1JFMA

Crystal structure of murine nk cell ligand rae-1 beta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
DAHSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINKTMTSGDPGETANATEVKKCLTQPLKNLCQKLRNKVSNTKVDTHKTNGYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQSKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords retinoic acid early transcript beta
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 174
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jfmA00
3P4OA 1FO0H 4LCYA 2XFXA 3MR9A 1T7WA 4PREA 3GSVA 1S7SA 3IXAA 4MJIA 4F7TA 1QSEA 2BSSA 3ARFA 4F7EA 1S7TA 4PV9A 1KPVA 3TFKA 4L29A 3V5DA 2HJLA 3VWJA 5IVXA 3L3JA 3LKSA 5IEKA 4U1HA 4U1MA 4N0FA 4U1NA 3RWEA 3VXOA 1ZT7A 4JQVA 4IIQC 4QOKA 2BVQA 2GTWA 4U1SA 1W0VA 5D7JC 3S6CA 3V5KA 1JGDA 1FG2A 3OXSA 1P1ZA 2FZ3A 3PWNA 1HHKA 4Y4KA 3T1FA 5EUOA 3KPLA 4NQVA 3VXSA 3LN5A 1NANH 4NNYA 5IM7A 5FDWA 2E7LE 5INDA 4NO2A 1RK1A 4NT6A 3SDCA 4NO3A 4U6XA 5HGAA 1HHJA 3NFNA 1ZHBA 5IB2A 2AKRA 4PDCE 4V3EB 3OXRA 3QQ3A 1AGFA 3X11A 5B39A 1AO7A 3FQNA 1JGEA 3BXNA 3BGMA 4WU7A 5J6GA 1OSZA 2F74A 1HHIA 4PJ8A 4WWKC 4Y2DA 4Z77A 3OX8A 1MHCA 1RJYA 2YEZA 4ZUSA 1EXUA 5MEQA 1KJVA 2CLRA 5J6HA 4IRJA 4Y4HA 3VWKA 4WU5A 3GJFA 1WBZA 5FKPA 3VXUA 1I7RA 2CLZA 3O3DA 3P77A 3RUGA 1S7UA 1Z5LA 3GMMA 5D7IA 1BD2A 3RTQA 5C0IA 3HUJA 3I6KA 4HUWA 4U1IA 3FTGA 3BH8A 5ENWA 4NQDA 1E27A 5IB5A 3CCHA 3TO2A 1ONQA 3KLAA 1XR8A 1N2RA 1A9BA 4UQ3A 3QFDA 3BEWA 4XXCA 3RWGA 1DE4A 2FIKA 3MRHA 3FQWA 4PRHA 3TBTA 1OF2A 5F1NA 4ZUWA 2H6PA 1S9XA 3MRNA 3VJ6A 1M6OA 1L8JA 3H9SA 2ZSVA 3TO4A 1XH3A 5J1AA 4PJBA 4L8CA 3L3DA 3AREA 3KPQA 4K7FA 1KCGC 1JPFA 1T22A 4MX7A 2GUOA 1GZQA 4MJ5A 2AXFA 2BVOA 4V3DB 1LDPH 1PQZA 1FFPA 3MRPA 1K5NA 2OI9A 3MRJA 5DEGA 1T21A 4HKJA 1VADA 5DDHA 1I7UA 1S9WA 3GMQA 2AXGA 5FA4A 2HLAA 4X6CA 5MEPA 2FWOA 1S7VA 1QLFA 3MRDA 5F1IA 3U0PA 2VAAA 2AV7A 3FONA 3L3KA 3O3EA 1KJ2H 3SDAA 2X4QA 4PJEA 2HN7A 3CDGA 3P73A 3REWA 4S0UC 4NHUE 1EFXA 3FQXA 5HYJA 4QRSA 3M17A 4JFOA 3BHBA 3PWVA 3VFRA 1UQSA 2AV1A 3VFSA 5JHDA 5EU6A 3HCVA 1UXWA 4Z78A 4JFPA 1T7YA 1YDPA 2GITA 1P4LA 2X70A 5HGDA 3G08A 1S7XA 2V2XA 1S7WA 3WS3A 3X13A 4FTVA 5GSRA 5FA3A 4LCWA 1LD9A 4QRTA 3BUYA 2RFXA 5D2NA 3MRCA 3QEQA 5HHNA 1N59A 4ZFZA 5SWQA 3GMNA 5BRZA 3VFNA 1LK2A 2H26A 3QZWA 3TBSA 3SPVA 1JHTA 5E8PA 4L8SC 3DBXA 1ED3A 2ESVA 4Y16A 4L3CA 1S7RA 2D31A 3QDGA 3ARGA 3FQUA 2BNRA 2VLRA 3QUZA 4IHOA 3ROOA 1KBGH 2VLLA 3JTSA 3MV7A 1T7XA 1T0NA 1X7QA 3QUXA 3RL1A 4HX1A 1M05A 1SYSA 3VFMA 1OGTA 1I7TA 2NX5A 2X4TA 3GMPA 5AD0A 3GSQA 5ISZA 4QRRA 3RWCA 5HGHA 4PJIA 3MA7A 1BZ9A 1KTLA 3MRGA 3RWIA 3WUWA 1KPRA 3TJHA 2ZOKA 1W0WA 3GSXA 1G7PA 4G42A 3FOMA 4N5EA 3L3HA 1T7VA 3QFJA 3TA3A 4PR5A 1HYRC 3VFUA 1IM3A 2GJ6A 3FT3A 4MXQA 1ZAGA 2GTZA 4U1JA 4PG9A 5D7LA 3VXNA 1QEWA 1LP9A 3MGOA 3HAEA 2F54A 4PJ7A 3BP4A 1FZJA 3QULA 1QO3A 1U58A 2CLVA 3IT8D 3VXPA 1S7QA 5C09A 1CG9A 1I4FA 5EOTA 4PRPA 1QR1A 2YPKA 3BH9A 2VABA 3PWJA 4JFFA 3X14A 2J8UA 5C08A 3UPRA 5C0GA 4HUUA 1T1WA 1TMCA 2X4SA 4N0UA 3FOLA 2HJKA 3CH1A 5EFIA 5HHQA 1HHHA 4G9FA 3PWPA 1SYVA 5EU3A 1KPUA 1TVBA 2BVPA 5MEOA 1S9YA 3KYNA 3O3BA 1JFMA 5B38A 2XPGA 3CVHA 2F53A 3SDDA 3PQYA 4G8IA 4F7CA 2PYEA 3VXMA 4G59A 4ONOA 4PGCA 1LEGA 4F7MA 4GKNA 3E6HA 3VFWA 5HGBA 1EEZA 3MRIA 4E0RA 3KPNA 1INQA 3PABA 5ACZA 3L9RA 1A1MA 1A1OA 3D3VA 3RWFA 3VFTA 4MS8A 3ES6A 3M1BA 3L3IA 1YPZA 4O2FA 4NQXA 3GMOA 3ARDA 4NQCA 3KXFA 4N0CA 5SWSA 2FO4A 4LCCC 4PJCA 4MQ7A 1XZ0A 1DDHA 3BVNA 3RWJA 3WLBA 5H94A 3E2HA 3MRLA 4G43A 4K71B 4GKSA 1MWAH 4L4VA 1FZMA 4L8DA 4PGBA 4PRIA 4U6YA 1T1ZA 4WO4A 3SDXA 4ZAKA 3SCMA 3WS6A 3I6GA 4HWZA 3C9NA 4NSKA 3O4LA 4EUPA 3VFPA 3VH8A 1JF1A 4LNRA 1DUZA 4I48A 2X4UA 2AK4A 3ARBA 1AGBA 3PWLA 4NO5A 1MI5A 3LKRA 5EO1A 1OGAA 5F7DA 3FT4A 3HLAA 3FRUA 3MREA 4X6EA 1ZT4A 4MNQA 1G6RH 1TVHA 4PRAA 1A6ZA 3DTXA 4WW2C 3W39A 4JRXA 4L8BA 3TZVC 3FQTA 4JFDA 4E5XA 1KJ3H 4O2EA 1RJZA 1ZVSA 4PJXA 5E9DA 4PRBA 4JFEA 4WUUA 5BS0A 3LN4A 1YN6A 5INCA 3V5HA 1FZKA 5IB3A 3CZFA 4L9LC 4EI5A 1MHEA 3HG1A 1JPGA 3CPLA 5SWZA 3LKNA 1NEZA 3ILQC 3GSRA 3CC5A 1AGEA 3RWDA 3TN0A 4D0CA 3B6SA 1ZT1A 3KPRA 5E6IC 5C9JA 2P5WA 3E3QA 3JTCA 4NO0A 4PJ9A 2NW3A 4WJ5A 1ZSDA 4QRQA 3ERYA 1N5AA 4PJGA 5L2KA 1S8DA 3DX6A 3P4MA 3KPOA 3QUKA 1AKJA 4L4TA 3BW9A 3VXRA 1RK0A 3HE6A 3MV8A 4ZUUA 4JRYA 4U1LA 3UTSA 1FFNA 1N3NA 3E6FA 1CD1A 3WL9A 2ZSWA 5C0CA 1QSFA 2VLJA 4PJHA 3W0WA 1G7QA 1QVOA 2CIIA 2JCCA 4F7PA 1GZPA 2C7UA 1BIIA 1C16A 3TBWA 3MYJA 3KPPA 4HUXA 3TPUE 4D0BA 1B0GA 3FFCA 5BXFA 2ZOLA 3GMLA 2BSTA 4G9DA 1I1FA 4PG2A 5E8OA 2Q7YA 3DXAA 4PGDA 3GSNH 2CIKA 4PRNA 1XR9A 3ECBA 3RGVC 5MENA 4EN3C 1KJMA 5HHMA 3GIVA 1T1YA 2GAZA 1T20A 1WBYA 1B0RA 2MHAA 5EU5A 4MNGA 5F9JA 4G8GA 3KPMA 3OV6A 2V2WA 1UXSA 3D18A 4CW1A 3LV3A 3DX7A 5DEFA 2OL3H 4HS3A 1W72A 3I6LD 4NQEA 3VFVA 3MRQA 1ZHNA 3UBXA 4JFQA 1B3JA 4PRDA 5GSVA 4UQ2A 3UTQA 3BWAA 3D2UA 1A1NA 3FQRA 3O3AA 3TBVA 5HHPA 5L2JA 3RWHA 4HV8A 2P5EA 3UTTA 5IB4A 2PO6A 2BNQA 3TVMA 2VLKA 1R3HA 4D0DA 4PGEA 5C07A 3AM8A 5IEHA 4JQXA 3SKOA 5C0FA 3VFOA 2FYYA 3TF7A 1T80A 1CE6A 1VGKA 3QI9A 4ZUTA 1ZS8A 4CVXA 5C0AA 3H7BA 1VACA 4NNXA 3RL2A 4MVBA 3DMMA 3QDJA 2X4OA 2X4PA 2A83A 4FFEX 2CKBH 3LKQA 4ZUVA 3P9MA 1AGDA 4L3EA 4WDIA 5C0BA 2GT9A 1I1YA 1LQVA 3KPSA 5C0DA 3DX8A 3P4NA 4X6FA 5C0JA 4Y4FA 2BSRA 3AU1A 5D5MA 3TIDA 3QDMA 3ROLA 3MRKA 1JE6A 1HSBA 4MJ6A 4PV8A 3HPJA 3MRBA 3PWUA 4U1KA 3LKOA 1FFOA 1I1AA 3GSWA 2WY3A 3ILPA 3BP7A 3L3GA 1JUFA 1LEKA 3HE7A 1BQHA 3O9WA 1WBXA 3MV9A 5IROA 2YPLA 3JVGA 1E28A 2X4RA 3VRJA 4GUPA 4O2CA 1A9EA 3QUYA 4X6DA 3KWWA 2X4NA 1T1XA 3FT2A 4HUVA 3MGTA 5D2LA 5E00A 4PJDA 4PP8C 1HSAA 1HOCA 1EEYA 3O8XA 3RZCA 5C0EA 4LHUA 3MRRA 2UWEA 3VRIA 2DYPA 3QQ4A 4N8VA 3B3IA 1ZHLA 3MRMA 3P9LA 4I4WA 3BZFA 4PJFA 4PJAA 3VCLA 1P7QA 3BO8A 2BCKA 1ZHKA 5EO0A 4CVZA 3MROA 3TIEA 3LKPA 3GMRA 1DUYA 1T7ZA 3GSOA 5BJTA 3D39A 3JTTA 5IB1A 3X12A 3C8KA 5MERA 3D25A 1FZOA 3GSUA 5HHOA 1AGCA 3BEVA 4ELMA 4APQA 3SJVA 4QRUA 1QQDA 1IM9A 5D9SA 5E8NA 3BZEA 1NAMH 1YN7A 4PJ5A 1HHGA 1Q94A 5EU4A 2VE6A 4QRPA 3MRFA 3KYOA 4IRSA 3T8XA 3TBYA 1QRNA 3SKMA 1T0MA 4Z76A 1K8DA 3H9HA
