1JFSA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
b'ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
molecule tags Transcription/dna
source organism Escherichia coli
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jfsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA02
3I45A 2LYJA 2AXVA 2PIJA 2FMKA 4DQDA 3JPYA 5FBKA 4JB0A 1JDPA 2ID9A 2I6FA 2WB4A 5E3JA 3RVKA 5A7LA 1E6LA 4GHJA 4LRQA 2FMHA 4KRFA 1D1PA 1JDNA 4RK7A 4X4EA 5FWXA 5HM6A 4X4CA 4W5RA 2LP4Y 1E6KA 5HQJA 1JYEA 3LMKA 5BQ3A 3LKBA 1HF0A 1L5YA 3FMVA 3L6UA 4EVSA 4F11A 1P6QA 3CLKA 1DBPA 3RVQA 4NV3A 2HJ9A 4RV5A 1BVHA 1FQWA 1P6UA 4RY8A 4YO7A 4I6RA 1D1QA 4G0PA 1KRWA 4FBIA 1D5WA 2IVQA 2E4UA 1PERL 4N0QA 3LUAA 2WUSR 2E4YA 5JNVA 1NERA 3N53A 3NHMA 5FBHA 3H1FA 4RK5A 1R63A 3MIZA 1O4XA 3BRQA 2JVJA 2QVCA 3KJXA 4X4HA 1A04A 1DG9A 1ZUGA 2L17A 1WH6A 1JFVA 1OXBB 1YVUA 3O21A 4YARA 1CQTA 4QICA 1D2AA 4MPTA 4Z4CA 1ZZ9A 4RXMA 3QLUA 4PICA 1EWKA 2PL9A 3Q7TA 4JASB 4FE7A 2IPMA 4DADA 4ZMRA 1RNLA 2AXZA 2R1JL 4JCXA 2A9PA 4KPYA 4W5NA 3GN5A 2AXUA 3QWGA 2PUAA 1NTRA 3CFYA 4YCSA 5ED4A 2W42A 3RVLA 4IVZA 2FEPA 5DLEA 5EWMB 3RVSA 4N76A 2RDMA 3O1HB 4UHJA 4F3TA 4MCTA 1SQ8A 2IKSA 3DLHA 1NY5A 3I09A 4MQFB 4KFCA 4OLAA 2A6CA 2GRLA 1ZAYA 2NT3A 4MS3A 3FFTA 4F12A 2AWIA 2FEKA 3BILA 4G97A 3DBIA 2MYNA 2IYNA 3K4HA 2GWRA 5BR1A 2EF8A 2B5AA 1LBIA 4MS1B 2MEZA 4JOQA 3C3MA 2R63A 4KREA 1EWVA 1QO0A 1DBWA 1Z15A 4KQCA 3T6KA 1TMYA 3KYJB 3GL9A 4G0QA 2WRZA 5KWSA 3L1PA 3CHYA 3QK7A 3Q41A 1QQAA 4MS4A 3N75A 1YS6A 3GA5A 1CHNA 1PHRA 1VKRA 3IPAA 3KG2A 3LUCA 3MYYA 4QPJC 4RY9A 2CHFA 5GOTA 2IPLA 4X4GA 1MVOA 2HQOA 1GT0C 3Q9SA 2RGYA 1DBQA 2HSGA 1ZH2A 1TJYA 5TPWB 1CEYA 2FQWA 3VK0A 1JX6A 1SXIA 4MR9A 4D6XA 2JVIA 2ICTA 3LUFA 3KCNA 2GKGA 2ZAYA 3G85A 3F6PA 5T3YA 3HV2A 4KV7A 3JXDL 2P4UA 2FMFA 3FFXA 3LOPA 3N0XA 2FQXA 3HUTA 3H5WA 2HPHA 3HDVA 3QEMA 3SM9A 3P9YA 4Z9BA 2BNOA 4MS4B 3N0WA 3JVDA 5DTEA 4X4BA 1GLGA 3O1JC 4D6YA 3JPWA 3H5OA 2PE5A 1OXKB 4HNQA 4J1WA 2H8RA 3C97A 4PYRA 1ZH4A 1B0NA 3OLYA 4Q6BA 4IILA 1RZRD 2X7XA 3CLCA 1LMB3 1PUXA 2M98A 2FLWA 4MLDA 2JB9A 2KEIA 4YG7B 2JVLA 2H0AA 1PRVA 1ZPQA 3UUGA 4KNYA 3FYMA 2NZUG 4EUKA 4MRMA 5FWYB 2N9UA 2WJAA 3O1IC 5CNIA 1CYEA 1AB5A 4RZSA 1ADRA 4LX8A 5B3JA 4P1ZA 2LYPA 4YLEA 5PNTA 4TLLB 3A3KA 3GRCA 1YSEA 1YS7A 2R48A 4RK4A 3LISA 1FSPA 3QYXA 2MQKA 3CZ5A 3D02A 4OTZA 4OG2A 3TO5A 3MM4A 1LJLA 4Q6WA 3SCGA 3CRNA 5I4CA 3O9XA 5T7BA 1NXVA 1WIZA 3SCFA 4XXHA 3JVIA 2XCJA 1R69A 1YMUA 3M6MD 1M2EA 4IF4A 4IWRA 2FTKE 2MSLA 1PEAA 2PJUA 3EJWA 1WH8A 1Y7YA 4YG4A 1OSLA 3OP9A 2PMCA 5KQMA 4KQ9A 3EODA 3VNBA 2H3HA 4I8TA 3A0UA 1VRVA 3QX9A 