1JFSA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jfsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA02
1JYFA 4Z58A 3Q7SA 2OQRA 1PEAA 1S8NA 3KG2A 3QELB 3Q7TA 5CNKA 5KWSA 4KREA 2HQOA 1E2BA 3CECA 1FFSA 1Z15A 3JVIA 1WH6A 4RS3A 3GA5A 3S8QA 5IC5A 1U2QA 2CD7A 2RJOA 3OM1A 3MA0A 4ZPJA 3R0JA 5TQ0A 3ZKCA 4EUKA 2CHFA 1BDJA 2FKAA 4X4BA 2MYNA 3RVRA 1U8TA 4EYGA 3IP7A 4XAQA 3QLUC 1ZZ9A 2PL1A 3D02A 3D8UA 3H1GA 3M9XA 4IF4A 1PNRA 3FMVA 4MQEB 2QW1A 1S7EA 4EY3A 1LK0A 4KFCA 4B09A 4MR9B 2FQWA 3LKBA 2A6CA 1RXEA 4YGXB 1NXOA 1RPJA 1D4ZA 3T38A 3OO1A 4WXEA 1P6UA 2M1ZA 3GBVA 3I09A 2PKXA 5CHYA 2LYKA 1A2OA 3RVMA 2L19A 1GUBA 2O4AA 1TJYA 1OXKB 8ABPA 5C5EA 3FFTA 3FYAA 3KYIB 6ABPA 1WH8A 1ZESA 5DKFA 2E4ZA 4KMRA 4MQFB 1ZAYA 4IMIB 3G5GA 3EUSA 1IIBA 3H6HA 3O2JA 4RSMA 3E3MA 1C0EA 2IPNA 5B3JA 1RIOA 3VNBA 1JFSA 1NERA 2FLKA 3EAFA 3CZCA 1ZH2A 5HQJA 3SNKA 2CROA 3U3WA 4OB4A 5FBKA 1SQ8A 2M98A 3FFXA 3LTEA 4YLEA 5DCLA 4DN6A 4N0QA 4RXUA 5T3YA 3DLBA 2ID9A 2WJAA 3BBLA 2PUFA 4LE0A 3O9XA 3ZHMA 4I6TA 3H5LA 3LUFA 1QP7A 2PIJA 2KEJA 3R1FA 1JF8A 4X4DA 1SXGA 2B5AA 4O5AA 4KQCA 4XFKA 4ZJPA 5JNRA 4S04A 3JTEA 2E4WA 3O1IC 1OXBB 1ISRA 3ROTA 1GLGA 4MS4B 2IDMA 2MYTA 3LFPA 3DGFC 3F6PA 2QU7A 3IVPA 3MLFA 1DZ3A 1Z25A 1RXIA 2MYUA 3OQNA 3FDFA 3LMKA 4N47A 3UK0A 1QPZA 1XHFA 1E3OC 2JBAA 1LCCA 3CTPA 2L49A 2CWDA 1NY5A 3GBPA 4YWHA 5IUNC 4MCXA 1BDHA 4JCYA 3QEKA 1QNLA 1NTRA 4YG7B 4Y9TA 3DLHA 5BRAA 3FMYA 1ABFA 1A04A 1QO0D 5KQGA 3I45A 4W5QA 4YRZA 3EODA 2HPHA 2GZUA 3SCGA 2CHEA 3H5WA 2VUHB 1QP0A 1DP4A 3RVQA 4IWRA 5JS2A 5KQLA 4UHKA 1CYEA 3O2QB 4MS3A 5CNMA 4CBVA 2OFYA 1QQAA 3CRNA 3VK0A 1KGSA 1ZZCA 4PU4C 1NXWA 2FLWA 3H1EA 4MAAA 1USIA 3KS9A 3KJXA 3E61A 4OATA 1Y7YA 1LJLA 3BRSA 3KZ3A 4JCXA 1GCAA 1M5UA 2FEPA 3JS5A 4GNRA 5GOTA 1E6KA 4Z4HA 2L17A 2NUBA 1DC7A 1MB3A 2VUIB 3RVKA 1K66A 3MF4A 2GBPA 3GT7A 4G0XA 4HNSA 1ZN2A 3NNDA 4KK4A 1TVMA 3GWGA 3OMXA 1RZRA 4NV3A 2IVGA 1DCKA 1SXIA 2PAFA 3TX6A 5FWYA 1APBA 1M2FA 1D5WA 1R69A 3QX8A 2R63A 2QVGA 2L8NA 5KC8A 2PE5A 1RZRD 1Z18A 5TQ2A 3BILA 3C3MA 4ETNA 3HEBA 1XWWA 3N8IA 3Q15C 3TMYA 3QK7A 5HKOA 1MAVA 1JWLA 3PXPA 1UXCA 4JASB 4RK0A 5IEJA 1CQTA 2L2QA 2A9QA 3HM9A 4JA2A 4OLBA 2EWTA 1KRXA 4PE5B 4GPAA 4RY0A 4E7PA 5TPZA 1DBWA 1YSEA 1F51E 3F51A 4Z5CA 3LUCA 4OTZA 2LYLA 3OLYA 4MQEA 2HJ9A 4MRMA 5JNVA 1AB6A 2NZVG 5I4CA 3O21A 4XXHA 2Q5CA 4MR9A 3UUGA 3ZHIA 2GI4A 4QYWA 1AU7A 1WIZA 5PNTA 2BNMA 1XHEA 2IYNA 4JB2A 3RVJA 5KQPA 2LCVA 4J1XA 4RXTA 3HCWA 2DRIA 4JOQA 4PZ0A 4P1ZA 1CHNA 4MLDA 4WZZA 3SM9A 2XDYA 2XCJA 2O49A 2IPMA 3N53A 3A3KA 3CZ5A 1YIOA 3KKEA 5JNUA 4DADA 1VRVA 3A10A 2FQXA 3OQMA 2JB9A 4MPTA 2GX6A 3KYJB 1M5TA 3GYBA 1ZZ6A 2IPLA 1Z16A 1SXHA 1A0OA 2FEKA 4MYRA 1PRAA 3M9WA 3JPWA 4LZLA 1X57A 3QYXA 4NDWA 1TMYA 3CU5A 1LLIA 2JK1A 3H5VA 4XASA 3CFYA 2HSGA 4LE2A 2IPAB 2A9RA 3QEMA 1JFTA 5CNJA 4YG4A 5E3JA 3RVNA 4Z0NA 2VK2A 5EWLA 1QKKA 4MRMB 3L6UA 2E4UA 2FEWB 4N0PA 3EDCA 3O74A 3B2NA 2FMIA 1E6MA 1C4WA 4G0QA 2RGYA 1U04A 1W25A 3LUKA 2WB4A 2FN8A 4YP9A 4FE4A 4KV7A 2ICPA 3KLNA 4N03A 4E7OA 4F11A 2OR1L 2MEZA 5TQ2B 2FTKE 4FB4A 4Z4CA 4P98A 4F8DA 4I6RA 4LDZA 3GBFA 3S99A 1HF0A 4W5TA 2PUEA 1PERL 4RY9A 4FN3A 3HK2A 5HSGA 4TLLB 5C5CA 4Q6WA 5IBQA 4G0ZA 1L1MA 1DBQA 4HYEA 4F3TA 5KQMA 1Y1LA 2QXYA 4IMJB 2LYSA 2NT4A 3LUHA 4Z5DA 5EWJA 5TQ0B 4PEVA 3HSYA 3RQIA 3SQNA 2GRLA 1JFVA 3ILHA 3N0RA 1WETA 3OLVA 3HUUA 5IUKC 4PU3C 5IULC 3K4HA 4F12A 1YMUA 3LFTA 2R48A 3QLVC 2WUSR 1PUXA 2F8SA 3KXAA 3Q9SA 3NHZA 2IKSA 3CG4A 4NICA 3Q7RA 3C97A 4WT7A 3VNAA 4LX8A 3EULA 3KLOA 1NEQA 3C3KA 2PL9A 4X4HA 3OM0A 4X4CA 1T34A 3GV0A 4NCAA 1B00A 4PU8A 4KQ9A 4OBBA 2LIVA 2A9OA 1YVUA 2PMCA 4PYRA 4W5NA 3TO5A 1LBIA 4G0PA 2RDMA 4YR7A 3QQ6A 5TPZD 1XWRA 3HVRA 1NXXA 4O8BA 2AXVA 1ZGZA 2E4VA 4JB0A 2B4AA 4W5OA 2E4YA 3ILYA 3QEMB 1PRVA 4WUTA 4F06A 4YARA 1B0NA 4GHJA 1CJGA 1JL3A 1OCTC 4IA8A 5D2CA 4J1WA 1RPEL 1SRRA 4YO7A 2H0AA 2P9HA 1BAPA 3HUTA 2LYRA 3F6CA 4G97A 1X2LA 4MLCA 3KSMA 4MS4A 2O38A 3RVPA 4QPJC 4TMYA 1ZS4A 1LJUA 3JVDA 2WMYA 3KHTA 4IGAA 4RWEA 3EQZA 5FWXB 4Z59A 1U0SY 2FXIA 3LOPA 1Z17A 3DBIA 3HZHA 2AYZA 4XARA 1LBHA 4FE7A 3MMNA 2AUWA 4MR7A 2LP4Y 2L18A 3H6GA 4EYOA 4Z4GA 1DJMA 1FSPA 1DWKA 1Z26A 2FMKA 1VLZA 2QSJA 1TM2A 5K98B 2PJUA 2FMFA 3LUGA 3QLTA 4H3HB 1DG9A 3URMA 1NATA 5TPWA 2IU7A 5F64A 4RU1A 1Z2EA 4RK7A 3MQ4A 4Z9AA 4RK5A 2LBPA 4I6UA 3T95A 1IC8A 2XIUA 3FFWA 4UHJA 1PHRA 1JDPA 2NZUG 3ROFA 2YHAA 4RZSA 3OMWA 4Y42A 1MIHA 4MS1A 4KK3A 4TLMB 1O4XA 2ZWMA 2I6FA 4QICA 9ABPA 1PRUA 1ZPQA 1YMVA 3L1PA 3C3WA 1YK0A 2AXZA 3D1NI 3SG0A 1Z2DA 2NT3A 4MS1B 1ZY2A 4RK6A 1E6LA 1ADRA 4D6XA 3HJFA 3JPYA 2AXUA 1U2PA 4Z4FA 1AB5A 2R4QA 3IP5A 3BRQA 4G0OA 4EVSA 4ZMRA 1KRWA 3BS3A 2MYPA 1ZITA 3QELA 5IX8A 3QF3A 4MCTA 2JVIA 3T8YA 3IDOA 4LE1A 4D74A 2GWRA 2WWVD 5T7BA 2F8TA 2GRMA 3W9SA 1HEYA 2E4XA 2LPMA 3TB6A 1DCMA 2YHBA 3MIZA 2ZAYA 2KYRA 3RVOA 1D1PA 3HDGA 4LRQA 1D2AA 2WIUB 1EAYA 2X7XA 4RXMA 4DQDA 2W42A 4RKRA 1BVHA 5BRJA 3A0UA 1GCGA 2IVBA 4YS6A 3B7HA 3OLXA 2N9UA 1EWVA 1NXTA 2BNNA 3NNNA 5GQSA 4JQDA 4XLTA 3K9CA 5ED4A 2BJCA 3M6MD 4ZYLA 1ZUGA 6CHYA 1Z12A 1FQWA 