1JFSA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jfsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA02
2E4VA 1BDHA 4RDCA 2FQWA 5EWLB 4Z99A 3MLFA 5ABPA 2JVLA 1PEYA 1NERA 1ZITA 4IWRA 5HQJA 1AU7A 1LQCA 2YHAA 3C6QA 3HXMA 1XWRA 4OB4A 2HJ9A 8ABPA 2LBPA 4F06A 2IU7A 3L1PA 1ZH4A 5C5EA 1BAPA 1L5YA 3RVJA 1SXGA 3H1FA 2B1JA 2EBYA 3SM9A 3QF3A 3JPWA 5FBKA 3CZ5A 3H1EA 4PEVA 2RGYA 2QSJA 3GYBA 4RS3A 4FN3A 4MPTA 2WUSR 3HSYA 4EVSA 1SXHA 3MIZA 5BQ3A 4MS4B 4JQDA 5CNIA 4O8BA 1J56A 5TQ2B 2O49A 2A9QA 2FN8A 1Z2DA 3N53A 3GRCA 3MM4A 2MYTA 3OLVA 1MB0A 2IPNA 2L19A 3H75A 4HNSA 3HDGA 2PE5A 3IP7A 4GQMA 3C3WA 1HF0A 2PUBA 1WIZA 2XCJA 3SG0A 3TO5A 2E4YA 4KRFA 2PL9A 3GBVA 4G0ZA 1B0NA 2JVKA 3A0RB 3N75A 2R4QA 1MVOA 1ZZ8A 1ZVVA 1TJYA 2CWDA 2A9PA 3LUFA 4MGEA 4F8JA 2AW6A 1USIA 4I6TA 5GOTA 4YWHA 2LYRA 3T6KA 1H9CA 1R63A 4HNRA 1ZZCA 1EWTA 4N0QA 4RV5A 1KRWA 2L18A 1Y7YA 1I3CA 4WT7A 4I8TA 3JVDA 5EWMA 4F12A 3JTEA 1DW9A 3M9XA 1LK0A 1NXXA 1D1PA 3C3KA 1YTUA 2NUBA 3IP9A 4YG4A 1VLZA 1YVUA 3NBMA 1Z16A 3EQ2A 4RY0A 2EWTA 2E4ZA 4NICA 3RVMA 3H5IA 3F6PA 3O1HB 3CECA 1JFVA 5TQ0B 3D8UA 2WWVD 3SQNA 4RXTA 5HKOA 1ZY2A 2F8SA 3SAJA 3SCFA 1JLKA 3RVSA 3RVRA 1Y1LA 5B3JC 1S7EA 2ICPA 1Z18A 4OTZA 1PRAA 2FXIA 3O2SB 3OLXA 4MQFA 2WY2D 3O2QB 3DLBA 2FKAA 2IDMA 4D6XA 1W9HA 4F11A 1RXIA 2NZUG 4KMRA 1U2PA 4OLBA 4MRMA 2IVBA 2A9OA 3KYIB 3UUGA 5GQSA 5KQGA 2FQXA 4RK6A 3Q7RA 1K68A 3H5TA 2FW0A 2R48A 1RZSA 2DRIA 2PUDA 5KC8A 1E2BA 1WH8A 3MF4A 3JVIA 3URMA 5JNWA 1ZPQA 4IF4A 4PU3C 1USGA 3IP6A 1D2AA 2QXYA 2HSGA 3N8IA 4N0PA 1YK1A 3MMNA 3T38A 2RDMA 1GUBA 3HM9A 3CG0A 2HPHA 2OR1L 1DP4A 2QW1A 3QLTA 4KQCA 2AXUA 1YS7A 5EWLA 3ROFA 4DN6A 1FSPA 4NQRA 2FMIA 3C3MA 1ABEA 4YLEA 1A04A 3FFWA 5KQLA 1Y9QA 1CYEA 2JCGA 1D5WA 3HZIB 4EYGA 2OQRA 3F7NA 2QV0A 6ABPA 2FMKA 3KTOA 3K9CA 3Q7SA 4KV7A 2ZWMA 2GKGA 1POUA 4KPYA 3GWGA 3LUCA 2XSDC 3DNVB 2PUEA 1DRKA 1M2FA 2HQRA 4KK4A 5IX8A 4MCXA 1GCAA 3BD1A 4PU4C 3N6VA 4YGXB 1RPJA 3HS3A 3LTEA 2QVGA 2OENG 2QVCA 1ZZ7A 4FE7A 4OG2A 3CS3A 3QX8A 5IC5A 5FWYA 2YHBA 2VUHB 2WB4A 2FSPA 3BREA 1DCMA 3HJFA 1BA2A 2PKXA 2L17A 3DGEC 3O21A 4H3KB 5TPWA 1ZGZA 1JHZA 1AB5A 2N9UA 5FWXB 3EUSA 3LKBA 5DTEA 1RZRD 1QP4A 3KJXA 3BDNA 1L1MA 1C0EA 1SD5A 3Q7TA 3ROTA 3H5OA 5CHYA 3RVLA 2KEKA 1ISSA 1NTRA 1U2QA 3JPYA 4S05A 3ZKCA 4XASA 4RXUA 3BILA 1Z12A 3GL9A 4M88A 2HQBA 5KQPA 4S04A 1QPZA 4RY8A 1RIOA 3GBPA 2FEKA 1PEAA 2WRZA 3NHZA 3F73A 1A0OA 4MQFB 3T8YA 1X57A 2D5VA 3G85A 4TLMB 2L49A 5A7LA 4H60A 4W5NA 2GX6A 2IV1A 4ZJPA 3A10A 1IIBA 1RXEA 5EWMB 3OMXA 1ZDMA 3OQMA 3W9SA 3GN5B 1JYFA 3EQZA 4TLLB 4XLTA 4IVZA 1KGSA 3D1NI 1YS6A 3S99A 1HEYA 5ED4A 2A6CA 4IA8A 3A0UA 1M5UA 2MEZA 2KYRA 3B2NA 2JK1A 5BR1A 1PUXA 2XDYA 1UTXA 2AYZA 4IGAA 3QWGA 4P98A 1FFSA 3QX9A 5JS1A 2IPLA 3HK2A 1DCFA 1Z13A 1OSLA 2X7XA 1TM2A 3H5LA 4F3TA 4I6UA 1JH9A 3EGCA 4HYEA 3TMYA 3RZZA 2WJWA 2XIUA 5IUJC 3PXPA 1R69A 3FFXA 4E7PA 4MS3B 4MRMB 2PUGA 3G1WA 4MAAA 5FWXA 3LUJA 4MS1A 5T7BA 3NNDA 4O1HA 1JBEA 3F52A 3OMWA 1ZZBA 3N0XA 1QO0A 2MYPA 3H6GA 4G0OA 4JB2A 4N47A 4YBAA 3B7HA 1NATA 2MSLA 1GLGA 2JRLA 2VYCA 3JY6A 5CNKA 3RVQA 3QQ6A 2IPMA 4D74A 4N76A 1FFWA 3FYAA 4Q7EA 2A9RA 3IDOA 1E6LA 3OLZA 4LZLA 2AWIA 5TQ2A 5KI6A 3OQOA 4CBVA 1O4XA 2IPAB 3I42A 2PPXA 4J1XA 3FMVA 4JA2A 4RZSA 3F6CA 3LOPA 3HV2A 4G0MA 2LYLA 1KMIY 1LCDA 4FBIA 4XAQA 3CFYA 4LDZA 4O1IA 2L8NA 4L4UA 3RVOA 3MQ4A 3GN5A 2QU7A 3CU5A 1DBPA 4NDWA 4YG7B 2FEWB 4G0PA 2BNOA 2IVGA 5EWJB 1NXTA 1VRVA 2O38A 2CHEA 3GA5A 3O1IC 4Z0NA 3F51A 1DRJA 4TN5A 3GT7A 2RJNA 3VNAA 4X4BA 1E6KA 4WZZA 4Z4FA 4F8DA 2LP4Y 3LISA 1DG9A 3QK7A 5JNSA 1A2OA 4N41A 4PU7A 3E61A 4Z4CA 4KQ9A 5TPWB 4G0XA 3FDFA 3CLCA 2KEJA 1NXSA 1ZN2A 3ILHA 3RH0A 4G0QA 4YS6A 5DGCA 4EUKA 1P2FA 1RZRA 4RK7A 3KXAA 5K98B 1X2LA 4ETIA 1PNTA 4ML3A 4EYOA 5BRJA 4ZMSA 5JNRA 1APBA 3ILYA 4MQEB 4MYRA 1ABFA 3KYJB 4OATA 3T95A 5JNUA 1T34A 2O20A 3D02A 3KCNA 3UKJA 3N0RA 4X4EA 3E3MA 4P1ZA 1FQWA 2PUAA 4ETMA 3GBFA 3QLVA 2NZVG 4YO7A 4YARA 2E4XA 2IVQA 4X4DA 3EULA 2Q5CA 1CQTA 1WH6A 2H8RA 2QZJA 4X4FA 3QEMB 2FTKE 4G97A 2KZ8A 3UK0A 3TD9A 1JDNA 3HDVA 3H1GA 1JWLA 3CKMA 3H5WA 4EY3A 5TQ0A 1DWKA 4FE4A 1PHRA 4Z58A 5T3YA 5CNJA 2MSKA 2M98A 2E4WA 4Y9TA 2W42A 3DZDA 3NNSA 2LUOA 3KKEA 2PL1A 4H3HB 2GZUA 1NXWA 1WETA 3O1JC 1M5TA 4RK5A 1Z15A 4IILA 3H6HA 3HO1A 3OLWA 5C5CA 4WXMA 3SY8A 3DLHA 3A3KA 5JNVA 3HCWA 4Z5DA 1EWKA 2KPJA 2LIVA 4WUTA 2B4AA 3R0JA 1JDPA 5D2CA 1E3OC 1Z17A 1ZH2A 2IOYA 4KK3A 4IMIB 1QO0D 5FBHA 3BBLA 2PUFA 4PU8A 2M1ZA 3P9YA 4ZYLA 4ZPJA 4JCXA 4RK4A 5B3JA 4X4CA 3TRBA 5HM6A 2JBAA 4MLDA 2HQOA 4YCSA 2LYJA 1L5ZA 2CHFA 3O74A 1QP7A 1NEQA 3VK0A 1AB6A 4Z9AA 4RU1A 3QELB 4KFCA 5CNMA 2AXVA 4MR9A 5TPZA 3JXDL 3CTPA 4Q6BA 2E4UA 3K4HA 2FMFA 4LX8A 3KHTA 2NT3A 3CLKA 3HZHA 2WMYA 2EF8A 1IC8A 4X4GA 3HUUA 2OFYA 5IBQA 4MR7B 5IUNC 2BNMA 3IPAA 3CG4A 4IMJB 2ZAYA 4WXEA 1F4VA 4Y42A 1RPEL 3RVNA 4D6YA 1PRUA 4GPAA 2FN9A 1LLIA 3RVPA 4KVFA 1ZESA 2TMYA 1NXVA 4OBBA 3BRQA 1D1QA 4YRZA 1TLFA 1OCTC 4QICA 3IVPA 3UFDA 1EAYA 1USKA 1DBWA 3QELA 5IEBA 3BRSA 3EAFA 2PLNA 1NY5A 4EYQA 5KC9A 3QEMA 5IULC 2PMCA 2P9HA 3KS9A 1BDIA 