1JFMA

Crystal structure of murine nk cell ligand rae-1 beta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
DAHSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINKTMTSGDPGETANATEVKKCLTQPLKNLCQKLRNKVSNTKVDTHKTNGYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQSKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords retinoic acid early transcript beta
total genus 41
structure length 174
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jfmA00
1W72A 5L2JA 3MRJA 2D31A 4L4TA 1G6RH 3DX6A 3RUGA 3L3KA 2VLRA 3O3EA 4HUUA 3RWFA 3H9HA 2FZ3A 1JF1A 3GSVA 1Q94A 4NHUE 3TZVC 3GJFA 5IEKA 1FZKA 1VADA 4GKNA 5GSRA 3PQYA 1LK2A 2MHAA 4LCYA 5GSVA 2FYYA 3V5DA 1TMCA 1EXUA 1T1XA 1P1ZA 2H26A 4IRJA 3QEQA 4PRBA 1KJ2H 3BO8A 3FQNA 3L3IA 3P9MA 5C0IA 3ERYA 2X4QA 3M17A 3ARFA 3FT4A 4N0UA 4PG9A 2BVOA 1DE4A 2WY3A 1P7QA 3PWLA 4NQEA 1T7ZA 1VGKA 1KPRA 4E5XA 1PQZA 1LDPH 2HN7A 3E2HA 3O8XA 1T20A 4PJDA 3BEVA 4G8GA 5EU3A 3TBYA 1T0NA 3T8XA 3WS6A 1HYRC 4X6FA 5IM7A 4PGBA 3FQUA 3T1FA 4HKJA 3MRCA 3RWJA 1VACA 4MNGA 3TO4A 3MR9A 2F53A 4E0RA 2YPKA 3KXFA 4ZUUA 4JQVA 3GSXA 4F7EA 3DXAA 4EI5A 4MJIA 4PJGA 5EU4A 4HUWA 4F7MA 3QQ3A 1YPZA 4IHOA 3MGTA 4PGEA 5F7DA 5F1NA 3VFVA 4Z77A 3TN0A 5EUOA 5C0AA 1FZMA 3X12A 1AGCA 4PJ8A 5C9JA 3O3AA 4PG2A 3CCHA 3MA7A 4Z76A 3GMOA 4WWKC 3KYOA 3VCLA 5ACZA 1S9WA 3QUXA 4PJ9A 4PJAA 4L8BA 3H9SA 1G7PA 1NEZA 3WLBA 1ZHKA 2HJLA 4K71B 3GSWA 3UTSA 1IM3A 3BZFA 3HAEA 3TVMA 2GAZA 3I6KA 2OI9A 1S7XA 1UXSA 4F7PA 4G43A 4CVXA 3GMQA 4PGCA 1EEZA 4HS3A 4JFFA 3MROA 4WW2C 4ZUVA 5IVXA 3BH9A 3LKPA 1ZAGA 1DUYA 1W0WA 5E00A 1ED3A 3WL9A 3PABA 3TBSA 4X6DA 3TA3A 3MRKA 1HHHA 2X4UA 3LV3A 3GMPA 1S9XA 5INCA 3TBVA 3V5KA 4PRNA 3QDJA 3FQRA 1S7WA 5FKPA 4IIQC 3VFSA 3LN4A 2VLJA 3KLAA 3L3GA 4L8SC 2XPGA 3KPRA 4L9LC 3QDMA 1EFXA 3X14A 3BW9A 3W39A 1GZPA 5SWZA 1MWAH 5D9SA 3BHBA 4NO5A 5BJTA 2DYPA 3GSRA 3H7BA 4L4VA 5D7JC 2V2XA 4ONOA 3SKOA 1I4FA 3DX8A 3SPVA 4PJBA 5HYJA 3I6GA 4MX7A 4V3EB 3ES6A 2X4PA 4NO2A 1JUFA 2BVPA 1B0GA 2ESVA 3KPNA 1ZHLA 1GZQA 1YN7A 1AGEA 5IB3A 3HE6A 1JHTA 3SCMA 3SJVA 1QEWA 2FO4A 4HUVA 4ZFZA 4LCCC 5C07A 3FFCA 3S6CA 3BP4A 4HV8A 1JGDA 1UXWA 2FIKA 4G9FA 5E8PA 1ZSDA 5C0CA 3D2UA 1LEKA 1JPFA 3ROOA 1MHCA 3VRJA 3VXNA 3L9RA 1AGFA 1T7VA 1INQA 3LKRA 3MRIA 3P9LA 1S7QA 3GMLA 4XXCA 3GSUA 3JTCA 3JVGA 4JFQA 2BSTA 4Y4FA 5EU6A 5H94A 3SDDA 3D18A 3D3VA 4U1IA 1FZOA 1A1OA 3GIVA 5EFIA 4QOKA 1CG9A 2BNRA 2AXFA 2ZOKA 5C0BA 3QI9A 5EO1A 3LKOA 4U6XA 5HHOA 4Y4KA 1LP9A 1RK0A 2J8UA 4IRSA 4PRAA 5IB4A 4JRYA 1OGAA 3DMMA 5HHMA 2GJ6A 4LHUA 5HGHA 1IM9A 4EUPA 4LCWA 3OXSA 2CLVA 5BS0A 4NQXA 1AGBA 3QULA 5L2KA 3MV7A 1N5AA 5MEPA 3E6HA 3ILQC 4MJ6A 4PGDA 3WS3A 3P73A 4PRIA 3KPSA 1QSFA 3QFJA 4QRSA 1JFMA 1SYVA 3O3DA 3OV6A 3VFRA 3CVHA 1I1YA 3L3HA 2UWEA 4WU5A 1A9BA 5D2NA 3ECBA 1OGTA 1ONQA 2CKBH 5F1IA 1DUZA 1FFOA 1CD1A 1R3HA 3VFUA 3X11A 3FT2A 5ENWA 5D5MA 2FWOA 3GMNA 2GTZA 1NANH 3SDAA 2E7LE 3KYNA 1JGEA 2VABA 3MRGA 3MRQA 3TO2A 1QSEA 1RJYA 1ZVSA 2NW3A 1AGDA 2BVQA 5EU5A 1YDPA 3IXAA 5FA4A 5C0FA 5DDHA 3AREA 3HLAA 4PJFA 3TFKA 1HSAA 5C0JA 1E28A 4PJHA 5EOTA 4MXQA 3D39A 1I1FA 4ZUTA 4FTVA 5FA3A 3MRPA 4NSKA 1E27A 4NT6A 2AV1A 4NNXA 4EN3C 4L8DA 5C0GA 5HHQA 1P4LA 4G42A 4PJXA 1X7QA 3AU1A 1UQSA 1HHKA 1HHIA 3CZFA 2V2WA 2X4OA 2VAAA 3HUJA 3ARGA 4N5EA 4S0UC 1N2RA 4NO3A 3MV9A 3CPLA 2CLZA 2OL3H 3GSOA 4WUUA 3BZEA 1T1ZA 1AO7A 1A6ZA 4JFPA 2GUOA 4PR5A 2RFXA 3MRHA 4I4WA 2AXGA 1QLFA 4HWZA 2AKRA 2AK4A 2H6PA 3VXUA 3VXOA 1A1NA 5E8OA 3KWWA 4NO0A 3KPQA 1EEYA 4HUXA 5HGDA 3CDGA 3JTTA 3PWUA 1T80A 2A83A 5FDWA 1KTLA 3RWCA 1S8DA 4G9DA 3UBXA 1BQHA 1T22A 1HHJA 3LKSA 3RWIA 3WUWA 5MERA 4U1NA 1TVBA 4JRXA 2HLAA 4MVBA 5E8NA 3KPPA 5D7IA 1S7TA 4HX1A 3RWEA 1LD9A 3RL1A 5D7LA 1XZ0A 3VWKA 1T7XA 1B3JA 3MRMA 3VFMA 4O2CA 4O2EA 3CH1A 2HJKA 1WBXA 3KPOA 3TIEA 1XR8A 3VWJA 1T0MA 3BP7A 3FRUA 3ILPA 4JQXA 5SWSA 3RWDA 3SDCA 4PJ5A 5SWQA 3VH8A 5EO0A 3VFOA 1YN6A 3MRDA 1C16A 5IB5A 1FFPA 1L8JA 1W0VA 2GT9A 3FQWA 3KPMA 1ZS8A 4QRPA 5E6IC 5ISZA 1U58A 2F74A 3MRBA 1FG2A 3FT3A 4NNYA 4U1MA 3P4MA 4D0DA 1S7RA 3VFWA 5D2LA 1LQVA 3BGMA 3HG1A 4PRDA 1A1MA 3E3QA 1G7QA 3UPRA 2X4TA 4PDCE 3B3IA 1ZT4A 3V5HA 1KPUA 1B0RA 1ZHNA 2CLRA 3FONA 4MS8A 4Y16A 3I6LD 2ZOLA 1TVHA 1MI5A 5IB1A 3VRIA 3O9WA 2X4SA 4U1LA 5C09A 4L3EA 2GTWA 3ROLA 4Y4HA 5MENA 2X4RA 3TJHA 1QVOA 2VE6A 3QDGA 1HSBA 3MREA 3QQ4A 3QUKA 2VLKA 4PJEA 4N8VA 3RGVC 4WU7A 4QRQA 3VJ6A 2XFXA 4D0CA 5IEHA 4ZUSA 4L8CA 1RJZA 4MJ5A 2YPLA 3BXNA 4NQCA 3VFTA 1K8DA 2ZSWA 2X4NA 4WO4A 3FOLA 3OXRA 4N0FA 2ZSVA 3CC5A 4PV9A 4UQ2A 3ARBA 3VXMA 1T7YA 3QZWA 1N3NA 5J1AA 4MNQA 4PRHA 1A9EA 3GMMA 5C0EA 4WDIA 5MEOA 4QRUA 3P77A 4X6EA 5E9DA 5HGBA 1KJMA 4L3CA 4X6CA 2BCKA 3VFPA 1I1AA 1BIIA 3JTSA 4U1HA 3UTTA 4PRPA 5AD0A 4N0CA 4PJCA 5IB2A 1BZ9A 1KBGH 1KPVA 3GMRA 4NQVA 5C0DA 5F9JA 1QO3A 3TBWA 2BSSA 1XR9A 2CIIA 1RK1A 5J6GA 4U6YA 3REWA 3MRLA 5IROA 3TBTA 4CW1A 5HGAA 1OF2A 4O2FA 1T1WA 5B39A 5BRZA 4WJ5A 4K7FA 2YEZA 4ZUWA 1KCGC 3BEWA 4MQ7A 1I7RA 1JPGA 3VXRA 1K5NA 3GSNH 2C7UA 3ARDA 3TIDA 5HHPA 2JCCA 1T1YA 2PO6A 1JE6A 3OX8A 4L29A 3RTQA 1N59A 4JFOA 3LN5A 3C8KA 2GITA 3VXSA 4G59A 3U0PA 1ZT1A 1S7VA 3PWPA 1T7WA 1LEGA 3RWHA 3QUYA 3NFNA 3HPJA 3VFNA 3W0WA 4F7TA 2PYEA 4PV8A 4QRRA 1FFNA 1FO0H 2P5EA 1XH3A 5MEQA 1ZHBA 3P4OA 5BXFA 5B38A 3PWJA 3RZCA 3MRFA 1FZJA 2Q7YA 3MV8A 3L3DA 1M6OA 3IT8D 3HE7A 1QQDA 3P4NA 2AV7A 1DDHA 3QUZA 1HHGA 5DEFA 3BH8A 3C9NA 3PWVA 3FQTA 4PJ7A 5HHNA 2VLLA 1S7UA 4Y2DA 3MRRA 2BNQA 3HCVA 1M05A 4FFEX 4CVZA 4ELMA 3DX7A 4V3DB 1T21A 4APQA 4GKSA 3RL2A 3RWGA 3E6FA 2NX5A 4G8IA 1HOCA 3VXPA 3UTQA 4F7CA 3LKQA 1BD2A 2F54A 4LNRA 5J6HA 4U1SA 4I48A 3B6SA 2X70A 1WBYA 1S9YA 1AKJA 4JFDA 1QR1A 4GUPA 1Z5LA 3DTXA 3G08A 5DEGA 3MRNA 1NAMH 3KPLA 4D0BA 3FOMA 3TF7A 3DBXA 5C08A 3AM8A 3BUYA 4UQ3A 4ZAKA 3O3BA 5JHDA 1SYSA 1WBZA 3QFDA 4JFEA 3X13A 3SDXA 1ZT7A 3PWNA 3MYJA 3FTGA 4PREA 3M1BA 3GSQA 2CIKA 3LKNA 1KJ3H 3L3JA 3BWAA 4U1JA 1QRNA 4U1KA 4PJIA 4QRTA 5INDA 3SKMA 3BVNA 4PP8C 2P5WA 2BSRA 1KJVA 4Z78A 3TPUE 1I7TA 1CE6A 1MHEA 1I7UA 3D25A 3MGOA 4NQDA 3FQXA 3O4LA 1OSZA 1S7SA
