1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
1PX8A 1V3MA 1EH9A 4UFLA 4HOWA 1UKOA 1TMQA 3VSUA 1NWTA 1O7DC 1HIZA 2YBTA 1PEZA 4DWSD 1E4IA 3VILA 4U5KA 4IUGA 3HG5A 3BVWA 1HL9A 4CCEA 3CHDA 1VEMA 2WHLA 2Y24A 4DUVA 1UR4A 2J7DA 4XUYA 3AICA 4U31A 3AOFA 1HJUA 1D7FA 2BHYA 2GK1B 4R5EA 5DMYA 3EDFA 2CXGA 3VNYA 3N04A 1KQYA 2J4GA 1UG6A 2A3CA 2WKGA 2C0HA 1PJ9A 1ITXA 2EPLX 3VM7A 1XGZA 1OGBA 4B15A 1UH4A 1OIMA 3LPOA 1FH8A 4JKMA 1QNQA 1J10A 5HDRA 1PZ2A 4RE3A 4PSRA 1UWUA 3EJRA 5C8BB 1E6RA 3ECQA 1IT0A 3LPPA 4P7RA 4JAWA 2JFEX 2EAEA 2DIJA 1W3KA 1H5VA 1ESWA 1B3YA 4HP5A 1QWNA 3JUGA 3WNNA 4TX8A 5E09A 2VRJA 5M5DA 3VD9A 3NYDA 1JNEA 3ARQA 3CZNA 2OWWA 1CTNA 1XSJA 4QP0A 1MQRA 3T2OA 4P8UA 2F7OA 3U5UA 2Y5EA 1QVBA 1OGGA 2JE8A 5CLWA 3GZAA 4IPLA 2EBNA 2DT0A 2WMKA 3ZJKA 3WKZA 4FNTA 1NOUA 4U2YA 1NM9A 1W91A 5CLTA 2WMGA 2VI0A 3EDJA 3ZJ6A 2YL8A 2ZXBA 4D6IA 4PCSA 2DGAA 2J74A 5E0CA 4CN1A 3ALGA 2DH3A 3L4YA 3W38A 1UD4A 4W7WA 2YLLA 1UZ1A 4J28A 2ZUUA 1L0PA 2DSVA 3TTQA 1R33A 5JBEA 1JDAA 1B3WA 2WHMA 2WK2A 3QOKA 3UR7A 1OCQA 4FF5A 1RP8A 1QBAA 4TOQA 1NARA 1W9XA 3WDRA 2CIPA 4AXNA 4DM1A 1SMAA 4ZENA 1N82A 1E3XA 4HOZA 4Z2HA 1BGGA 2C8NA 4LXFA 3M46A 4TVDA 1E55A 2VRQA 1ITCA 1VEPA 4H2CA 1Q4NX 3WSUA 3BUBA 2JIEA 3VIKA 4DO5A 1CGUA 3OGSA 2W62A 4AZ5A 3OGRA 1HL8A 3OLDA 3HG2A 2YA0A 3CIVA 3BH4A 3DHUA 2J7FA 3RM8A 3ARZA 2J25A 1DEDA 4CVWA 3OGVA 2NSXA 3S5YA 1XH0A 1R46A 4EE9A 2BVTA 3AXIA 1OD8A 3KL0A 5KEZA 2FHFA 1UOKA 3WUFA 4PRWA 4TXEA 4GO9A 3AYRA 3VIIA 2OYMA 7CGTA 3UG5A 1V6YA 1R47A 2EPMX 3UG3A 2WW5A 2VZUA 3IGUA 2VMFA 3CHEA 4U3CA 3WENA 3VGFA 2WXDM 2V5DA 2YA1A 1CZ1A 1IV8A 1GQKA 1BAGA 3SCOA 1AQHA 3AI0A 3TTYA 3CHCA 5M03A 5E6YA 2CCRA 3ARWA 4BA0A 4H8UA 2VUYA 1W2PA 1YQ2A 2YBUA 3POHA 2G3MA 3RMEA 3PBGA 1W3HA 4UOJA 4EKJA 2OWXA 2F1BA 1C8XA 3TTSA 3LPGA 3A22A 1V3JA 3AHYA 1ZBKA 4ZEPA 4N42A 4PMQA 1FHDA 1TFVA 2CBVA 1CGVA 1HJWA 3SUVA 1UKPA 1TQUA 1J0YA 4OGZA 2ZUTA 2YFNA 1X1NA 1DWIM 1GPFA 3OBAA 4U5IA 1EHNA 2QMJA 1L8NA 3WH9A 1H3GA 3AXHA 5E9AA 4AD0A 1GOMA 2CEQA 1IZKA 3WBAA 1TG7A 4CVUA 4PTMA 5IHSA 4F9DA 1EO5A 1TA3A 2CYGA 3GH7A 4AY1A 3AYSA 1UR1A 3HU7A 3ARYA 4CD6A 3MMWA 3N9KA 4JFWA 1CDGA 5I24A 3A23A 4TUFA 1HX0A 4PMZA 2WC7A 2G8ZA 1GOOA 1YHTA 4TVCA 2WBKA 5C70A 3BAWA 3T2QA 1BPLB 4P7NA 1E15A 1J0IA 3AMDA 4D1JA 2ZXAA 2VX7A 1BYBA 2W66A 4PBGA 4XX6A 2E0PA 1XH1A 2F7RA 3WQVA 3WF4A 4IISA 2WHJA 3RM9A 1JYVA 3U7BA 1PPIA 3L4WA 4ZE5A 2DEPA 1H09A 1JAEA 1KWKA 1F4AA 3TP4A 4MB3A 2YDSA 1E6NA 3DX3A 1V0KA 1WZLA 4GI8A 1JIBA 1JFXA 2WMJA 2O9OA 3AZSA 1GOQA 1JZ6A 4P8WA 4QDMA 4W7VA 1JDDA 1MQQA 4ATLA 2BS9A 3HG3A 1R87A 3S5ZA 1MFUA 1U30A 1CLVA 4L4PA 5BXPA 3KLKA 1H11A 2YOCA 4MNKA 3BMWA 5I0DA 3WQWA 2XYLA 5A8MA 1W9UA 3SUUA 5DO8A 1EDGA 1KTBA 1HKMA 2YIHA 3DYPA 1R7OA 1M01A 3SEPA 4LGXA 2RGMA 1TZ7A 1QI2A 4CCCA 1GUVA 1UR0A 3HN3A 4PMXA 2DT1A 4FMVA 5CQ1A 2XSAA 4AZ7A 2YKKA 5FOOA 5HPOA 2XGBA 3VPLA 3D3AA 3SCWA 3B9EA 1ZU8A 3ARVA 3WL1A 4PSPA 3RILA 5GQBA 1GOKA 3PZQA 3CUFA 4AIEA 5BXSA 3BAKA 5D4YA 3OG2A 4MNMA 4P8VA 1PIFA 1BHGA 1LL6A 3GNPA 4R27A 1UASA 4UQ9A 1Q6FA 3N11A 1V08A 1EOKA 3T2PA 1CXFA 4JIEA 2ZX8A 2X1IA 1I1XA 3AROA 2J77A 2Y8KA 5D8WA 2IXVA 3ZJ7A 1VF8A 1E40A 5I5RA 3EMQA 3SURA 4OIFA 4JKLA 2DIEA 5EBAA 1XSIA 4YPJA 2OSXA 4AZCB 5LA1A 4HZ7A 4UFIA 4BF7A 1G0CA 3D5HA 3CZJA 1TCMA 2J8FA 2ZUVA 2JF7A 2E4TA 1GQIA 3SCSA 1W9PA 1UA3A 1PZ3A 2BY1A 2VX6A 3BLBA 1FFRA 3AQUA 4W8LA 3LXAA 3VIMA 3NJ3A 4AYSA 2XWDA 3AMLA 4FNQA 2BHUA 3WL0A 1JZ4A 1J0KA 1BYDA 2BY3A 2D0FA 2XVLA 1GVYA 4BQ3A 1UWQA 1LQ0A 4F79A 3AS2A 3U5YA 3VIOA 1ZBWA 2X2YA 4MADA 4GO8A 4UOQA 3PTKA 2JIWA 1JZ8A 1UD3A 1E0WA 2ESCA 5C71A 2WZIA 3CC1A 3FHAA 1H0GA 1WKYA 4W85A 2X2IA 3UEQA 4RE2A 4UCFA 4UQEA 1XC6A 3CZKA 2D23A 3SCUA 2JEPA 2GDUA 4MJ2A 3N18A 3IJ9A 2DSWA 3T08A 4GI6A 2ZX6A 2VC9A 1CGTA 3L4ZA 1ZL1A 3OA5A 3FHQA 1WZAA 3IJ8A 3VGBA 3VD7A 1TVPA 2VX5A 5LA2A 3RCNA 1IZJA 2D2OA 1FHLA 1US3A 3CZGA 3BAIA 1OD0A 2WB5A 5HXMA 1TR1A 2J47A 2WLYA 3WQ6A 2QPUA 3EMCA 3DHPA 3H54A 3LMYA 1V3HA 3BSGA 4TVUA 1KXHA 4WK9A 4CD8A 3CZSA 1PIGA 4NZCA 1NWRA 3VDBA 1UWSA 1JZ3A 2OYLA 3EDEA 1C7TA 1FOBA 5AY7A 3VD4A 4JHZA 1JF5A 4IM4A 1BSIA 1WAWA 3NSNA 4CD4A 5I77A 1HVXA 1QOXA 3GM8A 4BQ5A 3AIVA 4E4PA 2XVKA 3GNOA 1DWGM 4LQ1A 2A3HA 3DECA 5A2AA 5A95A 4GKLA 3AHXA 4HA3A 1XH2A 3PZOA 3BUIA 2WYSA 1J01A 4W5UA 3CUGA 1LWJA 2WPGA 3VSVA 5CJ5A 1E43A 1ISXA 1JFHA 1TVNA 4TTUA 4LYRA 3A4AA 1JF6A 1VB9A 1WZKA 1VIWA 4MB4A 1ZBVA 2IGTA 4S3JA 3A3HA 4UFHA 1W3LA 1C92A 1VEOA 1BQCA 4W89A 3N13A 2CERA 2XFFA 2G4FA 1BVZA 3EDKA 4J3UA 4HPHA 3GYCA 3ZQ9A 3K1DA 5E6ZA 3BMVA 1XYFA 4M82A 1ZJBA 2W92A 5M3WA 5I79A 3RDKA 1B30A 3CPUA 5CPQA 3FNDA 3NDYA 2D73A 4DM2A 4UTFA 3ZR5A 1VFUA 1I75A 3HMCA 4CU8A 4WLCA 5A6LA 2PC8A 3AIWA 1KWGA 5IFTA 1GZJA 2FGLA 1MYRA 3CTTA 2O9TA 2VVNA 3DX1A 4RL3A 4HOXA 3OZOA 2OWCA 3ARUA 3WD3A 1MW3A 5GPRA 1XYZA 2BY0A 3GXFA 1R34A 3LRLA 4D6CA 3CLWA 1C93A 4X9YA 1GJWA 1QNSA 1M7XA 1HJQA 4JZ5A 5A1AA 5CG0A 1RPKA 3ZT7A 4B9YA 4N0RA 4V27A 1W1PA 3WDPP 4C7GA 2WVVA 2F1AA 1OB0A 4XV0A 1E0XA 3PZNA 4UR9A 1TE1A 4AIOA 3GH5A 2A3AA 1UH2A 4UQCA 1DWAM 2O9RA 1Y7VA 3W6LA 3HZ3A 