1JFMA

Crystal structure of murine nk cell ligand rae-1 beta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
DAHSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINKTMTSGDPGETANATEVKKCLTQPLKNLCQKLRNKVSNTKVDTHKTNGYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQSKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords retinoic acid early transcript beta
total genus 41
structure length 174
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jfmA00
5INDA 2BNRA 1BD2A 5D7LA 1X7QA 4F7TA 3SJVA 4N8VA 5FKPA 1CG9A 4MXQA 4LHUA 4N0CA 5IVXA 1LK2A 4IIQC 2AK4A 5DEFA 2XPGA 4L8SC 5C0BA 4K7FA 2UWEA 3ERYA 2BSRA 3HAEA 4WU5A 3VFNA 3TPUE 3QEQA 3GSXA 3TBYA 2VLJA 3TIDA 3LV3A 1T7WA 3GIVA 1JHTA 3SPVA 3QZWA 4G8GA 4WW2C 3TO2A 1VGKA 5D9SA 1A6ZA 4G9DA 4HUXA 1UXWA 1XH3A 3WLBA 1T7VA 1AKJA 1B0GA 2NW3A 4L4VA 1NAMH 3BGMA 1T1XA 3FONA 3MRDA 5E8PA 2A83A 4EUPA 1SYSA 3DBXA 3PWJA 5SWQA 3AM8A 3MRLA 4ZUWA 3ROLA 3MGOA 4K71B 1IM9A 4CVZA 4O2FA 3I6GA 1FFPA 4ELMA 3MROA 3VXMA 2X4NA 1GZQA 3QI9A 4PJDA 5HHNA 3ROOA 3SKOA 1WBZA 3RL2A 3MYJA 3VFSA 5D5MA 4PGCA 3BHBA 3CPLA 3O3DA 3HPJA 3BWAA 4L3CA 2HJKA 1JF1A 5ACZA 3W39A 5EU3A 3ILQC 1LDPH 4CW1A 1EEYA 3GMQA 1EFXA 3VFOA 5MENA 1QO3A 1EXUA 5C0IA 4JFDA 3O3AA 3M17A 2GT9A 2CLZA 4U1SA 3TVMA 1N59A 1W0WA 3D2UA 2XFXA 3UTTA 5MEOA 3QUZA 5D7IA 4QRQA 4UQ3A 1LP9A 2X4UA 1UXSA 2F74A 1G6RH 1HSAA 2X4RA 3QDJA 1ZHBA 2GTWA 1QRNA 4X6FA 1KBGH 4PRIA 3VFWA 1JUFA 3VXPA 3GSNH 5J6GA 1I4FA 1XR8A 2V2WA 1EEZA 1ZS8A 2ESVA 5B39A 4HWZA 3UTQA 2ZOKA 1ZAGA 4JFEA 4N5EA 5EFIA 1HOCA 1R3HA 5HHPA 4JFPA 1S7TA 4WU7A 5EU4A 3KLAA 1KJMA 5D2NA 1B3JA 3MR9A 2H26A 4NQDA 1KPRA 5EUOA 1N5AA 4L29A 4Y16A 2BNQA 2AKRA 4U1JA 5DEGA 2GJ6A 4O2CA 1ZHLA 2FWOA 1Q94A 3I6KA 5C0EA 3OV6A 4NO2A 4MJ5A 1JPGA 2C7UA 1KJ3H 4IHOA 1TVHA 3MRBA 5F9JA 5SWZA 1T21A 5F1IA 3FQWA 3PABA 1HSBA 1Z5LA 5ISZA 1FFOA 3DX6A 1QSFA 4PGBA 5HYJA 5C0AA 5IEHA 5HGHA 2V2XA 4D0DA 3IT8D 1JFMA 3UPRA 3RL1A 3KPRA 5DDHA 3PQYA 4PREA 1G7PA 3FT4A 2BSTA 4PG9A 5BRZA 3QFDA 2FZ3A 4D0CA 4JFFA 2E7LE 4PJ7A 4PV8A 3VFMA 4U1LA 1T0MA 3TIEA 3L3DA 4PDCE 3VXOA 4MNQA 4X6DA 2VLKA 3TBSA 1E27A 3GSQA 2VE6A 1CD1A 3CVHA 5C09A 1NANH 1ZSDA 2YEZA 3VWKA 4FTVA 2H6PA 4E0RA 4JFOA 4ONOA 4D0BA 2CIKA 1PQZA 2OI9A 3E3QA 5E00A 4APQA 4F7CA 1QEWA 1K8DA 3C9NA 4GUPA 4JQVA 2X70A 3BUYA 4Y4HA 3KPQA 3JVGA 3L3HA 3LKNA 3VXUA 4I4WA 4S0UC 3MRNA 3LKPA 5EOTA 3TBTA 1XR9A 4NQEA 4HUUA 4MNGA 2X4QA 3D25A 1AGDA 1IM3A 1G7QA 1NEZA 1QSEA 1T7XA 5HGDA 3QQ4A 3V5DA 1A1NA 4Z77A 4F7EA 4G42A 2PO6A 3W0WA 1JE6A 2OL3H 1WBYA 4PRNA 5C0CA 1JGEA 4U1MA 3MGTA 3HCVA 1T7ZA 3L3KA 3PWUA 3JTSA 4PJXA 4PJFA 1E28A 3TF7A 4NQVA 3X13A 4V3EB 3GMMA 3VRIA 1M05A 1HHKA 1T80A 4PRAA 3OXSA 4U1HA 5D2LA 2BCKA 3RGVC 3RWGA 4CVXA 3MRGA 3G08A 1KJVA 2VABA 3RUGA 1ZT1A 4PR5A 5FA3A 3O9WA 3FQXA 5F7DA 1LQVA 5EU6A 3V5KA 1W72A 3TJHA 1TMCA 3PWPA 3SDAA 4Z76A 4PGEA 4NT6A 2FO4A 5B38A 2AXGA 1AGCA 2AXFA 2FIKA 3VFVA 1GZPA 3E6HA 4ZUTA 1RK0A 3ARFA 3QFJA 3TFKA 3RTQA 3S6CA 3KPOA 1ED3A 1S9XA 3GMRA 1YN7A 4LCCC 3V5HA 4GKSA 3TBVA 1ZT4A 1P1ZA 2P5WA 4JRXA 3P9MA 4NO0A 4LCWA 3PWNA 1C16A 5GSRA 3VJ6A 5C08A 1P7QA 3QULA 1A9BA 1T20A 3VFPA 4QRPA 5HGAA 3KWWA 5FA4A 5EO1A 3D18A 3I6LD 2NX5A 5IEKA 4PG2A 3T8XA 1HHIA 3JTCA 1I7RA 1INQA 1WBXA 4PV9A 3BXNA 5SWSA 4MJIA 1T22A 1BZ9A 3SKMA 3VFUA 4I48A 1ZVSA 2D31A 1P4LA 4N0FA 3X12A 4PJIA 3MRCA 3P4OA 3P77A 4MVBA 3T1FA 1RJZA 1U58A 2WY3A 4QRRA 5C0FA 3OXRA 1K5NA 3D3VA 3B3IA 2GITA 4MS8A 3O8XA 4N0UA 1OGTA 2X4TA 3CC5A 1I7TA 3AU1A 3MRFA 5GSVA 3RWEA 4G8IA 4X6EA 1HYRC 1S7SA 4PP8C 3FTGA 3KPLA 3RWFA 3ARGA 4U6XA 4FFEX 3GSWA 2BVQA 3RWHA 4IRSA 5BXFA 3WS3A 1T1WA 3GSVA 3SDDA 2RFXA 2X4SA 3BVNA 1FZOA 1T0NA 1T1YA 3BH8A 1A9EA 3HG1A 4PJBA 5EU5A 1SYVA 4PRHA 3ARBA 2MHAA 3TA3A 3ILPA 3O3BA 3WL9A 4U1IA 3GMPA 3FQUA 2ZSWA 4PJ5A 3C8KA 3B6SA 3RWCA 1AO7A 3DX8A 1S9YA 4G43A 3WS6A 3O4LA 3P9LA 3QUKA 3BEWA 3KPPA 5L2JA 3MRJA 4PJEA 2J8UA 4L9LC 5IB2A 1QLFA 2BVPA 3LKOA 1I1FA 1KPUA 3H7BA 5IROA 2VAAA 4PRBA 3L3IA 3LKRA 3TN0A 3KYNA 4Y4KA 5JHDA 4MJ6A 4V3DB 1N2RA 1KCGC 1QVOA 5E8NA 3VFTA 1DDHA 3RZCA 3CCHA 1W0VA 4WO4A 4ZUUA 3HLAA 4MX7A 1FZKA 5J1AA 4WWKC 3MRIA 5BJTA 3RWIA 2X4OA 3MRPA 5C07A 1MHCA 2BSSA 2FYYA 3BP7A 3KYOA 3GMOA 4HS3A 1KPVA 1I7UA 4PJHA 3VWJA 4LNRA 3LKSA 1B0RA 5IB4A 1S7QA 5INCA 3KPNA 1UQSA 3CH1A 4G59A 4HX1A 4PRPA 3GMNA 4QRUA 4HUWA 1FZMA 1RK1A 2Q7YA 5J6HA 1BQHA 3GJFA 4L4TA 5C0JA 3L3JA 5IB3A 5MEQA 4PJAA 1L8JA 5E6IC 3REWA 1HHGA 4PJGA 3H9SA 1RJYA 4WJ5A 3E2HA 5C9JA 2CLVA 3DXAA 3IXAA 2F53A 5D7JC 1AGBA 4JRYA 3FQNA 4UQ2A 3HE6A 3FQRA 3FT3A 4HKJA 3L3GA 2P5EA 4ZUVA 3E6FA 3BP4A 5H94A 3DMMA 3FRUA 4U1NA 2CKBH 4HUVA 4NO5A 2HLAA 1HHHA 3LN4A 3MRKA 4U6YA 4WUUA 1LD9A 5C0DA 5C0GA 5IM7A 4L8BA 5HHMA 5ENWA 5IB5A 1S7WA 3OX8A 2HN7A 2AV7A 3GSRA 1OF2A 3FOLA 1HHJA 4O2EA 1DUZA 4E5XA 3VXSA 4Y2DA 3CDGA 4PJ9A 5L2KA 3WUWA 1ZT7A 4X6CA 1OGAA 2F54A 4L3EA 2BVOA 2GUOA 4ZFZA 3SDXA 1YPZA 4NNYA 5IB1A 3PWVA 3JTTA 1ZHKA 3H9HA 3VRJA 1T7YA 1AGFA 3BZFA 2PYEA 4F7PA 3MV7A 3U0PA 1LEKA 3P73A 3SCMA 5F1NA 3DTXA 3ECBA 4PGDA 2ZOLA 4HV8A 5FDWA 3FFCA 3MREA 4G9FA 3TO4A 3GMLA 2VLRA 3TBWA 4L8CA 3MRQA 3VFRA 5HHOA 4QRSA 2YPLA 1YN6A 3M1BA 4L8DA 4PRDA 1S7VA 1CE6A 3FOMA 1FO0H 4Z78A 1MWAH 1T1ZA 3MV9A 2YPKA 5AD0A 2AV1A 3BW9A 1S7UA 1ZHNA 4QRTA 3QUYA 1OSZA 1FZJA 4NHUE 2GAZA 3VCLA 3P4MA 3GSOA 4PJCA 1S7RA 3VXRA 4F7MA 3PWLA 4JQXA 3NFNA 5E8OA 1KTLA 3KPSA 1VACA 3HUJA 4NQCA 5EO0A 5MERA 3LKQA 4EI5A 1I1YA 1A1OA 3KPMA 1JGDA 3AREA 1TVBA 3P4NA 3DX7A 3MRHA 1S7XA 5HHQA 3D39A 3HE7A 2ZSVA 1DUYA 4JFQA 3QDMA 3RWDA 2CLRA 3GSUA 5E9DA 1QQDA 3BH9A 4GKNA 3UTSA 1MHEA 3L9RA 3VH8A 4NQXA 1YDPA 3BEVA 4WDIA 4EN3C 3KXFA 1S9WA 1JPFA 1MI5A 3MRMA 3QDGA 3O3EA 4ZUSA 4MQ7A 3LN5A 4Y4FA 4PJ8A 3FQTA 1M6OA 1VADA 2X4PA 1N3NA 1FFNA 3X11A 1ONQA 5MEPA 2CIIA 1BIIA 3QUXA 2VLLA 4LCYA 4NO3A 1LEGA 4QOKA 3RWJA 3ARDA 3CZFA 1FG2A 3ES6A 1XZ0A 2HJLA 3MA7A 3SDCA 3MRRA 5HGBA 1QR1A 1DE4A 4NSKA 4U1KA 3QQ3A 1S8DA 2GTZA 4IRJA 4NNXA 3BO8A 3FT2A 1A1MA 1KJ2H 5BS0A 3UBXA 1AGEA 4XXCA 2DYPA 1I1AA 3MV8A 2JCCA 4ZAKA 3BZEA 3X14A 3TZVC 3VXNA