chains in the Genus database with same CATH superfamily
3P4OA 1FO0H 4LCYA 2XFXA 3MR9A 1T7WA 4PREA 3GSVA 1S7SA 3IXAA 4MJIA 4F7TA 1QSEA 2BSSA 3ARFA 4F7EA 1S7TA 4PV9A 1KPVA 3TFKA 4L29A 3V5DA 2HJLA 3VWJA 5IVXA 3L3JA 3LKSA 5IEKA 4U1HA 4U1MA 4N0FA 4U1NA 3RWEA 3VXOA 1ZT7A 4JQVA 4IIQC 4QOKA 2BVQA 2GTWA 4U1SA 1W0VA 5D7JC 3S6CA 3V5KA 1JGDA 1FG2A 3OXSA 1P1ZA 2FZ3A 3PWNA 1HHKA 4Y4KA 3T1FA 5EUOA 3KPLA 4NQVA 3VXSA 3LN5A 1NANH 4NNYA 5IM7A 5FDWA 2E7LE 2O5NA 5INDA 4NO2A 1RK1A 4NT6A 3SDCA 4NO3A 4U6XA 5HGAA 1HHJA 3NFNA 1ZHBA 5IB2A 2AKRA 4PDCE 4V3EB 3OXRA 3QQ3A 1AGFA 3X11A 5B39A 1AO7A 3FQNA 1JGEA 3BXNA 3BGMA 4WU7A 5J6GA 1OSZA 2F74A 1HHIA 4PJ8A 4WWKC 4Y2DA 4Z77A 3OX8A 1MHCA 1RJYA 2YEZA 4ZUSA 1EXUA 5MEQA 1KJVA 2CLRA 5J6HA 4IRJA 4Y4HA 3VWKA 4WU5A 3GJFA 1WBZA 5FKPA 3VXUA 1I7RA 2CLZA 3O3DA 3P77A 3RUGA 1S7UA 1Z5LA 3GMMA 5D7IA 1BD2A 3RTQA 5C0IA 3HUJA 3I6KA 4HUWA 4U1IA 3FTGA 3BH8A 5ENWA 4NQDA 1E27A 5IB5A 3CCHA 3TO2A 1ONQA 3KLAA 1XR8A 1N2RA 1A9BA 4UQ3A 3QFDA 3BEWA 4XXCA 3RWGA 1DE4A 2FIKA 3MRHA 3FQWA 4PRHA 3TBTA 1OF2A 5F1NA 4ZUWA 2H6PA 1S9XA 3MRNA 3VJ6A 1M6OA 1L8JA 3H9SA 2ZSVA 3TO4A 1XH3A 5J1AA 4PJBA 4L8CA 3L3DA 3AREA 3KPQA 4K7FA 1KCGC 1JPFA 1T22A 4MX7A 2GUOA 1GZQA 4MJ5A 2AXFA 2BVOA 4V3DB 1LDPH 1PQZA 1FFPA 3MRPA 1K5NA 2OI9A 3MRJA 5DEGA 1T21A 4HKJA 1VADA 2NYKA 5DDHA 1I7UA 1S9WA 3GMQA 2AXGA 5FA4A 2HLAA 4X6CA 5MEPA 2FWOA 1S7VA 1QLFA 3MRDA 5F1IA 3U0PA 2VAAA 2AV7A 3FONA 3L3KA 3O3EA 1KJ2H 3SDAA 2X4QA 4PJEA 2HN7A 3CDGA 3P73A 3REWA 4S0UC 4NHUE 1EFXA 3FQXA 5HYJA 4QRSA 3M17A 4JFOA 3BHBA 3PWVA 3VFRA 1UQSA 2AV1A 3VFSA 5JHDA 5EU6A 3HCVA 1UXWA 4Z78A 4JFPA 1T7YA 1YDPA 2GITA 1P4LA 2X70A 5HGDA 3G08A 1S7XA 2V2XA 1S7WA 3WS3A 3X13A 4FTVA 5GSRA 5FA3A 4LCWA 1LD9A 4QRTA 3BUYA 2RFXA 5D2NA 3MRCA 3QEQA 5HHNA 1N59A 4ZFZA 5SWQA 3GMNA 5BRZA 3VFNA 1LK2A 2H26A 3QZWA 3TBSA 3SPVA 1JHTA 5E8PA 4L8SC 3DBXA 1ED3A 2ESVA 4Y16A 4L3CA 1S7RA 2D31A 3QDGA 3ARGA 3FQUA 2BNRA 2VLRA 3QUZA 4IHOA 3ROOA 1KBGH 2VLLA 3JTSA 3MV7A 1T7XA 1T0NA 1X7QA 3QUXA 3RL1A 4HX1A 1M05A 1SYSA 3VFMA 1OGTA 1I7TA 2NX5A 2X4TA 3GMPA 5AD0A 3GSQA 5ISZA 4QRRA 3RWCA 5HGHA 4PJIA 3MA7A 1BZ9A 1KTLA 3MRGA 3RWIA 3WUWA 1KPRA 3TJHA 2ZOKA 1W0WA 3GSXA 1G7PA 4G42A 3FOMA 4N5EA 3L3HA 1T7VA 3QFJA 3TA3A 4PR5A 1HYRC 3VFUA 1IM3A 2GJ6A 3FT3A 4MXQA 1ZAGA 2GTZA 4U1JA 4PG9A 5D7LA 3VXNA 1QEWA 1LP9A 3MGOA 3HAEA 2F54A 4PJ7A 3BP4A 1FZJA 3QULA 1QO3A 1U58A 2CLVA 3IT8D 3VXPA 1S7QA 5C09A 1CG9A 1I4FA 5EOTA 4PRPA 1QR1A 2YPKA 3BH9A 2VABA 3PWJA 4JFFA 3X14A 2J8UA 5C08A 3UPRA 5C0GA 4HUUA 1T1WA 1TMCA 2X4SA 4N0UA 3FOLA 2HJKA 3CH1A 5EFIA 5HHQA 1HHHA 4G9FA 3PWPA 1SYVA 5EU3A 1KPUA 1TVBA 2BVPA 5MEOA 1S9YA 3KYNA 3O3BA 1JFMA 5B38A 2XPGA 3CVHA 2F53A 3SDDA 3PQYA 4G8IA 4F7CA 2PYEA 3VXMA 4G59A 4ONOA 4PGCA 1LEGA 4F7MA 4GKNA 3E6HA 3VFWA 5HGBA 1EEZA 3MRIA 4E0RA 3KPNA 1INQA 3PABA 5ACZA 3L9RA 1A1MA 1A1OA 3D3VA 3RWFA 3VFTA 4MS8A 3ES6A 3M1BA 3L3IA 1YPZA 4O2FA 4NQXA 3GMOA 3ARDA 4NQCA 3KXFA 4N0CA 5SWSA 2FO4A 4LCCC 4PJCA 4MQ7A 1XZ0A 1DDHA 3BVNA 3RWJA 3WLBA 5H94A 3E2HA 3MRLA 4G43A 4K71B 4GKSA 1MWAH 4L4VA 1FZMA 4L8DA 4PGBA 4PRIA 4U6YA 1T1ZA 4WO4A 3SDXA 4ZAKA 3SCMA 3WS6A 3I6GA 4HWZA 3C9NA 4NSKA 3O4LA 4EUPA 3VFPA 3VH8A 1JF1A 4LNRA 1DUZA 4I48A 2X4UA 2AK4A 3ARBA 1AGBA 3PWLA 4NO5A 1MI5A 3LKRA 4JO8A 5EO1A 1OGAA 5F7DA 3FT4A 3HLAA 3FRUA 3MREA 4X6EA 1ZT4A 4MNQA 1G6RH 1TVHA 4PRAA 1A6ZA 3DTXA 4WW2C 3W39A 4JRXA 4L8BA 3TZVC 3FQTA 4JFDA 4E5XA 1KJ3H 4O2EA 1RJZA 1ZVSA 4PJXA 5E9DA 4PRBA 4JFEA 4WUUA 5BS0A 3LN4A 1YN6A 5INCA 3V5HA 1FZKA 5IB3A 3CZFA 4L9LC 4EI5A 1MHEA 3HG1A 1JPGA 3CPLA 5SWZA 3LKNA 1NEZA 3ILQC 3GSRA 3CC5A 1AGEA 3RWDA 3TN0A 4D0CA 3B6SA 1ZT1A 3KPRA 5E6IC 5C9JA 2P5WA 3E3QA 3JTCA 4NO0A 4PJ9A 2NW3A 4WJ5A 1ZSDA 4QRQA 3ERYA 1N5AA 4PJGA 5L2KA 1S8DA 3DX6A 3P4MA 3KPOA 3QUKA 1AKJA 4L4TA 3BW9A 3VXRA 1RK0A 3HE6A 3MV8A 4ZUUA 4JRYA 4U1LA 3UTSA 1FFNA 1N3NA 3E6FA 1CD1A 3WL9A 2ZSWA 5C0CA 1QSFA 2VLJA 4PJHA 3W0WA 1G7QA 1QVOA 2CIIA 2JCCA 4F7PA 1GZPA 2C7UA 1BIIA 1C16A 3TBWA 3MYJA 3KPPA 4HUXA 3TPUE 4D0BA 1B0GA 3FFCA 5BXFA 2ZOLA 3GMLA 2BSTA 4G9DA 3I0TA 1I1FA 4PG2A 5E8OA 2Q7YA 3DXAA 4PGDA 3GSNH 2CIKA 4PRNA 1XR9A 3ECBA 3RGVC 5MENA 4EN3C 1KJMA 5HHMA 3GIVA 1T1YA 2GAZA 1T20A 1WBYA 1B0RA 2MHAA 5EU5A 4MNGA 5F9JA 4G8GA 3KPMA 3OV6A 2V2WA 1UXSA 3D18A 4CW1A 3LV3A 3DX7A 5DEFA 2OL3H 4HS3A 1W72A 3I6LD 4NQEA 3VFVA 3MRQA 1ZHNA 3UBXA 4JFQA 1B3JA 4PRDA 5GSVA 4UQ2A 3UTQA 3BWAA 3D2UA 1A1NA 3FQRA 3O3AA 3TBVA 5HHPA 5L2JA 3RWHA 4HV8A 2P5EA 3UTTA 5IB4A 2PO6A 2BNQA 3TVMA 2VLKA 1R3HA 4D0DA 4PGEA 5C07A 3AM8A 5IEHA 4JQXA 3SKOA 5C0FA 3VFOA 