chains in the Genus database with same CATH superfamily
1W72A 5L2JA 3MRJA 2D31A 4L4TA 1G6RH 3DX6A 3RUGA 3L3KA 2VLRA 3O3EA 4HUUA 3RWFA 3H9HA 2FZ3A 1JF1A 3GSVA 1Q94A 4NHUE 3TZVC 3GJFA 5IEKA 1FZKA 1VADA 4GKNA 5GSRA 3PQYA 1LK2A 2MHAA 4LCYA 5GSVA 2FYYA 3V5DA 1TMCA 1EXUA 1T1XA 1P1ZA 2H26A 4IRJA 3QEQA 4PRBA 1KJ2H 3BO8A 2NYKA 3FQNA 3L3IA 3P9MA 5C0IA 3ERYA 2X4QA 3M17A 3ARFA 3FT4A 4N0UA 4PG9A 2BVOA 1DE4A 2WY3A 1P7QA 3PWLA 4NQEA 1T7ZA 1VGKA 1KPRA 4E5XA 1PQZA 1LDPH 2HN7A 3E2HA 3O8XA 1T20A 4PJDA 3BEVA 4G8GA 5EU3A 3TBYA 1T0NA 3T8XA 3WS6A 1HYRC 4X6FA 5IM7A 4PGBA 3FQUA 3T1FA 4HKJA 3MRCA 3RWJA 1VACA 4MNGA 3TO4A 3MR9A 2F53A 4E0RA 2YPKA 3KXFA 4ZUUA 4JQVA 3GSXA 4F7EA 3DXAA 4EI5A 4MJIA 4PJGA 5EU4A 4HUWA 4F7MA 3QQ3A 1YPZA 4IHOA 3MGTA 4PGEA 5F7DA 5F1NA 3VFVA 4Z77A 3TN0A 5EUOA 5C0AA 1FZMA 3X12A 1AGCA 4PJ8A 5C9JA 3O3AA 4PG2A 3CCHA 3MA7A 4Z76A 3GMOA 4WWKC 3KYOA 3VCLA 5ACZA 1S9WA 3QUXA 4PJ9A 4PJAA 4L8BA 3H9SA 1G7PA 1NEZA 3WLBA 1ZHKA 2HJLA 4K71B 3GSWA 3UTSA 1IM3A 3BZFA 3HAEA 3TVMA 2GAZA 3I6KA 2OI9A 1S7XA 1UXSA 4F7PA 4G43A 4CVXA 3GMQA 4PGCA 1EEZA 4HS3A 4JFFA 3MROA 4WW2C 4ZUVA 5IVXA 3BH9A 3LKPA 1ZAGA 1DUYA 1W0WA 5E00A 1ED3A 3WL9A 3PABA 3TBSA 4X6DA 3TA3A 3MRKA 1HHHA 2X4UA 3LV3A 3GMPA 1S9XA 5INCA 3TBVA 3V5KA 4PRNA 3QDJA 3FQRA 1S7WA 5FKPA 4IIQC 3VFSA 3LN4A 2VLJA 3KLAA 3L3GA 4L8SC 2XPGA 3KPRA 4L9LC 3QDMA 1EFXA 3X14A 3BW9A 3W39A 1GZPA 5SWZA 1MWAH 5D9SA 3BHBA 4NO5A 5BJTA 2DYPA 3GSRA 3H7BA 4L4VA 5D7JC 2V2XA 4ONOA 3SKOA 1I4FA 3DX8A 3SPVA 4PJBA 5HYJA 3I6GA 4MX7A 4V3EB 3ES6A 2X4PA 4NO2A 1JUFA 2BVPA 1B0GA 2ESVA 3KPNA 1ZHLA 1GZQA 1YN7A 1AGEA 5IB3A 3HE6A 1JHTA 3SCMA 3SJVA 1QEWA 2FO4A 4HUVA 4ZFZA 4LCCC 5C07A 3FFCA 3S6CA 3BP4A 4HV8A 1JGDA 1UXWA 2FIKA 4G9FA 5E8PA 1ZSDA 5C0CA 3D2UA 1LEKA 1JPFA 3ROOA 1MHCA 3VRJA 3VXNA 3L9RA 1AGFA 1T7VA 1INQA 3LKRA 3MRIA 3P9LA 1S7QA 3GMLA 4XXCA 3GSUA 3JTCA 3JVGA 4JFQA 2BSTA 4Y4FA 5EU6A 5H94A 3SDDA 3D18A 3D3VA 4U1IA 1FZOA 1A1OA 3GIVA 5EFIA 4QOKA 1CG9A 2BNRA 2AXFA 2ZOKA 5C0BA 3QI9A 5EO1A 3LKOA 4U6XA 5HHOA 4Y4KA 1LP9A 1RK0A 2IA1A 2J8UA 4IRSA 4PRAA 4JRYA 5IB4A 1OGAA 3DMMA 5HHMA 2GJ6A 4LHUA 5HGHA 1IM9A 4EUPA 4LCWA 3OXSA 2CLVA 5BS0A 4NQXA 3I0TA 1AGBA 3QULA 5L2KA 3MV7A 1N5AA 5MEPA 3E6HA 3ILQC 4MJ6A 4PGDA 3WS3A 3P73A 4PRIA 3KPSA 1QSFA 3QFJA 4QRSA 1JFMA 1SYVA 3O3DA 3OV6A 3VFRA 3CVHA 1I1YA 3L3HA 2UWEA 4WU5A 1A9BA 5D2NA 3ECBA 1OGTA 1ONQA 2CKBH 5F1IA 1DUZA 1FFOA 1CD1A 1R3HA 3VFUA 3X11A 3FT2A 5ENWA 5D5MA 2FWOA 3GMNA 2GTZA 1NANH 3SDAA 2E7LE 3KYNA 1JGEA 2VABA 3MRGA 3MRQA 3TO2A 1QSEA 1RJYA 1ZVSA 2NW3A 1AGDA 2BVQA 5EU5A 1YDPA 3IXAA 5FA4A 5C0FA 5DDHA 3AREA 3HLAA 4PJFA 3TFKA 1HSAA 5C0JA 1E28A 4PJHA 5EOTA 4MXQA 3D39A 1I1FA 4ZUTA 4FTVA 5FA3A 3MRPA 4NSKA 1E27A 4NT6A 2AV1A 4NNXA 4EN3C 4L8DA 5C0GA 5HHQA 1P4LA 4G42A 4PJXA 1X7QA 3AU1A 1UQSA 1HHKA 1HHIA 3CZFA 2V2WA 2X4OA 2VAAA 3HUJA 3ARGA 4N5EA 4S0UC 1N2RA 4NO3A 3MV9A 4JO8A 3CPLA 2CLZA 2OL3H 3GSOA 4WUUA 3BZEA 1T1ZA 1AO7A 1A6ZA 4JFPA 2GUOA 4PR5A 2RFXA 3MRHA 4I4WA 2AXGA 1QLFA 4HWZA 2AKRA 2AK4A 2H6PA 3VXUA 3VXOA 1A1NA 5E8OA 3KWWA 4G59C 4NO0A 3KPQA 1EEYA 4HUXA 5HGDA 3CDGA 3JTTA 3PWUA 1T80A 2A83A 5FDWA 1KTLA 3RWCA 1S8DA 4G9DA 3UBXA 1BQHA 1T22A 1HHJA 3LKSA 3RWIA 3WUWA 5MERA 4U1NA 1TVBA 4JRXA 2HLAA 4MVBA 5E8NA 3KPPA 5D7IA 1S7TA 4HX1A 3RWEA 1LD9A 3RL1A 5D7LA 1XZ0A 3VWKA 1T7XA 1B3JA 3MRMA 3VFMA 4O2CA 4O2EA 3CH1A 2HJKA 1WBXA 3KPOA 3TIEA 1XR8A 3VWJA 1T0MA 3BP7A 3FRUA 3ILPA 4JQXA 5SWSA 3RWDA 3SDCA 4PJ5A 5SWQA 3VH8A 5EO0A 3VFOA 1YN6A 3MRDA 1C16A 5IB5A 1FFPA 1L8JA 1W0VA 2GT9A 3FQWA 3KPMA 1ZS8A 4QRPA 5E6IC 5ISZA 1U58A 2F74A 3MRBA 1FG2A 3FT3A 4NNYA 4U1MA 3P4MA 4D0DA 1S7RA 3VFWA 5D2LA 1LQVA 3BGMA 3HG1A 4PRDA 1A1MA 3E3QA 1G7QA 3UPRA 2X4TA 4PDCE 3B3IA 1ZT4A 3V5HA 1KPUA 1B0RA 1ZHNA 2CLRA 3FONA 4MS8A 4Y16A 3I6LD 2ZOLA 1TVHA 1MI5A 5IB1A 3VRIA 3O9WA 2X4SA 4U1LA 5C09A 4L3EA 2GTWA 3ROLA 4Y4HA 5MENA 2X4RA 3TJHA 1QVOA 2VE6A 3QDGA 1HSBA 3MREA 3QQ4A 3QUKA 2VLKA 4PJEA 4N8VA 3RGVC 4WU7A 4QRQA 3VJ6A 2XFXA 4D0CA 5IEHA 4ZUSA 4L8CA 1RJZA 4MJ5A 2YPLA 3BXNA 4NQCA 3VFTA 1K8DA 2ZSWA 2X4NA 4WO4A 3FOLA 3OXRA 4N0FA 2ZSVA 3CC5A 4PV9A 4UQ2A 3ARBA 3VXMA 1T7YA 3QZWA 1N3NA 5J1AA 4MNQA 4PRHA 1A9EA 3GMMA 5C0EA 4WDIA 5MEOA 4QRUA 3P77A 4X6EA 5E9DA 5HGBA 1KJMA 4L3CA 4X6CA 4BKWA 2BCKA 3VFPA 1I1AA 1BIIA 3JTSA 4U1HA 3UTTA 4PRPA 5AD0A 4N0CA 4PJCA 5IB2A 1BZ9A 1KBGH 1KPVA 3GMRA 4NQVA 5C0DA 5F9JA 1QO3A 3TBWA 2BSSA 1XR9A 2CIIA 1RK1A 5J6GA 4U6YA 3REWA 3MRLA 5IROA 3TBTA 4CW1A 5HGAA 1OF2A 4O2FA 1T1WA 5B39A 5BRZA 4WJ5A 4K7FA 2YEZA 4ZUWA 1KCGC 3BEWA 4MQ7A 1I7RA 1JPGA 3VXRA 1K5NA 3GSNH 2C7UA 