1JL3A 1YMVA 2GI4A 2MYUA 4Z4IA 4NV3A 2BNNA 3I09A 4QPJC 4PICA 3LUDA 2LCVA 2CSFA 3QEKA 3KG2A 3DGFC 1UXCA 1BDJA 4MCTA 3JXCL 4O5AA 2F8TA 4GNRA 4UHKA 4Z4HA 5HSGA 2IYNA 2ICTA 3BS3A 3ZHMA 1QP0A 2R25B 1JFTA 4EGSA 4DQDA 5FWYB 2P4UA 5PNTA 4JASB 2AXZA 7ABPA 2H0AA 4G86A 3OP9A 1K66A 1NXPA 1ZZ6A 3SCGA 1JF8A 1YK0A 4RXMA 2MYNA 4EVRA 1MB3A 1OXKB 2JVIA 3KZ3A 2KEIA 4PZ0A 1F51E 3ZHIA 2ID7A 3LUKA 3LUGA 3TX6A 3R1FA 1XHEA 2FLWA 3VNBA 2FLKA 1OXBB 1C4WA 3QLUA 3FGZA 4JB0A 2PAFA 3I45A 1DC8A 2BJCA 4JAVC 2I6FA 1JX6A 2LYQA 3OO1A 4Z5CA 1U8TA 4JOQA 3JXBC 3LUAA 2PJUA 1YIOA 4X4HA 1QQAA 2NT4A 1QKKA 4ETNA 3OMTA 2AUWA 2FEPA 3MA0A 2LYSA 4N03A 1P6QA 2JB9A 2H3HA 1GUDA 2VK2A 3NNNA 4Q6WA 5DLEA 1KRXA 4B09A 3CZCA 5KQMA 4RKRA 3CNBA 1SXIA 3CHYA 4J1WA 4RY9A 2FVYA 2GBPA 1DC7A 4TMYA 1PERL 1LJLA 1QNLA 2RJOA 3CRNA 3O2JA 4WWHA 4Z9BA 5DKFA 3KSMA 4YP9A 1BVHA 1R8JA 3OO0A 1MIHA 1TVMA 4XXHA 3Q9SA 2B5AA 3L49A 3QLUC 5JS2A 3TB6A 4W5QA 1SRRA 4Z4EA 4LE2A 4KNYA 5TPZD 1B00A 4PE5B 2R1JL 4I6RA 1JYEA 4MLCA 3EJWA 4MS3A 4RSMA 4XFKA 2ID9A 4QYMA 3OLYA 5EWJA 3FFTA 3N0WA 3QYXA 3SCHA 1ZHHA 3RVKA 2IUOA 5DCLA 3H5VA 5F64A 2FJRA 4JCYA 2LPMA 1YSEA 4EVQA 3RQIA 1QMPA 1Z2EA 3SNKA 5BRAA 2HINA 4Z4GA 1W25A 1Z25A 2GWRA 3IP5A 2PUCA 2FQYA 3I5AA 6CHYA 2AYXA 5IUKC 1GCGA 5TQJA 1ZUGA 2CD7A 2MSWA 4GHJA 1D4ZA 1S8NA 3C97A 2PIJA 4RK1A 2BGGA 3OM0A 4XARA 1EFAA 2IKSA 3KLNA 5KWSA 2LYPA 3G7DA 1ISRA 1FFGA 1XHFA 4EYKA 1DZ3A 2O4AA 1RNLA 9ABPA 2FMHA 1ZAYA 1VKRA 4LE0A 4MQEA 4YR7A 1VPWA 5JNTA 3FMYA 4MR8A 3LFPA 4QYWA 2R47A 2GRMA 3U3WA 3L6UA 3JS5A 3O75A 1TMYA 2L2QA 3MYYA 2GRLA 1CEYA 1QQBA 2JVJA 1E6MA 2JBAB 3F6WA 3GV0A 3NHMA 1SQ8A 1NXOA 1CHNA 2WJAA 3S8QA 4X4IA 1ZZ9A 1JFSA 3HUTA 4YG1A 4KZKA 3LFTA 4MR9B 4IRXA 4RWEA 4NCBA 1MAVA 3M9WA 1U0SY 4G0YA 2LYKA 1YMUA 2VUIB 3LKVA 3Q41A 4HNQA 4LDAA 3IPCA 4MS1B 4PYRA 1Z26A 3LMKA 5I4CA 3FYMA 1DCKA 3OM1A 3KLOA 4MR7A 4RK0A 4W5RA 4MR8B 1LBIA 4W5OA 4MS4A 4ZMRA 1GT0C 2V0NA 1ADRA 4FB4A 1PNRA 3EDCA 3Q15C 1ZS4A 3CROL 1LJUA 2XJ3A 4Z5HA 5IEJA 1PRVA 1LBHA 1XWWA 2QR3A 4RKQA 4DADA 1DJMA 1LCCA 1EWVA 3M6MD 3HVRA 1P6UA 4NCAA 4JP1A 2CROA 1LMB3 4L85A 2MQKA 3EODA 5E3JA 1EHCA 3O9XA 1M2EA 4UHJA 4W5TA 3LUHA 2WIUB 4Z59A 1DBQA 1CJGA 1P8AA 1U04A 2J48A 3QLVC 5TE9A 3OQNA 4LRQA 1ZGGA 2XI8A 4KREA 3G5GA 4LE1A 3DBIA 4OLAA 1UXDA 1UDRA 4E7OA 4YV7A 1URPA 3HEBA 2R63A
chains in the Genus database with same CATH superfamily
3M1YA 1K5HA 2FZ5A 2PQMA 3FUVA 4I1YA 4TLDA 1E32A 1KP9A 4EFLA 4BGUA 5A9SB 3MHTA 2BEWA 4IWRA 3BMOA 4PTLA 3C6QA 3GD7A 5BUSA 3DAOA 2IUTA 4AZ3A 1TXGA 3IS3A 8ABPA 3VH4A 4A0QA 5IJ9A 3I2GA 3ZWWA 1Y9EA 2EX0A 3WTBA 1L7NA 3PFIA 1ELOA 3H1EA 3WK9A 2HMVA 5AW2A 4FN3A 2XKAA 3WK6A 5JBIA 4JQDA 3I9KA 4FEYA 4G5FA 4B71A 3PLAE 4JIMA 4MYTA 1K0UA 1PZGA 3D3KA 2BCGY 5AESA 3KWJA 3GAFA 5BY2A 5HMMA 2PKCA 4B3GA 4OQFA 2B21A 2WT4A 1Y98A 3H75A 4IEFB 2EARA 4NU5A 5LD2B 2RKBA 1IJBA 4KQGA 2G40A 3X0DA 2GETA 3AL2A 1Z7BA 2CBXA 4DIOA 3B13B 2UYOA 2ACVA 1HF0A 1SY7A 5C5IA 2GXUA 4E5VA 3OJLA 2BFPA 4YRIA 2BD0A 2VEDA 4AS2A 1AF7A 1FPMA 2G1AA 3GJSA 3BMQB 1QORA 4COKA 1ZYUA 2B4TO 1HGXA 1QYWA 3EEFA 3ASUA 3QIVA 4OQEA 1BS1A 1R4MB 2QGZA 2G06A 3Q6MA 4GLFA 3ZI7A 4KDFA 4FR0A 3L4BA 2UZ3A 3AYZB 3UB2A 3AIIA 2R8XA 1VECA 5FOUA 4AF8A 1MKYA 5AM3A 2Q4RA 4JXZA 3JVDA 2HMAA 4KAXA 1MF7A 2VKTA 1X0XA 4UNQA 3T94A 4NOJA 3W3AD 4GR5A 4WFJA 3MBOA 3PLRA 1IM2A 3TFWA 4R84A 4BEBA 4F5ZA 1P18A 1L4KA 2PN1A 5FOVA 3RTGA 3F6PA 4N7RA 4C4ZA 3K0SA 1XTBA 2C5FA 2DPYA 4E1VA 2RD2A 3TAHA 1Y7IA 3OCXA 4IS3A 3NGLA 4CT0A 3EDRA 1ADJA 4GBGA 1WU8A 2DFDA 3L3BA 4JYBA 1VDMA 2PS3A 4BQSA 2OWEA 1XAIA 2R1ZA 3L6BA 2NV0A 2BY4A 5L3RA 5B3JC 5LJIA 3S55A 2FN3A 3ETJA 4ZRMA 4A1FA 1HDIA 2J59A 4DJ5X 3NVKI 3QMWA 1ST3A 1VOTA 5DTRA 3G2JA 4JVNA 4NPAA 4F11A 2Z2YA 4L73A 2ASVA 2RCYA 2YWCA 3HG7A 4EF6A 2C07A 2F3QA 5EJ4A 4QYIB 4TTTS 4IM7A 4DCOA 4HUJA 4RPCA 1QIEA 1FJGB 4PG8A 4C76A 2J5XA 1OJLA 4QUIA 3ZZMA 4ZCLA 5JAHA 3RSLA 1KOGA 3ONNA 5BW5A 1XQVA 1P9LA 1ZG3A 3GRVA 3S28A 2FMIA 1MOSA 4F3YA 4B3IA 3O8NA 4BXOA 4YFVA 2D74A 3KVVA 1Q16A 3AF0A 4HGRA 2OQRA 3L7DA 4BKRA 5IU6A 3S7ZA 5K0BA 2R0QC 3E9EA 1SO8A 3MERA 5SZIA 1NAIA 1XIVA 2ZWMA 3H3JA 2C2HA 3QRWA 1R0WA 3QVVA 5EMJA 2Y76A 4BAUA 3VV2A 1CUJA 5IYZF 2ORIA 4MCXA 2QLFA 5C7LO 2XOXA 1DXHA 3MT0A 3S7TA 2DHEA 1J0DA 2HMYB 2XMCA 3VR2A 2IYUA 3S40A 3WJAA 2JFFA 1FVOA 1YRWA 2VUHB 1QM5A 4D5GA 4OXNA 5FBVB 3PNVA 3W2EA 1BA2A 1PN3A 1PG0A 2L17A 4FGJA 3H9GA 3UUFA 1AZTA 3IQHX 4ZCQA 2RBKA 5FWXB 2AEMA 3TZCA 1WL8A 4NDZA 1XCBA 3U5TA 1J5EB 3D4NA 3QYJA 1J8YF 1C0EA 3UF0A 2XNDD 1R9MA 1DXOA 1N2BA 3ZHQA 1WUKS 3L1VA 2WJ4A 5H83A 3QKRB 4RTNA 5IW8A 1ONNA 5AQ1A 3ECCA 2W71A 1XG5A 3V1MA 4CIBA 4ME6A 1ZJYA 1A0OA 1BO6A 1NMSA 3NEYA 3TW8A 2HT6A 1IZ0A 3HJTA 3ZCTA 1X57A 1X9HA 2SKDA 4RVFA 2NP6A 4I1UA 2GF9A 1MQ8B 1GKUB 5TGTA 5BPHA 3IVAA 2W8BA 1ZDMA 1U3CA 4JH0A 3W9SA 5CEFA 5GJWC 1M0EA 5ULLA 3VFDA 3TSWA 3O4GA 2HLHA 2M6RA 3GW8A 4W7HA 3F74A 1RYDA 3HB0A 1ZD8A 3GMDA 2PVSA 3K7EA 3WYFA 4TQ9A 1LK5A 2JK1A 1QHFA 1FP6A 5ADWA 1CUXA 2M6KA 1VE9A 2I7TA 4FHDA 1JG2A 1SOVA 3C43A 4JL5A 3W2FA 1TM2A 4BNHA 1SBZA 1NJ6A 