2FYYA 3TF7A 1T80A 1CE6A 1VGKA 3QI9A 4ZUTA 1ZS8A 4CVXA 5C0AA 3H7BA 1VACA 4NNXA 3RL2A 4MVBA 3DMMA 3QDJA 2X4OA 2X4PA 2A83A 4FFEX 2CKBH 3LKQA 4ZUVA 3P9MA 1AGDA 4L3EA 4WDIA 5C0BA 2GT9A 1I1YA 1LQVA 3KPSA 5C0DA 3DX8A 3P4NA 4X6FA 5C0JA 4Y4FA 2BSRA 3AU1A 5D5MA 3TIDA 3QDMA 3ROLA 3MRKA 1JE6A 1HSBA 4MJ6A 4PV8A 3HPJA 3MRBA 3PWUA 4U1KA 3LKOA 1FFOA 1I1AA 3GSWA 2WY3A 3ILPA 3BP7A 3L3GA 1JUFA 1LEKA 3HE7A 1BQHA 3O9WA 1WBXA 3MV9A 5IROA 4BKWA 2YPLA 3JVGA 1E28A 2X4RA 3VRJA 4GUPA 4O2CA 1A9EA 3QUYA 4X6DA 3KWWA 2X4NA 1T1XA 3FT2A 4HUVA 3MGTA 5D2LA 5E00A 4PJDA 4PP8C 1HSAA 1HOCA 1EEYA 3O8XA 3RZCA 5C0EA 4LHUA 3MRRA 2UWEA 3VRIA 2DYPA 3QQ4A 4N8VA 3B3IA 1ZHLA 3MRMA 3P9LA 4I4WA 3BZFA 4PJFA 4PJAA 3VCLA 1P7QA 3BO8A 2BCKA 1ZHKA 5EO0A 4CVZA 3MROA 3TIEA 3LKPA 3GMRA 1DUYA 4G59C 1T7ZA 3GSOA 5BJTA 3D39A 3JTTA 5IB1A 3X12A 3C8KA 5MERA 3D25A 1FZOA 3GSUA 5HHOA 1AGCA 3BEVA 4ELMA 4APQA 3SJVA 2IA1A 4QRUA 1QQDA 1IM9A 5D9SA 5E8NA 3BZEA 1NAMH 1YN7A 4PJ5A 1HHGA 1Q94A 5EU4A 2VE6A 4QRPA 3MRFA 3KYOA 4IRSA 3T8XA 3TBYA 1QRNA 3SKMA 1T0MA 4Z76A 1K8DA 3H9HA
chains in the Genus database with same CATH topology
3P4OA 1FO0H 4LCYA 2XFXA 3MR9A 1T7WA 4PREA 3GSVA 1S7SA 3IXAA 4MJIA 4F7TA 1QSEA 2BSSA 3ARFA 4F7EA 1S7TA 4PV9A 1KPVA 3TFKA 4L29A 3V5DA 2HJLA 3VWJA 5IVXA 3L3JA 3LKSA 5IEKA 4U1HA 4U1MA 4N0FA 4U1NA 3RWEA 3VXOA 1ZT7A 4JQVA 4IIQC 4QOKA 2BVQA 2GTWA 4U1SA 1W0VA 5D7JC 3S6CA 3V5KA 1JGDA 1FG2A 3OXSA 1P1ZA 2FZ3A 3PWNA 1HHKA 4Y4KA 3T1FA 5EUOA 3KPLA 4NQVA 3VXSA 3LN5A 1NANH 4NNYA 5IM7A 5FDWA 2E7LE 5INDA 4NO2A 1RK1A 4NT6A 3SDCA 4NO3A 4U6XA 5HGAA 1HHJA 3NFNA 1ZHBA 5IB2A 2AKRA 4PDCE 4V3EB 3OXRA 3QQ3A 1AGFA 3X11A 5B39A 1AO7A 3FQNA 1JGEA 3BXNA 3BGMA 4WU7A 5J6GA 1OSZA 2F74A 1HHIA 4PJ8A 4WWKC 4Y2DA 4Z77A 3OX8A 1MHCA 1RJYA 2YEZA 4ZUSA 1EXUA 5MEQA 1KJVA 2CLRA 5J6HA 4IRJA 4Y4HA 3VWKA 4WU5A 3GJFA 1WBZA 5FKPA 3VXUA 1I7RA 2CLZA 3O3DA 3P77A 3RUGA 1S7UA 1Z5LA 3GMMA 5D7IA 1BD2A 3RTQA 5C0IA 3HUJA 3I6KA 4HUWA 4U1IA 3FTGA 3BH8A 5ENWA 4NQDA 1E27A 5IB5A 3CCHA 3TO2A 1ONQA 3KLAA 1XR8A 1N2RA 1A9BA 4UQ3A 3QFDA 3BEWA 4XXCA 3RWGA 1DE4A 2FIKA 3MRHA 3FQWA 4PRHA 3TBTA 1OF2A 5F1NA 4ZUWA 2H6PA 1S9XA 3MRNA 3VJ6A 1M6OA 1L8JA 3H9SA 2ZSVA 3TO4A 1XH3A 5J1AA 4PJBA 4L8CA 3L3DA 3AREA 3KPQA 4K7FA 1KCGC 1JPFA 1T22A 4MX7A 2GUOA 1GZQA 4MJ5A 2AXFA 2BVOA 4V3DB 1LDPH 1PQZA 1FFPA 3MRPA 1K5NA 2OI9A 3MRJA 5DEGA 1T21A 4HKJA 1VADA 5DDHA 1I7UA 1S9WA 3GMQA 2AXGA 5FA4A 2HLAA 4X6CA 5MEPA 2FWOA 1S7VA 1QLFA 3MRDA 5F1IA 3U0PA 2VAAA 2AV7A 3FONA 3L3KA 3O3EA 1KJ2H 3SDAA 2X4QA 4PJEA 2HN7A 3CDGA 3P73A 3REWA 4S0UC 4NHUE 1EFXA 3FQXA 5HYJA 4QRSA 3M17A 4JFOA 3BHBA 3PWVA 3VFRA 1UQSA 2AV1A 3VFSA 5JHDA 5EU6A 3HCVA 1UXWA 4Z78A 4JFPA 1T7YA 1YDPA 2GITA 1P4LA 2X70A 5HGDA 3G08A 1S7XA 2V2XA 1S7WA 3WS3A 3X13A 4FTVA 5GSRA 5FA3A 4LCWA 1LD9A 4QRTA 3BUYA 2RFXA 5D2NA 3MRCA 3QEQA 5HHNA 1N59A 4ZFZA 5SWQA 3GMNA 5BRZA 3VFNA 1LK2A 2H26A 3QZWA 3TBSA 3SPVA 1JHTA 5E8PA 4L8SC 3DBXA 1ED3A 2ESVA 4Y16A 4L3CA 1S7RA 2D31A 3QDGA 3ARGA 3FQUA 2BNRA 2VLRA 3QUZA 4IHOA 3ROOA 1KBGH 2VLLA 3JTSA 3MV7A 1T7XA 1T0NA 1X7QA 3QUXA 3RL1A 4HX1A 1M05A 1SYSA 3VFMA 1OGTA 1I7TA 2NX5A 2X4TA 3GMPA 5AD0A 3GSQA 5ISZA 4QRRA 3RWCA 5HGHA 4PJIA 3MA7A 1BZ9A 1KTLA 3MRGA 3RWIA 3WUWA 1KPRA 3TJHA 2ZOKA 1W0WA 3GSXA 1G7PA 4G42A 3FOMA 4N5EA 3L3HA 1T7VA 3QFJA 3TA3A 4PR5A 1HYRC 3VFUA 1IM3A 2GJ6A 3FT3A 4MXQA 1ZAGA 2GTZA 4U1JA 4PG9A 5D7LA 3VXNA 1QEWA 1LP9A 3MGOA 3HAEA 2F54A 4PJ7A 3BP4A 1FZJA 3QULA 1QO3A 1U58A 2CLVA 3IT8D 3VXPA 1S7QA 5C09A 1CG9A 1I4FA 5EOTA 4PRPA 1QR1A 2YPKA 3BH9A 2VABA 3PWJA 4JFFA 3X14A 2J8UA 5C08A 3UPRA 5C0GA 4HUUA 1T1WA 1TMCA 2X4SA 4N0UA 3FOLA 2HJKA 3CH1A 5EFIA 5HHQA 1HHHA 4G9FA 3PWPA 1SYVA 5EU3A 1KPUA 1TVBA 2BVPA 5MEOA 1S9YA 3KYNA 3O3BA 1JFMA 5B38A 2XPGA 3CVHA 2F53A 3SDDA 3PQYA 4G8IA 4F7CA 2PYEA 3VXMA 4G59A 4ONOA 4PGCA 1LEGA 4F7MA 4GKNA 3E6HA 3VFWA 5HGBA 1EEZA 3MRIA 4E0RA 3KPNA 1INQA 3PABA 5ACZA 3L9RA 1A1MA 1A1OA 3D3VA 3RWFA 3VFTA 4MS8A 3ES6A 3M1BA 3L3IA 1YPZA 4O2FA 4NQXA 3GMOA 3ARDA 4NQCA 3KXFA 4N0CA 5SWSA 2FO4A 4LCCC 4PJCA 4MQ7A 1XZ0A 1DDHA 3BVNA 3RWJA 3WLBA 5H94A 3E2HA 3MRLA 4G43A 4K71B 4GKSA 1MWAH 4L4VA 1FZMA 4L8DA 4PGBA 4PRIA 4U6YA 1T1ZA 4WO4A 3SDXA 4ZAKA 3SCMA 3WS6A 3I6GA 4HWZA 3C9NA 4NSKA 3O4LA 4EUPA 3VFPA 3VH8A 1JF1A 4LNRA 1DUZA 4I48A 2X4UA 2AK4A 3ARBA 1AGBA 3PWLA 4NO5A 1MI5A 3LKRA 5EO1A 1OGAA 5F7DA 3FT4A 3HLAA 3FRUA 3MREA 4X6EA 1ZT4A 4MNQA 1G6RH 1TVHA 4PRAA 1A6ZA 3DTXA 4WW2C 3W39A 4JRXA 4L8BA 3TZVC 3FQTA 4JFDA 4E5XA 1KJ3H 4O2EA 1RJZA 1ZVSA 4PJXA 5E9DA 4PRBA 4JFEA 4WUUA 5BS0A 3LN4A 1YN6A 5INCA 3V5HA 1FZKA 5IB3A 3CZFA 4L9LC 4EI5A 1MHEA 3HG1A 1JPGA 3CPLA 5SWZA 3LKNA 1NEZA 3ILQC 3GSRA 3CC5A 1AGEA 3RWDA 3TN0A 4D0CA 3B6SA 1ZT1A 3KPRA 5E6IC 5C9JA 2P5WA 3E3QA 3JTCA 4NO0A 4PJ9A 2NW3A 4WJ5A 1ZSDA 4QRQA 3ERYA 1N5AA 4PJGA 5L2KA 1S8DA 3DX6A 3P4MA 3KPOA 3QUKA 1AKJA 4L4TA 3BW9A 3VXRA 1RK0A 3HE6A 3MV8A 4ZUUA 4JRYA 4U1LA 3UTSA 1FFNA 1N3NA 3E6FA 1CD1A 3WL9A 2ZSWA 5C0CA 1QSFA 2VLJA 4PJHA 3W0WA 1G7QA 1QVOA 2CIIA 2JCCA 4F7PA 1GZPA 2C7UA 1BIIA 1C16A 3TBWA 3MYJA 3KPPA 4HUXA 3TPUE 4D0BA 1B0GA 3FFCA 5BXFA 2ZOLA 3GMLA 2BSTA 4G9DA 1I1FA 4PG2A 5E8OA 2Q7YA 3DXAA 4PGDA 3GSNH 2CIKA 4PRNA 1XR9A 3ECBA 3RGVC 5MENA 4EN3C 1KJMA 5HHMA 3GIVA 1T1YA 2GAZA 1T20A 1WBYA 1B0RA 2MHAA 5EU5A 4MNGA 5F9JA 4G8GA 3KPMA 3OV6A 2V2WA 1UXSA 