3OMTA 1JH9A 2PLNA 4N76A 1DCFA 1TLFA 2FMHA 2IUOA 1M2EA 1EHCA 3H5IA 4IVZA 2KEIA 3F73A 2MSWA 3CROL 1ISSA 1DBPA 5A7LA 5FWXA 1P2FA 3FGZA 2H3HA 1JYEA 3QLVA 1QP4A 3BREA 2JRLA 3IP9A 4MR8A 2FSPA 4KPYA 1GUDA 1L5ZA 3CLKA 3I42A 2XI8A 4L4UA 2AWIA 1VPWA 4N41A 3G85A 4Z4EA 4YG1A 4M88A 1H9CA 3SY8A 3BDNA 4PICA 4KVFA 2PUCA 2ID7A 4ETIA 1EWKA 1LQCA 2D5VA 3IPCA 3BD1A 5B3JC 4FBIA 2RJNA 2HQRA 3MYYA 2PUBA 3RVLA 3NHMA 4NQRA 3JXBC 4EVQA 1FFGA 4ETMA 1ZZ8A 4WWHA 4JP1A 1ABEA 1FFWA 1JBEA 1PEYA 5EWJB 4F8JA 2MQKA 1POUA 4RK1A 3JY6A 5BQ3A 3LKVA 3P9YA 2OENG 1LMB3 3OLZA 1Z13A 5FBHA 4MGEA 4Z5HA 4LDAA 7ABPA 1CEYA 3CKMA 1ZDMA 4ML3A 3HXMA 3EQ2A 5EWLB 3H5OA 4X4GA 1UXDA 5JS1A 4KZKA 1RZSA 2WY2D 4Z9BA 3G7DA 1JDNA 4W5RA 3HO1A 1UTXA 5DTEA 3RH0A 4OLAA 1MVOA 4Q7EA 3H1FA 3H75A 2H8RA 1YK1A 1DRJA 1GT0C 2AYXA 4H60A 1QQBA 1K68A 5BR1A 2FN9A 3N0XA 4RDCA 4NCBA 2JVKA 1SD5A 5JNTA 3OP9A 3SCFA 3O75A 4HNQA 2VYCA 5ABPA 3OLWA 2V0NA 4WXMA 1ZZ7A 2BNOA 1NXVA 5JNSA 5IEBA 2KEKA 2IVQA 3UFDA 2QZJA 1ZVVA 4G86A 2WJWA 3FYMA 2J48A 5DLEA 1LCDA 2MSLA 2HINA 4RK4A 3CLCA 2FVYA 3UKJA 2WRZA 4D6YA 3EJWA 3GN5B 2A9PA 4IRXA 2AW6A 2EF8A 1DC8A 3LUDA 3MM4A 2PUGA 2QR3A 5JNWA 4Z99A 3CG0A 5DGCA 3L49A 3JXDL 2BGGA 5HM6A 3O1JC 1ZH4A 2R1JL 3GN5A 3GRCA 4ZMSA 1EFAA 3N75A 1KMIY 3GL9A 3G1WA 3HZIB 4S05A 4L85A 2PPXA 2IOYA 2XJ3A 2MSKA 3DGEC 2EBYA 3LUJA 5FWYB 4JAVC 3QWGA 4X4FA 2XSDC 3N6VA 1DW9A 3HDVA 1BA2A 4MR7B 3HS3A 1EWTA 4OG2A 3JXCL 5EWMB 2JCGA 3T6KA 1I3CA 4MQFA 2JVJA 3TD9A 4I8TA 4KRFA 4QYMA 5TPWB 1USGA 2LYPA 3KTOA 4GQMA 5TQJA 3OO0A 4X4EA 1OSLA 5EWMA 1R8JA 4RV5A 3HV2A 3LUAA 2R47A 3SAJA 2KPJA 2FJRA 2JVLA 4Q6BA 4RKQA 1L5YA 2PUAA 1RNLA 4EVRA 1BDIA 3F6WA 1R63A 3QLUA 1W9HA 2QVCA 3NNSA 4YCSA 2LYQA 1ZGGA 3I5AA 4O1IA 1D1QA 1MB0A 2PUDA 3C6QA 2ICTA 1Y9QA 3SCHA 2B1JA 2LYJA 4RY8A 3IP6A 3H5TA 3Q41A 3F7NA 3O2SB 1ZZBA 3IPAA 1J56A 4EYQA 3F52A 2JBAB 4EYKA 4X4IA 1ZHHA 4HNRA 2CSFA 1JHZA 2HQBA 3O1HB 5KC9A 3DZDA 4O1HA 4TN5A 1QMPA 1P8AA 4EGSA 2R25B 1PNTA 1JLKA 1NXSA 1USKA 1NXPA 1YS7A 3CS3A 1YTUA 1DRKA 2FQYA 4G0MA 4H3KB 4KNYA 4Z4IA 2IV1A 5KI6A 4G0YA 4YV7A 5TE9A 3A0RB 2GKGA 3N0WA 3NBMA 3LISA 3RZZA 1YS6A 1UDRA 3RVSA 1QO0A 4IILA 3DNVB 3OQOA 4MS3B 5IUJC 3EGCA 1VKRA 3TRBA 3KCNA 5CNIA 2FW0A 2P4UA 4YBAA 2O20A 4MR8B 1JX6A 2KZ8A 2QV0A 1URPA 3CHYA 3CNBA 1F4VA 2LUOA 1P6QA 4PU7A 2TMYA 3QX9A
chains in the Genus database with same CATH superfamily
1ZNWA 1N8TA 1PEAA 1R12A 3LNTA 3OTQA 1W1UA 2OK8A 4MUKA 4WGFA 3KJGA 4PQYA 1A7KA 4INAA 3CLSD 3LVQE 4GBED 4MJ3A 3UTCA 4QU9A 1CFJA 1UOEA 2JLZA 1ZPDA 1X86B 2FP4B 3K0BA 4ZAZA 5TQ0A 2M9MA 3ZKCA 4KIWA 1YS9A 2F1JA 1E2PA 2IEGA 2RCNA 4H6XA 4WNIA 2PL1A 4W9MC 1A4IA 1ZNQO 5FIUA 3WHLA 3MERA 4R69A 3ZI7A 4EGQA 2BKVA 2PUWA 3L7NA 1TEZA 1MHTA 4HNAB 4KWEA 1JVSA 4CQNA 1WA5A 4LNHA 4ALLA 3WAJA 1LK0A 1BNCA 4NMWA 2XZDA 1DVRA 4YJGB 1PK9A 4UUPA 4ZV7A 4K05A 4AJNA 5BUZA 2I3DA 5LYJA 1ULTA 2Y1XA 1I0LA 5DHPA 1XROA 2IHYA 1ZNZA 4CI9A 4MDFA 2CKMA 3CE6A 3B52X 2Q99A 2RAPA 3HJTA 2G1AA 4NAUA 1CUSA 4OJTA 4RPKA 3I4FA 4JJ8A 2JGDA 1K5GA 3IPXA 3KYIB 3MK31 4CF5A 3O8BA 1Q17A 1ZESA 1ICIA 4RE6A 2CHQA 2QDKA 3E9DA 4FT2A 4WH0A 1SU7A 1TZCA 3C6ZA 3ZWQA 3U19A 1IIBA 5FBQB 2YJ5A 2ZSUA 4MCIA 4ILEA 4F3RA 5ICGA 1BWPA 4FFRA 3F71A 4Q4JA 1HYQA 2H1RA 3PPWA 4DCTA 2XR1A 4DDWA 4PXYA 3A4TA 1ECPA 2ZTSA 2HA5A 2UU9B 1N2CE 3M5PA 4A15A 3ABZA 3KLMX 4KMSA 4YJFB 2EKLA 2OHFA 4X45A 4UMDA 3ZCSA 2DETA 4M9RA 4REQA 2OLEA 3FTFA 2BUBA 4D8UA 1R0ZA 5EIXA 3D4OA 3VH3A 3NTOA 1GPKA 4O5AA 4XFKA 4PGAA 4X90A 4GQAA 2PL3A 4D0NA 2WQ6A 3KOMA 3WWYA 2WSMA 4ICIA 4K3UA 2W58A 4XDYA 3DZHA 3LFPA 3K6JA 4XCVA 3FDFA 3DZ8A 4ZO6A 4A2WA 2BYTA 1QPZA 4ZZ0A 4D41A 4CM7A 5LQSA 3S2FA 1IN5A 3B1KA 1NY5A 5C8ZA 3EARA 3IKLA 4MVJD 1CNFA 5I7HA 2VTVA 4C7OB 1Q7BA 2G80A 3DHWC 1SHTX 3U40A 4Y2PA 4TSKA 5BRAA 1A2QA 3N6XA 4LWPA 5EZSA 1EGMB 1P60A 3FWPA 4YXFA 4WA7A 4GRDA 4MPRA 4KO3S 4N49A 1EQUA 3G0DA 3C74A 1UFOA 2NXWA 3KQYA 4QUJA 1QHHB 4ABTA 3G2KA 3MJRA 3A2MA 4MS3A 4MX8A 3WHKA 1LFDB 1AZTA 3HYTA 2X3YA 4HB3A 3TPZA 4KBYA 1N8SA 3QFIA 3DQPA 1USIA 2AZ4A 3A31A 1SY7A 3TCNA 3ZCXA 2NNWB 2P27A 2C5HA 4UCWA 821PA 3D3NA 1YFJA 4L5JA 5C3MA 3K7EA 2CYCA 1MB3A 1ESNA 2AN4A 4LCJA 5CLQA 2ZAGA 2GK7A 4ZO7A 2RHHA 4X63A 4AJHA 1UFVA 3N2KB 4I4NA 3RASA 3W4KA 2VJDA 2B3TA 4CF4A 1VBNA 3I6MA 2Q45A 4FYIA 4OBWA 1TJ3A 1M2FA 4KFSA 4BWGA 1R15A 4UBNA 2XKJE 2OHVA 2PZFA 1VDZA 1H93A 5KTTA 3EGIA 2UZAA 5JH7A 3ZWKA 2Q2WA 2CUZA 2VP9A 1UBHS 5FOWA 2GZ2A 2VJMB 5C4IA 1MZVA 3TLBA 3CSDA 4JASB 3QU2A 4WPGA 4KAJA 3L6DA 2MXDA 2YNMC 1L2TA 4FFDA 4S0ZA 2B4YA 4KGXA 3WK6A 1Q19A 3OJOA 1E2LA 1Y33E 3EG9A 4I8XA 2GN4A 1F51E 1MAUA 4Z5CA 3RYHB 4GVPA 3TQFA 3JQCA 2HIGA 4ECEA 1OB5A 2HJ9A 5M29A 2OPHA 3UAXA 2EKBA 1K5DA 5DVZA 2NZVG 4QDJA 3V42A 3VPDA 4KGZA 1SKAA 4LSGA 3W6OA 4B44A 3VPGA 2DPMA 4G2TA 1JQBA 1K86A 3UV6A 1CUBA 1LS1A 1DCTA 1V9LA 1WZUA 4PAOA 4LI0A 1FNNA 1SZPA 1JKJA 1XHEA 2WWIA 2IXAA 4MDHA 4ZARA 5IFLA 5CT6A 3Q0EA 1KOJA 3NATA 3OQHA 4IL5A 4OP1A 4UZFA 1Z22A 3K5WA 1EP9A 1XJ5A 3PR3A 4KFTA 4IHJF 4P1ZA 1Q1GA 3SM9A 2ANBA 4NMMA 4NF2A 5JDCC 3KYCB 3UJHA 3JCZA 2PKEA 