1JFHA

Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 A resolution.
pubmed rcsb
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jfhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfhA01
4AD4A 3CUFA 2YDSA 4FLOA 4UQEA 1J12A 2ZXBA 5M03A 2O9TA 2FHCA 2VUYA 3WMSA 4HA3A 1HJWA 2X0YA 1G0CA 5EFDA 4D6JA 1HKJA 2WCGA 5EMYA 3CUHA 2WHKA 2WVVA 3A6OA 4IM4A 3KL3A 4E2OA 1XCXA 2XSBA 4AIEA 2ESCA 2CKSA 5D9NA 3L2MA 1WPCA 3AIBA 1UWUA 3PZ9A 2ZUMA 1E5NA 3N15A 1UYQA 3MKKA 1EOKA 4AWEA 2A3BA 4IPLA 1Q6FA 2YFNA 5IHRA 2J7CA 4Z2LA 1EA9C 3K4DA 3A23A 4KRTA 3CZNA 3OZPA 1FFRA 1ZJAA 2EABA 4PEEA 4AD0A 3GXPA 3AHTA 1WE5A 2PWHA 5A6LA 1V6WA 3WL0A 4ATDA 1E0XA 1GQJA 3WY2A 2F7RA 3BLBA 1JDDA 2J25A 4MNMA 3AQUA 3U57A 3LXAA 1UWRA 4AC1X 3WDHA 2X2JA 3L4VA 4U3AA 4XX6A 2YLAA 1BYDA 5LA1A 2G3NA 3PHAA 4WSKA 1V6VA 3BGAA 3AYSA 5A6MA 1WCGA 2YDQA 1VBRA 1RD6A 4GI9A 1O6IA 3L4YA 5IHSA 2BS9A 2BVYA 1E4MM 5ECUA 1IT0A 4ACZB 1GONA 4DUWA 3OIHA 3WEZA 2A3HA 1UZ4A 3SCPA 2C7FA 2GDVA 1D3CA 4AZGA 2EPMX 2CCRA 2EO7A 1JI1A 4LX4A 6TAAA 1OB0A 3WNMA 1J10A 3EDEA 5I6SA 1K9DA 2G3MA 3W24A 8A3HA 3OLGA 2Q8XA 1JDCA 4AZCB 1C90A 2FE0A 4CGTA 4PTMA 1FOBA 4JKKA 4BQ5A 3D50A 2VZVA 4HTYA 2WVTA 4Q22A 1W9DM 1W91A 4WSJA 4D6DA 3WQ8A 2VQUA 4GO9A 3AJ7A 3CHFA 1CPUA 4D6IA 2XYLA 4PMXA 7TAAA 2G3IA 4HMCA 4YHGA 4LQ1A 1E6SM 2J8FA 3AISA 5I0DA 3AXXA 1MW1A 2PF0A 5JUVA 1BYBA 3WF1A 5DF0A 3ARVA 3BUQA 3SCSA 4V2XA 1EQPA 4J27A 3F4VA 4CD6A 2J7GA 4LYPA 4IISA 5E09A 1M01A 4BQ2A 5FCZA 1JL8A 3VGGA 4AXNA 2Y8VA 2JFEX 4KWUA 3FY1A 5IDIA 4DO6A 4BCEA 3SUSA 3AIWA 5M5DA 2XM2A 1X1NA 4MTVA 1ISWA 3A5VA 3AZTA 1WDQA 1FHDA 1TA3B 2A3EA 3U7VA 4F66A 1XYFA 1VENA 3VNZA 1BQCA 4UTFA 5I79A 1MQQA 1QNRA 2VCBA 2G4FA 2X0HA 3AIVA 3CIVA 3PZUA 3OGSA 3DC0A 2YL6A 3AMKA 4D71A 2ZX8A 3AFBA 3WNNA 4FK9A 2Y8KA 3FHQA 5JBDA 1RP9A 3WH8A 1OIFA 2V3DA 3GXDA 3M7SA 1LJYA 3NDYA 1XH1A 4AZ7A 4NXSA 1HN1A 1QNPA 1C7TA 1JIBA 2XG9A 1DHKA 3T0AA 3WD1A 2DQXA 3EJSA 4JAWA 3TTSA 2JIWA 2WB5A 3FNDA 5A6BA 3VGHA 1ITCA 5I2UA 2VX7A 2D3NA 2ZWYA 1F4HA 2BV9A 1HJXA 2VNCA 3WFLA 1H09A 1CIUA 4U5IA 3BMVA 3CHCA 4L4PA 4JCLA 4U31A 4U2ZA 1JNEA 2BFGA 3ZT5A 1UR4A 1OWQA 4D6CA 2VOTA 4WLCA 1CGYA 3VILA 4D6GA 3OGRA 2J8GA 1JXKA 5LYRA 2WZEA 3WIJA 3WL1A 3O6AA 6CGTA 3SUWA 2W4XA 3BAXA 1E56A 4W5UA 2FGZA 1KB3A 3EMCA 1J0YA 1EIBA 2B31A 3ZJKA 1BPLB 1FH7A 3WH9A 1CXFA 3F5KA 1UWSA 3M07A 3ZSSA 1YHTA 2CPUA 5C70A 2ZUTA 3MUAA 2YJQA 1JZ7A 1CEOA 1UWIA 4JL1A 3HMCA 3II1A 5DMYA 2WMHA 4XZBA 4DWSC 1JXJA 2E9BA 4ZEPA 2GVYA 1C8QA 3EJRA 3EJQA 3AIUA 3N12A 2WVUA 4GKLA 1A47A 3SCVA 4PMYA 3GBDA 1MW2A 4ATWA 1JYWA 1GOIA 4FMVA 5A95A 5EFFA 3AYRA 4H8UA 3VU2A 4GZIA 2WW5A 3QR3A 3SCWA 3KE0A 1V03A 3CTTA 4UFJA 1L0PA 3QHNA 5IXEA 3QGVA 3SUUA 1NWSA 8CGTA 5HOSA 1BLIA 4PUDA 4UQ9A 1EHAA 1EQCA 2WKLA 3AXIA 2D3LA 2ZX6A 2VJXA 1XCWA 1PPIA 2OSWA 3QOMA 4MJ4A 3LPPA 3ECQA 1AQMA 3L4XA 1B1YA 1M53A 4ML4A 3CPUA 4N0RA 2XN2A 1HL8A 1E5JA 1CXKA 1KGUA 4NZCA 2XVGA 4NRSA 4P7QA 1QOXA 3WBEA 2VX4A 3M6DA 4AD1A 4ZXLA 2E9MA 3THCA 1Z32X 2Y4SA 3ZSTA 2QMJA 4TVUA 2QV4A 3WD4A 4GINA 2E0PA 1HXKA 5AC5A 3VINA 2EBNA 1J0KA 5I5RA 1KR1A 2JIEA 2YL5A 5LA0A 2GUYA 3O9NA 5M17A 3RM4A 4BS0A 1TVNA 3AXHA 3KEHA 3MANA 1KWGA 2GJRA 3OLIA 1HKKA 1JYVA 2EPOA 3NIYA 1HWWA 5A8NA 2GJXA 3RIKA 3ZO9A 2GSJA 4CN4A 1VJZA 3LPFA 4B16A 3W81A 3EDJA 5DT5A 2W62A 4WJXA 1JAEA 1PIGA 1V3HA 1LG1A 4DM1A 3CUIA 3FXYA 1DTUA 1PIFA 2FGLA 4QLKA 1LQ0A 5AYBA 4CD7A 4AMXA 1PEZA 1DWAM 2OWXA 2Z1SA 1KXHA 1VF8A 5CXPA 5BXSA 2Y24A 3BAIA 3FHAA 1TA3A 5D4YA 4HU8A 1E70M 4CCDA 2X2YA 2JF6A 2YFOA 4MAVA 3ARZA 1B31A 4D6EA 3CZEA 3LXBA 1TQWA 4JFVA 2WZHA 1ISXA 1Q6GA 2ZICA 4F8XA 2OSXA 2VRJA 1U2YA 3WBAA 1XRVA 4ACYA 4CU6A 3B9AA 1V3JA 3K8MA 5A6SA 2XPKA 1H0IA 4AISA 2CESA 1KQYA 1BG9A 1SZNA 1PX8A 4PMQA 1W9VA 3A4WA 1OIMA 2QF8A 1C92A 4AZ6A 1HJUA 1J11A 1AQHA 1V0NA 1E4NA 4J3SA 1GHSA 3CUGA 3HG4A 3RPMA 4CUCA 3WD0A 2XVPA 3SURA 1E6ZA 1B90A 3DHUA 3AI0A 1LLOA 3OBAA 4PBGA 3CZLA 1DWJM 1TG7A 1UZ1A 3WELA 1J9YA 2D0HA 4Z2JA 1PZ3A 3DDFA 3VTRA 2YA1A 2VRKA 1CXLA 1WB0A 1CGWA 3VM5A 2V5DA 2XGBA 2XFYA 2UY4A 4GPNA 1B2YA 3F5LA 1E43A 2HVMA 4IPNB 1HX0A 1QI2A 4GI8A 1VB9A 2WANA 1E55A 4J3UA 4QCFA 3WMBA 3VD4A 2EAEA 4W87A 4PMVA 1QWUA 2NT1A 1WAWA 4H41A 3EJTA 4KRUA 1GQIA 2J47A 2F2HA 2FHFA 3GTNA 1U30A 2ZE0A 3WF2A 1UKTA 4OGZA 1A3HA 1W1YA 1US3A 1KGWA 1RPKA 1CTNA 1ECEA 1OGSA 1QX1A 1TQUA 3DX1A 2CITA 4ZXOA 3BSHA 1GNXA 2WMFA 4PSPA 4W84A 1R8LA 1R86A 4M80A 3MMDA 5GNXA 2WVSA 1ZBWA 1FA2A 2XUCA 3PZOA 3N1AA 2ZX5A 3W29A 4JFWA 2E4TA 1OT1A 1V3KA 1WDRA 2DSVA 3BUIA 3T2PA 1FH8A 5HXMA 2PB1A 4AZBA 3KLLA 3AMLA 1TQSA 3BXWA 3ALFA 2EXOA 3S6TA 1KCKA 4PCSA 2GK1A 4CKQA 3TP4A 1UA7A 1UH4A 5A6AA 2FYVA 1UWQA 3W27A 2F8QA 1DWFM 3K8KA 4OKDA 1UR9A 3ARUA 3VGBA 1NP0A 1NWUA 1EOMA 4DO5A 1MWOA 2EADA 2ZXDA 1R46A 3VMOA 3AS0A 3NCOA 2Y5EA 1MXGA 3ARXA 4DUVA 2IGTA 1MQPA 2WMGA 3DYOA 2W63A 3WH6A 3VD3A 1V3IA 3TV8A 1JF6A 3VX1A 4EK7A 3ZR6A 4FLQA 1UKSA 3KL0A 1GCYA 4LGXA 2VVSA 1OT2A 1VEPA 4LYQA 3NDZA 2D1ZA 3W82A 1VFFA 4MNJA 1W3JA 4AD2A 2V5CA 5CPTA 5C8BB 1H3GA 4FF5A 1S46A 4JKLA 4DWSD 1ISVA 1BTCA 2F18A 2WC7A 1LF1A 1KGXA 2BY2A 3IGUA 