2F1IA 4OREX 4UBMA 3CIFA 1CQIA 3DFFA 1JHDA 3OQ1A 1TPZA 1A7JA 4WY5A 4ANFA 2P0EA 1TIKA 1ZEMA 1JMVA 2FZGA 2SECE 3LOUA 5JE8A 1DADA 4D9EA 1GPLA 1MO2A 3F52A 1GGNA 1ZMBA 4GRAA 2OO5C 4N47A 4K2AA 4UAVA 2PLAA 4PNZA 1O5TA 3TTSA 1H66A 2XT0A 1ZBQA 3MGKA 1CQJB 1Z4IA 5CNKA 2FZCA 2HCRA 1DTSA 2WU8A 3ORSA 2BTQA 4KWEA 1FOEB 3FYAA 5JADA 3OESA 2YVQA 1M3SA 4D02A 4JA2A 4JC5A 1TJPB 2YVLA 3UVEA 3MS2A 5BSFA 3HV2A 3PXAA 4EYSA 4LJLA 1EUZA 1VLQA 3C4QA 3CUYA 4YQZA 3U4MA 1CB0A 4OMFG 1CVIA 5JAQA 4L4UA 4OH7A 4BNDB 3O5AA 2YRFA 4HHEA 4UU7A 1PS0A 2NNLD 4YG7B 1COWD 3VZDA 4U7GA 4P3NA 1KJ8A 3R5KA 1WHSA 2ILVA 3UA4A 2DUWA 4YRDA 1KYIA 1Y6ZA 1X14A 1XX6A 3DM5A 4IOKA 4TN5A 2DWQA 3IOYA 3E9RA 3AR2A 4M3NA 4RHCA 2DSTA 5CIQA 4EGCB 3TGLA 2CVOA 3GEDA 1OH8A 3ZDDA 2UYGA 1KEWA 1Q0QA 2AOXA 4P4NA 4ROTA 3CE6A 3GHHA 1KI6B 2KEJA 2FWNA 1IJKA 2Q29A 4JBYA 2YYSA 3RH0A 4QULA 2HU7A 1P2FA 4XUDA 4AJ9A 1ZNZA 3WKAA 3YASA 5JNRA 5C3MA 1E2LA 4INOA 3GUVA 3BXHA 3VO1A 1P2BA 4GI3A 3UMCA 4UTVA 1Z62A 3GLHE 4R54A 3LGSA 5DGHA 3EGWA 3FW1A 3DPUA 1C30B 3E9NA 3PPXA 1FMJA 5HUJA 3C7AA 1UK8A 3AJAA 2VK1A 4JBHA 1Z5NA 2NZVG 5FADA 3ORYA 3FLEA 1YQUA 3LZCA 1H8ED 4NENB 4D3SA 3IEKA 4LJ7A 1RRPA 1X1CA 1FTYA 1Z34A 2CUZA 3UGQA 1EUDB 4O2AB 1ODLA 4BL5A 5J4YA 2P9FA 4GM1A 1EFCA 4LWQA 2B3TA 2I6UA 1WQ1R 2J4CA 2X8WA 3FA2A 3H5WA 3H8SA 4UBKA 4URFA 3VM6A 4GSLA 1QKIA 2O2IA 4RFSA 3JQFA 3TD6A 2YYYA 1QBKC 4M9RA 1KSFX 1LDGA 3PHHA 1GJRA 4DV2B 4GNKA 3K5WA 1JIVA 2FFJA 2QPOA 2Q4DA 2AK2A 3EVTA 3NHSA 3AUYA 3C45A 4LOHA 1N2ZA 2F9MA 5KYWA 3GLSA 1JEOA 1BU8A 3MT9A 3G1UA 4KR9A 1KMCA 1R9GA 4HPXB 1T1SA 1KEEA 1HLPA 2IS4A 3DLPX 4L8WB 3G02A 1U5CA 4C2UA 5K3EA 1XVVA 5K09A 3NTLA 4PBRA 1QO0D 4QUKA 4AMGA 2PXTA 3A6KA 1KPGA 3INYA 3H5AA 4M1KA 3THOA 4ZPJA 1I4OA 2JCVA 4X4CA 2ROQA 3GJ7A 2GEFA 1Y3AA 2QN3A 4OHKA 4C30A 3WLAA 4RU1A 5CIWA 3TXXA 3JR7A 3P2IA 4UUNA 5TPZA 3D4OA 3TM4A 4IEIA 1M0WA 4UOZA 5IJ0B 5IVPA 1U8FO 4PR0A 4X7BA 5JCJA 1PL0A 1XPUA 2O2YA 3O73A 3I5YA 1PTJA 5I8PA 4O59O 1WXQA 3PYMA 1L6RA 2V7EA 3ANMA 4XTCS 1CLUA 4KIJA 3E1GA 3VGPA 3P9RA 3OBBA 4TTQA 3CG4A 4L3OA 5EKDA 1JSCA 1O5OA 1XKQA 2X7HA 5CMLA 3ZK9A 3VVBA 1RPEL 1ESEA 2C3OA 1N5JA 2O48X 1Z0AA 1KZGB 1R50A 3B6MA 4GPAA 3GEBA 1SC3A 3JQRA 1N2GA 3KSUA 4W99A 3FUCA 4UJ5A 4CW7A 2FPRA 3BL5A 1SKQA 4ALJA 3OQIB 4KN9S 2PANA 3DE1X 1BS2A 2RB4A 4Z86A 1ACLA 4R2LA 3D43A 4V0OA 2HZ7A 1FCJA 1M2HA 2ZTHA 4Z4IA 2HDOA 1Z75A 4EKNB 1MJFA 3I09A 4QPJC 1A4UA 1K63A 1E98A 3SC3A 3WBJA 3RC9A 1V9SA 4M8KA 3G2LA 2XCUA 5IT9A 1YZKA 5ALVA 2BFMA 2A78A 4CQLB 4CL8A 1BDJA 3IULA 2CNWA 4U2EA 3I04M 2VYFA 4Y2SA 4K87A 3UYLA 1AQJA 2F8TA 4ZQEA 3VTFA 4TTVA 1RLOA 1WAMA 3EXG1 4EGSA 1TK9A 5DYTA 3MWJA 2NU7A 4QOIA 2IYRA 3GC6A 3UEOA 4BFLA 1N2CA 1GR1A 2RGGA 4HTAA 4JGBA 3RD5A 3K0CA 2XUFA 4MMXB 1LI4A 1TZ2A 3A4NA 3STWA 1BCRB 2JFYA 4QGFA 3JD1A 2HHLA 2ZI5A 3FM9A 1X1QA 1VI5A 2W2TA 5FTNA 1S3SA 4X92A 2BGIA 4PZPA 2ONJA 5FBRB 1QRSA 4CIAA 2NNWB 4CT4B 2IL1A 1Z0SA 1XELA 3ZZ0A 4JB0A 3KQSA 3VMFA 3WG9A 2BFAA 2H07A 3OIWA 5CJJA 3UWOA 4E6PA 1G6KA 1G8GA 2P6NA 3Q7QA 4FMCB 3VHLB 5TIIA 4GI1A 3U7FB 1WE2A 2VCEA 2ZT7A 5KQSA 1MN6A 4X0EA 4ISCA 2CZGA 4J1NA 1SCUB 4Y2XA 3UGJA 3I2FA 5D85A 1Y8QB 3UWKA 1ANKA 2PUJA 5EQJB 1P6QA 4I50B 3NC1C 3PCXA 4K81B 1Q3KA 1U7PA 3SMQA 2WZBA 3NBFA 4JROA 4L2IA 2Q9UA 4C0BA 4GMHA 5A6SA 1TUIA 1QNLA 3KETA 2IXDA 4Y0AA 1GGEA 4WACA 3U7JA 3QNUA 3GH1A 3DMNA 3MTEA 4S1TA 3ZCSA 1UWKA 4FDUA 1UP4A 2R6CA 3GEPA 1GL7A 3A9ZA 4CZ2A 4YYZA 3FUWA 3FXAA 1EB8A 1NRJB 1FFDA 2Y0DA 1JXAA 4MLCA 2CVHA 2QWXA 4MS3A 1H6CA 2B1GA 4HDRB 5LZ8A 4A2WA 5JBQA 1KWKA 1HG0A 4DRYA 3KQUA 4Z49A 1HETA 2G4CA 1IONA 3RSZA 2R6FA 2ZYHA 6NULA 4ATNA 4F4HA 1KY5A 4MCJA 1NVFA 2XYPA 1QMPA 3FAKA 2CUKA 4KXMA 3W1EA 1TA4A 2QHXA 2VQ3A 2AYXA 3A4IA 3DS8A 3TEPA 4NJMB 4Q18A 5IM5A 5IUKC 5C8DA 3QVJA 1OB2A 3ZN2A 3RSOA 2HQSA 1CUVA 4QEKA 1SKAA 2XRFA 3C97A 4PLVA 5DXAA 3JQ8A 4NL4H 4BE4A 1UZMA 4BP3A 1DZ3A 1N7HA 1QVAA 1CQPA 5DSZA 3WE7A 1U8XX 1A9ZA 2E6KA 2FGJA 2NPIA 5B7QA 2OGTA 3FRIA 2VJLA 2VQSA 4I9NA 1P45A 2GPJA 1QRUA 3ITDA 1Z68A 2NO5A 2YQZA 4HR7A 4R31A 1EJBA 3LBIA 4MYDA 4O25A 4Q3CA 2WWTA 1ZC4A 4YJFA 2JBAB 3I9FA 2CMFA 1ZFNA 2VYVD 3GCXA 4J94A 1DBIA 3WRXC 1I6KA 2ZT5A 3A8TA 2AJ8A 3G49A 4GPTA 3W7VA 1STOA 2QKYA 2WPDD 4OP1A 3LFTA 4IRXA 1AT1A 2LTAA 2VJAA 3GOQA 4ZI7F 3N8HA 2RSLA 2J4FA 3UFBA 2NIPA 4EMSA 1PDWA 4MPJA 1CNFA 2XQGA 1Z26A 1GAEO 2HV8A 1UR5A 3W79A 3D0RA 1OZGA 5CPBA 4HDQB 5ADVA 2R79A 4QDZA 3CUEF 3EXG2 1ADRA 4JJAA 4KXNA 1VE3A 1NRIA 4XJVA 3TNYA 3ZC3A 4ZKDA 4OX9Y 1Y9AA 4OHMA 2WZCA 1GQYA 1P73A 4MKXA 4C7XA 3I2KA 4AN0A 4ZU6X 3GRKA 2AOUB 3U61B 4NCAA 2IXAA 2GCNA 3KQLA 4HH4A 1SQGA 2GZAA 1EHCA 4D45A 2G6BA 4YLGA 3GGCA 3LUHA 4Q02A 2W2MA 1U04A 1IRIA 3KJGA 3K72B 4PQGA 1G64A 4QUAA 2JI7A 1PBTA 3SGLA 3G5GA 3WYAA 2O0KA 3V00A 4D9JA 5JY1A 3K8YA 4OLAA 1R4MA 1GQFA 1NP6A 3T34A 1MU0A 1URPA 1V48A 4GE3A 4Q47A 2IDJA 1CUFA 3DHYA 1IPFA 3OM9A 4JELA 4WHMA 1C7IA 1WU7A 2O3UA 4PVDA 3GNSA 4BIMA 4GC5A 4J0HA 4JVSB 3OU6A 4C6TB 5AK4A 1JEAA 3A4TA 3AR7A 3HJRA 1DFGA 1XRRA 5F3WB 5EJ5A 3C98A 4D56A 3MUEA 3D64A 2Q5JA 3GROA 1NF9A 1C2TA 4QOGA 4R40A 