMUA 4W70A 3ZWTA 3PS6A 3RB5A 2IH8A 5F9OL 3BUYB 4BJLA 3VA6A 3EGXB 3HF3A 3OG6B 3C8KB 3FTZA 2CJUH 3THUA 1FDLH 5HYFA 4YVXA 4FIRA 5AW8B 3PGFL 2X1IA 2CLFA 4JFYB 2Z2AA 1D9KB 3DXAD 2P9RA 4B9KC 1MJ8L 3WH5A 1CDBA 4PRTA 1KELH 2DQJL 2ED7A 1G9NH 3V4PL 5BS0A 1L7IL 4NC1E 3W38A 4HISA 2YSWA 3HM7A 4S3AA 1RK1B 1EYWA 3E0GA 4O15A 2WQSA 2R83A 1BREA 1FTXA 1XM3A 3U30B 4YSDA 2VE6B 1ZXQA 2QJHA 3PBUA 4KX8A 4UM8A 4KPHL 4H9VA 1TZ7A 3IWPA 3NSXA 4AVFA 2WMHA 1Z9LA 4PJEE 1TJMA 1JI2A 1U8NB 1WD8A 2HFEB 4HKZB 5HY9B 3IJDA 1OZQA 3EFOB 1XLGA 1BQLH 5F7NC 3CFJB 2ZA3A 5KUMA 2DJXA 3WJXA 2L7QA 3L3OC 4GIOA 4XO3A 3JUYA 1IT9L 1ECEA 1AYOA 4MNGB 3RJXA 4ROPA 5CHNB 4QTIH 5EBWA 1TVPA 1J0JA 4PMDA 4WKAA 3CXFA 3AZTA 4LSSH 3UT0A 2DI9A 2FQGA 1VHNA 5C9XA 1T20A 1CK0H 3DV4A 3GNML 4M7ZC 3DPBA 2WNXA 4A8IA 1O5XA 2OLSA 2BVTA 3OR6A 2TSBA 1I3UA 1I8IA 3BESR 3QJXA 2J6EA 2EDJA 2B0SL 3JZUA 4UMGA 4DPAX 3W28A 4GMTL 2A83A 1ZP4A 4LV4A 2LLNA 3II3A 4FOMA 1NDYA 1RQHA 3BSZL 2VDQB 4Z9KB 4CDHA 4DZHA 5LHEA 3CHCA 4XNDA 2XPGB 3OP2A 1U91A 3GMPB 4JQ4A 4XXCA 1OG6A 1WZKA 4Q8UA 1GC1C 4HUVB 1XG4A 3LH2H 4L1LA 4U1KB 2ZVIA 4WRHA 1MIEL 3IN0A 4AVKA 4X7TA 4MZ2A 3OKDB 1BJ1H 4ZQPA 2Z35A 3BO8A 1EGJL 1JZ2A 4KTDH 1GIGL 3BP6B 4WD0A 5JOFA 4FE9A 4NQCD 4IU3A 1I2PA 3ESUF 5CEZE 1XLLA 5HNRA 1L0YA 2YR3A 1UWEH 4LCSA 3EF4A 2DJMA 4QAIA 3CAKA 1LP9A 2YLHA 3SQBB 3W7GA 4AVIA 1EBPA 3IANA 3HMXH 1JGDB 4P48A 4ML4A 3MHUA 1U6AH 2Z4TA 4XNXL 1Q9OB 5KVEL 3MNWA 1EFXA 4NHUB 2DQWA 2DY3A 4QRNA 3L1OH 5H8DA 3UR7A 2ENJA 2XKNA 4C56E 4F80A 3W2JA 2CLHA 1NANH 3R6IA 3B5GA 1VADB 3C0SA 1ZPLA 4HAGA 3H12A 5IQ9B 3WE1A 4OKVA 5D1ZI 4B9YA 4X5RA 3I6GA 4C6LA 3HS0C 2V67A 3AIEA 1XGTA 4DJEC 5I0VA 3JWDC 2EBNA 2IBZY 4LU5L 5BVPL 5I2IB 1GCYA 3WFCL 3CK0L 3EZ8A 3GRBA 3BE1L 1MRAA 3CDYA 4Z7NF 5DX7A 4L4TB 3TNMB 2P28B 1R2SA 4FIQA 2C13A 4BBWA 5PAZA 1E43A 2O5NA 1F4HA 2VC6A 1AL8A 5KSBA 4IFKB 3U2EA 3ATFA 3WNKA 5J1AA 4G2AA 3VWKA 2E68A 3O3EB 1FDZA 1ORQA 3BJLA 4D6FA 2O5XH 5F96H 3NOEA 4YHKL 1IX2A 4OCXH 3TLLA 2VI0A 2EDNA 4YHLL 1NEPA 1ZJBA 4MKSA 4LLVA 3E0VA 3H7LA 2AXGB 1DWIM 4KX9A 4Z7QB 4YZFE 3AWNA 3MCOA 4M8UA 4KDTC 3RYMA 4XX5A 3ITXA 3WO8A 4KTEL 5GISL 1W32A 3R0KA 5SWZE 3GC3A 4Y9AA 4Y8FA 5IRPA 1WQVT 1WA3A 1CXKA 1KJVB 2ICSA 1IM3A 1UIOA 3WY2A 1R3WA 1PE1A 2W63A 2DBLH 4H9TA 2NQ9A 1IL1B 3HNVL 4LCCA 3MBWB 3MLTA 4JHWH 3UJFA 4FABL 4Z2HA 1FLTX 4LGSB 2O4EA 2G2RB 1GNXA 3ZKMD 3U57A 4JX6A 2XIDA 3MC5A 3MP4A 4HPYH 4G5AA 4AQ8C 1DQIA 4B9FA 5ID1A 2CDGA 4UB0L 4NZRL 4ONVA 1YLVA 5JPMA 3Q1SL 4NF7A 4NKIL 4QE5A 3L4XA 4NZCA 3P93A 3A13A 3DSNB 1EHLH 4MJHA 4Y2DA 4JB9H 1F6AB 3IYLW 2EGZA 2Z8SA 4I3SL 3AT9A 4GI8A 3PYCA 3LXBA 3OXRB 3F12A 3PBWA 1IFGA 4XVDA 2Y36H 4GJIA 3W74A 4ZFCA 1JFQH 2OSYA 3VFTB 3NSFA 2GOKA 1HXMB 3DFSA 5J5RA 1TCRB 3VRIA 4HZ8A 3CG8A 5DQPA 5CJXA 5M94B 2QPEB 1BQKA 4RFEB 2V33A 5CIPA 4O02B 1N18A 4XMTA 1KNOA 4BQ4A 2P44B 2G9HB 2AQWA 4Z7WA 1HO4A 1I7UA 1XLHA 3VFLA 1Z9SB 2HH0L 2J7EA 2QR6A 4NJJA 4Y8EA 3T77A 3NEXA 2F19H 4HMCA 1DBKH 4QHNB 1JK9A 2JF1A 5EIIB 3N41B 2YSSB 1ONEA 4AEIL 4WRLA 3MO1A 1PCXA 1E6SM 5FDYA 2C8NA 1YECL 3UNDA 1N82A 5JOPE 3QI9A 5SV3A 1N8IA 1YAZA 2CKBH 4URIA 4C4KT 4PS3A 4MD0A 2CO7B 1DVJA 4ELME 4RK8A 4U5KA 1AGCB 