5EWJB 3A0RB 2GRMA 1XHEA 1PRAA 3LTEA 2QVGA 5IBQA 3RVMA 3O2SB 4X4FA 1NXSA 2XI8A 4RKRA 1J56A 1YTUA 1MIHA 1QP0A 4O1IA 3H5TA 3LUKA 2IVGA 2L49A 2YHAA 3LUHA 4RXUA 1NEQA 3VNAA 3LFTA 4LE0A 1Z13A 1HEYA 1RXEA 1P2FA 4KVFA 2JK1A 4YV7A 3OLZA 3DGEC 1QP7A 1MB3A 1EFAA 1IC8A 4WXEA 1M5TA 2E4WA 3LUJA 1E3OC 4G0XA 4EGSA 1H9CA 2LYQA 3JY6A 1U0SY 5TQJA 3O2QB 4ETIA 4O8BA 6ABPA 5EWMA 3KHTA 1BDJA 3SCHA 2VUHB 4XLTA 3HVRA 3RZZA 1BAPA 5HSGA 4PEVA 5IEJA 4LE1A 1ZZBA 2GZUA 1ZY2A 3L49A 3O74A 2LIVA 1JF8A 3PXPA 3OMWA 3SQNA 3QELA 5IUJC 5TPZD 4MR7A 3N6VA 4TLMB 1YIOA 4QYWA 4RK1A 2D5VA 3H6HA 3F51A 1M5UA 2E4XA 4PU4C 2FW0A 2XSDC 2WMYA 4IRXA 2CSFA 3HCWA 4OB4A 3H5LA 2LCVA 1FFWA 4GQMA 2OFYA 5CNKA 3JXCL 2L18A 3MA0A 1DC8A 2KZ8A 1Y1LA 2QXYA 2QSJA 5KC8A 4LDAA 1ZN2A 5CNJA 4YR7A 3F6WA 1ZHHA 1QKKA 1KGSA 4G0YA 4N41A 1RZRA 3JS5A 3H1GA 1DW9A 3GV0A 4H3HB 4Z4EA 4G86A 1DCFA 4E7OA 1A0OA 1POUA 3FGZA 3IP7A 3CECA 3CG4A 3UFDA 3E3MA 4WZZA 1ZVVA 1JH9A 1KMIY 1SRRA 3Q7SA 2CROA 3H5IA 4N03A 3ROTA 3RVPA 1Z18A 4RXTA 3OM0A 3S8QA 1NXOA 2A9RA 5TQ0B 3TRBA 4MAAA 4EVRA 3DGFC 4W5QA 2L19A 1GUDA 1USGA 2LUOA 4IMIB 4RKQA 2CHEA 5IULC 4PU7A 2FLKA 4Q7EA 1DJMA 2WIUB 3ZHIA 1SXGA 2FQYA 1XWWA 2B4AA 1KRXA 4JB2A 3BBLA 1LQCA 1DP4A 2LYLA 4MCXA 1W9HA 3KTOA 2OR1L 2TMYA 2GI4A 2YHBA 2CWDA 1QMPA 4PU3C 4RK0A 1JLKA 1E2BA 5TPWA 2JCGA 2KYRA 1R8JA 4PE5B 4P98A 4I6UA 1LCDA 1W25A 1XWRA 4UHKA 5KI6A 3NNNA 3OLXA 3QEKA 1Z26A 2FXIA 4NICA 2IDMA 4RDCA 5IUKC 4D74A 1ZS4A 2FSPA 1E6MA 1SD5A 5TQ2B 3C3WA 3F6CA 1QPZA 2ICPA 3CU5A 4H3KB 8ABPA 5KQPA 3IP9A 1A2OA 4N47A 1BDHA 3IPCA 3NNSA 4EYKA 1JBEA 1JYFA 2RJOA 3MQ4A 2IPNA 4X4IA 1UXDA 3K9CA 5C5CA 3NNDA 3ZKCA 4JQDA 3H5VA 3HEBA 1I3CA 4JAVC 4MR9B 2IV1A 4OBBA 1Z25A 4Z4GA 2R4QA 5C5EA 2HINA 3CKMA 3BD1A 1ZITA 3BRSA 3S99A 2O4AA 2PL1A 5HKOA 5JNSA 4PU8A 1TVMA 1LJUA 1CJGA 3N0RA 4S04A 1PRUA 3BREA 3EQ2A 2O38A 1ISRA 1YMVA 1U2PA 2KEKA 3GYBA 2PUFA 3H1EA 3SNKA 2PKXA 4MS1A 5BRJA 1RIOA 1C0EA 3G1WA 4GPAA 4MQEA 3DLBA 3EULA 1QP4A 4KZKA 1X57A 2PUEA 5JNTA 3LUDA 5KC9A 2L8NA 3CG0A 2E4VA 2XJ3A 1GUBA 3URMA 2NZVG 1X2LA 2ID7A 3KXAA 1DRJA 4MR8A 5IX8A 2KPJA 4L4UA 2PPXA 4YRZA 3MLFA 3NBMA 2LYKA 4RWEA 4F8DA 3ROFA 3I42A 5DCLA 4E7PA 5KQLA 1K68A 4EYGA 1JFTA 3LUGA 4H60A 4YGXB 5KQGA 1RXIA 3F52A 3RH0A 3RQIA 4FN3A 3GBPA 3O2JA 3HZIB 3UK0A 1D4ZA 4MQEB 1L1MA 2R47A 4ETMA 4DN6A 2FKAA 4MS3B 3T8YA 3FMYA 2WJWA 2MSWA 2IPAB 4B09A 4EY3A 4HYEA 1USKA 4OATA 2VYCA 1Z16A 5DGCA 3HDGA 1YK0A 3IVPA 3KKEA 4JA2A 2ZWMA 3ILYA 5ABPA 1XHFA 2EWTA 3SY8A 4LE2A 2MYUA 4NCBA 5EWLA 2J48A 3O75A 4HNRA 4EYQA 3JTEA 4W5OA 4FB4A 4Z59A 1EWTA 1FFSA 3JXBC 1F51E 3LKVA 4RSMA 1U04A 4XAQA 