1HTTA 2AFHE 3BIFA 3IGFA 4OGKA 1M8PA 2GILA 3IVGA 3JARB 1DQNA 3SM9A 2W83A 3JPWA 5FBKA 1IHPA 4LZZA 1PVDA 5FI5A 4QJ4A 1BQ3A 2RHCA 3VZCA 4E94A 5BQFA 4YCDA 5IZCA 2IYPA 1QIMA 3H13A 1BXRB 3SXUA 2FN8A 1AXGA 2YWFA 4ARZB 1DC6A 4PYNA 3QY9A 1L3BA 1KC1A 4BP8A 4N5IX 1NVGA 4QEDA 2IH2A 3ELWA 4YJGB 3T9BA 3U6BA 1X1BA 4FYPA 2CHUA 1CZUA 2R5FA 3PKIA 2MU1A 2YINC 2A4KA 2XTNA 1W49A 4NPHA 4F86A 5L3SB 3CEAA 3EY9A 3CUTA 4A6XA 1JH8A 4C3UA 5JQGF 2AEFA 1M7HA 2XNDA 3C48A 1OF1A 2PL9A 1PL7A 4LISA 1J2YA 3RIYA 4BQRA 4UATA 2AW6A 1BYIA 2FG7C 3NVMB 2WQZA 4C5BA 5L3QA 3KRTA 1Y8CA 3QE3A 1JRLA 1PFKA 1Y1SA 4ISBA 4N1AA 3W5UA 1ORWA 3DAHA 1E5XA 4OIFA 1J7KA 2Y1XA 4EEZA 2IS1A 3F9RA 3MWGA 1I3CA 3TXYA 1X7ZA 2VO1A 2C2OA 5JQGB 1NMQA 2WM9B 3BMXA 4R2HA 1J25A 3BJMA 2ASEA 1OXTA 2F9FA 4I4LA 5CU7A 2CLSA 1T5DX 1YVUA 3IP9A 3I4CA 1WQ3A 2OPHA 3IUQA 3VDRA 1AUVA 1DO8A 3GFTA 3RVMA 3K53A 4AZ0A 4R9VA 4KIWA 3RU7A 4ALLA 3DQZA 5EJ9A 4DUPA 1DRWA 4I3GA 4WOPA 4BWGA 2WOOA 1UXHA 3HXLA 5AOAA 2VF4X 4NBUA 1IN6A 2R1VA 2IZ1A 3N8NA 5DNAA 3HLYA 1R6BX 5G4KB 4II3A 2VC2B 3DB1A 4XX1A 4AMBA 1Z8DA 2FPSA 1T8TA 4X1KA 1IJFA 3UUGA 2N1BA 4S0XA 1DB3A 3CISA 1MRSA 3UV3A 1ENPA 1SUAA 2PPVA 2RK3A 2GNOA 3PFNA 2A58A 1AN9A 1CUCA 1G5PA 2IY7A 4RC9A 3UCEA 1FRQA 4BFTA 4E3WA 1E9FA 2VHJA 4AJIA 5KNBH 1WH8A 5LLTA 4YDQA 3AFGA 4FUQA 2EW2A 2I55A 3WLOA 5J47A 3A31A 3VHQA 3BXXA 4ZO7A 2XQJA 1I33A 3T38A 5L8VA 3GELA 4EDFA 4F5WA 2B4QA 1L4NA 1WM1A 2BR5A 5KNCH 1M0TA 4GR9A 4M4SA 1E1RD 1X7XB 2YS6A 4WKPA 2E1RA 3U7HB 1RC8A 4DRXA 1YS4A 1RQGA 3WGGA 1KI2A 2XMRA 3ZCUA 2EBWA 1TZJA 3VNQA 1T1EA 1YVRA 3IXMA 5AVKA 4FR2A 3GWGA 5ALUA 5LN1A 1WX1A 5CUQA 4JI3B 1XQ1A 2VTBA 1UXJA 4PU4C 1A77A 3WGNA 1JW9B 1ZH8A 4DXHA 1L7MA 3CTMA 3H4IA 3JZFA 1HX7A 2B5VA 5JMOA 3HXQA 3CURA 4N0EA 3LVFO 2RAFA 1H2RS 3ICCA 1PJBA 2QRVB 5GAHi 1PFWA 2B83A 2CCGA 3ZY2A 4CCYA 4DYHA 5C2JB 3T3EA 4DAEA 1C3EA 2JGDB 1K4KA 3K0EA 1ZW1A 2CXNA 4AULA 4EABA 1ABBA 3AX6A 3TX2A 3SLRA 3K8QA 5FL3A 1RJFA 4J91A 4MQUA 3WLRA 2AKEA 1X3LA 2YL2A 1E5LA 4PIMA 2ZIFA 3IOCA 2E5LB 4S04A 1QPZA 2PSHA 4GX1A 4EA8A 4CDMA 1QFZA 3WNDA 5HE9A 2WRZA 1H69A 4NBSA 4KUEA 4MQFB 4B6JA 2PH1A 4EO9A 3G85A 1YI8A 1T8PA 3CZQA 4H60A 1XQ9A 1J8MF 3ZWVA 1ULZA 1G8FA 1SPXA 3CVXA 1C7RA 1UMDB 3C7KA 3JQFC 1U5AA 3N0VA 1JHAA 1KMNA 5DGXA 3EXEB 1WMAA 1EK1A 5KAPA 3LPLA 3A0UA 3L8FA 3U9LA 2Y0PA 1QG2A 1X7HA 3WJ7A 3UV7A 3B3JA 2I54A 1MQAA 3NV7A 1JR2A 2AZXA 1GQ2A 3CT4A 5I47A 3T1TA 3T4PA 3I1FA 3W5AA 1D1SA 3ZJTA 5DJ5A 1JH9A 5C1PA 1U0RA 5DF1A 2ZYGA 3SYMA 4B8ZA 1LBQA 3CJQA 4BNJA 5CT4A 4DXDA 2FF5A 1FQKA 1PJSA 1JJ7A 5HRAA 5CLLA 1J70A 2BFWA 2PZ8A 2VSOA 4NBLA 3TWOA 4AROA 3UJ7A 5AVVA 4JC0A 4A4DA 4ZO4A 3L0CA 3ESZA 1ZZBA 1N3IA 3PGVA 1V95A 4C5CA 4DSNA 3H1TA 3VVLA 5KTTA 1CF4A 1GLGA 1C9EA 1QIDA 2ZBRA 3DBOB 4R51A 3OC0A 1VRWA 4D74A 1E66A 3ZTWA 4J1SA 4OSPA 5FBZA 3X1MA 2BC9A 2AWIA 3R0XA 1WMDA 3SYRA 3FMVA 1NBOA 4RZSA 4FNMA 3W4IA 4LZOA 2OHOA 1PWHA 2IP2A 3U1VA 1FU8A 1KMIY 1S2OA 3D4PA 4MI3A 1PLKA 3AEKA 3R7WA 2DPHA 3TSYA 3O4VA 1RW4A 4EGQA 1ZIOA 2Y66A 2N3ZA 4NDWA 2GH1A 2J7PA 3NGMA 1MGPA 3OT1A 4IWNA 4HXEB 3Q9UA 3T5TA 1WD7A 4YN3A 1B23P 1VRVA 2OAGA 2Z5VA 3MJ4A 1HNXB 1YDHA 1IOLA 2XDQA 4OO3A 2FDCA 3BUSA 4BV9A 4G89A 5HP4A 3L8DA 2M32A 3C15C 4Z4FA 1L2TA 4LNUB 2F55A 1R27A 1DG9A 2ZRIA 1Y3CE 4MVJF 3HXOA 3TTTA 1MJNA 1TYAE 4KQ9A 1R3DA 2VQFB 3MCTA 3ESYA 3JQEA 3G7NA 1C9KA 1VJCA 3U09A 1EXWA 4K3UA 1SVNA 1WVGA 2FPIB 4XQCA 5MN5A 1Z4MA 3LT1A 4RK7A 3N2LA 2REXB 2CDAA 1APBA 3A9VA 5KWVA 5ITZA 1R7RA 3ILYA 4LQDA 4NOKA 4D80A 3GJQA 3WB2A 1N5RA 1QHNA 2OHIA 2R86A 3KOXA 2WINI 3DB2A 2AUTA 4RCVA 3WKDA 2JAPA 5JDCA 4WA8A 1QFXA 3UXEA 1O94C 3OMLA 4ZHQA 3QTBA 1TD9A 4LPKA 1PTKA 3G79A 4YX9A 2Q3BA 4C1BA 3A26A 3GGGA 4ZXPA 4OV6B 1JVBA 2HEIA 1U2RA 4RZIA 4AN4A 1E3EA 2IZOA 1UFVA 3LPAA 4XYLA 1KAQA 1OX4B 3D54D 3K9WA 3RC8A 2R96A 2RHJA 4L8GA 4DR7B 5H70A 2COEA 3H1GA 2GM9A 3PUYA 1T5IA 4LN1A 3IT3A 3Q4GA 2GEJA 3E2MA 2M98A 1XGKA 4YUVA 4AM8A 4MIEA 1KI3A 5I9IA 2QLJA 5BW6B 2P68A 2RBGA 2PL1A 5KJ6A 4H7PA 3Q3JB 4YCNA 3O1JC 4OGWA 4RULA 3IIEA 3ME5A 3COSA 3C0KA 4IILA 4P0PB 1WZUA 2Q9BA 2D0DA 2PSEA 4IFEA 3ESQA 3VZSA 5K2OA 4M87A 3R7WB 2GXQA 4JL6A 4UUQA 1PIWA 3R0JA 2I6XA 3A6EA 4MB2A 1UDXA 2II6A 4LG1A 3VPAA 4AN1A 1QYIA 3JWIA 3KEQA 4D0LB 3VYWA 1E3OC 5JV5A 1R18A 1AY0A 1ZOIA 4JLSA 2BV3A 2ZS8A 4FYKA 3WB9A 4CQMB 2HJVA 3B60A 4E5PA 1XYGA 7MDHA 4RA6A 5LA6F 1ZM2A 1XTVA 4M55A 4WZAB 4YCSA 2FUG6 4W4TA 3RGWS 3WYDA 4HNVA 5G1PA 1ECCA 3NX4A 3B7PA 4HRXA 2PQ0A 2DVMA 2LDXA 4HDMB 1B1CA 1X94A 3QELB 3KZVA 5EE0A 3HKCA 2J8ZA 1RPAA 1JJVA 3KE9A 3G2KA 4LXHA 4PYOA 4ZVSA 1EXVA 3T3MB 4OI4A 2NADA 1NONA 1FNMA 4X4GA 4J1QA 3BHJA 3HJHA 5JO0A 2G3YA 2W00A 4BPRA 3IPAA 3OIDA 4H15A 4LJ9A 4MJXA 3CT6A 2PT5A 1XD9A 3BB4A 3NH9A 4LYGA 3FF4A 3G5MA 3L1UA 1FDVA 3C39A 3MEQA 2PZLA 3H2JA 4NU8X 3RVNA 3JATB 4PU0A 3S3TA 3OEHA 2Z83A 1LQTA 3QOFA 4NCIA 1TU4A 3H17A 1V1MB 3HDYA 2Q8QA 3ZG6A 1VLHA 2LR0A 2VNKA 4PRLA 4GMDA 4IXMA 3EAFA 5A3SA 4HADA 5C7OO 1IWPB 4UEOA 2ODQA 2FW8A 3U49A 2C4WA 1IWOA 2V58A 1BDIA 1JL3A 1VJDA 3PIIA 2NLOA 5D5PA 3KALA 4RPIA 3K71B 3UUEA 4EG8A 