chains in the Genus database with same CATH superfamily
5INDA 2BNRA 1BD2A 5D7LA 1X7QA 4F7TA 3SJVA 4N8VA 4G59C 5FKPA 1CG9A 4MXQA 4LHUA 4N0CA 5IVXA 1LK2A 4IIQC 2AK4A 5DEFA 2XPGA 4L8SC 5C0BA 4K7FA 2UWEA 3ERYA 2BSRA 3HAEA 4WU5A 3VFNA 3TPUE 3QEQA 3GSXA 3TBYA 2VLJA 3TIDA 3LV3A 1T7WA 3GIVA 1JHTA 3SPVA 3QZWA 4G8GA 4WW2C 3TO2A 1VGKA 5D9SA 1A6ZA 4G9DA 4HUXA 1UXWA 1XH3A 3WLBA 1T7VA 1AKJA 1B0GA 2NW3A 4L4VA 1NAMH 3BGMA 1T1XA 3FONA 3MRDA 5E8PA 2A83A 4EUPA 1SYSA 3DBXA 3PWJA 5SWQA 3AM8A 3MRLA 4ZUWA 3ROLA 3MGOA 4K71B 1IM9A 4CVZA 4O2FA 3I6GA 1FFPA 4ELMA 3MROA 3VXMA 2X4NA 1GZQA 3QI9A 4PJDA 5HHNA 3ROOA 3SKOA 1WBZA 3RL2A 3MYJA 3VFSA 5D5MA 4PGCA 3BHBA 3CPLA 3O3DA 3HPJA 3BWAA 4L3CA 2HJKA 1JF1A 5ACZA 3W39A 5EU3A 3ILQC 1LDPH 4CW1A 1EEYA 3GMQA 1EFXA 3VFOA 5MENA 1QO3A 1EXUA 5C0IA 4JFDA 3O3AA 3M17A 2GT9A 2CLZA 4U1SA 3TVMA 1N59A 1W0WA 3D2UA 2XFXA 3UTTA 5MEOA 3QUZA 5D7IA 4QRQA 4UQ3A 1LP9A 2X4UA 1UXSA 2F74A 1G6RH 1HSAA 2X4RA 3QDJA 1ZHBA 2GTWA 2IA1A 1QRNA 4X6FA 1KBGH 4PRIA 3VFWA 1JUFA 3VXPA 3GSNH 5J6GA 1I4FA 1XR8A 2V2WA 1EEZA 1ZS8A 2ESVA 5B39A 4HWZA 3UTQA 2ZOKA 1ZAGA 4JFEA 4N5EA 5EFIA 1HOCA 1R3HA 5HHPA 4JFPA 1S7TA 4WU7A 5EU4A 3KLAA 1KJMA 5D2NA 1B3JA 3MR9A 2H26A 4NQDA 1KPRA 5EUOA 1N5AA 4L29A 4Y16A 2BNQA 2AKRA 4U1JA 5DEGA 2GJ6A 4O2CA 1ZHLA 2FWOA 1Q94A 3I6KA 5C0EA 3OV6A 4NO2A 4MJ5A 1JPGA 2C7UA 1KJ3H 4IHOA 1TVHA 3MRBA 5F9JA 5SWZA 1T21A 5F1IA 3FQWA 3PABA 1HSBA 1Z5LA 5ISZA 1FFOA 3DX6A 1QSFA 4PGBA 5HYJA 5C0AA 5IEHA 5HGHA 2V2XA 4D0DA 3IT8D 1JFMA 3UPRA 3RL1A 3KPRA 5DDHA 3PQYA 4PREA 1G7PA 3FT4A 2BSTA 4PG9A 5BRZA 3QFDA 2FZ3A 4D0CA 4JFFA 2E7LE 4PJ7A 4PV8A 3VFMA 4U1LA 1T0MA 3TIEA 3L3DA 4PDCE 3VXOA 4MNQA 4X6DA 2VLKA 3TBSA 1E27A 3GSQA 2VE6A 1CD1A 3CVHA 5C09A 1NANH 1ZSDA 2YEZA 3VWKA 4FTVA 2H6PA 4E0RA 4JFOA 4ONOA 4D0BA 2CIKA 1PQZA 2OI9A 3E3QA 5E00A 4APQA 4F7CA 1QEWA 1K8DA 3C9NA 4GUPA 4JQVA 2X70A 3BUYA 4Y4HA 3KPQA 3JVGA 3L3HA 3LKNA 3VXUA 4I4WA 4JO8A 4S0UC 3MRNA 3LKPA 5EOTA 3TBTA 1XR9A 4NQEA 4HUUA 4MNGA 2X4QA 3D25A 1AGDA 1IM3A 1G7QA 1NEZA 1QSEA 1T7XA 5HGDA 3QQ4A 3V5DA 1A1NA 4Z77A 4F7EA 4G42A 2PO6A 3W0WA 1JE6A 2OL3H 1WBYA 4PRNA 5C0CA 1JGEA 4U1MA 3MGTA 4BKWA 3HCVA 1T7ZA 3L3KA 3PWUA 3JTSA 4PJXA 4PJFA 1E28A 3TF7A 4NQVA 3X13A 4V3EB 3GMMA 3VRIA 1M05A 1HHKA 1T80A 4PRAA 3OXSA 4U1HA 5D2LA 2BCKA 3RGVC 3RWGA 4CVXA 3MRGA 3G08A 1KJVA 2VABA 3RUGA 1ZT1A 4PR5A 5FA3A 3O9WA 3FQXA 5F7DA 1LQVA 5EU6A 3V5KA 1W72A 3TJHA 1TMCA 3PWPA 3SDAA 4Z76A 4PGEA 4NT6A 2FO4A 5B38A 2AXGA 1AGCA 2AXFA 2FIKA 3VFVA 1GZPA 3E6HA 4ZUTA 1RK0A 3ARFA 3QFJA 3TFKA 3RTQA 3S6CA 3KPOA 1ED3A 1S9XA 3GMRA 1YN7A 4LCCC 3V5HA 4GKSA 3TBVA 1ZT4A 1P1ZA 2P5WA 4JRXA 3P9MA 4NO0A 4LCWA 3PWNA 1C16A 5GSRA 3VJ6A 5C08A 1P7QA 3I0TA 3QULA 1A9BA 1T20A 3VFPA 4QRPA 5HGAA 3KWWA 5FA4A 5EO1A 3D18A 3I6LD 2NX5A 5IEKA 4PG2A 3T8XA 1HHIA 3JTCA 1I7RA 1INQA 1WBXA 4PV9A 3BXNA 5SWSA 4MJIA 1T22A 1BZ9A 3SKMA 3VFUA 2NYKA 4I48A 1ZVSA 2D31A 1P4LA 4N0FA 3X12A 4PJIA 3MRCA 3P4OA 3P77A 4MVBA 3T1FA 1RJZA 1U58A 2WY3A 4QRRA 5C0FA 3OXRA 1K5NA 3D3VA 3B3IA 2GITA 4MS8A 3O8XA 4N0UA 1OGTA 2X4TA 3CC5A 1I7TA 3AU1A 3MRFA 5GSVA 3RWEA 4G8IA 4X6EA 1HYRC 1S7SA 4PP8C 3FTGA 3KPLA 3RWFA 3ARGA 4U6XA 4FFEX 3GSWA 2BVQA 3RWHA 4IRSA 5BXFA 3WS3A 1T1WA 3GSVA 3SDDA 2RFXA 2X4SA 3BVNA 1FZOA 1T0NA 1T1YA 3BH8A 1A9EA 3HG1A 4PJBA 5EU5A 1SYVA 4PRHA 3ARBA 2MHAA 3TA3A 3ILPA 3O3BA 3WL9A 4U1IA 3GMPA 3FQUA 2ZSWA 4PJ5A 3C8KA 3B6SA 3RWCA 1AO7A 3DX8A 1S9YA 4G43A 3WS6A 3O4LA 3P9LA 3QUKA 3BEWA 3KPPA 5L2JA 3MRJA 4PJEA 2J8UA 4L9LC 5IB2A 1QLFA 2BVPA 3LKOA 1I1FA 1KPUA 3H7BA 5IROA 2VAAA 4PRBA 3L3IA 3LKRA 3TN0A 3KYNA 4Y4KA 5JHDA 4MJ6A 4V3DB 1N2RA 1KCGC 1QVOA 5E8NA 3VFTA 1DDHA 3RZCA 3CCHA 1W0VA 4WO4A 4ZUUA 3HLAA 4MX7A 1FZKA 5J1AA 4WWKC 3MRIA 5BJTA 3RWIA 2X4OA 3MRPA 5C07A 1MHCA 2BSSA 2FYYA 3BP7A 3KYOA 3GMOA 4HS3A 1KPVA 1I7UA 4PJHA 3VWJA 4LNRA 3LKSA 1B0RA 5IB4A 1S7QA 5INCA 3KPNA 1UQSA 3CH1A 4G59A 4HX1A 4PRPA 3GMNA 4QRUA 4HUWA 1FZMA 1RK1A 2Q7YA 5J6HA 1BQHA 3GJFA 4L4TA 5C0JA 3L3JA 5IB3A 5MEQA 4PJAA 1L8JA 5E6IC 3REWA 1HHGA 4PJGA 3H9SA 1RJYA 4WJ5A 3E2HA 5C9JA 2CLVA 3DXAA 3IXAA 2F53A 5D7JC 1AGBA 4JRYA 3FQNA 4UQ2A 3HE6A 3FQRA 3FT3A 4HKJA 3L3GA 2P5EA 4ZUVA 3E6FA 3BP4A 5H94A 3DMMA 3FRUA 4U1NA 2CKBH 4HUVA 4NO5A 2HLAA 1HHHA 3LN4A 3MRKA 4U6YA 4WUUA 1LD9A 5C0DA 5C0GA 5IM7A 4L8BA 5HHMA 5ENWA 5IB5A 1S7WA 3OX8A 2HN7A 2AV7A 3GSRA 1OF2A 3FOLA 1HHJA 4O2EA 1DUZA 4E5XA 3VXSA 4Y2DA 3CDGA 4PJ9A 5L2KA 3WUWA 1ZT7A 4X6CA 1OGAA 2F54A 4L3EA 2BVOA 2GUOA 4ZFZA 3SDXA 1YPZA 4NNYA 5IB1A 3PWVA 3JTTA 1ZHKA 3H9HA 3VRJA 1T7YA 1AGFA 3BZFA 2PYEA 4F7PA 3MV7A 3U0PA 1LEKA 