5CHYA 1DCMA 2NT4A 1NXTA 4YWHA 3SAJA 3E61A 3DNVB 2MYTA 2QR3A 4Z4FA 2FJRA 1TM2A 1ZESA 1PNRA 3C3KA 2BJCA 1Z2EA 4G0MA 4TMYA 5K98B 5FWYA 3HK2A 5JS2A 3QLVA 4Y9TA 3HM9A 2JRLA 4F06A 4EVQA 3C6QA 1FFGA 3M9WA 1AU7A 1TLFA 4FE4A 1BDIA 1LLIA 1P8AA 4XASA 1Z2DA 3OQMA 2PUBA 4F8JA 3CTPA 4ZPJA 3D8UA 4KK4A 4ML3A 3SG0A 1OCTC 1U2QA 4Z0NA 1ZZCA 4YBAA 3RVJA 1K66A 5IEBA 3W9SA 3MMNA 3N8IA 3I5AA 4XFKA 5TPZA 1USIA 2M1ZA 1APBA 4PZ0A 3KLNA 4XARA 3ILHA 4EYOA 2A9OA 2XIUA 2JBAA 2P9HA 3HZHA 3RVRA 3HO1A 3EAFA 5DKFA 4O5AA 2FN9A 5D2CA 1VPWA 1ZDMA 4W5TA 1GCGA 3OLWA 4MYRA 2AYXA 1BA2A 3HJFA 4TN5A 1Z12A 1UXCA 1S8NA 4X4DA 1ZGGA 9ABPA 3Q7RA 4G0OA 3GN5B 1Y9QA 2BNMA 1Z17A 2QW1A 4YP9A 2RJNA 3BS3A 6CHYA 1MAVA 1QQBA 4G0ZA 1LCCA 4JP1A 1JHZA 5B3JC 1C4WA 1VLZA 3GWGA 4MQFA 2LYSA 1S7EA 2JVKA 2VK2A 3OMXA 5BRAA 2LBPA 1ZZ6A 2VUIB 3R1FA 1EAYA 1SXHA 5GQSA 3R0JA 5EWJA 2FN8A 4WWHA 2LYRA 4LDZA 4MGEA 3IP5A 1EHCA 1L5ZA 4MRMB 1NXPA 3KZ3A 2DRIA 3OM1A 3TMYA 7ABPA 3IP6A 1RZSA 3QQ6A 2HQBA 1PNTA 3B7HA 1F4VA 3ZHMA 1NXWA 1RPEL 1GCAA 1M2FA 4ETNA 3D1NI 1PEYA 4GNRA 1ABFA 1AB6A 2FMIA 3H6GA 4Z5DA 3QELB 4Z9AA 2MSKA 2QV0A 1JWLA 2HQRA 2R25B 3KSMA 3GT7A 3CZCA 3OO1A 1ZGZA 1T34A 3CNBA 3KS9A 1ZZ7A 4RY0A 1QNLA 4ZYLA 3OO0A 5EWLB 1JFSA 4HNSA 4YS6A 2QU7A 4WUTA 3RVOA 1DC7A 2KEJA 4Z4IA 2PUDA 1YK1A 1U8TA 3QLVC 3Q15C 4RK6A 2NUBA 4NQRA 2LPMA 4IMJB 3TX6A 3KLOA 4M88A 5JNRA 5JNUA 3QF3A 4Z5HA 4Z99A 3QEMB 4I6TA 3LFPA 1UDRA 2F8SA 4MR7B 1DWKA 1ISSA 2AYZA 3EGCA 4KMRA 4L85A 5CNMA 4IA8A 3QLUC 1ZZ8A 4Z58A 3G7DA 2PAFA 3EQZA 3HSYA 3FYAA 3HS3A 3EDCA 1NXXA 1URPA 1LK0A 3OLVA 3KYIB 1QO0D 3T38A 2IVBA 3OQNA 3CROL 3BDNA 3FFWA 4OLBA 1B00A 2B1JA 5IC5A 3TB6A 2AW6A 3UKJA 3OMTA 4NDWA 3EUSA 3B2NA 4YG1A 2IOYA 2QZJA 2GBPA 2JBAB 2GX6A 3F7NA 2PLNA 1MB0A 4RU1A 3GBVA 2O49A 1UTXA 3FDFA 3CS3A 1JL3A 2CD7A 3A10A 2BNNA 3DZDA 4MLCA 2L2QA 4Z4HA 3U3WA 2MYPA 3IDOA 3OQOA 3HUUA 5F64A 1LBHA 2AUWA 3G5GA 4ZMSA 2V0NA 3TD9A 2PUCA 4RS3A 4N0PA 1NATA 2XDYA 4CBVA 4NCAA 2OENG 3NHZA 1WETA 2Q5CA 3RVNA 4MR8B 4Y42A 3M9XA 5TQ0A 2EBYA 2A9QA 1DRKA 2FVYA 2E4ZA 5TE9A 5JS1A 2BGGA 3MF4A 2O20A 1DCKA 4KK3A 3HXMA 1DZ3A 2FEWB 3T95A 5FWXB 2WY2D 5JNWA 2IU7A 1RPJA 4O1HA 3QX8A 4WT7A 4ZJPA 4QYMA 4Z5CA 4S05A 4J1XA 2PUGA 2F8TA 3QLTA 5IUNC 2OQRA 4JCYA 1IIBA 5TQ2A 4IGAA 2WWVD 3GBFA 4LZLA 3F73A 2IUOA 1ABEA 4WXMA 3H75A
chains in the Genus database with same CATH superfamily