3GH7A 1IV8A 4TOQA 1QHPA 3CZKA 1NWRA 1QNQA 3UG4A 1OM0A 2YBTA 1MYRA 1VEMA 2J7BA 1H11A 2CHOA 5FL1A 1XC6A 4V27A 3B9EA 4Z2KA 1RH9A 2QHAA 2BVTA 1U33A 4PTVA 3D5HA 4QLJA 4Z2HA 3SCQA 3ALGA 1I1WA 1UG6A 1MW3A 3ZM8A 2WCAA 4IUGA 4P8UA 2J7EA 3MUZ1 1ZS2A 4QDMA 1MW0A 3TONA 3WENA 2XFFA 3RMEA 3AMGA 2O9RA 4GXPA 4NF7A 1KXVA 3L2LA 3VD5A 7CGTA 2PI6A 2WK2A 3IJ9A 4W85A 1GOOA 4UFIA 4NRRA 2GDUA 1KWKA 1GUVA 1GVYA 4NX0A 1B3YA 1GQLA 3CO4A 1N82A 4QFUA 4FLSA 1TE1A 2D24A 3ZT6A 2VI0A 4JFTA 2WM0A 4QAWA 5I77A 5JIWA 3WH5A 1E0VA 1QNOA 3ARPA 2DT1A 2DPEA 2CIPA 1JZ3A 2W5FA 2WMJA 1UKQA 4X9YA 2UY5A 4P7RA 1US2A 5A3HA 1ZU8A 2O9OA 3UESA 2DSZA 2VZOA 4M1RA 2VC9A 2VTFA 1UUQA 2CBIA 1W2VA 4UZUA 1VFMA 1BGAA 4TTUA 4PTXA 4XUYA 1GOKA 5D9OA 1B9ZA 4QLLA 3WDPP 2XVKA 2YIHA 4LYRA 4ZE4A 5CLWA 5GNYA 4UQBA 3ZJ7A 4UQDA 2D20A 3W53A 1TQVA 4ZE5A 1SFSA 3AIEA 1JD9A 2RGLA 4HPGA 4W8BA 1B3WA 4KGLA 3RJYA 1UA3A 1VFUA 3UR8A 5CLTA 3W6LA 3CC1A 3WUGA 3BAYA 2J7HA 3GNOA 2WMKA 2FH8A 2XGIA 2XM1A 3CMJA 3A47A 3VIGA 4MDOA 4MNKA 2BY0A 3GNRA 2WBGA 3SIMA 1FH9A 1JYNA 2X2IA 2RGMA 2VRQA 3S5ZA 1E71M 1UOKA 1R34A 2YDRA 3G6MA 2VL4A 2C8NA 4GZEA 4W7VA 3VDAA 3RO8A 3BAWA 1FP8A 1HP5A 3IJ8A 3IAPA 3T08A 3MS8A 1UD5A 2BVDA 1EDGA 2J4GA 1K9FA 4XB3A 4TXEA 1JD7A 1QHOA 4OBSA 5CPSA 4RE2A 1MFVA 5I3DA 4HPHA 3THDA 2GFTA 4AD5A 4JFSA 3AS2A 3A21A 2ZUNA 2WSKA 2DIEA 3WKZA 4HZ6A 5E70A 3CLWA 1R33A 2ZUWA 1QW9A 4AYGA 2VCCA 2WBKA 4P8XA 4U3CA 2VVNA 3DX3A 1KXTA 1H0GA 4AEFA 4MB4A 3KZSA 2ZXQA 1HIZA 3ZMRA 2DT3A 4PCTA 3UR7A 3BC9A 3CZSA 1DP0A 4X0VA 1E6PA 3DYPA 4GO8A 4HA4A 1EXPA 3WD2A 1C8YA 2OW7A 5FKYA 3GNPA 3PBGA 4CD8A 2D22A 5HPOA 1KCLA 1UD4A 4OIFA 3WFZA 3CZJA 3MI6A 1M03A 4AMCA 3WSUA 3ZJ8A 1E4LA 4F79A 1V3LA 4H04A 2MANA 3GXTA 2BXYA 3CZ8A 4HZ7A 3WQ6A 1Q6CA 3B8SA 4D6FA 2DSKA 3WNPA 1UR8A 3O2LA 3AS1A 3PZNA 1NOFA 4CD5A 4U33A 5BCAA 4BA0A 4D6HA 3AS3A 4DWSA 3GXMA 2WXDM 3ARYA 4M82A 3WUEA 3BLPX 2EQDA 2PWFA 4PSRA 3WF4A 4WKHA 2BHZA 4AY1A 3GH5A 4GQRA 1J0IA 3VDBA 3ZQ9A 4NSBA 3VOCA 2E8ZA 4S3JA 4OOUA 4F9JA 3L4ZA 4UCFA 2Z1KA 4AW7A 1K9TA 5E1QA 1WO2A 1CBGA 2VT0A 2BHYA 5ABHA 4FNTA 1CECA 1UKPA 5A2BA 5A8MA 1C7SA 3RJXA 4AZ5A 4E4PA 3HJEA 1ODZA 2YBUA 1CENA 2OYMA 5BXPA 1NM9A 4GIAA 3VGDA 3KLKA 4AEEA 4CU8A 5A2CA 4MADA 2W67A 4P8VA 3LRLA 1KBBA 3NSXA 2E9LA 3IK2A 3AROA 3VIOA 4NXKA 3BSGA 3CBWA 2WWDA 2DH3A 4D1IA 5FL0A 2F61A 1H49A 1BG4A 1ZJBA 1TVPA 1W1TA 3U7BA 1E73M 1ZBKA 5GQBA 4Z2IA 2YLLA 1NARA 2CEQA 5HBFA 1OGBA 3PZTA 4UFKA 1W9XA 1GZJA 3AHXA 1NP2A 4UZSA 4URIA 4F9DA 1E15A 5EBAA 4AD3A 1HTYA 1G9HA 1C8XA 3GDBA 3WD3A 3AMCA 2W91A 1E1EA 3RCNA 3U5YA 1JNDA 1BYCA 4EAMA 5A8OA 3A24A 2WYSA 3WQWA 4QP0A 3K46A 2QPSA 2DT0A 1KBKA 3TTQA 2WPGA 3GM8A 1V0LA 2YOCA 4JKMA 3WF3A 1TMQA 2VO5A 1UD3A 5DO8A 5BYWA 3AICA 4XV0A 4ACZA 1OINA 3PZMA 3MU7A 4W88A 2G3JA 3FAWA 3VO0A 4UFLA 3VM7A 3AHZA 1IZKA 4EANA 3CHEA 2F7PA 2CBVA 2CHNA 4PMZA 1PJ9A 2OWWA 4GZJA 2OYLA 3ARWA 1PX3A 4FNPA 2CETA 2XN0A 2CBJA 5DT7A 2QPUA 5HDRA 1ZBCA 2XN1A 3OLEA 4A3YA 3TTYA 3VKKA 1BFNA 4M24A 2WZIA 2YA2A 1JG9A 3UETA 2BNJA 3WEOA 3ZIZA 5I23A 1NOWA 1LWHA 4W7WA 1WP6A 3UG5A 5ABEA 4L4OA 2J78A 2EEXA 3VIHA 4HOZA 3VIKA 3ZR5A 1E0WA 3MUY1 3DX2A 1E9LA 1W1PA 2PBOA 4M29A 4B9ZA 4A3HA 5E0CA 3OG2A 5D9MA 4M81A 3VNYA 3PTQA 1WZLA 1VFOA 4FLRA 3BMWA 4H8HA 2CERA 3I3DA 3BUPA 3BVUA 1JFXA 2XTKA 1GPFA 3WH7A 1AMYA 3A4AA 1HVXA 1QBAA 1W9PA 4J3WA 3BUDA 1PAMA 3T2QA 3M46A 3WY4A 1QNSA 4J3TA 3VSUA 4D1JA 5AYIA 3IJ7A 5DEZA 4JCMA 3VIIA 3CGTA 4PMDA 3ARSA 4J7RA 1V3MA 1PX4A 3HG3A 4FNQA 1GHRA 4W8LA 3N04A 3FN9A 1BYAA 3GXNA 4JFUA 3TTOA 4W5ZA 3N11A 2X05A 1XSJA 2OW6A 1WZKA 3EDDA 4J3XA 3GXIA 1QWNA 1XHGA 3E1F1 6A3HA 2O9PA 4C7FA 1R7OA 4YPJA 4TX8A 1D2KA 5A94A 1DWIM 4H8VA 4JHZA 2F7OA 3AZSA 3KL5A 1T0OA 3WQVA 2JF7A 1EHNA 4CN6A 1EO7A 2NSXA 2WLZA 3SCRA 2CXGA 3SCNA 2OYKA 5IFPA 4M56A 3ARQA 5A8QA 1JAKA 3EJUA 5ABFA 1V08A 3CUJA 4MB5A 3VDCA 1BGGA 1I1XA 4P7LA 3TOPA 1MQRA 1M7XA 4N42A 2ZWZA 1H41A 3ZT7A 1UR1A 2E40A 1XH0A 4H2CA 3AMDA 4UOQA 1QPKA 4HOXA 1R47A 1WKYA 1OD8A 1XD1A 3EDKA 2WMIA 3CMGA 3WY1A 2VCAA 3D4YA 5ABGA 5CG0A 5C71A 3VIPA 3POHA 1E6NA 3EBVA 4PMUA 3CV5A 4DWSB 2WLYA 1EO5A 4UR9A 1BAGA 1BVNP 3RM9A 3DYMA 3PTMA 3A22A 3IAQA 4XZWA 1EGZA 1DEDA 2E8YA 4UOJA 3AZRA 2VZTA 2XJ7A 3J7HA 5HPCA 1JZ8A 3DHPA 4U5KA 3EMQA 3WUBA 5BXRA 3NSNA 4MB1A 4TVDA 5E0FA 2XVNA 4HMEA 1G94A 1W2PA 4PMNA 2E3ZA 3VVGA 1B0IA 1XGZA 3PZGA 1H2JA 2WVVB 5A2AA 3W37A 5E9AA 3SUVA 3W25A 1XSIA 1C93A 3WN6A 4UQAA 2ZUUA 1EDQA 3RDKA 4AIUA 4K68A 1WDPA 5FIPA 2J74A 3GZAA 3HG2A 1VEOA 1M04A 2W61A 1GJUA 3A4XA 3NYDA 3BVXA 1WDSA 2DT2A 3LXCA 3MV01 2ZOXA 1AVAA 3VSTA 4R5EA 4KGJA 2VURA 3WNKA 3S2CA 1V0MA 3AHYA 1TR1A 2QLYA 1XD0A 3BCDA 3LX9A 4HZ8A 1KTCA 3K4AA 2VX5A 2UY3A 1ZB5A 3VPLA 4Q7NA 1Q6DA 1LL6A 5CSUA 1TFVA 2FH6A 5BWFA 3RILA 1RP8A 3UERA 1ITXA 3QOKA 5A1AA 1K9EA 5JBFA 5GPRA 1B30A 1ZBVA 4MJ2A 4DM2A 4HA1A 1BHGA 3GH4A 3TA9A 3D4ZA 4P8WA 1EDTA 1E3ZA 3L4WA 3S5YA 1E6RA 2DGAA 2VX6A 4BF7A 2X09A 4Y7EA 2AAAA 4NZJA 4OBRA 3WQ5A 1NH6A 2DSWA 3BUBA 1HJSA 2F1AA 1ODUA 5BRPA 1J0JA 1Q6EA 5KEZA 1UASA 1P6WA 3EDFA 4JIEA 2VR5A 4LPCA 3VMPA 1G5AA 2DEPA 1UH2A 1R85A 3EJPA 