3ARDA 3TIDA 5HHPA 2JCCA 1T1YA 2PO6A 1JE6A 3OX8A 4L29A 3RTQA 1N59A 4JFOA 2O5NA 3LN5A 3C8KA 2GITA 3VXSA 4G59A 3U0PA 1ZT1A 1S7VA 3PWPA 1T7WA 1LEGA 3RWHA 3QUYA 3NFNA 3HPJA 3VFNA 3W0WA 4F7TA 2PYEA 4PV8A 4QRRA 1FFNA 1FO0H 2P5EA 1XH3A 5MEQA 1ZHBA 3P4OA 5BXFA 5B38A 3PWJA 3RZCA 3MRFA 1FZJA 2Q7YA 3MV8A 3L3DA 1M6OA 3IT8D 3HE7A 1QQDA 3P4NA 2AV7A 1DDHA 3QUZA 1HHGA 5DEFA 3BH8A 3C9NA 3PWVA 3FQTA 4PJ7A 5HHNA 2VLLA 1S7UA 4Y2DA 3MRRA 2BNQA 3HCVA 1M05A 4FFEX 4CVZA 4ELMA 3DX7A 4V3DB 1T21A 4APQA 4GKSA 3RL2A 3RWGA 3E6FA 2NX5A 4G8IA 1HOCA 3VXPA 3UTQA 4F7CA 3LKQA 1BD2A 2F54A 4LNRA 5J6HA 4U1SA 4I48A 3B6SA 2X70A 1WBYA 1S9YA 1AKJA 4JFDA 1QR1A 4GUPA 1Z5LA 3DTXA 3G08A 5DEGA 3MRNA 1NAMH 3KPLA 4D0BA 3FOMA 3TF7A 3DBXA 5C08A 3AM8A 3BUYA 4UQ3A 4ZAKA 3O3BA 5JHDA 1SYSA 1WBZA 3QFDA 4JFEA 3X13A 3SDXA 1ZT7A 3PWNA 3MYJA 3FTGA 4PREA 3M1BA 3GSQA 2CIKA 3LKNA 1KJ3H 3L3JA 3BWAA 4U1JA 1QRNA 4U1KA 4PJIA 4QRTA 5INDA 3SKMA 3BVNA 4PP8C 2P5WA 2BSRA 1KJVA 4Z78A 3TPUE 1I7TA 1CE6A 1MHEA 1I7UA 3D25A 3MGOA 4NQDA 3FQXA 3O4LA 1OSZA 1S7SA
chains in the Genus database with same CATH topology
1W72A 5L2JA 3MRJA 2D31A 4L4TA 1G6RH 3DX6A 3RUGA 3L3KA 2VLRA 3O3EA 4HUUA 3RWFA 3H9HA 2FZ3A 1JF1A 3GSVA 1Q94A 4NHUE 3TZVC 3GJFA 5IEKA 1FZKA 1VADA 4GKNA 5GSRA 3PQYA 1LK2A 2MHAA 4LCYA 5GSVA 2FYYA 3V5DA 1TMCA 1EXUA 1T1XA 1P1ZA 2H26A 4IRJA 3QEQA 4PRBA 1KJ2H 3BO8A 3FQNA 3L3IA 3P9MA 5C0IA 3ERYA 2X4QA 3M17A 3ARFA 3FT4A 4N0UA 4PG9A 2BVOA 1DE4A 2WY3A 1P7QA 3PWLA 4NQEA 1T7ZA 1VGKA 1KPRA 4E5XA 1PQZA 1LDPH 2HN7A 3E2HA 3O8XA 1T20A 4PJDA 3BEVA 4G8GA 5EU3A 3TBYA 1T0NA 3T8XA 3WS6A 1HYRC 4X6FA 5IM7A 4PGBA 3FQUA 3T1FA 4HKJA 3MRCA 3RWJA 1VACA 4MNGA 3TO4A 3MR9A 2F53A 4E0RA 2YPKA 3KXFA 4ZUUA 4JQVA 3GSXA 4F7EA 3DXAA 4EI5A 4MJIA 4PJGA 5EU4A 4HUWA 4F7MA 3QQ3A 1YPZA 4IHOA 3MGTA 4PGEA 5F7DA 5F1NA 3VFVA 4Z77A 3TN0A 5EUOA 5C0AA 1FZMA 3X12A 1AGCA 4PJ8A 5C9JA 3O3AA 4PG2A 3CCHA 3MA7A 4Z76A 3GMOA 4WWKC 3KYOA 3VCLA 5ACZA 1S9WA 3QUXA 4PJ9A 4PJAA 4L8BA 3H9SA 1G7PA 1NEZA 3WLBA 1ZHKA 2HJLA 4K71B 3GSWA 3UTSA 1IM3A 3BZFA 3HAEA 3TVMA 2GAZA 3I6KA 2OI9A 1S7XA 1UXSA 4F7PA 4G43A 4CVXA 3GMQA 4PGCA 1EEZA 4HS3A 4JFFA 3MROA 4WW2C 4ZUVA 5IVXA 3BH9A 3LKPA 1ZAGA 1DUYA 1W0WA 5E00A 1ED3A 3WL9A 3PABA 3TBSA 4X6DA 3TA3A 3MRKA 1HHHA 2X4UA 3LV3A 3GMPA 1S9XA 5INCA 3TBVA 3V5KA 4PRNA 3QDJA 3FQRA 1S7WA 5FKPA 4IIQC 3VFSA 3LN4A 2VLJA 3KLAA 3L3GA 4L8SC 2XPGA 3KPRA 4L9LC 3QDMA 1EFXA 3X14A 3BW9A 3W39A 1GZPA 5SWZA 1MWAH 5D9SA 3BHBA 4NO5A 5BJTA 2DYPA 3GSRA 3H7BA 4L4VA 5D7JC 2V2XA 4ONOA 3SKOA 1I4FA 3DX8A 3SPVA 4PJBA 5HYJA 3I6GA 4MX7A 4V3EB 3ES6A 2X4PA 4NO2A 1JUFA 2BVPA 1B0GA 2ESVA 3KPNA 1ZHLA 1GZQA 1YN7A 1AGEA 5IB3A 3HE6A 1JHTA 3SCMA 3SJVA 1QEWA 2FO4A 4HUVA 4ZFZA 4LCCC 5C07A 3FFCA 3S6CA 3BP4A 4HV8A 1JGDA 1UXWA 2FIKA 4G9FA 5E8PA 1ZSDA 5C0CA 3D2UA 1LEKA 1JPFA 3ROOA 1MHCA 3VRJA 3VXNA 3L9RA 1AGFA 1T7VA 1INQA 3LKRA 3MRIA 3P9LA 1S7QA 3GMLA 4XXCA 3GSUA 3JTCA 3JVGA 4JFQA 2BSTA 4Y4FA 5EU6A 5H94A 3SDDA 3D18A 3D3VA 4U1IA 1FZOA 1A1OA 3GIVA 5EFIA 4QOKA 1CG9A 2BNRA 2AXFA 2ZOKA 5C0BA 3QI9A 5EO1A 3LKOA 4U6XA 5HHOA 4Y4KA 1LP9A 1RK0A 2J8UA 4IRSA 4PRAA 5IB4A 4JRYA 1OGAA 3DMMA 5HHMA 2GJ6A 4LHUA 5HGHA 1IM9A 4EUPA 4LCWA 3OXSA 2CLVA 5BS0A 4NQXA 1AGBA 3QULA 5L2KA 3MV7A 1N5AA 5MEPA 3E6HA 3ILQC 4MJ6A 4PGDA 3WS3A 3P73A 4PRIA 3KPSA 1QSFA 3QFJA 4QRSA 1JFMA 1SYVA 3O3DA 3OV6A 3VFRA 3CVHA 1I1YA 3L3HA 2UWEA 4WU5A 1A9BA 5D2NA 3ECBA 1OGTA 1ONQA 2CKBH 5F1IA 1DUZA 1FFOA 1CD1A 1R3HA 3VFUA 3X11A 3FT2A 5ENWA 5D5MA 2FWOA 3GMNA 2GTZA 1NANH 3SDAA 2E7LE 3KYNA 1JGEA 2VABA 3MRGA 3MRQA 3TO2A 1QSEA 1RJYA 1ZVSA 2NW3A 1AGDA 2BVQA 5EU5A 1YDPA 3IXAA 5FA4A 5C0FA 5DDHA 3AREA 3HLAA 4PJFA 3TFKA 1HSAA 5C0JA 1E28A 4PJHA 5EOTA 4MXQA 3D39A 1I1FA 4ZUTA 4FTVA 5FA3A 3MRPA 4NSKA 1E27A 4NT6A 2AV1A 4NNXA 4EN3C 4L8DA 5C0GA 5HHQA 1P4LA 4G42A 4PJXA 1X7QA 3AU1A 1UQSA 1HHKA 1HHIA 3CZFA 2V2WA 2X4OA 2VAAA 3HUJA 3ARGA 4N5EA 4S0UC 1N2RA 4NO3A 3MV9A 3CPLA 2CLZA 2OL3H 3GSOA 4WUUA 3BZEA 1T1ZA 1AO7A 1A6ZA 4JFPA 2GUOA 4PR5A 2RFXA 3MRHA 4I4WA 2AXGA 1QLFA 4HWZA 2AKRA 2AK4A 2H6PA 3VXUA 3VXOA 1A1NA 5E8OA 3KWWA 4NO0A 3KPQA 1EEYA 4HUXA 5HGDA 3CDGA 3JTTA 3PWUA 1T80A 2A83A 5FDWA 1KTLA 3RWCA 1S8DA 4G9DA 3UBXA 1BQHA 1T22A 1HHJA 3LKSA 3RWIA 3WUWA 5MERA 4U1NA 1TVBA 4JRXA 2HLAA 4MVBA 5E8NA 3KPPA 5D7IA 1S7TA 4HX1A 3RWEA 1LD9A 3RL1A 5D7LA 1XZ0A 3VWKA 1T7XA 1B3JA 3MRMA 3VFMA 4O2CA 4O2EA 3CH1A 2HJKA 1WBXA 3KPOA 3TIEA 1XR8A 3VWJA 1T0MA 3BP7A 3FRUA 3ILPA 4JQXA 5SWSA 3RWDA 3SDCA 4PJ5A 5SWQA 3VH8A 5EO0A 3VFOA 1YN6A 3MRDA 1C16A 5IB5A 1FFPA 1L8JA 1W0VA 2GT9A 3FQWA 3KPMA 1ZS8A 4QRPA 5E6IC 5ISZA 1U58A 2F74A 3MRBA 1FG2A 3FT3A 4NNYA 4U1MA 3P4MA 4D0DA 1S7RA 3VFWA 5D2LA 1LQVA 3BGMA 3HG1A 4PRDA 1A1MA 3E3QA 1G7QA 3UPRA 2X4TA 4PDCE 3B3IA 1ZT4A 3V5HA 1KPUA 1B0RA 1ZHNA 2CLRA 3FONA 4MS8A 4Y16A 3I6LD 2ZOLA 1TVHA 1MI5A 5IB1A 3VRIA 3O9WA 2X4SA 4U1LA 5C09A 4L3EA 2GTWA 3ROLA 4Y4HA 5MENA 2X4RA 3TJHA 1QVOA 2VE6A 3QDGA 1HSBA 3MREA 3QQ4A 3QUKA 2VLKA 4PJEA 4N8VA 3RGVC 4WU7A 4QRQA 3VJ6A 2XFXA 4D0CA 5IEHA 4ZUSA 4L8CA 1RJZA 4MJ5A 2YPLA 3BXNA 4NQCA 3VFTA 1K8DA 2ZSWA 2X4NA 4WO4A 3FOLA 3OXRA 4N0FA 2ZSVA 3CC5A 4PV9A 4UQ2A 3ARBA 3VXMA 1T7YA 3QZWA 1N3NA 5J1AA 4MNQA 4PRHA 1A9EA 3GMMA 5C0EA 4WDIA 5MEOA 4QRUA 3P77A 4X6EA 5E9DA 5HGBA 1KJMA 4L3CA 4X6CA 2BCKA 3VFPA 1I1AA 1BIIA 3JTSA 4U1HA 