1JFMA

Crystal structure of murine nk cell ligand rae-1 beta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
DAHSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINKTMTSGDPGETANATEVKKCLTQPLKNLCQKLRNKVSNTKVDTHKTNGYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQSKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords retinoic acid early transcript beta
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 174
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jfmA00
4ZUTA 3TJHA 3L3KA 3D18A 4U6XA 3VFSA 1E27A 2CLZA 3L3GA 5C07A 3QI9A 3O9WA 3FOLA 1EEYA 2DYPA 1FFOA 1T7VA 3HPJA 4G43A 4PRNA 4ZAKA 5ISZA 1CD1A 2FYYA 1ZHLA 4FFEX 3V5DA 4PV9A 4L8SC 1UXWA 4WDIA 1KJ3H 1SYSA 4WWKC 1AGCA 1S9XA 4G8GA 3X11A 1S7TA 4PGDA 1MHCA 3ES6A 2P5WA 5C0DA 3G08A 1T1WA 3MRFA 1VGKA 3MRMA 5D7JC 5IEHA 4IRJA 3V5KA 5IROA 2F53A 3JVGA 1FZMA 4PJEA 3P4OA 2FO4A 2H6PA 3I6LD 4LNRA 1MHEA 2BVQA 3SDAA 3SKMA 4ZUUA 1DUYA 5E00A 5E9DA 1T80A 2HLAA 2BVPA 4JFQA 3RZCA 3QQ4A 3T1FA 4GKSA 4NNXA 4PJ7A 3VFWA 1N59A 3GSQA 4NNYA 1FO0H 1WBXA 4Z77A 4UQ3A 4X6EA 1NANH 1JPFA 4WJ5A 2X4NA 3M17A 5IB1A 5C0IA 2BVOA 2HN7A 2VE6A 1JGEA 5JHDA 2VLJA 3PWVA 4G9FA 3BHBA 3W0WA 3BXNA 3MRIA 3FQUA 3VRJA 4JFOA 3CCHA 2ZOLA 3ARFA 4I4WA 3O3BA 1AGDA 3CVHA 5SWSA 1K8DA 4D0DA 1N3NA 3GMMA 4PJCA 1T21A 5HGDA 1WBZA 3DMMA 3QDGA 3H7BA 3LKQA 2BSTA 3MRGA 3NFNA 2VAAA 1AGEA 1BD2A 3MV9A 1HHHA 4Y16A 5HHMA 3QEQA 4Z76A 4NHUE 3CC5A 5EU5A 1T22A 5HHOA 3WS3A 4PRPA 1I7TA 3CPLA 3GSVA 4QRTA 3H9SA 1X7QA 3LKPA 5GSRA 3WLBA 4E0RA 1OSZA 3PABA 2V2WA 1G6RH 4NQCA 4NSKA 2X4SA 2BNQA 1AO7A 4D0BA 1Q94A 3GIVA 4K71B 2F74A 4U6YA 5D2LA 3P4MA 3FT4A 3GSXA 4JQXA 2X4TA 3CZFA 3VXSA 5MEQA 1EFXA 3KPRA 1QVOA 5HHQA 3DX8A 2D31A 3FFCA 3WUWA 1KBGH 1JF1A 3QUZA 1LDPH 3FTGA 5MEPA 3QUYA 2HJKA 3PWJA 5E6IC 4ZFZA 4PDCE 5F9JA 3VCLA 1BZ9A 3AM8A 1INQA 3VXPA 4F7CA 3ERYA 4NQVA 4L8CA 5DEGA 3AREA 3P77A 4PREA 3OXSA 3QQ3A 5HYJA 1AGFA 3ILQC 1JGDA 1HSBA 2GTZA 3D39A 1MWAH 1LQVA 3HG1A 4L4TA 5GSVA 1HHGA 3I6GA 5D7IA 3VFTA 2HJLA 3TZVC 3PWNA 4PJ8A 3VH8A 3MRHA 3TBYA 2AXFA 3BEVA 3GSWA 4PJAA 3TO2A 1S7XA 1WBYA 3KPSA 4MXQA 2AKRA 3VFMA 3RGVC 1A9BA 4JFFA 3BEWA 3DBXA 4V3EB 4I48A 3SDCA 5MEOA 3VXMA 4PGBA 4O2FA 2E7LE 4ZUVA 3RWHA 1QO3A 2X70A 3OXRA 4L29A 2YEZA 4UQ2A 3RWFA 2X4OA 3QDJA 1A1NA 4V3DB 5B38A 4PRIA 3RL2A 2ZSWA 2XFXA 5INDA 3PWUA 1LP9A 4U1LA 1KPRA 3E6FA 4E5XA 4IIQC 3LN4A 3O4LA 5FKPA 4G8IA 3DX6A 3GMPA 1LEKA 2GITA 3BZFA 3TBWA 3AU1A 4Y2DA 1FFNA 3UBXA 1IM3A 1E28A 3QULA 4HUXA 4G59A 2YPKA 1S8DA 4EI5A 3SPVA 1M6OA 4NO2A 4QRUA 4CW1A 3KPPA 4N5EA 2ZSVA 1A1OA 2XPGA 4PGCA 4U1SA 3TN0A 4PJ5A 4O2CA 3MROA 3O3AA 1HHIA 1KJMA 1YN6A 1Z5LA 3LKSA 3VRIA 3PQYA 3IXAA 1ZHBA 1ZSDA 5D2NA 1ED3A 1P4LA 4NQXA 1GZQA 1ZT4A 2V2XA 4JRYA 1T7YA 3DXAA 5H94A 5BRZA 5J6HA 2FWOA 3E3QA 4N0FA 4PRAA 4GUPA 2PYEA 1L8JA 2AK4A 1CE6A 4MJIA 4QRQA 1T1YA 3FQTA 1P7QA 4PJBA 1XZ0A 4WU7A 5ENWA 5HHNA 4ELMA 4HUUA 3KPNA 3TBVA 3BP7A 4X6FA 3RWDA 5D5MA 4NO5A 1I1YA 1G7PA 3D2UA 5HGBA 3ARGA 5J1AA 2JCCA 1UXSA 5C0BA 3TIEA 4F7EA 3MRBA 1VADA 1JHTA 3HLAA 2BSRA 3MREA 4PRDA 5BXFA 1N5AA 1BQHA 1KPUA 5FA3A 3PWPA 4APQA 4L3CA 3RWCA 1FFPA 2UWEA 1ZAGA 1LD9A 4F7MA 3TVMA 4Z78A 1S7SA 1EXUA 3BVNA 4G9DA 4JFDA 2X4PA 3JTTA 3L9RA 4IHOA 1AGBA 3MRRA 3DX7A 2OL3H 4HKJA 4CVXA 1FZKA 3HUJA 2X4QA 2VABA 4ZUWA 3VFPA 1A6ZA 3D25A 1U58A 5C0FA 5L2JA 4O2EA 1NAMH 5E8NA 2PO6A 4WW2C 1ZT7A 1T7XA 3BGMA 4PG2A 3MRNA 2VLKA 1HSAA 1XR8A 5C08A 1HHJA 4L8BA 2X4RA 4MJ6A 2FZ3A 2ZOKA 3LN5A 3VFVA 2BSSA 5F1NA 1QEWA 1AKJA 3BH8A 1B0GA 3UTQA 5MENA 4NT6A 5EU6A 3BH9A 3LKOA 3O3DA 2MHAA 1S9YA 3KPMA 3GMNA 1FZOA 3FQRA 4GKNA 1QLFA 3L3DA 3FOMA 4L8DA 1YPZA 3LV3A 1RJYA 1QQDA 1KPVA 1LK2A 4PJHA 4EN3C 3RWEA 1TVHA 2ESVA 3MRJA 4ONOA 1I7RA 1ZHNA 3KYOA 4F7PA 1W72A 5C0EA 3TBSA 3GSNH 4PG9A 4QRPA 3MV8A 1T20A 1A9EA 1TMCA 3MA7A 1OGTA 5EOTA 4L9LC 5EFIA 3REWA 5SWZA 1JFMA 1FZJA 3VFUA 4PP8C 3KPLA 5HGAA 4JFPA 1DE4A 3HCVA 2CIIA 4LCCC 1I1FA 3IT8D 4XXCA 1K5NA 3HE6A 1IM9A 3FT2A 4MNQA 4NO0A 2A83A 1I1AA 1DDHA 1HHKA 2VLRA 3LKRA 1QSEA 5C0JA 3RWJA 5FDWA 5E8PA 3SKOA 3O3EA 5IB5A 2P5EA 2YPLA 4NQEA 4PR5A 2CKBH 3CDGA 4WU5A 5MERA 1S9WA 3KXFA 3RUGA 3UTTA 1T7WA 2FIKA 3UPRA 5EUOA 3V5HA 5BJTA 3VFNA 1JUFA 2GAZA 4MVBA 3O8XA 5AD0A 4WO4A 4JRXA 4HWZA 4S0UC 4MS8A 2AV7A 2GTWA 3MGTA 4PJIA 4MX7A 4X6DA 1KCGC 1QSFA 3PWLA 5D9SA 1XH3A 3P4NA 3VWKA 1B3JA 3BUYA 2F54A 1ZVSA 3MRQA 3MV7A 4NO3A 3FQWA 1FG2A 5IM7A 4Y4HA 3TA3A 5IVXA 2GUOA 4U1KA 4LCYA 1ZT1A 1XR9A 1S7WA 2CIKA 1P1ZA 5B39A 4N0CA 1ZHKA 4PJXA 3S6CA 3BW9A 5HGHA 3UTSA 5BS0A 1OGAA 5C0GA 1TVBA 3GSUA 4QRSA 1T0MA 1YDPA 3QUXA 5F7DA 3KLAA 3H9HA 3T8XA 5DEFA 1R3HA 3GJFA 3GMOA 5F1IA 3U0PA 3C8KA 3KPOA 3QFJA 3DTXA 5C0CA 3KPQA 3QZWA 4N8VA 4FTVA 3P73A 2AXGA 3GMQA 3BWAA 5E8OA 5EU4A 1OF2A 2NX5A 3BP4A 3JTSA 3ROOA 4HV8A 4L3EA 1HYRC 1QRNA 4JQVA 4Y4FA 3E2HA 3FT3A 5EO1A 2C7UA 3ARDA 3B3IA 4PJDA 3MRDA 5IB4A 5IB2A 3RL1A 1T0NA 3TIDA 1T1XA 1KTLA 1BIIA 2H26A 5EU3A 1GZPA 3SDXA 2BNRA 3VXUA 1ZS8A 3TBTA 5C9JA 1PQZA 2X4UA 3MYJA 4D0CA 5DDHA 3HAEA 5IEKA 3C9NA 1S7RA 3GSRA 1MI5A 4K7FA 4JFEA 4IRSA 4F7TA 1G7QA 1RJZA 1T7ZA 3RWIA 3QDMA 2CLVA 1I4FA 1N2RA 5HHPA 3L3JA 1I7UA 3OV6A 3VXNA 3W39A 4QRRA 3WS6A 3X12A 1EEZA 1YN7A 2GJ6A 3GMRA 3CH1A 4U1JA 2OI9A 3L3HA 4X6CA 1S7VA 3QUKA 5FA4A 4PRHA 3B6SA 1ONQA 3VXRA 1S7UA 4PJGA 3D3VA 1W0WA 3P9MA 4EUPA 1W0VA 2NW3A 4HS3A 4N0UA 4HUWA 5C09A 4L4VA 4PV8A 5EO0A 4Y4KA 3ECBA 2RFXA 3FRUA 5D7LA 4PJ9A 1DUZA 3BO8A 3E6HA 3ROLA 1JPGA 1KJVA 3FQNA 4U1IA 3TFKA 3TO4A 2WY3A 3ARBA 3HE7A 4MQ7A 4U1NA 3MRLA 4NQDA 3FONA 3X13A 5IB3A 3LKNA 4PGEA 5J6GA 1RK1A 1SYVA 3GSOA 1HOCA 4WUUA 5ACZA 3VJ6A 1QR1A 3SCMA 4U1MA 3MGOA 3MRPA 1B0RA 3VXOA 3L3IA 4MNGA 3MRCA 5L2KA 3WL9A 1M05A 3ILPA 2Q7YA 3SJVA 1JE6A 2CLRA 4G42A 1KJ2H 4ZUSA 3KWWA 4QOKA 3RTQA 2VLLA 1VACA 1NEZA 1RK0A 3OX8A 3P9LA 3VFOA 5C0AA 3JTCA 3TPUE 1S7QA 3MR9A 4LCWA 5INCA 1C16A 4CVZA 2AV1A 3GMLA 1CG9A 3VFRA 2J8UA 4HX1A 3TF7A 3RWGA 1LEGA 3MRKA 3VWJA 4HUVA 4LHUA 4MJ5A 3X14A 4PRBA 3BZEA 3I6KA 5SWQA 1T1ZA 1A1MA 2BCKA 4PJFA 3QFDA 3FQXA 4U1HA 3SDDA 3KYNA 2GT9A 3M1BA 1UQSA