4WKOA 1VCNA 4HGQA 2DQSA 1QFSA 2TECE 4M54A 3N2KA 2JHCA 2PAAA 1R0ZA 1PZNA 2W8ZA 3V8RA 2BMDA 3VC3A 3BS3A 5C7YA 1PJAA 3AHFA 4QREA 4N49A 3SJBA 2X1LA 1OLSA 1XF1A 3UWPA 2FP4A 2VHEA 4B76A 1H1DA 2YJNA 3N5CA 1DEHA 2VATA 3GVHA 3H2GA 1ZLYA 1O95C 1GR0A 3ANXA 3HRIA 4G25A 4YQYA 1XCMA 2P9TA 5BSGA 1CWUA 4WE3A 3TRIA 1IH8A 1K66A 1SIBE 2ZRPA 3F3KA 3FGOA 1K08A 1YL7A 4UNNA 3T9DA 4OM8A 3NR2A 4RFLA 2ZB2A 3C3DA 4I4TA 4UU1A 4NAUA 4YACA 2Y71A 5HKLA 1NZFA 1JEYB 1U3GA 2OLKA 4LOKA 4KE9A 4O4LB 2VTVA 3SMVA 2Q1YA 3GDHA 4EPWA 3PC8C 2QENA 1UCFA 3BSWA 4UPVA 3EWIA 3R3ZA 4XRRA 5HILA 2YXEA 1ZZEA 1YE3A 2VJQA 4HAOA 2BONA 3DTVD 3ETLA 3IRUA 3LDGA 4CYMA 1XMPA 2JJ1D 3EISA 1U8TA 3EZFA 3LXXA 3L8HA 1DAPA 3CGGA 4X62B 4TS3A 3OVMA 2GEUA 1FLAA 1LW7A 4MWDA 4QQNA 4N03A 4B43A 3GOHA 2I2CA 2QG6A 2XYRA 4RH0A 3CZCA 4RPLA 1JBQA 4P4TA 2ZI6A 1F6DA 3LX5A 1E1LA 1M1NA 1YUNA 4S2UA 4P84A 3WBKA 2A5DA 4KXFB 1EFPB 4B83A 1ZRNA 3L7BA 4HCJA 1E3MA 5JJIA 5CITA 1XN1A 1OGJA 4YP9A 4DGSA 3R9XB 1ORDA 1WV1A 2C8LA 2FQQA 4NXMB 2Z2KA 3M6IA 4ZO9A 1PR2A 2YXPX 3C6KA 3E9MA 4NJEB 5FBWB 2C3MA 2ID9A 3L6EA 4QYMA 3JU3A 3OLYA 4IUYA 1TQ2A 1YB2A 1P1BA 3ZBQA 3R7FA 1FYWA 3ZU5A 1ZI8A 3Q98A 2UAGA 4D3XA 4ZGGA 1CUBA 2BHRA 1RWMA 4BNUA 5J2TB 4I1RA 1H4TA 3C5CA 1ZOSA 2O0LA 3LO8A 4Q03A 1JI3A 2CFOA 3CX7A 3LQ4A 1DMSA 4CG2A 4RAOA 3FPAA 4OI1A 4X6YA 1YCFA 3RUPA 4G26A 1U1EA 3O93A 2QTCA 5EIBD 3WHKA 2JEOA 3UBTA 3CEPB 2OL4A 4BJHB 1MEEA 1ISRA 1Q0SA 3EH1A 3OJWA 1M1UA 4JXKA 3TLZA 2AI1A 2RIRA 4IMRA 2D6FA 4TVOA 3QKWA 1IN7A 1SXJD 1YRBA 2VK4A 1E77A 3R0ZA 4K0RA 3OFKA 1ZR4A 1R5BA 3BWDD 1FDUA 4F56A 3U3WA 3UPDA 3I83A 2XOKA 4GZMA 4U5XA 4NH4A 1MO3A 4UHHA 1ATZA 1NLZA 2FVXA 3FKSD 1NWHA 1Q7GA 3HA2A 4O0LA 1E1CB 1GY8A 3GV0A 4J0KA 5AH0A 5HWSA 1NXOA 1K4MA 1CE8B 3QSGA 2L42A 3IJ5A 4J9VA 1QO7A 1BRMA 2EZUA 2HSDA 1JAHA 1UK7A 2E1PA 3BHMA 4XR4A 3IV6A 1Z39A 1DOHA 4BQFA 3Q41A 1CLEA 3MJTA 4P8RA 1S2IA 2IQIA 2EFDB 5ENDA 4BFXA 5B12A 3THRA 3SPXA 5B7GA 1LBIA 2GVNA 5A4AA 5KCZA 1NVEA 1V3QE 4W9NC 1OX6A 3THWB 4QXQA 3GJ5A 4ARZA 3NAMA 2JARA 1DIRA 2GAAA 1LBHA 4JJKA 1EUYA 5IAKA 1Z56C 5CXXA 4ESVA 2FG5A 1P6UA 1TM7E 1TW2A 1JIXA 1NW9B 4G5SA 3OOYA 2OFXA 4RVHA 3A4LA 2Q50A 2H17A 1YS1X 1M75A 3FDXA 1NP3A 4TXJA 5FWNA 2MDTA 2XD9A 2WJVA 1H93A 3AOEA 1XDUA 1Q5PA 4L3VA 3C6XA 1NN5A 2Q6KA 4P4SB 1CJGA 2DBRA 4OOFA 1CDEA 4AX8A 1B41A 3WLJA 4GX5A 4UXHA 5BWBA 4XEUA 4EYGA 2HRBA 2QVBA 3EZNA 4N5DA 1H5UA 3HVHA 4PFSA 4DVJA 4QELA 4DMCA 2W58A 3CN9A 3U40A 5EWLB 5F2NA 3MLFA 2QTRA 5KU1A 3D81A 4K9SA 3NTRA 2HO5A 4Q66C 521PA 3ITEA 3GVIA 4MW9A 1GNVA 1GAWA 2I4RA 2O8EA 4P0QB 3V48A 2LBPA 5CX1A 1PK8A 1AXRA 4JT2A 1SXPA 2GNAA 5AK5A 2Z6VA 5JI3E 3K70B 3ER9A 2PBLA 1F14A 3TNDA 3T35A 4F5EA 2O5VA 5FNZA 3GYBA 3T7SA 1JEQA 5BNTA 2JGAA 4OMCA 1VKJA 2QX7A 4DIUA 4HLUA 2SKEA 5GV7A 4ZVUA 1UPAA 4FJ0A 5DW0A 1EGHA 5DOVA 4HN4B 1UPBA 4XTRA 4DCPA 3U80A 5ELMA 4NFSA 1LSOA 4F2GA 1T2DA 2ZDQA 4AB1A 3JASA 4LRXA 2PA0A 4HDAA 3C41J 1RDFA 1RWPA 2OTCA 4EW2A 4GQMA 3FDIA 1PJZA 1A82A 1D2NA 1TYEB 1WMFA 3GLTA 3TL2A 4F5YA 3QWFA 2C54A 5IM4F 2AFRA 4LZJA 3R75A 3TL6A 3A0RB 1VG8A 2LCQA 3U7RA 4A8TA 3TQTA 4FUTA 4IGKA 4CKWB 2A9PA 3CRQA 1EQUA 3MOIA 2BMVA 1BGWA 4FWTA 1NVTA 5SYAA 5BVHA 5HZKA 4OUDB 4JP8A 1SUWA 1FRFS 1T5LA 5JT1A 1UAAA 4DV6B 2B37A 5JAOA 5F35A 2NQTA 3EVFA 5EWMA 4F12A 2Q45A 3O0TA 5TX7A 2JAQA 1TM4E 2J41A 3PXGA 4EOGA 3RS0A 1TTTA 1L4UA 2MXDA 2NUBA 2WT9A 3KLMX 2AF4C 2WYUA 1P1RA 3L4KA 1V41E 2AFHB 4KXVA 4FEAA 1GNLA 1ISIA 1ZRMA 4BTLA 1EWYA 2AFVA 3OIVA 1GNQA 1MMFB 1C7FA 2QYSA 4KO8A 3ZXSA 3RVSA 1CUUA 1YR2A 2YV3A 4B6EA 3QVUA 4OTZA 2SCUB 1S8AA 5U4XA 3A1EA 4G9EA 4BNNA 3NHKA 3RUHA 4ZZIA 4FTWA 2C5EA 2Z57A 2ZSBA 3ABZA 4M0LA 1FTWA 3ROKA 3M4YA 2GXAA 5CD1A 4JD5A 1XZ8A 4QVGA 3DMGA 1CSEE 4L95C 1M2VB 4YJ2F 5EHZA 4ILEA 1KEZA 2H0RA 5AP9A 1DJPA 1MB2A 3N2YA 4NV1A 1D2AA 1ICEA 1M1YE 1RMYA 3M6FA 1LPOA 5AJUA 1SQ5A 3NCHA 1MHTA 3MJRA 3LW7A 2DECA 2VRNA 4JNKA 1JDSA 5DZSA 3QLTA 4A5SA 1M72A 2CMDA 4UUMA 4D9GA 5I7VA 1U99A 2WJIA 4JOBA 3STHA 1WLSA 3C3MA 3RLIA 3LDHA 1E9AA 2PHZA 2ATVA 2ZITA 4NAVA 3VR0A 1J0EA 3OZUA 1ORHA 3MAAC 3QPDA 4IIDA 2J7PD 3A1CA 4DSAA 4CG3A 3LUCA 3QEAZ 2OOKA 2HSWA 5CCBA 3V6MA 4OJKA 2V5AA 2B99A 1UJMA 4TL8A 1MB9A 4H1VA 1VCMA 2ADMA 2EBHX 3AGQA 4O4JF 5DN9A 2DWCA 3QX8A 3RK0A 5C4IA 5CXSA 1IVNA 3HGTA 3E22A 1PU2A 2WSIA 3P0IA 3ZEIA 1E2EA 1P6XA 3CUKA 4V0SA 3RSSA 3BREA 3PIDA 4OK5A 3IIMA 4PHCA 2BGTA 3H0CA 3V4SA 1DEAA 2CD9A 2CFRA 4AG3A 3JRXA 2RGEA 1W6RA 1RBZA 4JLNA 4FI3F 4MUIA 4Q9LA 1QP4A 5LQAA 2JKZA 2FP3A 2AFHA 1LNQA 3BHNA 3JQCA 4Z3KA 1IOVA 1P3DA 1BMDA 1JHPA 4LYAA 3EPPA 4PAMA 4QU8A 2ZATA 2FPUA 4UW9A 3D0QA 2BFDB 1UJ6A 3V7UA 1Y80A 3JAKA 2H1RA 2WTMA 4DYDA 4GVPA 3NMUF 4DJJA 1MV8A 2L49A 4W5NA 2VN8A 2M4HA 2J3IA 4JY7A 1LI7A 2UDPA 3CW2A 1RJEA 3WWZA 3ZI4A 3Q0EA 1LC0A 1XZIA 3QH4A 3BPSA 1DL5A 1XXHA 1IBCA 2GK3A 2XB6A 5ALLA 3K1AB 1XC7A 3NH6A 3FJ1A 1I0LA 4DS3A 4ALKA 5EC8A 1PVOA 4CQLA 1O2DA 1N5MA 2VNAA 2IYSA 3KKZA 3I04A 2GD2A 1NUAA 1JJBA 3ADDA 2Y93A 4KGZA 1WCWA 2AQKA 3PQ3A 2AYZA 2QI9F 4KXQA 2KS6A 2YFYA 4RQUA 1OFIA 3GJRA 4JT4A 1WBDA 5LP6F 4I6UA 3B9QA 