1E30A 1VR6A 4Z08A 4Z95L 2X53A 3TMLA 3UBPC 3M5ZA 1HUVA 3L3KB 4NILA 1DO5A 2P76A 4OFDA 2RJHA 1S2CA 1K72A 3B3IA 2WSRA 1ZANH 4GY4A 3WKMH 4LEOB 1A1NB 4AQOA 1FGVL 1UD4A 4EF3A 5E99L 3IXTA 5LB1A 5I1DA 1AW2A 4HX1B 5JORA 1GYCA 5D4YA 1J8HE 1F3DH 1FVEA 1EP1A 4LCWE 4ZI8A 1HSAA 2B1AH 3TXZA 2QFRA 4O0ZA 1U92A 5JW4M 1PCWA 3WHE1 3QFEA 4FFTA 1R9ZA 2CLEA 1U5HA 3KBWA 3FVMA 3VOCA 4TMPA 3W7IA 3OHXA 2ZZ1A 4TO8A 3EHBB 4QRPE 4NAQA 4PV9B 5C0CA 3WNMA 3DOHA 3QB7C 1BFTA 1ZJAA 2Y69B 3SCMC 1V03A 1G67A 2VXVH 2P24B 2BZNA 3RX8A 3A3YB 1VIZA 5LA1A 3EWXA 3TEWA 4X0VA 4PJAF 2WLLB 5EBMA 1OP3K 5H37H 4UIMB 2EUVA 4KO5A 2VDNB 2VURA 3U9PL 1VGAA 5BZZA 4M43H 1TJHH 4U1SB 4NQDE 3P74A 1Q1PA 2CKRA 3GO2A 4APXA 2IWGA 4JZ5A 2Q1EA 4NPYA 4QHRA 5E2VL 3C08H 1BYOA 4KHXL 1WG3A 3EWUA 3MMDA 3VIMA 4ZDHB 3LV3A 3SODB 3GR4A 3GDBA 3P0YH 4CVXB 2PURA 3WENA 3LIUA 3BPNB 2NNRA 1YEJL 3SSJA 1YJDL 1A5LC 2PF8A 1KBGL 4NQXA 1U2HA 5FGBA 4LF2A 2E9GA 5KUKA 4FQXA 1FNLA 1K5NB 4IQHA 3CT2A 1OXYA 2VLRD 3GVRA 3M0YA 1GONA 3PREA 4FPSA 4UMBA 3QH3A 3AHZA 4ERSH 5KVDH 4D8AA 5E7FA 1ADQH 3GK8H 4HHAB 3B2UD 1U9KA 3CNYA 4OZHA 4H20L 3MYJA 4B9ZA 2VX7A 3OKNA 3O4LA 2BP5M 5HMDA 2CYGA 1P5UB 1YE6A 3LLFA 2YGOA 2WKJA 3MRPB 1G1KA 4M4RB 3QXDA 2WZPD 3N14A 2EH8L 4WI0B 1KYOK 1PIGA 3D34A 3VGDA 3GIPA 3C2RA 4Z5RB 5FYKD 1KBJA 3P02A 2J4GA 2CIIA 4BK5A 5IF0A 1VJIA 4PLKC 1WUNT 3F65A 5HR6A 3PP3K 4P3WA 1FG2A 3DIFA 1S3HA 1HDMA 3EWBX 1V3JA 4GRLD 1EO7A 3HN8A 3WLKX 5GXBB 1FWRA 4JQXC 5F1NB 4NQSA 1OYCA 2LU7A 1KJ2B 4B9GA 3QZ6A 3SDCC 2EYTB 4PAZA 4F0MA 1F4XH 1LEGA 3T1WA 3EJTA 5C6WH 1WCBB 3RFRA 2VXUL 1QPKA 3P30L 4G70B 5C2XA 4CNSA 1P0DA 4GVIA 1SQ7A 3FFCD 4YCPA 3LPOA 1XV8A 4TR9A 3M8OL 3TFXA 1SUXA 1WYIA 1WCGA 3K6DA 5KZ6A 4NAEA 5IFTA 2E86A 4QDMA 3P0XA 1JV2A 3DUSB 5CLZA 3N3TA 4HAFA 4L1DA 2YPLB 4D3CH 3DHFA 1TRIA 1GJUA 2C14A 3D18A 3NP3A 4NWUH 2Y1YA 1BD2B 3NZQA 1JGUH 3SBWA 2WCSA 1ZS2A 1OCNA 1BXVA 4FP8H 3NCFB 4PCPA 3U7YL 1UACL 1CD1B 4AQ1B 5EZPA 3VYNA 5HYJA 1SYSB 4F37K 3MCYA 4TVSa 5DK3A 1T04A 4YPJA 1DVQA 4G9FD 1AJ7L 3GLEA 5TBOA 1CI3M 2AEQL 2E4FA 2EDTA 4E41D 4WNSA 4Q6IC 1JUFB 5K69A 4CADA 3VGGA 4R7NA 4XTRD 5GSVB 4GE8A 4M8VA 3BSMA 2E28A 5BU9A 5I77A 3SO3B 5EOCL 2VJ0A 4K1WA 4XZLX 2R4RH 4NZ5A 1UVQB 2Y7QA 3QJTB 2OU4A 2G50A 3VOIA 1FL5A 1A4JB 2VMCA 5I75C 1BBJB 3N9KA 3ARZA 4WUKH 4JW3A 1MEWA 4NNYB 3WHXB 5FYLE 2B4CH 5EFFA 1HJSA 1A50A 2OKMA 4IQEA 3UJJH 4J6IA 4QXUH 4WY0F 5EFDA 3LJ3A 1YQVL 2JXMA 1L2UA 3PPSA 1E9IA 4S39A 3RPMA 3R58A 3E2HC 2A6IB 5IB4B 3RGVC 4JFHD 2WXMA 2AQ3A 2ICEB 5LCVL 4L29A 3OZYA 1E70M 2JJTA 5FLVA 1O6VA 4MCZB 4AYBA 1DN0B 2E59A 1AH1A 3T42A 4WNJA 2AQTA 1OAKL 1ZHLA 3T5WA 4QG8A 4EKXA 5FB8A 2BIMA 4DK6A 2G0KA 2Z64C 3KRZA 1BYPA 5I16B 2CWXA 4Z7UE 2HN7A 4XD3A 4IX0A 1VF5C 4JFPB 4O11A 1GZQA 4U6VL 4I9AA 3P9MA 3ZL1A 1QUNB 1HJWA 1AFVL 5HGDB 4YMZA 3T78A 3VFMA 3JWNG 4LPWA 4O2FB 3SN0A 4QF1B 1SU5A 4LBRA 1BIIA 2OMZA 3QNZA 3MV7A 5BW7C 1CBGA 4DTGH 4PRHA 5CC6A 2W4XA 3HUJA 4W6YB 3QJFB 5KSWA 5D2NA 1SOKA 4BD4A 3IDJB 2R9HD 3C5ZC 2V63A 3SZ8A 5JZ7C 2UY2A 2KYIA 5F6HI 3D6NA 5JH2A 2A1YA 2V38A 3IVTA 3OIXA 4DJED 2AV1B 5IWLC 1U8CA 2UY4A 3HQPA 1KLUB 4QBXA 1OWWA 5EG6C 2YQ3A 3V4LA 3BUPA 4FZ8H 1GMIA 3C6LC 2ZXEB 