3UTTA 4PRPA 5AD0A 4N0CA 4PJCA 5IB2A 1BZ9A 1KBGH 1KPVA 3GMRA 4NQVA 5C0DA 5F9JA 1QO3A 3TBWA 2BSSA 1XR9A 2CIIA 1RK1A 5J6GA 4U6YA 3REWA 3MRLA 5IROA 3TBTA 4CW1A 5HGAA 1OF2A 4O2FA 1T1WA 5B39A 5BRZA 4WJ5A 4K7FA 2YEZA 4ZUWA 1KCGC 3BEWA 4MQ7A 1I7RA 1JPGA 3VXRA 1K5NA 3GSNH 2C7UA 3ARDA 3TIDA 5HHPA 2JCCA 1T1YA 2PO6A 1JE6A 3OX8A 4L29A 3RTQA 1N59A 4JFOA 3LN5A 3C8KA 2GITA 3VXSA 4G59A 3U0PA 1ZT1A 1S7VA 3PWPA 1T7WA 1LEGA 3RWHA 3QUYA 3NFNA 3HPJA 3VFNA 3W0WA 4F7TA 2PYEA 4PV8A 4QRRA 1FFNA 1FO0H 2P5EA 1XH3A 5MEQA 1ZHBA 3P4OA 5BXFA 5B38A 3PWJA 3RZCA 3MRFA 1FZJA 2Q7YA 3MV8A 3L3DA 1M6OA 3IT8D 3HE7A 1QQDA 3P4NA 2AV7A 1DDHA 3QUZA 1HHGA 5DEFA 3BH8A 3C9NA 3PWVA 3FQTA 4PJ7A 5HHNA 2VLLA 1S7UA 4Y2DA 3MRRA 2BNQA 3HCVA 1M05A 4FFEX 4CVZA 4ELMA 3DX7A 4V3DB 1T21A 4APQA 4GKSA 3RL2A 3RWGA 3E6FA 2NX5A 4G8IA 1HOCA 3VXPA 3UTQA 4F7CA 3LKQA 1BD2A 2F54A 4LNRA 5J6HA 4U1SA 4I48A 3B6SA 2X70A 1WBYA 1S9YA 1AKJA 4JFDA 1QR1A 4GUPA 1Z5LA 3DTXA 3G08A 5DEGA 3MRNA 1NAMH 3KPLA 4D0BA 3FOMA 3TF7A 3DBXA 5C08A 3AM8A 3BUYA 4UQ3A 4ZAKA 3O3BA 5JHDA 1SYSA 1WBZA 3QFDA 4JFEA 3X13A 3SDXA 1ZT7A 3PWNA 3MYJA 3FTGA 4PREA 3M1BA 3GSQA 2CIKA 3LKNA 1KJ3H 3L3JA 3BWAA 4U1JA 1QRNA 4U1KA 4PJIA 4QRTA 5INDA 3SKMA 3BVNA 4PP8C 2P5WA 2BSRA 1KJVA 4Z78A 3TPUE 1I7TA 1CE6A 1MHEA 1I7UA 3D25A 3MGOA 4NQDA 3FQXA 3O4LA 1OSZA 1S7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W72 A;  5L2J A;  3MRJ A;  2D31 A;  4L4T A;  1G6R H;  3DX6 A;  3RUG A;  3L3K A;  2VLR A;  3O3E A;  4HUU A;  3RWF A;  3H9H A;  2FZ3 A;  1JF1 A;  3GSV A;  1Q94 A;  4NHU E;  3TZV C;  3GJF A;  5IEK A;  1FZK A;  1VAD A;  4GKN A;  5GSR A;  3PQY A;  1LK2 A;  2MHA A;  4LCY A;  5GSV A;  2FYY A;  3V5D A;  1TMC A;  1EXU A;  1T1X A;  1P1Z A;  2H26 A;  4IRJ A;  3QEQ A;  4PRB A;  1KJ2 H;  3BO8 A;  3FQN A;  3L3I A;  3P9M A;  5C0I A;  3ERY A;  2X4Q A;  3M17 A;  3ARF A;  3FT4 A;  4N0U A;  4PG9 A;  2BVO A;  1DE4 A;  2WY3 A;  1P7Q A;  3PWL A;  4NQE A;  1T7Z A;  1VGK A;  1KPR A;  4E5X A;  1PQZ A;  1LDP H;  2HN7 A;  3E2H A;  3O8X A;  1T20 A;  4PJD A;  3BEV A;  4G8G A;  5EU3 A;  3TBY A;  1T0N A;  3T8X A;  3WS6 A;  1HYR C;  4X6F A;  5IM7 A;  4PGB A;  3FQU A;  3T1F A;  4HKJ A;  3MRC A;  3RWJ A;  1VAC A;  4MNG A;  3TO4 A;  3MR9 A;  2F53 A;  4E0R A;  2YPK A;  3KXF A;  4ZUU A;  4JQV A;  3GSX A;  4F7E A;  3DXA A;  4EI5 A;  4MJI A;  4PJG A;  5EU4 A;  4HUW A;  4F7M A;  3QQ3 A;  1YPZ A;  4IHO A;  3MGT A;  4PGE A;  5F7D A;  5F1N A;  3VFV A;  4Z77 A;  3TN0 A;  5EUO A;  5C0A A;  1FZM A;  3X12 A;  1AGC A;  4PJ8 A;  5C9J A;  3O3A A;  4PG2 A;  3CCH A;  3MA7 A;  4Z76 A;  3GMO A;  4WWK C;  3KYO A;  3VCL A;  5ACZ A;  1S9W A;  3QUX A;  4PJ9 A;  4PJA A;  4L8B A;  3H9S A;  1G7P A;  1NEZ A;  3WLB A;  1ZHK A;  2HJL A;  4K71 B;  3GSW A;  3UTS A;  1IM3 A;  3BZF A;  3HAE A;  3TVM A;  2GAZ A;  3I6K A;  2OI9 A;  1S7X A;  1UXS A;  4F7P A;  4G43 A;  4CVX A;  3GMQ A;  4PGC A;  1EEZ A;  4HS3 A;  4JFF A;  3MRO A;  4WW2 C;  4ZUV A;  5IVX A;  3BH9 A;  3LKP A;  1ZAG A;  1DUY A;  1W0W A;  5E00 A;  1ED3 A;  3WL9 A;  3PAB A;  3TBS A;  4X6D A;  3TA3 A;  3MRK A;  1HHH A;  2X4U A;  3LV3 A;  3GMP A;  1S9X A;  5INC A;  3TBV A;  3V5K A;  4PRN A;  3QDJ A;  3FQR A;  1S7W A;  5FKP A;  4IIQ C;  3VFS A;  3LN4 A;  2VLJ A;  3KLA A;  3L3G A;  4L8S C;  2XPG A;  3KPR A;  4L9L C;  3QDM A;  1EFX A;  3X14 A;  3BW9 A;  3W39 A;  1GZP A;  5SWZ A;  1MWA H;  5D9S A;  3BHB A;  4NO5 A;  5BJT A;  2DYP A;  3GSR A;  3H7B A;  4L4V A;  5D7J C;  2V2X A;  4ONO A;  3SKO A;  1I4F A;  3DX8 A;  3SPV A;  4PJB A;  5HYJ A;  3I6G A;  4MX7 A;  4V3E B;  3ES6 A;  2X4P A;  4NO2 A;  1JUF A;  2BVP A;  1B0G A;  2ESV A;  3KPN A;  1ZHL A;  1GZQ A;  1YN7 A;  1AGE A;  5IB3 A;  3HE6 A;  1JHT A;  3SCM A;  3SJV A;  1QEW A;  2FO4 A;  4HUV A;  4ZFZ A;  4LCC C;  5C07 A;  3FFC A;  3S6C A;  3BP4 A;  4HV8 A;  1JGD A;  1UXW A;  2FIK A;  4G9F A;  5E8P A;  1ZSD A;  5C0C A;  3D2U A;  1LEK A;  1JPF A;  3ROO A;  1MHC A;  3VRJ A;  3VXN A;  3L9R A;  1AGF A;  1T7V A;  1INQ A;  3LKR A;  3MRI A;  3P9L A;  1S7Q A;  3GML A;  4XXC A;  3GSU A;  3JTC A;  3JVG A;  4JFQ A;  2BST A;  4Y4F A;  5EU6 A;  5H94 A;  3SDD A;  3D18 A;  3D3V A;  4U1I A;  1FZO A;  1A1O A;  3GIV A;  5EFI A;  4QOK A;  1CG9 A;  2BNR A;  2AXF A;  2ZOK A;  5C0B A;  3QI9 A;  5EO1 A;  3LKO A;  4U6X A;  5HHO A;  4Y4K A;  1LP9 A;  1RK0 A;  2J8U A;  4IRS A;  4PRA A;  5IB4 A;  4JRY A;  1OGA A;  3DMM A;  5HHM A;  2GJ6 A;  4LHU A;  5HGH A;  1IM9 A;  4EUP A;  4LCW A;  3OXS A;  2CLV A;  5BS0 A;  4NQX A;  1AGB A;  3QUL A;  5L2K A;  3MV7 A;  1N5A A;  5MEP A;  3E6H A;  3ILQ C;  4MJ6 A;  4PGD A;  3WS3 A;  3P73 A;  4PRI A;  3KPS A;  1QSF A;  3QFJ A;  4QRS A;  1JFM A;  1SYV A;  3O3D A;  3OV6 A;  3VFR A;  3CVH A;  1I1Y A;  3L3H A;  2UWE A;  4WU5 A;  1A9B A;  5D2N A;  3ECB A;  1OGT A;  1ONQ A;  2CKB H;  5F1I A;  1DUZ A;  1FFO A;  1CD1 A;  1R3H A;  3VFU A;  3X11 A;  3FT2 A;  5ENW A;  5D5M A;  2FWO A;  3GMN A;  2GTZ A;  1NAN H;  3SDA A;  2E7L E;  3KYN A;  1JGE A;  2VAB A;  3MRG A;  3MRQ A;  3TO2 A;  1QSE A;  1RJY A;  1ZVS A;  2NW3 A;  1AGD A;  2BVQ A;  5EU5 A;  1YDP A;  3IXA A;  5FA4 A;  5C0F A;  5DDH A;  3ARE A;  3HLA A;  4PJF A;  3TFK A;  1HSA A;  5C0J A;  1E28 A;  4PJH A;  5EOT A;  4MXQ A;  3D39 A;  1I1F