3P73A 3SCMA 5F1NA 3DTXA 3ECBA 4PGDA 2ZOLA 4HV8A 5FDWA 3FFCA 3MREA 4G9FA 3TO4A 3GMLA 2VLRA 3TBWA 4L8CA 3MRQA 3VFRA 5HHOA 4QRSA 2YPLA 1YN6A 3M1BA 4L8DA 4PRDA 1S7VA 1CE6A 3FOMA 1FO0H 4Z78A 1MWAH 1T1ZA 3MV9A 2YPKA 5AD0A 2AV1A 3BW9A 1S7UA 1ZHNA 4QRTA 3QUYA 1OSZA 1FZJA 4NHUE 2GAZA 3VCLA 3P4MA 3GSOA 4PJCA 1S7RA 3VXRA 4F7MA 3PWLA 4JQXA 3NFNA 5E8OA 1KTLA 3KPSA 1VACA 3HUJA 4NQCA 5EO0A 5MERA 3LKQA 4EI5A 1I1YA 1A1OA 3KPMA 1JGDA 3AREA 1TVBA 3P4NA 3DX7A 3MRHA 1S7XA 5HHQA 3D39A 3HE7A 2ZSVA 1DUYA 4JFQA 3QDMA 3RWDA 2CLRA 3GSUA 5E9DA 1QQDA 3BH9A 4GKNA 3UTSA 1MHEA 3L9RA 2O5NA 4NQXA 3VH8A 1YDPA 3BEVA 4WDIA 4EN3C 3KXFA 1S9WA 1JPFA 1MI5A 3MRMA 3QDGA 3O3EA 4ZUSA 4MQ7A 3LN5A 4Y4FA 4PJ8A 3FQTA 1M6OA 1VADA 2X4PA 1N3NA 1FFNA 3X11A 1ONQA 5MEPA 2CIIA 1BIIA 3QUXA 2VLLA 4LCYA 4NO3A 1LEGA 4QOKA 3RWJA 3ARDA 3CZFA 1FG2A 3ES6A 1XZ0A 2HJLA 3MA7A 3SDCA 3MRRA 5HGBA 1QR1A 1DE4A 4NSKA 4U1KA 3QQ3A 1S8DA 2GTZA 4IRJA 4NNXA 3BO8A 3FT2A 1A1MA 1KJ2H 5BS0A 3UBXA 1AGEA 4XXCA 2DYPA 1I1AA 3MV8A 2JCCA 4ZAKA 3BZEA 3X14A 3TZVC 3VXNA
chains in the Genus database with same CATH topology
5INDA 2BNRA 1BD2A 5D7LA 1X7QA 4F7TA 3SJVA 4N8VA 5FKPA 1CG9A 4MXQA 4LHUA 4N0CA 5IVXA 1LK2A 4IIQC 2AK4A 5DEFA 2XPGA 4L8SC 5C0BA 4K7FA 2UWEA 3ERYA 2BSRA 3HAEA 4WU5A 3VFNA 3TPUE 3QEQA 3GSXA 3TBYA 2VLJA 3TIDA 3LV3A 1T7WA 3GIVA 1JHTA 3SPVA 3QZWA 4G8GA 4WW2C 3TO2A 1VGKA 5D9SA 1A6ZA 4G9DA 4HUXA 1UXWA 1XH3A 3WLBA 1T7VA 1AKJA 1B0GA 2NW3A 4L4VA 1NAMH 3BGMA 1T1XA 3FONA 3MRDA 5E8PA 2A83A 4EUPA 1SYSA 3DBXA 3PWJA 5SWQA 3AM8A 3MRLA 4ZUWA 3ROLA 3MGOA 4K71B 1IM9A 4CVZA 4O2FA 3I6GA 1FFPA 4ELMA 3MROA 3VXMA 2X4NA 1GZQA 3QI9A 4PJDA 5HHNA 3ROOA 3SKOA 1WBZA 3RL2A 3MYJA 3VFSA 5D5MA 4PGCA 3BHBA 3CPLA 3O3DA 3HPJA 3BWAA 4L3CA 2HJKA 1JF1A 5ACZA 3W39A 5EU3A 3ILQC 1LDPH 4CW1A 1EEYA 3GMQA 1EFXA 3VFOA 5MENA 1QO3A 1EXUA 5C0IA 4JFDA 3O3AA 3M17A 2GT9A 2CLZA 4U1SA 3TVMA 1N59A 1W0WA 3D2UA 2XFXA 3UTTA 5MEOA 3QUZA 5D7IA 4QRQA 4UQ3A 1LP9A 2X4UA 1UXSA 2F74A 1G6RH 1HSAA 2X4RA 3QDJA 1ZHBA 2GTWA 1QRNA 4X6FA 1KBGH 4PRIA 3VFWA 1JUFA 3VXPA 3GSNH 5J6GA 1I4FA 1XR8A 2V2WA 1EEZA 1ZS8A 2ESVA 5B39A 4HWZA 3UTQA 2ZOKA 1ZAGA 4JFEA 4N5EA 5EFIA 1HOCA 1R3HA 5HHPA 4JFPA 1S7TA 4WU7A 5EU4A 3KLAA 1KJMA 5D2NA 1B3JA 3MR9A 2H26A 4NQDA 1KPRA 5EUOA 1N5AA 4L29A 4Y16A 2BNQA 2AKRA 4U1JA 5DEGA 2GJ6A 4O2CA 1ZHLA 2FWOA 1Q94A 3I6KA 5C0EA 3OV6A 4NO2A 4MJ5A 1JPGA 2C7UA 1KJ3H 4IHOA 1TVHA 3MRBA 5F9JA 5SWZA 1T21A 5F1IA 3FQWA 3PABA 1HSBA 1Z5LA 5ISZA 1FFOA 3DX6A 1QSFA 4PGBA 5HYJA 5C0AA 5IEHA 5HGHA 2V2XA 4D0DA 3IT8D 1JFMA 3UPRA 3RL1A 3KPRA 5DDHA 3PQYA 4PREA 1G7PA 3FT4A 2BSTA 4PG9A 5BRZA 3QFDA 2FZ3A 4D0CA 4JFFA 2E7LE 4PJ7A 4PV8A 3VFMA 4U1LA 1T0MA 3TIEA 3L3DA 4PDCE 3VXOA 4MNQA 4X6DA 2VLKA 3TBSA 1E27A 3GSQA 2VE6A 1CD1A 3CVHA 5C09A 1NANH 1ZSDA 2YEZA 3VWKA 4FTVA 2H6PA 4E0RA 4JFOA 4ONOA 4D0BA 2CIKA 1PQZA 2OI9A 3E3QA 5E00A 4APQA 4F7CA 1QEWA 1K8DA 3C9NA 4GUPA 4JQVA 2X70A 3BUYA 4Y4HA 3KPQA 3JVGA 3L3HA 3LKNA 3VXUA 4I4WA 4S0UC 3MRNA 3LKPA 5EOTA 3TBTA 1XR9A 4NQEA 4HUUA 4MNGA 2X4QA 3D25A 1AGDA 1IM3A 1G7QA 1NEZA 1QSEA 1T7XA 5HGDA 3QQ4A 3V5DA 1A1NA 4Z77A 4F7EA 4G42A 2PO6A 3W0WA 1JE6A 2OL3H 1WBYA 4PRNA 5C0CA 1JGEA 4U1MA 3MGTA 3HCVA 1T7ZA 3L3KA 3PWUA 3JTSA 4PJXA 4PJFA 1E28A 3TF7A 4NQVA 3X13A 4V3EB 3GMMA 3VRIA 1M05A 1HHKA 1T80A 4PRAA 3OXSA 4U1HA 5D2LA 2BCKA 3RGVC 3RWGA 4CVXA 3MRGA 3G08A 1KJVA 2VABA 3RUGA 1ZT1A 4PR5A 5FA3A 3O9WA 3FQXA 5F7DA 1LQVA 5EU6A 3V5KA 1W72A 3TJHA 1TMCA 3PWPA 3SDAA 4Z76A 4PGEA 4NT6A 2FO4A 5B38A 2AXGA 1AGCA 2AXFA 2FIKA 3VFVA 1GZPA 3E6HA 4ZUTA 1RK0A 3ARFA 3QFJA 3TFKA 3RTQA 3S6CA 3KPOA 1ED3A 1S9XA 3GMRA 1YN7A 4LCCC 3V5HA 4GKSA 3TBVA 1ZT4A 1P1ZA 2P5WA 4JRXA 3P9MA 4NO0A 4LCWA 3PWNA 1C16A 5GSRA 3VJ6A 5C08A 1P7QA 3QULA 1A9BA 1T20A 3VFPA 4QRPA 5HGAA 3KWWA 5FA4A 5EO1A 3D18A 3I6LD 2NX5A 5IEKA 4PG2A 3T8XA 1HHIA 3JTCA 1I7RA 1INQA 1WBXA 4PV9A 3BXNA 5SWSA 4MJIA 1T22A 1BZ9A 3SKMA 3VFUA 4I48A 1ZVSA 2D31A 1P4LA 4N0FA 3X12A 4PJIA 3MRCA 3P4OA 3P77A 4MVBA 3T1FA 1RJZA 1U58A 2WY3A 4QRRA 5C0FA 3OXRA 1K5NA 3D3VA 3B3IA 2GITA 4MS8A 3O8XA 4N0UA 1OGTA 2X4TA 3CC5A 1I7TA 3AU1A 3MRFA 5GSVA 3RWEA 4G8IA 4X6EA 1HYRC 1S7SA 4PP8C 3FTGA 3KPLA 3RWFA 3ARGA 4U6XA 4FFEX 3GSWA 2BVQA 3RWHA 4IRSA 5BXFA 3WS3A 1T1WA 3GSVA 3SDDA 2RFXA 2X4SA 3BVNA 1FZOA 1T0NA 1T1YA 3BH8A 1A9EA 3HG1A 4PJBA 5EU5A 1SYVA 4PRHA 3ARBA 2MHAA 3TA3A 3ILPA 3O3BA 3WL9A 4U1IA 3GMPA 3FQUA 2ZSWA 4PJ5A 3C8KA 3B6SA 3RWCA 1AO7A 3DX8A 1S9YA 4G43A 3WS6A 3O4LA 3P9LA 3QUKA 3BEWA 3KPPA 5L2JA 3MRJA 4PJEA 2J8UA 4L9LC 5IB2A 1QLFA 2BVPA 3LKOA 1I1FA 1KPUA 3H7BA 5IROA 2VAAA 4PRBA 3L3IA 3LKRA 3TN0A 3KYNA 4Y4KA 5JHDA 4MJ6A 4V3DB 1N2RA 1KCGC 1QVOA 5E8NA 3VFTA 1DDHA 3RZCA 3CCHA 1W0VA 4WO4A 4ZUUA 3HLAA 4MX7A 1FZKA 5J1AA 4WWKC 3MRIA 5BJTA 3RWIA 2X4OA 3MRPA 5C07A 1MHCA 2BSSA 2FYYA 3BP7A 3KYOA 3GMOA 4HS3A 1KPVA 1I7UA 4PJHA 3VWJA 4LNRA 3LKSA 1B0RA 5IB4A 1S7QA 5INCA 3KPNA 1UQSA 3CH1A 4G59A 4HX1A 4PRPA 3GMNA 4QRUA 4HUWA 1FZMA 1RK1A 2Q7YA 5J6HA 1BQHA 3GJFA 4L4TA 5C0JA 3L3JA 5IB3A 5MEQA 4PJAA 1L8JA 5E6IC 3REWA 1HHGA 4PJGA 3H9SA 1RJYA 4WJ5A 3E2HA 5C9JA 2CLVA 3DXAA 3IXAA 2F53A 5D7JC 1AGBA 4JRYA 3FQNA 4UQ2A 3HE6A 3FQRA 3FT3A 4HKJA 3L3GA 2P5EA 4ZUVA 3E6FA 3BP4A 5H94A 3DMMA 3FRUA 4U1NA 2CKBH 4HUVA 4NO5A 2HLAA 1HHHA 3LN4A 3MRKA 4U6YA 4WUUA 1LD9A 5C0DA 5C0GA 5IM7A 4L8BA 