2E25A 5LHFA 3L54A 3AAZA 2MH4A 5IFHH 4CNNA 2RFXA 3K1GA 4WGHA 2YL8A 3REQB 3UO1L 1S9WA 3KPTA 3ZKQD 4LVDA 3T0ED 3PWPE 2R69L 3Q0HA 3G04A 3HCVA 3INPA 1EO8H 4HT3A 2GJ6A 4Y8AA 4UF7C 3LQZA 2EDKA 1KXTA 3WN5C 1ZNNA 1OAZH 4KEMA 1E67A 4P2RB 4Z1PA 2ZSWB 1CLOL 4HXBH 4JG1H 3GFXA 2IH9A 3LVTA 4QIRA 2JKIS 1H5BA 3SCPA 3FQNA 4L1XA 1Z7AA 4UIKL 3CVDA 3TH2T 1OHZA 3STLA 4GUHA 3ULAB 1CMOA 3I7SA 3TK7A 4PJHF 4ZUVB 1RPQA 2JQMA 4QKXB 3KZ8A 3DHUA 1A2YA 2XV6B 4PTWA 3HPZA 2GITB 2YAPA 2Y5JA 2J8FA 1U8LB 2DT1A 2X0HA 4L9XA 1N26A 1WEJH 4H9UA 1UJPA 4CW1A 2GSEA 5FF6B 2I5YH 5ADPL 5B80A 2WBGA 2F54E 5AW5B 3VGAB 2X1RA 3VXTB 1RBAA 1QOKA 1UB5A 3UAJD 2FLRT 2RAMA 2FVKA 4BJHA 2VKXA 4PGBA 4O4WA 5GGQL 4V27A 4PPTA 1DQLH 4S1QL 1VH7A 2P0OA 4MNQA 1M6JA 2BGSA 1BPVA 1A6TA 4CCDA 4XPHH 3V9EA 1ROWA 1FX6A 1SLVA 4CQCA 2Z6IA 1MFBH 1MRFH 2NSOA 4MZYA 3DX3A 4ELKB 4O58L 3O3DA 4PJGF 3AXXA 4JFEB 4AC7C 3C09B 3I50L 5IESL 3IAGC 3QK0A 1E6OL 2KDYA 3EWWA 4DZ8B 3ZR4A 4O0KA 4J40A 2V5YA 3OLIA 1NGWB 1KB5H 1K9FA 1UP3A 2ZF9A 2VN4A 3GI9L 1TREA 2AANA 3PHSA 4DPPA 5IROC 2QJMA 4XCYB 1HL8A 3F7QA 5J13B 3AUOA 1XT5A 4IPLA 1ET7A 4XH2B 1F58L 2EEAA 1C12B 2A6DA 4JHZA 4D7BA 3BP4A 5E03A 4J3ZA 4F92B 3QORB 4KROD 1ZLDA 3M47A 4I0PB 3GXNA 1Q6OA 3Q13A 4N2BA 3IUHA 4G43B 4TOQA 1LE9A 3H4GA 4KZEL 4O4VA 5H2ZA 2JIXB 3TJHC 3MV9E 2Y62A 2WHJA 4V1DD 4A6GA 3KGRA 1A5BA 4K5LA 4C6KA 3ARQA 3WMSA 4I2XE 4YDLB 1IM9D 2BS9A 1V0NA 5C0BA 1DBBH 1OCWL 2NX5A 4WK0B 3LKNB 5ENWB 2A3CA 2Q3OA 4JM2B 4GRSA 4Z7VB 5TQ2H 3BE7A 3CQJA 3WQFA 3LLDA 5GJPA 2UZYA 5JQ6H 3TJEL 1EAOA 5I71C 3CDZB 2FL5A 3JV6A 1N9PA 4ZTOH 4KDWA 4E0RA 1CFTB 5GGTH 4IGBB 1A6ZB 1J0YA 2VW4A 4WF7A 3GK0A 1E9OA 3BQUA 3EA1A 2EH7L 1MFDL 2XVNA 2VR4A 3BHBB 5KG9B 4TOYL 1AS7A 2WXOA 1N8FA 4XZ4A 3IJEB 5CGYD 4PW9A 3QEUA 1P7QD 5FOBA 2WYSA 3SKNA 5JNYB 4W88A 1XZWA 5C0EA 2LT9A 3B0PA 1VBHA 1B4KA 3T40A 2CBQA 3A6OA 3SCMD 5SWSD 3BVDB 2GJLA 1FWAC 1Z9MA 4RCAA 2OLDA 3DAQA 1LORA 4A8NA 3RY4A 2G5BB 3ZLFA 1TUXA 3C60B 1PKQB 3HQOA 3RWDB 4JKNA 5J12C 2PW1A 4M7LH 4IQLA 3TN6A 2LR4A 1HW6A 3L3GB 3NIFB 4AWEA 1JZHA 1OCOB 3QQNA 2IAMB 3MV11 3AT8A 3KPQB 5K9DA 4PJ7E 1NOFA 5I6MA 5ABTA 3W88A 4DF2A 2AKZA 3QULB 3TVMC 4DNMA 4TXVB 5L9DH 1UZ8B 2XN9E 2AJSL 4IG2A 3IIZA 3NJLA 1DE6A 2BDNL 2A6JB 3QIWC 4KDVA 3L9RA 5KVGE 1LLWA 2DTSA 4F2EA 3V6BR 5H1WA 3P0WA 2R29A 1DZBA 3HE6A 2MJWA 3CFEB 4WR3A 1R46A 1DQXA 4KI5D 3VFSA 4N90D 3BZDA 2Q8BL 1KCVH 5E4OA 3GXMA 2Y8UA 4ECNA 5B1JC 4IHCA 2DOCA 1I8KA 1WDDA 1UM4H 3SPJA 3BP7B 5AYYA 2X2IA 3D9AL 4L64A 3MJ8B 4U1IB 4I18A 2X6AA 2C9VA 3L3HB 4B5XA 1WYJA 4LCUA 1JPFB 2RAGA 2AI0H 5H37A 1TFVA 3FRPB 1CFBA 1CD8A 4GAGH 5AB0A 2ZXQA 1QOPA 4ELDA 2PDNA 1M68A 3V1PA 1FYTB 1AW1A 3RRAA 4KCWA 2YEQA 5T1DL 4CEXC 4HK3J 5DD5H 4ZXBC 3VNKA 4QRTB 2AQRA 3S8WA 2BOFX 3TA3A 2ISSA 3T05A 4YVUA 3O9WA 4PLKD 5AC7A 3NAAL 3FJ6A 2UUDK 4XWGL 3WNJA 5LIYX 1CU4L 1NUFA 5F7EL 5BOFA 1V4YA 4X6BA 2VM8A 3DUHA 4Q4EA 3MGTA 3S48A 2GGJA 1GHFL 1NP2A 3WZ0E 3GEWB 3H6JA 1LCOA 3NG3A 4TLTA 3C5JA 2DUAA 2NY3D 1V55B 4YN5A 1CG9B 4Y16B 5C9ZA 4OZGE 4CKVX 1HTYA 1RBOB 2CIPA 5KEZA 2VDPL 4FLSA 2IWKA 2PO6B 3HBQA 4PJBB 5LDUA 2P8PA 3CD4A 1FORH 3OKLA 1KT2B 1DVFA 4FZIA 1NCAH 1HINH 1MPAH 5F9JA 1KLZA 