1WHSB 2GBLC 3EEQA 1G8MA 2LYJA 1P3DA 5SICE 4ZI7F 2WFLB 1GU0A 1HDEA 1EE9A 2PUVA 4V39A 4X00A 2OKGA 2BEVB 5ECYA 3SGLA 1RKBA 3W04A 2X6QA 4UOZA 2PH3A 3U80A 1L5QA 2Y68A 4NMXB 2EJCA 3VYSB 3BF8A 3PEWA 4PZPA 5G1PA 1HNZB 5LQRA 3RJMA 2QYSA 3Q5EA 1BMTA 4AWAA 3I2KA 1ODSA 1XKQA 5ALIA 2EKQA 4J1TA 3HACA 3I6MA 2VZEA 1UKCA 5KAMA 1B0UA 2QR2A 3K0BA 2XDAA 3F71A 1PG5A 4X20A 4FBIA 1D5WA 4KPUB 2CE2X 1I3KA 2OHGA 2CMFA 4XJXA 2QAGA 4DUYB 1N9ZA 2HA0A 1UOPA 3V2IA 4F45A 1ZM3A 5LMNB 3UFXA 2X8BA 3SN6A 1JFVA 3EEFA 5T8KA 1HQ1A 1FMLA 1B41A 1JR3D 2B1QA 3KWMA 1EFUA 3Q7TA 3KQVA 1QTIA 3Q98A 1R64A 3H05A 5CFQA 2CWWA 3J7AC 2R9VA 2O8FA 4KAFA 2FE1A 4TM8A 1H2HA 4MB0A 3BCUA 4PW0A 3I9LA 1C7JA 4R6WA 2ZAOA 3RVSA 1A71A 5KOJA 3ZQKA 1VMAA 4MI1A 4YAFA 5AXBA 3DL0A 4Y0VA 1JDUA 2NT3A 3FWNA 2R85A 1EFPB 3P9PA 4OKIA 2Z8YA 4DJDC 4TWRA 2GJ9A 2Y1WA 1NYLA 5CBPA 5BWCA 4F2DA 2ZCUA 5IHXA 4DIBA 2C4KA 3GL9A 4JBIA 3AIKA 2ZUEA 5EVJA 1C1YA 3ZEAA 1IM8A 4I55F 5HJ5A 2I3GA 3LUCA 4OMDA 1IN8A 3FLAA 2WA1A 1G6HA 1XYYA 2HQOA 4R83A 4EHNA 3KCQA 5C0OE 1A98A 1M1UA 1TEHA 4M7OA 5BQPA 1QYDA 2Z83A 4N3BA 4NFHA 3K6KA 3LUFA 4WKPA 3TINA 4QWWA 2GKGA 3U3MA 2OCPA 4QOFA 4CPDA 621PA 5JPDA 3LM8A 2PSEA 4JT4A 2HHCA 4X5OA 4MUNA 1PR9A 2O8VA 3PQ6A 4M9QA 3SFZA 3PXDA 1XDBA 5D5HA 4EHLA 3Q8XB 3HKEB 4WK4B 3K94A 3G2KA 1V3VA 3E58A 1EK0A 5FTLA 2WF5A 1IG0A 4H0CA 4DLSA 4B3RB 2C3YA 1M2OA 3MJEA 3MWEB 1HR0B 5IFLA 2HLNA 2GHQA 3L9WA 4KR2A 3M0EA 2XYQA 2G40A 2GLXA 3A6GA 1GLNA 4IJ6A 4GPTA 3QVKA 2Z58A 2JJ1D 3KTFA 4FWIB 2IWHA 2FLWA 4QUDA 1ENPA 2EFYA 2HK9A 2Q5EA 2FFQA 4Q3LA 4ZDWA 2G71A 4IVNA 3K0HA 3V7FA 1KYIA 4BTEA 2P77A 4M37A 3R5XA 3ET5A 3HA7A 3UUGA 3HVIA 1BS1A 3QFTA 3ZNPA 1GO2A 3NQ41 4OK5A 1LLFA 4QUJA 1Z6QA 4S1PA 1WSDA 3CKYA 5K3CA 4Y2XA 4R31A 3KAKA 4F2GA 1A82A 2BM9A 4IGIA 3V9PA 2PRYA 3ZY4A 3D02A 2RGDA 4IEFB 3H0EA 2WF9A 3LVQE 2C96A 1UQTA 1XF1A 3A6JA 4TTJA 1JBKA 1HKUA 2QSUA 2V6GA 2HCSA 4BLUA 4D41A 3HY4A 3AGPA 1QVWA 1FSZA 1ORWA 1YQDA 3K15A 3S27A 3U26A 5B64A 4F5ZA 1PEAA 4XOIA 4J75A 3ZE6A 3AI7A 5KKCA 1ADCA 1RI5A 1WHTB 3C7CB 3MCZA 4KQWA 4P4NA 2JIQA 4BLPA 5THKA 1UDXA 4HBGA 3N5KA 3RANA 3RRXA 3I2FA 3L6EA 2WZQA 3GVIA 4W7IA 3I52A 3I01A 2R6DA 4N12A 1HA3A 2HQSA 2XKJE 4KUHA 1HYGA 3QFSA 2QVGA 2IU3A 1RPTA 2GFIA 2OHXA 2SKCA 3O2SB 5F2OA 1J56A 3RVMA 1YTUA 1IK4A 2QAJA 4US2R 3EFBA 3H5TA 1NBME 4KWEA 1ORRA 3G8CA 3BDVA 3SBDA 5B1EA 2VIIA 3VNAA 3WJ7A 3ANXA 1CQZA 5C7IO 4MA0A 5J4VA 5ALPA 3C5VA 4F56A 4CG1A 2HWXA 2PS0A 3AU9A 3LQKA 2PG3A 5FNZA 4B83A 3TFWA 1KFKB 4Y6QA 2H1RA 2PXFA 2E4WA 5LUAA 1E3OC 4G0XA 3ZVMA 3ZVNA 3HCOA 4L5YA 5JDCA 1RI1A 3KPWA 1H2RS 3E9QA 3SXPA 3DHWC 4LHVA 2C2BA 5EHZA 3AJEA 5F1KA 2B98A 3MUFA 5DX0A 4HVLA 3K0KA 1ZZBA 3VR2D 4O2AA 2V6FA 3AEYA 2W2OA 1UBKS 1SGWA 2X4GA 4CF7A 4FWTA 2GPTA 4HLDA 4XD7A 4K9PA 3SE7A 1W36B 2PKQP 3BJRA 2CJFA 4MUHA 2I22A 4HYYA 1FDIA 5BOSA 1ETUA 4HGRA 1WUJS 3ZKWB 