chains in the Genus database with same CATH superfamily
4ZUTA 3TJHA 3L3KA 3D18A 4U6XA 3VFSA 1E27A 2CLZA 3L3GA 5C07A 3QI9A 3O9WA 3FOLA 1EEYA 2DYPA 1FFOA 1T7VA 3HPJA 4G43A 4PRNA 4ZAKA 5ISZA 1CD1A 2FYYA 1ZHLA 4FFEX 3V5DA 4PV9A 4L8SC 1UXWA 4WDIA 1KJ3H 1SYSA 4WWKC 1AGCA 1S9XA 4G8GA 3X11A 1S7TA 2NYKA 4PGDA 1MHCA 3ES6A 2P5WA 5C0DA 3G08A 1T1WA 3MRFA 1VGKA 3MRMA 5D7JC 5IEHA 4IRJA 3V5KA 5IROA 2F53A 3JVGA 1FZMA 4PJEA 3P4OA 2FO4A 2H6PA 3I6LD 4LNRA 1MHEA 2BVQA 3SDAA 3SKMA 4ZUUA 1DUYA 5E00A 5E9DA 1T80A 2HLAA 2BVPA 4JFQA 3RZCA 3QQ4A 3T1FA 4GKSA 4NNXA 4PJ7A 3VFWA 1N59A 3GSQA 4NNYA 1FO0H 1WBXA 4Z77A 4UQ3A 4X6EA 1NANH 1JPFA 4WJ5A 2X4NA 3M17A 5IB1A 5C0IA 2BVOA 2HN7A 2VE6A 1JGEA 5JHDA 2VLJA 3PWVA 4G9FA 3BHBA 3W0WA 3BXNA 3MRIA 3FQUA 3VRJA 4JFOA 3CCHA 2ZOLA 3ARFA 4I4WA 3O3BA 1AGDA 3CVHA 5SWSA 1K8DA 4D0DA 1N3NA 3GMMA 4PJCA 1T21A 5HGDA 1WBZA 3DMMA 3QDGA 3H7BA 3LKQA 2BSTA 3MRGA 3NFNA 2VAAA 1AGEA 1BD2A 3MV9A 1HHHA 4Y16A 5HHMA 3QEQA 4Z76A 4NHUE 3CC5A 5EU5A 1T22A 5HHOA 3WS3A 4PRPA 1I7TA 3CPLA 3GSVA 4QRTA 3H9SA 1X7QA 3LKPA 5GSRA 3WLBA 4E0RA 1OSZA 3PABA 2V2WA 4BKWA 1G6RH 4NQCA 4NSKA 2X4SA 2BNQA 1AO7A 4D0BA 1Q94A 3GIVA 4K71B 2F74A 4U6YA 5D2LA 3P4MA 3FT4A 3GSXA 4JQXA 2X4TA 3CZFA 3VXSA 5MEQA 1EFXA 3KPRA 1QVOA 5HHQA 3DX8A 2D31A 3FFCA 3WUWA 1KBGH 1JF1A 3QUZA 1LDPH 3FTGA 5MEPA 3QUYA 2HJKA 3PWJA 5E6IC 4ZFZA 4PDCE 5F9JA 3VCLA 1BZ9A 3AM8A 1INQA 3VXPA 4F7CA 3ERYA 4NQVA 4L8CA 5DEGA 3AREA 3P77A 4PREA 3OXSA 3QQ3A 5HYJA 1AGFA 3ILQC 1JGDA 1HSBA 2GTZA 3D39A 1MWAH 1LQVA 3HG1A 4L4TA 5GSVA 1HHGA 3I6GA 5D7IA 3VFTA 2HJLA 3TZVC 3PWNA 4PJ8A 3VH8A 3MRHA 3TBYA 2AXFA 3BEVA 3GSWA 4PJAA 3TO2A 1S7XA 1WBYA 3KPSA 4MXQA 2AKRA 3VFMA 3RGVC 1A9BA 4JFFA 3BEWA 3DBXA 4V3EB 4I48A 3SDCA 5MEOA 3VXMA 4PGBA 4O2FA 2E7LE 4ZUVA 3RWHA 1QO3A 2X70A 3OXRA 4L29A 2YEZA 4UQ2A 3RWFA 2X4OA 3QDJA 1A1NA 4V3DB 5B38A 4PRIA 3RL2A 2ZSWA 2XFXA 5INDA 3PWUA 1LP9A 3I0TA 4U1LA 1KPRA 3E6FA 4E5XA 4IIQC 3LN4A 3O4LA 5FKPA 4G8IA 3DX6A 3GMPA 1LEKA 2GITA 3BZFA 3TBWA 3AU1A 4Y2DA 1FFNA 3UBXA 1IM3A 1E28A 3QULA 4HUXA 4G59A 2YPKA 1S8DA 4EI5A 3SPVA 1M6OA 4NO2A 4QRUA 4CW1A 3KPPA 4N5EA 2ZSVA 1A1OA 2XPGA 4PGCA 4U1SA 3TN0A 4PJ5A 4O2CA 3MROA 3O3AA 1HHIA 1KJMA 1YN6A 1Z5LA 3LKSA 3VRIA 3PQYA 3IXAA 1ZHBA 1ZSDA 5D2NA 1ED3A 1P4LA 4NQXA 1GZQA 1ZT4A 2V2XA 4JRYA 1T7YA 3DXAA 5H94A 5BRZA 5J6HA 2FWOA 3E3QA 4N0FA 4PRAA 4GUPA 2PYEA 1L8JA 2AK4A 1CE6A 4MJIA 4QRQA 1T1YA 3FQTA 1P7QA 4PJBA 1XZ0A 4WU7A 5ENWA 5HHNA 4ELMA 4HUUA 3KPNA 3TBVA 3BP7A 4X6FA 3RWDA 5D5MA 4NO5A 1I1YA 1G7PA 3D2UA 5HGBA 3ARGA 5J1AA 2JCCA 1UXSA 5C0BA 3TIEA 4F7EA 3MRBA 1VADA 1JHTA 3HLAA 2BSRA 3MREA 4PRDA 5BXFA 1N5AA 1BQHA 1KPUA 5FA3A 3PWPA 4APQA 4L3CA 3RWCA 1FFPA 2UWEA 1ZAGA 1LD9A 4F7MA 3TVMA 4Z78A 1S7SA 1EXUA 3BVNA 4G9DA 4JFDA 2X4PA 3JTTA 3L9RA 4IHOA 1AGBA 3MRRA 3DX7A 2OL3H 4HKJA 4CVXA 1FZKA 3HUJA 2X4QA 4JO8A 2VABA 4ZUWA 3VFPA 1A6ZA 3D25A 1U58A 5C0FA 5L2JA 4O2EA 1NAMH 5E8NA 2PO6A 4WW2C 1ZT7A 1T7XA 3BGMA 4PG2A 3MRNA 2VLKA 1HSAA 1XR8A 5C08A 1HHJA 4L8BA 2IA1A 2X4RA 4MJ6A 2FZ3A 2ZOKA 3LN5A 3VFVA 2BSSA 5F1NA 1QEWA 1AKJA 3BH8A 1B0GA 3UTQA 5MENA 4NT6A 5EU6A 3BH9A 3LKOA 3O3DA 2MHAA 1S9YA 3KPMA 3GMNA 1FZOA 3FQRA 4GKNA 1QLFA 3L3DA 3FOMA 4L8DA 1YPZA 3LV3A 1RJYA 1QQDA 1KPVA 1LK2A 4PJHA 4EN3C 3RWEA 1TVHA 2ESVA 3MRJA 4ONOA 1I7RA 1ZHNA 3KYOA 4F7PA 1W72A 5C0EA 3TBSA 3GSNH 4PG9A 4QRPA 3MV8A 1T20A 1A9EA 1TMCA 3MA7A 1OGTA 5EOTA 4L9LC 5EFIA 3REWA 5SWZA 1JFMA 1FZJA 3VFUA 4PP8C 3KPLA 5HGAA 4JFPA 1DE4A 3HCVA 2CIIA 4LCCC 1I1FA 3IT8D 4XXCA 1K5NA 3HE6A 1IM9A 3FT2A 4MNQA 4NO0A 2A83A 1I1AA 1DDHA 1HHKA 2VLRA 3LKRA 1QSEA 5C0JA 3RWJA 5FDWA 5E8PA 3SKOA 3O3EA 5IB5A 2P5EA 2YPLA 4NQEA 4PR5A 2CKBH 3CDGA 4WU5A 5MERA 1S9WA 3KXFA 3RUGA 3UTTA 1T7WA 2FIKA 3UPRA 5EUOA 3V5HA 5BJTA 3VFNA 1JUFA 2GAZA 4MVBA 3O8XA 5AD0A 4WO4A 4JRXA 4HWZA 4S0UC 4MS8A 2AV7A 2GTWA 3MGTA 4PJIA 4MX7A 4X6DA 1KCGC 1QSFA 3PWLA 5D9SA 1XH3A 2O5NA 3P4NA 1B3JA 3VWKA 3BUYA 2F54A 1ZVSA 3MRQA 3MV7A 4NO3A 3FQWA 1FG2A 5IM7A 4Y4HA 3TA3A 5IVXA 2GUOA 4U1KA 4LCYA 1ZT1A 1XR9A 1S7WA 2CIKA 1P1ZA 5B39A 4N0CA 1ZHKA 4PJXA 3S6CA 3BW9A 5HGHA 3UTSA 5BS0A 1OGAA 5C0GA 1TVBA 3GSUA 4QRSA 1T0MA 1YDPA 3QUXA 5F7DA 3KLAA 3H9HA 3T8XA 5DEFA 1R3HA 3GJFA 3GMOA 5F1IA 3U0PA 3C8KA 3KPOA 3QFJA 3DTXA 5C0CA 3KPQA 3QZWA 4G59C 4FTVA 4N8VA 3P73A 2AXGA 3GMQA 3BWAA 5E8OA 5EU4A 1OF2A 2NX5A 3BP4A 3JTSA 3ROOA 4HV8A 4L3EA 1HYRC 1QRNA 4JQVA 4Y4FA 3E2HA 3FT3A 5EO1A 2C7UA 3ARDA 3B3IA 4PJDA 3MRDA 5IB4A 5IB2A 3RL1A 1T0NA 3TIDA 1T1XA 1KTLA 1BIIA 2H26A 5EU3A 1GZPA 3SDXA 2BNRA 3VXUA 1ZS8A 3TBTA 5C9JA 1PQZA 