2FVMA 1X4ZA 4DYEA 2VZ1A 2XICA 4OM1H 4U4IA 3WNOA 5IHWA 1A22B 3LQLA 3A4JA 3A64A 4BGDA 4NHVA 2NWSA 2V30A 3SE3C 3T2NL 1RUSA 3QQ4B 1UD6A 4W9IC 4J2PA 3ZGHA 1A0DA 1SW7A 2BWIA 4GXVL 4PRPA 3PJNA 1YEDB 3R06A 4WFGD 4AXKA 1X4YA 3CN4A 3VK5A 4K68A 3PXLA 2B5IC 1ZIAA 2YN3A 2F6AA 2R8WA 5DEZA 4ODBD 5E2TH 2OSLA 2R15A 5KS9B 2Q09A 4P2VA 5C8JB 3N2BA 4I7WA 1YDOA 3EJSA 1N0XL 4K7PL 2NUYA 5CP7B 1OF2B 3VABA 2GC7C 4C5YA 4WVRA 4JX5A 3QUML 2YL6A 3RJYA 3E8UL 4ETQA 4LO9A 4QCFA 3GFUA 1E28A 1T1WB 5TQ0L 4IMFA 3PUOA 4W8BA 4WOZA 1KFAL 1XDJA 4KK6C 3KPMB 4AYDC 1S5IH 5SV4A 1TO5A 5CG7A 2YW4A 3ROLA 4RKAA 1OM0A 4ZBCA 2NUPA 2E7HA 4LARL 2D3VA 4R3SA 1TIUA 1UGKA 1R47A 4K3EL 2E6AA 1BXNA 3EDEA 1QNIA 1AD9B 4KKXA 2QKSA 3P11H 2V2WA 3FX4A 1LLZA 2WWKT 5DLML 3IJYA 4KPLA 5ACZA 2LTQC 2G2NA 1KC7A 1AGFB 2VAAA 2BCKA 4N8VA 5E9DE 4WJ5B 3FO1B 2ESVA 3SUVA 3V5DA 3T4AB 3O15A 3OQRA 2C4FT 4XBGB 2AK1H 2VJ8A 4GGHA 2NDGA 3MO4A 1F8TH 3TH4T 3T9WA 2KLSA 3LPGA 2DT3A 1G7VA 1Z44A 4PJ9A 1OGAD 2NQCA 4NRSA 4PRIA 5ICXB 1T2QL 4NKDB 1UZ1A 5FJTA 2CHRA 3CO4A 3H9HA 4U1NB 1DQVA 1XB8A 2QZRA 3FCUB 4HU2A 5GGSY 3MOAH 3OGCB 3L5XH 1I7TA 2D7OA 5BUPA 3SE6A 3K2UL 3APNA 4PHZA 4ACZA 4E8DA 3HIZA 1DQJB 5F1IA 4L8CA 3D0CA 3NEVA 4OJFH 2HVKB 3U7WL 2G96A 4Q33A 4HGMA 2D3NA 4FQQA 2E8YA 1W9BM 3QPYA 4XXCC 1T0MB 3PZNA 1UUQA 1A4MA 1Y0EA 1U41A 3BKJH 4EVNA 1QLFA 1I60A 3D0VA 4WGWB 1A1OA 5E0FA 1HKLH 3BPOB 1YPIA 3ORWA 1M03A 4GBXA 1VFAB 3H0TA 3NABH 2BNRE 2Q6ZA 1CTOA 2YD5A 3FT3B 4IIQA 3DSFH 4RZBA 3N1GC 1TV5A 2YL5A 2BNQA 5LZLA 3EO9L 3BVUA 4JY4A 1UXWA 1JWUA 1N4XL 3BSHA 5K9QI 4YHPA 4F2BA 4RGOH 1XCTB 2QULA 2Y63A 4OCYH 4HWBH 4UCGA 3UAEA 3QUZC 3MA7B 1G7PB 2BP1A 1HESA 2IG2H 3RVVC 3OSVA 3QVQA 4KCVA 4HDIA 2IQDA 1RJRA 1E4NA 4GP8B 2C0AA 3HMCA 1NMBH 1OSPH 3LBMA 4MZ8A 1YY8A 3WS6A 2O30A 4YK4C 5DR5H 3V8OA 1Y5VA 5IJBC 4HEPA 3DA0A 4ADUA 3QXTA 5K9CA 3T6WA 5AYIA 4G82A 4GIYA 4XP9L 3FNKA 3L0GA 2V5TA 2WLIA 3DRQB 4N4PA 4LCQA 4JS3A 2JELL 1VIWA 3DG6A 3TN0B 4MA1B 4HSHA 3SB3A 2D24A 2BGNE 4JHOA 3PGDA 3SZ6A 1RCOB 1V6WA 5TFSL 1XKYA 1M1BA 2WBJB 4HZLB 1P4BH 5JIHA 3TYFA 3LTVA 3NSCA 1F00I 4TNWK 5A2BA 1JNNL 2FB4L 1MFCL 4OD2B 3M7SA 2DQUL 2RUSA 1C29A 4X8XA 4MNGE 4JZOB 5A6TC 4ZTXA 3MLSL 2YGNA 2V5SA 3FQUB 4IBSA 1QBLL 2R0ZH 5ANMB 4G7SB 5IFJA 1UB6A 3VWKC 4KKRA 1A4KA 1INEL 1QNZH 9RUBA 4M19A 3QWRD 1EPVA 2J3SA 3QHFH 2HXTA 7FABL 1FNEA 4YGVB 5BOZG 1IKOP 3CCHB 1PG7H 2OMYA 4H1LA 3V0DA 5GJNA 2VO8A 2BB0A 3A12A 4F48A 5BQ7B 2HT2D 2X4NA 3KPSA 1R5IB 5T3XE 2WMIB 4LSVL 3T6ZA 4XHJC 1PLGL 5J06A 4CNPA 2AJUH 3MBXH 3WL0A 4EIBA 3SZKC 3V5KB 5LBVA 4YXLH 2EADA 1VLIA 3QYCA 1JL8A 3MACH 3PZUA 3GBLA 5EOQL 1AKJD 3WJZA 3FTXA 2F6XA 3EKCA 2XVGA 2XHYA 1SUJA 1HXYA 3PHOA 4JUSA 4LCCC 2VUYA 2PBGA 2HK0A 4XPBH 2OO0A 4H25B 4F58H 2R0WL 1TJ0A 4GWEA 1S5WA 4PYSA 4W9CC 1TPXB 4FQCH 1L8PA 2XKUA 4X4YB 1UA6L 4FXGA 5A16B 2X1UA 1MHPL 3WLIA 3BH8B 5LAPA 1W72L 5JPMC 4Z2LA 4MWAC 1CTMA 5EO1A 2XU2A 3IMVA 3R8BB 3RILA 1XH0A 4RISL 4OGQC 4XUGA 1FE8H 4Y2DC 3QP3A 12E8H 2DI8A 1IUZA 1S9YA 2WZTA 1F0LA 1W5MA 3SGZA 5MHSD 1OX5A 4RMRA 1DWAM 4KRPC 4JNMA 2OXGB 2NYZA 3MRDB 4Y4KB 1BAFL 4GT7A 3FBKA 1V0LA 1L7TH 1CTNA 4S2BA 1IBGH 1QD0A 3TN4A 4GS7C 3NL6A 3EA3A 