5D3QA 2WMYA 1Z74A 2IPOA 4S2EA 3T7CA 4B0OA 3K2QA 4XQGA 2H18A 1M6NA 4KFUA 3UC9A 2QZPA 2L42A 2EJVA 1OH6A 1VL5A 2PO5A 1GYQA 4YEDA 2L18A 3UG6A 3VMFA 4BZXA 1GGEA 5EHIA 4C9BA 1KNXA 2EP5A 2NACA 4WCFB 4B44A 2UYCA 1U1GA 3QPDA 3T0IA 1BW9B 3W5BA 2UZ1A 3MWDA 4YQFA 4JYZA 1U31A 2Y1DA 1BQ3A 3EQ7A 2F6RA 4G85A 4G86A 2PXXA 1I1NA 1SK9A 5AT1A 3EG5A 1N8SA 4QPDA 2ANBA 4YDQA 1NRXA 5LZ9A 3Q3EA 4DPKA 1ZOIA 3QJGA 5CX4A 3IXLA 4AB1A 1VYUA 4JNKA 3ZS8A 5CFMA 3NHPA 3OUTA 4MQ5A 2Y4NA 4OJYA 4W5QA 3T7AA 1W29A 1HDGO 3LUBA 1CUWA 4PU7A 4NBVA 5FOTA 1NJ5A 2GBGA 1WM1A 3C1OA 1SU8A 3PE4A 1P72A 3NBFA 4Y2HA 1RYMA 2RGNA 3U3XA 1DUIA 2GO1A 5KNCD 1KSHA 2WMOB 4B3XA 2XB2A 2V0CA 4PRLA 1ESMA 4ZO9A 2B2NA 1IN1A 1P9WA 3LX6A 4F2HA 4F4CA 5K2MA 1IZ0A 4JT2A 3PNSA 3QLJA 3CVJA 2AZ4A 4OO3A 4MOWA 4RK0A 5I5EA 5MDHA 4EJFA 1E2BA 2TMDA 1QHYA 3KB6A 1PFQA 2X3FA 1I94B 3O03A 5FKJA 2Z6UA 2CC2A 2WPDD 2X58A 4AZ3B 2V7XA 4WLEA 1Q3KA 2G5CA 2E55A 3CLVA 4RSHA 1JFFB 3UOGA 4URVR 3ESBA 3F6CA 1ADJA 4FDVA 5EKXA 4TYQA 2FGJA 3T5AA 3MTIA 1QIIA 5TNXA 2HRZA 4HAUA 1JQ5A 4RTPA 1K98A 1WOYA 2GZ3A 1XTJA 4M9UA 5D00A 5D7BA 4QXOA 2CFSA 5ALOA 4GMGA 4F5EA 5ALTA 1O57A 4YA6A 4FYYA 2ZTMA 1KI9A 3MQ4A 2IPNA 3LHIA 1JHRA 2X0RA 1HLPA 2F1JA 2FF5A 3TI7A 2XMGA 3NNDA 5JZ9A 3D64A 1I3CA 1B1AA 3LX8A 1YA8A 4JLOA 3NDRA 4COKA 4QULA 3VHXA 1E1DA 1JH8A 2JG3A 2WTBA 2XGMA 5A4FS 3ZKAA 5KTTA 2HCTA 2J59A 1WXHA 2QE7A 5CW2A 1PRUA 5J1TB 1U98A 3ORSA 2LWIA 1IBLB 1NOIA 4TTSA 3U3JA 2ZI3A 4LTNA 4WN9A 1QJCA 3O7WA 5HE9A 5SZJA 4ZJZA 3AF0A 5H82A 4UE2A 4KGZA 4Q4HB 4AZTA 1R4NA 2NSDA 3U4MA 3EF3A 1VE1A 2XE7A 3MW8A 1F7VA 3PR1A 3LT1A 3ZOZA 4CCYB 3IV7A 5TS3A 2C9DA 1G21B 2QL5A 4LMPA 2FSVC 4XFJA 4OMFG 2P1RA 5KOHA 3BMCB 4WY8A 4YRZA 4ZT3A 4Q9LA 3JVEA 1JSRA 3CNQS 1NR5A 2WABA 3BB4A 3JASB 4LF6B 2PY6A 4S35A 4YREA 1VMIA 3R4CA 5AYVA 3RH0A 4Q4JB 4IWXA 1IY1A 4Q1DA 1JA1A 1QVZA 2XYRA 2C4VA 3LC1O 4O2BF 4YJFB 3ULKA 3FUVA 4RV9A 3FGPA 3MCVA 1FX0A 2C9MA 3FPBA 2A9KA 3AUFA 4PZ9A 4OFXA 4AIRA 4BEBA 2X6TA 3N70A 3LPMA 1WUKS 5T4HA 1ZNYA 4G07A 3SIXA 1D07A 1ODFA 1QAOA 4QUBA 3UT5B 4YMLA 1A7JA 1XDWA 4IMRA 1VRWA 4G26A 1XHFA 1ZSVA 4Y7DA 2XT9A 1OU4A 2ODAA 3HWSA 4KLNA 4L0MA 1CC1S 2F8MA 1AKWA 1N3YA 2GD2A 1X8KA 1ST2A 3A1SA 3MT7A 2VYVD 3G2LA 4JMPA 1T2CA 3K8YA 3EVBA 4W5OA 5GWXA 1JJFA 4XSHA 2ZVPX 3AONB 1FU4A 3G2MA 4BKUA 1SQSA 4JJIA 4CFZA 3LKVA 1LK5A 4ZO6A 4AX4A 1UKYA 3B3QA 2XEXA 5CHYA 3SAJA 1FA9A 1NWCA 1PLKA 1WB4A 3DCIA 4Q19A 5B30A 4L3OA 3GFQA 2J9FB 3NU1A 5JRJA 2XCSB 4Z4FA 1G63A 3EXAA 3GIDA 3UV3A 1DX9A 3ZN2A 3RADC 2G28A 4GMKA 5T4BA 3LBFA 2PGOA 3I8OA 1NLMA 2Q9BA 4R68A 4Y9TA 3ICPA 2X77A 3OZGA 2PSSA 1VMEA 1P8AA 