3PEUA 4J4BA 3RZZA 3B78A 4GPEA 5FA5A 5IUJC 2ACKA 3COZA 4JBXA 1CR4A 3B1JA 1UPTA 3FNIA 2HK9A 4Q5IA 4R9RA 4QRIA 2BLNA 5YASA 2OO3A 4FCVA 4FT4A 4ZOBA 4GD3Q 3QOWA 3I52A 4FDAA 1M1YA 1T5OA 1PR0A 4ZVLA 2XZOA 4NTZA 5CCEA 5F77A 1HE1C 2Z04A 4JJIA 4EW6A 3MNFA 1ISPA 4RHXA 3AGPA 3F8SA 4WK0B 3G2MA 1B93A 1KO7A 2WTBA 4PG5A 4HL6A 3UXMA 2BE9A 3QF4B 5DTIA 5B1DA 4Q1BA 5I48A 4PYMA 2P2LA 3H65A 4EPTA 5BRNA 3VNSA 1R88A 4FBIA 4DJDC 2ZZMA 3F6EX 5FLYA 1JDUA 2OK8A 3WIUA 2YWEA 4G0PA 4C21A 4NKRA 4WADA 2BNOA 1OBOA 1TW3A 3MK31 1EWQA 1XE3A 2OV3A 3H2YA 3F51A 3G6KA 2HB6A 3E9YA 3RRJA 3OEHD 5KOYA 5E6UB 2HU8A 5AXDA 3V1YA 1LRKA 1T8RA 1ESNA 1RM4A 2Q5EA 3IO5A 4IY1A 4CTOA 2VEOA 3VOAA 4M9SA 4L78A 2QRJA 3DFZA 4C2BA 3RC2A 1K92A 4I4NA 3OBIA 4BO5A 1T36B 2F43B 4BX3A 5IABA 1X7GA 3KOOA 4ETIA 4NCJA 3CH5A 5EXTA 1WABA 2A2ZA 2AG5A 4UUBA 3SK0A 3UXYA 2A3NA 1I6LA 4KOEC 4WZAE 4DXAA 1WXFA 2XBUA 3H2ZA 3HCOA 3CCBA 3ML1A 4FFBB 3RQSA 3C5VA 1MDBA 2BRUA 3LGAA 5HOQA 4QDKA 3AFMA 2F1RA 4GKJB 2ZS7A 4R7TA 4E2XA 1G18A 1UWVA 2WP0A 4P1ZA 4HFNA 4ETMA 5C0OE 3GG2A 2JJ2A 3HWWA 3KKOA 1TLLA 4KIFA 5IKPA 3IAUA 2AC2A 4FN4A 3WMGA 1RYHA 4TTIA 3NT2A 2ZWOA 1YRQA 5CDTA 3TD9A 3GX1A 1JWLA 3G0CA 1PT8A 3R3WA 3TD2A 4QVKA 2C7GA 1USVA 3M5WA 1PHRA 4Z58A 1W85B 1QZUA 4IJKA 1UKZA 2Q3FA 5IJXA 4OQ4A 3S8MA 3BJEA 3NNSA 1I2ZA 4AZTA 4CF4A 1NXWA 3CLTD 4U4AA 3VC1A 2CCJA 1E1MA 3T7AA 1Y9DA 3IXLA 4F9FA 5E1BA 5JH7B 2C9MA 2QRVA 2XRYA 1K7XB 4NDNE 4RVNA 4YJHB 1GNTA 5AKJA 5EVJA 5HJ2A 4EG6A 3GP3A 1RI2A 1Y1KE 1T1IA 2FUNB 3FPCA 3K1TA 4NYIQ 4JHLA 5D2CA 5CAEB 3WGQA 1KDYA 4DA7A 3P2EA 3HKEB 5G1OA 5JTTA 4PU8A 3JQDA 1I10A 4U2BA 5BWOA 4XWYA 4KDEA 4Y9UA 5B6JA 3VDQA 4EARA 3OZGA 3FCAA 1CIVA 2WM2A 3KYCA 5DWDA 4JI1B 3VR6D 1EGAA 1K9SA 2O4CA 2Y92A 1T6YA 4KVGA 4IOLA 3SSOA 3UY4A 4FJ2A 3II6X 3OJEA 2PWYA 4DJAA 5LU9A 3EOBI 1N92A 2RC5A 1HE4A 3MD9A 2H1FA 1J09A 2VNSA 3R40A 3VYVA 3CCFA 5JDIA 1FMLA 2PX2A 4QOHA 5BYBA 3WGMA 3IB3A 3KUUA 1EZ4A 1G8AA 2C2WA 3MWLA 3QFFA 4QAJA 1IHUA 5E9WA 1QMGA 1FXWF 1QPGA 2LKDA 3CPHA 5JFOA 1TVKA 3PQCA 3LRXA 4AG6A 5T67A 3EF0A 2FN9A 4K05A 1ZQ1A 3B12A 2NN3C 1E3WA 3BRQA 4OY3A 2QTBA 5JC8A 2GCPA 1NVKA 4RS4A 5A3RA 3IVPA 1EAYA 1GSOA 2AWOA 2VFAA 3GRZA 1A98A 4RKWA 2YZ7A 1U2SA 2RGBA 3QEMA 1XZMA 2QX4A 1TADA 3BDIA 1LQ2A 3BEOA 3IP1A 1E1KA 3M6WA 2GI4A 4L7VA 2C2GA 2J67A 3K0AA 5FLEX 2M6SA 4FWIB 1PCXA 4F04A 3L05A 2C4TA 2XCSB 2GHQA 1IN1A 5AKLA 3W3ZB 4KQKA 1V45E 3QPVA 2QM3A 3QEKA 4V03A 4ZVKA 3E1SA 3OE5A 2A1TR 3NPAA 1I30A 3C6MA 2Q46A 1XEXB 2OBBA 3D8RA 3K0HA 5FFMA 5HSGA 3WIVA 3BWMA 4HS9A 2YCBA 2NVBA 1J8DA 1PJ8A 1Z4LA 1DHRA 3M4JA 4KLAA 1D0SA 1IQUA 4XCQA 3B9PA 5BSWA 4NV0A 2AI3A 5AJHA 4KSBA 5EVCA 5JD4A 5KYWB 2H2FA 1C0LA 1TZKA 3F0TA 1QYXA 3COYA 4PSCA 4PZ9A 5F52A 4YUYA 3T3NA 2FCAA 3AEZA 1VMKA 2UXCB 2ZYRA 2P5YA 5IXJA 2CXOA 2QZPA 1QH8A 5CYOA 1N2XA 1JF8A 4KPEC 2XADA 3F7MA 1K9VF 1E0JA 1X2BA 1CUAA 1F51E 3AL3A 3EUFA 3R3JA 721PA 1G21E 3S2SA 4DANA 3K20A 1ZICA 4B8WA 3QPUA 4HVLA 1MAUA 5HEKA 4MIKA 3SVZA 2ZSUA 2P4EA 4TWAA 5G0SA 3IMKA 1L5MA 2V5VA 4K6HA 3ZI0A 4C6HA 4YMVA 3A1DA 3TRHA 3BD7A 3RW9A 1KK3A 2ET6A 2XB2A 3C24A 5LM3A 4GH5A 5CGZA 3P9NA 4FE3A 3K6RA 4QQKA 3R7NA 2NUAA 3ZEAA 5E9QA 4DLLA 3GJZA 2LGJA 2XXBA 2AUWA 2A9JA 3NNNA 1C50A 4MUAA 3HJGA 4Q6WA 1ZAKA 4L28A 4X6UA 1ZM3A 1LBSA 4U7FA 3U4AA 2NU9A 1E9CA 1W4LA 2XLCA 3BDVA 1Y4DE 1F8UA 5DI3B 3FOFC 3O2JA 1IHXA 1PKXA 2W11A 2FWAA 2IBMA 4JQYA 4Z9BA 1NI5A 4PX3A 1M6HA 1OAOC 1XA4A 2W2LD 2YUTA 3GXOA 5L4SA 2WF6A 3K05A 3TB6A 1NNEA 2B1IA 1QDEA 3QLUC 4W5QA 1FDRA 3VPHA 2M1XA 1FFHA 4A2CA 2ZJZA 2NVWA 2VK8A 2R1JL 5HK9A 3DZBA 1BSVA 3CLUD 3RC3A 2XA2A 3CLRC 1TFUA 4HEA1 3T7KA 1O9GA 2HQ1A 2IYOA 2DULA 2OWDA 4S0ZA 1OXVA 2BBWA 4FGZA 3FHCB 2AJDA 2MTBA 4MVJM 2AXEA 3PTZA 1B2LA 2BFBB 1U5BA 1CV2A 1XDZA 3K2EA 3EEQA 1X92A 1NJFA 4PO3X 4DCVA 1JPNA 1DAGA 5KOHA 1UPUA 1Z25A 2G67A 5JXHA 4P5DA 1N3YA 3SQLA 4PZAA 4YP5A 3PRJA 4BBJA 3ZWPA 4UPEA 5KS2A 1KE2A 4PINA 3V7YA 2PTHA 2WJ6A 2AFIE 1BWQA 1LPPA 2MSWA 2R8EA 4IXWA 4TXMA 3EEOA 4ZREA 1R15A 4QQ8A 3PD1A 1ZO8A 3EX7C 4E4YA 3NHYA 4WKGA 1EG2A 1S4MA 3NW9A 3ELYA 3DKRA 4LCJA 2RAVA 2ZTLA 1CEEA 4OHCA 4XSVA 4I14A 5T6MA 4MPPA 2E7ZA 2R5WA 4U6SA 4L8VA 4I55F 1RYFA 1YU9A 5KYYA 3DWFA 1CERA 3C6YA 5AO9A 5AVJA 3SJAA 2WHPA 4L8FA 2BCJQ 4EW3A 4UVEA 4H7EA 1W8DA 3UAOA 2FW1A 2QAGB 3PITA 4O5AA 3BCUA 3LKVA 4R8SA 3ET4A 1YZHA 4CU5A 2OM6A 2DR2A 5AKGA 3CE9A 5I4CA 2O8DA 4GXQA 4OI2A 2EW8A 1NVVR 4M89A 3BFKA 2MINA 1Y3DE 2C78A 4D9BA 1FMFA 3LPCA 2DYKA 2XWSA 3I4FA 4M0EA 3NVAA 4UQOA 2Q49A 4JVLA 4GL4A 4JOCA 4Z5HA 2ZYTX 4G67A 4A8HA 4A9AA 3VR5A 4JI7B 1EWVA 4E1AA 3W5VA 3HVRA 3H0EA 1AGNA 1ZCZA 1II8A 2VJMA 4I2VA 4UDXX 2IE0A 1WKCA 3PE4A 3SLKA 1C8LA 2CLCX 3UAXA 2MQKA 1KH2A 1P0IA 3OJCA 4K8OA 4NZZA 1W2GA 2I65A 1YIDA 5EMHA 4UHJA 3R9IA 2ZR9A 1P8AA 1O95D 1L3CA 1E59A 2H4YA 1BS9A 3GT0A 3W5BA 2FOIA 2ZSAA 3FVWA 3L5KA 5TVGA 5AI4A 4ZTZB 4BNXA 1A5BB 1RPZA 3HEBA 1P3JA 1PJRA 3TUIC 3WIBA 5L7YA 2FQWA 4PS1A 4ZO8A 4Z99A 2VZEA 1M76A 3HB9A 4TV8F 5D3ZA 1OH5A 3PGKA 4KITB 1AU7A 1GFSA 4HWTA 4MX8A 3HXMA 4BMYA 3OZSA 1XWRA 1XQWA 1E1YA 4HYYA 2ZAIA 