1EGZA 3WUGA 3VUPA 5IXEA 3DC0A 4CU6A 4AEEA 3WF2A 2F8QA 4A4AA 2B31A 4BQ4A 1P6WA 4GPNA 3RPMA 4LYPA 4UZSA 1JZ7A 2VCCA 4XB3A 3BUDA 4H8VA 1SZNA 1JG9A 3RO8A 4AMCA 2OLHA 3AMGA 3O9NA 3CMJA 3ZIZA 2JALA 4WKHA 1JYXA 2XJ7A 3VU2A 3NSXA 2GDVA 2XN1A 1CXIA 1OBAA 2EQDA 4DUXA 4WSJA 3CBWA 4M8UA 4ZXOA 4AZGA 2NT0A 1OIFA 3ZO9A 1V02A 4PTXA 4FK9A 5GNXA 2W4XA 7TAAA 2WWDA 1C90A 3VX0A 5AYIA 4Z2KA 3VGGA 5FIPA 2J62A 2IUZA 1H41A 1QPKA 4WF7A 5A6KA 2BXZA 2IXUA 1LLOA 4Z2IA 1CXEA 4HU8A 5CGTA 4WJXA 1E0VA 3ZT6A 2UY5A 3M07A 5KZ6A 1V0MA 3AISA 3VO0A 1HWWA 1GQLA 2WLZA 1E56A 2CBJA 3CZLA 2EPOA 3K8LA 3VM5A 4B9ZA 4WKAA 4JHOA 1B2YA 3QR3A 4HMEA 1GQJA 3MSGA 1KXQA 2JF6A 2WCGA 4CN6A 1VBRA 4WSKA 3ARPA 3THDA 3FXYA 1E4LA 2WMFA 1R85A 1CIUA 4AMWA 3UR8A 2ZOXA 3ARTA 1ZJAA 3AS3A 3VDAA 4E8CA 4MJ4A 4AWEA 4B16A 4NZJA 3AIQA 3CGTA 2V3EA 4W93A 5ABFA 3L4TA 2WVVB 1M03A 1K9TA 4HZ6A 1Q6GA 4OJYA 4PTVA 1GHSA 1DHKA 1O6IA 4DWSC 1HJSA 3RJXA 5IHRA 3A6OA 5DT5A 4HPGA 1E5JA 2E3ZA 2VCAA 2E40A 2D3LA 3W37A 3W6MA 1BTCA 4HA1A 2XSBA 3GDBA 1GOIA 4NF7A 3D52A 3OLIA 1HKIA 1LJYA 1ZBCA 3D4ZA 5A8QA 3W25A 3G6MA 1O7AA 3EBVA 3WMBA 2DT3A 1AVAA 2G41A 1MW1A 1KCLA 1OGSA 1HP4A 3DDFA 3KE0A 5A6BD 4JCMA 2GJXA 1W1VA 3CH9A 4JFSA 5ABHA 3U57A 4M24A 7A3HA 5F7UA 3E1F1 1EIBA 4AYGA 1E4MM 3L4UA 5D9PA 1D2KA 3WH5A 1JZ2A 3UERA 1NWSA 2WHKA 3OB8A 3N12A 4FLOA 3NUKA 1R8LA 1QI0A 3SCVA 1TQVA 3A21A 3QHMA 2PWGA 2ZE0A 1UKTA 3L4VA 3I3DA 3PZMA 4RE4A 1A3HA 4UOZA 1K6AA 1KGUA 1UA7A 4H04A 1H0IA 3DDGA 2WCAA 1LL7A 1CGWA 4FLRA 4ZE4A 1CXHA 1SMDA 3ARRA 2X0HA 4GINA 2VVSA 4MTVA 2YL5A 2EO7A 2WKLA 2D1ZA 3WNMA 4AD1A 2PF0A 3O2LA 4W7UA 2QMKA 3B9DA 1EO7A 2E9BA 4J3XA 1E5NA 1WNOA 3GXPA 1C8YA 2E9LA 4D6DA 1WO2A 2J78A 3EYPA 1PAMA 1UWIA 2J79A 2JEQA 4XZWA 1UWTA 1OWQA 3ARSA 2X2HA 4AEFA 1B3VA 1FH9A 4UZUA 4PMNA 1JYWA 4W87A 4P7LA 4V28A 3WFZA 3KZSA 5CSUA 3N15A 2V38A 3PTMA 1LF1A 2X0YA 4PMVA 4WKFA 2ZX5A 4HMDA 1QI4A 5I78A 1CGYA 1M53A 4GQRA 1WB0A 1WE5A 2HISA 2CBIA 3WEMA 2DQXA 2VL4A 4ML4A 4JL2A 2PI6A 1E70M 2CPUA 3NDZA 3GXDA 2EABA 4D72A 3WDHA 1AQ0A 1V6WA 1KQZA 4MB1A 4KH2A 4HU0A 1SR0A 3PZVA 1TQWA 2W91A 2Z1KA 3A24A 1E4NA 2VQUA 3AJ7A 2V3FA 1HKKA 3MMDA 3W0KA 2FH6A 4D6EA 1H1NA 2WSKA 1KGXA 4AZCA 4D71A 4PN2A 5EMYA 4K68A 3I3EA 3EMZA 4UQDA 3EDDA 3MANA 3W28A 2G3NA 3GTNA 3D4YA 4DWSA 1GJUA 3KLLA 4E8DA 1KGWA 2X05A 5I23A 4PUDA 2OYKA 5A6BA 1TUXA 5JBFA 2VRKA 1HTYA 5ABFB 2ZX7A 1UD6A 1XSKA 3AMCA 2PB1A 3WEOA 3CUJA 1QI5A 1MFVA 2J7BA 4URIA 3WD0A 4JKKA 3ZT5A 2ZXDA 3W24A 3SIMA 2CKRA 5CZKA 1CEOA 1VJZA 5JUVA 3LX9A 3CUHA 4D1IA 3K46A 1HF6A 3B8SA 1V0NA 5EB8A 5EFFA 2XUCA 4NSBA 1FP9A 3PZTA 4IPNB 4QLLA 2WMHA 2DH2A 4UQAA 2WANA 2GJXB 5A6SA 4J3TA 1NOWA 2VR4A 3VD3A 1ODUA 4C7FA 3AXXA 5BROA 1KFWA 4NRSA 4LX4A 3BVUA 5M17A 4CCDA 5DEZA 3PZ9A 1U33A 3LXCA 5GNYA 2XVNA 1UD5A 1DWFM 4E2OA 1FH7A 1UQYA 2D0HA 1W1YA 5ECUA 4NI3A 1MW0A 3EJUA 1BG9A 1R75A 2Y2WA 2WMIB 2FH8A 1QW9A 4D6GA 5BCAA 3PN8A 3MS8A 2J7EA 2GSJA 3KEHA 2BV9A 3W27A 2V3GA 3II1A 2XVPA 1NP2A 2VTFA 4JFTA 2VO5A 3WD4A 4EK7A 2PWHA 1V6XA 3EJQA 5FKYA 4OBSA 3UCQA 3BAXA 1V6VA 5D9MA 2WVSA 4AD5A 6TAAA 2EPKX 5DT7A 3CMGA 1JI2A 4A3HA 3WY1A 1J0JA 1CYGA 3IK2A 5LA0A 3EJPA 4F8XA 1HJXA 1MXDA 1WCGA 1GVIA 1R86A 2ALWA 4QFUA 5E0FA 3BXWA 4WIWA 3WMCA 3FAXA 2G3JA 1QHZA 4J7RA 1Z32X 1UKQA 3WNKA 2CKSA 1E6QM 2VZSA 1C8QA 3WY3A 2J7HA 5E70A 1B1YA 2PWFA 5A8NA 1EQCA 3U7VA 3WH6A 3WDQA 1KR1A 3W82A 3VIJA 3BAJA 3BAYA 1WDRA 4DWSB 3WDJA 2DPEA 1WZMA 2E9MA 4CU7A 1XHGA 1EOMA 2W63A 2ZUNA 3WQ5A 3AIBA 4FLSA 2OSWA 1XRVA 3H53A 2CETA 3GNRA 3BCFA 5HOSA 3OIHA 4UFKA 4JFVA 4GZEA 3TV8A 1JNDA 1KR0A 1VFFA 3WD1A 3K4DA 3L2LA 2YL9A 1JXKA 1KB3A 1VFMA 2XVGA 1EHAA 1UR2A 1OT2A 4TX6A 1H49A 2F61A 3GXIA 4FNSA 1HN1A 2A3BA 1SFSA 1ZB5A 2VNCA 1PX3A 1W2VA 3DX0A 4GXPA 4Q22A 1CPUA 3L2MA 5CXPA 2W67A 4M80A 4W8AA 4MAZA 1J9YA 4BZYA 1HXJA 2PBGA 3O6AA 3ZR6A 1LG1A 2WMIA 3DYOA 1ISYA 2D20A 3QHOA 2WSPA 3LRKA 1DWJM 2XM2A 4D6FA 2XPKA 3BLPX 3KL5A 2WNWA 5FL1A 1WDQA 1JL8A 1AMYA 4KRUA 3GXMA 3AZRA 1WDSA 1OINA 2QV4A 4CD7A 1BFNA 2FGZA 2QF8A 1LWHA 2FYVA 2W5FA 4PTWA 2OSYA 1KTCA 5ABEA 3WEZA 3FY1A 1F4HA 4EAMA 4GIAA 3QGVA 3BVTA 1MXGA 4MNJA 3N17A 1WDPA 2WC3A 1NH6A 3WQ4A 2GUYA 1HJVA 3VKKA 1CECA 4XZBA 3ZMRA 1I1WA 5BXRA 3TTOA 1SYTA 4X0NA 3MI6A 4A3YA 5BYWA 2AOSA 1K9DA 4ACYA 2O9PA 1G94A 3W53A 4D6HA 3D51A 6CGTA 4D6JA 4F66A 5LYRA 3MUAA 2VZTA 2A3EA 1E1FA 3MMUA 4AZ6A 4J3VA 1QBBA 3WY4A 1A47A 2X8RA 6A3HA 2FE0A 1KBKA 4PEEA 3FAWA 2V5CA 5CPSA 3BVXA 1LL4A 5D9NA 1G01A 2D0GA 1B9ZA 2XFYA 3T09A 3POCA 1OM0A 4QCEA 4W88A 5A69A 1BGAA 4LYQA 2GK1A 4U33A 3VNZA 3PTQA 1QWUA 1J12A 3L4XA 2ZXQA 2UY2A 4DO6A 3ZM8A 2FHCA 1XV8A 1MW2A 1VRXA 3IAPA 4UNIA 1GHRA 3MU7A 3W4RA 1E6PA 2WAGA 3W26A 4OOUA 5FD0A 2F2HA 3LRMA 2UY4A 1KCKA 4PYSA 2YDRA 5A2BA 1XCWA 4EANA 1E6XM 3W29A 1W9VA 3WNPA 3VMNA 3ZSSA 4CUCA 2YA2A 1HT6A 2XM1A 3AS1A 1NQ6A 2PBOA 3CZEA 1ISZA 4PMYA 1UD8A 4CD5A 4U3AA 2EJ1A 4YHGA 4MPKA 2XTKA 2O92A 1OSEA 2UY3A 2TAAA 3A47A 1M04A 2E8ZA 4AZHA 2VCBA 3BCDA 4FNRA 3VSTA 1NOFA 4FLQA 2VR5A 4NRRA 4NZFA 1QHOA 2F7QA 4JL1A 2ZUMA 2YFOA 8A3HA 2ZWZA 3J7HA 4HA4A 2CITA 3WN6A 4AMXA 3AMKA 3T0BA 3A5VA 1JD7A 5I2UA 3F5JA 3VGEA 1JD9A 2BFGA 4H41A 2WZEA 4DUWA 3VGDA 4PUEA 3BLKA 3VOCA 3EJTA 3MKKA 2BNJA 1W3JA 4B3KA 3SCQA 1ZS2A 1V02E 3PHAA 5E1QA 3WELA 1VFOA 4PMUA 3WBEA 1Q6CA 4ACZB 4HMCA 4M1RA 4W86A 3THCA 3W81A 1ODZA 1S46A 3ARXA 3PZIA 1FP8A 4AIUA 5TD4A 4YHEA 3WUBA 3VGHA 3ZOAA 5A6JA 3ZJ8A 1EXPA 4QCFA 2YLAA 1V6UA 4QLJA 3AIEA 2XIIA 3BC9A 1E6SM 3NIYA 4AZBA 1NWUA 2BHZA 3M7SA 3UETA 4M81A 3MUZ1 2ZUSA 3AIRA 2GJPA 1TQTA 3SUWA 1MQPA 1HKJA 8CGTA 2J75A 3BGAA 1QW8A 2CNCA 4F9JA 1CENA 2J7GA 4MNLA 2GVYA 3WIJA 3VIPA 3TOPA 2ZICA 4MB5A 2YDQA 2DSUA 1UHVA 1E73M 4Q7NA 4H8HA 4QAWA 2YL6A 1W9DM 2XN0A 2CESA 5CGMA 1KXVA 3WH7A 2C7FA 3AHTA 4GI9A 2VZVA 3G6LA 4MDPA 1E3ZA 4AISA 2MANA 2EXOA 5HNNA 4BS0A 4Y7EA 3MUIA 1Q6DA 2J7CA 3RJYA 2CBUA 4AD4A 3UESA 1ECEA 3WUEA 4OBRA 2WCSA 5JIPA 4MDOA 2NW0A 3VMPA 4GZIA 4X0VA 2EEXA 5FL0A 1GOWA 3MSDA 1BF2A 5BRPA 2V3DA 1PS3A 1CGXA 3WD2A 2UWFA 2D22A 1EDQA 3F5LA 2VZOA 2BXYA 4AD2A 1B0IA 1G1YA 1W32A 2ZUWA 4UQBA 5D8ZA 3SCRA 4J27A 1BYAA 3VX1A 1MVYA 3LXBA 3T0AA 4GZJA 3WDIA 1CNVA 1FA2A 1TQSA 4CKQA 1T0OA 4BQ2A 2Y8VA 3VVGA 3AFBA 2AMGA 3NCOA 4KGLA 4TTGA 5IDIA 3BUPA 3N1AA 3CHFA 1DWHM 4JCLA 3I3BA 3VTRA 3F5KA 3VIGA 4UFJA 2XIBA 5IFPA 5A6AA 1JI1A 2XHYA 1K9FA 4OKDA 1QNOA 5GNZA 2CHOA 1VJSA 1LG2A 2EPNA 1QNRA 3CUIA 2FHBA 3LPFA 3UG4A 2E8YA 4P8XA 1CXKA 3VINA 1J18A 3A4XA 4J3WA 3OLGA 4BCEA 2ZIDA 1RH9A 3AZTA 1UR9A 2FDMA 1BVNP 3WNOA 3OLEA 3HJEA 4CGTA 1CXLA 2EADA 4FNUA 3GBEA 1CWYA 3VDHA 2Z1SA 1U2YA 3OZPA 4OOZA 3BVVA 1JYNA 2DSKA 1C3FA 3GXTA 3FW6A 3GH4A 4OZOA 1E1EA 1UKSA 3WF1A 3SCTA 4JFUA 1GW1A 3D50A 3S6TA 4L4OA 5A6MA 3B9AA 5A8PA 5CPTA 1X6LA 1EDTA 1VBUA 5FCZA 1V3IA 5DFAA 1ISVA 5I6SA 4ACZA 4Z2JA 3BUQA 3WMSA 4W84A 1J0HA 3CV5A 1H2JA 2D3NA 2WBGA 2HVMA 3H55A 1B90A 1TA3B 1PX4A 5DF0A 1UZ4A 9CGTA 4MAVA 1XCXA 4P7QA 5A94A 3VDCA 3MUY1 1GORA 3KL3A 4QLKA 1JGIA 4AZIA 4ZFMA 3SUSA 1W9BM 1US2A 4H7VA 2G3IA 4AD3A 4P7OA 2ZX9A 4KWUA 4C7DA 1UR8A 4HZ8A 1BLIA 1CLXA 1QNPA 4AW7A 1E72M 1OT1A 2CHNA 3VMOA 3M6DA 1K9EA 3IAQA 1BYCA 4V2XA 3MV11 2ZWYA 2F18A 1J11A 2AAAA 1CBGA 4HTYA 4W8BA 3WFLA 4PMDA 1VENA 1DP0A 5HBFA 3K8MA 3MO4A 4ATWA 1G9HA 1HXKA 2NT1A 3CZ8A 4M56A 3IANA 3TA9A 2D24A 2W61A 3K8KA 4J3SA 1V3KA 3NSMA 1E71M 2BVDA 3K4AA 4Z2GA 3VD5A 5D9OA 1V03A 4PCTA 3VIFA 3ZSTA 4ZXLA 5A3HA 2X2JA 4ATDA 4DO4A 4NXKA 2VQTA 4YN5A 2OW6A 3KWXA 2VURA 1X6NA 3WF3A 1AQMA 1EQPA 2GFTA 3BSHA 2DDXA 1B3XA 3F4VA 2F7PA 1R7AA 2RGLA 2QLYA 2XFRA 1GNXA 3DX4A 5HPCA 1E9LA 2XGIA 3S2CA 2Y4SA 4OUEA 1W1TA 1UH3A 4AC1X 2EACA 3CO4A 5AYBA 5ABGA 1ISWA 4S3KA 2VX4A 3APGA 5JBDA 1V0LA 5CSYA 3WF0A 3QOMA 1E6ZA 2PWDA 4GQQA 1KBBA 1WPCA 3WQ8A 2BVYA 1QX1A 3SUTA 5A8OA 4LPCA 1QI3A 2XWEA 3AS0A 3QHNA 1PBGA 1MWOA 3T0DA 1RP9A 2DSZA 2QPSA 3DYMA 3RIKA 2VJXA 5EFDA 1V3LA 3WH8A 5A2CA 5BXTA 2QHAA 3SCNA 4PMRA 1KXTA 1XD1A 3VIHA 4KGJA 2WVUA 2YJQA 4PMOA 1QHPA 5BRQA 2WWCA 4CN4A 2VT0A 2X09A 4U2ZA 1HVQA 1NP0A 3WY2A 3EJSA 1UUQA 1G5AA 1HNYA 1D3CA 1B3ZA 1JAKA 1DTUA 4FNPA 1Q6EA 1VAHA 2XN2A 3AHVA 1XD0A 4Z2LA 3AIUA 3RM4A 1UQZA 5I3DA 3MV01 3GXNA 3WNLA 1WP6A 1BG4A 1JZ5A 2WM0A 2DT2A 2OW7A 3A4WA 3IJ7A 3SCPA 1JXJA 1FFQA 1C7SA 4NXSA 1UWRA 1GCYA 3GBDA 2PWEA 1H4PA 3PZUA 4W5ZA 4UFMA 4KMQA 3HG4A 2J8GA 2XG9A 3TONA 4B3LA 2GJRA 3AHZA 1C91A 4KRTA 1RD6A 1UYQA 2WC4A 1HP5A 5BWFA 2VOTA 1JDCA 3PZGA 4NX0A 3FN9A 3DX2A 4M29A 5JIWA 2WZHA 1B31A 1J0ZA 2BY2A 2WVTA 1EA9C 3ALFA 1GONA 1UD2A 5AC5A 5AC4A 2Q8XA
chains in the Genus database with same CATH superfamily
2PNDA 3D05A 3HG1A 1V3MA 4NNAA 3TN5A 1OX4A 2BOBB 1CR9L 4UFLA 1JFQH 1UKOA 2A7NA 1VZHA 1FAIH 4HX1B 1LMKA 4JMNA 3VSUA 1SJCA 2REQA 5G1MA 4ODHH 1YMHB 4ZPVB 5FUCC 5EV7A 3N4FA 3U2ZA 3BW9A 1YN6B 1PEZA 2WQDA 1E4IA 5H8MA 4JG1L 4UDUB 4FE9A 1DCLA 1CI3M 5DFVD 3CSBA 4BA8A 2FDBP 4NYLA 5M7QA 5IUCA 2EXWC 1JDFA 4PY8I 2WHLA 4JDBA 3C6LC 2Y24A 3AU1A 5I1IH 1L6YA 1MZRA 2V82A 3EWUA 2P8CA 3NFUA 2J7DA 2BLFA 3T6ZA 4G6FD 2HTLC 2XRAL 3QDJE 3GVVA 1L6PA 3NN8A 5D37A 4KDTA 3AOFA 4F57L 4UT7L 4W9LC 4EN3A 3UJEA 5CBBA 1D7FA 1MREH 3NIGE 2GK1B 4O57A 1D2PA 4L3CA 3JVGC 5D2LE 1XIFA 3LU2A 3SPVB 1MWAB 3VNYA 3N04A 4AUYA 3UTPD 1P2CA 3KM2A 1YC8A 3O4LA 1R0AH 5FHAL 2WTPA 4BKLA 4K38A 2Q7YA 5I1JL 5DZPA 3QIWC 4LEBA 3MWAA 5HDQH 2WKGA 4EDWL 1BD2D 2OJEB 1CGSH 1KRMA 2FZ3A 1LQSR 2PXYC 3KBMA 1PJ9A 2ZSVB 3B2XA 5GZNA 4GBXC 5KVDL 5ICYA 1UZ6E 2QQNH 4N9GA 3UPCA 2PCFA 1VKXA 3R4DA 4X5XB 3T4YB 3VM7A 3VYOA 1OE2A 5MEOB 2I5YH 1TNMA 2GYIA 3THQA 1UH4A 1S7VB 4F7PA 1OIMA 43CAB 3QKEA 4EX4A 1WT5A 4OZGA 1F3RB 3CBJB 1FH8A 3QJHA 1QNQA 1TPB1 2FZ9A 5GS0D 3Q5TA 2ZQ0A 4TPRL 1EEQA 3HC0A 3ESMA 5DVMA 2PDNA 3URAA 1MRDH 1NBYB 1ZCCA 1DFXA 3NSYA 3ISIX 4YC2B 2G5RA 2JCCE 3WTVA 3WE6B 4JTJA 5FLUA 4DQWA 5IQOA 3TMQA 2IQ9L 3ECQA 3U9UA 5IBXA 4Q4SA 3LEVH 4LU5L 3K5RA 4M5ZL 4UUJB 3SCMC 3ECWA 2I27N 3F12A 1R5YA 2BIOA 4QGTA 2FIKA 1F76A 5CS7A 2I69A 1I9EA 2PYFB 1ICQA 4P2QE 4A7VA 4S1DD 2D4FA 1AK5A 1S7TB 3UTSB 3ARBA 4XUGA 2OXGB 2PD5A 4KFOA 4XH2B 5LSMA 4ZS6D 3EJYD 2Q76B 3EHBC 2G9HB 3V4PL 4LNCA 5BOOA 3IUIA 1S5IL 5F2GA 3RIFF 1C1EH 1C8PA 1H5VA 4JNXA 1W3KA 5E2UL 1LM8V 1Z9NA 4AQLA 