3D18A 4CW1A 3LV3A 3DX7A 5DEFA 2OL3H 4HS3A 1W72A 3I6LD 4NQEA 3VFVA 3MRQA 1ZHNA 3UBXA 4JFQA 1B3JA 4PRDA 5GSVA 4UQ2A 3UTQA 3BWAA 3D2UA 1A1NA 3FQRA 3O3AA 3TBVA 5HHPA 5L2JA 3RWHA 4HV8A 2P5EA 3UTTA 5IB4A 2PO6A 2BNQA 3TVMA 2VLKA 1R3HA 4D0DA 4PGEA 5C07A 3AM8A 5IEHA 4JQXA 3SKOA 5C0FA 3VFOA 2FYYA 3TF7A 1T80A 1CE6A 1VGKA 3QI9A 4ZUTA 1ZS8A 4CVXA 5C0AA 3H7BA 1VACA 4NNXA 3RL2A 4MVBA 3DMMA 3QDJA 2X4OA 2X4PA 2A83A 4FFEX 2CKBH 3LKQA 4ZUVA 3P9MA 1AGDA 4L3EA 4WDIA 5C0BA 2GT9A 1I1YA 1LQVA 3KPSA 5C0DA 3DX8A 3P4NA 4X6FA 5C0JA 4Y4FA 2BSRA 3AU1A 5D5MA 3TIDA 3QDMA 3ROLA 3MRKA 1JE6A 1HSBA 4MJ6A 4PV8A 3HPJA 3MRBA 3PWUA 4U1KA 3LKOA 1FFOA 1I1AA 3GSWA 2WY3A 3ILPA 3BP7A 3L3GA 1JUFA 1LEKA 3HE7A 1BQHA 3O9WA 1WBXA 3MV9A 5IROA 2YPLA 3JVGA 1E28A 2X4RA 3VRJA 4GUPA 4O2CA 1A9EA 3QUYA 4X6DA 3KWWA 2X4NA 1T1XA 3FT2A 4HUVA 3MGTA 5D2LA 5E00A 4PJDA 4PP8C 1HSAA 1HOCA 1EEYA 3O8XA 3RZCA 5C0EA 4LHUA 3MRRA 2UWEA 3VRIA 2DYPA 3QQ4A 4N8VA 3B3IA 1ZHLA 3MRMA 3P9LA 4I4WA 3BZFA 4PJFA 4PJAA 3VCLA 1P7QA 3BO8A 2BCKA 1ZHKA 5EO0A 4CVZA 3MROA 3TIEA 3LKPA 3GMRA 1DUYA 1T7ZA 3GSOA 5BJTA 3D39A 3JTTA 5IB1A 3X12A 3C8KA 5MERA 3D25A 1FZOA 3GSUA 5HHOA 1AGCA 3BEVA 4ELMA 4APQA 3SJVA 4QRUA 1QQDA 1IM9A 5D9SA 5E8NA 3BZEA 1NAMH 1YN7A 4PJ5A 1HHGA 1Q94A 5EU4A 2VE6A 4QRPA 3MRFA 3KYOA 4IRSA 3T8XA 3TBYA 1QRNA 3SKMA 1T0MA 4Z76A 1K8DA 3H9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4O A;  1FO0 H;  4LCY A;  2XFX A;  3MR9 A;  1T7W A;  4PRE A;  3GSV A;  1S7S A;  3IXA A;  4MJI A;  4F7T A;  1QSE A;  2BSS A;  3ARF A;  4F7E A;  1S7T A;  4PV9 A;  1KPV A;  3TFK A;  4L29 A;  3V5D A;  2HJL A;  3VWJ A;  5IVX A;  3L3J A;  3LKS A;  5IEK A;  4U1H A;  4U1M A;  4N0F A;  4U1N A;  3RWE A;  3VXO A;  1ZT7 A;  4JQV A;  4IIQ C;  4QOK A;  2BVQ A;  2GTW A;  4U1S A;  1W0V A;  5D7J C;  3S6C A;  3V5K A;  1JGD A;  1FG2 A;  3OXS A;  1P1Z A;  2FZ3 A;  3PWN A;  1HHK A;  4Y4K A;  3T1F A;  5EUO A;  3KPL A;  4NQV A;  3VXS A;  3LN5 A;  1NAN H;  4NNY A;  5IM7 A;  5FDW A;  2E7L E;  5IND A;  4NO2 A;  1RK1 A;  4NT6 A;  3SDC A;  4NO3 A;  4U6X A;  5HGA A;  1HHJ A;  3NFN A;  1ZHB A;  5IB2 A;  2AKR A;  4PDC E;  4V3E B;  3OXR A;  3QQ3 A;  1AGF A;  3X11 A;  5B39 A;  1AO7 A;  3FQN A;  1JGE A;  3BXN A;  3BGM A;  4WU7 A;  5J6G A;  1OSZ A;  2F74 A;  1HHI A;  4PJ8 A;  4WWK C;  4Y2D A;  4Z77 A;  3OX8 A;  1MHC A;  1RJY A;  2YEZ A;  4ZUS A;  1EXU A;  5MEQ A;  1KJV A;  2CLR A;  5J6H A;  4IRJ A;  4Y4H A;  3VWK A;  4WU5 A;  3GJF A;  1WBZ A;  5FKP A;  3VXU A;  1I7R A;  2CLZ A;  3O3D A;  3P77 A;  3RUG A;  1S7U A;  1Z5L A;  3GMM A;  5D7I A;  1BD2 A;  3RTQ A;  5C0I A;  3HUJ A;  3I6K A;  4HUW A;  4U1I A;  3FTG A;  3BH8 A;  5ENW A;  4NQD A;  1E27 A;  5IB5 A;  3CCH A;  3TO2 A;  1ONQ A;  3KLA A;  1XR8 A;  1N2R A;  1A9B A;  4UQ3 A;  3QFD A;  3BEW A;  4XXC A;  3RWG A;  1DE4 A;  2FIK A;  3MRH A;  3FQW A;  4PRH A;  3TBT A;  1OF2 A;  5F1N A;  4ZUW A;  2H6P A;  1S9X A;  3MRN A;  3VJ6 A;  1M6O A;  1L8J A;  3H9S A;  2ZSV A;  3TO4 A;  1XH3 A;  5J1A A;  4PJB A;  4L8C A;  3L3D A;  3ARE A;  3KPQ A;  4K7F A;  1KCG C;  1JPF A;  1T22 A;  4MX7 A;  2GUO A;  1GZQ A;  4MJ5 A;  2AXF A;  2BVO A;  4V3D B;  1LDP H;  1PQZ A;  1FFP A;  3MRP A;  1K5N A;  2OI9 A;  3MRJ A;  5DEG A;  1T21 A;  4HKJ A;  1VAD A;  5DDH A;  1I7U A;  1S9W A;  3GMQ A;  2AXG A;  5FA4 A;  2HLA A;  4X6C A;  5MEP A;  2FWO A;  1S7V A;  1QLF A;  3MRD A;  5F1I A;  3U0P A;  2VAA A;  2AV7 A;  3FON A;  3L3K A;  3O3E A;  1KJ2 H;  3SDA A;  2X4Q A;  4PJE A;  2HN7 A;  3CDG A;  3P73 A;  3REW A;  4S0U C;  4NHU E;  1EFX A;  3FQX A;  5HYJ A;  4QRS A;  3M17 A;  4JFO A;  3BHB A;  3PWV A;  3VFR A;  1UQS A;  2AV1 A;  3VFS A;  5JHD A;  5EU6 A;  3HCV A;  1UXW A;  4Z78 A;  4JFP A;  1T7Y A;  1YDP A;  2GIT A;  1P4L A;  2X70 A;  5HGD A;  3G08 A;  1S7X A;  2V2X A;  1S7W A;  3WS3 A;  3X13 A;  4FTV A;  5GSR A;  5FA3 A;  4LCW A;  1LD9 A;  4QRT A;  3BUY A;  2RFX A;  5D2N A;  3MRC A;  3QEQ A;  5HHN A;  1N59 A;  4ZFZ A;  5SWQ A;  3GMN A;  5BRZ A;  3VFN A;  1LK2 A;  2H26 A;  3QZW A;  3TBS A;  3SPV A;  1JHT A;  5E8P A;  4L8S C;  3DBX A;  1ED3 A;  2ESV A;  4Y16 A;  4L3C A;  1S7R A;  2D31 A;  3QDG A;  3ARG A;  3FQU A;  2BNR A;  2VLR A;  3QUZ A;  4IHO A;  3ROO A;  1KBG H;  2VLL A;  3JTS A;  3MV7 A;  1T7X A;  1T0N A;  1X7Q A;  3QUX A;  3RL1 A;  4HX1 A;  1M05 A;  1SYS A;  3VFM A;  1OGT A;  1I7T A;  2NX5 A;  2X4T A;  3GMP A;  5AD0 A;  3GSQ A;  5ISZ A;  4QRR A;  3RWC A;  5HGH A;  4PJI A;  3MA7 A;  1BZ9 A;  1KTL A;  3MRG A;  3RWI A;  3WUW A;  1KPR A;  3TJH A;  2ZOK A;  1W0W A;  3GSX A;  1G7P A;  4G42 A;  3FOM A;  4N5E A;  3L3H A;  1T7V A;  3QFJ A;  3TA3 A;  4PR5 A;  1HYR C;  3VFU A;  1IM3 A;  2GJ6 A;  3FT3 A;  4MXQ A;  1ZAG A;  2GTZ A;  4U1J A;  4PG9 A;  5D7L A;  3VXN A;  1QEW A;  1LP9 A;  3MGO A;  3HAE A;  2F54 A;  4PJ7 A;  3BP4 A;  1FZJ A;  3QUL A;  1QO3 A;  1U58 A;  2CLV A;  3IT8 D;  3VXP A;  1S7Q A;  5C09 A;  1CG9 A;  1I4F A;  5EOT A;  4PRP A;  1QR1 A;  2YPK A;  3BH9 A;  2VAB A;  3PWJ A;  4JFF A;  3X14 A;  2J8U A;  5C08 A;  3UPR A;  5C0G A;  4HUU A;  1T1W A;  1TMC A;  2X4S A;  4N0U A;  3FOL A;  2HJK A;  3CH1 A;  5EFI A;  5HHQ A;  1HHH A;  4G9F A;  3PWP A;  1SYV A;  5EU3 A;  1KPU A;  1TVB A;  2BVP A;  5MEO A;  1S9Y A;  3KYN A;  3O3B A;  1JFM