A;  4ZUT A;  4FTV A;  5FA3 A;  3MRP A;  4NSK A;  1E27 A;  4NT6 A;  2AV1 A;  4NNX A;  4EN3 C;  4L8D A;  5C0G A;  5HHQ A;  1P4L A;  4G42 A;  4PJX A;  1X7Q A;  3AU1 A;  1UQS A;  1HHK A;  1HHI A;  3CZF A;  2V2W A;  2X4O A;  2VAA A;  3HUJ A;  3ARG A;  4N5E A;  4S0U C;  1N2R A;  4NO3 A;  3MV9 A;  3CPL A;  2CLZ A;  2OL3 H;  3GSO A;  4WUU A;  3BZE A;  1T1Z A;  1AO7 A;  1A6Z A;  4JFP A;  2GUO A;  4PR5 A;  2RFX A;  3MRH A;  4I4W A;  2AXG A;  1QLF A;  4HWZ A;  2AKR A;  2AK4 A;  2H6P A;  3VXU A;  3VXO A;  1A1N A;  5E8O A;  3KWW A;  4NO0 A;  3KPQ A;  1EEY A;  4HUX A;  5HGD A;  3CDG A;  3JTT A;  3PWU A;  1T80 A;  2A83 A;  5FDW A;  1KTL A;  3RWC A;  1S8D A;  4G9D A;  3UBX A;  1BQH A;  1T22 A;  1HHJ A;  3LKS A;  3RWI A;  3WUW A;  5MER A;  4U1N A;  1TVB A;  4JRX A;  2HLA A;  4MVB A;  5E8N A;  3KPP A;  5D7I A;  1S7T A;  4HX1 A;  3RWE A;  1LD9 A;  3RL1 A;  5D7L A;  1XZ0 A;  3VWK A;  1T7X A;  1B3J A;  3MRM A;  3VFM A;  4O2C A;  4O2E A;  3CH1 A;  2HJK A;  1WBX A;  3KPO A;  3TIE A;  1XR8 A;  3VWJ A;  1T0M A;  3BP7 A;  3FRU A;  3ILP A;  4JQX A;  5SWS A;  3RWD A;  3SDC A;  4PJ5 A;  5SWQ A;  3VH8 A;  5EO0 A;  3VFO A;  1YN6 A;  3MRD A;  1C16 A;  5IB5 A;  1FFP A;  1L8J A;  1W0V A;  2GT9 A;  3FQW A;  3KPM A;  1ZS8 A;  4QRP A;  5E6I C;  5ISZ A;  1U58 A;  2F74 A;  3MRB A;  1FG2 A;  3FT3 A;  4NNY A;  4U1M A;  3P4M A;  4D0D A;  1S7R A;  3VFW A;  5D2L A;  1LQV A;  3BGM A;  3HG1 A;  4PRD A;  1A1M A;  3E3Q A;  1G7Q A;  3UPR A;  2X4T A;  4PDC E;  3B3I A;  1ZT4 A;  3V5H A;  1KPU A;  1B0R A;  1ZHN A;  2CLR A;  3FON A;  4MS8 A;  4Y16 A;  3I6L D;  2ZOL A;  1TVH A;  1MI5 A;  5IB1 A;  3VRI A;  3O9W A;  2X4S A;  4U1L A;  5C09 A;  4L3E A;  2GTW A;  3ROL A;  4Y4H A;  5MEN A;  2X4R A;  3TJH A;  1QVO A;  2VE6 A;  3QDG A;  1HSB A;  3MRE A;  3QQ4 A;  3QUK A;  2VLK A;  4PJE A;  4N8V A;  3RGV C;  4WU7 A;  4QRQ A;  3VJ6 A;  2XFX A;  4D0C A;  5IEH A;  4ZUS A;  4L8C A;  1RJZ A;  4MJ5 A;  2YPL A;  3BXN A;  4NQC A;  3VFT A;  1K8D A;  2ZSW A;  2X4N A;  4WO4 A;  3FOL A;  3OXR A;  4N0F A;  2ZSV A;  3CC5 A;  4PV9 A;  4UQ2 A;  3ARB A;  3VXM A;  1T7Y A;  3QZW A;  1N3N A;  5J1A A;  4MNQ A;  4PRH A;  1A9E A;  3GMM A;  5C0E A;  4WDI A;  5MEO A;  4QRU A;  3P77 A;  4X6E A;  5E9D A;  5HGB A;  1KJM A;  4L3C A;  4X6C A;  2BCK A;  3VFP A;  1I1A A;  1BII A;  3JTS A;  4U1H A;  3UTT A;  4PRP A;  5AD0 A;  4N0C A;  4PJC A;  5IB2 A;  1BZ9 A;  1KBG H;  1KPV A;  3GMR A;  4NQV A;  5C0D A;  5F9J A;  1QO3 A;  3TBW A;  2BSS A;  1XR9 A;  2CII A;  1RK1 A;  5J6G A;  4U6Y A;  3REW A;  3MRL A;  5IRO A;  3TBT A;  4CW1 A;  5HGA A;  1OF2 A;  4O2F A;  1T1W A;  5B39 A;  5BRZ A;  4WJ5 A;  4K7F A;  2YEZ A;  4ZUW A;  1KCG C;  3BEW A;  4MQ7 A;  1I7R A;  1JPG A;  3VXR A;  1K5N A;  3GSN H;  2C7U A;  3ARD A;  3TID A;  5HHP A;  2JCC A;  1T1Y A;  2PO6 A;  1JE6 A;  3OX8 A;  4L29 A;  3RTQ A;  1N59 A;  4JFO A;  3LN5 A;  3C8K A;  2GIT A;  3VXS A;  4G59 A;  3U0P A;  1ZT1 A;  1S7V A;  3PWP A;  1T7W A;  1LEG A;  3RWH A;  3QUY A;  3NFN A;  3HPJ A;  3VFN A;  3W0W A;  4F7T A;  2PYE A;  4PV8 A;  4QRR A;  1FFN A;  1FO0 H;  2P5E A;  1XH3 A;  5MEQ A;  1ZHB A;  3P4O A;  5BXF A;  5B38 A;  3PWJ A;  3RZC A;  3MRF A;  1FZJ A;  2Q7Y A;  3MV8 A;  3L3D A;  1M6O A;  3IT8 D;  3HE7 A;  1QQD A;  3P4N A;  2AV7 A;  1DDH A;  3QUZ A;  1HHG A;  5DEF A;  3BH8 A;  3C9N A;  3PWV A;  3FQT A;  4PJ7 A;  5HHN A;  2VLL A;  1S7U A;  4Y2D A;  3MRR A;  2BNQ A;  3HCV A;  1M05 A;  4FFE X;  4CVZ A;  4ELM A;  3DX7 A;  4V3D B;  1T21 A;  4APQ A;  4GKS A;  3RL2 A;  3RWG A;  3E6F A;  2NX5 A;  4G8I A;  1HOC A;  3VXP A;  3UTQ A;  4F7C A;  3LKQ A;  1BD2 A;  2F54 A;  4LNR A;  5J6H A;  4U1S A;  4I48 A;  3B6S A;  2X70 A;  1WBY A;  1S9Y A;  1AKJ A;  4JFD A;  1QR1 A;  4GUP A;  1Z5L A;  3DTX A;  3G08 A;  5DEG A;  3MRN A;  1NAM H;  3KPL A;  4D0B A;  3FOM A;  3TF7 A;  3DBX A;  5C08 A;  3AM8 A;  3BUY A;  4UQ3 A;  4ZAK A;  3O3B A;  5JHD A;  1SYS A;  1WBZ A;  3QFD A;  4JFE A;  3X13 A;  3SDX A;  1ZT7 A;  3PWN A;  3MYJ A;  3FTG A;  4PRE A;  3M1B A;  3GSQ A;  2CIK A;  3LKN A;  1KJ3 H;  3L3J A;  3BWA A;  4U1J A;  1QRN A;  4U1K A;  4PJI A;  4QRT A;  5IND A;  3SKM A;  3BVN A;  4PP8 C;  2P5W A;  2BSR A;  1KJV A;  4Z78 A;  3TPU E;  1I7T A;  1CE6 A;  1MHE A;  1I7U A;  3D25 A;  3MGO A;  4NQD A;  3FQX A;  3O4L A;  1OSZ A;  1S7S A; 
#chains in the Genus database with same CATH topology
 1W72 A;  5L2J A;  3MRJ A;  2D31 A;  4L4T A;  1G6R H;  3DX6 A;  3RUG A;  3L3K A;  2VLR A;  3O3E A;  4HUU A;  3RWF A;  3H9H A;  2FZ3 A;  1JF1 A;  3GSV A;  1Q94 A;  4NHU E;  3TZV C;  3GJF A;  5IEK A;  1FZK A;  1VAD A;  4GKN A;  5GSR A;  3PQY A;  1LK2 A;  2MHA A;  4LCY A;  5GSV A;  2FYY A;  3V5D A;  1TMC A;  1EXU A;  1T1X A;  1P1Z A;  2H26 A;  4IRJ A;  3QEQ A;  4PRB A;  1KJ2 H;  3BO8 A;  2NYK A;  3FQN A;  3L3I A;  3P9M A;  5C0I A;  3ERY A;  2X4Q A;  3M17 A;  3ARF A;  3FT4 A;  4N0U A;  4PG9 A;  2BVO A;  1DE4 A;  2WY3 A;  1P7Q A;  3PWL A;  4NQE A;  1T7Z A;  1VGK A;  1KPR A;  4E5X A;  1PQZ A;  1LDP H;  2HN7 A;  3E2H A;  3O8X A;  1T20 A;  4PJD A;  3BEV A;  4G8G A;  5EU3 A;  3TBY A;  1T0N A;  3T8X A;  3WS6 A;  1HYR C;  4X6F A;  5IM7 A;  4PGB A;  3FQU A;  3T1F A;  4HKJ A;  3MRC A;  3RWJ A;  1VAC A;  4MNG A;  