3JUGA 3IJ6A 4Z7VA 3UXAA 2UZXB 3C6LB 5I1AA 5CUSL 5L2KB 1QPQA 5AC6A 3QUZB 4HCRA 3WFDH 5KSUA 4BUQA 2AQTA 1OGAA 3GSOA 4FULA 1HUVA 5I8EB 3ZDWA 4D8ZA 2VRJA 3TZNA 3VD9A 5HMFA 5I0WA 1EGJH 5M5DA 4HBCL 2J8OA 3RWHB 4JVPA 1TWZA 1SHWA 2GGGA 2R27A 3ZE0F 3H23A 3VA8A 1S2CA 2VISB 4FXGA 3UBXI 1W5QA 2CJUL 3SQOL 2OWWA 1GY1A 1XSJA 5IW6A 4QP0A 3T2OA 2XPZA 5BNKA 1B0GA 1CL7L 2F7OA 4WO4D 1LK3L 4O51A 3QGKC 2J6EH 1K4CA 2DMBA 5BZZA 4NKDB 2H3XC 2OQHA 1PGRB 4P59L 4BKSC 5SWZA 1K8DA 5CLWA 2OELA 3PJNA 2PDWA 3GZAA 4XXDA 4XNZB 4D9RE 1AGBA 3O8XA 3EYUL 1FCCA 3ERXA 3QQ4A 2YXOA 3WKZA 1W91A 3GJFK 2ZG1A 3Q2WA 3DPBA 5KW9H 3GKFA 4X6DA 5JHLL 3GTXA 5CIPH 3ATDA 3ZJ6A 1LORA 4QXTB 4PRPB 2ZXBA 3VXRE 5BRZA 4K7VA 4D6IA 1I1YB 5HGAB 2DGAA 1P69B 4L2LA 4ZOBA 4B5TA 2J74A 1OE1A 2H6OA 3BPLC 2IXQA 2OL3A 2WGNB 1EB3A 5M95B 2LTQB 5I1CH 2A6JA 2DH3A 3L4YA 2L8AA 4FC3E 2Y7GA 3OKYA 2TMDA 4GYPC 4HDIA 4A2RA 3EIFA 4LLVA 4W7WA 4NQDB 3FO9A 4D9QE 2BIHA 3HUJF 5J8LA 2HH0H 5D96B 4NPJA 3T2NH 4G80B 1R33A 3KYKL 4DLFA 2H26A 2WHMA 1LLZA 4TO8A 4KFMA 4OZFA 1H7PA 1D5BA 1QCWA 4FF5A 3L3HB 1YTKA 3GSRB 1RP8A 1Q4WA 1ICTA 1VS1A 1Z9SB 3K5XA 3V2AR 4EXAA 5I6LA 1W9XA 2WBWB 3GMMB 1ZTVA 2ESVE 3OHMB 1M7IA 4AXNA 4YXHL 4F3HA 3RUGB 2CLPA 3D3VB 2DMGA 3FT4B 3HE7C 1OAYL 3VYLA 1RBLA 1AYOA 2C7UB 1E3XA 2VDOH 4HOZA 1XL4A 1NELA 3P61A 4JQVA 4Z2HA 3HZKB 2NX5A 5CIPA 5EUOB 1BGGA 3S1UA 4LXFA 5IB1B 2OTDA 4S38A 1AD0B 4A8LA 1KCVH 2OTUB 4TVDA 5IB5B 4ZZKA 1E55A 2A4AA 2CZDA 2VRQA 1VEPA 2X40A 4XAZA 2GC7C 5E8PB 3PWJA 2CO6A 3BUBA 3FHEA 5IR1A 4JO4H 1A5OC 3O7UA 3VIKA 4DO5A 4PRHB 3VCLB 3GSVB 1NJ9A 4W6YB 5E08L 2B9BA 3QUYD 1AH3A 3WK3A 3TH4T 3RG1C 3T3MB 1HU8A 1LBMA 1NF0A 1KGYE 1DJQA 2PDUA 5AECA 2HKHL 1JZDC 4FL4B 3CIVA 5JMUA 1MRFL 4RETB 4TUJA 3OAZK 3V0EA 4GUOA 3N4AA 4XVTL 3E0FA 3BP4A 3GUGA 1I8IA 5FXCH 3GS4A 3ZTCC 1UGKA 1CT5A 3OGVA 3VNMA 3NQAA 3ULVH 4YS4A 3ILEA 1P6CA 3V8OA 1DVUA 4LNYA 3NJNA 3UW6A 5MERB 3GJEA 1KN2L 1XT5A 4PIRF 3SKJH 4KNQA 1O5PA 4WENB 3NG3A 2O7SA 7FABL 1K7EA 2Y1VA 3KL0A 3S4SG 3W2MA 3W88A 3QUMH 1A80A 2VW7A 4M6NH 4Z76B 3L5AA 4PJFA 3ZIYA 3NPZB 1AQDB 3QWOA 4GRLD 4RCAA 5D1XD 3AYRA 7CGTA 3PG8A 3W7LA 4OD1H 4LFHD 4RDQF 2ZTJA 1KBGH 5AZEL 1NLDL 1TU2B 1AO7D 3TCLB 2ITFA 1HH9B 1OIOA 4ZQKA 1B4RA 4MA1C 4XPGH 5HGHB 4H1LB 1Z3GL 4ZDHB 2V5DA 1R3SA 4IOSA 1GZHA 3UWUA 3TQPA 3L95B 4HUXA 4YGVA 5E2VL 4DFHA 3SCOA 1M3IA 1YPZA 2QPEB 1OB1B 2ROYA 5M03A 1O6SA 2EIJB 3A4JA 3BAEL 3LV6A 3ARWA 4G3YH 5E6YA 3G77A 1JV2A 4TQEL 3MNMA 4IGHA 2DLEA 5I1LB 3MV9D 3POHA 2ENJA 1GVOA 1X9RA 3MJ8A 3RMEA 5JPNB 4WRHA 1BYPA 2WXLA 2YGNA 1ID5I 3DHMA 3MMEA 2AEWA 2XGIA 3PBGA 5DA4A 2OWXA 4OECA 2F1BA 5BU9A 1TO5A 2K6YA 3ARDB 3A12A 3EXSA 1EAQA 4Q8PA 4I5XA 4O8AA 4FG4A 2V9UA 4F8PA 5EZLB 1JPTH 4DIXA 4DP6X 3R0NA 4QOKD 3RGVD 1TFVA 1CGVA 2JQAA 4FABH 1XLHA 1T5XA 4ZYKA 4Q33A 4KX7A 4FX7A 3HPFA 2HYMA 1IJNA 4FIQA 4KKNA 5EOQL 3KXFB 2MCG1 1DWIM 1AFVH 2X70B 4D8PA 4LU0A 2DN7A 4MXWH 1MUJB 1VHNA 4U5IA 4NCC1 4Z17A 2GJZB 5C0BE 5HYSB 4H5SB 3IPEA 3HV8A 2QJJA 1RURH 2DLFL 4BE6A 1EJUC 3B3IA 5D7KD 2V8MA 4L9LA 4OT7A 4DRSA 4JFEE 5B4MD 1KFJA 3APTA 2KX9A 3N14A 2ZCKH 5HGAA 1L0XA 1U8NA 3PJSA 1Q9LA 4CVXB 1BXCA 3LNGA 3L23A 3MSRA 1RCQA 4I87A 1BLNA 4BHYA 3AQDA 3DLQR 4U1KA 4CMHB 1KNWA 4YDMA 1J1OL 2PTTA 3FB8A 1XPGA 2VFDA 4PTMA 2ZONA 4JUSA 3QR1A 3H2FA 5AD0B 1JXDA 3F7RA 1K8IB 4H9ZA 4F9DA 3T4AA 2IALB 3LZ3A 1RZ7H 3E8VA 4G80A 4W4OC 1SO5A 1TXKA 1O66A 3T8MA 4U3XA 3WIHH 1C5BH 1WD8A 2A6IB 4LHQB 5DC2A 3VXTB 1HEJC 3EPNA 5HHMB 2PRMA 5DHVH 1RZJH 3ARYA 1XUZA 4E4FA 3MMWA 3H0TB 3BLOA 4GLRH 4ZXBD 4TUFA 1HX0A 3TFKD 2Y7QB 1TJMA 2ATKB 2ADGB 2R83A 5AYQA 3EOBB 4OUOA 4GKZB 4TVCA 3STBA 3GD1C 4PJHE 1T6WA 1QA9B 4XOCA 3CM4A 3R06B 4JY5H 2W38A 1H5BC 5C70A 4DP1X 3BAWA 3NWRA 3L9YA 3T2QA 3V4BA 4O4VA 3B37A 5DC9B 1TETH 1E8YA 3TPUA 5FDWA 1A66A 3QFWA 5E8PA 2NUXA 4U4MA 1WFUA 4F0RA 2YD5A 3FTGB 4DO7A 5K7JA 3LVEA 3ULAB 4ML9A 4JX6A 4XWGH 5FECB 3DSFH 5ETUB 3KOFA 1MMFA 2G3FA 4MZ1A 5JHMA 4M9PA 4KFPA 4PBGA 1VFTA 4GIPD 2NY7L 2F7RA 4I2XE 3M0JA 3WF4A 4QNEA 4FR1A 3HPSA 4LRTA 4XQ6A 5F6HJ 3U7BA 1WDDA 3L4WA 2AHIA 4O58L 3ZKNC 5FGBA 4HSAC 4JBSA 2DEPA 3T8QA 4YBLC 1CTMA 1N67A 4JZJC 4D0CB 3JQOB 4X4XB 5JW5B 4XPTL 3VTTA 1H8LA 5ECJE 3C5ZC 5MENB 3K2IA 4N0YL 3S46A 5H1WA 1KGCE 1XR2A 6XIAA 3QFJA 4GI8A 3TJEH 1T7XA 5KSBB 2P5WE 2FZDA 1XX9C 5AW4B 3TUUA 1JZ6A 5FFGA 4P8WA 4UMBA 4QDMA 2HMID 3LLDA 4P07A 3TSDA 1HZKA 1ZUAX 1AS8A 2BS9A 4UU9B 3HG3A 3V6FB 5T8IA 3QB7C 5BRBA 3B7YA 1GEQA 1W0MA 1PLAA 2DIAA 4XZLX 3QT2A 1JCNA 1LO4L 4JAMA 2F6XA 4YGVB 3BE7A 1HKWA 5BXPA 2Z26A 1AG6A 3EYFA 2YN3A 4RZKA 5J6SA 3WQWA 3RWEB 8FABB 1A7BA 3Q6GH 1W9UA 2H5UA 3FUDA 3TTEA 4XPFH 3QV6A 4XPBL 4YSTA 3GI8H 1SYSA 3CU7A 2ZP9A 2FQGA 2F9RA 2B1OA 4IGNA 4RFEB 3QA3B 3IU4L 2I17A 3NEVA 1QI2A 5F4SA 1NPNA 5I1HL 2WB1A 1JP5A 5DC4B 2GGJA 4PMXA 1XGTA 4N0FA 7REQA 5CSZA 3MRBA 5TDNB 5FIEA 4M62L 1I2OA 3EOOA 1NCOA 5F9JA 2CBOA 4ZMYA 4QRSA 1B4KA 3PHOB 3VPLA 5T5NG 3KRBA 3Q01A 3D3AA 3W7IA 1A9VA 4IRZH 4R9HA 1T1XB 3V4VB 3VUSA 5D7HA 4FA8A 1MRFH 3UXFA 2WYHA 2QGBA 3QDMB 3ZDYB 5GQBA 1F4YH 2I9LB 2PLKA 3CBKB 3V5KB 1TG8A 1SJDA 4AIEA 5CJMA 3JZ7A 3QY6A 4BFOA 3LHTA 2CHRA 2VEIA 5D7LE 5F9OH 3UU0A 3BWUF 4U1NB 5E2WH 4N0UA 1EFQA 4DGYL 3OG2A 5C9UA 4H9VA 4KFZC 1B6DA 3W7EA 3BJLA 3X3FH 1A25A 1PIFA 3QXDA 1BHGA 4LAOA 3PXJA 3B06A 4UQ9A 3MUCA 1YAZA 3TCLA 2VDLH 1V08A 4YL9A 1NBZB 2ID5A 2PDBA 1B0WA 4A1RA 3TA4D 2NNRA 4DOHB 4F7MA 4JIEA 4E2DA 1GIGH 2XACC 4IBYA 2K6WA 5TFSL 2EDHA 4FD0A 3L95A 4HUXB 1CD9B 3N9GL 3NVQA 4F2FA 1IE7C 3NPXA 3GPSA 4HHHA 5BW6A 2XWTB 3MUGB 3CHPA 4XCEB 1VF8A 3SGEH 4QY8A 4GIYA 4XVSL 2Y2TA 3GSXA 4FQ2L 5GRYA 3UO1L 2BP0B 3KPQB 3TA3D 3ZY7A 1IO4C 3FKRA 5EBAA 3VE7A 2IPKA 1BFVH 1BD2A 3T1GA 4DP8X 5LCVH 2OSXA 4JUTA 3ZYJA 1OK8A 4TVPD 4HZ7A 1J87A 3NJKA 1AQKH 4NQEB 3SJVD 2EDBA 3PDOA 2AVGA 3FFCA 3TSMA 1TCMA 2PR9A 5C07A 2B0MA 2J8FA 4PIBA 2WOQA 4IIFA 4ZI8A 4FTVE 3W7OA 12E8H 1QVOA 2AK1L 2ITCA 4PFEA 2YAQA 4PJ5E 3CUXA 4ACTA 1KCRL 3KPSE 2IBZX 3GDLA 1OGAD 1OVZA 4R7XA 2ZUYA 2WQRA 2J5LC 1W80A 1Y07A 4KXBA 4GYFA 2WHVA 2YKLL 3CVHL 1F73A 3GIVA 2BY1A 3VIMA 3AQUA 1FFRA 1HIMH 3LXAA 2DTMH 4M7JH 3V35A 4P3CH 5DK2B 4J5NA 2Z4QA 1PD1A 3AMLA 3KGSA 3R2GA 3W1PA 1JUFB 3FB6B 4E5XA 1E9OB 2CLVA 3PIQA 4ODUA 1FDLL 1P4UA 3SY6A 3RHWK 3SPGA 2BHUA 1N5YL 1X39A 4Q0XH 2EEBA 3LMJH 2VOMA 4K1GA 4ZAKC 4BSVA 1PKQE 1RIUH 4L8CA 1NIFA 1OAZL 3DDMA 4WX2A 2YAHA 4J5VA 1MIEL 1RZ8A 1KTNA 1LQ0A 4A21A 3X14A 2JI2A 4QNPE 3UZEC 3U5YA 3VIOA 5B7YA 4L4VB 4UOQA 1U8KB 3IU3B 4U1KB 3PTKA 4M19A 5CD5D 2AXWA 3EFDL 3L65A 1HQRA 4UXDA 4KY1L 2D31A 2DWYA 3LRGA 2XG5A 3MZ2A 3T81A 1CX9A 5KBMA 1DVSA 5C71A 1B3JA 1QRQA 5ITBL 3DESA 2IG2H 5EU6A 4F48A 2REQB 1TUFA 3B8DA 3C08H 4KWVA 4DZ5A 4JZJA 1CBJA 1F3DH 3GSNH 1PHWA 3IMSA 2BW5A 1T0NA 1QRNB 2XA8L 3CK0L 5KS9B 1FWHC 5AYYA 3EB3A 1FZOB 2VXUL 5H8DA 4IOSD 3RIAF 1YZZA 5FEBA 1KRBC 2Y07H 4KUZL 5EBMA 5REQA 1RZJC 5DJ8A 1QSED 3BGMA 5TFSH 3DTXA 2B20A 4P4RB 4D0BB 3MJGX 1J5HA 2JEPA 2OEKA 1O9WA 3J07A 1WTLA 5HVGB 1WFOA 3INUL 5F3BB 3IK4A 4Y4FC 1YLBB 3AM8C 4ZMAT 3C4UA 3C09B 3O3BA 4KJWC 3C6SB 2VLJD 1YTEA 1Q90A 3IJ9A 1U2HA 1BFVL 4RISH 3GG8A 2FZMA 1L9MA 4ODHL 2BK8A 3T3PF 4XCFL 4F7KA 5EMLA 2A5UA 3FHQA 4XXWA 1TRIA 4J40A 2PGFA 3XISA 1TVPA 5LA2A 2J6EA 4GZ7A 5CSZB 1IZJA 4H7ZA 5JHAA 4RAUA 2G5BB 4AVFA 1T2QL 2ZSVA 5F9JB 2AKRB 4B91A 1YMMA 4L5FL 5DJ6A 4A66A 2VDQL 3NFSL 5LKNA 3HZYA 4DQOH 1J96A 1OD0A 1NEZG 4UT6H 3TN0B 5FEWA 1T1XA 3CLEH 1F56A 3V4VA 1ME7A 3WQ6A 3AUWB 3FF8A 1NGWB 4DKFL 3N85L 2QPUA 4L1WA 4S10A 2YD7A 1JRBA 2F1EA 3DHPA 3H54A 3EMCA 4KESA 2XI9A 4RKAA 3VAVA 4O50A 4TV3A 4HS3A 3M0VA 3P8IA 4FZIA 2FGWL 2FSEA 4WZHA 1KXHA 1RK7A 2GFBB 1D9KB 4A2GA 1R0AL 4PHXA 1PIGA 4HIIA 2OODA 2Z4TA 4LUSA 3NCYP 5DEGA 2ZCZA 4AENA 4I0PB 3L2IA 2MRYA 5CILL 2AEOA 1XXFC 3CX5J 4JQIL 5JVLA 2E7CA 3ARGA 3C87A 1J9CT 5AAWC 1QAPA 1FOBA 3VD4A 3UBFA 1JE6A 1U1HA 3DX5A 4AQAA 2CHWA 1UM6H 3I50H 1SR9A 3NSNA 2OXGA 1HVXA 3C6LD 3GRIA 4E4PA 2IG2L 3NZQA 4Y16B 6PAZA 3EYFB 1XIHA 2XWTA 3EPMA 4DJEC 1WBZA 3DECA 4X9FA 1DQQB 3W0WB 1NAMA 2HJFA 2VW4A 4JN2B 4F37F 5JOEA 4WKZA 4BDVB 1XFPA 2ONEA 4JXCA 4DZAA 5A95A 4HXAL 5IJVB 2E77A 1ZGLA 4Z7VB 4EXBA 3F7PC 5CINL 5B39B 1Y1UA 4HQQL 4RDZA 4YU1A 3W2LA 5MENE 2WYSA 3AZUA 2XBDA 2Y70A 4N8CH 3P0XA 1RSFA 3R4IA 4JR5A 1E27B 3TVMD 4W5UA 3C2AL 2ACSA 4F9LA 2XIQA 3LV5A 3W5MA 4XE0A 2IDSA 5CJ5A 3RWHA 3GIZH 1UXMA 4DEFA 2VM4A 2IV8A 1W16A 1AACA 1EWHA 3MA7A 4WGWB 5IMKA 3WCYA 1E9ZB 2V63A 4PULA 2BGQA 3TC3A 3PYCA 2O5ZH 3A4AA 1EHLL 1B0GB 3HE6D 3R8GA 1JF6A 3PL6D 2LLGA 1GL4B 4N9GB 3V6OA 5ALCH 1VKXB 1UZDA 4NEHB 1ZS8A 4BFGA 4G1KA 2H6PA 1AP2A 5DJAB 4JTAA 3ANVA 1OCZB 2LT9A 2QVFB 1MFEL 3AQZA 2WWKT 4UFHA 1QSZA 1VEOA 3CXDL 1T5KA 2WYZA 1F8IA 2A85A 4IBZA 1CDIA 1FIEA 1T3FB 4Y2WA 3FFOA 3SPVA 2JB5L 4LUIA 4JM2F 4O02B 1GKEA 1UOLA 3BANA 3O3RA 1IM9B 4PUBL 3STGA 3BZFB 2WW8A 2XQBL 2J9ZA 5KZCB 3UA3A 4UQ2A 2IH1B 5K9OB 1YPIA 3GY1A 3RVVC 5IJBC 4NJJA 4GWEA 2VLRD 1N9PA 5DQDL 3QZBA 5J06A 5M3WA 3CV1A 1GC1C 2OZNA 5I79A 3MV9B 4IIZA 4PBDA 1A6UL 1OOWA 1B30A 2QDHA 2FNBA 3DUGA 3IUDA 1JMZA 1NDMA 2OMYB 2Z7WA 4LARL 5F9DC 2A74A 1XI3A 1T0NB 3IIXA 1TZIA 1YDPB 5H35A 4LRSA 4UTFA 1VFUA 4KDVA 1DBKL 4I88A 3IAGC 3LDVA 5K9CA 5A2IH 1I31A 2XQ0A 4X4ME 5DRZB 4CU8A 2YW3A 1RLDA 2PC8A 3NTCH 1GJIA 3AIWA 3W2JA 3USBA 5H2BB 3RU8X 5IFTA 1GZJA 2C5DC 2FGLA 2B5IB 1ETZB 1P4LA 1HZHL 3ZE2B 5BUAA 4AIBA 3IMBA 2HJKB 3D4GA 3CTTA 5EIIG 4LALA 4IP7A 1XLCA 1Z2KA 5E7FA 2Y6TE 3WO4B 2AMUA 4NZ4A 4C6IA 5GPRA 3F7QA 5F96L 2LAAA 3U9WA 2R1XB 5CKSA 3B34A 4OR1A 3G1RA 4D6CA 3PS6A 2LE9A 5I9QB 2FWUA 4YNGA 3ZYOA 4H8QA 5DVPA 7A3HA 1R3YA 4HNVA 2V7NB 3D07A 2DLGA 3KJ4C 1M2OA 1HJQA 1XINA 3MQIA 3BW3A 4JDVA 2D7TL 1UZ8B 4B9YA 2OMNA 3V9CA 2X4NA 1GTHA 5T3ZH 4IOIB 4JFEA 4WR3A 1S78C 4PH8A 1OGAB 1YNLL 3BT2H 5J1TC 5KUMA 4XP5L 2V2WB 3V4UL 1N5YH 1F2XK 1ET5A 4P2OA 4RSYA 2EKSB 5KZCD 1E0XA 4H8NA 3V9EA 3APNA 1OTTD 5LDUA 3T8XA 4AJVA 1D5IL 1TE1A 4APXA 4Z7WE 4IX0A 4GAFB 4A67A 3ZPDA 2JI3A 5HHMD 5HSFA 5HR7A 1ONWA 5KBLA 4OLYL 2AEPL 3NO1A 3BIAX 1Y7VA 4XCNB 2CU9A 4XXCA 4B4FA 4KK6C 3CE1A 3QFJD 5IXEA 3TPKA 1LO5B 1R5IB 2MOVA 4L4VD 1XISA 1KB9J 5FB8B 4R9OA 2F68X 1YG9A 1JFQL 3GMQB 2VAJA 1AH0A 3WF2A 4LC6A 1RIHH 4TS6A 1KYOJ 