3IIPA 2ZCKL 4OOUA 5L0QC 1FP5A 2GUOB 5EZOL 3QDMD 4OZFB 1K3IA 3X14A 4IUGA 4XXDB 2R94A 5GNXA 1XGPB 3RKPA 3IE9A 4X0NA 5F6HJ 1N6UA 3B5TA 1ADSA 3DDGA 1LQ0A 3WUWB 3MRJA 1PZDA 5C08D 1S7VB 3HNTL 2PDKA 2A3TA 3W7JA 2OJPA 3M5YA 4HPXA 2D31B 4LXFA 1CGXA 4K2UL 5E6ZA 3L5HA 3U0PB 2ZQ0A 3GUGA 3ZE0F 4P3CH 1OTTC 3UTSA 5HULA 3FB7B 3U4FA 1ZBVA 1WC7B 1BQHB 3HAEH 4FHAA 3CVHL 3TVMD 3P54A 1XXDC 4IOSA 5J3HD 3JT0A 3L5WA 4BH8A 4HK5A 4H9MA 1AOHA 2WXFA 4ODHL 3E3QC 4LL9A 2HQAA 4GPVA 5DT1L 3L4ZA 3SADA 3QXAA 4Z7QE 4N02A 3I9IA 3G5XA 2UYLA 2WHMA 4B60A 2FIKB 2VERA 4QHPA 5F1VA 3F03K 3FRUA 4HLJA 3NIGF 1FO0L 2NNAB 3VXRB 4A2DA 2H8PA 2HUEA 4FHJA 3CSYA 4JY5H 4M1GH 4BZ1H 3WF4A 2VL5B 1AQHA 2QQLH 1CFQA 1JNLH 4MY9A 3UPAA 3ZSTA 1AS6A 3O07A 4XZUA 1GXEA 3OHXC 1Q45A 3QAZB 1N0LB 2O5YH 2EICA 2Y0SA 1QRNA 5D1XD 4NLAA 3MY9A 3I6LE 4C6NA 2CLKA 3SQLA 1VFTA 1TVNA 3HJEA 2A6KA 4HMDA 4WGXA 4DLFA 1PZSA 4AG4L 2QT3A 3MJMA 3CSFA 1N59B 1TT6A 5LWYL 2YOAA 4KHTH 1VS1A 2OXHB 4P57A 3B9AA 1ORSB 1E4KA 1A6AA 4HK0B 2X1WL 3W2LA 1GTHA 5A3HA 5B38B 4JIHA 1HS6A 1R3IH 4Q4MA 1MFAL 2AABL 1SZGA 4IJBA 4DELA 4ZYKA 4RXGA 1CGWA 5FGBC 4RH4A 4PJ8C 1VFMA 1KTDB 5AL0A 3JQOB 3RYSA 2WNNA 1PX8A 4FQXC 4UAOB 4R7LA 4F2FA 1ERNA 4G8IA 1ENUA 1C3FA 1AR1C 4LF1A 1NAL1 1ISVA 1YMMA 3K71A 5CSZA 5CG0A 1NC2B 3DUGA 1R3LA 5TF1L 3AHYA 2PDLA 2ZRYA 5C09A 2PWGA 4LASH 3GDRA 1MEXL 3R7MA 2ZAGA 1XF3B 1L6FA 4YZWA 5G5DB 2EEDA 5I09A 1OTUD 1GOMA 1GVRA 3MKKA 4RGND 5T1KD 4XOEA 2VCAA 4DP9X 5DFTA 4DUVA 3EYSH 4QHLB 3ETBJ 3W83A 3N42B 5AOJA 2CSPA 1G7MB 4E68A 4K38A 1YNTF 8RUCA 3BUIA 2P1YA 4BK5C 4DSYA 1N7KA 2NLYA 5TD4A 5CZVL 5K93A 3HN3A 2DDQL 4GI9A 2PPAA 4N3TA 3I9GL 4Z3GA 4KK8D 2R2CA 3AABA 4LX4A 5KITA 4K1GA 4RZCA 1CDHA 1TZIB 1E4IA 3UEZA 2R7EA 4HJJH 3KZPA 4UOW0 3B9DA 2IH3A 5AG8A 4P4KA 4XI5D 3N34A 2QCDA 3WL9B 1PY0A 3NUKA 5KW9L 3HEIB 3GJFK 2GVEA 1HNYA 1CFMA 5I1HL 4LY8A 1A47A 1RALA 4HQQH 4PVLA 3WSQH 4KK6D 4HK7A 3SIMA 2JJUA 3E96A 2X6CA 3O8XA 5JUEH 2W9MA 3ZXWA 3SDXF 2FJSA 1WGOA 3UZEA 1U93B 5I3FA 3VOHA 2CA4A 2CZEA 4TX8A 2R27A 2P5ED 5FM5O 1IGSA 1KDIA 5EU6B 5I3JA 3RWEA 4ZW5A 7REQB 1JDCA 4WFEE 3W27A 4DNLA 2DYPA 4MKMA 3SBWC 4JREB 4AI7A 3T65B 3QUXD 2FDMA 1SMDA 2OL3L 1MUWA 4HSNA 1QDSA 4WKHA 4RDQG 3E6FB 4AWTA 4GW4A 3MAWA 2I57A 1GMEA 2NY2C 4FA6A 3LKQB 2PP8A 3KR3H 1BGXH 2WLZA 3A21A 2PDYA 3EOTH 4CEUC 4Y4HA 2HG0A 1KPUB 2D2HA 3OLGA 1HGWA 2QSQA 3PWVA 3STFA 1DLHA 4N9OB 2J7GA 3FXIC 1RPUA 1V77A 2GTZB 4P7QA 1FLRL 1SDDB 3DK2A 4P3DA 1UUMA 1Q8MA 5FDWB 1RJYA 4D6HA 2NY5C 3FHEA 1GW0A 3KX6A 4P2CG 3UWZA 5KBPA 4G7QB 5T3ZD 3OPZL 3QV6A 2XSAA 4PWGA 5GRUL 4PJAA 4H04A 1KBBA 3VDHA 4YHOH 5IG7A 4BA8A 4DPRA 4KQ0A 1W1B1 2F7FA 2YL9A 5LN4A 4D9QD 2R2HA 3AB0C 2JQZA 3BOVA 3VYOA 3GMNA 1EMTL 3ELQA 5IK3A 3ARSA 5E0CA 5FV2A 1OOAA 1WBYA 4H8WH 4BY3A 4WV1C 4GSDL 4CMHB 4L8SB 3QTGA 3WAKA 2HJPA 4FXJA 4EF9A 3FUFA 2JJTC 4AY1A 3RLGA 2GK1A 2UZ9A 3BYYA 5F6IC 4JN2A 2XVPA 1XGYH 4ZFZA 5FYKU 3QE5A 3L2LA 5HHOA 4PP2B 4BR1A 2OMXB 1HL2A 4RGMC 4UM9D 3SECA 3OSKA 1N5YH 4CGUB 2YPVA 2DDXA 4FQ2H 4JL1A 3EJZC 3QUZD 3G5YB 2JIWA 1DUYB 3QUYA 4A7QA 4MD4B 1KG0B 5IVXB 1MHEA 3DRTA 4AMXA 4TSAL 4Q9QH 3BDKA 4AMAA 2HPIA 2BV9A 3CM4A 5C0GB 3Q9QA 3CL7A 4GP4B 