3TO4 A;  3MR9 A;  2F53 A;  4E0R A;  2YPK A;  3KXF A;  4ZUU A;  4JQV A;  3GSX A;  4F7E A;  3DXA A;  4EI5 A;  4MJI A;  4PJG A;  5EU4 A;  4HUW A;  4F7M A;  3QQ3 A;  1YPZ A;  4IHO A;  3MGT A;  4PGE A;  5F7D A;  5F1N A;  3VFV A;  4Z77 A;  3TN0 A;  5EUO A;  5C0A A;  1FZM A;  3X12 A;  1AGC A;  4PJ8 A;  5C9J A;  3O3A A;  4PG2 A;  3CCH A;  3MA7 A;  4Z76 A;  3GMO A;  4WWK C;  3KYO A;  3VCL A;  5ACZ A;  1S9W A;  3QUX A;  4PJ9 A;  4PJA A;  4L8B A;  3H9S A;  1G7P A;  1NEZ A;  3WLB A;  1ZHK A;  2HJL A;  4K71 B;  3GSW A;  3UTS A;  1IM3 A;  3BZF A;  3HAE A;  3TVM A;  2GAZ A;  3I6K A;  2OI9 A;  1S7X A;  1UXS A;  4F7P A;  4G43 A;  4CVX A;  3GMQ A;  4PGC A;  1EEZ A;  4HS3 A;  4JFF A;  3MRO A;  4WW2 C;  4ZUV A;  5IVX A;  3BH9 A;  3LKP A;  1ZAG A;  1DUY A;  1W0W A;  5E00 A;  1ED3 A;  3WL9 A;  3PAB A;  3TBS A;  4X6D A;  3TA3 A;  3MRK A;  1HHH A;  2X4U A;  3LV3 A;  3GMP A;  1S9X A;  5INC A;  3TBV A;  3V5K A;  4PRN A;  3QDJ A;  3FQR A;  1S7W A;  5FKP A;  4IIQ C;  3VFS A;  3LN4 A;  2VLJ A;  3KLA A;  3L3G A;  4L8S C;  2XPG A;  3KPR A;  4L9L C;  3QDM A;  1EFX A;  3X14 A;  3BW9 A;  3W39 A;  1GZP A;  5SWZ A;  1MWA H;  5D9S A;  3BHB A;  4NO5 A;  5BJT A;  2DYP A;  3GSR A;  3H7B A;  4L4V A;  5D7J C;  2V2X A;  4ONO A;  3SKO A;  1I4F A;  3DX8 A;  3SPV A;  4PJB A;  5HYJ A;  3I6G A;  4MX7 A;  4V3E B;  3ES6 A;  2X4P A;  4NO2 A;  1JUF A;  2BVP A;  1B0G A;  2ESV A;  3KPN A;  1ZHL A;  1GZQ A;  1YN7 A;  1AGE A;  5IB3 A;  3HE6 A;  1JHT A;  3SCM A;  3SJV A;  1QEW A;  2FO4 A;  4HUV A;  4ZFZ A;  4LCC C;  5C07 A;  3FFC A;  3S6C A;  3BP4 A;  4HV8 A;  1JGD A;  1UXW A;  2FIK A;  4G9F A;  5E8P A;  1ZSD A;  5C0C A;  3D2U A;  1LEK A;  1JPF A;  3ROO A;  1MHC A;  3VRJ A;  3VXN A;  3L9R A;  1AGF A;  1T7V A;  1INQ A;  3LKR A;  3MRI A;  3P9L A;  1S7Q A;  3GML A;  4XXC A;  3GSU A;  3JTC A;  3JVG A;  4JFQ A;  2BST A;  4Y4F A;  5EU6 A;  5H94 A;  3SDD A;  3D18 A;  3D3V A;  4U1I A;  1FZO A;  1A1O A;  3GIV A;  5EFI A;  4QOK A;  1CG9 A;  2BNR A;  2AXF A;  2ZOK A;  5C0B A;  3QI9 A;  5EO1 A;  3LKO A;  4U6X A;  5HHO A;  4Y4K A;  1LP9 A;  1RK0 A;  2IA1 A;  2J8U A;  4IRS A;  4PRA A;  4JRY A;  5IB4 A;  1OGA A;  3DMM A;  5HHM A;  2GJ6 A;  4LHU A;  5HGH A;  1IM9 A;  4EUP A;  4LCW A;  3OXS A;  2CLV A;  5BS0 A;  4NQX A;  3I0T A;  1AGB A;  3QUL A;  5L2K A;  3MV7 A;  1N5A A;  5MEP A;  3E6H A;  3ILQ C;  4MJ6 A;  4PGD A;  3WS3 A;  3P73 A;  4PRI A;  3KPS A;  1QSF A;  3QFJ A;  4QRS A;  1JFM A;  1SYV A;  3O3D A;  3OV6 A;  3VFR A;  3CVH A;  1I1Y A;  3L3H A;  2UWE A;  4WU5 A;  1A9B A;  5D2N A;  3ECB A;  1OGT A;  1ONQ A;  2CKB H;  5F1I A;  1DUZ A;  1FFO A;  1CD1 A;  1R3H A;  3VFU A;  3X11 A;  3FT2 A;  5ENW A;  5D5M A;  2FWO A;  3GMN A;  2GTZ A;  1NAN H;  3SDA A;  2E7L E;  3KYN A;  1JGE A;  2VAB A;  3MRG A;  3MRQ A;  3TO2 A;  1QSE A;  1RJY A;  1ZVS A;  2NW3 A;  1AGD A;  2BVQ A;  5EU5 A;  1YDP A;  3IXA A;  5FA4 A;  5C0F A;  5DDH A;  3ARE A;  3HLA A;  4PJF A;  3TFK A;  1HSA A;  5C0J A;  1E28 A;  4PJH A;  5EOT A;  4MXQ A;  3D39 A;  1I1F A;  4ZUT A;  4FTV A;  5FA3 A;  3MRP A;  4NSK A;  1E27 A;  4NT6 A;  2AV1 A;  4NNX A;  4EN3 C;  4L8D A;  5C0G A;  5HHQ A;  1P4L A;  4G42 A;  4PJX A;  1X7Q A;  3AU1 A;  1UQS A;  1HHK A;  1HHI A;  3CZF A;  2V2W A;  2X4O A;  2VAA A;  3HUJ A;  3ARG A;  4N5E A;  4S0U C;  1N2R A;  4NO3 A;  3MV9 A;  4JO8 A;  3CPL A;  2CLZ A;  2OL3 H;  3GSO A;  4WUU A;  3BZE A;  1T1Z A;  1AO7 A;  1A6Z A;  4JFP A;  2GUO A;  4PR5 A;  2RFX A;  3MRH A;  4I4W A;  2AXG A;  1QLF A;  4HWZ A;  2AKR A;  2AK4 A;  2H6P A;  3VXU A;  3VXO A;  1A1N A;  5E8O A;  3KWW A;  4G59 C;  4NO0 A;  3KPQ A;  1EEY A;  4HUX A;  5HGD A;  3CDG A;  3JTT A;  3PWU A;  1T80 A;  2A83 A;  5FDW A;  1KTL A;  3RWC A;  1S8D A;  4G9D A;  3UBX A;  1BQH A;  1T22 A;  1HHJ A;  3LKS A;  3RWI A;  3WUW A;  5MER A;  4U1N A;  1TVB A;  4JRX A;  2HLA A;  4MVB A;  5E8N A;  3KPP A;  5D7I A;  1S7T A;  4HX1 A;  3RWE A;  1LD9 A;  3RL1 A;  5D7L A;  1XZ0 A;  3VWK A;  1T7X A;  1B3J A;  3MRM A;  3VFM A;  4O2C A;  4O2E A;  3CH1 A;  2HJK A;  1WBX A;  3KPO A;  3TIE A;  1XR8 A;  3VWJ A;  1T0M A;  3BP7 A;  3FRU A;  3ILP A;  4JQX A;  5SWS A;  3RWD A;  3SDC A;  4PJ5 A;  5SWQ A;  3VH8 A;  5EO0 A;  3VFO A;  1YN6 A;  3MRD A;  1C16 A;  5IB5 A;  1FFP A;  1L8J A;  1W0V A;  2GT9 A;  3FQW A;  3KPM A;  1ZS8 A;  4QRP A;  5E6I C;  5ISZ A;  1U58 A;  2F74 A;  3MRB A;  1FG2 A;  3FT3 A;  4NNY A;  4U1M A;  3P4M A;  4D0D A;  1S7R A;  3VFW A;  5D2L A;  1LQV A;  3BGM A;  3HG1 A;  4PRD A;  1A1M A;  3E3Q A;  1G7Q A;  3UPR A;  2X4T A;  4PDC E;  3B3I A;  1ZT4 A;  3V5H A;  1KPU A;  1B0R A;  1ZHN A;  2CLR A;  3FON A;  4MS8 A;  4Y16 A;  3I6L D;  2ZOL A;  1TVH A;  1MI5 A;  5IB1 A;  3VRI A;  3O9W A;  2X4S A;  4U1L A;  5C09 A;  4L3E A;  2GTW A;  3ROL A;  4Y4H A;  5MEN A;  2X4R A;  3TJH A;  1QVO A;  2VE6 A;  3QDG A;  1HSB A;  3MRE A;  3QQ4 A;  3QUK A;  2VLK A;  4PJE A;  4N8V A;  3RGV C;  4WU7 A;  4QRQ A;  3VJ6 A;  2XFX A;  4D0C A;  5IEH A;  4ZUS A;  4L8C A;  1RJZ A;  4MJ5 A;  2YPL A;  3BXN A;  4NQC A;  3VFT A;  1K8D A;  2ZSW A;  2X4N A;  4WO4 A;  3FOL A;  3OXR A;  4N0F A;  2ZSV A;  3CC5 A;  4PV9 A;  4UQ2 A;  3ARB A;  3VXM A;  1T7Y A;  3QZW A;  1N3N A;  5J1A A;  4MNQ A;  4PRH A;  1A9E