2X4UA 3MYJA 4D0CA 5DDHA 3HAEA 5IEKA 3C9NA 1S7RA 3GSRA 1MI5A 4K7FA 4JFEA 4IRSA 4F7TA 1G7QA 1RJZA 1T7ZA 3RWIA 3QDMA 2CLVA 1I4FA 1N2RA 5HHPA 3L3JA 1I7UA 3OV6A 3VXNA 3W39A 4QRRA 3WS6A 3X12A 1EEZA 1YN7A 2GJ6A 3GMRA 3CH1A 4U1JA 2OI9A 3L3HA 4X6CA 1S7VA 3QUKA 5FA4A 4PRHA 3B6SA 1ONQA 3VXRA 1S7UA 4PJGA 3D3VA 1W0WA 3P9MA 4EUPA 1W0VA 2NW3A 4HS3A 4N0UA 4HUWA 5C09A 4L4VA 4PV8A 5EO0A 4Y4KA 3ECBA 2RFXA 3FRUA 5D7LA 4PJ9A 1DUZA 3BO8A 3E6HA 3ROLA 1JPGA 1KJVA 3FQNA 4U1IA 3TFKA 3TO4A 2WY3A 3ARBA 3HE7A 4MQ7A 4U1NA 3MRLA 4NQDA 3FONA 3X13A 5IB3A 3LKNA 4PGEA 5J6GA 1RK1A 1SYVA 3GSOA 1HOCA 4WUUA 5ACZA 3VJ6A 1QR1A 3SCMA 4U1MA 3MGOA 3MRPA 1B0RA 3VXOA 3L3IA 4MNGA 3MRCA 5L2KA 3WL9A 1M05A 3ILPA 2Q7YA 3SJVA 1JE6A 2CLRA 4G42A 1KJ2H 4ZUSA 3KWWA 4QOKA 3RTQA 2VLLA 1VACA 1NEZA 1RK0A 3OX8A 3P9LA 3VFOA 5C0AA 3JTCA 3TPUE 1S7QA 3MR9A 4LCWA 5INCA 1C16A 4CVZA 2AV1A 3GMLA 1CG9A 3VFRA 2J8UA 4HX1A 3TF7A 3RWGA 1LEGA 3MRKA 3VWJA 4HUVA 4LHUA 4MJ5A 3X14A 4PRBA 3BZEA 3I6KA 5SWQA 1T1ZA 1A1MA 2BCKA 4PJFA 3QFDA 3FQXA 4U1HA 3SDDA 3KYNA 2GT9A 3M1BA 1UQSA
chains in the Genus database with same CATH topology
4ZUTA 3TJHA 3L3KA 3D18A 4U6XA 3VFSA 1E27A 2CLZA 3L3GA 5C07A 3QI9A 3O9WA 3FOLA 1EEYA 2DYPA 1FFOA 1T7VA 3HPJA 4G43A 4PRNA 4ZAKA 5ISZA 1CD1A 2FYYA 1ZHLA 4FFEX 3V5DA 4PV9A 4L8SC 1UXWA 4WDIA 1KJ3H 1SYSA 4WWKC 1AGCA 1S9XA 4G8GA 3X11A 1S7TA 4PGDA 1MHCA 3ES6A 2P5WA 5C0DA 3G08A 1T1WA 3MRFA 1VGKA 3MRMA 5D7JC 5IEHA 4IRJA 3V5KA 5IROA 2F53A 3JVGA 1FZMA 4PJEA 3P4OA 2FO4A 2H6PA 3I6LD 4LNRA 1MHEA 2BVQA 3SDAA 3SKMA 4ZUUA 1DUYA 5E00A 5E9DA 1T80A 2HLAA 2BVPA 4JFQA 3RZCA 3QQ4A 3T1FA 4GKSA 4NNXA 4PJ7A 3VFWA 1N59A 3GSQA 4NNYA 1FO0H 1WBXA 4Z77A 4UQ3A 4X6EA 1NANH 1JPFA 4WJ5A 2X4NA 3M17A 5IB1A 5C0IA 2BVOA 2HN7A 2VE6A 1JGEA 5JHDA 2VLJA 3PWVA 4G9FA 3BHBA 3W0WA 3BXNA 3MRIA 3FQUA 3VRJA 4JFOA 3CCHA 2ZOLA 3ARFA 4I4WA 3O3BA 1AGDA 3CVHA 5SWSA 1K8DA 4D0DA 1N3NA 3GMMA 4PJCA 1T21A 5HGDA 1WBZA 3DMMA 3QDGA 3H7BA 3LKQA 2BSTA 3MRGA 3NFNA 2VAAA 1AGEA 1BD2A 3MV9A 1HHHA 4Y16A 5HHMA 3QEQA 4Z76A 4NHUE 3CC5A 5EU5A 1T22A 5HHOA 3WS3A 4PRPA 1I7TA 3CPLA 3GSVA 4QRTA 3H9SA 1X7QA 3LKPA 5GSRA 3WLBA 4E0RA 1OSZA 3PABA 2V2WA 1G6RH 4NQCA 4NSKA 2X4SA 2BNQA 1AO7A 4D0BA 1Q94A 3GIVA 4K71B 2F74A 4U6YA 5D2LA 3P4MA 3FT4A 3GSXA 4JQXA 2X4TA 3CZFA 3VXSA 5MEQA 1EFXA 3KPRA 1QVOA 5HHQA 3DX8A 2D31A 3FFCA 3WUWA 1KBGH 1JF1A 3QUZA 1LDPH 3FTGA 5MEPA 3QUYA 2HJKA 3PWJA 5E6IC 4ZFZA 4PDCE 5F9JA 3VCLA 1BZ9A 3AM8A 1INQA 3VXPA 4F7CA 3ERYA 4NQVA 4L8CA 5DEGA 3AREA 3P77A 4PREA 3OXSA 3QQ3A 5HYJA 1AGFA 3ILQC 1JGDA 1HSBA 2GTZA 3D39A 1MWAH 1LQVA 3HG1A 4L4TA 5GSVA 1HHGA 3I6GA 5D7IA 3VFTA 2HJLA 3TZVC 3PWNA 4PJ8A 3VH8A 3MRHA 3TBYA 2AXFA 3BEVA 3GSWA 4PJAA 3TO2A 1S7XA 1WBYA 3KPSA 4MXQA 2AKRA 3VFMA 3RGVC 1A9BA 4JFFA 3BEWA 3DBXA 4V3EB 4I48A 3SDCA 5MEOA 3VXMA 4PGBA 4O2FA 2E7LE 4ZUVA 3RWHA 1QO3A 2X70A 3OXRA 4L29A 2YEZA 4UQ2A 3RWFA 2X4OA 3QDJA 1A1NA 4V3DB 5B38A 4PRIA 3RL2A 2ZSWA 2XFXA 5INDA 3PWUA 1LP9A 4U1LA 1KPRA 3E6FA 4E5XA 4IIQC 3LN4A 3O4LA 5FKPA 4G8IA 3DX6A 3GMPA 1LEKA 2GITA 3BZFA 3TBWA 3AU1A 4Y2DA 1FFNA 3UBXA 1IM3A 1E28A 3QULA 4HUXA 4G59A 2YPKA 1S8DA 4EI5A 3SPVA 1M6OA 4NO2A 4QRUA 4CW1A 3KPPA 4N5EA 2ZSVA 1A1OA 2XPGA 4PGCA 4U1SA 3TN0A 4PJ5A 4O2CA 3MROA 3O3AA 1HHIA 1KJMA 1YN6A 1Z5LA 3LKSA 3VRIA 3PQYA 3IXAA 1ZHBA 1ZSDA 5D2NA 1ED3A 1P4LA 4NQXA 1GZQA 1ZT4A 2V2XA 4JRYA 1T7YA 3DXAA 5H94A 5BRZA 5J6HA 2FWOA 3E3QA 4N0FA 4PRAA 4GUPA 2PYEA 1L8JA 2AK4A 1CE6A 4MJIA 4QRQA 1T1YA 3FQTA 1P7QA 4PJBA 1XZ0A 4WU7A 5ENWA 5HHNA 4ELMA 4HUUA 3KPNA 3TBVA 3BP7A 4X6FA 3RWDA 5D5MA 4NO5A 1I1YA 1G7PA 3D2UA 5HGBA 3ARGA 5J1AA 2JCCA 1UXSA 5C0BA 3TIEA 4F7EA 3MRBA 1VADA 1JHTA 3HLAA 2BSRA 3MREA 4PRDA 5BXFA 1N5AA 1BQHA 1KPUA 5FA3A 3PWPA 4APQA 4L3CA 3RWCA 1FFPA 2UWEA 1ZAGA 1LD9A 4F7MA 3TVMA 4Z78A 1S7SA 1EXUA 3BVNA 4G9DA 4JFDA 2X4PA 3JTTA 3L9RA 4IHOA 1AGBA 3MRRA 3DX7A 2OL3H 4HKJA 4CVXA 1FZKA 3HUJA 2X4QA 2VABA 4ZUWA 3VFPA 1A6ZA 3D25A 1U58A 5C0FA 5L2JA 4O2EA 1NAMH 5E8NA 2PO6A 4WW2C 1ZT7A 1T7XA 3BGMA 4PG2A 3MRNA 2VLKA 1HSAA 1XR8A 5C08A 1HHJA 4L8BA 2X4RA 4MJ6A 2FZ3A 2ZOKA 3LN5A 3VFVA 2BSSA 5F1NA 1QEWA 1AKJA 3BH8A 1B0GA 3UTQA 5MENA 4NT6A 5EU6A 3BH9A 3LKOA 3O3DA 2MHAA 1S9YA 3KPMA 3GMNA 1FZOA 3FQRA 4GKNA 1QLFA 3L3DA 3FOMA 4L8DA 1YPZA 3LV3A 1RJYA 1QQDA 1KPVA 1LK2A 4PJHA 4EN3C 3RWEA 1TVHA 2ESVA 3MRJA 4ONOA 1I7RA 1ZHNA 3KYOA 4F7PA 1W72A 5C0EA 3TBSA 3GSNH 4PG9A 4QRPA 3MV8A 1T20A 1A9EA 1TMCA 3MA7A 1OGTA 5EOTA 4L9LC 5EFIA 3REWA 5SWZA 1JFMA 1FZJA 3VFUA 4PP8C 3KPLA 5HGAA 4JFPA 1DE4A 3HCVA 2CIIA 4LCCC 1I1FA 3IT8D 4XXCA 1K5NA 3HE6A 1IM9A 3FT2A 4MNQA 4NO0A 2A83A 1I1AA 1DDHA 1HHKA 2VLRA 3LKRA 1QSEA 5C0JA 3RWJA 5FDWA 5E8PA 3SKOA 3O3EA 5IB5A 2P5EA 2YPLA 4NQEA 4PR5A 2CKBH 3CDGA 4WU5A 5MERA 1S9WA 3KXFA 3RUGA 3UTTA 1T7WA 2FIKA 3UPRA 5EUOA 3V5HA 5BJTA 3VFNA 1JUFA 2GAZA 4MVBA 3O8XA 5AD0A 4WO4A 4JRXA 4HWZA 4S0UC 4MS8A 2AV7A 2GTWA 3MGTA 4PJIA 4MX7A 4X6DA 1KCGC 1QSFA 3PWLA 5D9SA 1XH3A 3P4NA 3VWKA 1B3JA 3BUYA 2F54A 1ZVSA 3MRQA 3MV7A 4NO3A 3FQWA 1FG2A 5IM7A 4Y4HA 3TA3A 5IVXA 2GUOA 4U1KA 4LCYA 1ZT1A 1XR9A 1S7WA 2CIKA 1P1ZA 5B39A 4N0CA 1ZHKA 4PJXA 3S6CA 3BW9A 5HGHA 3UTSA 5BS0A 1OGAA 5C0GA 1TVBA 3GSUA 4QRSA 1T0MA 1YDPA 3QUXA 5F7DA 3KLAA 3H9HA 3T8XA 5DEFA 1R3HA 3GJFA 3GMOA 5F1IA 3U0PA 3C8KA 3KPOA 3QFJA 3DTXA 5C0CA 3KPQA 3QZWA 4N8VA 