3WXVH 4ODTL 3GE7A 1GQNA 3MX0A 1YE4A 3H6OA 1W8NA 5G1MA 2O92A 1MVUB 4WHTA 1QWNA 4X6DE 5DJ0A 1IAIM 5D2NC 5IB2B 2HRLA 3H2EA 4PH8A 1U42A 3HE7D 2XWRA 3HC3L 2B7DT 5JTWA 1NTHA 1JXGA 5E6RB 4JN8A 4CQBA 3W00A 3N25A 5IM7A 4X42A 3RURA 2WVUA 4C6MA 3QJQB 3VSQA 1H62A 4K39A 1AP2B 5ECUA 2YPLE 3Q3GA 5CM1A 4LW7A 5I82A 1X5YA 4ALAC 4N9DA 4MNLA 3PJWA 3S37X 3WXWH 4IBZA 1AJ2A 2D8KA 1L9TA 4WO0A 2VLKD 1NF0A 4FRWA 4UT9A 3F64A 4XC1H 2WK2A 2HMCA 2F2HA 4GQ9H 4DPCX 1F3EA 5EORL 1YVLA 4XXWA 2FYYA 2H1PH 3GTVA 3CV6A 2MPAH 1S8DA 5FOJA 3PJSA 3RO8A 2PYFA 2N59A 2IGFH 5DS8A 3TBVB 4LFYA 5DUBA 4Z2IA 4U1GC 2OSXA 2IC2A 3H2NA 5HGGS 1WAAF 1U1JA 3UTTD 3VD3A 3VU2A 3F00A 2EKCA 1P0BA 1XVSA 4IJ3B 4PBFA 2XWEA 4U1LB 3ZDZE 5IBTH 3O6DA 1H5BC 3BWAA 4E2DA 2DWXA 4F7EA 4XPTH 4XPFH 5DWUH 3HG3A 1DQML 5HJYA 5LAXB 3AZUA 1CC3A 1Y0LA 3QZEA 3CWGA 4RA0C 5A6JA 4Q22A 1TFPA 3PPCA 3G18A 4LRIA 3GH5A 4NG3A 1A7PL 4D1JA 3DX7A 4P7NA 1BIHA 2GJZA 3AIRA 2QDEA 2X2UA 1OAUH 2W88A 1VF8A 3GSWA 4P2OA 2FJFA 4WW2A 1C16B 4JQ3A 5XIAA 4BQ6A 4OGYL 1B2YA 4XO4A 3DNKA 2DQFA 2ITDB 1VHPA 4K7VA 2H6PB 3WD0A 5C2UB 4FMVA 1SMAA 4MDJB 3HOJA 5G1TA 3ZZQA 3W7QA 4UNUA 4FDWA 3FL7A 3BOXA 5JR1H 1M7OA 2Y1HA 4MWAD 4YHZH 2EDFA 2MHAA 5BNXD 3FAXA 5DZLA 4F27A 5I7GA 4L4VD 5EUOB 4RNRB 2CNYA 4NO2A 3BKMH 1JFHA 4JZJB 4LPXA 3SKOA 5K9XA 3LEYL 1R2TA 1AD0B 1SR0A 2Z91A 3SGGA 1QO2A 3FV9A 1C93A 1VAHA 4NKOB 1KIRA 3I85A 3FFOA 4MA3B 1RHHB 3UIZA 1HL5A 4N0FA 1AO7D 2E5BA 5BV7B 1KLGA 4JY6A 2TSYA 3ECBB 2YEZA 3B8WA 3BP5B 1FHGA 3NEOA 4JRYA 5C7ZA 3VI4A 3M1BB 3KBEA 5DFAA 4RBPH 3NIDF 3TO2A 3WK3A 3SI9A 2DVXA 3C9NB 1GVYA 4PUKA 1QSZA 5EH1A 5JIMA 2DQEH 4P5TA 3URNA 1I3RB 5EF1A 4JTGA 1I1FB 3SD2A 2P5WA 5CXPA 2NW3A 2K7PA 1OTTD 2QTEA 1L5GA 4YBQC 5I1JH 2XTLA 5AAMA 2QDDA 3TCLB 5D04C 4O16A 4AZUA 2CR3A 2Y25A 2CETA 1YYMH 4HJ0C 2DQXA 4ICWA 3GAKA 1FHDA 2OGYA 4HU3A 2X4UA 4PR5B 2XPZA 3IVKB 4MMYA 2EIZB 4NJGA 2YDQA 2VC5A 4EF8A 5IFPA 3FN0L 1XO8A 5F8RC 3SAZA 4PW4A 3GSNH 4O57A 3FQXB 3PG8A 3WLHA 2CA3A 2J1ZA 5I19H 1XL6A 2JKEA 1U4EA 4H0IA 5K5YA 3OZ9H 1NGYB 5JPNA 4RWYL 3P77A 4HBQA 2C1PB 4Z76B 5D2YA 4HYWA 2YKKA 5K9OA 2H8XA 4KK5C 5E6UB 3FT0A 1UOKA 3SY5A 2WLJA 1ETJA 3D85D 4PVBA 3HI6L 3EAKA 1QPOA 2P8LB 4RAHA 1UUSA 1OEZW 3BT2H 5FECA 5I30H 2I9TA 2EUZA 4PMRA 3DURB 3RJQB 3QARA 4XVJH 3WI9A 1G4PA 2CBPA 2Y1ZA 3K8LA 4BF7A 1MAMH 1EH9A 3H3PL 3N2XA 5TGBB 5JQIB 1S4IA 2I60H 4JFEE 3WEAA 5HMSA 3RL1B 3HMWH 4DN4H 1UBPC 1OX4A 3VQMA 5E2WL 1EEZA 2P7TA 1MJJA 2QL1A 2ADJA 1JTPA 3S3JA 1LO0H 4O1CA 4JE4B 4YXGA 4J1UB 4TLKA 2X2GA 4FOKA 4PJ8D 2X1TA 4NGHH 5D9SA 3BPCB 4EKJA 3C56A 4FN0A 3HURA 3HBPA 3PQYE 5HQMA 4LYKA 1V3IA 5C2BL 4OF3A 2DQDH 3WF2A 4QRRD 1UXSB 2NSXA 3IGAB 2J47A 4I18C 3TBTB 1W6LA 3LNFA 3N55A 1QG3A 4I85A 3TBWA 2YRBA 3VNIA 3H54A 1XLKA 5DHYB 5FYJH 3VC6A 3HRZC 3S35X 2P42B 3MUAA 5IB5B 2WXJA 1FNSH 1OHQA 4QRQB 4EAEA 1QEXA 3TZNA 4MA7L 5K59F 1SJAA 3O9WC 2CLPA 4XVUC 4OCWH 1LO4L 3TAOA 3GMQA 4OUOA 3GMLB 4AYSA 5F7AA 3T8XB 1CLYL 3FONB 3VXSE 4P23C 2NV9A 1H49A 4Z7VE 5DHXB 4Z7IA 4IKIA 2APSA 3C0LA 1NWSA 1WSST 1ZENA 4NNPL 2DY2A 4RR4A 2ITCA 2R1WB 1LOSA 5D1QA 2PU1A 4P4RA 1K8DA 3KWSA 1TWZA 3KEHA 3PWUB 1IILE 1M6OA 2R82A 4JDYA 5DJ2B 2WYZA 2OQYA 