5HHMA 5ENWA 5IB5A 1S7WA 3OX8A 2HN7A 2AV7A 3GSRA 1OF2A 3FOLA 1HHJA 4O2EA 1DUZA 4E5XA 3VXSA 4Y2DA 3CDGA 4PJ9A 5L2KA 3WUWA 1ZT7A 4X6CA 1OGAA 2F54A 4L3EA 2BVOA 2GUOA 4ZFZA 3SDXA 1YPZA 4NNYA 5IB1A 3PWVA 3JTTA 1ZHKA 3H9HA 3VRJA 1T7YA 1AGFA 3BZFA 2PYEA 4F7PA 3MV7A 3U0PA 1LEKA 3P73A 3SCMA 5F1NA 3DTXA 3ECBA 4PGDA 2ZOLA 4HV8A 5FDWA 3FFCA 3MREA 4G9FA 3TO4A 3GMLA 2VLRA 3TBWA 4L8CA 3MRQA 3VFRA 5HHOA 4QRSA 2YPLA 1YN6A 3M1BA 4L8DA 4PRDA 1S7VA 1CE6A 3FOMA 1FO0H 4Z78A 1MWAH 1T1ZA 3MV9A 2YPKA 5AD0A 2AV1A 3BW9A 1S7UA 1ZHNA 4QRTA 3QUYA 1OSZA 1FZJA 4NHUE 2GAZA 3VCLA 3P4MA 3GSOA 4PJCA 1S7RA 3VXRA 4F7MA 3PWLA 4JQXA 3NFNA 5E8OA 1KTLA 3KPSA 1VACA 3HUJA 4NQCA 5EO0A 5MERA 3LKQA 4EI5A 1I1YA 1A1OA 3KPMA 1JGDA 3AREA 1TVBA 3P4NA 3DX7A 3MRHA 1S7XA 5HHQA 3D39A 3HE7A 2ZSVA 1DUYA 4JFQA 3QDMA 3RWDA 2CLRA 3GSUA 5E9DA 1QQDA 3BH9A 4GKNA 3UTSA 1MHEA 3L9RA 3VH8A 4NQXA 1YDPA 3BEVA 4WDIA 4EN3C 3KXFA 1S9WA 1JPFA 1MI5A 3MRMA 3QDGA 3O3EA 4ZUSA 4MQ7A 3LN5A 4Y4FA 4PJ8A 3FQTA 1M6OA 1VADA 2X4PA 1N3NA 1FFNA 3X11A 1ONQA 5MEPA 2CIIA 1BIIA 3QUXA 2VLLA 4LCYA 4NO3A 1LEGA 4QOKA 3RWJA 3ARDA 3CZFA 1FG2A 3ES6A 1XZ0A 2HJLA 3MA7A 3SDCA 3MRRA 5HGBA 1QR1A 1DE4A 4NSKA 4U1KA 3QQ3A 1S8DA 2GTZA 4IRJA 4NNXA 3BO8A 3FT2A 1A1MA 1KJ2H 5BS0A 3UBXA 1AGEA 4XXCA 2DYPA 1I1AA 3MV8A 2JCCA 4ZAKA 3BZEA 3X14A 3TZVC 3VXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IND A;  2BNR A;  1BD2 A;  5D7L A;  1X7Q A;  4F7T A;  3SJV A;  4N8V A;  5FKP A;  1CG9 A;  4MXQ A;  4LHU A;  4N0C A;  5IVX A;  1LK2 A;  4IIQ C;  2AK4 A;  5DEF A;  2XPG A;  4L8S C;  5C0B A;  4K7F A;  2UWE A;  3ERY A;  2BSR A;  3HAE A;  4WU5 A;  3VFN A;  3TPU E;  3QEQ A;  3GSX A;  3TBY A;  2VLJ A;  3TID A;  3LV3 A;  1T7W A;  3GIV A;  1JHT A;  3SPV A;  3QZW A;  4G8G A;  4WW2 C;  3TO2 A;  1VGK A;  5D9S A;  1A6Z A;  4G9D A;  4HUX A;  1UXW A;  1XH3 A;  3WLB A;  1T7V A;  1AKJ A;  1B0G A;  2NW3 A;  4L4V A;  1NAM H;  3BGM A;  1T1X A;  3FON A;  3MRD A;  5E8P A;  2A83 A;  4EUP A;  1SYS A;  3DBX A;  3PWJ A;  5SWQ A;  3AM8 A;  3MRL A;  4ZUW A;  3ROL A;  3MGO A;  4K71 B;  1IM9 A;  4CVZ A;  4O2F A;  3I6G A;  1FFP A;  4ELM A;  3MRO A;  3VXM A;  2X4N A;  1GZQ A;  3QI9 A;  4PJD A;  5HHN A;  3ROO A;  3SKO A;  1WBZ A;  3RL2 A;  3MYJ A;  3VFS A;  5D5M A;  4PGC A;  3BHB A;  3CPL A;  3O3D A;  3HPJ A;  3BWA A;  4L3C A;  2HJK A;  1JF1 A;  5ACZ A;  3W39 A;  5EU3 A;  3ILQ C;  1LDP H;  4CW1 A;  1EEY A;  3GMQ A;  1EFX A;  3VFO A;  5MEN A;  1QO3 A;  1EXU A;  5C0I A;  4JFD A;  3O3A A;  3M17 A;  2GT9 A;  2CLZ A;  4U1S A;  3TVM A;  1N59 A;  1W0W A;  3D2U A;  2XFX A;  3UTT A;  5MEO A;  3QUZ A;  5D7I A;  4QRQ A;  4UQ3 A;  1LP9 A;  2X4U A;  1UXS A;  2F74 A;  1G6R H;  1HSA A;  2X4R A;  3QDJ A;  1ZHB A;  2GTW A;  1QRN A;  4X6F A;  1KBG H;  4PRI A;  3VFW A;  1JUF A;  3VXP A;  3GSN H;  5J6G A;  1I4F A;  1XR8 A;  2V2W A;  1EEZ A;  1ZS8 A;  2ESV A;  5B39 A;  4HWZ A;  3UTQ A;  2ZOK A;  1ZAG A;  4JFE A;  4N5E A;  5EFI A;  1HOC A;  1R3H A;  5HHP A;  4JFP A;  1S7T A;  4WU7 A;  5EU4 A;  3KLA A;  1KJM A;  5D2N A;  1B3J A;  3MR9 A;  2H26 A;  4NQD A;  1KPR A;  5EUO A;  1N5A A;  4L29 A;  4Y16 A;  2BNQ A;  2AKR A;  4U1J A;  5DEG A;  2GJ6 A;  4O2C A;  1ZHL A;  2FWO A;  1Q94 A;  3I6K A;  5C0E A;  3OV6 A;  4NO2 A;  4MJ5 A;  1JPG A;  2C7U A;  1KJ3 H;  4IHO A;  1TVH A;  3MRB A;  5F9J A;  5SWZ A;  1T21 A;  5F1I A;  3FQW A;  3PAB A;  1HSB A;  1Z5L A;  5ISZ A;  1FFO A;  3DX6 A;  1QSF A;  4PGB A;  5HYJ A;  5C0A A;  5IEH A;  5HGH A;  2V2X A;  4D0D A;  3IT8 D;  1JFM A;  3UPR A;  3RL1 A;  3KPR A;  5DDH A;  3PQY A;  4PRE A;  1G7P A;  3FT4 A;  2BST A;  4PG9 A;  5BRZ A;  3QFD A;  2FZ3 A;  4D0C A;  4JFF A;  2E7L E;  4PJ7 A;  4PV8 A;  3VFM A;  4U1L A;  1T0M A;  3TIE A;  3L3D A;  4PDC E;  3VXO A;  4MNQ A;  4X6D A;  2VLK A;  3TBS A;  1E27 A;  3GSQ A;  2VE6 A;  1CD1 A;  3CVH A;  5C09 A;  1NAN H;  1ZSD A;  2YEZ A;  3VWK A;  4FTV A;  2H6P A;  4E0R A;  4JFO A;  4ONO A;  4D0B A;  2CIK A;  1PQZ A;  2OI9 A;  3E3Q A;  5E00 A;  4APQ A;  4F7C A;  1QEW A;  1K8D A;  3C9N A;  4GUP A;  4JQV A;  2X70 A;  3BUY A;  4Y4H A;  3KPQ A;  3JVG A;  3L3H A;  3LKN A;  3VXU A;  4I4W A;  4S0U C;  3MRN A;  3LKP A;  5EOT A;  3TBT A;  1XR9 A;  4NQE A;  4HUU A;  4MNG A;  2X4Q A;  3D25 A;  1AGD A;  1IM3 A;  1G7Q A;  1NEZ A;  1QSE A;  1T7X A;  5HGD A;  3QQ4 A;  3V5D A;  1A1N A;  4Z77 A;  4F7E A;  4G42 A;  2PO6 A;  3W0W A;  1JE6 A;  2OL3 H;  1WBY A;  4PRN A;  5C0C A;  1JGE A;  4U1M A;  3MGT A;  3HCV A;  1T7Z A;  3L3K A;  3PWU A;  3JTS A;  4PJX A;  4PJF A;  1E28 A;  3TF7 A;  4NQV A;  3X13 A;  4V3E B;  3GMM A;  3VRI A;  1M05 A;  1HHK A;  1T80 A;  4PRA A;  3OXS A;  4U1H A;  5D2L A;  2BCK A;  3RGV C;  3RWG A;  4CVX A;  3MRG A;  3G08 A;  1KJV A;  2VAB A;  3RUG A;  1ZT1 A;  4PR5 A;  5FA3 A;  3O9W A;  3FQX A;  5F7D A;  1LQV A;  5EU6 A;  3V5K A;  1W72 A;  3TJH A;  1TMC A;  3PWP A;  3SDA A;  4Z76 A;  4PGE A;  4NT6 A;  2FO4 A;  5B38 A;  2AXG A;  1AGC A;  2AXF A;  2FIK A;  3VFV A;  1GZP A;  3E6H A;  4ZUT A;  1RK0 A;  3ARF A;  3QFJ A;  3TFK A;  3RTQ A;  3S6C A;  3KPO A;  1ED3 A;  1S9X A;  3GMR A;  1YN7 A;  4LCC C;  3V5H A;  4GKS A;  3TBV A;  1ZT4 A;  1P1Z A;  2P5W A;  4JRX A;  3P9M A;  4NO0 A;  4LCW A;  3PWN A;  1C16 A;  5GSR A;  3VJ6 