2ZIDA 1OGGA 2JEQA 1DWHM 1UH3A 5HNNA 4JHOA 1EH9A 3PZQA 2YKKA 2JE8A 3VMNA 3SCUA 4MAZA 3JUGA 3K1DA 1JI2A 2W92A 1KQZA 1XSKA 2NT0A 3ZJ6A 1W3LA 1BVZA 1W3KA 2IXUA 1V02E 4AZCA 2A3CA 1CXHA 1GW1A 1W1VA 4P7NA 3HG5A 4U2YA 1JYXA 5A8PA 5IFTA 1GOQA 1E6QM 3FW6A 1HP4A 3K8LA 2WC4A 2ZUSA 2DH2A 1C3FA 3GYCA 3BAJA 4HU0A 2EPNA 1W9BM 1TQTA 2X8RA 2YA0A 4X0NA 3WDRA 1L8NA 4WKAA 1PZ2A 1GVIA 2Y2WA 4FNRA 5D8WA 1CGUA 3CH9A 4H7VA 4TTGA 3ARRA 3N13A 4W8AA 4OJYA 3I3EA 3PZIA 5CQ1A 3D51A 4AMWA 2A3AA 4WF7A 1WZMA 3ZOAA 1ISZA 1D7FA 1HF6A 2JEPA 2PC8A 3L4TA 3W38A 5E6ZA 4GQQA 4J3VA 3IANA 5A6KA 1B3ZA 4CU7A 3MO4A 1TZ7A 4PMOA 4DO4A 3G6LA 3GBEA 1OBAA 1H5VA 2AOSA 4M8UA 1VRXA 3MUIA 4Z2GA 1CXEA 1CGTA 4TUFA 5CGTA 1PBGA 1V6UA 4PUEA 1GOMA 1UD6A 3BVTA 4PN2A 4OUEA 3WDJA 1B3VA 1G01A 1O7DC 1CNVA 1PS3A 1QI0A 1LL4A 3NUKA 3OZOA 1CXIA 3W4RA 3MMUA 5AY7A 5LA2A 3WY3A 5D8ZA 3VUPA 7A3HA 2V3GA 2BY3A 4CD4A 4YN5A 3A3HA 2WHMA 1VIWA 2WHLA 3OA5A 2J79A 4GI6A 3POCA 1JDAA 1JZ2A 5CSYA 1CWYA 2XWEA 4RL3A 4FNSA 1QHZA 3W28A 1HKIA 4ZFMA 2UWFA 5BROA 1R87A 1GOWA 3LPGA 2EPKX 2XFRA 2EACA 2CBUA 4S3KA 3VD9A 4PYSA 5I24A 3NJ3A 4ATLA 2FHBA 2XSAA 1KXQA 5I78A 4EKJA 3N18A 2HISA 3LMYA 3CZGA 1KFWA 1F4AA 2OLHA 1OD0A 4JZ5A 3VX0A 1JGIA 5JIPA 3SCTA 3D3AA 3CHDA 4TVCA 3PZVA 2DDXA 3U5UA 4OOZA 3VD7A 3L4UA 2GK1B 1CGXA 5TD4A 1UQZA 2XIIA 4NZFA 4UNIA 2OSYA 2G8ZA 2YL8A 2WMIB 1H4PA 1MFUA 1DWGM 5FOOA 1W3HA 3H54A 3I3BA 1HKMA 2V38A 2J7DA 1GJWA 4AZHA 4AYSA 1CGVA 2WC3A 2XIBA 1E72M 1H1NA 4BQ3A 2D73A 3LRKA 1GORA 1CDGA 1HL9A 4C7DA 2XVLA 1UR2A 4W93A 5CPQA 4EE9A 2CKRA 1FHLA 4PRWA 2CYGA 4PTWA 1NQ6A 2EPLX 2VMFA 1BF2A 3T0BA 1HJVA 4WIWA 3ARTA 1W32A 4J28A 3MSGA 4KH2A 4QCEA 2NW0A 2PWGA 3RM8A 1SMAA 1J01A 3BVVA 5E6YA 3VIFA 5ABFB 4B15A 1YQ2A 5A69A 4R27A 3DECA 2BXZA 2V3EA 4NI3A 1QI4A 4FNUA 1LG2A 1NWTA 1I75A 2VR4A 1QI3A 1Y7VA 2UY2A 3WEMA 5KZ6A 4BQ4A 1HJQA 3WQ4A 5AC4A 2ZX7A 4RE4A 1O7AA 9CGTA 4UQCA 1C91A 4TX6A 2TAAA 1WZAA 1UQYA 4KMQA 1HT6A 3HZ3A 5A6BD 3N9KA 2WAGA 4RE3A 1GQKA 2FDMA 4W86A 1ISYA 2D0FA 3QHMA 3LPOA 5A6JA 3PN8A 3AOFA 2J75A 4MPKA 3VGFA 2GJXB 1V02A 3WNOA 2V3FA 1FFQA 1WNOA 4E8CA 1V0KA 4PMRA 1XYZA 3BCFA 3B9DA 2WKGA 4P7OA 2XHYA 2YL9A 1VJSA 4CVWA 2DSUA 1LL7A 4HMDA 3LRMA 1XH2A 4WKFA 1MXDA 4HOWA 3W26A 2C0HA 3FAXA 1K6AA 3AHVA 4MNLA 1UKOA 2WSPA 1JF5A 3UEQA 3WDQA 1QVBA 1AQ0A 1SR0A 1ZL1A 1OCQA 2PWEA 3PTKA 4HP5A 2EJ1A 3VGEA 1SYTA 2WWCA 3NSMA 2WNWA 4A4AA 3EMZA 1KR0A 3WDIA 1E40A 3T0DA 3MMWA 3AIRA 2AMGA 3VDHA 1OSEA 3AIQA 2JALA 1CLXA 2WHJA 1JFHA 1SMDA 4B3KA 3BVWA 3BLKA 1QI5A 3DX4A 1X6NA 2F7QA 2ZXAA 1TUXA 1UWTA 3WMCA 3SUTA 4CCEA 3SEPA 2ZX9A 2VZUA 2BY1A 2G41A 1X6LA 1R7AA 2F1BA 4CN1A 4AIOA 3QHOA 1LWJA 4WK9A 4LXFA 3VSVA 2PBGA 4W7UA 1KTBA 4BZYA 4CCCA 3BH4A 3H53A 1UHVA 1XV8A 1JZ5A 2D0GA 1E3XA 1E6XM 4UFMA 1J0HA 1NOUA 1B3XA 1VAHA 3WUFA 1TCMA 5JBEA 5CGMA 4V28A 4AZIA 2ALWA 5F7UA 4D72A 2X1IA 5BXTA 1HVQA 3W6MA 3MV11 1R75A 3KWXA 2WCSA 1G1YA 2X2HA 4B9YA 1CYGA 3EYPA 1MVYA 4E8DA 3HU7A 1J18A 1QW8A 3OB8A 2J77A 3DX0A 1V6XA 1UD2A 1CZ1A 5EB8A 1E1FA 2J62A 3APGA 1Q4NX 3T09A 3DDGA 5BRQA 4YHEA 3F5JA 3WF0A 1HXJA 3W0KA 4MB3A 1ESWA 1IZJA 1E4IA 3N17A 4DUXA 4MDPA 4UOZA 1UR0A 1QBBA 1W9UA 4OZOA 4ZENA 3WNLA 5GNZA 3T2OA 3UCQA 4CVUA 1V6YA 3H55A 5D9PA 5CZKA 2QMKA 1FP9A 5CJ5A 5M3WA 5DFAA 3VIMA 2PWDA 4JL2A 1VBUA 2CNCA 5FD0A 1JZ4A 3MSDA 2O92A 2ZUVA 4C7GA 3UG3A 2VZSA 1UD8A 2D23A 2W66A 2IXVA 2VQTA 2DIJA 2D2OA 3BAKA 1HNYA 1BSIA 3VIJA 2BHUA 2OWCA 3HN3A 4B3LA 2GJPA 4W89A 3GXFA 2IUZA 4UFHA 3D52A 3OGVA 2XWDA 3SCOA 1CLVA 2J7FA 1JZ6A 1J0ZA 3OLDA
chains in the Genus database with same CATH superfamily
5BV7C 3EH4B 3N9GH 2BCMA 1F58H 4FFTA 3WIHA 5EZOL 4RGNB 4UQEA 2ZXBA 2EG6A 2IDSA 3TUUA 1VSCA 2R1WB 4FYRA 1FL5B 1W1ZA 5CCKL 2D9QB 3ATYA 1C9DA 1A7RH 3CLFL 4FKEA 2VDQL 1O6VA 4LRNL 4EQ3A 5I1CL 3OKNB 1G0CA 2YQGA 3FFCB 3F8UB 4M7LL 4A7SA 4ZFFA 3MTXA 4Z7IA 1U83A 3GT6A 1CW2A 4GVHA 3V95A 2XN9A 2DZVA 3LCGA 3H8AA 4OLUL 3PB0A 1E4XH 1HKVA 3KH4A 3L7EB 4L4TD 2WXFA 2PEVA 3MP3A 4XBEH 3QH3B 1K03A 3VVVA 2BP1A 1DE4A 3NZUA 2WHKA 5GS2D 1J8HA 1A5FH 1FNFA 3P4MB 4KKPA 4YXKH 3A6OA 4REQA 1XF5A 2SFPA 4YSPA 4NZTH 1XCXA 2P8MB 4AIEA 4D7PA 4OM1H 2XZZA 4K9JA 2ZVRA 2VLMD 4GAGH 1D6VL 4XBGB 3L2MA 2H2SD 1SW3A 4XPFH 1EFQA 2ATPB 1OEZW 4Q9CA 5FKPB 1YEIH 4G9FE 3B3IB 4RK8A 1BP3B 3E8UH 2EKJA 1I3RB 1IM9A 1T5WA 2QZ5A 4P5MA 2ADFH 4U6HA 3VD1A 4G7SB 3IARA 3PZ9A 4KZEH 1TQBC 2ZUMA 4F7PB 3N15A 2FKPA 1Z42A 4AWEA 1FHGA 3NEHA 2A3BA 4P2QA 4Z2LA 2X9ZA 4K5NA 1P9MA 3UYOD 3QZOA 3FT4A 3MTWA 4N2OA 4MSSA 3PUGA 4MY1A 3U6XS 5IHRA 1NBQA 2ZWSA 3SJVD 3TCLA 4F7CA 4PJDA 1ZLUK 2DUZA 2E7DA 1UCBL 5EUOA 4HS3B 5C0GB 3IJEB 3FF7A 3P60A 4Z1CA 3KBJA 3A23A 3PU7A 2BASA 2V5LA 2IO5A 4RDWA 3PWLB 1ZJAA 4XX1G 1RJYB 1J93A 4OAWB 4MKTA 3NIFB 3KBPA 4FFZH 3AHTA 4WJ5B 1WXYA 1WE5A 1COBA 2PWHA 4YBQD 5FOBA 5LG1A 1A64A 4HUMB 4CC4C 5I1AB 1FA4A 1G6CA 1L6WA 1O4UA 3WFEH 1JPGB 2Z91B 4LRNH 2FIKA 1GQJA 4O51A 3GIZH 2BVQA 2ZTJA 5FGSA 2J25A 3MJYA 3WJMB 1TF4A 3TYEA 3SGGA 4CLMA 4NHCH 3LXAA 2ORBL 4ORZC 4UZGA 5D2VA 2GBTA 1KB9K 4NNPL 3UAJA 3TQKA 3PPEA 4PJXA 4QXWA 3GE7A 2C1GA 2CBOA 2G75A 2YLAA 