2OQJA 1M1SA 4XVTH 2F61A 2BRRH 3H7BB 2F8OA 1SEQL 3FB6B 1G6RH 3I75B 4KY1H 3MRIB 1HGYA 2WQUA 4EMZA 7PTDA 4I77H 2HLAA 3AHTA 2AVFA 2OX1A 3NQDA 1WA1X 4ALDA 2DUXA 4OE7A 3LS4L 1AGEB 4KH2A 4IOFC 1MCOL 5AWNL 3V75A 4WTZA 4XPGH 1EGZA 1QWGA 3RWIA 4US5A 3U4AA 3QT2A 1OP5K 5J56B 2F53D 3MLWH 1X5FA 5E8EA 5DF0A 2DL9A 2ZP0T 1O1HA 3AAMA 4B5SA 3DJZA 2NY2D 4FULA 1WXYA 2MPVA 1TR1A 5CUSL 3LQAC 3HMXA 3IUDA 3FFDA 5F9OH 3U6RB 5DJAA 4KRNA 3NK3A 3EB2A 4PJDB 2PWVA 4W84A 1KKRA 4DFIA 4H2HA 1M3IA 1ECZA 1H8LA 2UY7B 4MTVA 1TUPA 3QYQA 3PGFH 3OAZH 3BLDA 5CBEB 1G4EA 3RUGE 3UU0A 1RIVL 2FD6L 3K5RA 3KPPB 1MJ8H 1NEZB 5H8MA 4FZEL 4AUBA 2R59A 3B7YA 5TDPA 3LBOA 2DQJH 3FYIB 4Z7OF 3V4PH 1L7IH 4HFWB 2OYKA 2CIKB 4MWFB 5DS2A 3CN1A 1LZOA 5CBJA 2BCMA 1F7BA 4TPRL 3BZ4A 4HLZG 4DYJA 5A8PA 3IFOB 1U5JA 2P52A 1QAPA 4KPHH 3S8GB 3NFPB 1RI8A 2IPJA 2Y89A 1FYTE 4OSUL 2D7MA 1N8WA 1H50A 4P2QB 2HUHA 5E5LA 4EDWL 4ZFMA 3QIBC 5GNYA 4XO8A 1IT7A 1NFDF 2R23A 3MRMA 2AOSA 2QBWA 4M7TA 25C8H 4ODUB 3BGFB 3PABB 3NN8B 3PHQB 1IT9H 1RZPA 1JQVA 4NRZA 4X9YA 1B4JH 1P4LA 5KANG 5AVVB 2RB8A 1XYBA 3VSUA 3RCMA 4YBLC 3LN5A 1DSWA 1WWAX 2HZGA 2EEBA 1NOUA 5FIPA 4ZPVA 3BUTA 4PG2A 4G83A 1HAUA 4BQCA 1W3LA 1JD9A 3UTQA 1XIHA 3ZSSA 3CTTA 1FSKB 1UGNA 3RZCA 1QLEB 1S9VA 3UBXI 4POUB 2VAJA 4R7DA 2B0SH 4RDZA 4PJBE 2BIOA 3NA4A 1G7HA 5DJXA 2E74C 4GMTH 1MH5B 4DEPC 1MNSA 4YWGL 3SYPA 5EU5B 2FSEB 3BSZH 4N1CA 3V4UL 3W39A 5H35A 4NUPA 3EA2A 1I1CA 3HG1B 3K6NA 2EO1A 3EO1B 1IMHC 1RV8A 3L7RA 3UJSA 2X89D 3FCTB 3SGKA 4OY9A 1KFEA 4XAZA 4FNQA 5GRWA 2FYVA 3IGFA 1PSCA 4UTAL 4GBXC 3MPGA 3WJMB 1MIEH 5AHLA 3S3GA 3LGEA 3DBXB 3ZHFA 5GRYA 4IIQC 1EGJH 3KJ6L 3V36A 5BWAA 3GGWA 1QPNA 2XSBA 1GIGH 3WAJA 3DYOA 5A43C 3EUDA 4C1NB 4ONFL 3K74B 5I18L 4JKPL 4JTEA 5F4XA 2UY5A 4UQIM 1K8CA 4BFIB 3KWWA 2ZIDA 4ES4A 4IJRA 4MJ5A 4O12A 1OO2A 3MXVL 4CMMA 3RR1A 4JFDB 3SQSA 4D6CA 3R0NA 3ZWSA 4XNXH 2YZ8A 3WS6C 4OIFA 5JIWA 4JN1L 3V7AE 5KVEH 1XISA 3SGDH 4QO1B 4PRWA 3FT2B 3MRHB 2WD0A 5F4SA 1L2QA 3D39B 4HCRL 2AKMA 3V6OE 1EXPA 2W80C 3CU7A 1X5AA 1OC7A 4NI3A 5GGSB 2Y06L 5EEZA 4OZIA 3P3UA 5CR8A 3R4DA 5FC9A 1DBAH 4DN3L 1W6WA 5HMFA 3ESOA 4TX6A 5DCDA 3TFKC 5TK2A 2CNZA 3KRSA 2Q5BA 5BVPH 2OFJA 4XBPA 5GS1B 1LK2A 1S7WB 2CKBA 2E9MA 5IR1B 4ATTA 3WFCH 3CK0H 3IACA 2Y7FA 5IW6B 1OM3L 1IXNA 5LGKA 2FJGB 4Q58C 3VCLA 2GGHA 4PSPA 1NBYA 5ICYB 2E5EA 1FC2D 1U8KB 5I1LB 4F0HA 4LDEB 4G71B 5HYSA 4KS0A 4PG9A 3TYEA 4W9HC 2D03L 4PUMA 3PM6A 3COTA 2CLIA 1DEEB 3ATBA 1BVLA 3KHDA 1JMXA 4HF5H 4YHKH 1C08B 5MENA 1D2KA 2HS8A 2PI6A 4YHLH 1HEHC 1KLFB 3CQHA 1IAKB 5C9WA 2YDAA 1CPUA 4AXWA 3F6IA 4LGRB 1H8NA 5A7EA 3KS0H 4ZMXA 1KRBC 4KTEH 4DXXA 5GISH 2C4XA 2NY4C 4DFHA 5C0IA 3WGVB 4S11A 3DESA 1XFCA 2FZ3A 3HZYB 4FG2A 2J73A 4Z1AA 4YS1A 1J87A 3X1FA 5E7BA 3H1ZA 4YTQA 2BODX 4R4FL 3HNVH 4ODWA 1VKFA 4FABH 5C9JA 4Y4FA 4DP0X 4O53A 3QSRA 3A4XA 1LGVA 5EZIL 2W62A 1DDHA 1MDRA 2B3IA 4FXGC 3BGMB 2FQIA 1UQSA 4I9TA 4AIXA 3AXHA 4R97B 5BOOA 4L18A 3WH7A 1FJ1B 3UZWA 4NZRH 2DJ4A 3KXFA 4N2MA 1CI1A 3ITOA 4F7KA 3Q1SH 1WS8A 4NKIH 4HJ0D 1AHKA 3MTWA 5J1SC 3ARDA 1JZ7A 2VM9A 1OARL 3SGJA 3UP6A 1W0MA 4OU3A 5D2LA 3I4KA 4I3SH 5E1AB 4FKKA 3SDCD 1TWIA 4V15A 2J9XA 1DQTA 