4FTVA 3P73A 2AXGA 3GMQA 3BWAA 5E8OA 5EU4A 1OF2A 2NX5A 3BP4A 3JTSA 3ROOA 4HV8A 4L3EA 1HYRC 1QRNA 4JQVA 4Y4FA 3E2HA 3FT3A 5EO1A 2C7UA 3ARDA 3B3IA 4PJDA 3MRDA 5IB4A 5IB2A 3RL1A 1T0NA 3TIDA 1T1XA 1KTLA 1BIIA 2H26A 5EU3A 1GZPA 3SDXA 2BNRA 3VXUA 1ZS8A 3TBTA 5C9JA 1PQZA 2X4UA 3MYJA 4D0CA 5DDHA 3HAEA 5IEKA 3C9NA 1S7RA 3GSRA 1MI5A 4K7FA 4JFEA 4IRSA 4F7TA 1G7QA 1RJZA 1T7ZA 3RWIA 3QDMA 2CLVA 1I4FA 1N2RA 5HHPA 3L3JA 1I7UA 3OV6A 3VXNA 3W39A 4QRRA 3WS6A 3X12A 1EEZA 1YN7A 2GJ6A 3GMRA 3CH1A 4U1JA 2OI9A 3L3HA 4X6CA 1S7VA 3QUKA 5FA4A 4PRHA 3B6SA 1ONQA 3VXRA 1S7UA 4PJGA 3D3VA 1W0WA 3P9MA 4EUPA 1W0VA 2NW3A 4HS3A 4N0UA 4HUWA 5C09A 4L4VA 4PV8A 5EO0A 4Y4KA 3ECBA 2RFXA 3FRUA 5D7LA 4PJ9A 1DUZA 3BO8A 3E6HA 3ROLA 1JPGA 1KJVA 3FQNA 4U1IA 3TFKA 3TO4A 2WY3A 3ARBA 3HE7A 4MQ7A 4U1NA 3MRLA 4NQDA 3FONA 3X13A 5IB3A 3LKNA 4PGEA 5J6GA 1RK1A 1SYVA 3GSOA 1HOCA 4WUUA 5ACZA 3VJ6A 1QR1A 3SCMA 4U1MA 3MGOA 3MRPA 1B0RA 3VXOA 3L3IA 4MNGA 3MRCA 5L2KA 3WL9A 1M05A 3ILPA 2Q7YA 3SJVA 1JE6A 2CLRA 4G42A 1KJ2H 4ZUSA 3KWWA 4QOKA 3RTQA 2VLLA 1VACA 1NEZA 1RK0A 3OX8A 3P9LA 3VFOA 5C0AA 3JTCA 3TPUE 1S7QA 3MR9A 4LCWA 5INCA 1C16A 4CVZA 2AV1A 3GMLA 1CG9A 3VFRA 2J8UA 4HX1A 3TF7A 3RWGA 1LEGA 3MRKA 3VWJA 4HUVA 4LHUA 4MJ5A 3X14A 4PRBA 3BZEA 3I6KA 5SWQA 1T1ZA 1A1MA 2BCKA 4PJFA 3QFDA 3FQXA 4U1HA 3SDDA 3KYNA 2GT9A 3M1BA 1UQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUT A;  3TJH A;  3L3K A;  3D18 A;  4U6X A;  3VFS A;  1E27 A;  2CLZ A;  3L3G A;  5C07 A;  3QI9 A;  3O9W A;  3FOL A;  1EEY A;  2DYP A;  1FFO A;  1T7V A;  3HPJ A;  4G43 A;  4PRN A;  4ZAK A;  5ISZ A;  1CD1 A;  2FYY A;  1ZHL A;  4FFE X;  3V5D A;  4PV9 A;  4L8S C;  1UXW A;  4WDI A;  1KJ3 H;  1SYS A;  4WWK C;  1AGC A;  1S9X A;  4G8G A;  3X11 A;  1S7T A;  4PGD A;  1MHC A;  3ES6 A;  2P5W A;  5C0D A;  3G08 A;  1T1W A;  3MRF A;  1VGK A;  3MRM A;  5D7J C;  5IEH A;  4IRJ A;  3V5K A;  5IRO A;  2F53 A;  3JVG A;  1FZM A;  4PJE A;  3P4O A;  2FO4 A;  2H6P A;  3I6L D;  4LNR A;  1MHE A;  2BVQ A;  3SDA A;  3SKM A;  4ZUU A;  1DUY A;  5E00 A;  5E9D A;  1T80 A;  2HLA A;  2BVP A;  4JFQ A;  3RZC A;  3QQ4 A;  3T1F A;  4GKS A;  4NNX A;  4PJ7 A;  3VFW A;  1N59 A;  3GSQ A;  4NNY A;  1FO0 H;  1WBX A;  4Z77 A;  4UQ3 A;  4X6E A;  1NAN H;  1JPF A;  4WJ5 A;  2X4N A;  3M17 A;  5IB1 A;  5C0I A;  2BVO A;  2HN7 A;  2VE6 A;  1JGE A;  5JHD A;  2VLJ A;  3PWV A;  4G9F A;  3BHB A;  3W0W A;  3BXN A;  3MRI A;  3FQU A;  3VRJ A;  4JFO A;  3CCH A;  2ZOL A;  3ARF A;  4I4W A;  3O3B A;  1AGD A;  3CVH A;  5SWS A;  1K8D A;  4D0D A;  1N3N A;  3GMM A;  4PJC A;  1T21 A;  5HGD A;  1WBZ A;  3DMM A;  3QDG A;  3H7B A;  3LKQ A;  2BST A;  3MRG A;  3NFN A;  2VAA A;  1AGE A;  1BD2 A;  3MV9 A;  1HHH A;  4Y16 A;  5HHM A;  3QEQ A;  4Z76 A;  4NHU E;  3CC5 A;  5EU5 A;  1T22 A;  5HHO A;  3WS3 A;  4PRP A;  1I7T A;  3CPL A;  3GSV A;  4QRT A;  3H9S A;  1X7Q A;  3LKP A;  5GSR A;  3WLB A;  4E0R A;  1OSZ A;  3PAB A;  2V2W A;  1G6R H;  4NQC A;  4NSK A;  2X4S A;  2BNQ A;  1AO7 A;  4D0B A;  1Q94 A;  3GIV A;  4K71 B;  2F74 A;  4U6Y A;  5D2L A;  3P4M A;  3FT4 A;  3GSX A;  4JQX A;  2X4T A;  3CZF A;  3VXS A;  5MEQ A;  1EFX A;  3KPR A;  1QVO A;  5HHQ A;  3DX8 A;  2D31 A;  3FFC A;  3WUW A;  1KBG H;  1JF1 A;  3QUZ A;  1LDP H;  3FTG A;  5MEP A;  3QUY A;  2HJK A;  3PWJ A;  5E6I C;  4ZFZ A;  4PDC E;  5F9J A;  3VCL A;  1BZ9 A;  3AM8 A;  1INQ A;  3VXP A;  4F7C A;  3ERY A;  4NQV A;  4L8C A;  5DEG A;  3ARE A;  3P77 A;  4PRE A;  3OXS A;  3QQ3 A;  5HYJ A;  1AGF A;  3ILQ C;  1JGD A;  1HSB A;  2GTZ A;  3D39 A;  1MWA H;  1LQV A;  3HG1 A;  4L4T A;  5GSV A;  1HHG A;  3I6G A;  5D7I A;  3VFT A;  2HJL A;  3TZV C;  3PWN A;  4PJ8 A;  3VH8 A;  3MRH A;  3TBY A;  2AXF A;  3BEV A;  3GSW A;  4PJA A;  3TO2 A;  1S7X A;  1WBY A;  3KPS A;  4MXQ A;  2AKR A;  3VFM A;  3RGV C;  1A9B A;  4JFF A;  3BEW A;  3DBX A;  4V3E B;  4I48 A;  3SDC A;  5MEO A;  3VXM A;  4PGB A;  4O2F A;  2E7L E;  4ZUV A;  3RWH A;  1QO3 A;  2X70 A;  3OXR A;  4L29 A;  2YEZ A;  4UQ2 A;  3RWF A;  2X4O A;  3QDJ A;  1A1N A;  4V3D B;  5B38 A;  4PRI A;  3RL2 A;  2ZSW A;  2XFX A;  5IND A;  3PWU A;  1LP9 A;  4U1L A;  1KPR A;  3E6F A;  4E5X A;  4IIQ C;  3LN4 A;  3O4L A;  5FKP A;  4G8I A;  3DX6 A;  3GMP A;  1LEK A;  2GIT A;  3BZF A;  3TBW A;  3AU1 A;  4Y2D A;  1FFN A;  3UBX A;  1IM3 A;  1E28 A;  3QUL A;  4HUX A;  4G59 A;  2YPK A;  1S8D A;  4EI5 A;  3SPV A;  1M6O A;  4NO2 A;  4QRU A;  4CW1 A;  3KPP A;  4N5E A;  2ZSV A;  1A1O A;  2XPG A;  4PGC A;  4U1S A;  3TN0 A;  4PJ5 A;  4O2C A;  3MRO A;  3O3A A;  1HHI A;  1KJM A;  1YN6 A;  1Z5L A;  3LKS A;  3VRI A;  3PQY A;  3IXA A;  1ZHB A;  1ZSD A;  5D2N A;  1ED3 A;  1P4L A;  4NQX A;  1GZQ A;  1ZT4 A;  2V2X A;  4JRY A;  1T7Y A;  3DXA A;  5H94 A;  5BRZ A;  5J6H A;  2FWO A;  3E3Q A;  4N0F A;  4PRA A;  4GUP A;  2PYE A;  1L8J A;  2AK4 A;  1CE6 A;  4MJI A;  4QRQ A;  1T1Y A;  3FQT A;  1P7Q A;  4PJB A;  1XZ0 A;  4WU7 A;  5ENW A;  5HHN A;  4ELM A;  4HUU A;  3KPN A;  3TBV A;  3BP7 A;  4X6F A;  3RWD A;  5D5M A;  4NO5 A;  1I1Y A;  1G7P A;  3D2U A;  5HGB A;  3ARG A;  5J1A A;  2JCC A;  1UXS A;  5C0B A;  3TIE A;  4F7E A;  3MRB A;  1VAD A;  1JHT A;  3HLA A;  2BSR A;  3MRE A;  4PRD A;  5BXF A;  1N5A A;  1BQH A;  1KPU A;  5FA3 A;  3PWP A;  4APQ A;  4L3C A;  3RWC A;  1FFP A;  2UWE A;  1ZAG A;  1LD9 A;  4F7M A;  3TVM A;  4Z78 A;  1S7S A;  1EXU A;  3BVN A;  4G9D A;  4JFD A;  2X4P A;  3JTT A;  3L9R A;  4IHO A;  1AGB A;  3MRR A;  3DX7 A;  2OL3 H;  4HKJ A;  4CVX A;  1FZK A;  3HUJ A;  2X4Q A;  2VAB A;  4ZUW A;  3VFP A;  1A6Z A;  3D25 A;  1U58 A;  5C0F A;  5L2J A;  4O2E A;  1NAM H;  5E8N A;  2PO6 A;  4WW2 C;  1ZT7 A;  1T7X A;  3BGM A;  4PG2 A;  3MRN A;  2VLK A;  1HSA A;  1XR8 A;  5C08 A;  1HHJ A;  4L8B A;  2X4R A;  4MJ6 A;  2FZ3 A;  2ZOK A;  3LN5 A;  3VFV A;  2BSS A;  5F1N A;  1QEW A;  1AKJ A;  3BH8 A;  1B0G A;  3UTQ A;  5MEN A;  4NT6 A;  5EU6 A;  3BH9 A;  3LKO A;  3O3D A;  2MHA A;  1S9Y A;  3KPM A;  3GMN A;  1FZO A;  3FQR A;  4GKN A;  1QLF A;  3L3D A;  3FOM A;  4L8D A;  1YPZ A;  3LV3 A;  1RJY A;  1QQD A;  1KPV A;  1LK2 A;  4PJH A;  4EN3 C;  3RWE A;  1TVH A;  2ESV A;  3MRJ A;  4ONO A;  1I7R A;  1ZHN A;  3KYO A;  4F7P A;  1W72 A;  5C0E A;  3TBS A;  3GSN H;  4PG9 A;  4QRP A;  3MV8 A;  1T20 A;  1A9E A;  1TMC A;  3MA7 A;  1OGT A;  5EOT A;  4L9L C;  5EFI A;  3REW A;  5SWZ A;  1JFM A;  1FZJ A;  3VFU A;  4PP8 C;  3KPL A;  5HGA A;  4JFP A;  1DE4 A;  3HCV A;  2CII A;  4LCC C;  1I1F A;  3IT8 D;  4XXC A;  1K5N A;  3HE6 A;  1IM9 A;  3FT2 A;  4MNQ A;  4NO0 A;  2A83 A;  1I1A A;  1DDH A;  1HHK A;  2VLR A;  3LKR A;  1QSE A;  5C0J A;  3RWJ A;  5FDW A;  5E8P A;  3SKO A;  3O3E A;  5IB5 A;  2P5E A;  2YPL A;  4NQE A;  4PR5 A;  2CKB H;  3CDG A;  4WU5 A;  5MER A;  1S9W A;  3KXF A;  3RUG A;  3UTT A;  1T7W A;  2FIK A;  3UPR A;  5EUO A;  3V5H A;  5BJT A;  3VFN A;  1JUF A;  2GAZ A;  4MVB A;  3O8X A;  5AD0 A;  4WO4 A;  4JRX A;  4HWZ A;  4S0U C;  4MS8 A;  2AV7 A;  2GTW A;  3MGT A;  4PJI A;  4MX7 A;  4X6D A;  1KCG C;  1QSF A;  3PWL A;  5D9S A;  1XH3 A;  3P4N A;  3VWK A;  1B3J A;  3BUY A;  2F54 A;  1ZVS A;  3MRQ A;  3MV7 A;  4NO3 A;  3FQW A;  1FG2 A;  5IM7 A;  4Y4H A;  3TA3 A;  5IVX A;  2GUO A;  4U1K A;  4LCY A;  1ZT1 A;  1XR9 A;  1S7W A;  2CIK A;  1P1Z A;  5B39 A;  4N0C A;  1ZHK A;  4PJX A;  3S6C A;  3BW9 A;  5HGH A;  3UTS A;  5BS0 A;  1OGA A;  5C0G A;  1TVB A;  3GSU A;  4QRS A;  1T0M A;  1YDP A;  3QUX A;  5F7D A;  3KLA A;  3H9H A;  3T8X A;  5DEF A;  1R3H A;  3GJF A;  3GMO A;  5F1I A;  3U0P A;  3C8K A;  3KPO A;  3QFJ A;  3DTX A;  5C0C A;  3KPQ A;  3QZW A;  4N8V A;  4FTV A;  3P73 A;  2AXG A;  3GMQ A;  3BWA A;  5E8O A;  5EU4 A;  1OF2 A;  2NX5 A;  3BP4 A;  3JTS A;  3ROO A;  4HV8 A;  4L3E A;  1HYR C;  1QRN A;  4JQV A;  4Y4F A;  3E2H A;  3FT3 A;  5EO1 A;  2C7U A;  3ARD A;  3B3I A;  4PJD A;  3MRD A;  5IB4 A;  5IB2 A;  3RL1 A;  1T0N A;  3TID A;  1T1X A;  1KTL A;  1BII A;  2H26 A;  5EU3 A;  1GZP A;  3SDX A;  2BNR A;  3VXU A;  1ZS8 A;  3TBT A;  5C9J A;  1PQZ A;  2X4U A;  3MYJ A;  4D0C A;  5DDH A;  3HAE A;  5IEK A;  3C9N A;  1S7R A;  3GSR A;  1MI5 A;  4K7F A;  4JFE A;  4IRS A;  4F7T A;  1G7Q A;  1RJZ A;  1T7Z A;  3RWI A;  3QDM A;  2CLV A;  1I4F A;  1N2R A;  5HHP A;  3L3J A;  1I7U A;  3OV6 A;  3VXN A;  3W39 A;  4QRR A;  3WS6 A;  3X12 A;  1EEZ A;  1YN7 A;  2GJ6 A;  3GMR A;  3CH1 A;  4U1J A;  2OI9 A;  3L3H A;  4X6C A;  1S7V A;  3QUK A;  5FA4 A;  4PRH A;  3B6S A;  1ONQ A;  3VXR A;  1S7U A;  4PJG A;  3D3V A;  1W0W A;  3P9M A;  4EUP A;  1W0V A;  2NW3 A;  4HS3 A;  4N0U A;  4HUW A;  5C09 A;  4L4V A;  4PV8 A;  5EO0 A;  4Y4K A;  3ECB A;  2RFX A;  3FRU A;  5D7L A;  4PJ9 A;  1DUZ A;  3BO8 A;  3E6H A;  3ROL A;  1JPG A;  1KJV A;  3FQN A;  4U1I A;  3TFK A;  3TO4 A;  2WY3 A;  3ARB A;  3HE7 A;  4MQ7 A;  4U1N A;  3MRL A;  4NQD A;  3FON A;  3X13 A;  5IB3 A;  3LKN A;  4PGE A;  5J6G A;  1RK1 A;  1SYV A;  3GSO A;  1HOC A;  4WUU A;  5ACZ A;  3VJ6 A;  1QR1 A;  3SCM A;  4U1M A;  3MGO A;  3MRP A;  1B0R A;  3VXO A;  3L3I A;  4MNG A;  3MRC A;  5L2K A;  3WL9 A;  1M05 A;  3ILP A;  2Q7Y A;  3SJV A;  1JE6 A;  2CLR A;  4G42 A;  1KJ2 H;  4ZUS A;  3KWW A;  4QOK A;  3RTQ A;  2VLL A;  1VAC A;  1NEZ A;  1RK0 A;  3OX8 A;  3P9L A;  3VFO A;  5C0A A;  3JTC A;  3TPU E;  1S7Q A;  3MR9 A;  4LCW A;  5INC A;  1C16 A;  4CVZ A;  2AV1 A;  3GML A;  1CG9 A;  3VFR A;  2J8U A;  4HX1 A;  3TF7 A;  3RWG A;  1LEG A;  3MRK A;  3VWJ A;  4HUV A;  4LHU A;  4MJ5 A;  3X14 A;  4PRB A;  3BZE A;  3I6K A;  5SWQ A;  1T1Z A;  1A1M A;  2BCK A;  4PJF A;  3QFD A;  3FQX A;  4U1H A;  3SDD A;  3KYN A;  2GT9 A;  3M1B A;  1UQS A; 
#chains in the Genus database with same CATH topology
 4ZUT A;  3TJH A;  3L3K A;  3D18 A;  4U6X A;  3VFS A;  1E27 A;  2CLZ A;  3L3G A;  5C07 A;  3QI9 A;  3O9W A;  3FOL A;  1EEY A;  2DYP A;  1FFO A;  1T7V A;  3HPJ A;  4G43 A;  4PRN A;  4ZAK A;  5ISZ A;  1CD1 A;  2FYY A;  1ZHL A;  4FFE X;  3V5D A;  4PV9 A;  4L8S C;  1UXW A;  4WDI A;  1KJ3 H;  1SYS A;  4WWK C;  1AGC A;  1S9X A;  4G8G A;  3X11 A;  1S7T A;  2NYK A;  4PGD A;  1MHC A;  3ES6 A;  2P5W A;  5C0D A;  3G08 A;  1T1W A;  3MRF A;  1VGK A;  3MRM A;  5D7J C;  5IEH A;  4IRJ A;  3V5K A;  5IRO A;  2F53 A;  3JVG A;  1FZM A;  4PJE A;  3P4O A;  2FO4 A;  2H6P A;  3I6L D;  4LNR A;  1MHE A;  2BVQ A;  3SDA A;  3SKM A;  4ZUU A;  1DUY A;  5E00 A;  5E9D A;  1T80 A;  2HLA A;  2BVP A;  4JFQ A;  3RZC A;  3QQ4 A;  3T1F A;  4GKS A;  4NNX A;  4PJ7 A;  3VFW A;  1N59 A;  3GSQ A;  4NNY A;  1FO0 H;  1WBX A;  4Z77 A;  4UQ3 