3MUGB 5DD6A 5IB3A 1MO0A 3DFQA 1D5MA 2ZG3A 1DZ0A 1R5VA 3LV3B 5G1MA 2GQAA 1RV6X 3TJIA 4G6AD 2AQRA 2PYED 2AHIA 1V6VA 3MCMA 2H2SC 3ROOA 5C07E 1UFGA 3GW0A 2IKHA 2YDQA 1N8ZB 1X9UA 1CVRA 1RD6A 4AJYV 4YXLL 2AABH 3MV8D 3KBSA 4IQLA 3X12A 5TQLA 4LHJB 4M6OH 4QRTA 3L4YA 1O6IA 4WR3A 3BUVA 2W9EL 4Y2LA 4D8AA 3GBML 3RWIB 1XQKA 4LHUA 1MDTA 4UILH 5IW3A 3E9AA 4ACZB 3DJZA 4XVUC 4DUWA 3OIHA 3ET9F 1EFXB 1MRDH 3GNMH 3DX7B 1FYHB 4S1SH 3TXAA 4YSQA 3N1QC 4CMMA 3L16A 3L3KA 3QEUA 5T5FH 3QUYA 3RVXD 3X3GH 1J05B 2Q6WA 3DN5A 4PR4A 3QUKB 3SCPA 5CBIA 4QNEA 4DTGL 5T8IA 3UPBA 3ENEA 1QLFA 1JI1A 2EO7A 2VDNL 4ICWA 1A4CA 1Z48A 5DDHA 2CCRA 4J9JA 5D2YA 1XR9A 3BE1L 4D8PB 3GUGA 5FGBC 2IWGA 4LVOB 5AVTB 5EFIB 4HKBB 4C4BA 3HC4H 2C15A 4FHKA 2CCLA 1UTDA 2QDVA 2XG4B 4A2DA 2W27A 4IF2A 5C09D 3TW9A 1JQXA 1H8NA 2B5IC 2NY2D 2JJWA 4HLJA 3SW6A 1OF0A 1WCBB 2FE0A 2XG5B 1BXVA 4Z95L 5HDBF 3TBVB 4APXB 4MAYC 1FOBA 3BGMB 4KRNA 4FXJA 1I9IH 2HT4D 3ABSA 4A3RA 1H6FA 4ELME 3FCGA 4KY2A 5D5ME 1EFZA 3QUZA 2PR9A 3QIBD 3P0VH 2H32H 4HETA 4OKVB 3HFFA 4XPHH 5IM7B 4HUCA 1KRCC 1W9DM 4S39A 1W91A 2L7QA 2Z1XA 3NJVA 3SDYH 2CDFA 2Z31D 3EJZD 3OXRB 2FRGP 4HYWA 2KX9A 5IEHB 1E4KC 3H4XA 2B9AA 3C8DA 3EXLA 4V33A 3TJPA 3C09C 3V9CA 2IALA 3CHFA 4O50A 4D6IA 5FYKE 4H1LB 4XC3H 1VA9A 3IETB 4M93C 4PGJA 3LZOA 4NNXB 1BXBA 1L2UA 1FGVL 2B4CC 2XYLA 3W0WD 7TAAA 4IDJL 1DIEA 2G3IA 3U36A 4PVLA 2XXCB 3U9WA 4LQ1A 4B6ZA 4C57C 1E6SM 3RO6A 1ZV2A 3UAEA 5KS9E 3ARBB 2Y88A 1VRSA 3PNZA 2ESVA 1I6NA 3GHRA 2DQWA 4Z7WA 3MNWB 4Y7OC 4G43B 3NVDA 5DF0A 2PDNA 2LAGB 3LZ3A 3LNEA 3SCSA 3N4FA 3E9TA 1I2RA 4P23B 2I5QA 4QEEA 1EQPA 4X9GA 5L9DH 4JREB 1KDIA 5LLIC 2VDNH 2N56A 4H4NA 3F4VA 3BGMA 2I07A 3GIVB 3M4HA 3QUXB 2J7GA 2PDCA 4LYPA 5CG7A 2I17A 4PJXF 4IISA 1HIMH 2HP4A 4B95C 1I1CA 5E09A 3FOLB 5DVPA 1LNUA 4Y7MA 3RY4A 2QYGA 5A5WA 1JL8A 2J57A 4M62L 2KZKA 5KJ7E 5FF4A 1U8IB 3H42L 3R7RA 4AXNA 2Y8VA 2JFEX 3U2OA 1EXBA 3FY1A 3KFTA 5C07A 3SUSA 5EZIL 5M5DA 3RY6C 1P5UB 1WK0A 3V0FA 2IKGA 2VDHA 5KYNA 3W73A 1LL1A 3CFMA 2PCYA 4H25A 2DORA 4OZIA 4DWSA 3NMEA 4HLZH 3TT1L 5T3ZE 5I26A 4F4RA 5I00A 1RHFA 1I1FA 4IHBA 2LU3A 1KJMB 3LU2A 1XYFA 4JFFD 2AZAA 2O5XH 1QFUH 5HTSA 5GJSL 4NKDB 3ZHDA 2VH5H 4I2XB 1U36A 1L5GA 3ML9A 3PG2A 4RZCA 4ELKB 1BQCA 5D2NE 1LT8A 4UTFA 2VLJA 4XP5H 4I9MA 3B04A 2I24N 1MHHA 2EHHA 1HAUA 4G7YL 2HLFC 3DJRA 1ASOA 1FBIL 2QDWA 1GY1A 3L1GA 4M5ZL 2QT3A 3PZUA 3VOIA 4OF3A 3REQB 3H2AA 5FF2A 3BN9C 1HQRB 3M8OH 3RA7L 1JV2B 3QC5X 2J2ZB 2Q2EB 4NN7C 3ARED 5IJKC 5G5IA 1RPQA 3WK1A 4YXGA 4J8RB 4AUBA 5IMMA 5KSAB 3NEXA 5EDSA 3GIYA 1X39A 4M61B 1LNUB 2Q87A 5FS5A 1DUYB 4ZX5A 3TNMA 1DOSA 2Y8KA 2ITFA 3RWHB 3CV7A 4Z1AA 3NQBA 3B7SA 4JJ5B 3DKLA 3LZRA 1TTFA 4GG6B 5JIQA 1F8TH 2EEFA 1DCLA 3ARGD 4K94L 5L2KD 3SSJA 4XZ9A 1TJXA 4AG0A 4AZ7A 5FOBB 3RWDA 5EPMA 3ZE1F 4BI7A 1T7YA 4DGVL 3NCBB 4Z17A 1QNPA 3NIDB 5CILL 2NY5L 1P4BL 5D5MF 3S35X 4IIGA 3ZR4A 3V0VB 1R3LA 3MRPA 1N3NB 2ZWNA 3T8LA 4AKQA 2Y23A 4JM2F 2HLAA 1TPB1 1PAZA 3IGAA 5DXWA 1INQB 2CKBA 3SCMD 4P0DA 3TTSA 4AWUA 4IOIB 3VGHA 4B60A 3SDDD 5J13C 3G1HA 3BN3B 1LTXA 1FJ1B 1YLBB 2YYUA 2VNCA 1H09A 3U83A 3OKYA 4U5IA 3ESVF 4JCLA 2GK0B 3BCJA 3FUNA 1FN4B 4PS7A 5DVLA 2PP7A 4U2ZA 3ZZSA 2DQDL 3O4OB 1QPOA 3TSBA 2H9GA 4OLUH 1JNEA 2BFGA 3VIPA 3IVUA 1FAIL 3MSYA 3QEQA 2J56A 5CNHA 5DD3L 1BXXA 2CPCA 4WDIA 2GSIA 4WLCA 5DCDA 4O4VA 1QSEB 2CLRA 5IQ7L 2V5SA 1NGWB 4E68A 3OGRA 3DFYA 3OPZL 3APFA 3IFOB 2V2WA 2GVGA 3EWDA 4WDTA 2ZSWB 2N0MA 2QUNA 2RDXA 2W4XA 4JY4A 3I65A 3RTQB 1ZK9A 1OC5A 4ZUSA 1HCFX 1VQTA 1SEBA 3UOAB 3PP3H 2ZZ1A 4UIKL 4QG9A 2XKNA 1ZLPA 3QFEA 3BKYH 1SLUA 1EVUA 4IIQB 2OLSA 3CSTA 2BC4A 3ULVE 3DI0A 2C19A 4QRPE 5GZNC 3DK2A 5JA8B 3PCYA 3ABXA 4ZTYA 3QDJD 3WH9A 1CXFA 1J86A 3R8HA 2R8SH 3F5KA 4HZAA 1BBDH 3BVNA 3HMXL 1B0RA 4RFNB 2CPUA 2J5LC 3SIKA 1OAYL 3PABB 5C70A 3ULVC 5EEXA 3MUAA 3H2EA 4PP1D 3BEWB 1WGOA 1UA6H 1KLGB 1ZS8B 4R83A 1FFPB 1P4IL 2D4FA 4FG6D 1J5IA 1HHHA 3KNBA 2NTFA 3RWIA 4AM0Q 2ISDA 3AT8A 5KSVB 1IMHC 3L5XL 4G6FD 4Z18A 3QXAA 1UWIA 2REQB 4R3SB 3IGHX 3DPBB 5EO1A 2R14A 5DMYA 3HMCA 4HDIB 3BKJH 2E9BA 3MLRH 3PNWB 1E5CA 1GTEA 1C8QA 1L9OA 3U82B 3WLLA 4LLVA 1QA9A 1ONEA 3PBYA 4XQ6A 2QVKA 2IH3A 4C83A 2GGEA 1Z0MA 5BU9A 4DGUA 1S5HB 4LPWA 3N1MC 4XVEA 4KDVA 4PJ5A 4QT5A 5HGDA 1ZHKA 1Z0NA 5IB3B 3SGKA 1Z3RA 4J3OH 3HS0B 4ATWA 2A74B 2EILB 2GTWA 4JHAL 1JYWA 1ICQA 2X16A 4KFOA 4PUNA 1EUAA 4KI5E 4B5NA 5A95A 3B7UX 2J6EL 2NXZB 5JQIB 3VFMB 5KYYA 4IK7A 4H8UA 2NY0D 4NAJA 1IGCH 2AKRA 5CEXA 3APMA 3DHFA 2C4FT 3QR3A 4IH3A 2WYTA 3T1WA 9XIAA 1GSMA 3LXUX 4DVRL 1QEWA 1KCSL 3CEPA 1XIIA 3QGVA 3WBDA 3RY5A 3QHNA 4WZHA 5AECA 1Z6KA 4IMKA 3HAEB 5GZND 8CGTA 2FZ3A 3G5EA 1ZTVA 1NIUA 5HOSA 3A4JA 1ES0B 4NZ4A 5EOCJ 4E41A 5IJDC 5KVGE 4LSDA 4UUJA 3ULVD 3L5MA 4XBGA 1MNSA 1JN6B 3QNYB 4JY6A 2ADJA 1HQ4B 3GMNB 2VYOA 1NKRA 3JU2A 3W1UA 3THUA 2X0UA 1K8DA 3F00A 4MJ4A 1KGJA 4PJ7E 5F97E 4EXPX 5MP6L 1BKSA 4LH8A 1ELSA 1T5XB 4PJBF 4LDEB 4ZFOA 3K2KA 4M4RB 1MREL 1YJDL 3VFNB 1RK1A 2CHDA 1JMXA 3FULA 3QDHA 2YR3A 3P14A 5DEFA 5AC7A 2VE6A 3IDGA 3VB8A 2QCNA 3C6LB 4LIQE 4Y9OA 1QO3A 2BB0A 4KRPB 3SDXE 4G2AA 1OF2A 