4BQ4A 4FEZA 4DNHA 2WQXA 4BR1A 3EKLA 3KVQA 2W65A 4R97B 1I2QA 3UWZA 5F3BA 4CEXC 3OGCB 3SKOB 3DRQA 3KLAB 4QOKB 1JZ7A 3KOYA 2CGZA 5E2VH 3RO8A 4JY4A 2DQJH 5HHQB 1A9EA 2BZ7A 2PFHA 1CE6A 1IL1B 2AXFB 3ABKB 5F0MB 3B2VH 1PB0A 1YDVA 2OLHA 1ADQA 3AMGA 4Z7WB 3CMJA 3O9NA 1BKSA 2CIIA 3KXFD 4GSDH 1EYWA 5LJYH 1LEGA 4WV1B 4YHLH 4HS6A 4KEVA 3JZUA 1PD0A 4P8QA 4WKHA 3C60C 2XC8A 2XJ7A 3HRZA 2QJIA 3GZKA 2FEDC 5DJXB 2XN1A 3ZZ1A 1R3VA 1CXIA 3F5WA 4FR6A 2EQDA 3FN0L 3L3OA 4DUXA 3HM7A 3BKMH 3TLLA 1KM6A 4JTHA 5TPWH 3U4FA 4P5TC 1HDMB 3ELFA 3KDMB 5FOJA 4MQSB 3WJMB 3BP4B 1MUJA 1JMXA 4HC1L 2Z2AA 1BVOA 4N6QA 4UV7H 4GKOA 5F7HA 1PTDA 1YBQA 2DQ6A 2H6UA 4NKMA 4K5LA 2BLEA 4XBMA 1IT9L 2PW2B 5BZWB 1UWGH 2V37A 3KWVA 1ZLUK 4GUGA 2CMRL 4H2HA 2A99A 3SZKC 4Z2KA 4YTTA 4US5A 3ECBB 5FIPA 5T1LA 3SD2A 4JRXA 2PKDA 3HOGA 4HIIB 1AJ7H 1F1GA 2K9FB 4N2CA 1D9EA 2OZ4L 1B88A 2AZUA 2BXZA 4HCFA 1B6UA 3LQLA 4U7KA 3IFNH 1AFSA 3QV9A 4Z2IA 5IBXC 4IPIA 3FB7B 5I2IB 4K8GA 4TQPA 1IGWA 3TNMB 3B0UX 3NCXA 3IDYC 1E0VA 5FYLH 3M07A 5KZ6A 4DJFA 2DP3A 2O4QA 4X8XA 3AISA 2IPGA 3DG7A 3U0WL 3WFAA 2R51A 5FR3A 3GJEB 4PE8A 3DMMB 3GMRA 3UJTH 1U36A 5KSAC 1SEQH 2WLZA 1E56A 4OD1L 4DEWA 2CBJA 1KKRA 4N6RA 5I74B 4UIMA 2WZAA 1NGQL 3SDAC 3VM5A 1XLIA 2FZBA 1QO3B 2YWZA 4ADJA 3GNDA 4JDEB 3LSBA 3VA6A 4L5ZA 2VMJA 2WP3O 2DEWX 2DQIL 1P4LB 4BFKA 4JHOA 4L3EE 4Q4IA 4GNJA 4HJTA 1Z89A 3VVWA 1GQJA 3V4PB 5I26A 3MSGA 4MNQE 3PP3K 3WQGA 2Z7ZA 2LLLA 2WCGA 3PAOA 1AXIB 3W3OA 4H3DA 2HPOA 5K9JH 2KLRA 4PCFA 2FJSA 5BO1L 1A0DA 3THDA 4Q9RH 1MF2L 5BV7H 3KTSA 1I8KB 3CX2A 4G70B 1R85A 2IVFC 4AMWA 3EOLA 4HBCH 3BX7C 4JHWL 3OOQA 1C12A 1CFMA 4PB5A 3AS3A 3S3GA 5DJYA 1Z9OA 4QHPA 4AWEA 5DJAA 4PJAE 4B16A 2VMDA 2HZGA 1RQHA 1JPTL 1RZIA 2V3EA 4W93A 2FUQA 4NNPL 3PL6A 1M03A 4HZ6A 1BXXA 1NL0L 2ARJA 2Z34A 5I19H 1BVKA 4Q9QH 3ASWA 3VXUD 1WSST 4KOCA 5F7MC 2DDQL 1ZMYA 2WBJA 2V30A 4H9UA 3SW6A 1E2ZA 4C47A 3QZMA 1XBZA 3QJXA 4FZEL 2GT9B 5JIIA 1HJSA 5IHRA 2MQ0A 2VDKB 4XWGL 4LS1A 1XLFA 4UIOA 3UZ5A 3VXMB 3IN2A 1I8MA 3S34H 2FB4L 2DQHL 4LLQB 4DVRH 1SYVB 2E40A 1DJNA 1Z0MA 2D3LA 3C5XA 1YEKH 4GG8A 3TJEL 3VI4F 4YIQB 5LDSA 3W6MA 1OGAE 2RUSA 2GUOA 4HA1A 2XSBA 4MYAA 2H1LM 5CEYB 5TGBB 4NF7A 4U1MA 4MFEA 3OLIA 1LJYA 1MUWA 3L5JA 3FZUC 1I2NA 1P7TA 4FOKA 3W25A 5AW5B 1CYWA 2ATKA 3G6MA 3EBVA 1JS4A 4OCNC 3UJTL 1NCWH 3DRQB 3KLAA 3EO1B 3SGJC 4JFFA 3D48R 2DT3A 5F4WA 2EIEA 4PS7A 1AVAA 2BP8B 2G41A 4YYFA 2V5SA 1MW1A 1Z41A 1A8JH 3OBKA 4H6KA 4Z7WA 3W02A 1G9NH 5J8OA 3DDFA 5E6ID 3ITTA 2A6IA 4JCMA 2C1PB 3OO2A 3H22A 3JTSB 2EZ0C 4YL2A 1TE6A 1WA2X 3H3KA 5EOCL 3L0GA 5AKVA 3QTPA 5I09A 4JFSA 5ABHA 4KRMB 2NX1A 5BS0A 3BDYL 4N6FA 4XBJA 1LD9B 4M24A 4PLJD 1YC7A 2Z64C 3WKPA 5F7UA 3E1F1 1RZMA 5IVZA 1D5XA 2ICEA 1FIGH 2CDGA 4FFYH 3SBQA 4AZ8A 4AYGA 1D2KA 5D9PA 3DSNA 5E08H 3MLUL 1BMWA 4E0CA 3WH5A 1JZ2A 3R89A 4ZFZB 1CT8B 1RZFH 3FJNA 1R3RA 4GUJA 5FA5A 1IGCL 1CFQB 1QAWA 2RJMA 3AWGA 1F11B 1QI0A 4KVNH 4U6YA 4X6DE 4MD5B 1HL2A 2JKEA 1N64L 2R1KA 5DC0A 3MODH 3B1TA 2ZE0A 2BERA 2DU2A 1SJEB 2JFCA 2HEJA 2XG4B 5I16A 4RE4A 4XD4A 1TVHB 1KGUA 1A7QL 5SX5K 1IQWH 3VNLA 4H04A 3U1SL 3DDGA 2X4RB 2AGJH 3DKHA 3WLBB 3C2OA 1LO0L 4HWEH 2FJGB 3KYMB 4P46D 4ZW7A 3U0TA 1SM9A 3W2KA 2PS2A 5CAKA 3MUXA 3NACL 5B21A 3LQAH 1DLFH 1DN0A 2YQ2A 3ULUL 4ZQCA 3P8JA 4QTIH 5FV1L 3QRFM 3ARRA 3HVNA 3LDBB 2R7EB 3MRJB 4G1EB 4PMEA 4XCEA 1J79A 2Q86A 3QQ9D 1V4YA 4GINA 3JTBA 4S1SL 3P5ZA 4K3EL 4WQOA 2YL5A 4XNQA 3WFBL 4YHZL 2RAMA 4AD1A 4QOKA 4BUHA 1FVPA 2HMIC 2J6WA 5ENLA 3M0KA 5GJMA 3AWFA 3X3FL 4WY7H 2IAMD 2UZPA 4KH9A 3PV6B 3WLIA 4J3XA 3FFCB 2YC1A 4IKIA 1CLYL 3X13B 2HT3D 1AD1A 1TEFA 4OM0L 4LVOC 1T66D 3IETB 5GHWL 1U1JA 2RH9A 2OZ3A 4Y4HC 3HFTA 1IWAA 3ITXA 3GQYA 4S3DA 4D6DA 1G7PA 4RMBA 1QFWL 4XPFL 4YR6A 1IC0A 1WFTA 3TEYA 5J11B 2IMMA 3O6KH 3UGUA 2BM3A 4NILA 1NUDA 2J78A 3L5MA 5LXXA 12E8L 2J79A 2JEQA 1YUHB 5TJWK 4XZWA 4I89A 3U7AA 4HWZB 4H20L 2PDQA 1YNKH 2R91A 5EA9A 4QRFA 5CZXD 4HWNA 2X2HA 3BE1L 3S35X 3FKKA 4JFDD 3OQEA 3Q5YA 1USQA 4XIMA 4G7EB 4UZUA 4NJ9L 2WO2B 3QULB 5EMKA 4LCWE 3KZSA 5IMOB 4AV5A 3GDTA 1KFLA 3N15A 1KY6A 4Y4FB 4G7VL 1MFMA 3EGJA 2V38A 3O0KA 5HNTA 2ISVA 5DZVA 1CDCA 2DBLL 4MXWL 3ZL4L 4BKLB 4FI4A 4GXVH 3EPOA 1R5VB 3F65A 3LLFA 1UA6H 2EEDA 1LF1A 3OZ9H 1D8WA 4WKFA 2ZX5A 1KYFA 4HMDA 4WUKH 1HHHB 2YAEA 4WJEA 1CGYA 2WIIB 1HI6A 2JELL 2KL6A 4OCYL 2ALAA 3WEAA 4KPHH 3VXNB 3VFWB 1QWKA 3QPEA 5GJPA 3T4WA 2XTJB 5C6MA 5MEOA 1JPKA 4IZGA 2QHRH 1DDHA 1UJ3A 4P23B 3L12A 4YJ5A 5HOSA 3C60B 2QTEA 4FHJA 1E7VA 2YK1L 1RULL 3O6CA 4IG2B 4ML4A 1PYMA 4R84A 3M6YA 4BGDA 5FJPA 4CKVX 1LEIA 3H26A 2NV2A 3V5FA 2R39A 1AC6A 1U58A 2CPUA 3MUGA 4X8JB 4QRRB 5GS0L 1E70M 3ZXAC 3H12A 3EKZA 4N6RB 4CC4A 1YEDA 4OFKA 5JW4N 1JF1A 3ROOA 4HMNA 2LFEA 3WIHL 3HPLB 2FTWA 1S7QB 5I3HA 3Q1EA 5MEPA 5E8EA 3I7RA 2IDUA 3UNTA 1RI8A 1URZA 3OKKB 5M94B 3ARDD 1KYAA 4ZW5A 1QO5A 4JFFB 3RVXC 3TN4A 5EBLB 4JNYA 4MTMA 4L1HA 4I0CC 4KH2A 4FXTA 5HYQA 4Z7UF 5JZ7D 1EJOL 3E02A 4C83A 2OKTA 4BCXA 4WI7A 1CFSB 4H00A 1CZ8L 3MX0B 1N19A 4G6FB 5KYYB 3DXAE 2NX3A 2C18A 2EYRA 5FWQA 4POUB 4LDLB 3AJ7A 3VWJC 2WXKA 