A;  5C08 A;  1P7Q A;  3QUL A;  1A9B A;  1T20 A;  3VFP A;  4QRP A;  5HGA A;  3KWW A;  5FA4 A;  5EO1 A;  3D18 A;  3I6L D;  2NX5 A;  5IEK A;  4PG2 A;  3T8X A;  1HHI A;  3JTC A;  1I7R A;  1INQ A;  1WBX A;  4PV9 A;  3BXN A;  5SWS A;  4MJI A;  1T22 A;  1BZ9 A;  3SKM A;  3VFU A;  4I48 A;  1ZVS A;  2D31 A;  1P4L A;  4N0F A;  3X12 A;  4PJI A;  3MRC A;  3P4O A;  3P77 A;  4MVB A;  3T1F A;  1RJZ A;  1U58 A;  2WY3 A;  4QRR A;  5C0F A;  3OXR A;  1K5N A;  3D3V A;  3B3I A;  2GIT A;  4MS8 A;  3O8X A;  4N0U A;  1OGT A;  2X4T A;  3CC5 A;  1I7T A;  3AU1 A;  3MRF A;  5GSV A;  3RWE A;  4G8I A;  4X6E A;  1HYR C;  1S7S A;  4PP8 C;  3FTG A;  3KPL A;  3RWF A;  3ARG A;  4U6X A;  4FFE X;  3GSW A;  2BVQ A;  3RWH A;  4IRS A;  5BXF A;  3WS3 A;  1T1W A;  3GSV A;  3SDD A;  2RFX A;  2X4S A;  3BVN A;  1FZO A;  1T0N A;  1T1Y A;  3BH8 A;  1A9E A;  3HG1 A;  4PJB A;  5EU5 A;  1SYV A;  4PRH A;  3ARB A;  2MHA A;  3TA3 A;  3ILP A;  3O3B A;  3WL9 A;  4U1I A;  3GMP A;  3FQU A;  2ZSW A;  4PJ5 A;  3C8K A;  3B6S A;  3RWC A;  1AO7 A;  3DX8 A;  1S9Y A;  4G43 A;  3WS6 A;  3O4L A;  3P9L A;  3QUK A;  3BEW A;  3KPP A;  5L2J A;  3MRJ A;  4PJE A;  2J8U A;  4L9L C;  5IB2 A;  1QLF A;  2BVP A;  3LKO A;  1I1F A;  1KPU A;  3H7B A;  5IRO A;  2VAA A;  4PRB A;  3L3I A;  3LKR A;  3TN0 A;  3KYN A;  4Y4K A;  5JHD A;  4MJ6 A;  4V3D B;  1N2R A;  1KCG C;  1QVO A;  5E8N A;  3VFT A;  1DDH A;  3RZC A;  3CCH A;  1W0V A;  4WO4 A;  4ZUU A;  3HLA A;  4MX7 A;  1FZK A;  5J1A A;  4WWK C;  3MRI A;  5BJT A;  3RWI A;  2X4O A;  3MRP A;  5C07 A;  1MHC A;  2BSS A;  2FYY A;  3BP7 A;  3KYO A;  3GMO A;  4HS3 A;  1KPV A;  1I7U A;  4PJH A;  3VWJ A;  4LNR A;  3LKS A;  1B0R A;  5IB4 A;  1S7Q A;  5INC A;  3KPN A;  1UQS A;  3CH1 A;  4G59 A;  4HX1 A;  4PRP A;  3GMN A;  4QRU A;  4HUW A;  1FZM A;  1RK1 A;  2Q7Y A;  5J6H A;  1BQH A;  3GJF A;  4L4T A;  5C0J A;  3L3J A;  5IB3 A;  5MEQ A;  4PJA A;  1L8J A;  5E6I C;  3REW A;  1HHG A;  4PJG A;  3H9S A;  1RJY A;  4WJ5 A;  3E2H A;  5C9J A;  2CLV A;  3DXA A;  3IXA A;  2F53 A;  5D7J C;  1AGB A;  4JRY A;  3FQN A;  4UQ2 A;  3HE6 A;  3FQR A;  3FT3 A;  4HKJ A;  3L3G A;  2P5E A;  4ZUV A;  3E6F A;  3BP4 A;  5H94 A;  3DMM A;  3FRU A;  4U1N A;  2CKB H;  4HUV A;  4NO5 A;  2HLA A;  1HHH A;  3LN4 A;  3MRK A;  4U6Y A;  4WUU A;  1LD9 A;  5C0D A;  5C0G A;  5IM7 A;  4L8B A;  5HHM A;  5ENW A;  5IB5 A;  1S7W A;  3OX8 A;  2HN7 A;  2AV7 A;  3GSR A;  1OF2 A;  3FOL A;  1HHJ A;  4O2E A;  1DUZ A;  4E5X A;  3VXS A;  4Y2D A;  3CDG A;  4PJ9 A;  5L2K A;  3WUW A;  1ZT7 A;  4X6C A;  1OGA A;  2F54 A;  4L3E A;  2BVO A;  2GUO A;  4ZFZ A;  3SDX A;  1YPZ A;  4NNY A;  5IB1 A;  3PWV A;  3JTT A;  1ZHK A;  3H9H A;  3VRJ A;  1T7Y A;  1AGF A;  3BZF A;  2PYE A;  4F7P A;  3MV7 A;  3U0P A;  1LEK A;  3P73 A;  3SCM A;  5F1N A;  3DTX A;  3ECB A;  4PGD A;  2ZOL A;  4HV8 A;  5FDW A;  3FFC A;  3MRE A;  4G9F A;  3TO4 A;  3GML A;  2VLR A;  3TBW A;  4L8C A;  3MRQ A;  3VFR A;  5HHO A;  4QRS A;  2YPL A;  1YN6 A;  3M1B A;  4L8D A;  4PRD A;  1S7V A;  1CE6 A;  3FOM A;  1FO0 H;  4Z78 A;  1MWA H;  1T1Z A;  3MV9 A;  2YPK A;  5AD0 A;  2AV1 A;  3BW9 A;  1S7U A;  1ZHN A;  4QRT A;  3QUY A;  1OSZ A;  1FZJ A;  4NHU E;  2GAZ A;  3VCL A;  3P4M A;  3GSO A;  4PJC A;  1S7R A;  3VXR A;  4F7M A;  3PWL A;  4JQX A;  3NFN A;  5E8O A;  1KTL A;  3KPS A;  1VAC A;  3HUJ A;  4NQC A;  5EO0 A;  5MER A;  3LKQ A;  4EI5 A;  1I1Y A;  1A1O A;  3KPM A;  1JGD A;  3ARE A;  1TVB A;  3P4N A;  3DX7 A;  3MRH A;  1S7X A;  5HHQ A;  3D39 A;  3HE7 A;  2ZSV A;  1DUY A;  4JFQ A;  3QDM A;  3RWD A;  2CLR A;  3GSU A;  5E9D A;  1QQD A;  3BH9 A;  4GKN A;  3UTS A;  1MHE A;  3L9R A;  3VH8 A;  4NQX A;  1YDP A;  3BEV A;  4WDI A;  4EN3 C;  3KXF A;  1S9W A;  1JPF A;  1MI5 A;  3MRM A;  3QDG A;  3O3E A;  4ZUS A;  4MQ7 A;  3LN5 A;  4Y4F A;  4PJ8 A;  3FQT A;  1M6O A;  1VAD A;  2X4P A;  1N3N A;  1FFN A;  3X11 A;  1ONQ A;  5MEP A;  2CII A;  1BII A;  3QUX A;  2VLL A;  4LCY A;  4NO3 A;  1LEG A;  4QOK A;  3RWJ A;  3ARD A;  3CZF A;  1FG2 A;  3ES6 A;  1XZ0 A;  2HJL A;  3MA7 A;  3SDC A;  3MRR A;  5HGB A;  1QR1 A;  1DE4 A;  4NSK A;  4U1K A;  3QQ3 A;  1S8D A;  2GTZ A;  4IRJ A;  4NNX A;  3BO8 A;  3FT2 A;  1A1M A;  1KJ2 H;  5BS0 A;  3UBX A;  1AGE A;  4XXC A;  2DYP A;  1I1A A;  3MV8 A;  2JCC A;  4ZAK A;  3BZE A;  3X14 A;  3TZV C;  3VXN A; 
#chains in the Genus database with same CATH topology
 5IND A;  2BNR A;  1BD2 A;  5D7L A;  1X7Q A;  4F7T A;  3SJV A;  4N8V A;  4G59 C;  5FKP A;  1CG9 A;  4MXQ A;  4LHU A;  4N0C A;  5IVX A;  1LK2 A;  4IIQ C;  2AK4 A;  5DEF A;  2XPG A;  4L8S C;  5C0B A;  4K7F A;  2UWE A;  3ERY A;  2BSR A;  3HAE A;  4WU5 A;  3VFN A;  3TPU E;  3QEQ A;  3GSX A;  3TBY A;  2VLJ A;  3TID A;  3LV3 A;  1T7W A;  3GIV A;  1JHT A;  3SPV A;  3QZW A;  4G8G A;  4WW2 C;  3TO2 A;  1VGK A;  5D9S A;  1A6Z A;  4G9D A;  4HUX A;  1UXW A;  1XH3 A;  3WLB A;  1T7V A;  1AKJ A;  1B0G A;  2NW3 A;  4L4V A;  1NAM H;  3BGM A;  1T1X A;  3FON A;  3MRD A;  5E8P A;  2A83 A;  4EUP A;  1SYS A;  3DBX A;  3PWJ A;  5SWQ A;  3AM8 A;  3MRL A;  4ZUW A;  3ROL A;  3MGO A;  4K71 B;  1IM9 A;  4CVZ A;  4O2F A;  3I6G A;  1FFP A;  4ELM A;  3MRO A;  3VXM A;  2X4N A;  1GZQ A;  3QI9 A;  4PJD A;  5HHN A;  3ROO A;  3SKO A;  