1OGPA 3N25A 1EAPB 1PDZA 1ESOA 3M6DA 2VX4A 4M7ZC 5ENWA 4JNMA 1IQDA 4L61A 3OBEA 1Z32X 5D70H 5CKAA 5IBTH 3T0VA 3R11A 2HLFD 1PYWA 2JCCB 1ZLVK 1AKJB 3ZSTA 1E5UI 1EF3A 4TVUA 2AV7A 4UTAH 2CLZA 2QV4A 3QZWG 4G7FA 3WD4A 2SEBA 1FSKC 4GINA 4LS1A 4AV4A 2OO6A 5KVFH 1JNLH 4W4OA 3APTA 5A40E 3NCJH 4OGYH 4GWEA 1ICTA 3LHZA 5JMUA 4S2CA 2NNAB 4H0IA 4PTUB 1MSSA 4OV5A 1J0KA 3RZCA 1I7ZB 5JDSA 5C8JB 1KR1A 4K8RC 1KFCA 3QNYA 1Y1DA 4CVZA 2OSLB 1OX5A 4Z42C 4KQ4L 3IUDA 4HIIA 4BS0A 1E7VA 3F12A 4KHTL 4YDNA 1TTQA 2PFHA 1M7IA 1P7BA 4YLCA 2FZ3B 2PPEA 4KZCA 3II3A 3MANA 5B7ZA 5IBXA 5KSWA 3NQIA 4PJEB 1H50A 3O4LE 3SO3C 1MMFA 3KR3L 4X99B 1KWGA 3C60C 4DH2A 3F7KA 2YRBA 4QLWA 4UCGA 4L5FH 3IMBA 3QHZH 4UMBA 2EPOA 2JK5A 1C08A 4XNZC 4DJDD 5AOLA 5SV4A 1I8JA 4S3FA 3DX8B 4WO4D 3T3MB 4X42A 3RIKA 4Q9RL 5FYKD 1T83A 3CHRA 2GSJA 1Y5VA 4O13A 2F5AL 3LPFA 2HFFA 3DJSA 5EEYA 4B16A 5CC6A 2HFGL 4LCIL 1KEGL 3G1VA 5I15H 5IBXC 3AVEA 4PLJC 3WEXB 4L6HA 4ENEC 1O7SA 4W9TA 3N50A 1TTGA 3CYVA 2HB0A 3H9YA 3ZMEA 2J3SA 4GRWB 4LLUB 4UM8B 4B9CA 4HBCL 3VAVA 3RFRA 3GG0A 5DQ9B 3V79C 1LQ0A 5AYBA 1IARB 2ZONA 4CD7A 2C9XA 5L6UA 3EB3A 1L5GB 3QZLA 2Z1SA 2CZNA 1GOGA 3PBVA 1VF8A 1ZSXA 5CXPA 3FU6A 5BXSA 2Y24A 4DKEL 1EJ8A 3CFKA 1K8XA 4OGXL 3TQVA 5DMKA 3BEWA 4O8RA 4UB0L 5DLCA 1YYLH 1EX0A 1B3OA 4B0MB 4KPHH 5D4YA 3BT2L 2NR6C 3A67L 4LPUA 5IQOA 1PD1A 1U2CA 3MXWH 4R8WH 4CKVX 1G9MC 4M43H 1T0MB 5I1JL 2VWEE 2O56A 3ULUD 1EAJA 1KPRB 2GJ6E 1OCJA 3HNTH 2P3EA 2JF6A 2YFOA 1Z5LB 4C1NA 3D39E 3ARZA 2R2BB 4UAHA 3TT3H 1B0WA 2R0KL 4HHMA 1A6WL 1AGCA 4P59L 2OQHA 3E7JA 3HBPA 1GHFH 2F7IA 1NCOA 1ZA3B 4JFVA 5CJ8A 1WJ3A 3ESUF 1A3LH 3L2IA 1K02A 2AK1H 2A7RA 1Q6GA 4N9DA 1DSYA 2ZICA 5LCVL 4XNQB 4K5MA 4BYHA 1JE6A 2VRJA 1P5BA 4MG4A 1QSEA 2CLRB 1FWDC 2BWDA 3WBAA 3WUWA 1BOYA 2B77A 3TM6A 1XRSA 1P84K 3OG6B 3TXZA 1A4BA 4UB0H 2HLAB 3BQUA 3U46A 2PDKA 3OJGA 4P3DB 4C4UA 2D2CC 3TO4A 3K71A 1EEYA 1SZNA 3VYLA 3KVQA 2VMJA 1A7QH 5AB9A 1ED3A 2J8OA 3A4WA 3GR8A 5IHZA 2D69A 1ROWA 4E41E 2RFXA 4Y19E 4YIWA 3NA8A 5H94B 3QNFA 5T1LA 1CS6A 1KBPA 3BUYB 3O6MH 5DHVH 1C92A 1ADQA 2P26A 2WXOA 4OF5A 3HURA 3ZTJG 2HG5A 1IGMH 1HJUA 1F86A 3S3JA 1J11A 3OAZH 1OFBA 1AQHA 5EIVA 6FABL 3MYOA 5AZ2L 1V0NA 4LDCA 4PRDB 1DQWA 4J3SA 5KVDH 1GZ1A 1GHSA 5D7EA 2BRQA 3RPMA 2ZZUT 5M94B 1LK3L 1YPZF 1AOZA 2XVPA 5T91A 3SURA 3WD0A 3VXRE 1JV2A 2HRWA 3CFDB 1HOEA 3MBEA 3L13A 4P9MH 4WFFD 1ZVHA 5BRZA 2Q86A 2NX1A 2ZQ0A 4EACA 1BVKA 2GGJA 2Z34A 3CZLA 1T66D 5DRZA 4J1OA 1DWJM 1UJ3B 1UZ1A 1SXSA 5IBUB 3WELA 5SX5H 4FF9A 5CHNA 1PZ3A 3DDFA 4UTBA 4N9BA 1IGYB 3S5LA 3RTQC 4NM8L 1CXLA 1WB0A 4JBRA 2B39A 2C7UA 5JZ7D 4HCHA 1EBAA 1I3VA 1NEUA 3NEOA 3HHRB 2V33A 4ZXBA 5B3JE 1KMGA 1A4LA 2V5DA 4B3VA 1RUMH 1X5HA 1XSOA 2KKQA 4UV7H 4XMVA 1YEGH 3WTVA 4NO5A 3STGA 2H8XA 1M2VA 4G9PA 2IH8A 1AFVH 1B2YA 1KSRA 3F5LA 1XIWC 4XP1L 3Q67A 5J9PA 2F8OA 2VXSH 1QI2A 3PWPA 1E55A 3N85L 2EAEA 2I7OA 1Z2KA 4U1HA 2YOAA 2B3IA 1QWUA 3H8NA 4LLDA 1JNNH 4WEBL 4WV1B 1MUJA 3VFUA 3VFGH 5J5EA 1IR2A 2WY3B 1UM4H 1X5XA 5D1XB 1N64L 2OT1A 3EEZA 4RSVA 4UTAL 1GQIA 3HB3B 4XZ4A 5H4YA 1JRCA 4QRPA 3SDOA 1R5IB 1H9VA 4BFEA 1U58A 3MJMA 1PZBA 2QTVA 5C08B 3GSRB 1D5RA 4QR6A 2CUMA 1A6VL 1US3A 1KGWA 3IXTA 1G7MB 4Y16D 3CAWA 4E41D 1QX1A 3DX1A 4KK6D 5HJDA 4U1JA 3S0PA 1OY3B 3BSHA 2VELA 3VFLA 4DVOA 6ALDA 2PP0A 4N0UE 3VI4B 3GKWL 3FU7A 5LBSA 4W84A 3GEWB 3QBUA 5EBLA 2JTYA 1M6OB 2OJZL 1G6RL 4KNSA 3T3MF 4S3DA 4M80A 4YHKH 5J9PB 1WDDA 5I7GA 5GNXA 3EO0B 1YVLA 4FP8H 5A2FA 2OEJA 4UT9A 1UUMA 2PUQT 1MCPL 2WXGA 4GIPD 2VQ4A 4WFFE 5D1ZA 5EC1A 3VFTA 3M17B 3DXAA 5HVGB 3WE1A 5JHLH 4KZDH 3W29A 1KRMA 2C3ZA 5FYKH 3TCLB 1OT1A 4F7CB 1V3KA 1WDRA 1LE5B 4XHJD 3GU9A 3QQ3A 2J20A 3QJOA 2VAAB 2R23A 3T2PA 5L7XH 2AFNA 2VR8A 3PF3A 1HFUA 4ZMAT 1A3ZA 2A1WH 1EXUA 2LQRA 2WQUA 5HXMA 4D0DA 3U6XA 4Z7UE 3QHFL 2Y7NA 1NL0L 1BEYL 4JQIH 1JGEB 3TN3A 4CQCA 1OW0C 4M1GL 3IIOA 4IZGA 2JIXB 4LCWB 4K2UL 2XH2A 4JPKL 4YPGA 5HDWA 4IL0A 4EDWL 3BH9A 3S6TA 3VWJA 3TFCA 3QG7H 1ZUAX 4AQEA 5EN2B 1EBHA 3MV9A 2GK1A 3GWQA 4TU1A 3M45A 3H4FA 3TP4A 3K4WA 4TMCA 4IMLA 1AQDB 3L4CA 1SPQA 4JN2B 2Q8BH 3M5VA 2AV1B 4OCWH 1XQ4A 2FYVA 5C0BA 3BLEA 5DDHB 2CDGB 2V5JA 4TTDC 2DEYX 2C71A 4KCUA 4J39A 3FT3A 4KQNA 3M0MA 2I26N 5FCUH 1A1OB 3VOHA 4N1CA 1KC7A 4XTRC 5DJZB 3VGBA 3FC8A 1TENA 3RPTA 3IMTA 1UB5A 4FI6A 2EDRA 4TULL 4KPLA 1R19A 4NM4H 1TJIL 4JN1H 4P48A 4ZOCA 4LEFA 3VMOA 3AS0A 5U7SA 4ATTA 3BQ6A 5TQ2L 1PWLA 1BM3L 1JWUB 1NAKL 4WHTA 4BKLA 2C4FU 5J1AB 2HXUA 3XIMA 4PJBB 4WU7B 1DQVA 2MQGA 2IADA 3HE7D 3NCEB 1XF0A 1GYUA 3B0PA 1TWIA 1NCAL 1T7ZA 1S2AA 4PBFA 4Y6GA 3L3KB 4ZZFA 4ZFOL 2W63A 1MRFL 3VI4F 4IRSB 4P5TA 3TFBA 3T77B 3VD3A 3WH6A 4XD5A 4O2CA 4XRCA 3HPJA 2UVEA 3O9WB 2E6FA 4RLIA 4OSUL 1EB3A 1FWNA 3DG7A 4IGBA 5L2KE 1Z6JT 3LI0A 2BIHA 3L3GA 3QYSA 1FZMA 4MD0B 4UIKH 5D6DC 4MYAA 1W56A 4ODWA 3IDJA 4OD2A 4U1MA 4FLQA 3EYVB 3BSZH 3MCKB 4GK8A 3T6QC 5HJ3B 4LU5H 4LGXA 4XNZB 1OT2A 5FB8A 1N2RB 1SO4A 1FDLH 3CC5A 2QCDB 4LYQA 1FCQA 3LV3A 4PS4L 3IFLH 4NENB 1G0YR 1MZZA 2A9DA 2HKFL 5CGYC 2GZXA 1NUGA 4LVDA 5C8BB 3WEXA 1JR1A 5HY9A 1NTHA 2G97A 4KRZA 3G22A 3UTQA 4HH9B 5DJAA 