A;  5B38 A;  2XPG A;  3CVH A;  2F53 A;  3SDD A;  3PQY A;  4G8I A;  4F7C A;  2PYE A;  3VXM A;  4G59 A;  4ONO A;  4PGC A;  1LEG A;  4F7M A;  4GKN A;  3E6H A;  3VFW A;  5HGB A;  1EEZ A;  3MRI A;  4E0R A;  3KPN A;  1INQ A;  3PAB A;  5ACZ A;  3L9R A;  1A1M A;  1A1O A;  3D3V A;  3RWF A;  3VFT A;  4MS8 A;  3ES6 A;  3M1B A;  3L3I A;  1YPZ A;  4O2F A;  4NQX A;  3GMO A;  3ARD A;  4NQC A;  3KXF A;  4N0C A;  5SWS A;  2FO4 A;  4LCC C;  4PJC A;  4MQ7 A;  1XZ0 A;  1DDH A;  3BVN A;  3RWJ A;  3WLB A;  5H94 A;  3E2H A;  3MRL A;  4G43 A;  4K71 B;  4GKS A;  1MWA H;  4L4V A;  1FZM A;  4L8D A;  4PGB A;  4PRI A;  4U6Y A;  1T1Z A;  4WO4 A;  3SDX A;  4ZAK A;  3SCM A;  3WS6 A;  3I6G A;  4HWZ A;  3C9N A;  4NSK A;  3O4L A;  4EUP A;  3VFP A;  3VH8 A;  1JF1 A;  4LNR A;  1DUZ A;  4I48 A;  2X4U A;  2AK4 A;  3ARB A;  1AGB A;  3PWL A;  4NO5 A;  1MI5 A;  3LKR A;  5EO1 A;  1OGA A;  5F7D A;  3FT4 A;  3HLA A;  3FRU A;  3MRE A;  4X6E A;  1ZT4 A;  4MNQ A;  1G6R H;  1TVH A;  4PRA A;  1A6Z A;  3DTX A;  4WW2 C;  3W39 A;  4JRX A;  4L8B A;  3TZV C;  3FQT A;  4JFD A;  4E5X A;  1KJ3 H;  4O2E A;  1RJZ A;  1ZVS A;  4PJX A;  5E9D A;  4PRB A;  4JFE A;  4WUU A;  5BS0 A;  3LN4 A;  1YN6 A;  5INC A;  3V5H A;  1FZK A;  5IB3 A;  3CZF A;  4L9L C;  4EI5 A;  1MHE A;  3HG1 A;  1JPG A;  3CPL A;  5SWZ A;  3LKN A;  1NEZ A;  3ILQ C;  3GSR A;  3CC5 A;  1AGE A;  3RWD A;  3TN0 A;  4D0C A;  3B6S A;  1ZT1 A;  3KPR A;  5E6I C;  5C9J A;  2P5W A;  3E3Q A;  3JTC A;  4NO0 A;  4PJ9 A;  2NW3 A;  4WJ5 A;  1ZSD A;  4QRQ A;  3ERY A;  1N5A A;  4PJG A;  5L2K A;  1S8D A;  3DX6 A;  3P4M A;  3KPO A;  3QUK A;  1AKJ A;  4L4T A;  3BW9 A;  3VXR A;  1RK0 A;  3HE6 A;  3MV8 A;  4ZUU A;  4JRY A;  4U1L A;  3UTS A;  1FFN A;  1N3N A;  3E6F A;  1CD1 A;  3WL9 A;  2ZSW A;  5C0C A;  1QSF A;  2VLJ A;  4PJH A;  3W0W A;  1G7Q A;  1QVO A;  2CII A;  2JCC A;  4F7P A;  1GZP A;  2C7U A;  1BII A;  1C16 A;  3TBW A;  3MYJ A;  3KPP A;  4HUX A;  3TPU E;  4D0B A;  1B0G A;  3FFC A;  5BXF A;  2ZOL A;  3GML A;  2BST A;  4G9D A;  1I1F A;  4PG2 A;  5E8O A;  2Q7Y A;  3DXA A;  4PGD A;  3GSN H;  2CIK A;  4PRN A;  1XR9 A;  3ECB A;  3RGV C;  5MEN A;  4EN3 C;  1KJM A;  5HHM A;  3GIV A;  1T1Y A;  2GAZ A;  1T20 A;  1WBY A;  1B0R A;  2MHA A;  5EU5 A;  4MNG A;  5F9J A;  4G8G A;  3KPM A;  3OV6 A;  2V2W A;  1UXS A;  3D18 A;  4CW1 A;  3LV3 A;  3DX7 A;  5DEF A;  2OL3 H;  4HS3 A;  1W72 A;  3I6L D;  4NQE A;  3VFV A;  3MRQ A;  1ZHN A;  3UBX A;  4JFQ A;  1B3J A;  4PRD A;  5GSV A;  4UQ2 A;  3UTQ A;  3BWA A;  3D2U A;  1A1N A;  3FQR A;  3O3A A;  3TBV A;  5HHP A;  5L2J A;  3RWH A;  4HV8 A;  2P5E A;  3UTT A;  5IB4 A;  2PO6 A;  2BNQ A;  3TVM A;  2VLK A;  1R3H A;  4D0D A;  4PGE A;  5C07 A;  3AM8 A;  5IEH A;  4JQX A;  3SKO A;  5C0F A;  3VFO A;  2FYY A;  3TF7 A;  1T80 A;  1CE6 A;  1VGK A;  3QI9 A;  4ZUT A;  1ZS8 A;  4CVX A;  5C0A A;  3H7B A;  1VAC A;  4NNX A;  3RL2 A;  4MVB A;  3DMM A;  3QDJ A;  2X4O A;  2X4P A;  2A83 A;  4FFE X;  2CKB H;  3LKQ A;  4ZUV A;  3P9M A;  1AGD A;  4L3E A;  4WDI A;  5C0B A;  2GT9 A;  1I1Y A;  1LQV A;  3KPS A;  5C0D A;  3DX8 A;  3P4N A;  4X6F A;  5C0J A;  4Y4F A;  2BSR A;  3AU1 A;  5D5M A;  3TID A;  3QDM A;  3ROL A;  3MRK A;  1JE6 A;  1HSB A;  4MJ6 A;  4PV8 A;  3HPJ A;  3MRB A;  3PWU A;  4U1K A;  3LKO A;  1FFO A;  1I1A A;  3GSW A;  2WY3 A;  3ILP A;  3BP7 A;  3L3G A;  1JUF A;  1LEK A;  3HE7 A;  1BQH A;  3O9W A;  1WBX A;  3MV9 A;  5IRO A;  2YPL A;  3JVG A;  1E28 A;  2X4R A;  3VRJ A;  4GUP A;  4O2C A;  1A9E A;  3QUY A;  4X6D A;  3KWW A;  2X4N A;  1T1X A;  3FT2 A;  4HUV A;  3MGT A;  5D2L A;  5E00 A;  4PJD A;  4PP8 C;  1HSA A;  1HOC A;  1EEY A;  3O8X A;  3RZC A;  5C0E A;  4LHU A;  3MRR A;  2UWE A;  3VRI A;  2DYP A;  3QQ4 A;  4N8V A;  3B3I A;  1ZHL A;  3MRM A;  3P9L A;  4I4W A;  3BZF A;  4PJF A;  4PJA A;  3VCL A;  1P7Q A;  3BO8 A;  2BCK A;  1ZHK A;  5EO0 A;  4CVZ A;  3MRO A;  3TIE A;  3LKP A;  3GMR A;  1DUY A;  1T7Z A;  3GSO A;  5BJT A;  3D39 A;  3JTT A;  5IB1 A;  3X12 A;  3C8K A;  5MER A;  3D25 A;  1FZO A;  3GSU A;  5HHO A;  1AGC A;  3BEV A;  4ELM A;  4APQ A;  3SJV A;  4QRU A;  1QQD A;  1IM9 A;  5D9S A;  5E8N A;  3BZE A;  1NAM H;  1YN7 A;  4PJ5 A;  1HHG A;  1Q94 A;  5EU4 A;  2VE6 A;  4QRP A;  3MRF A;  3KYO A;  4IRS A;  3T8X A;  3TBY A;  1QRN A;  3SKM A;  1T0M A;  4Z76 A;  1K8D A;  3H9H A; 
#chains in the Genus database with same CATH topology
 3P4O A;  1FO0 H;  4LCY A;  2XFX A;  3MR9 A;  1T7W A;  4PRE A;  3GSV A;  1S7S A;  3IXA A;  4MJI A;  4F7T A;  1QSE A;  2BSS A;  3ARF A;  4F7E A;  1S7T A;  4PV9 A;  1KPV A;  3TFK A;  4L29 A;  3V5D A;  2HJL A;  3VWJ A;  5IVX A;  3L3J A;  3LKS A;  5IEK A;  4U1H A;  4U1M A;  4N0F A;  4U1N A;  3RWE A;  3VXO A;  1ZT7 A;  4JQV A;  4IIQ C;  4QOK A;  2BVQ A;  2GTW A;  4U1S A;  1W0V A;  5D7J C;  3S6C A;  3V5K A;  1JGD A;  1FG2 A;  3OXS A;  1P1Z A;  2FZ3 A;  3PWN A;  1HHK A;  4Y4K A;  3T1F A;  5EUO A;  3KPL A;  4NQV A;  3VXS A;  3LN5 A;  1NAN H;  4NNY A;  5IM7 A;  5FDW A;  2E7L E;  2O5N A;  5IND A;  4NO2 A;  1RK1 A;  4NT6 A;  3SDC A;  4NO3 A;  4U6X A;  5HGA A;  1HHJ A;  3NFN A;  1ZHB A;  5IB2 A;  2AKR A;  4PDC E;  4V3E B;  3OXR A;  3QQ3 A;  1AGF A;  3X11 A;  5B39 A;  1AO7 A;  3FQN A;  1JGE A;  3BXN A;  3BGM