1WBZ A;  3RL2 A;  3MYJ A;  3VFS A;  5D5M A;  4PGC A;  3BHB A;  3CPL A;  3O3D A;  3HPJ A;  3BWA A;  4L3C A;  2HJK A;  1JF1 A;  5ACZ A;  3W39 A;  5EU3 A;  3ILQ C;  1LDP H;  4CW1 A;  1EEY A;  3GMQ A;  1EFX A;  3VFO A;  5MEN A;  1QO3 A;  1EXU A;  5C0I A;  4JFD A;  3O3A A;  3M17 A;  2GT9 A;  2CLZ A;  4U1S A;  3TVM A;  1N59 A;  1W0W A;  3D2U A;  2XFX A;  3UTT A;  5MEO A;  3QUZ A;  5D7I A;  4QRQ A;  4UQ3 A;  1LP9 A;  2X4U A;  1UXS A;  2F74 A;  1G6R H;  1HSA A;  2X4R A;  3QDJ A;  1ZHB A;  2GTW A;  2IA1 A;  1QRN A;  4X6F A;  1KBG H;  4PRI A;  3VFW A;  1JUF A;  3VXP A;  3GSN H;  5J6G A;  1I4F A;  1XR8 A;  2V2W A;  1EEZ A;  1ZS8 A;  2ESV A;  5B39 A;  4HWZ A;  3UTQ A;  2ZOK A;  1ZAG A;  4JFE A;  4N5E A;  5EFI A;  1HOC A;  1R3H A;  5HHP A;  4JFP A;  1S7T A;  4WU7 A;  5EU4 A;  3KLA A;  1KJM A;  5D2N A;  1B3J A;  3MR9 A;  2H26 A;  4NQD A;  1KPR A;  5EUO A;  1N5A A;  4L29 A;  4Y16 A;  2BNQ A;  2AKR A;  4U1J A;  5DEG A;  2GJ6 A;  4O2C A;  1ZHL A;  2FWO A;  1Q94 A;  3I6K A;  5C0E A;  3OV6 A;  4NO2 A;  4MJ5 A;  1JPG A;  2C7U A;  1KJ3 H;  4IHO A;  1TVH A;  3MRB A;  5F9J A;  5SWZ A;  1T21 A;  5F1I A;  3FQW A;  3PAB A;  1HSB A;  1Z5L A;  5ISZ A;  1FFO A;  3DX6 A;  1QSF A;  4PGB A;  5HYJ A;  5C0A A;  5IEH A;  5HGH A;  2V2X A;  4D0D A;  3IT8 D;  1JFM A;  3UPR A;  3RL1 A;  3KPR A;  5DDH A;  3PQY A;  4PRE A;  1G7P A;  3FT4 A;  2BST A;  4PG9 A;  5BRZ A;  3QFD A;  2FZ3 A;  4D0C A;  4JFF A;  2E7L E;  4PJ7 A;  4PV8 A;  3VFM A;  4U1L A;  1T0M A;  3TIE A;  3L3D A;  4PDC E;  3VXO A;  4MNQ A;  4X6D A;  2VLK A;  3TBS A;  1E27 A;  3GSQ A;  2VE6 A;  1CD1 A;  3CVH A;  5C09 A;  1NAN H;  1ZSD A;  2YEZ A;  3VWK A;  4FTV A;  2H6P A;  4E0R A;  4JFO A;  4ONO A;  4D0B A;  2CIK A;  1PQZ A;  2OI9 A;  3E3Q A;  5E00 A;  4APQ A;  4F7C A;  1QEW A;  1K8D A;  3C9N A;  4GUP A;  4JQV A;  2X70 A;  3BUY A;  4Y4H A;  3KPQ A;  3JVG A;  3L3H A;  3LKN A;  3VXU A;  4I4W A;  4JO8 A;  4S0U C;  3MRN A;  3LKP A;  5EOT A;  3TBT A;  1XR9 A;  4NQE A;  4HUU A;  4MNG A;  2X4Q A;  3D25 A;  1AGD A;  1IM3 A;  1G7Q A;  1NEZ A;  1QSE A;  1T7X A;  5HGD A;  3QQ4 A;  3V5D A;  1A1N A;  4Z77 A;  4F7E A;  4G42 A;  2PO6 A;  3W0W A;  1JE6 A;  2OL3 H;  1WBY A;  4PRN A;  5C0C A;  1JGE A;  4U1M A;  3MGT A;  4BKW A;  3HCV A;  1T7Z A;  3L3K A;  3PWU A;  3JTS A;  4PJX A;  4PJF A;  1E28 A;  3TF7 A;  4NQV A;  3X13 A;  4V3E B;  3GMM A;  3VRI A;  1M05 A;  1HHK A;  1T80 A;  4PRA A;  3OXS A;  4U1H A;  5D2L A;  2BCK A;  3RGV C;  3RWG A;  4CVX A;  3MRG A;  3G08 A;  1KJV A;  2VAB A;  3RUG A;  1ZT1 A;  4PR5 A;  5FA3 A;  3O9W A;  3FQX A;  5F7D A;  1LQV A;  5EU6 A;  3V5K A;  1W72 A;  3TJH A;  1TMC A;  3PWP A;  3SDA A;  4Z76 A;  4PGE A;  4NT6 A;  2FO4 A;  5B38 A;  2AXG A;  1AGC A;  2AXF A;  2FIK A;  3VFV A;  1GZP A;  3E6H A;  4ZUT A;  1RK0 A;  3ARF A;  3QFJ A;  3TFK A;  3RTQ A;  3S6C A;  3KPO A;  1ED3 A;  1S9X A;  3GMR A;  1YN7 A;  4LCC C;  3V5H A;  4GKS A;  3TBV A;  1ZT4 A;  1P1Z A;  2P5W A;  4JRX A;  3P9M A;  4NO0 A;  4LCW A;  3PWN A;  1C16 A;  5GSR A;  3VJ6 A;  5C08 A;  1P7Q A;  3I0T A;  3QUL A;  1A9B A;  1T20 A;  3VFP A;  4QRP A;  5HGA A;  3KWW A;  5FA4 A;  5EO1 A;  3D18 A;  3I6L D;  2NX5 A;  5IEK A;  4PG2 A;  3T8X A;  1HHI A;  3JTC A;  1I7R A;  1INQ A;  1WBX A;  4PV9 A;  3BXN A;  5SWS A;  4MJI A;  1T22 A;  1BZ9 A;  3SKM A;  3VFU A;  2NYK A;  4I48 A;  1ZVS A;  2D31 A;  1P4L A;  4N0F A;  3X12 A;  4PJI A;  3MRC A;  3P4O A;  3P77 A;  4MVB A;  3T1F A;  1RJZ A;  1U58 A;  2WY3 A;  4QRR A;  5C0F A;  3OXR A;  1K5N A;  3D3V A;  3B3I A;  2GIT A;  4MS8 A;  3O8X A;  4N0U A;  1OGT A;  2X4T A;  3CC5 A;  1I7T A;  3AU1 A;  3MRF A;  5GSV A;  3RWE A;  4G8I A;  4X6E A;  1HYR C;  1S7S A;  4PP8 C;  3FTG A;  3KPL A;  3RWF A;  3ARG A;  4U6X A;  4FFE X;  3GSW A;  2BVQ A;  3RWH A;  4IRS A;  5BXF A;  3WS3 A;  1T1W A;  3GSV A;  3SDD A;  2RFX A;  2X4S A;  3BVN A;  1FZO A;  1T0N A;  1T1Y A;  3BH8 A;  1A9E A;  3HG1 A;  4PJB A;  5EU5 A;  1SYV A;  4PRH A;  3ARB A;  2MHA A;  3TA3 A;  3ILP A;  3O3B A;  3WL9 A;  4U1I A;  3GMP A;  3FQU A;  2ZSW A;  4PJ5 A;  3C8K A;  3B6S A;  3RWC A;  1AO7 A;  3DX8 A;  1S9Y A;  4G43 A;  3WS6 A;  3O4L A;  3P9L A;  3QUK A;  3BEW A;  3KPP A;  5L2J A;  3MRJ A;  4PJE A;  2J8U A;  4L9L C;  5IB2 A;  1QLF A;  2BVP A;  3LKO A;  1I1F A;  1KPU A;  3H7B A;  5IRO A;  2VAA A;  4PRB A;  3L3I A;  3LKR A;  3TN0 A;  3KYN A;  4Y4K A;  5JHD A;  4MJ6 A;  4V3D B;  1N2R A;  1KCG C;  1QVO A;  5E8N A;  3VFT A;  1DDH A;  3RZC A;  3CCH A;  1W0V A;  4WO4 A;  4ZUU A;  3HLA A;  4MX7 A;  1FZK A;  5J1A A;  4WWK C;  3MRI A;  5BJT A;  3RWI A;  2X4O A;  3MRP A;  5C07 A;  1MHC A;  2BSS A;  2FYY A;  3BP7 A;  3KYO A;  3GMO A;  4HS3 A;  1KPV A;  1I7U A;  4PJH A;  3VWJ A;  4LNR A;  3LKS A;  1B0R A;  5IB4 A;  1S7Q A;  5INC A;  3KPN A;  1UQS A;  3CH1 A;  4G59 A;  4HX1 A;  4PRP A;  3GMN A;  4QRU A;  4HUW A;  1FZM A;  1RK1 A;  2Q7Y A;  5J6H A;  1BQH A;  3GJF A;  4L4T A;  5C0J A;  3L3J A;  5IB3 A;  5MEQ A;  4PJA A;  1L8J A;  5E6I C;  3REW A;  1HHG A;  4PJG A;  3H9S A;  1RJY A;  4WJ5 A;  3E2H A;  5C9J A;  2CLV A;  3DXA A;  3IXA A;  2F53 A;  5D7J C;  1AGB A;  4JRY A;  3FQN A;  4UQ2 A;  3HE6 A;  3FQR A;  3FT3 A;  4HKJ A;  3L3G A;  2P5E A;  4ZUV A;  3E6F