2Q1EA 3US0A 4GG6F 1Q4WA 2A6JA 3LSCA 1IGIL 3G08B 1MCHA 1IF2A 1I8LA 1R3SA 3RL2A 1RBAA 3H0TB 3GHPA 4L5FE 1S46A 2QEJA 2WWKO 3EOAB 4FXTA 4U0RB 1ISVA 2OZ3A 4JDVB 1WYIA 2PDYA 5M2FX 1OCRB 1U8LA 1CFSA 4JNZA 1BTCA 1RU9H 2P42B 4UIMB 1QTYT 2NQDA 1XYBA 3GC5A 3W85A 1AFSA 5MKGB 1RK6A 4I9TA 3CWGA 3WOVA 4N3UA 3RCMA 5KG9B 1ROCA 1U8HA 8FABA 3OZ9L 1KGXA 4K9EC 3IGUA 3MBED 3HNSL 5ISZA 1T7XA 3GRWH 4QHUB 3VRJA 2CXEA 4M7TA 1WBHA 1QHPA 1OP5H 1LEGA 4Y5XA 4W70A 4L18A 2WUCL 4RR4A 3TYBA 4C91A 3UG4A 1QDSA 4DHLA 2PR4L 1Q6RA 2R0WL 1OM0A 4KKLC 2IQAB 4O2CB 1YC7A 4XRCB 1L9NA 1WUNT 2VXTL 1XDTT 4L1LA 4LSRL 4MJHA 4X98A 5FYJL 1VEMA 5HNRA 4GQ0A 2OMUA 1TE6A 4V27A 1KM2A 1RUKH 3CJJA 4A7VA 5C7XL 2QCMA 2QHAA 3VZZA 2VMCA 2XXGA 2QSCL 5E5MB 1NEZB 1KBGL 1U33A 4M8QA 4O54A 3ESPA 1RLCL 4X8XA 4DW2H 2OG9A 5E24E 3JUZA 4AC4A 3TH6A 4MRCA 1BJ1J 4QAMB 1PO9A 1MFDH 1NCNA 1YSOA 3ZM8A 4HF5L 4LPVA 5DJ6B 3PQYA 4N2NA 4AQAB 4NJIA 4WXZA 1JUBA 1BJMA 3MUZ1 1U22A 2J7EA 1BFSA 1SEBB 5CJQH 3VK5A 2XV2A 3ATDA 3Q0HA 3TONA 2UX7A 3I2CL 1W1IE 3GVQA 4Z7VF 3ZKNC 1RIHH 3QR2A 3RKDD 2F7FA 3AMGA 3RMEA 4GXPA 2H47C 5FM5M 1TIMA 4I0PA 3C0QA 4NF7A 2QUUA 1OJXA 3MRCB 5FEBA 1NGWA 1XXDC 5C0CB 1N10A 5H8PA 3RFZB 1DJQA 1AI1L 3IJ9A 2PYEE 4W85A 3TF7C 4UFIA 4NRRA 3TZVA 5KVGL 4U10A 5AZ1A 3PV6B 1GUVA 3L08A 2G30A 2P8CA 5E8EB 3WG6A 3TNNA 4R90H 2Y5JA 3CO4A 1N82A 4QFUA 4YWSA 1P7TB 2ZTBA 4UTBL 1XGQB 1TE1A 2C1HA 5JOFA 3UXDA 3S3DB 1TCRA 1BEYH 4N9OB 2VI0A 2ZF9A 2OLDA 1EQWA 1HDMA 4OZ4B 3FUJA 3HOGA 5DQJB 4EE2A 4Q9QL 1MN4A 4NKIH 1JGDA 4GQZA 1LLAA 3M1OA 1E0VA 1QNOA 2VXNA 2YB4A 5DELA 1C5CL 1S7SB 3UNDA 3ZDWA 5AWNL 2W60A 4H83A 3WTSA 3FTUA 3WKML 1AHKA 4LCCA 1CBVH 2CCWA 3HS0C 5EIIB 1D7KA 2A2IA 4HYVA 4G3YL 5KJ4A 4D0BB 2A9BA 1AW5A 4C5ZA 1A0CA 1HIML 4N1EA 4JS3A 3RRQA 1FNEA 1LT7A 3V0UA 1R5WB 3BL3A 4RW3A 4F7TB 4GG9A 1NUDA 3DWTA 1NEZA 4GG6A 2GUUA 4TR9A 1NDGA 2DI7A 4QDGA 2ZRYA 3S36X 2X38A 4PWGA 4LPYA 4MZRA 1VFTA 1DQLL 1TTCA 4L8SC 2VC9A 2RH0A 3HS0A 4GO6B 3CV6A 4JG5A 2E46A 1ILUA 2VN5A 3UBGA 3F1QA 2RIKA 5K39B 1W2VA 1CLKA 3A6BL 2W9LA 4N2MA 4NOFA 1O6SB 4AEOA 4W9HC 1ACCA 2VEFA 2O5YL 2X88A 3HNSH 3VFOB 3KH3A 4NKMB 1A4JB 5DYFA 3FHEA 3IIXA 1SDDA 2YIHA 4KRMB 5KINA 1L9QA 7PCYA 1H0DA 4HW6A 4OZIF 3G1YA 1W3IA 1B4KA 3CSFA 4FFVD 3DAQA 3HM7A 3SDYL 3RX3A 4WEBH 3VFGL 1Q2RA 1EVTC 2HT2C 4P2YA 3SE9H 4Z0XA 4IIZA 4RRPA 4ZE5A 4HWNA 3ABGA 1SFSA 2VXSL 4HEPG 4N0YH 5JW4R 1HJBC 3NZ1A 3BWUC 4TVPE 1VFUA 3ORJA 4PG2A 1OAKL 2XWCA 3HE6C 2ED8A 4KZ0A 3UR8A 4YTRA 3S1WA 3BYTA 2FTAA 2J55A 1TZHA 3KLDA 1XR2A 1JFQL 4XD3A 3UTOA 1GC1C 3I9PA 5C6WH 3QUYD 1OM9A 3FV9A 2CWXA 2J7HA 3GNOA 4O12A 1AD0A 2DAVA 1BWKA 3DFTA 4FP1A 3GK0A 1OSZB 1UPMB 2G9HA 4GOSA 4D8ZA 4LMQE 2FSDA 4ZB0A 4DK3A 1PNDA 1HZHH 3BP5B 4NVTA 2FD6L 3C2EA 3H23A 2WBGA 1E4JA 1UT1A 4PJIF 3SIMA 3TZNA 4TNWK 1XIGA 4AH2B 4R26H 4BSWB 4O57A 1X4XA 1PLGL 3R06B 4W9EC 4UQIM 5LNVA 1Q6LA 3IKCA 3ZYZA 5B1CA 1NLDH 4HUUA 3MRBA 1VS1A 3UXAA 1E71M 3S5ZA 1UOKA 1R34A 2OTDA 1MFEH 3FB5B 3NQAA 4GZEA 3LTVA 1J1PH 3U2CA 3BAWA 1P1ZB 5SWSD 1VKXA 1XBXA 2YGYA 2BSSB 5GGRY 3TN0D 1SXCA 1FP8A 5HYJB 1GYAA 3A4FA 1HU8A 1ANUA 3OJVC 1NCWL 5GGSB 3ECWA 3RDJA 3T08A 3DH7A 1NMBL 1UD5A 2BVDA 2HT2D 1KB5L 1I8KA 2BRRH 1YEJL 2X1XR 1EDGA 1RJQA 2PDQA 5F2MA 3O2VH 5DGQA 1QHOA 4PB5A 4NQCD 4OBSA 3SYCA 3S3BB 4M00A 5F71A 3H6JA 1MFVA 3OHXB 3QG7L 4JRYD 3T2NL 5C2BL 5I3DA 4LHQB 1HXMA 1WF5A 3THDA 4ZGYA 3CXDL 4GKNA 4AD5A 4JFSA 4J4KA 3AS2A 3LLXA 2ZG2A 2OL3B 3T40A 3HAEG 4A6YB 5C3IA 2XZQH 2WSKA 1J5TA 4K6AA 2BP8A 3ULVH 1GS7A 3QPXL 2GI0A 2DIEA 4WI7A 2XWTA 4U1KA 1P1XA 1DL7H 1S3HA 2ONEA 3CLWA 2EO9A 2QNEA 5MEND 5GRUL 1R33A 1P5VB 4JQ4A 2GQ9A 5DR5H 5D6DA 4LEXH 5ADPH 1C9SA 2WLLB 3O41A 1SM3L 3V0JA 1V77A 4PI0A 3VOFA 3W1TA 4JO8A 2YAFA 2OPCA 3MUJA 2JI3A 2ZVIA 3QQWA 1HXYB 1GGYA 3WK3A 2UZIH 4DKFL 1HIZA 3K6SA 1OP3H 3WIAA 3ZMRA 4DBEA 3DTXA 3U0WH 1IGSA 4I0PD 3D2UA 4X0VA 2L04A 1LO0L 2P7TB 3DYPA 1EFXA 5D7IE 1DBBL 2XQYK 4YBLC 5AVQB 4UINL 2O61B 1C8YA 1VFAA 2A7PA 1SJMA 3PQYD 1J8KA 5HQLA 3PBGA 4CD8A 4GXFA 2A9CA 3C08L 4CC0A 4L4JA 1Q0YL 2ITCA 5HPOA 3SPCA 4QHNA 5ITBL 1GMIA 4TNEA 2I9TA 2C34A 1A6VH 1MVUB 4XMLH 4Y8FA 1UD4A 1QSZA 3CZJA 3QDJA 1KPRA 4TM9A 1BD0A 3UH8A 3ZGHA 3BOLA 2PP1A 3MRMA 3TS8A 1B6DA 1QG3A 2AJZA 1OFRA 4ZMQA 4HGWA 1H51A 4B7LA 1KEML 4X6BB 5FEPA 3UCDA 3UR2A 3LQLA 3RLSA 5GVJA 4CNIB 1ME7A 3B8SA 3NEVA 2A0NA 3C3NA 3WNPA 4MMXA 4M93B 5KW9H 4YDVA 3SBRA 1UR8A 3O2LA 4I9JA 4WUIA 4XZIA 2EIEA 1RZGA 3ZE1E 2QULA 1L2QA 4WWKC 2KZHA 5BWAA 5BCAA 5DD5L 3MA9H 4YSEA 4OI9A 4E36A 4BA0A 1LEIA 4YX2H 3D39B 4TS6A 5K9OB 3H21A 4TSAL 5EZJA 3EJCA 3ARYA 2WXDM 4OF7A 4PTTB 2OU4A 5J89A 1NGZA 3HV9A 3LNMA 3DA0A 1WHPA 4BWWA 1P0NA 2I7SA 5H6HA 1CICA 1GG1A 3P62A 4I0PC 1AUSL 2DLFL 3KZ8A 4LSVL 4P2QB 1VFBB 3KRUA 3MA8A 3B8UA 4DQWA 4NRZB 2BLFA 3NJNA 4NO2B 5I66B 1KV7A 4MZ1A 3RMJA 2CWRA 2JKJA 1JZGA 2XLLA 3MX0B 4K23L 1E30A 3K5SA 2E8ZA 4LKCA 3SCMA 3W0WB 3GSUB 4O1CA 4DRSA 4RKAA 2LLGA 1M71B 1IGTB 3VGAB 1BFOA 3RJOA 1SJDA 1XIJA 3C86A 3WBXA 1K9TA 3BKML 4FKHA 1QBLL 3Q13A 1MCEA 5D9SB 1PY0A 4ZO6A 2AV7B 2YPIA 4X6CB 5GRUH 3B1UA 2EAWA 2VT0A 2IBZY 1JPMA 