1TX4B 3EB9A 4UTRA 2NPFA 1E1RA 1S2DA 2CKMA 2IV7A 4MXDA 1U2QA 4ND7A 5P8WA 1R6DA 4HB0A 1ZKDA 4DMRA 4IKOA 4Z49A 3CLSC 5ITWA 3KVRA 5JSQA 4QREA 4FDLA 1ZISA 3I0MA 1WJGA 4ZOLF 5DOZA 2C5FA 3GCZA 1XLVA 3KOXA 4AO8A 2Y1GA 4P08A 3HZHA 4JGIA 4G0VA 3GT3A 3LIIA 4WY2A 2YV4A 4O5AA 4B4DA 5D2CA 3T9CA 1K08A 2DH5A 5AKEA 3THWA 3H18A 2GXSA 3LLSA 3WQHA 2CLHB 3TW8A 4AO6A 2XH8A 3IEUA 1JDZA 1Z5WA 2C9BA 2NUPA 2QJTA 2QKYA 2ZRIA 4FFOA 2XTMA 2XSZD 3RS3A 5DYGA 1ZIDA 1E0DA 2DBYA 2EC5A 4F3YA 2J9YB 4LOLA 5JHHB 5A1JA 5IAGA 2VAMA 1KXZA 1G3RA 2BFEB 2IVZA 1JSLA 2WZDA 3K09C 4KDRA 4UJ3A 4UUAA 1TZMA 4MUAA 1ZQ9A 3BDAA 3VOBA 5A5DA 5BRAA 1N5MA 1ZZ6A 5LL6P 1UT5A 2FN8A 1KFBB 2ZWVA 2I65A 4N39A 4QGAA 3L8DA 4OXRA 1RRMA 2JFBA 5ALMA 1PL8A 5FX2A 1W36D 1W4RA 1X7ZB 2ZBUA 4OOEA 4XIJA 5GADl 1WMAA 1KZHA 3UHOA 3ZHMA 5U4XA 5LXTB 4QXQA 3GRFA 3SWWA 1ZGJA 4DNQA 4WXHA 2QIPA 1FTWA 2OBFA 2BCGY 2BKXA 1XCMA 2MSEB 1P0CA 2P1ZA 2HMTA 4YMIA 3ZGOA 1U7HA 2R5WA 4AJHA 4H27A 1G42A 1QNLA 2D2EA 1Z0FA 4KGXA 1UL1X 1JFSA 4PCVA 2ZS7A 1I2MA 1WCWA 2PUDA 1TQ2A 4O4HF 5AK6A 1WD7A 1M6VB 1ZA2A 3R75A 4M88A 3U61B 2GUGA 3I1JA 4P7BA 1X1TA 4EM6A 3UJHA 2OFPA 3H1TA 3NBAA 2Q7DA 4E11A 1Z5PA 2E2WA 2B3TA 1GEEA 1OZ0A 4NV0A 2AYZA 3LDAA 5B58T 1RE1A 1E8NA 3GVXA 3L8ZA 4KDFA 3HSYA 3SF8B 4YJDA 1OX4B 3ED1A 2OO5C 4JQZA 4QLAA 4R8KA 1OH8A 3BJZA 5CT4A 1EEXB 1GNRA 2QUZA 1OV6A 1T4MA 4MRPA 4W8GA 4AS2A 3V7NA 4PWZA 3OP4A 2B1JA 2Y27A 5KYXA 2PCJA 4QA9A 3RJ9A 1ZYUA 2HIGA 3MJFA 1SXQA 3MTBA 3NJ8A 2LGJA 4Q5IA 3AR8A 4B7AA 2X19A 1M0TA 2PRZA 3DE5X 2BIFA 2Q4BA 3DLPX 1G5QA 1YHZA 2O23A 1CZLA 2SNIE 1ULHA 3QYPA 4M1KA 1NJ1A 4WEOA 4FI3F 4JI3B 3ZWYA 1YZ3A 2DAPA 5BNWA 5JCJA 4GPBA 1K0FA 2C58A 1R37A 3U31A 2QTZA 4MLCA 4BO7A 3P1JA 4Z4HA 1E2HA 4MUKA 4OHYA 1V3UA 5AFSA 2ZYWX 3HUUA 3PR3A 5M34A 4WW0A 1JR3A 1Z2OX 2OCYC 3QE9Y 1JDBC 1KI8A 2BFAA 1O94A 4F21A 4HDKA 1U80A 3D0QA 1XU9A 4IX1A 4RS3A 3WWDA 3KLMX 1Y9ZA 2H59A 5JYBA 2ORYA 2OR3A 1KSFX 3AH8A 3ANYB 1IG3A 2R7MA 1T29A 2DP4E 3HN7A 4I8DA 1WPQA 2GVDC 4KQ6A 4RKFA 2R1VB 5SY9A 3KKMA 4M8LA 3THSA 1ZK0A 2RAUA 2YWJA 3QOFA 3M34A 3DOHA 4XCVA 1JVSA 5A4IS 4UDOA 1X1QA 5KDLA 3QKIA 1CDOA 2AD1A 3GNSA 1U3GA 2II6A 1E92A 1E5TA 1G20B 4UREA 3ETHA 1ORVA 1KHTA 3I6BA 4IIHA 5JDIC 2EX1A 1I6KA 2ZSJA 2Q0SA 2WAYA 3DONA 4JP2A 5JE8A 1T9HA 4AZVA 4JBHA 2HRBA 1LF5A 4H77A 4Q39A 3ROMA 4BVHA 2Q8NA 1Q44A 3CISA 3CZPA 3EYWA 3SHWA 3KVNA 2MSDB 1LWOA 4BVLA 4ENWA 5KNBH 5HQTA 1P5RA 4IRMA 3V8BA 1MGOA 4JJAA 1REQA 2NO0A 3DLIA 3W8RA 3CRMA 3U37A 3VC2A 5BWMA 3AK4A 4D4MA 1F4PA 2XWJI 4JI0B 3PGA1 5ADUS 3NIWA 4MYTA 2I9KA 2W2QA 5GIOE 3S2FA 1NDUA 1Y7PA 1DBPA 4EW1A 1NSFA 7MHTA 3O2NA 