A;  3BP4 A;  5H94 A;  3DMM A;  3FRU A;  4U1N A;  2CKB H;  4HUV A;  4NO5 A;  2HLA A;  1HHH A;  3LN4 A;  3MRK A;  4U6Y A;  4WUU A;  1LD9 A;  5C0D A;  5C0G A;  5IM7 A;  4L8B A;  5HHM A;  5ENW A;  5IB5 A;  1S7W A;  3OX8 A;  2HN7 A;  2AV7 A;  3GSR A;  1OF2 A;  3FOL A;  1HHJ A;  4O2E A;  1DUZ A;  4E5X A;  3VXS A;  4Y2D A;  3CDG A;  4PJ9 A;  5L2K A;  3WUW A;  1ZT7 A;  4X6C A;  1OGA A;  2F54 A;  4L3E A;  2BVO A;  2GUO A;  4ZFZ A;  3SDX A;  1YPZ A;  4NNY A;  5IB1 A;  3PWV A;  3JTT A;  1ZHK A;  3H9H A;  3VRJ A;  1T7Y A;  1AGF A;  3BZF A;  2PYE A;  4F7P A;  3MV7 A;  3U0P A;  1LEK A;  3P73 A;  3SCM A;  5F1N A;  3DTX A;  3ECB A;  4PGD A;  2ZOL A;  4HV8 A;  5FDW A;  3FFC A;  3MRE A;  4G9F A;  3TO4 A;  3GML A;  2VLR A;  3TBW A;  4L8C A;  3MRQ A;  3VFR A;  5HHO A;  4QRS A;  2YPL A;  1YN6 A;  3M1B A;  4L8D A;  4PRD A;  1S7V A;  1CE6 A;  3FOM A;  1FO0 H;  4Z78 A;  1MWA H;  1T1Z A;  3MV9 A;  2YPK A;  5AD0 A;  2AV1 A;  3BW9 A;  1S7U A;  1ZHN A;  4QRT A;  3QUY A;  1OSZ A;  1FZJ A;  4NHU E;  2GAZ A;  3VCL A;  3P4M A;  3GSO A;  4PJC A;  1S7R A;  3VXR A;  4F7M A;  3PWL A;  4JQX A;  3NFN A;  5E8O A;  1KTL A;  3KPS A;  1VAC A;  3HUJ A;  4NQC A;  5EO0 A;  5MER A;  3LKQ A;  4EI5 A;  1I1Y A;  1A1O A;  3KPM A;  1JGD A;  3ARE A;  1TVB A;  3P4N A;  3DX7 A;  3MRH A;  1S7X A;  5HHQ A;  3D39 A;  3HE7 A;  2ZSV A;  1DUY A;  4JFQ A;  3QDM A;  3RWD A;  2CLR A;  3GSU A;  5E9D A;  1QQD A;  3BH9 A;  4GKN A;  3UTS A;  1MHE A;  3L9R A;  2O5N A;  4NQX A;  3VH8 A;  1YDP A;  3BEV A;  4WDI A;  4EN3 C;  3KXF A;  1S9W A;  1JPF A;  1MI5 A;  3MRM A;  3QDG A;  3O3E A;  4ZUS A;  4MQ7 A;  3LN5 A;  4Y4F A;  4PJ8 A;  3FQT A;  1M6O A;  1VAD A;  2X4P A;  1N3N A;  1FFN A;  3X11 A;  1ONQ A;  5MEP A;  2CII A;  1BII A;  3QUX A;  2VLL A;  4LCY A;  4NO3 A;  1LEG A;  4QOK A;  3RWJ A;  3ARD A;  3CZF A;  1FG2 A;  3ES6 A;  1XZ0 A;  2HJL A;  3MA7 A;  3SDC A;  3MRR A;  5HGB A;  1QR1 A;  1DE4 A;  4NSK A;  4U1K A;  3QQ3 A;  1S8D A;  2GTZ A;  4IRJ A;  4NNX A;  3BO8 A;  3FT2 A;  1A1M A;  1KJ2 H;  5BS0 A;  3UBX A;  1AGE A;  4XXC A;  2DYP A;  1I1A A;  3MV8 A;  2JCC A;  4ZAK A;  3BZE A;  3X14 A;  3TZV C;  3VXN A; 
#chains in the Genus database with same CATH homology
 5IND A;  2BNR A;  1BD2 A;  5D7L A;  1X7Q A;  4F7T A;  3SJV A;  4N8V A;  5FKP A;  1CG9 A;  4MXQ A;  4LHU A;  4N0C A;  5IVX A;  1LK2 A;  4IIQ C;  2AK4 A;  5DEF A;  2XPG A;  4L8S C;  5C0B A;  4K7F A;  2UWE A;  3ERY A;  2BSR A;  3HAE A;  4WU5 A;  3VFN A;  3TPU E;  3QEQ A;  3GSX A;  3TBY A;  2VLJ A;  3TID A;  3LV3 A;  1T7W A;  3GIV A;  1JHT A;  3SPV A;  3QZW A;  4G8G A;  4WW2 C;  3TO2 A;  1VGK A;  5D9S A;  1A6Z A;  4G9D A;  4HUX A;  1UXW A;  1XH3 A;  3WLB A;  1T7V A;  1AKJ A;  1B0G A;  2NW3 A;  4L4V A;  1NAM H;  3BGM A;  1T1X A;  3FON A;  3MRD A;  5E8P A;  2A83 A;  4EUP A;  1SYS A;  3DBX A;  3PWJ A;  5SWQ A;  3AM8 A;  3MRL A;  4ZUW A;  3ROL A;  3MGO A;  4K71 B;  1IM9 A;  4CVZ A;  4O2F A;  3I6G A;  1FFP A;  4ELM A;  3MRO A;  3VXM A;  2X4N A;  1GZQ A;  3QI9 A;  4PJD A;  5HHN A;  3ROO A;  3SKO A;  1WBZ A;  3RL2 A;  3MYJ A;  3VFS A;  5D5M A;  4PGC A;  3BHB A;  3CPL A;  3O3D A;  3HPJ A;  3BWA A;  4L3C A;  2HJK A;  1JF1 A;  5ACZ A;  3W39 A;  5EU3 A;  3ILQ C;  1LDP H;  4CW1 A;  1EEY A;  3GMQ A;  1EFX A;  3VFO A;  5MEN A;  1QO3 A;  1EXU A;  5C0I A;  4JFD A;  3O3A A;  3M17 A;  2GT9 A;  2CLZ A;  4U1S A;  3TVM A;  1N59 A;  1W0W A;  3D2U A;  2XFX A;  3UTT A;  5MEO A;  3QUZ A;  5D7I A;  4QRQ A;  4UQ3 A;  1LP9 A;  2X4U A;  1UXS A;  2F74 A;  1G6R H;  1HSA A;  2X4R A;  3QDJ A;  1ZHB A;  2GTW A;  1QRN A;  4X6F A;  1KBG H;  4PRI A;  3VFW A;  1JUF A;  3VXP A;  3GSN H;  5J6G A;  1I4F A;  1XR8 A;  2V2W A;  1EEZ A;  1ZS8 A;  2ESV A;  5B39 A;  4HWZ A;  3UTQ A;  2ZOK A;  1ZAG A;  4JFE A;  4N5E A;  5EFI A;  1HOC A;  1R3H A;  5HHP A;  4JFP A;  1S7T A;  4WU7 A;  5EU4 A;  3KLA A;  1KJM A;  5D2N A;  1B3J A;  3MR9 A;  2H26 A;  4NQD A;  1KPR A;  5EUO A;  1N5A A;  4L29 A;  4Y16 A;  2BNQ A;  2AKR A;  4U1J A;  5DEG A;  2GJ6 A;  4O2C A;  1ZHL A;  2FWO A;  1Q94 A;  3I6K A;  5C0E A;  3OV6 A;  4NO2 A;  4MJ5 A;  1JPG A;  2C7U A;  1KJ3 H;  4IHO A;  1TVH A;  3MRB A;  5F9J A;  5SWZ A;  1T21 A;  5F1I A;  3FQW A;  3PAB A;  1HSB A;  1Z5L A;  5ISZ A;  1FFO A;  3DX6 A;  1QSF A;  4PGB A;  5HYJ A;  5C0A A;  5IEH A;  5HGH A;  2V2X A;  4D0D A;  3IT8 D;  1JFM A;  3UPR A;  3RL1 A;  3KPR A;  5DDH A;  3PQY A;  4PRE A;  1G7P A;  3FT4 A;  2BST A;  4PG9 A;  5BRZ A;  3QFD A;  2FZ3 A;  4D0C A;  4JFF A;  2E7L E;  4PJ7 A;  4PV8 A;  3VFM A;  4U1L A;  1T0M A;  3TIE A;  3L3D A;  4PDC E;  3VXO A;  4MNQ A;  4X6D A;  2VLK A;  3TBS A;  1E27 A;  3GSQ A;  2VE6 A;  1CD1 A;  3CVH A;  5C09 A;  1NAN H;  1ZSD A;  2YEZ A;  3VWK A;  4FTV A;  2H6P A;  4E0R A;  4JFO A;  4ONO A;  4D0B A;  2CIK A;  1PQZ A;  2OI9 A;  3E3Q A;  5E00 A;  4APQ A;  4F7C A;  1QEW A;  1K8D A;  3C9N A;  4GUP A;  4JQV A;  2X70 A;  3BUY A;  4Y4H A;  3KPQ A;  3JVG A;  3L3H A;  3LKN A;  3VXU A;  4I4W A;  4S0U C;  3MRN A;  3LKP A;  5EOT A;  3TBT A;  1XR9 A;  4NQE A;  4HUU A;  4MNG A;  2X4Q A;  3D25 A;  1AGD A;  1IM3 A;  1G7Q A;  1NEZ A;  1QSE A;  1T7X A;  5HGD A;  3QQ4 A;  3V5D A;  1A1N A;  4Z77 A;  4F7E A;  4G42 A;  2PO6 A;  3W0W A;  