3W0KA 3MMDA 5SX4I 2C13A 4D8AA 4P06A 2YZRA 5EZOL 3BSZL 2WSKA 4K8HA 3VCRA 4CAGA 4GUHA 3FH7A 5IJDC 3C5ZA 3I75A 3THAA 3BSZA 5BQ7B 4PN2A 4L4VE 4DY1A 1KTJA 4HIEB 4IS6B 5EMYA 2ZCGA 4OF3A 4DZ8B 1P43A 5D70H 3H4WA 1QUNA 2N01B 3L7EA 2UY6B 4NM8L 5AVRB 3JW7A 1MJUL 3QLLA 4JANA 2G3NA 1JNJA 3D4YA 3FPYA 4QEEA 3EFDH 4LCVA 3I4KA 4E8DA 3QLDA 4G71B 3HJZA 1WTGT 1TUXA 5D5MF 3DUSB 3AY2A 3LRSB 1HTYA 3QEQD 3U6RA 5ECVA 2ZX7A 1IQDB 1UD6A 1MCKA 4FQ1L 3AMCA 4JZOB 4BQ6A 3O63A 4OE7A 3SRDA 3ZL1A 2KUTA 5I3KA 3WEOA 2PLTA 1QI5A 5I8OH 4J9JA 1LE9B 3EAKA 5DUMH 1G7LA 1MFVA 1A7PH 4KTEL 1DN0B 4AKPA 1RAKA 1A5FL 2ZXDA 4N2DA 4U0RB 4U1MB 1TMHA 1LK2A 4XNZC 1WOBA 2PCPA 2PDCA 2IF7A 1OFQA 4DZBB 1P7KA 5IG7A 1CEOA 1PLCA 1NAMB 2HJFB 4JN2A 1VJZA 4TOQA 3OU8A 4QQ3A 4AK1A 4RMQA 1HF6A 4FA3A 3EO1A 2CO7B 2KDGA 4XI5C 1AUSL 5EFFA 2XUCA 4U28A 1JTOA 2Z92B 1NKGA 4KXZH 3WN5A 5B38B 4AL8C 4NSBA 5FCSH 1O7DE 1GGIH 4FQXD 3PZTA 4Z7OF 2P5EE 3DI0A 2WMHA 2JXMB 1JGDB 2HRPH 1XGUB 1RVFL 2DH2A 1SW7A 4ERGA 3ULUC 4C1LA 1TPFA 2GJXB 3MPCA 4PG9A 4LVAA 1AZVA 1URIA 1YQVH 1PHQA 1PMYA 4DOHE 2G5BA 4AGMA 1SF5A 3IMTA 2OSLA 4MJIB 3V10A 3WGVB 4HIQA 5JYLA 3PZ9A 1KLYA 4GYKA 2XVNA 3PG2A 3S35L 2QDDA 1UWYA 3FTZA 4MDRA 5D03A 3BDXA 1ZA3A 3KW7A 4AOFA 1FH7A 3CB3A 4MMYA 2LR4A 1KFKA 1OX5A 4G56A 3ISRA 2A9NL 2Y2YA 4JKPL 3WZ0E 1TVBA 4ATTA 1CFQA 3BP7A 1NSNL 2Y2WA 3AREA 3N5AA 5L4JA 2WMIB 4DPQA 4XNMA 5TQ0H 3TZVB 1O6VA 4EI5B 5IOPA 1NJ9B 3LMZA 3K6NA 4WXZA 3AITA 1F4YL 3CSGA 2KS0A 1GKRA 3UH8A 3WHE0 2E6JA 4M4RB 4W6WB 2OS7A 5BOJA 1N64H 1G4PA 2ZC1A 3X1BA 4GMTL 2V3GA 3II1A 3GSWA 2VO5A 3FU0A 2XVPA 4EK7A 3NP4A 4OQTL 5A7EA 1CF8H 3ABOA 4Q6XA 2PWHA 3PY9A 4NZUL 3KMDA 1V6XA 3ANUA 3KX6A 3BCJA 5FKYA 4IG2A 3S4TA 3UWQA 4YYCA 5I02A 4PJEB 4D94A 3BAXA 4L3ED 3O8XC 1YYLH 5EPDA 4HLZG 3E6EA 3QHFL 2HX8A 2JSFA 4A6YL 4JQ1A 3QRLA 1TPEA 1NSJA 4EE2A 1XLKA 1X4YA 2FO4B 4Y4KB 1ZSXA 3KCOA 3R8BB 4A6YA 5KAQG 3RB5A 2DVXA 4A3HA 4R26H 1GIGL 1IHIA 4WGXA 3HUJB 1S7QA 5G2NA 1X7IA 1OAUL 2QJDA 3STZB 4PGDB 5EA0L 1OAKL 3BIKB 2WZPA 2CRMA 2AI0L 4L37B 4ZFOA 3W76A 2TYSA 1VYRA 1OO2A 3T0TA 5T3XD 1SLVA 3WNJA 2X3AA 3X3GL 1B5TA 3WJJA 1TDQA 1EP3A 4PYGA 2KZ1B 4XSMA 4JRYB 3Q8CA 2XTJD 1TCRB 3MRPB 4MAUH 5DS8B 1A0EA 4WIWA 2BP1A 3H8AA 2FB3A 2MPVA 1QHZA 4R9XA 1J05B 3TXZA 1AC0A 3M8OH 2RFXA 2HZHA 1IBFA 4H88H 2R59A 3STFA 1WDAA 2V7NA 4J7RA 1TJPA 2QZRA 4JGJA 3BLLA 3IJIA 5ALCL 4Q7BA 3W0WA 2UV8G 3CS2A 1DPMA 4QRBA 2R15A 1TZGL 4HWZA 3GC4A 3QHZL 2BZNA 5AUMB 1TEYA 4PVNA 4Q74A 3PP4H 3NL5A 4L6HA 4Q8TA 4XAFA 4Q8QA 4F1SA 3U7VA 3NEXA 3WDQA 1F1AA 1GAFH 5KVEL 4HPYH 1A53A 1WFMA 3F64A 3O07A 1INEH 1AS6A 5F9WB 3BAYA 4FG6C 3FVDA 4JFOA 5B22A 3CFEA 1XR9A 4JY6A 2D9QB 4NN7B 3F6JA 4POYA 1KULA 1OADA 3QW4B 3RYSA 3JZEA 3FO1A 2J5LB 1WZMA 2A0LC 5AWNL 3S88H 1XHGA 1VKFA 3F04A 2DPEA 5FOBA 1QR1B 2E9MA 3HA0A 3P4OB 3L3KA 3ZKXC 1C5CH 3P67A 4RWYH 4M0XA 3C8DA 1PJWA 3KXFA 3H7VA 3IDMB 2JJSA 1KCWA 2WBJD 4Z77B 4AYID 2XICA 3W1XA 4BSJA 1QNZH 2CG9X 3R8HA 4IPJA 4RMWA 3SDAD 5JPNC 1GS8A 1P1ZB 4DESA 3AG1B 4YSDA 4RW3A 4Q6KA 1IC4L 2HG5A 1EDYA 5J13C 4LCSA 1WBXA 3OF6A 4PJ5B 1JNDA 1NUFA 1VFFA 1YE6A 3IJEA 1XGPB 3X17A 2WTRB 1FDZA 3RLGA 2FLMA 1LYXA 1BQLH 1XLJA 2B0SH 3GRGA 4LHUA 5CEXA 1P1VA 4HWUA 2I9UA 2YL9A 2VENA 1FZMB 1KB3A 1VFMA 1WWAX 4R0LA 5DI8A 4O18A 5KVFL 3FQRA 3OKEA 4G7SB 2IH9A 1CE6B 2AXFA 1EF3A 3RZWA 1Z5HA 4ZXBB 1V6TA 2CA3A 5ID0A 1QPPA 5JORA 1LEKB 1H49A 2QF7A 4TSAH 3SJNA 2J21A 5IMMA 1EJTC 3SQLA 3MCYA 2H32A 4QXGH 2ALRA 2OI9B 5L88L 1AANA 2A3BA 4PP1C 3VKAA 4HUMB 3I7SA 5IEHB 4V33A 3U2JA 1MZHA 3DG6A 3MLVH 3KM8A 4G9FA 2R2BA 1H1ZA 1RALA 3OVGA 3NL6A 4ZO7A 1A1NB 1XRTA 1A4MA 4QG9A 1HQ4A 3L9RA 5CWSA 5G4NA 2WOYA 3UC0H 1IM3B 4P5TD 4WIQA 1D6VH 4X5PA 3L2MA 3BKML 1KBPA 4GKNA 3CCHB 4MA8H 4MAZA 3WFEH 1S5WA 4UWMA 2OR9L 5H6HA 1WV7T 3PAVA 2K8QA 4XVOA 3ALPA 2J56A 2WSRA 4F0SA 4FPSA 2GSIA 1A1OB 3MROA 3ZR6A 1GMIA 3H9SD 3OKOB 1CLOH 3D3FA 5K9QG 1OVDA 3QHOA 2WXQA 1RCXB 1ZCOA 4OQ1A 4MXQD 4CCZA 3LRKA 4EI5C 2F5AL 1K72A 4RDYA 4D6FA 1ZTMA 3QXUA 2AJUH 4NRXA 1VBJA 3KL5A 2XUWA 4V1DD 4IHOB 1FVCB 1UZ8A 5C0AD 3V0WH 3VXRB 1WA0X 3W39A 4G9FD 2HWGA 4F0MA 5BMFH 1AMYA 4PY7B 4LQFL 4NQXA 4ONGL 4CA4A 5GGSB 4YWGH 4ZGYA 4ABWA 2HWZH 5HGBB 5DBUA 5ANMA 1HZYA 1FVEB 3AAZB 3F4WA 4PTWA 3SKUD 1U8PA 5C2BL 3OG4B 5DFVC 1B4TA 1BOGA 2NNXA 2VLLB 1PVHA 4U1HA 3MRHA 1P5BA 2GOUA 3QEUB 3KRSA 1XW8A 1YXDA 3PFQA 4DN3L 1RZ7L 4LCCC 2PF6A 4JDEA 3O81A 4X98B 4PGDA 3BVTA 1MXGA 4YFLI 4MNJA 3RGTA 2F8VA 1T20A 4PUUA 3TNNB 4CSZA 1J5IA 4HIHB 4FYTA 2WC3A 1NH6A 1LP6A 1HJVA 2NYYC 1QUMA 3ZMRA 1I1WA 3V6FA 4G7YH 3REQA 4N3TA 2FO8A 1SYTA 5DVLA 2QQ6A 1Z6JT 4MNGB 1U41A 1E8XA 3JYCA 2EH7L 2RFXB 1YEJL 2X87A 2ZOTA 3KLDA 4ZUWB 4ERSH 2EF9A 3E5BA 4HK0B 4QEHA 1OFOA 1DSYA 3GRWA 1DUZB 5DMGD 5IFAL 2ENSA 1TENA 2W65B 1G94A 3FRPA 4P2QD 5BV7C 4PB3A 1X7SA 1A7RH 4HC1H 4IGBA 1S3TC 1EANA 3X11B 1HE8A 3D51A 4UV4L 4D6JA 1UC4A 4F66A 1ZA3B 1FDJA 2YARA 2O61B 1OFEA 3ITOA 1XFBA 2HVJA 4J3VA 4UNUA 1VGKB 2YSSA 2JKLA 4K94C 3WY4A 4DGVH 4L61A 2DM4A 3C8NA 1N55A 3NM3A 2VDOL 4PEEA 1QTSA 3KPSD 3PTDA 2V5CA 3UP1A 2NX5E 3T0CA 4MDIB 1TFHA 