A;  4WU7 A;  5J6G A;  1OSZ A;  2F74 A;  1HHI A;  4PJ8 A;  4WWK C;  4Y2D A;  4Z77 A;  3OX8 A;  1MHC A;  1RJY A;  2YEZ A;  4ZUS A;  1EXU A;  5MEQ A;  1KJV A;  2CLR A;  5J6H A;  4IRJ A;  4Y4H A;  3VWK A;  4WU5 A;  3GJF A;  1WBZ A;  5FKP A;  3VXU A;  1I7R A;  2CLZ A;  3O3D A;  3P77 A;  3RUG A;  1S7U A;  1Z5L A;  3GMM A;  5D7I A;  1BD2 A;  3RTQ A;  5C0I A;  3HUJ A;  3I6K A;  4HUW A;  4U1I A;  3FTG A;  3BH8 A;  5ENW A;  4NQD A;  1E27 A;  5IB5 A;  3CCH A;  3TO2 A;  1ONQ A;  3KLA A;  1XR8 A;  1N2R A;  1A9B A;  4UQ3 A;  3QFD A;  3BEW A;  4XXC A;  3RWG A;  1DE4 A;  2FIK A;  3MRH A;  3FQW A;  4PRH A;  3TBT A;  1OF2 A;  5F1N A;  4ZUW A;  2H6P A;  1S9X A;  3MRN A;  3VJ6 A;  1M6O A;  1L8J A;  3H9S A;  2ZSV A;  3TO4 A;  1XH3 A;  5J1A A;  4PJB A;  4L8C A;  3L3D A;  3ARE A;  3KPQ A;  4K7F A;  1KCG C;  1JPF A;  1T22 A;  4MX7 A;  2GUO A;  1GZQ A;  4MJ5 A;  2AXF A;  2BVO A;  4V3D B;  1LDP H;  1PQZ A;  1FFP A;  3MRP A;  1K5N A;  2OI9 A;  3MRJ A;  5DEG A;  1T21 A;  4HKJ A;  1VAD A;  2NYK A;  5DDH A;  1I7U A;  1S9W A;  3GMQ A;  2AXG A;  5FA4 A;  2HLA A;  4X6C A;  5MEP A;  2FWO A;  1S7V A;  1QLF A;  3MRD A;  5F1I A;  3U0P A;  2VAA A;  2AV7 A;  3FON A;  3L3K A;  3O3E A;  1KJ2 H;  3SDA A;  2X4Q A;  4PJE A;  2HN7 A;  3CDG A;  3P73 A;  3REW A;  4S0U C;  4NHU E;  1EFX A;  3FQX A;  5HYJ A;  4QRS A;  3M17 A;  4JFO A;  3BHB A;  3PWV A;  3VFR A;  1UQS A;  2AV1 A;  3VFS A;  5JHD A;  5EU6 A;  3HCV A;  1UXW A;  4Z78 A;  4JFP A;  1T7Y A;  1YDP A;  2GIT A;  1P4L A;  2X70 A;  5HGD A;  3G08 A;  1S7X A;  2V2X A;  1S7W A;  3WS3 A;  3X13 A;  4FTV A;  5GSR A;  5FA3 A;  4LCW A;  1LD9 A;  4QRT A;  3BUY A;  2RFX A;  5D2N A;  3MRC A;  3QEQ A;  5HHN A;  1N59 A;  4ZFZ A;  5SWQ A;  3GMN A;  5BRZ A;  3VFN A;  1LK2 A;  2H26 A;  3QZW A;  3TBS A;  3SPV A;  1JHT A;  5E8P A;  4L8S C;  3DBX A;  1ED3 A;  2ESV A;  4Y16 A;  4L3C A;  1S7R A;  2D31 A;  3QDG A;  3ARG A;  3FQU A;  2BNR A;  2VLR A;  3QUZ A;  4IHO A;  3ROO A;  1KBG H;  2VLL A;  3JTS A;  3MV7 A;  1T7X A;  1T0N A;  1X7Q A;  3QUX A;  3RL1 A;  4HX1 A;  1M05 A;  1SYS A;  3VFM A;  1OGT A;  1I7T A;  2NX5 A;  2X4T A;  3GMP A;  5AD0 A;  3GSQ A;  5ISZ A;  4QRR A;  3RWC A;  5HGH A;  4PJI A;  3MA7 A;  1BZ9 A;  1KTL A;  3MRG A;  3RWI A;  3WUW A;  1KPR A;  3TJH A;  2ZOK A;  1W0W A;  3GSX A;  1G7P A;  4G42 A;  3FOM A;  4N5E A;  3L3H A;  1T7V A;  3QFJ A;  3TA3 A;  4PR5 A;  1HYR C;  3VFU A;  1IM3 A;  2GJ6 A;  3FT3 A;  4MXQ A;  1ZAG A;  2GTZ A;  4U1J A;  4PG9 A;  5D7L A;  3VXN A;  1QEW A;  1LP9 A;  3MGO A;  3HAE A;  2F54 A;  4PJ7 A;  3BP4 A;  1FZJ A;  3QUL A;  1QO3 A;  1U58 A;  2CLV A;  3IT8 D;  3VXP A;  1S7Q A;  5C09 A;  1CG9 A;  1I4F A;  5EOT A;  4PRP A;  1QR1 A;  2YPK A;  3BH9 A;  2VAB A;  3PWJ A;  4JFF A;  3X14 A;  2J8U A;  5C08 A;  3UPR A;  5C0G A;  4HUU A;  1T1W A;  1TMC A;  2X4S A;  4N0U A;  3FOL A;  2HJK A;  3CH1 A;  5EFI A;  5HHQ A;  1HHH A;  4G9F A;  3PWP A;  1SYV A;  5EU3 A;  1KPU A;  1TVB A;  2BVP A;  5MEO A;  1S9Y A;  3KYN A;  3O3B A;  1JFM A;  5B38 A;  2XPG A;  3CVH A;  2F53 A;  3SDD A;  3PQY A;  4G8I A;  4F7C A;  2PYE A;  3VXM A;  4G59 A;  4ONO A;  4PGC A;  1LEG A;  4F7M A;  4GKN A;  3E6H A;  3VFW A;  5HGB A;  1EEZ A;  3MRI A;  4E0R A;  3KPN A;  1INQ A;  3PAB A;  5ACZ A;  3L9R A;  1A1M A;  1A1O A;  3D3V A;  3RWF A;  3VFT A;  4MS8 A;  3ES6 A;  3M1B A;  3L3I A;  1YPZ A;  4O2F A;  4NQX A;  3GMO A;  3ARD A;  4NQC A;  3KXF A;  4N0C A;  5SWS A;  2FO4 A;  4LCC C;  4PJC A;  4MQ7 A;  1XZ0 A;  1DDH A;  3BVN A;  3RWJ A;  3WLB A;  5H94 A;  3E2H A;  3MRL A;  4G43 A;  4K71 B;  4GKS A;  1MWA H;  4L4V A;  1FZM A;  4L8D A;  4PGB A;  4PRI A;  4U6Y A;  1T1Z A;  4WO4 A;  3SDX A;  4ZAK A;  3SCM A;  3WS6 A;  3I6G A;  4HWZ A;  3C9N A;  4NSK A;  3O4L A;  4EUP A;  3VFP A;  3VH8 A;  1JF1 A;  4LNR A;  1DUZ A;  4I48 A;  2X4U A;  2AK4 A;  3ARB A;  1AGB A;  3PWL A;  4NO5 A;  1MI5 A;  3LKR A;  4JO8 A;  5EO1 A;  1OGA A;  5F7D A;  3FT4 A;  3HLA A;  3FRU A;  3MRE A;  4X6E A;  1ZT4 A;  4MNQ A;  1G6R H;  1TVH A;  4PRA A;  1A6Z A;  3DTX A;  4WW2 C;  3W39 A;  4JRX A;  4L8B A;  3TZV C;  3FQT A;  4JFD A;  4E5X A;  1KJ3 H;  4O2E A;  1RJZ A;  1ZVS A;  4PJX A;  5E9D A;  4PRB A;  4JFE A;  4WUU A;  5BS0 A;  3LN4 A;  1YN6 A;  5INC A;  3V5H A;  1FZK A;  5IB3 A;  3CZF A;  4L9L C;  4EI5 A;  1MHE A;  3HG1 A;  1JPG A;  3CPL A;  5SWZ A;  3LKN A;  1NEZ A;  3ILQ C;  3GSR A;  3CC5 A;  1AGE A;  3RWD A;  3TN0 A;  4D0C A;  3B6S A;  1ZT1 A;  3KPR A;  5E6I C;  5C9J A;  2P5W A;  3E3Q A;  3JTC A;  4NO0 A;  4PJ9 A;  2NW3 A;  4WJ5 A;  1ZSD A;  4QRQ A;  3ERY A;  1N5A A;  4PJG A;  5L2K A;  1S8D A;  3DX6 A;  3P4M A;  3KPO A;  3QUK A;  1AKJ A;  4L4T A;  3BW9 A;  3VXR A;  1RK0 A;  3HE6 A;  3MV8 A;  4ZUU A;  4JRY A;  4U1L A;  3UTS A;  1FFN A;  1N3N A;  3E6F A;  1CD1 A;  3WL9 A;  2ZSW A;  5C0C A;  1QSF A;  2VLJ A;  4PJH A;  3W0W A;  1G7Q A;  1QVO A;  2CII A;  2JCC A;  4F7P A;  1GZP A;  2C7U A;  1BII A;  1C16 A;  3TBW A;  3MYJ A;  3KPP A;  4HUX A;  3TPU E;  4D0B A;  1B0G A;  3FFC A;  5BXF A;  2ZOL A;  3GML A;  2BST A;  4G9D A;  3I0T A;  1I1F A;  4PG2 A;  5E8O A;  2Q7Y A;  3DXA A;  4PGD A;  3GSN H;  2CIK A;  4PRN A;  1XR9 A;  3ECB A;  3RGV C;  5MEN A;  4EN3 C;  1KJM A;  5HHM A;  