4YUZA 5EFZA 4ZYYA 3DLIA 4KBFA 3HNOA 5REQB 1DBVO 3HBNA 1E79D 4V0NA 3U31A 4DT1B 3GLHA 4R6XA 5FV4A 5J4LA 1G3RA 2Z2JA 1YRHA 2FPMA 3PC6A 1A8HA 1PKEA 3BXGA 1VBMA 3QXCA 4WEQA 2Z8XA 1AO3A 3AVVA 4S24A 2PWBA 4WNAA 2O49A 5TT1A 3E9CA 3GFFA 1KVQA 4CIDA 2GCOA 3W5SA 5JMWA 1J5PA 2GWHA 1W1WA 2ZSEA 3VAAA 5M2QA 1DWUA 3HGMA 4HTFB 2OCXA 5IJ0A 3DNPA 1N5KA 1OVGA 2OXIA 3B1KA 4M98A 5JS6A 1EBFA 1NLYA 5AW5A 5MGNA 1VB3A 2W6ID 3AUUA 4P7GA 3DCJA 3DEYX 3ENZA 5JAZA 1EP9A 1R16A 2X1MA 2O2HA 4A36A 1U1IA 2PH5A 3GFVA 3LF1A 2R4QA 5FNVF 4MJ3A 1EFPA 1PGJA 3VSEA 4CM6A 3CX3A 4F45A 4AUMA 3E6AA 2SKCA 3EVCA 5L4NA 1T2AA 2P8JA 4YWHA 1MX5A 3KUCA 3TW6A 2XRZA 3F5SA 4FQ7A 3PUHA 2CLEB 4R1MA 4CI9A 2L18A 4FEGA 3VR4A 4I8TA 1SRQA 5F2EA 4Q12A 2FPIA 5L3SA 2HWKA 2FNAA 1LK0A 1FJ2A 1XD2B 3R3UA 4BGDA 1MABB 3ZNOA 1CJTC 1TB4A 2ZREA 3NBMA 4H7IA 4JXXA 4G5QA 1CRQA 2WD8A 1KVTA 4Q3BA 3E18A 2VZ9A 4IHJA 2PR2A 4S1NA 4B1FA 3WLFA 1JLKA 2O4UX 2GD1O 4AJLA 2VBIA 5JZ9A 2NU7B 2QMEA 4DG5A 5BP7A 1OXMA 2OC9A 2NTEA 2CDNA 4U2FA 3L2OB 1H0HA 3INNA 3SX4A 4B33A 3N70A 1TTHA 2C1EA 5K0SA 4GBED 1DIGA 3D6HA 4RHTA 3QW4B 2R48A 4ND7A 3ZIAD 4PX2A 4A7PA 5FL7A 5TEVA 2WNSA 1JDBC 1FUEA 1MCZA 3HU5A 1ISFA 1U9ZA 2HA2A 1KOJA 3L07A 3M2PA 4HSGA 4OOEA 1GNSA 3KEFA 1HOTA 3INRA 3R0VA 1U8EA 2XV1A 4ZT7A 2C42A 2GB4A 1W96A 2PGJA 3GGJA 4S1OA 3ZIDA 1JKJB 4K28A 3CO5A 2IYTA 3FFWA 4IG9A 4XPZA 5KQLA 2FXVA 4EATA 1DIHA 2CXTA 2AG1A 3QVSA 5JMTA 3K9CA 3A3NA 4LJAA 2DKOA 2QNBA 3HYLA 4HWGA 4JR0A 1WVIA 3X1JA 5KQGA 2R00C 1FMTA 2PUEA 4AL4A 5BMOA 3OF2A 3N6XA 4FU0A 3V2UA 1CZKA 3THWA 4ZQBA 2QIPA 3MT7A 4B2IA 2DPMA 3OECA 4DLSA 4TLBA 2YIMA 3JAMA 3HS3A 4M8IA 5B1SA 1CNMA 5K2MA 3CKLA 2QRLA 1JQLB 1N2EA 3L0BA 3EUAA 3PI7A 1T10A 1BE8A 3RKSA 4L76A 5AW0A 1A69A 1WW3A 3RJ9A 1S2MA 5IDQA 4IVPA 3S2IA 3LQXA 1NZJA 1MJ5A 1NG1A 1PZEA 2ZVQX 1MRZA 3O21A 4H3KB 4Q3LA 3GJ8A 2ST1A 1H2BA 1I7LA 1U94A 2GPAA 5B53A 3WQRA 3IDSA 4UE6A 4FIDA 4RORA 5DTEA 4KRXA 3Q7TA 4AMYA 2QAGC 4AZ0B 1X8XA 3Q85A 5FRDA 2VTBB 3I23A 4IHJB 4QOJA 4PTZA 4QD3A 1D5CA 5BN3B 4PYIA 1ULAA 4LXUA 4YJFB 1U63A 4I5DA 3EZ7A 1GFWA 4IDEA 1KZHA 1TEHA 4ZC1A 4KR6A 4JFRA 3N58A 3HBAA 1WMEA 2ZIXB 2JZNA 1N0IA 1OILA 5HX7A 5IMSA 3OZRA 2ZIAA 5KSZA 4YK7A 1DJQA 1ZU5A 1SH7A 2CSUA 3ZV5A 2RHDA 5JATA 3LF2A 1PR9A 4LMAA 4N8SA 5CM9C 2FPXA 5HDQA 1DRUA 1U3DA 2QX6A 1FLVA 1LLCA 4RE6A 1NIJA 3BB3A 4E08A 2ZB3A 4ZIRA 4DTIA 5JMPA 3D1NI 1Z0KA 5CB0A 1TT7A 5K8TA 2I9KA 4PFKA 2VRBA 1CVRA 3PDIA 4CMCA 4IA8A 2PRYA 1N7JA 2I2BA 1P5HA 3DBRA 3JYNA 4TTAA 4JLBA 4W5WA 5ICFA 4BFSA 3B2NA 2GJAA 1XRJA 1XZKA 3OAAA 3UHAA 4CTMA 1O7JA 2GPSA 3SR0A 4CLEA 5BORA 5L6LB 2E48A 1QH1A 3KQMA 3PFCA 2D06A 2X7XA 3MWKA 4YWJA 1GCOA 3GRPA 1AGRA 1RBQA 3BQ9A 3BXFA 1XNHA 4KMSA 3RUFA 5KJ1A 1GLVA 4D41A 3E4DA 4MQ6A 1YAHA 3R3YA 2UKDA 2C1ZA 2FYTA 2EU8A 3OTGA 2IBTA 1L5KA 2AUNA 4QJ5A 4RPKA 3D3EA 1E3JA 3HKBA 3VX3A 5DVZA 3I73A 5FDFA 2EJBA 4FYYA 4MMYB 1W75A 1G4UR 2XYVA 4H27A 4RM2A 3KU1A 1RWVA 1OZFA 2REQA 3M7IA 5DHPA 1W36D 1RM5A 3EBPA 1IZ7A 2IPAB 4NCKA 2D0OB 3EYAA 2H0QA 4IDOA 4OK3A 3PQ5A 2I4OA 2QRHA 3AHCA 3KKNA 4W8GA 3HFRA 3LCCA 1LRJA 4GW3A 1YI1A 4Q7KA 4ZI7A 1E0AA 1RJ9B 4JL8A 1ZHFA 3RAPR 2F9LA 3SJZA 1RMQA 2I3AA 1ULBA 3LQYA 1ML3A 2YYAA 1M67A 3LXUX 3Q1KA 4R71A 2FWBA 1E8NA 2P7IA 2ISQA 2M6LA 1V25A 2KSQA 3GP5A 5E3IA 4TMZA 2OR3A 3HUEA 5EEGA 3Q8XB 3V1TC 3O4FA 4KYIB 4HRYA 2JKVA 3B5IA 3IVCA 1E7MA 4KWHA 5JNSA 1HH4A 4N54A 2CW5A 1E8DA 2UVDA 3B8HA 5KTYA 4PONA 5JVDB 2IEBA 3B1VA 4PO9A 1FDSA 3LD9A 3R41A 4QGGA 2HCNA 4XM2A 2LIPA 1XZDA 2CE2X 4RD4A 5K0LA 3DXFA 1A2QA 3PXCX 4LDQA 2V4ZA 3SC4A 3ACCA 1N6HA 1JJIA 1T6NA 2VRWA 2PXQA 1KHHA 3HI6A 4H16A 4HAYA 3M82A 4L5IA 5K0NA 1Q0TA 2JDID 5C5DA 1DT5A 2J3JA 3IT1A 3ZCPA 4G8CA 1Z22A 5A1TA 5IAOA 4Y6GB 1AGPA 3PSHA 4HX2A 5B7PA 2Z9CA 1QFJA 3C3YA 3QLVA 3ZVLA 1HEIA 2AE2A 2ZBDA 3R44A 5CEEA 2AOTB 5BV0A 2ORYA 4DCTA 3Q0TA 5KX5A 1VP9A 4RX1A 3OZWA 3Q7PA 1NX9A 2IEIA 4FCCA 4DCGA 4CEIA 4UE2A 1NR5A 4Q9HA 3SU8A 1YE8A 2VDKB 1N0UA 1P0CA 1HO3A 4KIUA 4PLHA 3KR9A 1ZHOA 2J32A 4XUCA 1KZYC 2YHIA 4RUKA 2DJ5A 4UCQA 4ZU3A 1XLTC 3GLFE 1G2PA 1GTJ1 3N2EA 2OSBA 4K9KA 5GJCA 1WETA 2CE7A 3MINA 5LIPA 4XD2A 1UMKA 1GILA 1KMHA 4B85A 2FE4A 2Q1WA 4B82A 1CETA 5FCDA 1IB0A 3IO3A 5CLGA 1UDCA 2YZMA 4HUTA 2EGGA 4EH1A 4M99A 4UM9B 4WZBE 4E33A 2FPOA 4GU5A 1NBHA 2WJPA 3AESB 3GEMA 1T5BA 2PG3A 4KOAA 1KBOA 3SZRA 4EJFA 2XDQB 2R8ZA 4YUWA 3ED5A 2GBLC 3ITKA 2VAXA 4D9MA 4RTKA 5LDDC 4LFAB 3D2AA 3BE6A 4QGBA 2UUOA 4RSGA 5HTKA 2W2LA 2VBGA 3GBSA 3DV0B 3ENKA 2DHQA 3FLMA 4XVQA 3SEFA 4WH0A 1UQUA 3VR3A 4X8HA 3OF5A 5BNIA 3MELA 2WYVA 4HYTA 4PHGA 5ALYA 5EI5A 3QV1A 2QNRA 2Z08A 1COZA 4Q6BA 1KHTA 4HDRA 4LIPD 3ZWMA 4I7EA 4C7OB 2QI9C 4ENUA 1Z33A 3C3EA 2ZB4A 3CKYA 3LCUA 2VSFA 4E51A 4MUKA 1RJDA 4LW8A 2JKYA 3TIGA 1BRTA 4DPKA 1TF7A 4OYHA 5CCDA 2IFTA 1YB7A 4AZVA 4C3ZA 4ZHQB 3EUEA 3QFRA 1CKEA 1XHLA 2W6OA 4Q0MA 4E5DA 1VPTA 1OCTC 1DO0A 2X0IA 4HAZA 4UOQA 2GRAA 1LPMA 4C89A 1ENOA 5L53A 1L4YA 3NP7A 3W06A 5IJ9B 3I2YX 1IAQA 1RAAA 2BDUA 2O2SA 2OZEA 2PMCA 3E1KA 4EZEA 4CEIB 1SOUA 2FK7A 1JTEA 1TRKA 2I1VB 4IIJA 2GO1A 2VH5R 4WMLA 4WXYB 