4HGOA 4C3VA 4ZAWA 5KO2A 3RADC 4D98A 3ESQA 3KYJB 4KEAA 1M5TA 3CRW1 4GD3Q 4LDPA 1CU1A 5FTWA 5TMBA 3DBRB 5EYPA 3L7CA 1JB1A 1TMYA 3H5VA 3MB8A 5U4XA 4CKBA 4QIHA 2WIFA 4IDCA 4UMVA 3CFYA 3SGLA 1M2JA 2IPAB 1NUAA 4YG4A 1OBHA 3PQDA 3W5VA 5EWLA 1AGXA 3KEFA 4PLHA 3QVXA 4KAXA 3AL0C 3OEWA 4MRMB 4U8GA 4PFKA 4K3VA 1JR3E 2C20A 2I8CA 2IUYA 3QJGA 4Q1BA 3S2UA 2BKLA 1FJXA 2RGYA 1CQZA 4DLVA 1T3HA 1SWWA 4DMRA 4JELA 4PGGA 2FN8A 4AY2A 1JR6A 5JSQA 1FZQA 5K3FB 2ATCA 2FDRA 3PCTA 4OHOA 4DQLA 3KKNA 2YMLA 2JA1A 3G2QA 3DVAB 4Z4CA 1QC5B 3U1VA 5KOHA 3TRDA 4BUCA 1MFPA 1HTTA 1YACA 4RY9A 2QLLA 5AW0A 3OTGA 3CA8A 1F60A 1FE8A 1RABA 2FFRA 4JX8A 3CVVA 3ROEA 4NH0A 4WBSA 2YS7A 4DQUA 2NT4A 4J3NA 5CK4A 2I66A 4PEVA 1KI6A 4UULA 2DEUA 3W3AA 5H83A 3ZY4A 4WESA 1RQPA 3BQNB 3K4HA 1YD7A 2YMMA 4D9IA 3C7DB 3ENZA 5HCIA 4H31A 3UN1A 1OILA 2QN1A 3TR5A 4K86A 5B58T 3DTVB 3DF9A 4N7JA 1DFIA 2IY9A 2EBFX 2WWYA 3F9CA 4R8SA 1B41A 3GLVA 2C9OA 4LNAA 3QUTA 5FA5A 3FPGA 1NVVR 1PNQA 221PA 4J0CA 1X7ZB 1E1KA 2ZBRA 3ZN2A 2O8DA 3VPXA 5AFSA 1UDWA 4X4CA 2N47A 2R8EA 1B00A 3G2MA 2AXNA 4BMYA 1NYTA 4L16A 2WFZA 3HKBB 4G0PA 3ZZUA 1NBWB 2CSUA 1E3DA 4AJIA 5ALWA 4HFNA 2O52A 4KACA 4NEQA 1PRVA 3ADPA 1KSJA 1B0NA 1HYEA 1T6YA 2B8NA 5JD5A 2ZSEA 3BMCB 1YFLA 1QGOA 3HKDA 3L6BA 4TL6A 5JV5A 3NS7A 1PRYA 5JD6A 4MQLA 4DB4A 4O2AB 3IHLA 1VB5A 4KAFA 4ZP1A 3DDOA 2C3YA 3DXXA 4G5HA 4AZ3B 4J75A 2D1YA 3I23A 3MXTA 3G5MA 3EQZA 3UQZA 3LOPA 4TXNA 1QAQA 3D4PA 3HZHA 5I3CA 1GAQA 4S1NA 4HFRA 2SBTA 2O8EA 4EYOA 2L18A 5F52A 1NYQA 3AEQA 3H2IA 2WAOA 1SC6A 4KN9S 3WS7A 1XEXB 5GV7A 3WYDA 1X15A 3FR7A 4LISA 5F78A 1E3JA 4LXHA 2IC5A 1QQ5A 4ZALA 4CT4B 2JJYA 3HDJA 1EVQA 1Z2EA 3CMMA 3FNBA 3FPAA 1HETA 4LJ4A 2FV8A 1Z7YA 2WTUA 4FI3C 4IKOA 1G19A 2H59A 3JRXA 3A9UA 1YRQA 1JIJA 1W8IA 1MJNA 1OIVA 4CTNA 1N1GA 3DW1X 1Y5NA 1GZVA 3D1VA 2ZE5A 5GMOA 2RAFA 4BGUA 4B3HA 2NT3A 3UPTA 2AOVA 1OFHA 3T0FA 3LCVB 1DNPA 1U2SA 2VG8A 1C2YA 4MGIR 1I4LD 1UBJS 4Q3DA 2K5UA 4EVSA 4F4JA 2CJPA 3QBVA 4FX2A 4KOAA 2QM0A 3OEYA 4U0JA 3T8YA 3TSYA 1FQOA 3B70A 3M0EA 1P5JA 3TTWA 5ICCA 5B2EA 2NXNA 4IGFA 3K0FA 4PAWA 3TM5A 5T7BA 1OLXA 4ECAA 1MX5A 4EX6A 2OZLB 6REQB 4JS0A 3BMNA 4QNRA 2D5BA 1HX7A 4L5YA 1OI2A 3PQ3A 3GFVA 4W1SA 3GLGA 1YB2A 2KB0A 3HMKA 3TF5A 1AC5A 4PFSA 3PFNA 4OB8A 3WTBA 1E3SA 5B4UA 2WPDA 3DL2A 5F7XA 3DVSX 4XZ3A 1Y3FE 1VP3A 3GLQA 2UKDA 3PUHA 2VSFA 4UHDA 4F1KA 2B1RA 1Z0UA 3M6MD 4E09A 5K8IA 2UUAB 3OMTA 3OUUA 1I13A 3N3AC 4FJ2A 1WSBA 1YL5A 1Z5OA 4MSUA 2R00A 3NXSA 2GCOA 5EZQA 4G5XA 1VPLA 4HWOA 2XA9A 4RFSB 1DBPA 4JLUA 3EYAA 1JKFA 2WOOA 2WZDA 1GA4A 5DHSA 3CLUC 1XXHB 4MR8A 1CY8A 5ITWA 2H65A 2XWQA 1T1RA 3GVCA 4DEXA 9GPBA 5HQ3B 3OPYI 5EMHA 2C0PA 4ARVA 1MO5A 4IGEA 4WY2A 3CUKA 3TTVA 2QTWB 4B4OA 3A1VA 4GBJA 2HUNA 3SU8A 2QQFA 1LXCA 1Z7GA 2AG6A 5ARCA 2RJNA 4PPGA 3UK2A 5ALJA 3WYBA 4F85A 4DRYA 3CISA 4OY3A 2VN8A 1UZNA 4M9SA 5CA1A 1W5AA 1ECBA 1XZPA 3FUCA 1FFWA 1JBEA 2QX4A 1RPZA 3TELA 3CLRD 4X1KA 4JY7A 2TRSB 3LKVA 3P9YA 4F97A 3OKAA 3C39A 4XB6B 5HA5A 3TZCA 2H7VA 1PR4A 2ODEA 2WF7A 3ND9A 3CKMA 7ABPA 2ASEA 3AZPA 3LQ4A 2H54A 2X6TA 1EWQA 1FTYA 4YMUA 4D4IA 2Y1CA 1PQ4A 2GO1A 2CHVA 4DOMA 4GHWA 4D4HA 3I9KA 3EY9A 3NO4A 1AKYA 1W0KA 3WP0A 1OH8A 3HO1A 1MVOA 4E70A 1QV9A 1CV2A 5FNZA 3EX7C 3H1FA 2YICA 3H75A 3SC2A 2H8RA 1WIWA 1UJ6A 3PEEA 1FXSA 1MQAA 4D9BA 2E5WA 4BY9E 4KQ2A 3A1DA 1FFYA 1VG1A 2EGUA 4U6NA 4F5WA 4LQCA 2DTEA 3OP9A 1H6DA 4L3WA 3IALA 4B0OA 2GF2A 3CZMA 3NGLA 4EI2A 2P75A 3GJRA 4GXRA 2B25A 3FX2A 4U02A 3MB5A 4HAYA 3TXAA 5H3LA 3M82A 2XE4A 1K4YA 3BIJA 3KJZA 5H81A 1YQUA 2E5FA 2F3SA 1P9RA 4KFRA 4BTVA 2QAJA 3QPDA 4WNCA 1E79A 3DLPX 4Y2SA 3UF0A 4MMZB 4D9JA 4DQXA 4YT4A 1RFGE 2L82A 5F1YA 3SHOA 2SHKA 4JYZA 3BSWA 1KP3A 3S7ZA 2BBWA 3NAZA 1X2EA 3LUDA 3TZQA 4EG4A 4JHXA 3GJSA 3AV0B 2PUGA 2QR3A 3JZAA 1L4GA 5ALKA 5AI8A 4Z99A 3ZY6A 5DGCA 4B3DA 1L7PA 4Z0PA 1PVOA 2IPOA 3BH7A 1GRNA 5B30A 2ZZNA 4AJ4A 3D4IA 4GP6A 4XM2A 3SE7A 1WHTB 1VLQA 3FNHA 1LV7A 1DRVA 1GZ4A 2MSKA 3DGEC 3ETGA 4L85A 2EBYA 1JXQA 1NHGA 1S2MA 2O1WA 4LZOA 1JDTA 3TW6A 1MTZA 3SYKA 3CX3A 4MHSA 1BA2A 4OHZA 4C0SA 4MMXB 1R4MA 3AU8A 4RMJA 4P0TA 1WS6A 1IQRA 5HFNA 1MFZA 2JIZA 3MAGA 2YC2C 1VOTA 3P2OA 2XRZA 3WIOA 4HATA 4G37A 3AT1A 4KKVA 3A1SA 3WLSA 5CFLA 1RNLA 2XKAA 1P29A 2R8PA 2BEWA 3I6IA 4LI3X 4C0XA 4IDAA 3V97A 2HDHA 4CYMA 1EJ6A 4B3TB 4K6GA 1JA0A 2IZOA 1HKHA 3NZEA 5TVGA 3WGQA 4BC1A 4I0WB 1NVTA 1ZGGA 3GX1A 1JXOA 1NVUQ 1Y9QA 1AD2A 5F35A 1GDHA 2FPLA 4KPGA 1YRYE 3VH4A 4MLZA 4MINA 5CUQA 3HFGA 3HLKA 1GOTA 3OICA 3D6MA 3SEAA 3O83A 3ZTTA 1SHJA 1ZEJA 2ST1A 3LQ2A 4G56A 2FI1A 4YA6A 1G9SA 4X4IA 2JJ1D 4GR4A 3ETHA 1NLUA 4H08A 3T41A 3KETA 3T95A 1C9NA 5CX1A 2D6FA 2YV4A 4KIGA 4EGSA 1KVTA 5JBQA 3NROA 5CD9A 1NGSA 4A0HA 1PIWA 2I0FA 2OAGA 2PJZA 4U2DA 1OFIA 5EXPA 1U8EA 4AWXA 2BH9A 3GT4A 3TZLA 1BVYF 5E9JA 4YRJA 2BHNA 3PQEA 4P7FA 1JVBA 1XCOA 2C2OA 4MUXA 4KQJA 4NU8X 3V4VB 2E87A 2GPJA 2M1XA 4HLQB 1DAIA 1YJCA 1R9GA 2EJVA 3A37A 2BC9A 5CAEA 1EUQA 3MUFA 5L7YA 5MHTA 1CY1A 3MRTA 4IY1A 1F4VA 1FU4A 4KIUA 4AO8A 2FZWA 1XMPA 2TMYA 3PSHA 3QX9A 3DVAA 4BLUA 4QBTA 4OSOA 1JLSA 5K6RA 