2YXXA 4JTSA 3TVMD 3S6DA 3W7DA 5ABHA 1XIWA 3P9LA 4LL4A 1FH2A 5BQDA 4LCUA 3GINA 3BEVA 2XXMB 4FNTA 4HJJH 3MHGA 1I7RA 4F8OA 3TN6A 4PRID 5TDPA 4F0LA 4LRTA 3PUOA 4XISA 4TX9A 5L2KA 3TCTA 3VFCA 4B9GA 4E4PA 1T96A 3HJEA 4ERGA 4H0GA 4R88A 5L88L 3D0VA 4N26A 3RGVB 3HIJA 5I8CB 4DZ5A 5EU3A 5I0YA 4NFDA 1GAFL 3DROA 3Q37A 4UR8A 5DK2B 3NXFA 1VACB 2UXTA 3BZJA 3GI8H 3TEUA 1HUVA 1KB5H 2BRRL 2WYHA 3OR7A 3UJTH 1IC5H 2BVOB 1CU4L 3EA3A 4FQLH 4P23C 5A2CA 4OH2A 2BCKA 3I75A 4UT7L 4KKXA 4XB8A 1I4FA 1K2DB 4QHKI 3NSXA 2BOCB 4Z7NE 3C6CA 4A22A 3VIOA 4ODSL 2MHAA 3BSGA 3OV6A 3CBWA 2JQMA 1IE7C 2NDFA 1JS4A 3F4WA 4D1IA 5FL0A 5LGJA 3FYEB 4H9MA 1H49A 2Y63A 3WFCL 2OEMA 2YARA 2HXAA 2RCSL 2FSEB 1E73M 3CB8A 2H1PL 5JNYA 4L1XA 1XR9B 1ZBKA 2CO4A 5J8OA 3GKFA 2H3KA 1EHXA 4LVEA 5HBFA 3AU0A 1MZHA 5AW4B 2X42A 2IS7A 4UFKA 3VFMA 4O11A 4APQC 1WAAA 1EANA 2FLRT 3E0GA 1EHKB 3GJEA 4MJIE 5GS0C 2PYFA 2P8BA 5L4FA 3WKYA 2FVNA 1E4WH 4KK8C 4ANVA 4UZSA 5EEZA 1OFEA 3MC5A 4QGTA 1GTNA 4KIRA 4ZSUA 3TNBA 3FVMA 3I6GA 3RVXC 4AD3A 3EOBA 3O2VL 5HYSG 2FIKB 3GS6A 3HAEA 3L68A 4IMKC 4GUCA 5JXEA 4E2BA 4ZA0A 2MPAL 4PCPA 4ZB2A 4YLBA 4AHQA 5IJVB 3KMDA 4W9FC 5BVPH 1L7IH 1O9VA 2DQCL 4HIJB 4L1SA 3IDNA 4UM9A 5E8PB 2AS5M 1KTKE 1L6SA 4POCA 3QORD 5JMRA 4N2FA 4GIOA 1E1EA 3KPSE 2AKRB 3S2NA 1U95B 5I76B 2DQUH 5C0NC 4H9XA 3GBNL 3MGTB 3L81A 4U3SA 1MI5E 1NOLA 4D9LL 2UXFA 4EAMA 4PJDB 1LD9B 4I7ZC 4XVTL 3N2BA 3X2QB 5KSAC 3UPRA 1R0AL 4AQOA 2AEQH 2XKUA 3ULUC 3M16A 2AQVA 2QQLH 5LBVA 4QP0A 1MCWM 3S5NA 3L5WB 1LDCA 3LRHA 2ARJB 3RAJL 2DT0A 3VCLB 2B4GA 2RHGA 4MKSA 3W7RA 1MFAL 4AM0A 4K3DL 4K3EH 3TTQA 3TBSA 2B5IB 4LPXA 5CMAB 5DWUH 4QRPD 5LXGH 2WPGA 3GM8A 2DM2A 4N8VA 2CU0A 3TVMB 3RJDA 3A12A 4ODWB 4LEEA 3RE0A 3SBPA 3U4BH 1K6QH 3V4PA 3BZFA 3IXAA 4PVMA 1LOQA 1M7JA 3U1SH 2BWGA 4PW4A 3MACL 3T04D 1KNWA 4PJ6A 3D47A 2W60B 2BOEX 4NENA 1L0YA 4XV0A 3GWJA 1J8HB 1FO0B 1UWYA 4M7KH 3F2CA 5JHAA 4EVZA 4JR9H 4KK5D 2KQNA 3MU7A 1Y1UA 2ZT9C 4YZFF 4KFPA 3FAWA 3O45B 4IU2A 2C79A 2IADB 3VO0A 4P3WA 4ZBCA 3CQIA 5HJLA 3QEQB 3Q7JA 4E0RA 4UFLA 3AHZA 3UWQA 1IZKA 5I6OA 3CHEA 1DQIA 4EANA 2CBVA 4OIAA 4PMZA 3UZ5A 2OWWA 3GQFA 2OYLA 4M5YL 4X7DC 1H19A 3U1PA 4UAOB 2YUVA 4BFIB 1TUPA 1PX3A 3X1NA 4DCQA 3O8XC 2WHVA 1E8YA 2DWDB 1QK0A 4E38A 2MCAA 2CLZB 1WWCA 2E6QA 2MEJB 3RKPA 1Q3NA 5T9BG 2VDLB 4BQCA 4F57H 1Z41A 3EXRA 32C2B 1SVCP 4FSAA 4O1AA 2QPUA 4JFED 3X1BA 3SYOA 2X0VA 1ZBCA 2NQLA 3R94A 2HWGA 2R69A 4RFEB 4N0FA 4QY8B 3T44A 3BISA 4Z7VB 1CL7L 1MJUL 3AY2A 3BICA 2CA4A 2XETA 3KGTA 4M1CC 1DE4B 4PJHA 5TBOA 1T7WA 4YDJB 4BH8B 4WWKD 1A5LC 5T5NG 2J73A 4OCYL 1G4EA 4WO0A 1JG9A 4FQCH 4B9FA 2LE9A 5LG6A 1J5CA 5I07A 1FGNL 1L0QA 3ZFHA 3R89A 4GJ1A 2R24A 3ZIZA 2ZKYA 2FB4H 3NACL 3VG0L 1LWHA 2WZ0A 4MD4B 4IOFC 4P2OB 3FFCA 3RX7A 4ZFFB 1N8IA 4GLRH 1RPXA 1GOXA 4W7WA 5E4OA 3WMLA 4E4UA 1FCCA 4LAMA 3SO5A 1EZSA 4KI5F 3SSZA 4F0KA 4YTTA 5EMLA 3DX2A 3GHEL 4R6UA 3BX7C 1E9LA 1A4KB 2OMUB 3FB8A 3GMOB 3MRGB 4AEHL 3AU6A 3B3BA 5E0CA 1P2CA 4DETA 3VYPA 3U9UB 2HX7A 1BFOB 3OHMB 3PTQA 2N0KA 2F1EA 4KK5C 4NZUL 4H8HA 3REVA 1WC7B 3V5KA 2OXHA 3VFTB 1NCBL 1RK7A 1YG9A 4O2EB 3I6EA 3VH8G 1JK8B 1T0NB 1JXDA 2HN7B 2Q2LA 5DLML 5DJCB 3RPIA 3SY6A 3HBLA 1QBAA 1MUCA 3WS6C 3QQ3B 1EJ7L 1W9PA 5I06A 3P3TA 2GTZB 1TWZA 1PAMA 4XC1H 2FYYA 5BZZA 3T2QA 3M46A 3EYSL 3NJMA 4Z1PA 1DHPA 3QIWA 5GJSH 4JJ5A 3WY4A 1JGLH 2DJUA 3FCSB 4HKJA 4JLRB 4UQ3B 4O58L 5D7JB 3VSUA 2WUCH 5AKQA 3MNDA 2V17H 5DEZA 3S2AA 4G42B 1FC1A 5ILTH 2DZSA 2Y5TA 4DXXA 2C9UA 3AWEA 4XCYA 3DI2B 1PX4A 2K6ZA 3IFNL 2N1KA 2XQBL 4JZNB 3IM1A 1NF7A 3N04A 4LBAA 4W8LA 1J8SA 3EXTA 4EXQA 3GXNA 5C08A 2NY3D 3G6AA 3TLRA 2IPKB 1VC4A 2UXVA 5JA9A 3OA3A 2OW6A 5I1DA 4R7LA 1MNUL 2VLJB 1WZKA 1MCDA 2DBJA 1X5JA 3EDDA 3NVQA 4J3XA 2P48B 1DTNA 4ZD3H 1DJWA 5KZCB 1UGNA 4JTHA 4EXAA 1R7OA 3C6SB 4XZUA 3GNDA 5D7KD 5FM4A 3W1NA 3CN0A 4TX8A 4M8VA 4DWDA 3HA0A 4H8VA 4BUQA 1DWIM 1K1DA 4C65A 2GIMA 3NSDA 2F58H 4LSTH 5FJIA 1HILA 2YQBA 2ZCLL 2EGZA 1T0OA 3WQVA 5GSRB 1EHNA 1TV8A 1EO7A 1A14H 2NSXA 2EPHA 4RDYA 2CXGA 2OYKA 1UACL 2YSTA 3GJFH 4HEMA 4HKJB 4APQD 2PR4H 3ARQA 4H6EA 3TC6A 5IFPA 1ZSDA 2K8QA 1BMGA 2BSCA 2PDMA 4UTUA 4IBYA 4E0CA 1EZ2A 4QYOA 5G4OA 1MJ7L 1MNNA 2PCFB 4RGOL 3CUJA 2ZCLH 4ROQA 1CQYA 3WTWA 1KB9J 5H37G 4XNXL 1A22B 1CF8L 3NTCL 1DN0A 1X5FA 4N0UA 3F7QA 2FNWA 1YDOA 1U1HA 2MCPH 3VTAA 3EZ4A 4O1DA 1IKFH 4R96B 3FYOA 3HVNA 4DIXA 2UXGA 1FWGC 4WEMB 3CFDA 4OQTL 1WBZB 8PAZA 2NUWA 3OYXA 5I6KA 5J06A 2FQEA 2AGJH 3NFNA 5JXAL 1T0PB 4US5A 4IIBA 1WA3A 3S88H 2R1LA 2CIIB 1KGCD 1R47A 3P0VL 4XPHL 4HOXA 3S5LB 5CEWA 1J7VR 5H2BB 1Q66A 4WDUA 5K9DA 3IDYC 1TXKA 3UAFA 5DMMA 4Y4HB 3T3PB 3EDKA 2WMIA 4P2QE 5LWYL 2LAAA 1DIDA 1SDYA 1FY6A 2QKFA 1GKPA 9RUBA 3OOQA 4XNDA 1WCBA 4IOIA 4IRJD 1J8VA 2P5EE 5D1XC 3GNXA 1XF3A 4G70B 3NFUA 5ABGA 5C71A 4MS8D 1IKNC 1AC0A 4GAJH 4NZRL 2NLIA 5CILH 3WUWG 2JKLA 4B27A 4TV5A 1R38A 4UR9A 3SN4A 3DURB 1JPHA 2PCXA 2D7PA 4GCXA 2DZXA 3DYMA 1GVSA 2YCLB 4ZT1A 3A22A 1SLWA 4ZMNA 1I7TB 1XDLA 2IAND 4ZUWA 4G9FD 4AVKA 3CH0A 2V2HA 1RD5A 3OP2A 2YN5A 5TQ2H 3ILQC 2QIIA 3IE4A 3O11B 3FB5A 2CSPA 1T83C 3BP5A 4JRFA 3WLMA 1DEDA 