3GIV A;  1T1Y A;  2GAZ A;  1T20 A;  1WBY A;  1B0R A;  2MHA A;  5EU5 A;  4MNG A;  5F9J A;  4G8G A;  3KPM A;  3OV6 A;  2V2W A;  1UXS A;  3D18 A;  4CW1 A;  3LV3 A;  3DX7 A;  5DEF A;  2OL3 H;  4HS3 A;  1W72 A;  3I6L D;  4NQE A;  3VFV A;  3MRQ A;  1ZHN A;  3UBX A;  4JFQ A;  1B3J A;  4PRD A;  5GSV A;  4UQ2 A;  3UTQ A;  3BWA A;  3D2U A;  1A1N A;  3FQR A;  3O3A A;  3TBV A;  5HHP A;  5L2J A;  3RWH A;  4HV8 A;  2P5E A;  3UTT A;  5IB4 A;  2PO6 A;  2BNQ A;  3TVM A;  2VLK A;  1R3H A;  4D0D A;  4PGE A;  5C07 A;  3AM8 A;  5IEH A;  4JQX A;  3SKO A;  5C0F A;  3VFO A;  2FYY A;  3TF7 A;  1T80 A;  1CE6 A;  1VGK A;  3QI9 A;  4ZUT A;  1ZS8 A;  4CVX A;  5C0A A;  3H7B A;  1VAC A;  4NNX A;  3RL2 A;  4MVB A;  3DMM A;  3QDJ A;  2X4O A;  2X4P A;  2A83 A;  4FFE X;  2CKB H;  3LKQ A;  4ZUV A;  3P9M A;  1AGD A;  4L3E A;  4WDI A;  5C0B A;  2GT9 A;  1I1Y A;  1LQV A;  3KPS A;  5C0D A;  3DX8 A;  3P4N A;  4X6F A;  5C0J A;  4Y4F A;  2BSR A;  3AU1 A;  5D5M A;  3TID A;  3QDM A;  3ROL A;  3MRK A;  1JE6 A;  1HSB A;  4MJ6 A;  4PV8 A;  3HPJ A;  3MRB A;  3PWU A;  4U1K A;  3LKO A;  1FFO A;  1I1A A;  3GSW A;  2WY3 A;  3ILP A;  3BP7 A;  3L3G A;  1JUF A;  1LEK A;  3HE7 A;  1BQH A;  3O9W A;  1WBX A;  3MV9 A;  5IRO A;  4BKW A;  2YPL A;  3JVG A;  1E28 A;  2X4R A;  3VRJ A;  4GUP A;  4O2C A;  1A9E A;  3QUY A;  4X6D A;  3KWW A;  2X4N A;  1T1X A;  3FT2 A;  4HUV A;  3MGT A;  5D2L A;  5E00 A;  4PJD A;  4PP8 C;  1HSA A;  1HOC A;  1EEY A;  3O8X A;  3RZC A;  5C0E A;  4LHU A;  3MRR A;  2UWE A;  3VRI A;  2DYP A;  3QQ4 A;  4N8V A;  3B3I A;  1ZHL A;  3MRM A;  3P9L A;  4I4W A;  3BZF A;  4PJF A;  4PJA A;  3VCL A;  1P7Q A;  3BO8 A;  2BCK A;  1ZHK A;  5EO0 A;  4CVZ A;  3MRO A;  3TIE A;  3LKP A;  3GMR A;  1DUY A;  4G59 C;  1T7Z A;  3GSO A;  5BJT A;  3D39 A;  3JTT A;  5IB1 A;  3X12 A;  3C8K A;  5MER A;  3D25 A;  1FZO A;  3GSU A;  5HHO A;  1AGC A;  3BEV A;  4ELM A;  4APQ A;  3SJV A;  2IA1 A;  4QRU A;  1QQD A;  1IM9 A;  5D9S A;  5E8N A;  3BZE A;  1NAM H;  1YN7 A;  4PJ5 A;  1HHG A;  1Q94 A;  5EU4 A;  2VE6 A;  4QRP A;  3MRF A;  3KYO A;  4IRS A;  3T8X A;  3TBY A;  1QRN A;  3SKM A;  1T0M A;  4Z76 A;  1K8D A;  3H9H A; 
#chains in the Genus database with same CATH homology
 3P4O A;  1FO0 H;  4LCY A;  2XFX A;  3MR9 A;  1T7W A;  4PRE A;  3GSV A;  1S7S A;  3IXA A;  4MJI A;  4F7T A;  1QSE A;  2BSS A;  3ARF A;  4F7E A;  1S7T A;  4PV9 A;  1KPV A;  3TFK A;  4L29 A;  3V5D A;  2HJL A;  3VWJ A;  5IVX A;  3L3J A;  3LKS A;  5IEK A;  4U1H A;  4U1M A;  4N0F A;  4U1N A;  3RWE A;  3VXO A;  1ZT7 A;  4JQV A;  4IIQ C;  4QOK A;  2BVQ A;  2GTW A;  4U1S A;  1W0V A;  5D7J C;  3S6C A;  3V5K A;  1JGD A;  1FG2 A;  3OXS A;  1P1Z A;  2FZ3 A;  3PWN A;  1HHK A;  4Y4K A;  3T1F A;  5EUO A;  3KPL A;  4NQV A;  3VXS A;  3LN5 A;  1NAN H;  4NNY A;  5IM7 A;  5FDW A;  2E7L E;  5IND A;  4NO2 A;  1RK1 A;  4NT6 A;  3SDC A;  4NO3 A;  4U6X A;  5HGA A;  1HHJ A;  3NFN A;  1ZHB A;  5IB2 A;  2AKR A;  4PDC E;  4V3E B;  3OXR A;  3QQ3 A;  1AGF A;  3X11 A;  5B39 A;  1AO7 A;  3FQN A;  1JGE A;  3BXN A;  3BGM A;  4WU7 A;  5J6G A;  1OSZ A;  2F74 A;  1HHI A;  4PJ8 A;  4WWK C;  4Y2D A;  4Z77 A;  3OX8 A;  1MHC A;  1RJY A;  2YEZ A;  4ZUS A;  1EXU A;  5MEQ A;  1KJV A;  2CLR A;  5J6H A;  4IRJ A;  4Y4H A;  3VWK A;  4WU5 A;  3GJF A;  1WBZ A;  5FKP A;  3VXU A;  1I7R A;  2CLZ A;  3O3D A;  3P77 A;  3RUG A;  1S7U A;  1Z5L A;  3GMM A;  5D7I A;  1BD2 A;  3RTQ A;  5C0I A;  3HUJ A;  3I6K A;  4HUW A;  4U1I A;  3FTG A;  3BH8 A;  5ENW A;  4NQD A;  1E27 A;  5IB5 A;  3CCH A;  3TO2 A;  1ONQ A;  3KLA A;  1XR8 A;  1N2R A;  1A9B A;  4UQ3 A;  3QFD A;  3BEW A;  4XXC A;  3RWG A;  1DE4 A;  2FIK A;  3MRH A;  3FQW A;  4PRH A;  3TBT A;  1OF2 A;  5F1N A;  4ZUW A;  2H6P A;  1S9X A;  3MRN A;  3VJ6 A;  1M6O A;  1L8J A;  3H9S A;  2ZSV A;  3TO4 A;  1XH3 A;  5J1A A;  4PJB A;  4L8C A;  3L3D A;  3ARE A;  3KPQ A;  4K7F A;  1KCG C;  1JPF A;  1T22 A;  4MX7 A;  2GUO A;  1GZQ A;  4MJ5 A;  2AXF A;  2BVO A;  4V3D B;  1LDP H;  1PQZ A;  1FFP A;  3MRP A;  1K5N A;  2OI9 A;  3MRJ A;  5DEG A;  1T21 A;  4HKJ A;  1VAD A;  5DDH A;  1I7U A;  1S9W A;  3GMQ A;  2AXG A;  5FA4 A;  2HLA A;  4X6C A;  5MEP A;  2FWO A;  1S7V A;  1QLF A;  3MRD A;  5F1I A;  3U0P A;  2VAA A;  2AV7 A;  3FON A;  3L3K A;  3O3E A;  1KJ2 H;  3SDA A;  2X4Q A;  4PJE A;  2HN7 A;  3CDG A;  3P73 A;  3REW A;  4S0U C;  4NHU E;  1EFX A;  3FQX A;  5HYJ A;  4QRS A;  3M17 A;  4JFO A;  3BHB A;  3PWV A;  3VFR A;  1UQS A;  2AV1 A;  3VFS A;  5JHD A;  5EU6 A;  3HCV A;  1UXW A;  4Z78 A;  4JFP A;  1T7Y A;  1YDP A;  2GIT A;  1P4L A;  2X70 A;  5HGD A;  3G08 A;  1S7X A;  2V2X A;  1S7W A;  3WS3 A;  3X13 A;  4FTV A;  5GSR A;  5FA3 A;  4LCW A;  1LD9 A;  4QRT A;  3BUY A;  2RFX A;  5D2N A;  3MRC A;  3QEQ A;  5HHN A;  1N59 A;  4ZFZ A;  5SWQ A;  3GMN A;  5BRZ A;  3VFN A;  1LK2 A;  2H26 A;  3QZW A;  3TBS A;  3SPV A;  1JHT A;  5E8P A;  4L8S C;  3DBX A;  1ED3 A;  2ESV A;  4Y16 A;  4L3C A;  1S7R A;  2D31 A;  3QDG A;  3ARG A;  3FQU A;  2BNR A;  2VLR A;  3QUZ A;  4IHO A;  3ROO A;  1KBG H;  2VLL A;  3JTS A;  3MV7 A;  1T7X A;  1T0N A;  1X7Q A;  3QUX A;  3RL1 A;  4HX1 A;  1M05 A;  1SYS A;  3VFM A;  1OGT A;  1I7T A;  2NX5 A;  2X4T A;  3GMP A;  5AD0 A;  3GSQ A;  5ISZ A;  4QRR A;  3RWC A;  5HGH A;  4PJI A;  3MA7 A;  1BZ9 A;  1KTL A;  3MRG A;  3RWI A;  3WUW A;  1KPR A;  3TJH A;  2ZOK A;  1W0W A;  3GSX A;  1G7P A;  4G42 A;  3FOM A;  4N5E A;  3L3H A;  1T7V A;  3QFJ A;  3TA3 A;  4PR5 A;  1HYR C;  3VFU A;  1IM3 A;  2GJ6 A;  3FT3 A;  4MXQ A;  1ZAG A;  2GTZ A;  4U1J A;  4PG9 A;  5D7L A;  3VXN A;  1QEW A;  1LP9 A;  3MGO A;  3HAE A;  2F54 A;  4PJ7 A;  3BP4 A;  1FZJ A;  3QUL A;  1QO3 A;  1U58 A;  2CLV A;  3IT8 D;  3VXP A;  1S7Q A;  5C09 A;  1CG9 A;  1I4F A;  5EOT A;  4PRP A;  1QR1 A;  2YPK A;  3BH9 A;  2VAB A;  3PWJ A;  4JFF A;  3X14 A;  2J8U A;  5C08 A;  3UPR A;  5C0G A;  4HUU A;  1T1W A;  1TMC A;  2X4S A;  4N0U A;  3FOL A;  2HJK A;  3CH1 A;  5EFI A;  5HHQ A;  1HHH A;  4G9F A;  3PWP A;  1SYV A;  5EU3 A;  1KPU A;  1TVB A;  2BVP A;  5MEO A;  1S9Y A;  3KYN A;  3O3B A;  1JFM A;  5B38 A;  2XPG A;  3CVH A;  2F53 A;  3SDD A;  3PQY A;  4G8I A;  4F7C A;  2PYE A;  3VXM A;  4G59 A;  4ONO A;  4PGC A;  1LEG A;  4F7M A;  4GKN A;  3E6H A;  3VFW A;  5HGB A;  1EEZ A;  3MRI A;  4E0R A;  3KPN A;  1INQ A;  3PAB A;  5ACZ A;  3L9R A;  1A1M A;  1A1O A;  3D3V A;  3RWF A;  3VFT A;  4MS8 A;  3ES6 A;  3M1B A;  3L3I A;  1YPZ A;  4O2F A;  4NQX A;  3GMO A;  3ARD A;  4NQC A;  3KXF A;  4N0C A;  5SWS A;  2FO4 A;  4LCC C;  4PJC A;  4MQ7 A;  1XZ0 A;  1DDH A;  3BVN A;  3RWJ A;  3WLB A;  5H94 A;  3E2H A;  3MRL A;  4G43 A;  4K71 B;  4GKS A;  1MWA H;  4L4V A;  1FZM A;  4L8D A;  4PGB A;  4PRI A;  4U6Y A;  1T1Z A;  4WO4 A;  3SDX A;  4ZAK A;  3SCM A;  3WS6 A;  3I6G A;  4HWZ A;  3C9N A;  4NSK A;  3O4L A;  4EUP A;  3VFP A;  3VH8 A;  1JF1 A;  4LNR A;  1DUZ A;  4I48 A;  2X4U A;  2AK4 A;  3ARB A;  1AGB A;  3PWL A;  4NO5 A;  1MI5 A;  3LKR A;  5EO1 A;  1OGA A;  5F7D A;  3FT4 A;  3HLA A;  3FRU A;  3MRE A;  4X6E A;  1ZT4 A;  4MNQ A;  1G6R H;  1TVH A;  4PRA A;  1A6Z A;  3DTX A;  4WW2 C;  3W39 A;  4JRX A;  4L8B A;  3TZV C;  3FQT A;  4JFD A;  4E5X A;  1KJ3 H;  4O2E A;  1RJZ A;  1ZVS A;  4PJX A;  5E9D A;  4PRB A;  4JFE A;  4WUU A;  5BS0 A;  3LN4 A;  1YN6 A;  5INC A;  3V5H A;  1FZK A;  5IB3 A;  3CZF A;  4L9L C;  4EI5 A;  1MHE A;  3HG1 A;  1JPG A;  3CPL A;  5SWZ A;  3LKN A;  1NEZ A;  3ILQ C;  3GSR A;  3CC5 A;  1AGE A;  3RWD A;  3TN0 A;  4D0C A;  3B6S A;  1ZT1 A;  3KPR A;  5E6I C;  5C9J A;  2P5W A;  3E3Q A;  3JTC A;  4NO0 A;  4PJ9 A;  2NW3 A;  4WJ5 A;  1ZSD A;  4QRQ A;  3ERY A;  1N5A A;  4PJG A;  5L2K A;  1S8D A;  3DX6 A;  3P4M A;  3KPO A;  3QUK A;  1AKJ A;  4L4T A;  3BW9 A;  3VXR A;  1RK0 A;  3HE6 A;  3MV8 A;  4ZUU A;  4JRY A;  4U1L A;  3UTS A;  1FFN A;  1N3N A;  3E6F A;  1CD1 A;  3WL9 A;  2ZSW A;  5C0C A;  1QSF A;  2VLJ A;  4PJH A;  3W0W A;  1G7Q A;  1QVO A;  2CII A;  2JCC A;  4F7P A;  1GZP A;  2C7U A;  1BII A;  1C16 A;  3TBW A;  3MYJ A;  3KPP A;  4HUX A;  3TPU E;  4D0B A;  1B0G A;  3FFC A;  5BXF A;  2ZOL A;  3GML A;  2BST A;  4G9D A;  1I1F A;  4PG2 A;  5E8O A;  2Q7Y A;  3DXA A;  4PGD A;  3GSN H;  2CIK A;  4PRN A;  1XR9 A;  3ECB A;  3RGV C;  5MEN A;  4EN3 C;  1KJM A;  5HHM A;  3GIV A;  1T1Y A;  2GAZ A;  1T20 A;  1WBY A;  1B0R A;  2MHA A;  5EU5 A;  4MNG A;  5F9J A;  4G8G A;  3KPM A;  3OV6 A;  2V2W A;  1UXS A;  3D18 A;  4CW1 A;  3LV3 A;  3DX7 A;  5DEF A;  2OL3 H;  4HS3 A;  1W72 A;  3I6L D;  4NQE A;  3VFV A;  3MRQ A;  1ZHN A;  3UBX A;  4JFQ A;  1B3J A;  4PRD A;  5GSV A;  4UQ2 A;  3UTQ A;  3BWA A;  3D2U A;  1A1N A;  3FQR A;  3O3A A;  3TBV A;  5HHP A;  5L2J A;  3RWH A;  4HV8 A;  2P5E A;  3UTT A;  5IB4 A;  2PO6 A;  2BNQ A;  3TVM A;  2VLK A;  1R3H A;  4D0D A;  4PGE A;  5C07 A;  3AM8 A;  5IEH A;  4JQX A;  3SKO A;  5C0F A;  3VFO A;  2FYY A;  3TF7 A;  1T80 A;  1CE6 A;  1VGK A;  3QI9 A;  4ZUT A;  1ZS8 A;  4CVX A;  5C0A A;  3H7B A;  1VAC A;  4NNX A;  3RL2 A;  4MVB A;  3DMM A;  3QDJ A;  2X4O A;  2X4P A;  2A83 A;  4FFE X;  2CKB H;  3LKQ A;  4ZUV A;  3P9M A;  1AGD A;  4L3E A;  4WDI A;  5C0B A;  2GT9 A;  1I1Y A;  1LQV A;  3KPS A;  5C0D A;  3DX8 A;  3P4N A;  4X6F A;  5C0J A;  4Y4F A;  2BSR A;  3AU1 A;  5D5M A;  3TID A;  3QDM A;  3ROL A;  3MRK A;  1JE6 A;  1HSB A;  4MJ6 A;  4PV8 A;  3HPJ A;  3MRB A;  3PWU A;  4U1K A;  3LKO A;  1FFO A;  1I1A A;  3GSW A;  2WY3 A;  3ILP A;  3BP7 A;  3L3G A;  1JUF A;  1LEK A;  3HE7 A;  1BQH A;  3O9W A;  1WBX A;  3MV9 A;  5IRO A;  2YPL A;  3JVG A;  1E28 A;  2X4R A;  3VRJ A;  4GUP A;  4O2C A;  1A9E A;  3QUY A;  4X6D A;  3KWW A;  2X4N A;  1T1X A;  3FT2 A;  4HUV A;  3MGT A;  5D2L A;  5E00 A;  4PJD A;  4PP8 C;  1HSA A;  1HOC A;  1EEY A;  3O8X A;  3RZC A;  5C0E A;  4LHU A;  3MRR A;  2UWE A;  3VRI A;  2DYP A;  3QQ4 A;  4N8V A;  3B3I A;  1ZHL A;  3MRM A;  3P9L A;  4I4W A;  3BZF A;  4PJF A;  4PJA A;  3VCL A;  1P7Q A;  3BO8 A;  2BCK A;  1ZHK A;  5EO0 A;  4CVZ A;  3MRO A;  3TIE A;  3LKP A;  3GMR A;  1DUY A;  1T7Z A;  3GSO A;  5BJT A;  3D39 A;  3JTT A;  5IB1 A;  3X12 A;  3C8K A;  5MER A;  3D25 A;  1FZO A;  3GSU A;  5HHO A;  1AGC A;  3BEV A;  4ELM A;  4APQ A;  3SJV A;  4QRU A;  1QQD A;  1IM9 A;  5D9S A;  5E8N A;  3BZE A;  1NAM H;  1YN7 A;  4PJ5 A;  1HHG A;  1Q94 A;  5EU4 A;  2VE6 A;  4QRP A;  3MRF A;  3KYO A;  4IRS A;  3T8X A;  3TBY A;  1QRN A;  3SKM A;  1T0M A;  4Z76 A;  1K8D A;  3H9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...