1P1IA 4M0MA 3KQUA 1FTQA 2Q1YA 1KERA 1E2BA 3L40A 4CLOA 4PO8A 3V48A 1MX9A 3T5TA 4GDFA 4N7MA 3E3OA 1M76A 1QTNA 4KO4S 1QNFA 3BGVA 4EY7A 1JU3A 4BNKA 4UTXA 4EL5A 1VPVA 2CHFA 2W6MA 1BH2A 2QZ4A 3E18A 4NZPA 5LUBA 4QU8A 3D8UA 3RHFA 3HVHA 3MGBA 2YKGA 3DOHA 2N3ZA 5DYWA 3OF3A 1JQ5A 3A26A 3P9QA 5BUCA 3CLTC 4QBKA 2CMHA 2QW1A 3P7MA 1O03A 1EU1A 1KI2A 3PNOA 3DFIA 1M73E 1RU3A 4QBFA 5P8WA 2G0TA 4A2PA 1QO7A 2OCAA 1NVAA 1YL6A 3HCBA 3PFBA 3REQA 1ZCFA 4C7MA 4CV1A 3TZEA 2Q6KA 5EIBC 2ZIFA 4S2UA 5CK5A 5K9ZA 2WPNA 4H27A 1C0LA 3QHAA 1DWPA 3KVNA 4PHGA 3M4YA 2VHVA 4JC0A 4O0MA 4WJZA 5HKLA 4PR3A 2VP4A 4RHCA 1BFKA 4Q4HA 1MAAA 2C4UA 1M72A 3PFCA 1DGQA 1KNQA 3WKEA 2Z8YM 3DAYA 1SBNE 3UPDA 4RY2A 3WLJA 3JQ7A 1P4JA 4EGJA 1ZD9A 4H35A 5IZCA 3EXFB 1JFSA 2EBWA 4A2QA 1WULS 2PA0A 4CUJA 5J59A 1E9RA 1AXRA 1RWKA 2QRMA 4JP3A 5C1DA 3MPOA 3T94A 4EJ0A 1SQ8A 2B4TO 1NJGA 3DLBA 3IUYA 5JTTA 2ID9A 3GEBA 2OV3A 3BBLA 5E1MA 2PY6A 2Y67A 4D8WA 2KLBA 3TKYA 4Q12A 4DCNA 4IQ8A 4GRAA 4C0QC 1AQIA 1H6CA 3C85A 4HSEA 5G02A 4BNWA 4ZICA 3RUEA 4L95C 5DNVA 4B8WA 1TCBA 1ISRA 1LC0A 4M1QA 3DJFA 2CMKA 2JH8A 4HWKA 2I3GA 4EKIA 2ON6A 4BO5A 1QHYA 4D5EA 2F43B 2B6NA 5EMMA 1ODKA 3O7MA 3S1AB 1Z25A 2QLJA 2VAWA 3CEAA 2WD8A 4ONEA 2HHLA 5FR1A 3BJEA 4QQ8A 5KYUA 2O5RA 4GL2A 1E9FA 4V2UA 1ZU4A 1E2EA 5D5PA 3TINA 3VGJA 4J0HA 1E1RA 5E6SA 3BB3A 3A6HA 4Y1RB 1GG5A 3NR2A 4WQMA 2P79A 1G4HA 3OQJA 5CIYA 1YQ9A 4UXJA 2BR3A 4MV1A 3B9QA 3NM5A 1VYUA 4IWRA 1NURA 2XSZD 3SSOA 4UHKA 3F6EX 3HGQA 5AWFC 1HMPA 3U7GA 1NC3A 3BTUA 3UMCA 3GRFA 3HB9A 5BR7A 1U2ZA 1GEEA 1T1JA 1FFEA 4NJEB 4LFBB 2Y1KA 2I8LA 2OY0A 3HPRA 4DNFA 2XMSA 1V0JA 2NO5A 3EOZA 1E3LA 4J0FA 5BO5A 5DYNA 5JLAA 1Q7TA 1GCAA 1M5UA 1X1RA 2C9YA 1ORHA 3VZCA 4S04A 5FUXA 1C1XA 1ZLXA 3ZWMA 2BGTA 4FW9A 1RQXA 3FCYA 1U7WA 3NNDA 4LZWA 1KJYA 5AM3A 1XKXA 3OMXA 5FULA 3T5BA 4A1OA 3GGGA 3M89A 5ICEA 4BOYA 1R5NA 2NAPA 5ICMA 3DBHA 1WMSA 5AM5A 2XCRB 2AD1A 1E2UA 1Z18A 4XTCS 5D00A 3B82A 4PYKA 1T8SA 2FP3A 5AOBA 4FOOA 1RS0A 5DP1A 1I9CA 3ZHVA 4EG0A 3O4VA 4R1NA 5FPHA 3ZZTA 5A4DA 5IEJA 5CYGA 2VPWA 4OLBA 2PTHA 1WB4A 2NUPA 2WAAA 1KJNA 2Z9CA 2OTCA 1KQNA 1MNAA 3BQ9A 1OFTA 3I6BA 5AP9A 1GARA 4G5FA 1ZK4A 2ZR7A 3IBCA 5GONF 3LUCA 5DU2A 5ADWA 4ZGWA 4RKYA 1EMDA 3HUEA 5IM5A 3W3ZB 2W2NA 4TV9B 5FI3A 3QX7A 3ZU5A 2Q5FA 1FDWA 3UFXA 2CZGA 2QSYA 1IDN1 4IR7A 1CCWA 4LBWA 4MR9A 9LDBA 3ZVNA 2Q29A 1XL1A 4BFLA 1HLFA 2WDPA 1LTKA 1QH8B 2J8ZA 4II2A 3CC8A 5IW8A 5IXSA 3O4FA 5ILOA 5LBIA 3BK1A 4IEIA 1WWKA 1WDLA 3C7KA 1FX0A 3GAAA 3N74A 3SC3A 1ZD8A 1ZCJA 3TLZA 2PZMA 2Z4TA 3EW9A 1I6LA 1U3UA 3A8TA 4FWTA 3GYBA 4RIFA 1CDOA 4LCEA 2NVUB 1DAHA 3MS2A 4QASA 3BXFA 1Z47A 3O4IA 1HDOA 1O5IA 1SVLA 1ZWKA 3LCJA 1DT5A 2BDUA 2PDAA 4XUGB 1MOZA 1N7JA 2D74A 3U48A 3LT1A 4FNGA 3STUA 1B1CA 3AL3A 4V39A 3SKVA 3DHVA 4WOJA 1G59A 4YC7A 3A9WA 3LBFA 3KJIA 4NEGA 2HV8A 1QORA 1B0AA 3LL7A 3PDWA 2OGTA 4Q19A 2YL2A 1O54A 2P65A 5KOIA 4NARA 4YP9A 3MAAC 3E5HA 1I4DD 1KJIA 5DOZA 1JKJB 4AMGA 3EUFA 3I9LA 3EC1A 1F7VA 1NQ5A 5CCBA 4L51A 5CTAA 5I7SA 2G08A 4W5TA 1E89A 4H6VA 4EGFA 5BPFA 1G3MA 4NXNB 2ECKA 3HSSA 4DQ0A 3BFVA 4G0ZA 3B7WA 1RAIA 2GLTA 4Q37A 3DE5X 4YXWA 1C9DB 3A25A 2LYSA 1O0SA 4F5YA 4QEZA 3AXSA 4MA0A 1ZK0A 4ZEWA 3KQVA 3MN1A 1W4LA 1KZ4A 4OJQA 4WKPA 3W2FA 5L6MB 3ILHA 4BMZA 1X87A 3KKPA 5DBHX 1UBOS 3HUUA 3U4MA 1GRCA 2QN6A 5HR5A 4Z0HO 2B37A 4PAQA 4H6WA 1AQNA 3UWDA 1A95A 1FU8A 2ZBEA 2WNHA 1ZJJA 4AAYA 1JG6A 2LDXA 4S35A 4Y9RA 4B7AA 2VBGA 1O94D 1I2AA 1RI5A 2X3FA 3C3KA 3LY7A 3WL6A 3OOSA 4NCAA 1T91A 1HE8B 1EBBA 1HRDA 4N3AA 4TTQA 1GT91 2OGSA 1JG2A 3P5BA 3TO5A 4CMHA 3H5RA 4EAQA 5M04A 3N28A 1VA5A 3AC0A 3U81A 5I4BA 4PHTA 3JQ7B 2V6JA 3WE7A 2AGVA 2PT7A 3AUAA 1KOFA 2WU4A 3COVA 1THZA 2VZ9A 3ZW7A 3ZU3A 3L3BA 4I1VA 4BVFA 3ESAA 4BV9A 3IKVA 3MEQA 4BO3A 1JHXA 2H0AA 3CH7A 1IM8A 3L8DA 3DHEA 3FNRA 4UUMA 5HFAA 1X2LA 2PGXA 2C0QA 1WDTA 2WYHA 5ALLA 2M6KA 4CG1A 1YRWA 1YR1A 1QJ4A 2PWBA 3MWJA 4TMYA 5FL7D 3WO0A 4Z7NB 2HA2A 3D1LA 1U0SY 2X5NA 2AG1A 4XKJA 2DFKB 4FM9A 1PGNA 2H2GA 1W1WA 1J9GA 2OFPA 4QGHA 3GAZA 4DLPA 3QZUA 2LDBA 5JFGA 1Z26A 3FAKA 1U6KA 3VTZA 1QUEA 3T5MA 3QUQA 5ES3A 3M6XA 5EZYF 4IOLA 2GPWA 1UH5A 1S4QA 1D0VA 4YQYA 3MT8A 3O8NA 3ICEA 4TLDA 3ZQ6A 1K3TA 1JZQA 1Q15A 3QKSA 2D5CA 3TVTA 2D1QA 1V3TA 4BJ6A 3T9FA 1XEWX 3DQZA 5FJJA 3O7WA 3ZC3A 4YUVA 1ZK1A 5JSZB 1ZPQA 2IUFA 1Z4IA 5GM2A 2R1ZA 3ZCQA 5JFOA 2BH2A 4W8OA 1B2RA 2QNRA 4I1RA 5FTMA 1B7GO 5A3VA 3F5MA 3KRTA 4D6XA 4D4JA 1VLMA 2CCKA 4ZA2A 5JR3A 4JUDX 2PZGA 5H80A 2QN2A 4UDNA 5T4BA 2ZSIA 3GJXC 1K8YB 1SXQA 2IHJA 3OLCX 1IATA 3LHKA 1I1QB 2D2EA 4XB1A 2ZAYA 1JE0A 1PVVA 2BL4A 1BA3A 2NNLD 1D1PA 2AG5A 1H42A 2Z1MA 3UHAA 3LLVA 5FFFA 4AROA 2GLUA 4PC3A 4P38A 1WPGA 1G55A 5WRFA 4JI4B 3L8FA 3HL4A 4AP6A 2QE7A 3GB9A 3NNNA 4IJ5A 1GZ6A 4KQ6A 2IP2A 2QX7A 4CCSA 5E9AA 5K2MA 4M37A 5EEGA 5FR2A 4NFSA 1FP2A 5KB3A 1GNTA 4MTLA 2IY7A 4N76A 4XYGA 4XQGA 2D0OB 4NVRA 1M2EA 4HAWA 2OESA 4RFVA 5B1IA 4IVZA 4ENUA 4L8WB 1Z8HA 4TGLA 1I51A 4NATA 4EFDA 4MYTA 3LWNA 2WKQA 5BNTA 4QPZA 1ELOA 1M2NA 4MAFA 4CR8A 1ZM4A 1PT8A 2AWIA 1VPWA 3WX0A 4YG1A 3IERA 2BHTA 3G88A 