2X4TA 4IK6A 4XIAA 3TWBA 5H8UA 2ALDA 2E7MA 4V1DA 3GBMH 5CSBA 2KLSA 2WLIA 1MNUH 2LABA 1FVCA 1U8JA 1G7MA 3MNVA 5F7FA 2F54B 2VXQL 1F6PA 2FB3A 4G6KH 4JG1L 1KM4A 3AUJA 4Q8WA 2DY2A 3DHPA 4I77L 4JJOA 4JO1L 5FGBA 1BF8A 1P1VA 4PG2C 3NCYP 3O0KA 3RLHA 3ZVHB 3NSNA 1SRDA 5CCJA 1P6AB 4MBOA 3VZYA 3KYKH 4Z7UB 2IBBA 3L12A 3KLAB 4MB1A 1XLMA 3CQ0A 3HG1D 4K15A 5TQ0L 3SQBB 4PMNA 3FN3A 2OKOA 1FORL 2OMBA 2VLRA 1ID5I 3UBHA 5GS3A 1FBAA 1E4XI 3W25A 3O0RH 4F20A 4IU3A 3TXVA 2PW2B 4HKXA 2KL6A 1ZKAA 1WD8A 4NO0D 4RVBA 3ZTCC 2BZCA 2P52A 2VAJA 2CH8A 2ZUUA 4UQAA 4WVRA 5FDWB 3MV9D 2XYBA 5FYJU 1HNGA 4Z3JA 3UPRB 1G7IA 2B0SL 4YMZA 2EH8L 3LHUA 2BNUB 3BJ91 3GHUA 1V7NH 2FYYB 1MVFA 1GJUA 1RQ5A 2NMSA 3FH8A 3BVXA 1M04A 2W61A 3CMFA 4AEHH 3NYDA 4ZMPA 1WDSA 4KBXA 1U92A 2FUQA 4YTUA 1EP1A 3AJXA 3B43A 4PJIA 3D12B 5F7AA 4XP1H 4QWWD 3D25B 2JIXD 5DUBA 3MV01 1G6RH 3VTMA 1S9XA 1KBLA 2WBJC 1SSGA 4K3JH 1R5WA 1ACYH 1S6NA 2K3HA 4FJ6A 4CC4A 3NCYS 1TR1A 3QRBA 3BCDA 3KPRA 4KT2A 1CK0H 1MLCB 2TSAA 3EYOB 3I84A 1K6QL 3H9SE 1A53A 1ZB5A 3HZKA 2M83A 2XWZA 4H5SB 4FQCL 3WHE0 2F08A 2YPVA 2GJ6A 3VFPA 1S7XB 4IRZA 4AQ1C 2A5UA 2B1AL 1NDVA 2YAEA 3FFCD 4FO4A 2JJUA 2FH6A 5BWFA 3IIZA 5JW4M 4Z7VA 1ZAGA 3W7JA 1TV2A 4GMSL 1NBYA 1QZNA 2R15A 2FNBA 2PTTA 3HUJB 4EI6A 5A1AA 1DKWA 3E3QC 3QOKA 4LUYA 5F9DC 2ZRUA 3ZLFA 3KPSD 4B4HA 2N3JA 4CEUC 2ATKA 3GM0A 4HA1A 1RERA 2RACA 1EDTA 5F7HA 1E3ZA 3FQWA 3PDOB 3DMMC 5LYRA 3L4WA 3R0UA 2BVUA 5DYOB 3S5YA 3VWKD 4BF7A 2YC1A 2X09A 3ALPA 3TNNB 1X6UA 3VI2A 2UZPA 2V82A 1UXWB 4MLSA 2XZ7A 1DQUA 4IRSD 4NZJA 1XR8A 3N14A 4PJAF 3R06A 3RBGA 3GTVA 3WQ5A 1NH6A 3KWTA 3LDVA 5AYXA 3S36L 3BMXA 5F4WA 2ZNXA 1MI3A 4XK2A 3BUBA 1J87A 3P2DA 4TSCL 1BFTA 1QUNA 1SYSB 4G1MA 3QUXC 3G1FA 4AMAA 3QW3A 3MN8A 4APXA 4BWLA 4QE4A 1VIZA 2J8UF 4GG8A 2AEIT 2Y9RT 4DK5A 1J0JA 4POZC 5DK0A 4GIYA 4B90A 2FDMA 5IMKA 5F6IB 4N8VB 3CSGA 3WHXA 3VI3E 4ODUB 1P6WA 2AL2A 3KGRA 4ZTEA 2FB2A 5SWSB 4LPCA 4HKPA 4OUIA 4K1GA 2VDLL 3HG1B 1SEQH 3OR6A 1JPSH 4HGKC 2AK1L 3CFJA 1TPUA 5EIQA 4MWAE 4Q32A 3KDMB 1CR9H 1DDTA 2YWYA 4K71C 3SDAC 3LK6A 3MT1A 4YC2C 4Z7QB 1KTNA 4Z0BH 1KGIA 3EJPA 5AFDA 4QRAA 1NFDB 1R0AH 1GGCL 3PL6C 6PCYA 3WJZA 3IPWA 4WFHD 3TW7A 1SXBA 5AZ2H 1DWHM 4QTIH 4KQ3H 2W65B 3KYMB 5CMAA 3E12A 1YUHA 4HHHA 4JHOA 5ICYB 5HNNA 3QRGL 2P8PA 3GMPB 1YJDC 1SHWA 3JRKA 2ARJA 3CHXA 5KBMA 2VGLM 5HATA 3D7PA 3SAZA 2BWIA 2ZCKL 1KYFA 1YN6B 5H35A 1VFBA 3KD4A 3TH4T 4FXSA 1F11B 5TE4L 2YBVA 2PTDA 1IC5L 3RDTB 4ZNEA 3B40A 3B06A 1CFSB 1MG3C 2BVEA 4RH4A 1Z9SB 4G5DA 4X4MA 3ZDZE 4JY5H 1VCBC 1XSKA 4EN3A 1KQZA 3QWOB 4KTDL 3T0EE 2VR6A 5HHNB 3CZFA 5E7FA 3IDXL 1LEGB 3L5HA 2HFFB 3PUUA 3E6HB 1W54A 1CN4A 2YZRA 5H1WA 4AZCA 2QQ6A 1CXHA 2L7JA 4N5EC 4HBCH 1XLAA 1DBKH 4PV8A 3VE0A 3KBVA 3LV5A 2JK5B 5IBUG 3LUTA 4N8VG 1KBIA 3PNWA 4PJEF 2K70A 2OQYA 5F88A 4GVIA 5U4NA 4HC1H 5IFTA 1PZ0A 3NP3A 2VFGA 2FO1A 3WJLC 1OD9A 2PUZA 1Q94A 5JO5A 1SW0A 2ZUSA 1QVOA 3TT3L 5HGDB 5FIEA 2VLJE 2BOCA 2YZ1A 4ESKA 2IFGA 4HU0A 2EPNA 1HI6B 2WIMA 1ONXA 1TQTA 2X8RA 3KPLA 4EWND 4JUSA 4X0NA 3WDRA 1YN6A 4LOVA 5F0LB 4EAEA 1OF8A 4G6ML 2WQRA 1TB3A 4IWWA 4J1UA 4PJ9B 1TCRB 1A6PA 2AK4A 2NUPB 1GYLA 1GW9A 1RLDA 2AJYH 4FNRA 1E5ZA 3GUTB 3FQUB 4MXWL 4XPGL 2NNRA 4OJFH 4PBVC 4BZ1H 6REQA 4OV9A 4MUZA 4PG9B 4XX1E 1DBAH 2W0UA 4NL1A 3WYRA 3N13A 5F1VA 3W87A 3DFHA 4HG4J 3W7MA 5B80A 1EJUC 5TK4A 4LASH 4Q6YA 2ZOKB 1LK2A 3I3EA 2J7LA 4NZTL 5JLZA 3PZIA 4Q8MA 2DD8L 3D51A 4AMWA 5CQ1A 3UL4A 3KWVA 5C0JB 1TVDA 2EIBA 2OXGB 3F6IA 3QQDA 3HHSB 1YMYA 4XN2A 2WB7A 3RWFB 1LBMA 1EAPA 4P8QA 4F9LC 2BH0A 1GVQA 4ALAH 3ZDXB 4IFRA 3SKJH 4AQLA 4JPIA 3VC5A 3G6JA 1KDJA 4P4KC 5C5YA 4H1LH 1JWSB 3ZU8A 2XKNB 2BSED 2X7LA 2OI9C 3P9MA 4FFZA 5C0FB 2WO4A 4J3OF 4RETB 3D87B 3L4TA 4GQQA 3VFNA 3PY9A 1XIWD 3Q6FA 3HZYB 3MKVA 5IM51 2NYYC 5FA4B 3W0WA 1UEMA 4CU7A 5TDPB 2X2GA 1JZDC 1TZ7A 3KLQA 2WMPB 4HCIA 4NUQA 1XHHA 3RVTD 4ABVA 1T1XA 1VGAA 1DQTA 3TO2B 5G5DB 1YHPA 4AX7A 3KPMA 5HD8D 1RZJL 3GBEA 3SADA 4N2GA 1DBAL 2DYRB 5BOEA 1VRXA 2OX5A 3QCTH 3MUIA 3CBKB 3TCXA 1FIGH 4ZW3A 1SJEB 4WKZA 1LBLA 1CXEA 1W8OA 4G9DA 4I77H 1P9MC 3MA9L 4JO1H 5MP6H 2QJMA 1A3XA 2Z1VA 4A8IA 3DPDA 1V6UA 5I6LA 3T3PE 1UD6A 5SWQA 2OGJA 5KW9L 1KO0A 2H32B 2G37A 1JF1B 5HA7A 4XN4A 3WLJA 5AVNA 2XWBB 3OTRA 1B3VA 1G01A 1O7DC 5LNSA 5CZTA 5TK2A 4NNYA 3MRIA 3EWZA 3MCLL 2O4MA 1OFOA 4H6RA 2WLMA 5GSRA 2W0PA 3NUKA 1LL4A 4Q7DA 1KULA 4KO6A 1DN2A 5IBTL 5LA2A 3P69A 4X8JB 3KOYA 4GA8A 2G0LA 4IRSC 5KYUA 1F45A 5D8ZA 5SWZD 5CEZH 1K8ZA 2A85A 4IXXA 4LVOC 3A3HA 2WHMA 5GGTH 2MKWA 4XSLA 4Y5XC 3MFFB 4X8GA 2BODX 3RG1C 3I7SA 2WO2B 4BGLA 1KFGA 1MCOH 1JDAA 1HHKA 1JZ2A 3G3MA 1MUJB 5CSYA 1YY8A 4MXWH 5ABAA 3ZN6A 5GS1A 4RL3A 5HJBA 4HCRA 5C9WA 4ZFMA 3U4KA 1LO4L 3OPSA 5DJDA 2TRHA 3VXNA 3LDBC 3M1BA 5F8RC 3RIFK 1Q1JH 3CNKA 1Q7MA 1M1XA 4QMEA 2MNRA 1ZA6B 4R4BB 2CBUA 3DOPA 4HU4A 3AG2B 2TMDA 1Z66A 1W3NA 4WV1A 2XY1A 1PVNA 3FDGA 3RUBL 2HISA 1V27A 4KOCA 4N2EA 4O02L 4F33B 1KFWA 1DQXA 5HHMD 3H2FA 2VYRE 2OLHA 1KLYA 5DZOA 2P5NA 3W83A 1SUXA 2R8SL 1Q7ZA 3D3AA 4LUTB 3C8HA 4OVVA 4NN6B 2IPFA 5CFAA 2EKSB 4TVCA 1AJ0A 4KDTC 2TODA 3L6FB 2A77H