A;  4X6E A;  1NAN H;  1JPF A;  4WJ5 A;  2X4N A;  3M17 A;  5IB1 A;  5C0I A;  2BVO A;  2HN7 A;  2VE6 A;  1JGE A;  5JHD A;  2VLJ A;  3PWV A;  4G9F A;  3BHB A;  3W0W A;  3BXN A;  3MRI A;  3FQU A;  3VRJ A;  4JFO A;  3CCH A;  2ZOL A;  3ARF A;  4I4W A;  3O3B A;  1AGD A;  3CVH A;  5SWS A;  1K8D A;  4D0D A;  1N3N A;  3GMM A;  4PJC A;  1T21 A;  5HGD A;  1WBZ A;  3DMM A;  3QDG A;  3H7B A;  3LKQ A;  2BST A;  3MRG A;  3NFN A;  2VAA A;  1AGE A;  1BD2 A;  3MV9 A;  1HHH A;  4Y16 A;  5HHM A;  3QEQ A;  4Z76 A;  4NHU E;  3CC5 A;  5EU5 A;  1T22 A;  5HHO A;  3WS3 A;  4PRP A;  1I7T A;  3CPL A;  3GSV A;  4QRT A;  3H9S A;  1X7Q A;  3LKP A;  5GSR A;  3WLB A;  4E0R A;  1OSZ A;  3PAB A;  2V2W A;  4BKW A;  1G6R H;  4NQC A;  4NSK A;  2X4S A;  2BNQ A;  1AO7 A;  4D0B A;  1Q94 A;  3GIV A;  4K71 B;  2F74 A;  4U6Y A;  5D2L A;  3P4M A;  3FT4 A;  3GSX A;  4JQX A;  2X4T A;  3CZF A;  3VXS A;  5MEQ A;  1EFX A;  3KPR A;  1QVO A;  5HHQ A;  3DX8 A;  2D31 A;  3FFC A;  3WUW A;  1KBG H;  1JF1 A;  3QUZ A;  1LDP H;  3FTG A;  5MEP A;  3QUY A;  2HJK A;  3PWJ A;  5E6I C;  4ZFZ A;  4PDC E;  5F9J A;  3VCL A;  1BZ9 A;  3AM8 A;  1INQ A;  3VXP A;  4F7C A;  3ERY A;  4NQV A;  4L8C A;  5DEG A;  3ARE A;  3P77 A;  4PRE A;  3OXS A;  3QQ3 A;  5HYJ A;  1AGF A;  3ILQ C;  1JGD A;  1HSB A;  2GTZ A;  3D39 A;  1MWA H;  1LQV A;  3HG1 A;  4L4T A;  5GSV A;  1HHG A;  3I6G A;  5D7I A;  3VFT A;  2HJL A;  3TZV C;  3PWN A;  4PJ8 A;  3VH8 A;  3MRH A;  3TBY A;  2AXF A;  3BEV A;  3GSW A;  4PJA A;  3TO2 A;  1S7X A;  1WBY A;  3KPS A;  4MXQ A;  2AKR A;  3VFM A;  3RGV C;  1A9B A;  4JFF A;  3BEW A;  3DBX A;  4V3E B;  4I48 A;  3SDC A;  5MEO A;  3VXM A;  4PGB A;  4O2F A;  2E7L E;  4ZUV A;  3RWH A;  1QO3 A;  2X70 A;  3OXR A;  4L29 A;  2YEZ A;  4UQ2 A;  3RWF A;  2X4O A;  3QDJ A;  1A1N A;  4V3D B;  5B38 A;  4PRI A;  3RL2 A;  2ZSW A;  2XFX A;  5IND A;  3PWU A;  1LP9 A;  3I0T A;  4U1L A;  1KPR A;  3E6F A;  4E5X A;  4IIQ C;  3LN4 A;  3O4L A;  5FKP A;  4G8I A;  3DX6 A;  3GMP A;  1LEK A;  2GIT A;  3BZF A;  3TBW A;  3AU1 A;  4Y2D A;  1FFN A;  3UBX A;  1IM3 A;  1E28 A;  3QUL A;  4HUX A;  4G59 A;  2YPK A;  1S8D A;  4EI5 A;  3SPV A;  1M6O A;  4NO2 A;  4QRU A;  4CW1 A;  3KPP A;  4N5E A;  2ZSV A;  1A1O A;  2XPG A;  4PGC A;  4U1S A;  3TN0 A;  4PJ5 A;  4O2C A;  3MRO A;  3O3A A;  1HHI A;  1KJM A;  1YN6 A;  1Z5L A;  3LKS A;  3VRI A;  3PQY A;  3IXA A;  1ZHB A;  1ZSD A;  5D2N A;  1ED3 A;  1P4L A;  4NQX A;  1GZQ A;  1ZT4 A;  2V2X A;  4JRY A;  1T7Y A;  3DXA A;  5H94 A;  5BRZ A;  5J6H A;  2FWO A;  3E3Q A;  4N0F A;  4PRA A;  4GUP A;  2PYE A;  1L8J A;  2AK4 A;  1CE6 A;  4MJI A;  4QRQ A;  1T1Y A;  3FQT A;  1P7Q A;  4PJB A;  1XZ0 A;  4WU7 A;  5ENW A;  5HHN A;  4ELM A;  4HUU A;  3KPN A;  3TBV A;  3BP7 A;  4X6F A;  3RWD A;  5D5M A;  4NO5 A;  1I1Y A;  1G7P A;  3D2U A;  5HGB A;  3ARG A;  5J1A A;  2JCC A;  1UXS A;  5C0B A;  3TIE A;  4F7E A;  3MRB A;  1VAD A;  1JHT A;  3HLA A;  2BSR A;  3MRE A;  4PRD A;  5BXF A;  1N5A A;  1BQH A;  1KPU A;  5FA3 A;  3PWP A;  4APQ A;  4L3C A;  3RWC A;  1FFP A;  2UWE A;  1ZAG A;  1LD9 A;  4F7M A;  3TVM A;  4Z78 A;  1S7S A;  1EXU A;  3BVN A;  4G9D A;  4JFD A;  2X4P A;  3JTT A;  3L9R A;  4IHO A;  1AGB A;  3MRR A;  3DX7 A;  2OL3 H;  4HKJ A;  4CVX A;  1FZK A;  3HUJ A;  2X4Q A;  4JO8 A;  2VAB A;  4ZUW A;  3VFP A;  1A6Z A;  3D25 A;  1U58 A;  5C0F A;  5L2J A;  4O2E A;  1NAM H;  5E8N A;  2PO6 A;  4WW2 C;  1ZT7 A;  1T7X A;  3BGM A;  4PG2 A;  3MRN A;  2VLK A;  1HSA A;  1XR8 A;  5C08 A;  1HHJ A;  4L8B A;  2IA1 A;  2X4R A;  4MJ6 A;  2FZ3 A;  2ZOK A;  3LN5 A;  3VFV A;  2BSS A;  5F1N A;  1QEW A;  1AKJ A;  3BH8 A;  1B0G A;  3UTQ A;  5MEN A;  4NT6 A;  5EU6 A;  3BH9 A;  3LKO A;  3O3D A;  2MHA A;  1S9Y A;  3KPM A;  3GMN A;  1FZO A;  3FQR A;  4GKN A;  1QLF A;  3L3D A;  3FOM A;  4L8D A;  1YPZ A;  3LV3 A;  1RJY A;  1QQD A;  1KPV A;  1LK2 A;  4PJH A;  4EN3 C;  3RWE A;  1TVH A;  2ESV A;  3MRJ A;  4ONO A;  1I7R A;  1ZHN A;  3KYO A;  4F7P A;  1W72 A;  5C0E A;  3TBS A;  3GSN H;  4PG9 A;  4QRP A;  3MV8 A;  1T20 A;  1A9E A;  1TMC A;  3MA7 A;  1OGT A;  5EOT A;  4L9L C;  5EFI A;  3REW A;  5SWZ A;  1JFM A;  1FZJ A;  3VFU A;  4PP8 C;  3KPL A;  5HGA A;  4JFP A;  1DE4 A;  3HCV A;  2CII A;  4LCC C;  1I1F A;  3IT8 D;  4XXC A;  1K5N A;  3HE6 A;  1IM9 A;  3FT2 A;  4MNQ A;  4NO0 A;  2A83 A;  1I1A A;  1DDH A;  1HHK A;  2VLR A;  3LKR A;  1QSE A;  5C0J A;  3RWJ A;  5FDW A;  5E8P A;  3SKO A;  3O3E A;  5IB5 A;  2P5E A;  2YPL A;  4NQE A;  4PR5 A;  2CKB H;  3CDG A;  4WU5 A;  5MER A;  1S9W A;  3KXF A;  3RUG A;  3UTT A;  1T7W A;  2FIK A;  3UPR A;  5EUO A;  3V5H A;  5BJT A;  3VFN A;  1JUF A;  2GAZ A;  4MVB A;  3O8X A;  5AD0 A;  4WO4 A;  4JRX A;  4HWZ A;  4S0U C;  4MS8 A;  2AV7 A;  2GTW A;  3MGT A;  4PJI A;  4MX7 A;  4X6D A;  1KCG C;  1QSF A;  3PWL A;  5D9S A;  1XH3 A;  2O5N A;  3P4N A;  1B3J A;  3VWK A;  3BUY A;  2F54 A;  1ZVS A;  3MRQ A;  3MV7 A;  4NO3 A;  3FQW A;  1FG2 A;  5IM7 A;  4Y4H A;  3TA3 A;  5IVX A;  2GUO A;  4U1K A;  4LCY A;  1ZT1 A;  1XR9 A;  1S7W A;  2CIK A;  1P1Z A;  5B39 A;  4N0C A;  1ZHK A;  4PJX A;  3S6C A;  3BW9 A;  5HGH A;  3UTS A;  5BS0 A;  1OGA A;  5C0G A;  1TVB A;  3GSU A;  4QRS A;  1T0M A;  1YDP A;  3QUX A;  5F7D A;  