1M8FA 2GJSA 2C2XA 1K7FB 4KVFA 3JQ8B 5D3KA 3UAOA 1XHLA 3R7LA 1CR1A 1EWKA 1ODCA 5T6MA 1E3WA 2BSAA 2IYFA 3S68A 5KOJA 1A77A 2ZS7A 3CLTD 1OGJA 4MRNA 3WYGA 4W8HA 4E2XA 1XCMA 4ZREA 2W2KA 3H18A 2YQ4A 4GWLA 5DM1A 2QL9A 4PR0A 3CR3C 3W5HA 1LQUA 5AQEA 1G0OA 2WC1A 3DAPA 3EEOA 4RK1A 2VA9A 1V1RA 4E1AA 4KR6A 1TCUA 1QVVA 2WVHA 4I1YA 4RIGA 4H7IA 1ZSVA 4IIDA 1QCYA 3BPSA 1F8GA 2VT6A 5AOAA 5EQTA 5EWLB 4ZTZB 2ZU6A 4IIJB 5CBPA 1BU8A 4X4GA 5DEOA 3N7UA 4QEKA 1SN7A 2QX8A 1G63A 3KIPA 2XUDA 4Y1EA 2VQEB 2P2SA 4I4IA 3UMRA 2NZ2A 2GDZA 2R6DA 4G81A 4YRIA 1B8OA 2XQJA 3RIHA 2JPDA 2JRCA 3E70C 4H0CA 5AVZA 5L95A 1QRDA 4Q4HB 1MVNA 5DI3B 1Y6RA 2A0KA 2C4KA 3IESA 3BWCA 1V8OA 3AI1A 4X97A 3ZH9B 2X5JO 1IZ0A 1RHMA 4I5EA 2W6ZA 4GOND 5CGZA 5DN6D 5L8VA 2VZ0A 3ANMA 1XWFA 4Y9UA 3EIOA 2IVQA 5TSDA 3RBAA 4OIMA 1EX6A 2PSHA 4URHA 1WUJS 2WQ7A 4O4IB 3W3AD 3OTIA 2CCJA 3G0OA 2TMKA 3JASA 3ITEA 4Q1DA 3SFTA 4D6PA 3I1IA 3CH5A 4OXYA 3U09A 4F2HA 2AW6A 5LP1A 3L1IA 5DCYA 3GUVA 5ECWA 3DJYA 4NAVA 2WVAA 4X65B 2OV8A 421PA 1A5BB 1FVHA 3D3JA 2CXRA 2DG2A 4X8HA 3SQOA 5KSZA 2PUVA 3GN5A 3OIDA 3LA6A 3QIAA 1QIJA 3ZZ0A 4KUHA 5AVVA 1QM5A 1RCUA 4Y9DA 5K4GA 1T25A 4J6FA 4F56A 1D1SA 3BS4A 4WK2B 2PCLA 1DKUA 1V8FA 1RLTA 2OAP1 1E99A 4BP8A 4AG6A 1X8JA 2RK4A 1DW9A 1Q7RA 2JCBA 5EWMB 5LZ8A 2E85A 1TFRA 2R5FA 1L7AA 2XGSA 2A6PA 4KRFA 1P62B 4HXGA 2LYPA 1IWBB 2QRVB 3OO0A 2CDNA 2OM6A 2ZT6A 1GTJ1 2B61A 2XUAA 3MBKA 2VYVD 4WN3A 1UM9B 5IABA 1QIHA 3QW4B 2HLHA 2PUAA 2IZ7A 3D7KA 2VDOB 3L7JA 1JQAA 3Q3EA 4H3VA 4R7ZA 3RREA 4ASUA 2O14A 3FMIA 4L15A 2X23A 2VC2B 3NRCA 4KX3A 5IN5A 1T5LA 1M6EX 4D3SA 2NUPB 1T3TA 4DAEA 1DG3A 4JUFA 4YCSA 3U60B 1EXNA 1HL7A 3FWHA 1JAIA 2AOUA 3LXUX 3P0RA 4ZVSA 4DLSA 4CF7A 5AVYA 1WBDA 4RD0A 2YV3A 3JWHA 2ZIGA 3D0OA 3OKZA 1TAQA 3D64A 3RS0A 1I36A 3H5NA 4RJJA 4JVSB 1HYBA 5I7AA 1QH1B 4LJ7A 3I5MA 3F52A 3T9AA 4CLHA 3HN2A 2PNJA 1U0HC 1NF2A 2P6MA 2X41A 3BJRA 3CSUA 3UOWA 5KTKA 4TN5A 2PMEA 1JIQA 1K7YA 1VE7A 3C6XA 2GERA 4WERA 1E6CA 2V7XA 3U4AA 5T8KA 2FX3A 3DE6X 2XNHA 2FUG6 5HE9A 2B92A 4HDKB 4ZGGA 4YV7A 5AD1A 2VJYA 3PWTA 3N0WA 3AVQA 4MQUA 4HN4B 5KOHB 5JYDA 5H68A 3VI4B 4GMXA 4IILA 4MW0A 1XRMA 3DP9A 4XH9B 2HUPA 3RIGA 1BEEA 4ZVQA 3W4IA 4E4RA 1NBAA 4YRPA 4M1EA 4YBAA 2XSZA 1CJUC 4IJWA 5M3BA 3LRPA 4MWZA 5ALSA 3KU1A 4GO1A 5IPFA 4XAQA 2QAGC 3I04M 3R7WB 3K4QA 3AETB 4I5GA 4Z58A 5CXSA 4QDZA 1GGEA 3WNVA 2X77A 5E4JA 4K03A 4C21A 1RYBA 5IH7A 3TYXA 4PV7A 4WW0A 3F4BA 1FX0B 1PW7A 3IBFA 5EE9A 2IW1A 3S8QA 1UKBA 2C95A 4DIUA 1HQYE 3KTFA 1DIRA 4Q00A 4UHEA 2ZIWB 4DNPA 4YI5A 4RADA 1HL3A 4NC9A 5GJVC 4ZFNA 3H1GA 5J23A 2YVUA 5BOSA 2R6ZA 3AUUA 2ZRPA 4HDSB 4B9EA 4ED9A 5K0SA 1UJCA 2H00A 2QUAA 5AJWA 1NULA 3SZUA 5A7FA 5LIRA 2G3YA 1FFCA 1KSFX 1R10A 3FVVA 2BMDA 1U81A 2QOEA 3G6KA 3H9CA 4LYHA 2ZJYA 3FG9A 3R7DA 2JKZA 5CDUA 4RZHA 3FTPA 3OESA 5EQDA 4M46A 5D7NA 4B83A 4BLPA 2UYYA 3TNLA 4RPIA 1KY5A 2X40A 5B37A 5ALMA 2EFJA 4CI0B 2O8CB 5A5GA 3VM6A 3X2EA 3TNFA 1OY1A 2IEAA 1NN5A 4LRTB 5DW3A 3UB4A 2WSSD 1ZD3A 3MJEA 5KNCA 2RI6A 5B3JA 3UZUA 1N2CA 2DLDA 3OZSA 4JSYA 4ND8A 3ROXA 4NTZA 4AZWA 2I6TA 4W6QA 1CY7A 1WABA 1OAKA 1DJPA 4ZQGA 2ONKA 5HF5A 1D5CA 1U8ZA 5AH0A 4HMPA 3PDUA 5K6TA 4TZ6A 2IP1A 1C4OA 1SOAA 2CNWA 2C4VA 2NZXA 4IJUA 1C30B 3ZHMA 4IRMA 4I6TA 1MMFB 1B1AA 1PU2A 2NACA 2P9QA 3FLEA 4GYYA 3DWEX 4MVJH 4BFCA 4EG5A 2ET6A 2O2ZA 4KQCA 3R8CA 1KAMA 2DE0X 2Y3IA 2E4WA 4XJXA 5T64A 4MYHA 3T3GA 4HNGA 1NW9B 2Z58A 3V1TC 5H3HA 1R0KA 4DLBA 3QXHA 5HP4A 3MLFA 1SD1A 5K1ZA 1E3OC 3CZQA 4R51A 2JFQA 1T6XA 3R5XA 3SZMA 5IUNC 3QEKA 1XFDA 1QX3A 1YUNA 4C4AA 4PLYA 2J9FA 1COWA 1XZCA 2V6GA 3RTBA 4F38A 2BLNA 2X6RA 2Q0QA 2GMWA 4IFBA 2C1XA 2BMWA 5EIOA 2G70A 1G2QA 4QO7A 2V3WA 4KXYA 2B2XA 5B4VA 2R7KA 1KIMA 3C3PA 5THXA 4AJLA 2XTJA 1GKYA 2AMYA 3R3HA 5JLJA 4C0HA 1DUIA 3U7JA 3KCQA 1Y7YA 1K1EA 1MA3A 2H1OA 2DB3A 4JCXA 4F3KA 2VYND 1D9ZA 1XAJA 2MT9A 4DXAA 3UGKA 3VTKA 2WZCA 1V4NA 3BF8A 2IHTA 3BH6A 4HPJB 3VNQA 2HCTA 1VHLA 2AFHE 3U9SA 2H1HA 4ND5A 4S24A 1YZNA 2YY5A 3IURA 2G4LA 2NO6A 3PHJA 1APBA 3TDKA 1UOPA 4GBGA 2QVGA 3UT0A 2E55A 8OHMA 1PX0A 2BGNA 4PX5A 1KQFA 3EY4A 2BMFA 4KYTA 5FOXA 1EFCA 3VR4H 2CT8A 1PWYE 1R6VA 3N2EA 4ABYA 3Q8XB 3H8JA 2OO3A 2VJNA 1CQTA 1Z28A 2VRBA 1QTIA 2BJWA 3OEED 3Q6MA 4HX5A 3HM9A 2Q3DA 5I9MA 4MRSA 3F74A 3I2YX 4GPAA 1IHUA 2PKYX 3PNKA 3KB8A 4HB0A 1YR2A 3BTSA 5DNEA 2WM3A 4NESA 1JKMA 3HY4A 3Q5EA 1U2GC 2I5PO 2MSNA 4MAMA 1KK1A 1GYQA 4N3CA 4PC7A 5ADHA 2QUBA 5HW0A 1WSWA 1U80A 2WIGA 2QL7A 3QPVA 3Q3JB 4GE3A 4AVYA 5HTOA 2HIHA 1DARA 2W2OA 1CC1S 1N2IA 3TL6A 4BJ3A 3IEIA 3PFHA 5JROA 2Q0XA 3MTQA 3TN7A 3QVTA 4OO3A 3VI3B 2LCVA 3I05A 2Z57A 5CLLA 1CHNA 4WZZA 2E1PA 4ZCRA 3FUVA 2RGEA 4UPDA 2XCJA 2O49A 2GN6A 1TKAA 3RFXA 4FDMA 3A4MA 3WL3A 3F3KA 1J97A 1QFSA 2EYUA 5HKKD 4M55A 5A9TA 1K5HA 2FDXA 2H63A 2P5UA 2IPLA 5DULA 3WGZA 1ZUD1 3FKQA 3L07A 1VE1A 2G5CA 2R8RA 3CU5A 1OLSA 4OQPA 3QU4A 2JK1A 1FNSA 3PUVA 4R81A 1KFCB 2YWRA 1XPJA 3QEMA 1I4WA 2HMAA 1SO8A 3FZQA 3GHYA 2IH4A 1TYBE 3NMUF 2PXXA 3FTDA 5J2UA 2ES4A 2X1HA 2HLDD 1JAXA 2O7SA 1PL0A 3IOBA 5C7LO 4H4DA 5ULLA 3UA3A 4N0PA 3FSGD 