2WIIB 1UA3A 2J72A 2ZWYA 4YUEL 5BRZD 4IT1A 4JYDA 2WYIA 3MGOA 1ZALA 3WUGA 1OFDA 1ADQA 3KUMA 2WWNA 1NDGB 5IB3A 3TBYA 1PSKL 5DJDA 3RDTA 1S7TA 3A3XA 3M17A 2VGLM 3MC0A 1E1CA 5D96B 2NYYC 3WQOA 3R8GA 4M4PA 3GIVB 4ZO7A 3TNOA 3WLWC 4PJIB 5BZWB 4LFHD 1NDMB 2HH0H 2AQVA 3OAWA 3FSZA 1UT9A 3D3FA 4K4KA 4HPNA 2ZG1A 4IK7A 1QNQA 4AEIH 2VLLA 5ANME 4CNOA 2GGEA 3FUJA 1GKEA 4J12A 1YECH 1P2CA 4I8YA 1ACYL 3PGCB 4PN2A 3A6BL 3UC0L 4HZMA 1T0OA 3ENLA 2B7OA 2X9XA 3UZQA 2V9TA 2QAPA 4CKQA 5IUCA 1XCQA 2PD9A 4Z95H 3MV8D 3WKYA 4E5XA 1EJUC 4AM0B 5IIEB 4U6HA 1YHPA 3GSNA 4XRCB 2P26A 2DBJA 2X0UA 1BCIA 1FGVH 2MOQA 3ETBF 1K8YA 4N6QA 5E99H 5F70A 3VNMA 3DO7B 4UTIA 4E9LA 2P88A 3LRGA 4AT6B 3UOAB 4JJHA 2C7UB 4NUJA 4WWOA 1XSOA 3I3BA 3VJ6B 4Q4PA 3O2WL 2A9BA 4YLWA 4GI4A 4OFCA 1JEZA 4KUCF 3UPMA 5FHAL 4Z2GA 3VXQA 5HDLA 3RGVD 5C0DB 1QACA 4AH2A 5FCUL 4TMBA 1B31A 4XAKD 2OOFA 3PZGA 1DXFA 1A3XA 2J79A 1BZ7B 4NSKB 3HI1B 3U9PH 2BSEA 1TQJA 1UZDA 3OYXA 8FABB 2N1TE 4P23D 4AWJC 3TV8A 3GVVA 3QFGA 2WV8A 5E2VH 4KHXH 3CBRA 3N44F 2E7CA 3WMPA 2YA1A 3GSQB 3AXMA 5CH9A 2QDHA 3CFNA 3MRFB 3CHPA 3SE9L 3NJVA 5GRVK 3VXMD 1YEJH 1YJDH 4PMZA 1R17A 3CXHJ 1L6ZA 1KBGH 4BF5A 5JO5A 3S1XA 4DYKA 3MLZL 1BVKB 4H40A 3KVDD 5FKAB 5JBDA 1JGEA 1PYMA 1A5MC 1SVCP 2QVTA 1PTDA 5DMGC 2FLMA 2G30A 3C5ZD 3OKKB 5E1GA 2NXZB 5JZ7D 2BMBA 1HEZB 3NQVA 3WDJA 5BYWA 5D7KD 3ABGA 3ZDXF 2I9LB 2CKNA 3TJ4A 1IGYB 2CH8A 2HTMA 4HH9B 1ZSXA 4O8RA 1TVBA 4QTFA 4BHYA 2BP8A 2JH2A 3FQWB 4GJJA 3FQRB 4H20H 5B22A 4ZMQA 3MCKB 1TQTA 1S7XB 3SDYL 3C6LD 1LTDA 4RNFA 1HHJA 3BZJA 2Z6JA 1KY7A 1W80A 3HZMA 4IHOA 3MRKB 2FWSA 1M05B 2EH8H 1T99A 3N9RA 2ADGA 4DVBA 4ZXOA 2CG9X 2WM1A 5GGRA 3QS3A 1G43A 1R3VA 3LNHA 2IDFA 3BW4A 1T21B 2VYOA 4RDWA 3C3NA 3FVDA 5EZJA 5BXFB 1K6WA 4CU7A 4HZ1A 4CC1A 3ZYJA 1DVYA 4P4KC 5HK4A 3CV7A 3N29A 4KEUA 5F7WC 2WXKA 1YA5A 3QRFM 1R7AA 2Y9RT 3RY5A 3T0AA 4UTUA 1KULA 2VXUH 2XXFA 3P30H 3O8XC 2J12B 3LZFL 1VFUA 1QYGL 3UZEC 3G5VB 1OAXL 1BF8A 1JZDC 2BPBA 2IMNA 3M8OH 5LVEA 4OFYA 1F13A 1K4GA 1NMAL 4UTHA 3TZFA 3KPRA 3AMGA 4NUQA 1P7HL 2YCLA 3LU2A 3ZR5A 4ZS6C 2OM5A 3BOLA 4WFFE 3QLLA 4BSVB 2WXIA 1J93A 4CGTA 5HYEA 5GS2H 3LNDA 5ESQA 5D93C 3QIBD 4R96B 1HT6A 1WCQA 4D0CA 4DCQB 2GDUA 3ZTCC 3EMZA 43CAB 3DKJA 3W87A 3CZFA 2PWEA 4YNYA 1XF4A 4MTMA 3IKCA 2CHOA 3OG4B 4XIAA 3U7YH 2IMRA 1XQ4A 4XGZA 3H2FA 4ZZKA 5M17A 1PZ2A 2XWTB 2IXQA 2A3HA 2WAGA 4AZ8A 3PG2A 1AJ7H 1COBA 4F2MA 4V1XA 3O11B 1SUHA 5KBNC 2AEQH 3GJFB 4Y4HC 3W9DB 1YDVA 4GUPB 1MI5A 1M7IB 3V4PA 2V2TB 1RJLA 3FPXA 3J7HA 1D5ZB 3ZDYB 2HKHL 3V95A 4PJ5A 3HHSB 1T0NA 5HHMD 1B3ZA 3ULVC 3EO0A 5EOCH 2DMHA 4A21A 1OGTA 1A3WA 3JV5A 4AQAB 5AG9A 1N12A 4OIBA 2F18A 3BK0A 1BG1A 2D2OA 2FZBA 2EXWC 5CU5A 4G6KL 1I9JL 2Q86B 1NLDL 3EYFA 1Q72L 4FTVA 2AJZB 5IROD 1J05A 1KTCA 3O8AA 2EYSB 4ZB0A 1LBLA 1OCBA 2FGLA 1UC5A 4GO9A 1JHKL 3FSWA 6ALDA 1U8MB 1WZMA 4DZAA 2BSCA 1NC4B 1YQVH 2H2PC 4WTWA 4Y2NA 4G8GD 4AIZB 3HB9A 3W85A 4PBEA 3L1FA 3W29A 1T7ZA 5F9WB 5BPPA 4H13C 5HATA 5LCVH 3P82A 4B92A 1GEHA 3MSGA 2LAGB 3KMDA 4RX0A 1U8OB 4XN7A 1TELA 4UNLA 3TJHD 4HS6A 3PWLB 2H26A 1OAKH 2UXGA 1ALDA 1WDQA 1DXEA 4NN5C 2Q3AA 2O93L 4FXFA 3GSXA 4IP4A 4GIRA 3VOJA 1SHXA 5CPQA 3QUYC <