5B36A 4EW2A 3KUKA 4ZAVA 1FQWA 2J7KA 3BFJA 2J3DA 2RH9B 3ELUA 3I4CA 2WJPA 3EE6A 4GZ5A 5FL7D 2A0YA 1B14A 1TTTA 2OO3A 1X80B 4LHYA 4J0HA 2JFFA 2HK7A 2WV9A 2AC7A 4IH9A 3PC2A 3DFFA 5FBHA 4YWJA 3TVYA 3ZV5A 4RHXA 2VZ0A 1E5QA 4ZALA 5FAKA 3BHJA 4C89A 1WH6A 3Q0TA 1H0HA 4L0QA 3EGWA 4FR2A 1UT6A 1FW8A 5CM9C 1CT9A 4DLZA 2HY7A 1NLFA 2Q6VA 3ONFA 1FQJA 1RXSA 2JCBA 3QU4A 4AKGA 3RRFA 4Y2JA 3EDQA 2PUAA 2W42A 1UODA 1Y9AA 1IXKA 2JGFA 1YZYA 1FNDA 2CLEB 3R40A 4DR3B 1EGVB 2IZ6A 1X2EA 2NTYC 4P33A 1YHNA 3SC3A 3DTTA 4KFCA 2PXAA 5D3ZA 5LBTA 1R00A 2IXTA 1F20A 2GEBA 3ZXSA 2VZ9A 4YAOA 2HBQA 3B38A 3DBIA 4W1SA 5GAGi 1KVSA 5IMSA 4FYWA 2MEZA 2ZB4A 2E49A 2ZRMA 3C3MA 3UO8B 2R63A 1W49A 2O2ZA 3WLPA 3ZDXB 4UATA 1SQFA 4R69A 3RVDA 3TOSA 1T0JB 2Z2YA 4MPRA 5E7IA 4TL7A 5KX5B 4UFOA 1SBCA 4DDMA 1T36B 1EDZA 1YS6A 1N5RA 3A1FA 3K2IA 4CV1A 4PBRA 1OX5A 3PNQA 5BUCA 2CHFA 2AOXA 4JSTA 1CEYA 4N82A 3MOSA 3GMDA 4ZHSA 1TZBA 4H1VA 4JI6B 2C03A 2JPDA 3UFBA 5J2UF 2H4ZA 1LRJA 4M0UA 4K9OA 2GN4A 4JJ6A 1PFWA 2R8ZA 2YTZA 2XUQA 1YAHA 4P86A 3RT9A 1OYVA 2CV1A 4LJKA 4B9AA 1HOXA 1ZC3A 1AS2A 2XI4A 3A2NA 4UNNA 3WNVA 5CIWA 1NIPA 1XIVA 4X1IA 4EG0A 1B76A 2OM6A 5AJTA 4ZVQA 1IAQA 2BKVA 4ZVOA 2JGJA 3HR8A 2WJHA 3D3NA 2GMWA 2H8RA 1E7MA 1Z34A 1B0NA 4EWLA 3T9FA 4JITA 5EKUA 2BGWA 5F1PA 5LBUA 2AUTA 2X7XA 4L57A 5AI5A 1BFUA 2AXPA 3DUFB 4TZTA 4BN5A 4TWIA 2X5KO 4A8JA 1KR5A 2R6GA 2R66A 4RULA 4KKXB 4D1YA 4GLJA 1QH1A 5A71A 5K4GA 3HKEA 1QCCA 3CX7A 4QDOA 2N9UA 1NMYA 3PF9A 1WQ4A 4MJLA 5DVZA 2GCEA 4YY3B 4CQMB 1I33A 3HB1A 5HFJA 3CLTC 1P73A 4JGGA 1DJNA 3NRCA 2DLDA 3RFXA 5CA0B 1YS7A 2QR5A 1CQIB 2R48A 2BELA 3LU1A 4WHMA 4X0EA 3B3JA 4NKRA 4QQRA 3RU9A 4ZQEA 5BSTA 1ENYA 3IAEA 4KOAA 2VHCA 4DQVA 2ZS9A 4WLUA 3W3ZB 1G64A 2A5GA 3O9XA 2YY6A 3FKSD 1WIZA 3OOJA 4IHJA 4M0LA 1Q16A 2FW7A 2PX8A 3SCFA 2WM3A 4TPKA 5H83A 2I4RA 3T5PA 3G8DA 2ASVA 4CL3A 3RODA 3S55A 3W9UA 3WWZA 5K0SA 3EJWA 3NGLA 1C3OA 2WG0A 4YG4A 4Q7QA 4HH3C 2VTBA 1AHHA 5HDBB 4ZU3A 3P0RA 2XWSA 4JGBA 4WN3A 4XM0A 1VA4A 4D56A 2Q5IA 5EWJB 2PKWA 1Y4UA 3GJ7A 5DBHX 1RHQA 1XZ8A 3FIJA 1ZVMA 3LYLA 5CCBA 3M6XA 2C42A 1B7GO 4RA9B 1UJ2A 3LAWA 5EJ4A 2MIIA 1X7XB 4RXUA 1EUYA 3RE1A 1EVKA 1J8QA 4XD2A 3OX2A 2EFHB 5FA5A 4DS3A 1MAHA 3F90A 3ECAA 4G0NA 1ETHA 1H4SA 4MAFA 3FPKA 3IUQA 3K73O 1DC3A 1SWVA 1OFUA 2CLKB 2R1UA 4XWGA 1Z5GA 2ZYAA 4A9AA 2GN9A 5TY0A 4CIAA 5E9WA 3SBOA 3FGOA 1JR2A 3GG2A 3JY6A 4I9GA 4ZIRB 1J0XO 3ITDA 4WOBA 2HA5A 4B82A 2I3BA 4GR5A 4DWJA 3T0FA 3DR5A 1DO8A 5D85A 1YBFA 1U2GA 5LZ7A 2VYQA 1NYQA 3K8QA 3T4EA 5FLKA 2QMHA 4PFQA 2C1ZA 3QELA 5CH8A 3D1VA 1BQEA 1P0IA 3OE7D 4G81A 1U4SA 4W8OA 4HTFA 4ZI7A 