4JR0A 5D5HA 4KLZA 3P2YA 2EQAA 1I0ZA 1SM4A 2FF7A 2JGRA 3ASZA 1SC3A 4REOA 1EFVB 2AEFA 1F06A 2H4ZA 1LWNA 3H2HA 1A9YA 5JO9A 4UHFA 5KPDA 1A69A 2JD0A 3NQ41 2CUNA 1Z2PX 3TEFA 1N2BA 2YWHA 3LDGA 1DBRA 1VJDA 1LLFA 1YXMA 4RESA 3RSZA 3U7QA 1EVEA 1KO4A 1XEAA 1STOA 5E7QA 1CQIB 3G82C 1R6AA 1KKLA 4OH7A 3HZOA 2WFAA 4ALIA 1ZFNA 4IMJB 4P5DA 1XRRA 4Z5DA 2GRUA 2P2NA 3ADOA 3HCRA 4I3FA 2OCDA 2X0DA 3UAWA 2HT6A 4AKEA 3M49A 4HXEB 1JEAA 3ZDQA 4HNVA 2F8MA 3ABOB 5HUQA 1C41A 3QTTA 1KC3A 1P81A 4QHYA 3TQHA 3LFTA 2D1RA 4BMXA 2R4UA 1VKOA 1CUVA 5BRNA 2J67A 3CNQS 5ES4B 4BMCA 4LF4B 3OZCA 3UK6A 3TNYA 13PKA 5CFPA 1WXIA 1T4CB 1TEXA 2IKSA 2B4QA 4F2WA 2PS0A 1QONA 1I1NA 1ATIA 3A9TA 3VTAA 3NXHA 1Q84A 3R8FA 3GD5A 4D0GA 4YNBA 1O95D 4BVBA 5KTNA 4PU8A 2P2LA 5LXTF 4OBBA 5KMGB 1HDZA 2WHRA 1OZHA 3I72A 3CJTA 1N9GA 3EPJA 3BX1A 1LEHA 1OLUA 1THMA 3EZ6A 3UUWA 4CWAA 1E1CA 5TPZD 4AG5A 1MEJA 5EKTA 1NXXA 1V48A 2AN3A 4GWKA 3ILYA 3U9TA 4KDRA 2VLIA 4AF8A 4YARA 4GPTA 2DSNA 1G291 1YRBA 3DKPA 4HYTA 4Z53A 1M2GA 1OCTC 2MR6A 2WJ6A 5JWHA 4KR2A 4LDNA 3V1LA 2ZIZA 5BR4A 3JALB 2ZOSA 4LF8B 1PJLA 4NH4A 4UE2A 2B4RO 2A59A 3OZTA 4MLCA 5ENDA 5IMBA 5HZGA 2A0XA 4BNXA 2PGIA 4J03A 3W6PA 1K2VN 1S02A 2HR1A 3IRVA 3TEMA 2HJVA 4LMAA 3SQDA 4AM8A 2C3OA 2Q0HA 3GZCA 2VAMA 3FHJA 3OQVA 5INTA 5A3JA 2CFTA 3EVCA 1YHZA 4QFMA 4WECA 2XE6A 4CTMA 3QWBA 1MC8A 3U80A 1FLVA 3WZLA 4M53A 3GUCA 1HDCA 1SCQA 3PUIA 1J00A 1AKQA 5I9SA 3B1VA 3TNJA 1SBYA 4RK7A 5LP6A 2FSIA 3LBNA 3INNA 3MQ4A 3RV4A 3FCOA 2CLIB 1BOOA 3HN7A 4IP0A 1IC8A 1JR3D 3SSMA 2XIUA 3D4BA 2WIDA 1KI8A 5F4ZA 3ROFA 5IG2A 4WKBA 1IAVA 1E4YA 2J32A 1DKOA 2WSIA 4LDQA 3WBBA 4Y42A 2A5DA 4FSDA 2PSJA 4KPEC 1VPTA 2O57A 3LW8A 1O4XA 3ZVRA 1XZAA 2ZWMA 3QVWA 4CCYA 3B20A 5EEHA 1JJAA 1QFZA 1YK0A 4Q3KA 2E7ZA 3QMVA 3ENQA 4LPSA 2K4MA 1AUPA 3BXEA 5KX5B 1F5NA 1YIDA 4RK6A 3KR1A 3ZHTA 1K8QA 3JQRA 1NI4A 2VTDA 1RLUA 4I1OA 3UMYA 2EF1A 4FGWA 1L4FA 1XXLA 3VJLA 3BS3A 1WDKA 1KVRA 3SDBA 4MUJA 3R0XA 1Z63A 5JD3A 1J39A 1JIXA 3L8EA 2ZUVA 3T54A 5AVRA 1REQA 2GRMA 1M6NA 3C98A 4NFLA 5JH7F 1R3UA 2P35A 3DPUA 4U9IS 1H05A 3BF7A 1DX4A 1KEEB 1RFLA 3OZUA 3PDIB 3BIFA 1LSSA 3G3EA 3GJ7A 1CW2B 2RB5A 3PTZA 4GSKA 4URFA 1QRRA 2W4IA 3E7XA 3OZBA 3JQQA 1IXYA 4QNNA 3KWJA 3AM3A 4WACA 5IASA 2IFTA 3DUWA 4TKVA 3GA0A 1Z8NA 2V98A 4DE5A 1Q1ZA 1ZVMA 2QDXA 1XZLA 3TLKA 4OHKA 3KB1A 3F9RA 1A96A 4BQPA 1WD5A 1CFZA 1Y34E 1S0UA 3MGAA 1N0HA 2W9XA 4LSZA 3GFBA 4C76A 5JWRA 3W79A 3A6PC 1SVUA 4TTRA 3AETA 1KE2A 3EW7A 3PQFA 4C0WA 2GILA 2Q6VA 5DK6A 5C8VA 1U3GA 3GLKA 2DZDA 4U3JB 2QMEA 2Y99A 2KS6A 3EA0A 2V4UA 4MYDA 4QYIA 1RRKA 5DB4A 4N5HX 2PKCA 2OXIA 3VDRA 3ZHXA 4EPVA 2A1TS 1S3FA 2XVMA 5GVSA 1GPJA 4YVFA 3TIFA 1NIJA 1E4OA 2G04A 3AH8A 1QVWA 3BMOB 3FMFA 3IPCA 4K81B 3WNDA 4RIIA 1XRNA 5DHUA 1WP4A 4NDAA 3VX3A 4FZ5A 2NOAA 1HLPA 5BQFA 5L3SB 1TNDA 4W9RA 4EHAA 1H23A 3EDQA 3GPBA 4HDKA 4WWHA 2CJYA 3KOZA 2O2SA 1JZSA 2FPOA 4TLAA 4F8JA 4FJ1A 4UBJA 2QVBA 1EQAA 1EXVA 4C01A 3W8FA 2A58A 3AM5A 3X43A 2WFLB 3OOWA 4OGGA 1Z4OA 4MGEA 5JVDF 2O7RA 3QWHA 3M83A 1Q50A 1ZEMA 4M9ZA 4TTTS 4ZI5A 3W6UA 4PLWA 4G5YA 4MJ7A 5I8WA 4KZKA 4ESHA 1CJBA 1RHJA 2XDQB 3GEMA 4GYKA 1WZ2A 3NAGA 4BUZA 4H1UA 5C7YA 5JZVA 3KUKA 1QE3A 3A05A 2FZ5A 3NYIA 5B57C 3D6TB 3WQRA 3D43A 1I3KA 2FN9A 3IHKA 3MOGA 3FYSA 4Y2UA 3ST7A 2BP7B 2X1VA 5JUWA 1LDNA 1PKEA 2DYKA 3K09C 4DRXA 1KBQA 2NYRA 3U9LA 4CMIA 3TGLA 4IQFA 5HF8A 1MG0A 1M2OB 2BFEA 2P4EA 4RL6A 1J21A 1W9MA 4RMNA 5AUQA 2BY4A 3I28A 2O8EB 2BPOA 3QFCA 4A1FA 3ICVA 3A06A 3NWJA 5DYIA 3BWEA 2MSLA 3KOYA 3K9LA 4HAVA 4QLOA 4RK4A 4G01B 1PFWA 4CEJB 4BNZA 2AOTA 3AKZA 4ZHSA 4TQUS 3O90A 5LKAA 2WJIA 4M7WA 2QE6A 4K6HA 3AXTA 3L49A 2OO5A 2I4OA 2LKCA 3BJMA 4PN7A 1DAKA 1IEQA 4FOTA 4WLOA 2F1OA 4BVKA 3FPSA 2EWVA 5JXGA 4BVLA 3IB6A 1KDTA 1UR5A 4M9QA 3RT1A 1KZ9A 4YIKA 5IAKA 5B3LA 2XJ3A 5KVAA 3IUMA 2GCEA 4LJYA 3IOYA 3CW8X 3TW0A 4GMDA 3EXFA 3A1FA 1IJEA 1Q14A 4O8CA 5LQUA 1EWTA 1UMBA 4NJMB 4XIYA 3SHFA 3DMTA 1V16A 1A9SA 5BWLA 2FPKA 3KLBA 2HIAA 5H82A 4B6FA 1E5DA 4KAAA 2J9GA 4DWJA 1N6KA 2FQQA 3BGDA 4RV9A 4UXHA 4TRRA 1BEZA 3L1VA 2B8JA 2AVNA 1EFKA 4IV0A 5CVUA 4DVGA 4K0RA 4EKDA 3ZXYA 5JY6A 2UUCB 1SQSA 1H69A 2ZSJA 4PYOA 3RS8A 1NF8A 4Q4CA 4U2EA 3D7LA 1EDBA 2WYVA 1W9HA 2JI7A 3NNSA 4LOIA 3OT4A 2A0WA 3OM9A 1ZONA 1Y3HA 3PK0A 3ZWWA 4HHEA 3LIIA 3U7HB 4YRLA 1Y9JA 3EBOA 2PUJA 2JAWA 1RHUA 4EFMA 2B1JA 3IP6A 4QTTB 1JLRA 1UBSB 2NYUA 3C3YA 1XO1A 3EB9A 4ODIA 3T3EA 2JBAB 3GCDA 3L0ZA 2J4FA 4CM3A 1JHZA 3IQGX 2ZE8A 1IWOA 2JIMA 3MTEA 4A0SA 5KSOA 1WP9A 1P8AA 1KAGA 5THKA 1N3LA 4K9QA 4L5CA 3HA2A 4JIGA 1Q92A 2O0KA 2KI5A 3JD4A 2R8XA 3PCXA 4WZAA 3STYA 1HT3A 4Z4IA 2PBLA 4HRYA 1BTOA 2CMGA 2ZAIA 3R1IA 3WLLA 3ESRA 2G9NA 5G0WA 1VHJA 4WDQA 4NV0A 4C30A 5KWEA 1QO0A 4E11A 1QGZA 1E9SA 1I33A 3DNVB 1QZUA 1YJQA 3U37A 2RGXA 2R84A 1L8XA 2OXRA 3UMSA 3LA8A 3TRBA 2GO7A 2OVBA 2FW0A 4IMRA 4ZHQF 4RTRA 2H7XA 2YOFA 1JX6A 1KY3A 1W96A 3ECCA 1Z3IX 4K0KB 1GGMA 1UWLA 1NQAO 3GA7A 4BGVA 4RLQA 2Z9DA 3A1TA 3CN9A 3HDQA 1EK5A 1S3IA 2C2KA 4HEA1 3U6BA 4K88A 4MHTA 5MDHA 1F2VA 3EOAI 2PZ8A 2YVQA 3AY7A 4CEHA 3GH3A 1IOLA 