1JE6 A;  2OL3 H;  1WBY A;  4PRN A;  5C0C A;  1JGE A;  4U1M A;  3MGT A;  3HCV A;  1T7Z A;  3L3K A;  3PWU A;  3JTS A;  4PJX A;  4PJF A;  1E28 A;  3TF7 A;  4NQV A;  3X13 A;  4V3E B;  3GMM A;  3VRI A;  1M05 A;  1HHK A;  1T80 A;  4PRA A;  3OXS A;  4U1H A;  5D2L A;  2BCK A;  3RGV C;  3RWG A;  4CVX A;  3MRG A;  3G08 A;  1KJV A;  2VAB A;  3RUG A;  1ZT1 A;  4PR5 A;  5FA3 A;  3O9W A;  3FQX A;  5F7D A;  1LQV A;  5EU6 A;  3V5K A;  1W72 A;  3TJH A;  1TMC A;  3PWP A;  3SDA A;  4Z76 A;  4PGE A;  4NT6 A;  2FO4 A;  5B38 A;  2AXG A;  1AGC A;  2AXF A;  2FIK A;  3VFV A;  1GZP A;  3E6H A;  4ZUT A;  1RK0 A;  3ARF A;  3QFJ A;  3TFK A;  3RTQ A;  3S6C A;  3KPO A;  1ED3 A;  1S9X A;  3GMR A;  1YN7 A;  4LCC C;  3V5H A;  4GKS A;  3TBV A;  1ZT4 A;  1P1Z A;  2P5W A;  4JRX A;  3P9M A;  4NO0 A;  4LCW A;  3PWN A;  1C16 A;  5GSR A;  3VJ6 A;  5C08 A;  1P7Q A;  3QUL A;  1A9B A;  1T20 A;  3VFP A;  4QRP A;  5HGA A;  3KWW A;  5FA4 A;  5EO1 A;  3D18 A;  3I6L D;  2NX5 A;  5IEK A;  4PG2 A;  3T8X A;  1HHI A;  3JTC A;  1I7R A;  1INQ A;  1WBX A;  4PV9 A;  3BXN A;  5SWS A;  4MJI A;  1T22 A;  1BZ9 A;  3SKM A;  3VFU A;  4I48 A;  1ZVS A;  2D31 A;  1P4L A;  4N0F A;  3X12 A;  4PJI A;  3MRC A;  3P4O A;  3P77 A;  4MVB A;  3T1F A;  1RJZ A;  1U58 A;  2WY3 A;  4QRR A;  5C0F A;  3OXR A;  1K5N A;  3D3V A;  3B3I A;  2GIT A;  4MS8 A;  3O8X A;  4N0U A;  1OGT A;  2X4T A;  3CC5 A;  1I7T A;  3AU1 A;  3MRF A;  5GSV A;  3RWE A;  4G8I A;  4X6E A;  1HYR C;  1S7S A;  4PP8 C;  3FTG A;  3KPL A;  3RWF A;  3ARG A;  4U6X A;  4FFE X;  3GSW A;  2BVQ A;  3RWH A;  4IRS A;  5BXF A;  3WS3 A;  1T1W A;  3GSV A;  3SDD A;  2RFX A;  2X4S A;  3BVN A;  1FZO A;  1T0N A;  1T1Y A;  3BH8 A;  1A9E A;  3HG1 A;  4PJB A;  5EU5 A;  1SYV A;  4PRH A;  3ARB A;  2MHA A;  3TA3 A;  3ILP A;  3O3B A;  3WL9 A;  4U1I A;  3GMP A;  3FQU A;  2ZSW A;  4PJ5 A;  3C8K A;  3B6S A;  3RWC A;  1AO7 A;  3DX8 A;  1S9Y A;  4G43 A;  3WS6 A;  3O4L A;  3P9L A;  3QUK A;  3BEW A;  3KPP A;  5L2J A;  3MRJ A;  4PJE A;  2J8U A;  4L9L C;  5IB2 A;  1QLF A;  2BVP A;  3LKO A;  1I1F A;  1KPU A;  3H7B A;  5IRO A;  2VAA A;  4PRB A;  3L3I A;  3LKR A;  3TN0 A;  3KYN A;  4Y4K A;  5JHD A;  4MJ6 A;  4V3D B;  1N2R A;  1KCG C;  1QVO A;  5E8N A;  3VFT A;  1DDH A;  3RZC A;  3CCH A;  1W0V A;  4WO4 A;  4ZUU A;  3HLA A;  4MX7 A;  1FZK A;  5J1A A;  4WWK C;  3MRI A;  5BJT A;  3RWI A;  2X4O A;  3MRP A;  5C07 A;  1MHC A;  2BSS A;  2FYY A;  3BP7 A;  3KYO A;  3GMO A;  4HS3 A;  1KPV A;  1I7U A;  4PJH A;  3VWJ A;  4LNR A;  3LKS A;  1B0R A;  5IB4 A;  1S7Q A;  5INC A;  3KPN A;  1UQS A;  3CH1 A;  4G59 A;  4HX1 A;  4PRP A;  3GMN A;  4QRU A;  4HUW A;  1FZM A;  1RK1 A;  2Q7Y A;  5J6H A;  1BQH A;  3GJF A;  4L4T A;  5C0J A;  3L3J A;  5IB3 A;  5MEQ A;  4PJA A;  1L8J A;  5E6I C;  3REW A;  1HHG A;  4PJG A;  3H9S A;  1RJY A;  4WJ5 A;  3E2H A;  5C9J A;  2CLV A;  3DXA A;  3IXA A;  2F53 A;  5D7J C;  1AGB A;  4JRY A;  3FQN A;  4UQ2 A;  3HE6 A;  3FQR A;  3FT3 A;  4HKJ A;  3L3G A;  2P5E A;  4ZUV A;  3E6F A;  3BP4 A;  5H94 A;  3DMM A;  3FRU A;  4U1N A;  2CKB H;  4HUV A;  4NO5 A;  2HLA A;  1HHH A;  3LN4 A;  3MRK A;  4U6Y A;  4WUU A;  1LD9 A;  5C0D A;  5C0G A;  5IM7 A;  4L8B A;  5HHM A;  5ENW A;  5IB5 A;  1S7W A;  3OX8 A;  2HN7 A;  2AV7 A;  3GSR A;  1OF2 A;  3FOL A;  1HHJ A;  4O2E A;  1DUZ A;  4E5X A;  3VXS A;  4Y2D A;  3CDG A;  4PJ9 A;  5L2K A;  3WUW A;  1ZT7 A;  4X6C A;  1OGA A;  2F54 A;  4L3E A;  2BVO A;  2GUO A;  4ZFZ A;  3SDX A;  1YPZ A;  4NNY A;  5IB1 A;  3PWV A;  3JTT A;  1ZHK A;  3H9H A;  3VRJ A;  1T7Y A;  1AGF A;  3BZF A;  2PYE A;  4F7P A;  3MV7 A;  3U0P A;  1LEK A;  3P73 A;  3SCM A;  5F1N A;  3DTX A;  3ECB A;  4PGD A;  2ZOL A;  4HV8 A;  5FDW A;  3FFC A;  3MRE A;  4G9F A;  3TO4 A;  3GML A;  2VLR A;  3TBW A;  4L8C A;  3MRQ A;  3VFR A;  5HHO A;  4QRS A;  2YPL A;  1YN6 A;  3M1B A;  4L8D A;  4PRD A;  1S7V A;  1CE6 A;  3FOM A;  1FO0 H;  4Z78 A;  1MWA H;  1T1Z A;  3MV9 A;  2YPK A;  5AD0 A;  2AV1 A;  3BW9 A;  1S7U A;  1ZHN A;  4QRT A;  3QUY A;  1OSZ A;  1FZJ A;  4NHU E;  2GAZ A;  3VCL A;  3P4M A;  3GSO A;  4PJC A;  1S7R A;  3VXR A;  4F7M A;  3PWL A;  4JQX A;  3NFN A;  5E8O A;  1KTL A;  3KPS A;  1VAC A;  3HUJ A;  4NQC A;  5EO0 A;  5MER A;  3LKQ A;  4EI5 A;  1I1Y A;  1A1O A;  3KPM A;  1JGD A;  3ARE A;  1TVB A;  3P4N A;  3DX7 A;  3MRH A;  1S7X A;  5HHQ A;  3D39 A;  3HE7 A;  2ZSV A;  1DUY A;  4JFQ A;  3QDM A;  3RWD A;  2CLR A;  3GSU A;  5E9D A;  1QQD A;  3BH9 A;  4GKN A;  3UTS A;  1MHE A;  3L9R A;  3VH8 A;  4NQX A;  1YDP A;  3BEV A;  4WDI A;  4EN3 C;  3KXF A;  1S9W A;  1JPF A;  1MI5 A;  3MRM A;  3QDG A;  3O3E A;  4ZUS A;  4MQ7 A;  3LN5 A;  4Y4F A;  4PJ8 A;  3FQT A;  1M6O A;  1VAD A;  2X4P A;  1N3N A;  1FFN A;  3X11 A;  1ONQ A;  5MEP A;  2CII A;  1BII A;  3QUX A;  2VLL A;  4LCY A;  4NO3 A;  1LEG A;  4QOK A;  3RWJ A;  3ARD A;  3CZF A;  1FG2 A;  3ES6 A;  1XZ0 A;  2HJL A;  3MA7 A;  3SDC A;  3MRR A;  5HGB A;  1QR1 A;  1DE4 A;  4NSK A;  4U1K A;  3QQ3 A;  1S8D A;  2GTZ A;  4IRJ A;  4NNX A;  3BO8 A;  3FT2 A;  1A1M A;  1KJ2 H;  5BS0 A;  3UBX A;  1AGE A;  4XXC A;  2DYP A;  1I1A A;  3MV8 A;  2JCC A;  4ZAK A;  3BZE A;  3X14 A;  3TZV C;  3VXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...