3KLA A;  3H9H A;  3T8X A;  5DEF A;  1R3H A;  3GJF A;  3GMO A;  5F1I A;  3U0P A;  3C8K A;  3KPO A;  3QFJ A;  3DTX A;  5C0C A;  3KPQ A;  3QZW A;  4G59 C;  4FTV A;  4N8V A;  3P73 A;  2AXG A;  3GMQ A;  3BWA A;  5E8O A;  5EU4 A;  1OF2 A;  2NX5 A;  3BP4 A;  3JTS A;  3ROO A;  4HV8 A;  4L3E A;  1HYR C;  1QRN A;  4JQV A;  4Y4F A;  3E2H A;  3FT3 A;  5EO1 A;  2C7U A;  3ARD A;  3B3I A;  4PJD A;  3MRD A;  5IB4 A;  5IB2 A;  3RL1 A;  1T0N A;  3TID A;  1T1X A;  1KTL A;  1BII A;  2H26 A;  5EU3 A;  1GZP A;  3SDX A;  2BNR A;  3VXU A;  1ZS8 A;  3TBT A;  5C9J A;  1PQZ A;  2X4U A;  3MYJ A;  4D0C A;  5DDH A;  3HAE A;  5IEK A;  3C9N A;  1S7R A;  3GSR A;  1MI5 A;  4K7F A;  4JFE A;  4IRS A;  4F7T A;  1G7Q A;  1RJZ A;  1T7Z A;  3RWI A;  3QDM A;  2CLV A;  1I4F A;  1N2R A;  5HHP A;  3L3J A;  1I7U A;  3OV6 A;  3VXN A;  3W39 A;  4QRR A;  3WS6 A;  3X12 A;  1EEZ A;  1YN7 A;  2GJ6 A;  3GMR A;  3CH1 A;  4U1J A;  2OI9 A;  3L3H A;  4X6C A;  1S7V A;  3QUK A;  5FA4 A;  4PRH A;  3B6S A;  1ONQ A;  3VXR A;  1S7U A;  4PJG A;  3D3V A;  1W0W A;  3P9M A;  4EUP A;  1W0V A;  2NW3 A;  4HS3 A;  4N0U A;  4HUW A;  5C09 A;  4L4V A;  4PV8 A;  5EO0 A;  4Y4K A;  3ECB A;  2RFX A;  3FRU A;  5D7L A;  4PJ9 A;  1DUZ A;  3BO8 A;  3E6H A;  3ROL A;  1JPG A;  1KJV A;  3FQN A;  4U1I A;  3TFK A;  3TO4 A;  2WY3 A;  3ARB A;  3HE7 A;  4MQ7 A;  4U1N A;  3MRL A;  4NQD A;  3FON A;  3X13 A;  5IB3 A;  3LKN A;  4PGE A;  5J6G A;  1RK1 A;  1SYV A;  3GSO A;  1HOC A;  4WUU A;  5ACZ A;  3VJ6 A;  1QR1 A;  3SCM A;  4U1M A;  3MGO A;  3MRP A;  1B0R A;  3VXO A;  3L3I A;  4MNG A;  3MRC A;  5L2K A;  3WL9 A;  1M05 A;  3ILP A;  2Q7Y A;  3SJV A;  1JE6 A;  2CLR A;  4G42 A;  1KJ2 H;  4ZUS A;  3KWW A;  4QOK A;  3RTQ A;  2VLL A;  1VAC A;  1NEZ A;  1RK0 A;  3OX8 A;  3P9L A;  3VFO A;  5C0A A;  3JTC A;  3TPU E;  1S7Q A;  3MR9 A;  4LCW A;  5INC A;  1C16 A;  4CVZ A;  2AV1 A;  3GML A;  1CG9 A;  3VFR A;  2J8U A;  4HX1 A;  3TF7 A;  3RWG A;  1LEG A;  3MRK A;  3VWJ A;  4HUV A;  4LHU A;  4MJ5 A;  3X14 A;  4PRB A;  3BZE A;  3I6K A;  5SWQ A;  1T1Z A;  1A1M A;  2BCK A;  4PJF A;  3QFD A;  3FQX A;  4U1H A;  3SDD A;  3KYN A;  2GT9 A;  3M1B A;  1UQS A; 
#chains in the Genus database with same CATH homology
 4ZUT A;  3TJH A;  3L3K A;  3D18 A;  4U6X A;  3VFS A;  1E27 A;  2CLZ A;  3L3G A;  5C07 A;  3QI9 A;  3O9W A;  3FOL A;  1EEY A;  2DYP A;  1FFO A;  1T7V A;  3HPJ A;  4G43 A;  4PRN A;  4ZAK A;  5ISZ A;  1CD1 A;  2FYY A;  1ZHL A;  4FFE X;  3V5D A;  4PV9 A;  4L8S C;  1UXW A;  4WDI A;  1KJ3 H;  1SYS A;  4WWK C;  1AGC A;  1S9X A;  4G8G A;  3X11 A;  1S7T A;  4PGD A;  1MHC A;  3ES6 A;  2P5W A;  5C0D A;  3G08 A;  1T1W A;  3MRF A;  1VGK A;  3MRM A;  5D7J C;  5IEH A;  4IRJ A;  3V5K A;  5IRO A;  2F53 A;  3JVG A;  1FZM A;  4PJE A;  3P4O A;  2FO4 A;  2H6P A;  3I6L D;  4LNR A;  1MHE A;  2BVQ A;  3SDA A;  3SKM A;  4ZUU A;  1DUY A;  5E00 A;  5E9D A;  1T80 A;  2HLA A;  2BVP A;  4JFQ A;  3RZC A;  3QQ4 A;  3T1F A;  4GKS A;  4NNX A;  4PJ7 A;  3VFW A;  1N59 A;  3GSQ A;  4NNY A;  1FO0 H;  1WBX A;  4Z77 A;  4UQ3 A;  4X6E A;  1NAN H;  1JPF A;  4WJ5 A;  2X4N A;  3M17 A;  5IB1 A;  5C0I A;  2BVO A;  2HN7 A;  2VE6 A;  1JGE A;  5JHD A;  2VLJ A;  3PWV A;  4G9F A;  3BHB A;  3W0W A;  3BXN A;  3MRI A;  3FQU A;  3VRJ A;  4JFO A;  3CCH A;  2ZOL A;  3ARF A;  4I4W A;  3O3B A;  1AGD A;  3CVH A;  5SWS A;  1K8D A;  4D0D A;  1N3N A;  3GMM A;  4PJC A;  1T21 A;  5HGD A;  1WBZ A;  3DMM A;  3QDG A;  3H7B A;  3LKQ A;  2BST A;  3MRG A;  3NFN A;  2VAA A;  1AGE A;  1BD2 A;  3MV9 A;  1HHH A;  4Y16 A;  5HHM A;  3QEQ A;  4Z76 A;  4NHU E;  3CC5 A;  5EU5 A;  1T22 A;  5HHO A;  3WS3 A;  4PRP A;  1I7T A;  3CPL A;  3GSV A;  4QRT A;  3H9S A;  1X7Q A;  3LKP A;  5GSR A;  3WLB A;  4E0R A;  1OSZ A;  3PAB A;  2V2W A;  1G6R H;  4NQC A;  4NSK A;  2X4S A;  2BNQ A;  1AO7 A;  4D0B A;  1Q94 A;  3GIV A;  4K71 B;  2F74 A;  4U6Y A;  5D2L A;  3P4M A;  3FT4 A;  3GSX A;  4JQX A;  2X4T A;  3CZF A;  3VXS A;  5MEQ A;  1EFX A;  3KPR A;  1QVO A;  5HHQ A;  3DX8 A;  2D31 A;  3FFC A;  3WUW A;  1KBG H;  1JF1 A;  3QUZ A;  1LDP H;  3FTG A;  5MEP A;  3QUY A;  2HJK A;  3PWJ A;  5E6I C;  4ZFZ A;  4PDC E;  5F9J A;  3VCL A;  1BZ9 A;  3AM8 A;  1INQ A;  3VXP A;  4F7C A;  3ERY A;  4NQV A;  4L8C A;  5DEG A;  3ARE A;  3P77 A;  4PRE A;  3OXS A;  3QQ3 A;  5HYJ A;  1AGF A;  3ILQ C;  1JGD A;  1HSB A;  2GTZ A;  3D39 A;  1MWA H;  1LQV A;  3HG1 A;  4L4T A;  5GSV A;  1HHG A;  3I6G A;  5D7I A;  3VFT A;  2HJL A;  3TZV C;  3PWN A;  4PJ8 A;  3VH8 A;  3MRH A;  3TBY A;  2AXF A;  3BEV A;  3GSW A;  4PJA A;  3TO2 A;  1S7X A;  1WBY A;  3KPS A;  4MXQ A;  2AKR A;  3VFM A;  3RGV C;  1A9B A;  4JFF A;  3BEW A;  3DBX A;  4V3E B;  4I48 A;  3SDC A;  5MEO A;  3VXM A;  4PGB A;  4O2F A;  2E7L E;  4ZUV A;  3RWH A;  1QO3 A;  2X70 A;  3OXR A;  4L29 A;  2YEZ A;  4UQ2 A;  3RWF A;  2X4O A;  3QDJ A;  1A1N A;  4V3D B;  5B38 A;  4PRI A;  3RL2 A;  2ZSW A;  2XFX A;  5IND A;  3PWU A;  1LP9 A;  4U1L A;  1KPR A;  3E6F A;  4E5X A;  4IIQ C;  3LN4 A;  3O4L A;  5FKP A;  4G8I A;  3DX6 A;  3GMP A;  1LEK A;  2GIT A;  3BZF A;  3TBW A;  3AU1 A;  4Y2D A;  1FFN A;  3UBX A;  1IM3 A;  1E28 A;  3QUL A;  4HUX A;  4G59 A;  2YPK A;  1S8D A;  4EI5 A;  3SPV A;  1M6O A;  4NO2 