2FWMX 4G0VA 5AW2A 2GARA 3GMIA 1XTJA 3ZWXA 4BVEA 6AT1A 5GIPE 2BSQA 3OJWA 2GA9A 1RRVA 4JBIA 4OB7A 2PJRA 4LZPA 1KQPA 2XTNA 3KT3A 4LPKA 1J2JA 2G9QA 5IJXA 3GPDG 5CMLA 4PZUA 3GZNA 1CEXA 2COUA 2FKAA 1BS1A 1R0YA 1V2HE 4MLPA 1MB9A 2LVBA 4AZ0A 1ZCBA 5C4GB 2BONA 4BDSA 3HFSA 4MV3A 1MA0A 2IYEA 1UT5A 4REQB 4TXJA 4LYAA 1Y80A 3B85A 2HU8A 4DNXA 4U9HS 4JJ7A 1CUXA 2ADFA 2FQWA 4MR9B 3PPVA 1XCPA 1FFXB 1Z0IA 3OQBA 4F1JA 2PS3A 2ECOA 4KODA 4RACA 5GY7A 4F2GA 1DKRA 4CKCB 4PXSA 2IS6A 3ZDFA 3LC2O 2QQ0A 3R23A 4OM8A 1T5DX 5CDFE 5JATA 3FZNA 3LBIA 3RHTA 3FKJA 2OBFA 3GUUA 2LYKA 3C14C 4HEJA 5CGQB 1IEXA 3NV9A 3AHEA 5SY9A 1K7EB 1PR2A 1TJYA 2FFBA 3HA5A 2JD2A 4JGBA 3FYAA 4H0NA 1EDOA 1ILWA 2QVXX 5JYEA 4AFNA 4MUAA 2GASA 2E4ZA 1OWOA 4JVLA 3JVVA 2O4CA 2ZYTX 3PTLA 1L8QA 3PXAA 1KMQA 5G4KA 1ORIA 4PQGA 3FYUC 3BXGA 2W6ID 4TMVA 3F47A 3ZIDA 1GSHA 1P4AA 3C3CA 2BZ1A 4R0VA 2VKTA 3TW8A 3L4KA 2CHUA 3L0PA 2ZYIA 3EZ9A 3FFXA 4YLEA 4DUGD 3LJKA 4EA7A 1KJWA 3TLXA 5JSYA 1PFYA 3L7LA 4BKPA 5CU7A 2WFLA 2ORWA 1XA4A 3OFND 3ORRA 4H7EA 4INPA 4V0MA 2HWKA 1C7JA 1E2JA 1H66A 1JF8A 1O4VA 2MOKA 3SIXA 4ZJPA 4QYTA 4G67A 1NBME 3CIOA 4WK6A 2EC5A 1EFPB 1XNJA 4BIMA 1PR6A 1U6JA 1XMJA 1PJZA 4BASA 3OWQA 1QE5A 2IUSA 4G65A 3I1FA 4FOSA 4H7DA 2JAUA 4K9LA 4A8HA 3MWGA 4DAOA 2YMQA 3E22A 3A2KA 5ALNA 3E1SA 3NOOA 3GLIB 1LU9A 3HYSA 5L3QA 4B82A 4W5QA 2FP4A 3LZDA 2FB9A 1Y1KE 2OR3A 4FHGA 4ZRNA 2HF7A 3WWDA 2LRHA 1N2OA 2AL7A 1X39A 3PGLA 4XM0A 2PT5A 5D5QA 3O2QB 2V0CA 3I4LA 2UVPA 2ZI9A 3GEHA 4LV8B 3U0VA 4C1BA 3FVQA 1J09A 1KGSA 1V1MA 2H2AA 4PSDA 1NF3A 1NXWA 1YR3A 2NQ8A 1GA6A 1Z5GA 2V5UA 4UMEA 1AHPA 1Z37A 1Z75A 3F7TA 4CUZA 2C5LA 2FEPA 5EJIA 3TOCA 3ZWPA 4CIDA 1E6KA 1H94A 4OMCA 2C29D 2PH7A 3KKKA 1D6MA 3B7PA 3PE3A 2RGNA 4FKBA 5ALRA 3LXXA 2ZJAA 4NCIA 2P5SA 5ESRA 2Q7DA 2D8AA 2R751 3ZS8A 4KK4A 3R4VA 4NBTA 4WZBA 5F1KA 1E60A 1P1RA 4B2YA 2I34A 4NV3A 4DG5A 4ND6A 1DCKA 1YOVB 3H19A 4XWGA 3OU2A 4ZQEA 5BYJA 1J5EB 4YQEA 5BW8A 1MX3A 2HHCA 1AV7A 3E9CA 1L5OA 1PT9A 3VDNB 2V9ZA 4MVWA 1IVSA 4J29A 4KE7A 4ESEA 2IQ5A 2FOIA 4IDPA 5JDIA 3E0QA 4FBMA 2XB4A 4PFQA 4DABA 1HI9A 1CR2A 4MCHA 1GA1A 1UXCA 3HM2A 1JALA 2BLLA 4UZEA 4GXTA 2AN9A 3QMPA 3STHA 2HHHB 2ECFA 3CRMA 2GSDA 4EITA 3ONNA 7MDHA 4V0LA 1A8IA 3EZLA 1DOZA 2X4IA 5AUOB 4JYBA 1OVGA 2Z1DA 5DTRA 4EH1A 4EHIA 3QY0A 1QGUA 3ZUPA 1JQEA 1QYIA 3PZBA 4MRMA 3QF7A 3REQB 3B1JA 3OE4A 1TA4A 4ZOLF 3RWOA 2JL1A 4LZNA 2O3JA 3L84A 4Y2XA 4NE7A 4NONA 1JFLA 2FW9A 2ZIXB 3CUYA 3H1PA 3RVJA 3EJ6A 4J9UE 4B79A 1QIDA 3RD5A 4BNFA 1UP7A 3KVOA 4TWIA 3DV9A 3N59A 3A6FA 2ZJ8A 4JNCA 3GEEA 5J5AA 1OGIA 2O48X 4DADA 3WOVA 1E1MA 2GAFA 3VDMA 5M2QA 2GX6A 1T5SA 3G1TA 1MV8A 4DLTA 1B23P 1ZZ6A 4DS3A 5J2UF 4RNCA 3F3YA 1TIKA 4U9UA 1M1NB 4WX2B 3BBPA 3E53A 4X3CA 2VZLA 3ZDXB 2CBGA 3GROA 2ADMA 1U8YA 5HK8A 3ZYCA 4DLYA 3AEUA 3EVGA 4LHXA 3G0CA 3SQLA 5K8CA 1CDZA 1KPGA 2CLEB 1PYGA 3GJQA 4UARA 3WY9A 5I5EA 5E8JA 3ZGVA 5BWBA 3FNQA 3N2KA 5E0KB 4DSZA 2ZIAA 2YZGA 4PZAA 4MWOA 2FMIA 5J1SB 5ELXA 1OQAA 2YBDA 1QB8A 4X1IA 1O89A 1J90A 4ZJZA 4FE4A 4KV7A 2ODTX 3RBVA 2D8MA 3OY2A 4F84A 5LQJA 2OR1L 1FS4A 2F62A 1JDBC 4TMKA 2P3SA 1ENYA 1GQ2A 4Q3CA 5AKIA 2HAEA 5KNBD 3GBFA 1U7HA 2DAPA 4X20B 1N78A 1H5NA 2ZSKA 3JWGA 2Q3MA 3F96A 3TZKA 4AICA 4ZU3A 1O5TA 4G1CA 1FP6A 3DZKA 2ZSBA 1L5KA 2C92A 3SD7A 1CJTC 1PD0A 1V43A 4L9AA 5IXJA 3NLLA 1ZXLA 1I4TD 3TQOA 3KPWA 3HPQA 1P0PA 1NMZA 4Y6GB 3WGHA 2QMUA 4QDTA 3OTOB 4YRFA 2GRLA 2OAQ1 3MRXA 2HWWA 3K92A 1MQ8B 3OLVA 1ZH6A 5CX4A 3RWBA 1IY9A 1KC1A 4B74A 4ZVMA 5HEKA 5LM3A 3BA1A 2DUUA 4PFJA 5KSPA 2ZRIA 3JQ8A 4GM0A 1TZMA 3MINB 2HF9A 1RWOA 4PLTA 3L0DA 2JNWA 3CG4A 1EGHA 5CBKA 1X7WA 1VSUA 4JC5A 2R79A 3H0CA 1C3VA 1VCMA 1KYTA 3OM0A 4EABA 4AP5A 1U0EA 3EZGA 1QK5A 3V3TA 2VPZA 4QJ3A 2AXEA 4HCJA 2VDPB 5HIJA 1UBUS 1QYCA 5LP6F 5CVEA 3OCYA 3QQ6A 3NGXA 1MB4A 4Q1AA 4YDQA 1QFMA 1RJ9A 3C0KA 4NE2A 2BFPA 2E4VA 3URKA 5ITZA 1L7DA 2VQDA 3HJUA 2ZIEA 4DCVA 5CLGA 2BISA 3W9BA 1U7OA 1X13A 1E7YA 4J1WA 1RPEL 1SRRA 3CTMA 3DMFA 4LXYA 5JIBA 2W6IA 2JH3A 3AL2A 1ZSYA 2D2FA 4G97A 4KI7A 4NPAA 1RAGA 3AHJA 4X60A 4Y2TA 3K9QO 3M81A 5AI6A 4BNDB 2ZJOA 3R44A 4GOMD 4EK9A 4Y8VA 3RGWS 4K5QA 3T7RA 1H1TA 1O4WA 3TTSA 1PJQA 1C9JA 3G0BA 3NHBA 1QHXA 2RMKA 3CLRC 3FDJA 3KHTA 3PFWO 4Z59A 2FXIA 4HF7A 4ZT6A 5K3FA 3TMKA 1AUQA 5C4MA 4EG3A 1KO5A 3RQSA 4HLDA 2CHGA 2P90A 2ZT7A 4ARUA 4ARCA 1DJMA 2VSYA 2VYVA 3GN1A 1DWKA 4C0JA 5ECDA 4IFTA 3BB1A 4LF7B 2XJ9A 2ZATA 1GAXA 1CF4A 3AQ4A 4O2LA 4YDRA 1UINA 2VDQB 4A8JA 1J22A 3DF7A 1BJTA 3E9RA 3R5TA 1XVAA 2Z4RA 2Q0SA 4RK5A 1WO8A 2OV2A 3CPSA 1YZTA 2J3KA 3FFWA 2NPOA 1DKLA 1OX4B 2FZCA 4M1SA 3CLUD 1JDZA 1O77A 2B21A 4GI7A 3OMWA 4IZIA 3M9LA 3MD0A 1YB6A 2XIJA 2G71A 3FSEA 3J81A 4LF5B 3KJFA 1JVNA 5K5EA 2OHXA 4YRSA 3W8RA 2GBLA 3JQAA 3ZJYA 4OBMA 1KH3A 1O8BA 2YUTA 3P5SA 2XQFA 3B6IA 4MEBA 3D6VA 4OXIA 4PONA 5DYGA 5FTNA 5HX7A 1CRPA 1DC6A 4CIYA 1AB5A 5E1BA 5DRTA 2JLQA 1NUTA 4YAKA 2VHJA 3LKZA 2MYPA 2HPAA 4OFBA 3ZBUA 2JVIA 5K8JB 3EFOB 4BE7B 4DA4A 2UDPA 2GBFA 2WWVD 1GCOA 2LPMA 2AZXA 2O50A 3KD3A 5D3MB 4C4SA 4ZWNA 3M3DA 4DPKA 5IVKA 3L0IB 5FUQA 1E5LA 1R4NB 