A;  3GMM A;  5C0E A;  4WDI A;  5MEO A;  4QRU A;  3P77 A;  4X6E A;  5E9D A;  5HGB A;  1KJM A;  4L3C A;  4X6C A;  4BKW A;  2BCK A;  3VFP A;  1I1A A;  1BII A;  3JTS A;  4U1H A;  3UTT A;  4PRP A;  5AD0 A;  4N0C A;  4PJC A;  5IB2 A;  1BZ9 A;  1KBG H;  1KPV A;  3GMR A;  4NQV A;  5C0D A;  5F9J A;  1QO3 A;  3TBW A;  2BSS A;  1XR9 A;  2CII A;  1RK1 A;  5J6G A;  4U6Y A;  3REW A;  3MRL A;  5IRO A;  3TBT A;  4CW1 A;  5HGA A;  1OF2 A;  4O2F A;  1T1W A;  5B39 A;  5BRZ A;  4WJ5 A;  4K7F A;  2YEZ A;  4ZUW A;  1KCG C;  3BEW A;  4MQ7 A;  1I7R A;  1JPG A;  3VXR A;  1K5N A;  3GSN H;  2C7U A;  3ARD A;  3TID A;  5HHP A;  2JCC A;  1T1Y A;  2PO6 A;  1JE6 A;  3OX8 A;  4L29 A;  3RTQ A;  1N59 A;  4JFO A;  2O5N A;  3LN5 A;  3C8K A;  2GIT A;  3VXS A;  4G59 A;  3U0P A;  1ZT1 A;  1S7V A;  3PWP A;  1T7W A;  1LEG A;  3RWH A;  3QUY A;  3NFN A;  3HPJ A;  3VFN A;  3W0W A;  4F7T A;  2PYE A;  4PV8 A;  4QRR A;  1FFN A;  1FO0 H;  2P5E A;  1XH3 A;  5MEQ A;  1ZHB A;  3P4O A;  5BXF A;  5B38 A;  3PWJ A;  3RZC A;  3MRF A;  1FZJ A;  2Q7Y A;  3MV8 A;  3L3D A;  1M6O A;  3IT8 D;  3HE7 A;  1QQD A;  3P4N A;  2AV7 A;  1DDH A;  3QUZ A;  1HHG A;  5DEF A;  3BH8 A;  3C9N A;  3PWV A;  3FQT A;  4PJ7 A;  5HHN A;  2VLL A;  1S7U A;  4Y2D A;  3MRR A;  2BNQ A;  3HCV A;  1M05 A;  4FFE X;  4CVZ A;  4ELM A;  3DX7 A;  4V3D B;  1T21 A;  4APQ A;  4GKS A;  3RL2 A;  3RWG A;  3E6F A;  2NX5 A;  4G8I A;  1HOC A;  3VXP A;  3UTQ A;  4F7C A;  3LKQ A;  1BD2 A;  2F54 A;  4LNR A;  5J6H A;  4U1S A;  4I48 A;  3B6S A;  2X70 A;  1WBY A;  1S9Y A;  1AKJ A;  4JFD A;  1QR1 A;  4GUP A;  1Z5L A;  3DTX A;  3G08 A;  5DEG A;  3MRN A;  1NAM H;  3KPL A;  4D0B A;  3FOM A;  3TF7 A;  3DBX A;  5C08 A;  3AM8 A;  3BUY A;  4UQ3 A;  4ZAK A;  3O3B A;  5JHD A;  1SYS A;  1WBZ A;  3QFD A;  4JFE A;  3X13 A;  3SDX A;  1ZT7 A;  3PWN A;  3MYJ A;  3FTG A;  4PRE A;  3M1B A;  3GSQ A;  2CIK A;  3LKN A;  1KJ3 H;  3L3J A;  3BWA A;  4U1J A;  1QRN A;  4U1K A;  4PJI A;  4QRT A;  5IND A;  3SKM A;  3BVN A;  4PP8 C;  2P5W A;  2BSR A;  1KJV A;  4Z78 A;  3TPU E;  1I7T A;  1CE6 A;  1MHE A;  1I7U A;  3D25 A;  3MGO A;  4NQD A;  3FQX A;  3O4L A;  1OSZ A;  1S7S A; 
#chains in the Genus database with same CATH homology
 1W72 A;  5L2J A;  3MRJ A;  2D31 A;  4L4T A;  1G6R H;  3DX6 A;  3RUG A;  3L3K A;  2VLR A;  3O3E A;  4HUU A;  3RWF A;  3H9H A;  2FZ3 A;  1JF1 A;  3GSV A;  1Q94 A;  4NHU E;  3TZV C;  3GJF A;  5IEK A;  1FZK A;  1VAD A;  4GKN A;  5GSR A;  3PQY A;  1LK2 A;  2MHA A;  4LCY A;  5GSV A;  2FYY A;  3V5D A;  1TMC A;  1EXU A;  1T1X A;  1P1Z A;  2H26 A;  4IRJ A;  3QEQ A;  4PRB A;  1KJ2 H;  3BO8 A;  3FQN A;  3L3I A;  3P9M A;  5C0I A;  3ERY A;  2X4Q A;  3M17 A;  3ARF A;  3FT4 A;  4N0U A;  4PG9 A;  2BVO A;  1DE4 A;  2WY3 A;  1P7Q A;  3PWL A;  4NQE A;  1T7Z A;  1VGK A;  1KPR A;  4E5X A;  1PQZ A;  1LDP H;  2HN7 A;  3E2H A;  3O8X A;  1T20 A;  4PJD A;  3BEV A;  4G8G A;  5EU3 A;  3TBY A;  1T0N A;  3T8X A;  3WS6 A;  1HYR C;  4X6F A;  5IM7 A;  4PGB A;  3FQU A;  3T1F A;  4HKJ A;  3MRC A;  3RWJ A;  1VAC A;  4MNG A;  3TO4 A;  3MR9 A;  2F53 A;  4E0R A;  2YPK A;  3KXF A;  4ZUU A;  4JQV A;  3GSX A;  4F7E A;  3DXA A;  4EI5 A;  4MJI A;  4PJG A;  5EU4 A;  4HUW A;  4F7M A;  3QQ3 A;  1YPZ A;  4IHO A;  3MGT A;  4PGE A;  5F7D A;  5F1N A;  3VFV A;  4Z77 A;  3TN0 A;  5EUO A;  5C0A A;  1FZM A;  3X12 A;  1AGC A;  4PJ8 A;  5C9J A;  3O3A A;  4PG2 A;  3CCH A;  3MA7 A;  4Z76 A;  3GMO A;  4WWK C;  3KYO A;  3VCL A;  5ACZ A;  1S9W A;  3QUX A;  4PJ9 A;  4PJA A;  4L8B A;  3H9S A;  1G7P A;  1NEZ A;  3WLB A;  1ZHK A;  2HJL A;  4K71 B;  3GSW A;  3UTS A;  1IM3 A;  3BZF A;  3HAE A;  3TVM A;  2GAZ A;  3I6K A;  2OI9 A;  1S7X A;  1UXS A;  4F7P A;  4G43 A;  4CVX A;  3GMQ A;  4PGC A;  1EEZ A;  4HS3 A;  4JFF A;  3MRO A;  4WW2 C;  4ZUV A;  5IVX A;  3BH9 A;  3LKP A;  1ZAG A;  1DUY A;  1W0W A;  5E00 A;  1ED3 A;  3WL9 A;  3PAB A;  3TBS A;  4X6D A;  3TA3 A;  3MRK A;  1HHH A;  2X4U A;  3LV3 A;  3GMP A;  1S9X A;  5INC A;  3TBV A;  3V5K A;  4PRN A;  3QDJ A;  3FQR A;  1S7W A;  5FKP A;  4IIQ C;  3VFS A;  3LN4 A;  2VLJ A;  3KLA A;  3L3G A;  4L8S C;  2XPG A;  3KPR A;  4L9L C;  3QDM A;  1EFX A;  3X14 A;  3BW9 A;  3W39 A;  1GZP A;  5SWZ A;  1MWA H;  5D9S A;  3BHB A;  4NO5 A;  5BJT A;  2DYP A;  3GSR A;  3H7B A;  4L4V A;  5D7J C;  2V2X A;  4ONO A;  3SKO A;  1I4F A;  3DX8 A;  3SPV A;  4PJB A;  5HYJ A;  3I6G A;  4MX7 A;  4V3E B;  3ES6 A;  2X4P A;  4NO2 A;  1JUF A;  2BVP A;  1B0G A;  2ESV A;  3KPN A;  1ZHL A;  1GZQ A;  1YN7 A;  1AGE A;  5IB3 A;  3HE6 A;  1JHT A;  3SCM A;  3SJV A;  1QEW A;  2FO4 A;  4HUV A;  4ZFZ A;  4LCC C;  5C07 A;  3FFC A;  3S6C A;  3BP4 A;  4HV8 A;  1JGD A;  1UXW A;  2FIK A;  4G9F A;  5E8P A;  1ZSD A;  5C0C A;  3D2U A;  1LEK A;  1JPF A;  3ROO A;  1MHC A;  3VRJ A;  3VXN A;  3L9R A;  1AGF A;  1T7V A;  1INQ A;  3LKR A;  3MRI A;  3P9L A;  1S7Q A;  3GML A;  4XXC A;  3GSU A;  3JTC A;  3JVG A;  4JFQ A;  2BST A;  4Y4F A;  5EU6 A;  5H94 A;  3SDD A;  3D18 A;  3D3V A;  4U1I A;  1FZO A;  1A1O A;  3GIV A;  5EFI A;  4QOK A;  1CG9 A;  2BNR A;  2AXF A;  2ZOK A;  5C0B A;  3QI9 A;  5EO1 A;  3LKO A;  4U6X A;  5HHO A;  4Y4K A;  1LP9 A;  1RK0 A;  2J8U A;  4IRS A;  4PRA A;  5IB4 A;  4JRY A;  1OGA A;  