A;  4QRU A;  4CW1 A;  3KPP A;  4N5E A;  2ZSV A;  1A1O A;  2XPG A;  4PGC A;  4U1S A;  3TN0 A;  4PJ5 A;  4O2C A;  3MRO A;  3O3A A;  1HHI A;  1KJM A;  1YN6 A;  1Z5L A;  3LKS A;  3VRI A;  3PQY A;  3IXA A;  1ZHB A;  1ZSD A;  5D2N A;  1ED3 A;  1P4L A;  4NQX A;  1GZQ A;  1ZT4 A;  2V2X A;  4JRY A;  1T7Y A;  3DXA A;  5H94 A;  5BRZ A;  5J6H A;  2FWO A;  3E3Q A;  4N0F A;  4PRA A;  4GUP A;  2PYE A;  1L8J A;  2AK4 A;  1CE6 A;  4MJI A;  4QRQ A;  1T1Y A;  3FQT A;  1P7Q A;  4PJB A;  1XZ0 A;  4WU7 A;  5ENW A;  5HHN A;  4ELM A;  4HUU A;  3KPN A;  3TBV A;  3BP7 A;  4X6F A;  3RWD A;  5D5M A;  4NO5 A;  1I1Y A;  1G7P A;  3D2U A;  5HGB A;  3ARG A;  5J1A A;  2JCC A;  1UXS A;  5C0B A;  3TIE A;  4F7E A;  3MRB A;  1VAD A;  1JHT A;  3HLA A;  2BSR A;  3MRE A;  4PRD A;  5BXF A;  1N5A A;  1BQH A;  1KPU A;  5FA3 A;  3PWP A;  4APQ A;  4L3C A;  3RWC A;  1FFP A;  2UWE A;  1ZAG A;  1LD9 A;  4F7M A;  3TVM A;  4Z78 A;  1S7S A;  1EXU A;  3BVN A;  4G9D A;  4JFD A;  2X4P A;  3JTT A;  3L9R A;  4IHO A;  1AGB A;  3MRR A;  3DX7 A;  2OL3 H;  4HKJ A;  4CVX A;  1FZK A;  3HUJ A;  2X4Q A;  2VAB A;  4ZUW A;  3VFP A;  1A6Z A;  3D25 A;  1U58 A;  5C0F A;  5L2J A;  4O2E A;  1NAM H;  5E8N A;  2PO6 A;  4WW2 C;  1ZT7 A;  1T7X A;  3BGM A;  4PG2 A;  3MRN A;  2VLK A;  1HSA A;  1XR8 A;  5C08 A;  1HHJ A;  4L8B A;  2X4R A;  4MJ6 A;  2FZ3 A;  2ZOK A;  3LN5 A;  3VFV A;  2BSS A;  5F1N A;  1QEW A;  1AKJ A;  3BH8 A;  1B0G A;  3UTQ A;  5MEN A;  4NT6 A;  5EU6 A;  3BH9 A;  3LKO A;  3O3D A;  2MHA A;  1S9Y A;  3KPM A;  3GMN A;  1FZO A;  3FQR A;  4GKN A;  1QLF A;  3L3D A;  3FOM A;  4L8D A;  1YPZ A;  3LV3 A;  1RJY A;  1QQD A;  1KPV A;  1LK2 A;  4PJH A;  4EN3 C;  3RWE A;  1TVH A;  2ESV A;  3MRJ A;  4ONO A;  1I7R A;  1ZHN A;  3KYO A;  4F7P A;  1W72 A;  5C0E A;  3TBS A;  3GSN H;  4PG9 A;  4QRP A;  3MV8 A;  1T20 A;  1A9E A;  1TMC A;  3MA7 A;  1OGT A;  5EOT A;  4L9L C;  5EFI A;  3REW A;  5SWZ A;  1JFM A;  1FZJ A;  3VFU A;  4PP8 C;  3KPL A;  5HGA A;  4JFP A;  1DE4 A;  3HCV A;  2CII A;  4LCC C;  1I1F A;  3IT8 D;  4XXC A;  1K5N A;  3HE6 A;  1IM9 A;  3FT2 A;  4MNQ A;  4NO0 A;  2A83 A;  1I1A A;  1DDH A;  1HHK A;  2VLR A;  3LKR A;  1QSE A;  5C0J A;  3RWJ A;  5FDW A;  5E8P A;  3SKO A;  3O3E A;  5IB5 A;  2P5E A;  2YPL A;  4NQE A;  4PR5 A;  2CKB H;  3CDG A;  4WU5 A;  5MER A;  1S9W A;  3KXF A;  3RUG A;  3UTT A;  1T7W A;  2FIK A;  3UPR A;  5EUO A;  3V5H A;  5BJT A;  3VFN A;  1JUF A;  2GAZ A;  4MVB A;  3O8X A;  5AD0 A;  4WO4 A;  4JRX A;  4HWZ A;  4S0U C;  4MS8 A;  2AV7 A;  2GTW A;  3MGT A;  4PJI A;  4MX7 A;  4X6D A;  1KCG C;  1QSF A;  3PWL A;  5D9S A;  1XH3 A;  3P4N A;  3VWK A;  1B3J A;  3BUY A;  2F54 A;  1ZVS A;  3MRQ A;  3MV7 A;  4NO3 A;  3FQW A;  1FG2 A;  5IM7 A;  4Y4H A;  3TA3 A;  5IVX A;  2GUO A;  4U1K A;  4LCY A;  1ZT1 A;  1XR9 A;  1S7W A;  2CIK A;  1P1Z A;  5B39 A;  4N0C A;  1ZHK A;  4PJX A;  3S6C A;  3BW9 A;  5HGH A;  3UTS A;  5BS0 A;  1OGA A;  5C0G A;  1TVB A;  3GSU A;  4QRS A;  1T0M A;  1YDP A;  3QUX A;  5F7D A;  3KLA A;  3H9H A;  3T8X A;  5DEF A;  1R3H A;  3GJF A;  3GMO A;  5F1I A;  3U0P A;  3C8K A;  3KPO A;  3QFJ A;  3DTX A;  5C0C A;  3KPQ A;  3QZW A;  4N8V A;  4FTV A;  3P73 A;  2AXG A;  3GMQ A;  3BWA A;  5E8O A;  5EU4 A;  1OF2 A;  2NX5 A;  3BP4 A;  3JTS A;  3ROO A;  4HV8 A;  4L3E A;  1HYR C;  1QRN A;  4JQV A;  4Y4F A;  3E2H A;  3FT3 A;  5EO1 A;  2C7U A;  3ARD A;  3B3I A;  4PJD A;  3MRD A;  5IB4 A;  5IB2 A;  3RL1 A;  1T0N A;  3TID A;  1T1X A;  1KTL A;  1BII A;  2H26 A;  5EU3 A;  1GZP A;  3SDX A;  2BNR A;  3VXU A;  1ZS8 A;  3TBT A;  5C9J A;  1PQZ A;  2X4U A;  3MYJ A;  4D0C A;  5DDH A;  3HAE A;  5IEK A;  3C9N A;  1S7R A;  3GSR A;  1MI5 A;  4K7F A;  4JFE A;  4IRS A;  4F7T A;  1G7Q A;  1RJZ A;  1T7Z A;  3RWI A;  3QDM A;  2CLV A;  1I4F A;  1N2R A;  5HHP A;  3L3J A;  1I7U A;  3OV6 A;  3VXN A;  3W39 A;  4QRR A;  3WS6 A;  3X12 A;  1EEZ A;  1YN7 A;  2GJ6 A;  3GMR A;  3CH1 A;  4U1J A;  2OI9 A;  3L3H A;  4X6C A;  1S7V A;  3QUK A;  5FA4 A;  4PRH A;  3B6S A;  1ONQ A;  3VXR A;  1S7U A;  4PJG A;  3D3V A;  1W0W A;  3P9M A;  4EUP A;  1W0V A;  2NW3 A;  4HS3 A;  4N0U A;  4HUW A;  5C09 A;  4L4V A;  4PV8 A;  5EO0 A;  4Y4K A;  3ECB A;  2RFX A;  3FRU A;  5D7L A;  4PJ9 A;  1DUZ A;  3BO8 A;  3E6H A;  3ROL A;  1JPG A;  1KJV A;  3FQN A;  4U1I A;  3TFK A;  3TO4 A;  2WY3 A;  3ARB A;  3HE7 A;  4MQ7 A;  4U1N A;  3MRL A;  4NQD A;  3FON A;  3X13 A;  5IB3 A;  3LKN A;  4PGE A;  5J6G A;  1RK1 A;  1SYV A;  3GSO A;  1HOC A;  4WUU A;  5ACZ A;  3VJ6 A;  1QR1 A;  3SCM A;  4U1M A;  3MGO A;  3MRP A;  1B0R A;  3VXO A;  3L3I A;  4MNG A;  3MRC A;  5L2K A;  3WL9 A;  1M05 A;  3ILP A;  2Q7Y A;  3SJV A;  1JE6 A;  2CLR A;  4G42 A;  1KJ2 H;  4ZUS A;  3KWW A;  4QOK A;  3RTQ A;  2VLL A;  1VAC A;  1NEZ A;  1RK0 A;  3OX8 A;  3P9L A;  3VFO A;  5C0A A;  3JTC A;  3TPU E;  1S7Q A;  3MR9 A;  4LCW A;  5INC A;  1C16 A;  4CVZ A;  2AV1 A;  3GML A;  1CG9 A;  3VFR A;  2J8U A;  4HX1 A;  3TF7 A;  3RWG A;  1LEG A;  3MRK A;  3VWJ A;  4HUV A;  4LHU A;  4MJ5 A;  3X14 A;  4PRB A;  3BZE A;  3I6K A;  5SWQ A;  1T1Z A;  1A1M A;  2BCK A;  4PJF A;  3QFD A;  3FQX A;  4U1H A;  3SDD A;  3KYN A;  2GT9 A;  3M1B A;  1UQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...