4OFDA 1QLFA 4B9FA 1LL4A 3DEQA 5D9NA 3KBNA 1MCSA 1PZ5A 2OZ4H 5E8DH 2VDLB 5CSGA 1CWVA 4OZFG 5HUOA 4F4RA 2X1WL 3T09A 5FOBB 2EKGA 3UADA 4ENEC 1OM0A 5KANI 3EKGA 2H0PA 3IIZA 3K13A 4O1CA 4IBVA 4FS0A 3BGGA 3GO2A 1EK3A 4F2UA 3FTWA 3BJTA 3LKOA 1F74A 4U33A 4LLQA 3VNZA 2W9EH 4XMPH 4QCEA 4OZGB 3PTQA 1K6QH 4QGCA 2HT2C 1SOXA 4WTZG 3L4XA 3L5WB 2FCBA 1FNAA 4NKMB 2APFA 3VNJA 5FYJL 4NZ8A 3UTTD 1XV8A 5I1JH 1QTYT 4EI6A 2WWMD 2KPNA 1TYGA 3WHXB 2O5NA 1W5MA 1A64A 1O4UA 1EEXA 3NVDA 4IBSA 1GHRA 4RH4A 2ZF8A 3T3PE 2O6CA 4JRXB 1ZT4B 4UILL 4EIUA 1CMOA 1EO8L 3MU7A 1QJWA 3MLRH 3W26A 3S9ZA 4LHUB 1WXZA 5HHVH 4OOUA 4QDGA 3LRMA 4A63A 1Z44A 4JIQA 5C0CD 1KCKA 1FHNA 1OAUH 1X7QA 3QJTB 4ABVA 4K6AA 2VR3A 3CB8A 3FJTA 1DQUA 1KYOK 2GUBA 3RY6A 2HXUA 1YMMD 4AE0A 1EKOA 4R4ND 3NJIA 2Y6ZA 1VCFA 5GVJA 1S5HA 3ZSSA 1TZOA 1M6JA 4OF6A 2PDLA 1HT6A 1L9OA 3TCTA 3GWJA 2PBOA 1S1RA 3LZFH 3GSXB 3CZEA 6REQB 1A5AA 1XTMA 1I7RA 1ISZA 3OKDA 4PMYA 4AC7C 5GSRA 4BFRA 1U2CA 1UACL 2NTFB 2VMEA 3N3EA 2P44B 3LKSB 4OCRH 4ONHA 5DJ0B 4YHGA 5K9JL 3KOWA 1L9TA 4GH1A 5DYFA 3FK3A 3W7JA 1CT8A 4DETA 5CJQL 3D9AL 4OTKA 1BVLA 4D9LL 5AW1B 3ZL2A 1RJLA 3RE0A 4FQIL 2AABH 2E7LC 4JIRA 3RJOA 1G7UA 2QDEA 3RK8A 4LPTA 3L1EA 3RUGE 2HX7A 4F20A 3BCDA 1NCBL 4M48H 4FNRA 3VKBA 3CD4A 1BFOB 4QRPB 4NRRA 3SE8L 4XMLL 3WJLC 4BKNA 3UZVA 4NI6A 3W9DB 3IJSB 4JQ2A 4L4MA 4XAPA 1UJTA 3QFDB 4NKDA 4Z7VF 1NUGA 2UYLA 3RKDC 1ZRQA 3MCKB 2AKZA 3T05A 3WLLA 4LGPB 3FU5A 3RUBL 1E6OH 4G8IA 5MI0B 1W0VB 3QUYB 4HGKC 5C3IA 5JW3H 3DX7B 4NHCL 3V0TA 5CC3A 2VGBA 3B8IA 3A6CL 5E9XA 3AACA 5E2WL 4C1KA 1X5GA 3TVMA 4DJED 3GNML 5TGBA 3FOLB 2Y89A 2QKSA 3EJJX 2PCYA 4JKWA 1QBLH 4XX5A 1ROCA 4CMHC 2FFCA 1WBXB 4PBEA 3X14B 1A4LA 5LIUX 2WBJB 5DR5L 1T1YA 2DZPA 2P1FA 2V4LA 5T5FH 2X6CA 3PC0A 5DELA 5HY9A 4ES8A 1FWSA 3CSPA 3DV6A 1XICA 4KROD 2WZEA 3HRZC 1T96A 2INFA 1U8QA 4AXKA 1EXUB 1K3ZA 3H7RA 3MU3A 1I8MB 4MMWA 3MCNA 1E7UA 1LXMA 4MUZA 1UIOA 4HN8A 2WQWA 1XGYH 1RZGA 1V7MH 1K4GA 4LUJA 1X1ZA 4M6MH 3FGCB 5C9JB 3L3HA 4QHLB 4FP8L 1QRNA 4YDJB 4NIYE 3WELA 4PZVA 2ZAHA 2GBUA 3PQYB 1Q6CA 1MRAA 3B5GA 2DIKA 3GI9L 2WQSA 3WBEA 4YZFF 3LB0A 4ACZB 3TDFA 1WC7B 4LSTH 5D6CB 3V0HA 2KPWA 3DBPA 1FP8A 3M1CA 3QMSA 2MKLC 5MEND 2XFWA 4KCUA 4W4NA 3LNIA 4FFWC 1QFWH 3QC3A 3WV0A 4E5XG 4R7WA 2BFVL 3WUBA 1Q13A 1IR2A 1Z9PA 3QJZA 4MG4A 4PMOA 4QCFA 1AW2A 4BWLC 1AD0A 4AGPA 3EOAA 4WFGE 2VXSL 4QLJA 3R6IA 1YNKL 2F8OA 3R19A 5FO9A 3AIEA 2XIIA 2C1PA 2HVKB 1UYWH 4HZLB 3LTPA 1OYBA 5B7MA 1XVSA 4DZHA 3RX2A 3NIDE 5DMKA 3HO8A 1NWUA 4PMNA 4Y1AD 4L4TD 4PJIB 1X7TA 5I6KA 2EG8A 3GAKA 4LLMA 3KDOA 2H3KA 3UETA 3FBKA 2AKRA 1TVHA 5BUPA 2NXYB 5HYJA 1Q9WB 1EHXA 1FFNA 1AZZC 3M0XA 4PY7A 4WU7B 3SUWA 4DQAA 4P2RA 1BEYH 1RJQA 3VC6A 1GS6X 4JQIA 5C55A 1U91A 3GJFH 1HC1A 3M1BB 3P9LB 1QW8A 2J75A 4V1DA 4AKQA 3QHTC 1CENA 1S7SA 2QHRL 2GVYA 4U1HB 1EPFA 3Q2NA 5I0XA 3VIPA 3I2CH 4PWEA 3GNNA 1E5YA 5KSAA 3UD6A 4PMFA 3LB6D 2X6VA 2PDGA 4LUSB 3OZ9L 5ABAA 5IHUL 2WBJC 2Z0UA 3SECA 3A5FA 5FJTA 4DGIL 1RK0A 1LO2L 4P3WA 3MZNA 4KEZA 4O1DA 4H8HA 1W1A1 2VEGA 2GKIA 1W9DM 2YL6A 4M5TA 1N8FA 5FF6A 1E9QA 2VLRB 4JR9L 3WH7A 2C7FA 3AB0B 1UT2A 1U95B 1BQKA 3ASOB 2BP3A 2VZVA 1H6EA 4GI9A 4ZDHA 5BOPA 1JK9A 1AJZA 2MANA 4FG6D 1DQWA 1L9QA 4JO1H 2DZXA 2YXXA 4FL4C 4QE4A 5HNNA 4P05A 2PO6A 4BS0A 1BJ1J 1JNNH 2XN9D 3MV7B 1Z9AA 2DMHA 2E59A 1TV2A 4WOZA 1HYRC 1WF5A 3TH3T 3QS2A 5FUZL 5EO1A 3RA7H 1MJJB 2Q5BA 4HJJH 4YHML 4AD4A 3LVTA 3V5HB 3TESA 4UTAA 2YN5A 4L9LC 5IZ7A 1ECEA 2BBFA 2NVAA 4JTKA 4FYRA 2CALA 3E0IA 1ACCA 5IKCB 4RCXA 1ZLWH 3Q6GL 2EYSA 1LJMA 4Z8FL 3U2OA 2ZUXA 3IGFA 2ZDRA 3KVJA 4P5TA 4NDMA 2VR9A 4WO0A 2WC4A 4F92B 2NW0A 5TH2B 2F5BH 3VOGA 4NT6B 2VDOB 5JR1L 1MNSA 1WYIA 5HHOA 1XXXA 3QDME 5ENWA 4X0VA 4ODSH 3JT2A 1ZA6B 2XTJC 4B5EA 1GOWA 2V5LA 1HI6B 3MSDA 2YRPA 1BF2A 3NQEA 5BWAA 1KJMB 3MHGA 2H8ZA 2TODA 4DYKA 3WD2A 2ZA1A 1NBCA 1YVLA 3H2CA 1ACYH 4B3EA 3M43A 5HJLA 3OVUB 3RJDA 3S2NA 3IBEA 4PV8A 2VZOA 1NZRA 1WS8A 3S6OA 2Y85A 2BXYA 4KJYA 1TWSA 1YNPA 1SUXA 3G6AB 1P4BL 4IL2A 1OANA 1PNDA 3AJXA 3CQJA 4WDUA 1BYAA 3O0RL 1UM4H 1F8MA 3NPSB 4JFFE 1MVYA 4CSSA 3Q37A 4GUFA 1I7TA 2A2IA 2PCPB 1U8NB 3PJSB 5IT2H 2CLOA 4GZJA 3SO5A 4X8GA 3IDXL 3CHXA 4CKQA 5LGHH 3OKKA 3TN6A 4UMGA 4JK0D 4LBSA 3KG5A 2ARWA 4MAYA 4NG3A 4BQ2A 2Y8VA 1RCYA 4L8SC 3TZVD 4NNXB 4YHZH 2QADC 3RB7A 1EJ7L 1SBSL 1YXCA 4DGYH 2Y7FA 2BNQE 3N41B 1OZMA 3N25A 5IDIA 3LYEA 4DPCX 3BUPA 3WIFA 3JTTB 2ZDSA 3KEDA 4JCLA 4RBPK 5C9JA 1S9WB 4NUGL 2IMRA 3F5KA 4GGHA 1RUKL 4K5PA 3T42A 3W7DA 1XF5A 4LPWA 5C0CB 1VFSA 3OPUA 5D2XA 4R7LA 5PCYA 1DVFA 5AW0B 1HINL 5ERWB 4PV9A 4AM0B 4APQC 4BBWA 3A3WA 4UR7A 2ORBL 1K9FA 3M7FB 4N68A 4TNEA 3QO1A 1AKJD 1QNOA 1GKOA 4LAQH 3GIZL 3UZXA 3AREC 1LG2A 3RX4A 4JTCA 3OMAB 2FJFA 4L64A 1Y18B 4PRBA 2Y6SD 4K3GA 2JKRM 1W8EA 4F15C 5FDYA 2PTDA 1AE6H 1CXKA 4BH8A 4I90A 1ZVHA 2PUQT 3LNDA 4PS4L 5D1XB 2IW0A 4YVVA 1AXSB 1J18A 2Q9OA 4N2OA 5EWIL 3TBWB 3ZHNA 5JNYA 4D9LH 1BA9A 1DBAH 2F53D 2CRYA 2QGHA 2IPUK 3AZTA 1ORQB 3VI4E 4QQUA 3US9A 1XGRB 4D7PA 1TPWA 1E4KA 1BVNP 4GAAA 3OLEA 2UYLB 2VDRL 1HL4A 2Y3AA 1IGTA 3QDJD 4EOWH