5I4KA 3AHDA 1KU6A 3GHYA 4NG4A 3KT8A 1T8SA 2D1YA 3D7RA 3AKDA 3LPNA 2XSZD 4AK9A 2Y99A 3CWCA 1X8JA 3LHDA 1DG1G 4Q3DA 1GPMA 3PNQA 5UKDA 4C0XA 2DUUA 3IQFA 1H2EA 3HP7A 2VSXA 3OICA 3ZYCA 4X91A 2NWQA 4HYQA 2PX0A 4IL5A 1QE0A 2W22A 4JASB 3MRXA 4AF6A 3IVRA 3RIHA 4XM0A 2OB2A 1B16A 4E03A 5IKEA 4UDNA 4D96A 4CG0A 1RRFA 3H04A 2OFWA 4R2WA 3ESCA 1GARA 8GPBA 3KZ3A 4ZN6A 3FSRA 3LUKA 4J2HA 1XAGA 3NT4A 2ZIUB 4TM7A 4EG7A 5JRJA 3I61A 2FEMA 1NWCA 2CNBA 1E4OA 3T5GA 4DCCA 1QLHA 1UZAA 1ZUWA 2ZP1A 4WCVA 3WWCA 4ERXA 4MDFA 2C95A 3WOHA 5IHPA 2W98A 1BXGA 3KKKA 4KIGA 3SZOA 3AXTA 2EP7A 5IM4A 4I19A 4DKJA 3F1KA 1UJ4A 3RHZA 4EZBA 1YQXA 3TJZA 3JXBC 2PFSA 3S5UA 1XRMA 2P9CA 3D2CA 2AUMA 3ZOZA 1CQWA 1WO8A 4JJ8A 1A7KA 5CDHA 2GMWA 1O95A 2JB9A 4OKNA 4QA9A 2A5JA 4PC7A 5EHXA 1MOQA 2G36A 1XNQB 2CKDA 3DE3X 1QGYA 3CNBA 1SA0A 5JAIA 3NHAA 5JOQA 4UASA 2XITA 3FN4A 3RSFA 1W4CA 2RJOA 2LCFA 3VTAA 3M6AA 3PX2A 3RADC 3LWNA 4JR2A 3K30A 2RGUA 2VZ0A 1BVHA 1QHHB 2VP4A 4RIEA 4QTTB 2ECOA 2D2XA 5DIFA 4JBIA 3BFPA 5TJHA 1UPCA 1P80A 2YNMA 4GL2A 3NEJA 3HCRA 1Z47A 5H9WA 1WOMA 2ZSFA 2YIJA 2HLNA 4MHOA 4UUPA 1NBMA 4PRYA 3V4PB 1O6GA 3PDUA 5EWJA 4A27A 1PSZA 1Y8RB 2YZKA 3JARA 3A6GA 4IUCS 3W1WA 4ZK2A 3D1VA 5TEWA 5C4GB 2NG1A 5F64A 5LP6B 4HVCA 1J2RA 2XOKD 5DIZA 2I87A 2JGLA 5DHSA 2P9JA 1EFLA 4HNHA 4EHDA 2BHTA 1GRRA 1UJ2A 2BZGA 1T9GS 2JH9A 2E21A 1TRHA 5LYJA 4H31A 1HDRA 2Y1FA 1DEXA 4KXWA 3B1YA 4PG4A 4Y3UA 3WDLA 4AO8A 4MWCA 2HX1A 5K9ZA 4BTVA 1D2MA 4EELA 3DFKA 4ALIA 1MVNA 4HGZA 3B6KA 5FLKA 5JC1A 1PJTA 1EIWA 2AK3A 2P90A 3DD1A 1YQDA 3EEBA 3JS5A 1QS0B 3ZDZB 2ZS9A 4AIRA 5GM2A 2X0DA 3IUEA 2NU6A 4KPUA 1FP7A 1ZONA 1J1ZA 3IIJA 4G09A 3VR4D 1SXQA 1OX4A 3JQAA 3W4KA 1H1LA 3BFXA 3O84A 4G0YA 4LDAA 2AXQA 2VDQB 3C16C 3ETGA 3RBZA 3O7MA 5IASA 5J4VA 4L4RA 1C2YA 1T8YA 1MIOB 4W5HA 2NYRA 3CLSD 4IH9A 3IL2A 5CYGA 4EUSA 2REOA 1OZHA 4Z7JA 3Q15C 1KI7A 2C7VA 1T2CA 3DZIA 3NOXA 5FUBA 2JCBA 4Y2GA 1IEVA 4YV2A 5B4TA 1DJMA 5I9SA 2XKBA 3IQEA 3M6MD 4XDHA 5DFAA 5BWMA 4N18A 2VP3A 3UT6A 3AHHA 3B38A 3IC5A 4RQTA 2Q7DA 2B8NA 2O2CA 3C6ZA 2N75A 3EODA 4HB3A 2ZWVA 4L85A 2GN4A 2ZUWA 4FGUA 4GICA 2C7PA 5DM4A 4DABA 1WPRA 1XEAA 2J48A 3FYDA 1XJ5A 3L92A 4JUIA 2IYEA 2R7KA 4LHEA 4OP3A 3VYUB 4F84A 4ZOLB 2C9ZA 1B8VA 1SHLA 2ZVDA 4W6QA 3VC2A 4B45A 3FNQA 4BVLA 4YV7A 1K75A 4TYQA 2E4VA 3WLEA 1P1CA 3OZVA 1XDGA 2FZKA 3LBAA 5L45A 1ZJJA 1GSHA 3E0QA 1P4GA 2VLIA 2GN0A 4FKZA 4J7UA 2BSXA 2XQKA 3WWPA 1LBTA 5D3QA 3R1IA 1KI6A 2V7GA 4MUGA 3IAXA 5DBGA 4P4SA 2HRDA 4CM1A 1VBFA 2EFHB 4JSTA 1KYXA 5GPBA 1GGVA 3P26A 3H1FA 3S2GA 1JJFA 4Z1MD 3NDPA 10MHA 1KO4A 4IDQA 4EKGA 1BHQ1 2HSZA 5DX1A 3H1BA 1V37A 1WCV1 2RB5A 3ZWYA 3EIEA 4N0MA 4EY7A 3W6ZA 1K6IA 4GDFA 4KWTA 3PX3A 1GGKA 4BGVA 2GUWA 2ZRBA 2NSJA 1UBLS 3D6JA 1ESCA 3O4JA 3PRYA 1Z2DA 4YPVA 5EXXA 3WLIA 5D3MB 2X4DA 2XHEA 2QP9X 4QXAA 1BVUA 3IUNA 5TT0A 1MC8A 1SCJA 3AEUB 5K3FB 2ZZNA 5F9MA 2CMHA 4WXPA 2HCSA 1X8KA 2GZ3A 3ESDA 1ZNXA 2CXSA 2XNJA 5JNLA 4XWGA 2C82A 4HB2A 3H2BA 1K8YB 1NLUA 1A8QA 2ATCA 4URXR 1SQSA 2AR0A 2O1EA 5JALA 1E7YA 2XPCA 4RMJA 4A0HA 2B9EA 4ZICA 3KB6A 1Z07A 3PD7A 5KBYA 2IU6A 5T4FA 3SC2B 3NQ41 3MLAA 4CLDA 4I6TA 3VDMA 4DDVA 1T9KA 3PGXA 2QXTA 3WAKA 1B8NA 4XPIA 1ZZCA 1EWTA 1JQ5A 4ZEOA 3ZQUA 1XAHA 2P3OA 4KO3S 1NUTA 1QV7A 3NIFB 4WT7A 4BASA 5AW8A 3KQVA 1EIZA 4RTOA 1NYRA 1PAUA 3M9XA 3R8FA 3ONDA 1WTCA 3TF5A 3K2IA 1QOPB 2F1HA 1PNVA 1YR6A 2P3SA 3D1LA 4YDSA 1JPUA 5ENVA 3LQ1A 3SZLA 5IZCC 3O1HB 3CECA 1B14A 4UPDA 4D42A 1Z7YA 2QTWB 4RXTA 1Q74A 3QUTA 3DMTA 1P4AA 1Z3IX 1J07A 1GL3A 1PT6A 3K94A 1F9EA 4M1OA 2C5LA 1H2AS 1Z4PX 3PHGA 3OLXA 2ZIEA 1E2FA 2VG8A 1WZ2A 4CCYB 1WCXA 1N4AA 2YDYA 4WKBA 3OQVA 4OJMX 3QXGA 2HOQA 5AHKA 1XPOA 4OLBA 3EG5A 5LOVF 3PJGA 2VLBA 4Q48A 1NVDA 5DMHA 3C1AA 3M89A 3BFJA 2OHGA 4EMTA 1EDEA 2GUGA 4IQFA 5JJ5A 2IXGA 1UEJA 2ODRD 1YKSA 5DB4A 5K8UA 4R9UC 1YZYA 1E2BA 2BFOA 1NF8A 2P9BA 1ZPQA 3IP6A 3OOEA 5I7SA 1JDVA 3QVGB 4AJ2A 4OMUA 4BX0A 3AV3A 2P9ZA 3R5XA 1NJ1A 3UOAB 1SC9A 2CHVA 2VT6A 4ZTUB 3F98A 2JAHA 2WKSA 2WSMA 1NM5C 1DDOA 2W6MA 3K73O 4B3XA 3KHSA 1E9DA 2EP5A 3JASB 3MG9A 2QRGA 2VDVE 4RYLA 2DCUA 2JCGA 2YJGA 2Z30A 1Q17A 4LYYA 4I4IA 1FU7A 1X3SA 2JFBA 2BEJA 5K6TA 2YOHA 2GKGA 3WNVA 1N1GA 1IYZA 1UF9A 1M34A 2HQRA 4I55B 3QKRA 1IWBB 1RKQA 1SUPA 4NLLA 1FDTA 5T64A 1Y37A 3KR0A 5E2AA 4DA8A 4EO4A 3TQSA 1QVWA 5BR7A 1FZTA 1X6VA 4Q1VA 3WSWA 2R6JA 5CBKA 3L8MA 4XFDA 2WB4A 3K4QA 1YCHA 4BN0A 4CIYA 1ZGAA 3WMWA 1R0CA 2QAIA 5DDIP 3TLXA 3EG9B 4BO1A 3ODGA 3DDNA 1MEJA 2JLUA 1PFVA 2OGZA 1NUHA 1XEWX 4B34A 4WBNF 5ICSA 1A9TA 2PMDA 2JBHA 1TLTA 3JPYA 4JS0A 4UCXA 4PZZA 3JD0A 2O7VA 4AS1A 1NW4A 2C77A 1DVRA 2EFEB 1Z12A 1NU6A 4J0CA 1M7GA 3VU9A 1PRYA 5KQPA 2WWWA 1IUNA 1PEAA 4J4TA 4R4JA 4V0QA 1XKLA 2SCUA 2MSCB 3HN6A 1CY1A 5JJCA 1AKRA 1F2UB 4B81A 2WSBA 1NW3A 1SKBA 2JIOA 2EL7A 4JI0B 4LVOA 2YWJA 1K2VN 2KBFA 5J1SB 2ZE7A 4FFLA 3EDQA 4TMXA 2R8BA 3GN5B 2VHXA 3AI1A 3FB1A 1KZ1A 3PDJA 1P61B 2DWOA 3QQ5A 4FI3C 4R0NA 4UDOA 4AJEA 4O33A 2W2OA 1NQUA 4DLAA 2VA8A 4H9GA 1J7JA 1E2JA 2WV9A 4NH0A 1JNXX 3RFFA 4PF1A 1YIAA 3D7KA 4YMGA 1TCCA 3AW9A 1GQQA