2C5SA 4RXMA 3SFZA 4RBNA 1KTIA 1ZJ6A 5B55A 1WZNA 1E3TA 3EE6A 4KVZA 1W5BA 2GFIA 3WGIA 4CUKA 2GCNA 2N9UA 2G9VA 3LHSA 3TVYA 4CM4B 2GD1O 3A6LA 1GFSA 3K9CA 3ZV6A 2HNKA 1Q0HA 3LY5A 4Y30A 3DCNA 1VIYA 3TMAA 1UAGA 4CMKA 3C6YA 2JFFA 3LOUA 1TLFA 3OIYA 2OXTA 5I7EA 3O4GA 4LJRA 2QWXA 2H4FA 3B51X 5KYXB 2IV2X 4MVJP 4YMHA 2BFCA 1RT9A 2ZQZA 4YAEA 1CE8B 1ML4A 2AOUB 2VDLB 3UMBA 1JQLB 2IELA 3IP9A 4JT4A 2XCOA 4PHFA 3TRIA 4EBBA 1GUDA 2W6JA 2EDAA 2F8LA 4J0DA 3YASA 1R0XA 2DULA 1KKUA 2PXDA 1L5HA 5AW6A 2CDBA 4K6FA 2PVSA 2R7MA 5FWNA 4N5MA 2XRYA 2ECPA 1T3SA 2R96A 3L7BA 1ZGHA 3RUAA 4PM4A 4FBIA 1TAUA 2PUBA 3LG2A 1YDHA 3IXQA 4HZUB 5MN5A 2VDKB 1DQNA 4W5JA 1ZZ8A 2ZKIA 2ZYUX 4JP1A 2W70A 4ZV4A 1EE9A 1VJGA 3UC9A 5ARDA 1POUA 1GNSA 4CHGA 2BEJA 3CUEF 3FUUA 1Z7WA 2Q9UA 1L7OA 3G59A 4M86A 4IIJA 4OGLA 4W1PA 5CBPB 1MCZA 1RSZA 1M5RA 4YBZA 2OILA 1JHVA 3V8EA 3D8NA 1M66A 2JJ1A 1I7QB 5JS6A 2L42A 4BNUA 1B0PA 2GCOB 4GPBA 1C7EA 1JV2B 3CWZA 3W77A 2VIIA 4B3MB 4U8HA 4JHLA 4Q3BA 5FPYA 1A71A 3H3XA 3HBLA 4WI1A 1R37A 4W5RA 1PZXA 1JDVA 1RQ7A 4PTLA 4Y0VA 4LYGA 1BGVA 2HCNA 1TD1A 2OEPA 1KEUA 2Q3LA 2YFYA 4FYMA 5TEWA 1TT5B 4G1UC 1RXSA 3ZGOA 4AMYA 1WF3A 1DRJA 1LI4A 1SQ0A 1K68A 2VNAA 3MJVA 4JC8A 3S0JA 4RULA 3L0SA 2OZLA 5D01A 4BV2A 1N6PA 4CLEA 3HUFA 3VU9B 2C7BA 4F6RA 2IJGX 4LFAB 3G79A 2BNOA 3EGWA 4RTNA 3QBEA 2WUWE 4CKEB 1WXQA 5IEBA 1FYDA 1SH7A 2BF4A 4KWCA 4ZXFA 4AXXA 1VC2A 5DLEA 4IZOA 4MTCA 1P2VA 5I8PA 2OBYA 2CLOB 2G1KA 1DKQA 2P6PA 4R2LA 1NBMA 2A9PA 1Z0AA 2F00A 3OEHD 3GDWA 2Q3JA 4KMOA 4WFQA 4D99A 5JECA 5JNWA 1TZ2A 1HA3A 2EL9A 2NTVA 4B1FA 2H7YA 1A5TA 4JB8A 4MWGA 5EERA 4RNDB 4F5DA 4E94A 1HZZC 2XNSA 1M8KA 3LUBA 3O4JA 3MNFA 3HZIB 1G1AA 2ZDGA 3PP8A 1L8LA 4FHDA 2IH5A 1AKRA 3DE7X 4QOJA 4EW6A 5DI9A 1GZDA 5HMLA 3AK4A 4X4FA 2XB2A 2XSDC 1JILA 1EM8A 1JHDA 3JXCL 3CSSA 1E96A 3DKIA 4LY3A 3TD9A 1UDXA 3SZ3A 2I1QA 2FX2A 1X9IA 4FINA 3IEKA 4R1SA 1R8QA 3ASYA 3REOA 3UIEA 4AN0A 5JQWA 4B3SB 4GLJA 4DSNA 4LNUA 2GTPA 3HU2A 1T9BA 3MUEA 2IV3A 4RKQA 4BEBA 5LYJF 4BYMA 4J3JA 4Z7JA 4RMIA 3WK7A 3I6ZA 1VLJA 5FBZA 3GQBB 3PGXA 4S1WA 1GDDA 4DGQA 3BIWA 1Z5UA 3CF4A 3B8EA 1AH2A 3PG5A 4E46A 4CU5A 2A5LA 2ZI4A 4FILA 1TCVA 4MVJM 4O1IA 1D1QA 1VJ5A 3WIDA 1JQJC 4NR0A 3SCHA 4MVJE 5EE3A 3VR5D 3K15A 3ZHYA 4HQRA 1E8NA 4YAUA 1RM4A 2JLSA 1ZZBA 4EG6A 1OBFO 2ZREA 1OR8A 4LJ5A 3EF1A 2Y76A 4OK3A 2VPTA 1EJBA 2HRCA 5IDQA 1Y4UA 1T9KA 4HAUA 1P33A 2BKXA 1XQYA 1I32A 1PS9A 2V9PA 3O4RA 2J3LA 3DKKA 1DELA 1VKHA 4QX6A 5DTMA 3GP3A 3SR0A 2O2DA 2ACEA 1YBFA 3EGDB 4FHCA 5KTOA 5I4KA 3LGSA 1FUEA 1SC4A 1XZMA 2QP3A 4LTMA 3W8EA 3KV1A 3GCXA 5A5VA 1GPH1 3OPQA 1S7CA 2DKNA 2LW7A 2W98A 2PUTA 3IT3A 4GXNA 3S29A 1YS6A 5AKYA 4DE8A 4YAWA 3J81k 3Q8WA 2OV6A 5JTUA 3AEKB 3KBBA 4MHOA 4WFIA 1FPMA 4ZT7A 4MPDA 2R6R1 3D8HA 4YN3A 4TPKA 3ZJ5A 3P9RA 3VPHA 3K2BA 4C3UA 4DTCA 3SXUB 3Q11A 2UYQA 2Q3CA 5JT1A 2YIMA 4N0MA 4IUDS 1V4VA 3VWSA 4EHNA 2QY9A 3HBAA 5AOVA 5TVKA 2DHQA 4DN6A 3RTDA 3HRKA 3LIPA 5LA6F 3UGTA 3RYFA 1G5IA 4WN9B 3EISA 3EVNA 1D2CA 1AZSC 1SCUA 2CLLB 3LO8A 5FQOA 3G68A 2ACWA 2R2GA 4HEA6 5FEMA 4X1IB 1A9XA 3QU7A 1WH6A 1KMNA 3FYUB 3SVZA 2QIPA 4FYWA 5EKDA 3D5TA 3CB4A 3FOCA 1FRQA 3H2KA 4DJDC 3U26A 1BW9A 2QX6A 2HBZA 4LXQA 4WK0B 4YYZA 1SBCA 3WYEA 1XPUA 3ZDBA 4FW8A 4Q9KA 2V7GA 2WK1A 3DVLA 5FAKA 1D2HA 1JPNA 1XE3A 2VP2A 1Z83A 1B3RA 3OCZA 4IJVA 1ESEA 1YRAA 2C4HA 2H1IA 2I7CA 3KYBA 4N0EA 3QYJA 4CQMA 4EQ6B 4EHHA 1M0SA 4KFCA 1MH1A 3RARA 2O7NA 2PV0A 4OHXA 1RPJA 1QVAA 1D4ZA 1UJBA 5K03A 1NNLA 4YQZA 3W6ZA 2XBLA 4YCMA 4HUQB 3VPFA 3DB1A 1SB9A 1PV2A 3F7MA 4GVXA 4NQZA 5EQFA 2NZJA 3C7CB 4KDCA 3ADKA 4QFBA 3VSBA 1HLDA 2AWOA 4YCCA 3N70A 5A4JA 3F9IA 1MXHA 3DWGA 1QHSA 2PCJA 2CNNA 4FVTA 1ZOPA 2WJ4A 4JWTA 3WWOA 2ZS9A 4C7VA 1YJXA 4RFLA 4UCQA 3CBQA 3E3MA 1C0EA 1DDGA 1MR3F 2XQGA 3L1JA 4JLOA 4L78A 4NG5A 5G3ZA 1LX7A 5IYZB 3HBNA 1NERA 1E2KA 1HF3A 1R6UA 3O3NB 521PA 3FWZA 4LMRA 3SDZA 3KAJA 3VGPA 3FJOA 1GTVA 3OY7A 3NHFA 3VR5A 2GEKA 4BKMA 1XCGB 1QRAA 3D7MA 1P61B 3LUFA 1FP4B 1PDWA 2IBTA 1F6WA 2PLAA 5JISA 1U63A 1W75A 1ZI9A 3AF4A 3KXDA 3DULA 2KEJA 5HG0A 3OCXA 3ZHQA 2XMQA 5CIQA 5A7GA 5JNRA 2PUHA 4IIEA 4MI9A 3O1IC 1OXBB 1LVHA 3DMGA 3L43A 4OOFA 1I4OA 4QG3A 1T6BY 1TDJA 3WJ1A 1WJGA 2QU7A 2C84A 4EFNA 4A3SA 5CVTA 5AOCA 4AKHA 3WISA 4PZDA 1JBKA 4OI1A 4IIHA 3LH5A 2XCSB 5EC8A 5BUQA 1SA0A 4HDMA 4X7MA 5BSWA 4YONB 5KYGA 1G1MA 1XIVA 2HJWA 3S7TA 5G3YA 3BE8A 3BRWA 5HDBB 1H9AA 1B15A 1FSSA 1QO0D 2L0XA 3KFLA 2Q21A 4XGIA 3RYIA 5HIAA 3ITNA 1PJAA 4PQFA 4Z2YA 4CT5A 3GNTA 3AVVA 3BGOS 3GJ6A 1BROA 1V6AA 4LRUA 5HKAA 2O2CA 3COYA 3EQ6A 3R4CA 4KPUB 1CQIA 2OUIA 2ISSD 4NNJA 4C3ZA 2XUKA 3HCDA 3MCUA 1VRWA 3CF6R 1U8UA 3V4RA 4K8RB 3QMWA 1GIAA 1QHHA 4N6NA 5AK6A 2JLWA 2D54A 4Y7CA 2AZMA 5EHXA 4AIRA 1UPTA 2GCPA 2NQ2C 3FNFA 4O1MA 1IONA 1GPUA 1LLQA 1WOYA 2I67A 1LBQA 2B1GA 4RELA 3NX4A 3OCWA 4G0XA 3JQPA 2EP8A 1K4MA 2JA2A 3DCJA 1MC4A 2PRIA 1T6NA 3Q9UA 2V6BA 2ZWVA 1SURA 3A58B 4WLUA 1SCJA 5HS4A 2GJ4A 3TR0A 4RQTA 1Z68A 3BG5A 4MVJI 2L8NA 1U90A 1QZTA 1E62A 3F49S 3WVNA 4CHTA 2OZVA 3RT7A 1IZZA 3NTXA 3VR5H 5CG1A 1AXEA 2WYIA 3BULA