3DMM A;  5HHM A;  2GJ6 A;  4LHU A;  5HGH A;  1IM9 A;  4EUP A;  4LCW A;  3OXS A;  2CLV A;  5BS0 A;  4NQX A;  1AGB A;  3QUL A;  5L2K A;  3MV7 A;  1N5A A;  5MEP A;  3E6H A;  3ILQ C;  4MJ6 A;  4PGD A;  3WS3 A;  3P73 A;  4PRI A;  3KPS A;  1QSF A;  3QFJ A;  4QRS A;  1JFM A;  1SYV A;  3O3D A;  3OV6 A;  3VFR A;  3CVH A;  1I1Y A;  3L3H A;  2UWE A;  4WU5 A;  1A9B A;  5D2N A;  3ECB A;  1OGT A;  1ONQ A;  2CKB H;  5F1I A;  1DUZ A;  1FFO A;  1CD1 A;  1R3H A;  3VFU A;  3X11 A;  3FT2 A;  5ENW A;  5D5M A;  2FWO A;  3GMN A;  2GTZ A;  1NAN H;  3SDA A;  2E7L E;  3KYN A;  1JGE A;  2VAB A;  3MRG A;  3MRQ A;  3TO2 A;  1QSE A;  1RJY A;  1ZVS A;  2NW3 A;  1AGD A;  2BVQ A;  5EU5 A;  1YDP A;  3IXA A;  5FA4 A;  5C0F A;  5DDH A;  3ARE A;  3HLA A;  4PJF A;  3TFK A;  1HSA A;  5C0J A;  1E28 A;  4PJH A;  5EOT A;  4MXQ A;  3D39 A;  1I1F A;  4ZUT A;  4FTV A;  5FA3 A;  3MRP A;  4NSK A;  1E27 A;  4NT6 A;  2AV1 A;  4NNX A;  4EN3 C;  4L8D A;  5C0G A;  5HHQ A;  1P4L A;  4G42 A;  4PJX A;  1X7Q A;  3AU1 A;  1UQS A;  1HHK A;  1HHI A;  3CZF A;  2V2W A;  2X4O A;  2VAA A;  3HUJ A;  3ARG A;  4N5E A;  4S0U C;  1N2R A;  4NO3 A;  3MV9 A;  3CPL A;  2CLZ A;  2OL3 H;  3GSO A;  4WUU A;  3BZE A;  1T1Z A;  1AO7 A;  1A6Z A;  4JFP A;  2GUO A;  4PR5 A;  2RFX A;  3MRH A;  4I4W A;  2AXG A;  1QLF A;  4HWZ A;  2AKR A;  2AK4 A;  2H6P A;  3VXU A;  3VXO A;  1A1N A;  5E8O A;  3KWW A;  4NO0 A;  3KPQ A;  1EEY A;  4HUX A;  5HGD A;  3CDG A;  3JTT A;  3PWU A;  1T80 A;  2A83 A;  5FDW A;  1KTL A;  3RWC A;  1S8D A;  4G9D A;  3UBX A;  1BQH A;  1T22 A;  1HHJ A;  3LKS A;  3RWI A;  3WUW A;  5MER A;  4U1N A;  1TVB A;  4JRX A;  2HLA A;  4MVB A;  5E8N A;  3KPP A;  5D7I A;  1S7T A;  4HX1 A;  3RWE A;  1LD9 A;  3RL1 A;  5D7L A;  1XZ0 A;  3VWK A;  1T7X A;  1B3J A;  3MRM A;  3VFM A;  4O2C A;  4O2E A;  3CH1 A;  2HJK A;  1WBX A;  3KPO A;  3TIE A;  1XR8 A;  3VWJ A;  1T0M A;  3BP7 A;  3FRU A;  3ILP A;  4JQX A;  5SWS A;  3RWD A;  3SDC A;  4PJ5 A;  5SWQ A;  3VH8 A;  5EO0 A;  3VFO A;  1YN6 A;  3MRD A;  1C16 A;  5IB5 A;  1FFP A;  1L8J A;  1W0V A;  2GT9 A;  3FQW A;  3KPM A;  1ZS8 A;  4QRP A;  5E6I C;  5ISZ A;  1U58 A;  2F74 A;  3MRB A;  1FG2 A;  3FT3 A;  4NNY A;  4U1M A;  3P4M A;  4D0D A;  1S7R A;  3VFW A;  5D2L A;  1LQV A;  3BGM A;  3HG1 A;  4PRD A;  1A1M A;  3E3Q A;  1G7Q A;  3UPR A;  2X4T A;  4PDC E;  3B3I A;  1ZT4 A;  3V5H A;  1KPU A;  1B0R A;  1ZHN A;  2CLR A;  3FON A;  4MS8 A;  4Y16 A;  3I6L D;  2ZOL A;  1TVH A;  1MI5 A;  5IB1 A;  3VRI A;  3O9W A;  2X4S A;  4U1L A;  5C09 A;  4L3E A;  2GTW A;  3ROL A;  4Y4H A;  5MEN A;  2X4R A;  3TJH A;  1QVO A;  2VE6 A;  3QDG A;  1HSB A;  3MRE A;  3QQ4 A;  3QUK A;  2VLK A;  4PJE A;  4N8V A;  3RGV C;  4WU7 A;  4QRQ A;  3VJ6 A;  2XFX A;  4D0C A;  5IEH A;  4ZUS A;  4L8C A;  1RJZ A;  4MJ5 A;  2YPL A;  3BXN A;  4NQC A;  3VFT A;  1K8D A;  2ZSW A;  2X4N A;  4WO4 A;  3FOL A;  3OXR A;  4N0F A;  2ZSV A;  3CC5 A;  4PV9 A;  4UQ2 A;  3ARB A;  3VXM A;  1T7Y A;  3QZW A;  1N3N A;  5J1A A;  4MNQ A;  4PRH A;  1A9E A;  3GMM A;  5C0E A;  4WDI A;  5MEO A;  4QRU A;  3P77 A;  4X6E A;  5E9D A;  5HGB A;  1KJM A;  4L3C A;  4X6C A;  2BCK A;  3VFP A;  1I1A A;  1BII A;  3JTS A;  4U1H A;  3UTT A;  4PRP A;  5AD0 A;  4N0C A;  4PJC A;  5IB2 A;  1BZ9 A;  1KBG H;  1KPV A;  3GMR A;  4NQV A;  5C0D A;  5F9J A;  1QO3 A;  3TBW A;  2BSS A;  1XR9 A;  2CII A;  1RK1 A;  5J6G A;  4U6Y A;  3REW A;  3MRL A;  5IRO A;  3TBT A;  4CW1 A;  5HGA A;  1OF2 A;  4O2F A;  1T1W A;  5B39 A;  5BRZ A;  4WJ5 A;  4K7F A;  2YEZ A;  4ZUW A;  1KCG C;  3BEW A;  4MQ7 A;  1I7R A;  1JPG A;  3VXR A;  1K5N A;  3GSN H;  2C7U A;  3ARD A;  3TID A;  5HHP A;  2JCC A;  1T1Y A;  2PO6 A;  1JE6 A;  3OX8 A;  4L29 A;  3RTQ A;  1N59 A;  4JFO A;  3LN5 A;  3C8K A;  2GIT A;  3VXS A;  4G59 A;  3U0P A;  1ZT1 A;  1S7V A;  3PWP A;  1T7W A;  1LEG A;  3RWH A;  3QUY A;  3NFN A;  3HPJ A;  3VFN A;  3W0W A;  4F7T A;  2PYE A;  4PV8 A;  4QRR A;  1FFN A;  1FO0 H;  2P5E A;  1XH3 A;  5MEQ A;  1ZHB A;  3P4O A;  5BXF A;  5B38 A;  3PWJ A;  3RZC A;  3MRF A;  1FZJ A;  2Q7Y A;  3MV8 A;  3L3D A;  1M6O A;  3IT8 D;  3HE7 A;  1QQD A;  3P4N A;  2AV7 A;  1DDH A;  3QUZ A;  1HHG A;  5DEF A;  3BH8 A;  3C9N A;  3PWV A;  3FQT A;  4PJ7 A;  5HHN A;  2VLL A;  1S7U A;  4Y2D A;  3MRR A;  2BNQ A;  3HCV A;  1M05 A;  4FFE X;  4CVZ A;  4ELM A;  3DX7 A;  4V3D B;  1T21 A;  4APQ A;  4GKS A;  3RL2 A;  3RWG A;  3E6F A;  2NX5 A;  4G8I A;  1HOC A;  3VXP A;  3UTQ A;  4F7C A;  3LKQ A;  1BD2 A;  2F54 A;  4LNR A;  5J6H A;  4U1S A;  4I48 A;  3B6S A;  2X70 A;  1WBY A;  1S9Y A;  1AKJ A;  4JFD A;  1QR1 A;  4GUP A;  1Z5L A;  3DTX A;  3G08 A;  5DEG A;  3MRN A;  1NAM H;  3KPL A;  4D0B A;  3FOM A;  3TF7 A;  3DBX A;  5C08 A;  3AM8 A;  3BUY A;  4UQ3 A;  4ZAK A;  3O3B A;  5JHD A;  1SYS A;  1WBZ A;  3QFD A;  4JFE A;  3X13 A;  3SDX A;  1ZT7 A;  3PWN A;  3MYJ A;  3FTG A;  4PRE A;  3M1B A;  3GSQ A;  2CIK A;  3LKN A;  1KJ3 H;  3L3J A;  3BWA A;  4U1J A;  1QRN A;  4U1K A;  4PJI A;  4QRT A;  5IND A;  3SKM A;  3BVN A;  4PP8 C;  2P5W A;  2BSR A;  1KJV A;  4Z78 A;  3TPU E;  1I7T A;  1CE6 A;  1MHE A;  1I7U A;  3D25 A;  3MGO A;  4NQD A;  3FQX A;  3O4L A;  1OSZ A;  1S7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...