2JFOA 4YMWA 1I0ZA 5TJHA 2XSDC 1B8OA 2LNMA 1Q95A 2WQZA 2ZQ5A 3HCWA 3UQZA 3T4UA 4DLYA 1AKRA 5L4SA 3VO2A 3TMAA 2AWNA 4DB2A 2AS0A 4QOSA 1BU8A 2PNJA 1GNVA 2VATA 1KA9H 4L0DA 4Q7LA 1CNEA 3SC2A 5I7FA 2REQA 3S1SA 3ILXA 2VQEB 3AL0C 2X22A 3O3CA 3G2QA 1NJ2A 3KSRA 4X24A 4CLRA 1O87A 3BD9A 1MRNA 2I4OA 3EZXA 3GOHA 5LB4A 2WTXA 4GBED 1Z0SA 1POUA 2ONYA 4KJXA 1EGQA 1SBZA 1KMIY 2O2HA 4K6MA 2AF3C 2PVPA 5AICA 3EOZA 3X1JA 1E7YA 1S5PA 1XD2B 3AKZA 1FBNA 1A4XA 1IY2A 3OKFA 3UC5A 3H99A 2I6TA 2HTEA 4BX9A 2NPOA 3ZCXA 4CI0B 4UOEA 4J7UA 1UXJA 1FFYA 4OGWA 5ELLA 3NT2A 3MT9A 3RS8A 2C8KA 1P5FA 3OZSA 3VSAA 2PBZA 3LBIA 1KOGA 3ETJA 2CJWB 2GTIA 3JSXA 5FUYA 1Z9BA 4AZSA 1JR6A 4Q3KA 4E31A 1C7EA 4B3MB 3MHTA 2FRXA 1SHKA 3ZEIA 2J67A 1KP9A 2OG2A 3LC0A 3TLEA 3VJMA 1VFPA 3ORFA 3JQAB 3TRIA 3DDZX 5AQEA 5AHOA 1HFKA 4CMJA 1BVYF 3EC2A 4MUMA 3KP1A 4REMA 4BXOB 3I62A 5C8XA 4EG7A 1OAAA 2VAXA 2XECA 3E7PA 2ZJOA 4KNVA 3CEMA 2B7CA 3JATA 4OLJA 3SLGA 2FXIA 4WESA 5KZMB 4WY5A 1J2UA 1ESZA 2D5IA 2BGGA 3PNMA 4M9XA 5ERXA 1GAEO 5KOYA 3NAMA 5B6IA 2YJ5A 2GCNA 2J4FA 4HF7A 3V1UA 4OHRA 4CMBA 3B5EA 3EXHA 1BDHA 2VDVE 3ITNA 5ES3A 3C1AA 1DKUA 3IO5A 3RBZA 2RJOA 3B1FA 4GE3A 2XMCA 2Q6LA 3B6MA 3EZ7A 1C3VA 1AZWA 2HRDA 3AEUB 4NYIR 5DPMA 2DSTA 3H5VA 3WGVA 1ND5A 2WJJA 4MWBA 3ZXUB 3MJVA 2PMWB 2J30A 1ZITA 3BRSA 1BHQ1 3CKMA 2QM0A 2EU8A 3I9MA 1N5IA 3L7YA 3M49A 4FILA 4KZPA 4QE3A 5EPOA 4AKEA 5HKOA 4HL6A 4D98A 4I50F 3BPSA 5IBRA 3LCCA 4HK4A 5BNZA 3FF4A 2Z5LA 3CNOA 3KJEA 4LYEA 1BMQA 1TA4A 3THXB 4IIYA 4OA5A 1FLNA 4DCJA 1H1LA 3QKTA 4HGYA 2CK3A 1HDZA 4N7MA 3ROXA 1B4DA 2ZAMA 5SZKB 5BR8B 5KTSA 3GJZA 4RIHA 4WA7A 2XNJA 3C5WP 1U6JA 4MUXA 4PPNA 5B12A 1PEKE 2L1PA 1J8VA 4RZ3A 5JXIA 3DDCA 3GLSA 2V3WA 2R7LA 4L4UA 4CFYA 3H2YA 3GP3A 1AGPA 1PT6A 1YR7A 1DNPA 2FPPA 3VAZA 2DT8A 4UAJA 2FNAA 2Q4OA 5KQLA 3FYHA 2XUAA 5ICSA 3BWVA 3C85A 4CKYA 4AQDA 5BWBA 4XQ0A 3TJMA 4EMTA 2QRPA 1BJRE 3DE6X 3SEZA 2JLUA 5IDWA 3TD6A 3UA4A 4MKFA 1OI2A 4INJA 4CFSA 2ZRPA 4NBWA 4MX8A 4O2AB 1LI4A 4N0DA 4DNXA 2ZPUA 5KPDA 4LYYA 3VI4B 4BJHB 3W79A 2CHVA 2D3WA 1BO6A 2BY4A 5J5AA 4FJ2A 2WJIA 1RQPA 3BMQB 1DFGA 2FPLA 4M55A 3BERA 4N7BA 3GNLA 2EV9A 4QTYA 1YR1A 4BPBA 4MCHA 1ULTA 4FYXA 4M1TA 2C2YA 1JP7A 3AVVA 3G5MA 5FOSA 1ZN9A 4FW9A 3T3PB 2RG7A 3ZHXA 2G6TA 3JXBC 1Z2NX 3WL4A 1QFXA 2FZLA 4OB8A 3WB1A 1OQAA 1V4VA 1MF7A 3DL4A 4IINA 1Z4IA 1Y6RA 5DMXA 3AV0B 3K70C 1E3SA 4MW2A 3OT4A 1NW6A 1CQWA 1KS9A 1QG2A 3NWPA 2W90A 2QAGB 4UHDA 4RF5A 3WLMA 4AJIA 4D43A 2CUZA 2PVSA 2VHZA 4UMDA 4PGMA 4GOMD 4FDAA 4A2WA 5HRAA 3ZD7A 1ISIA 1V45E 3WKDA 2WJGA 2P2LA 3A9ZA 3KO8A 1B15A 4ZCSA 3TLZA 10MHA 4NCXA 1CIJA 3C4JA 1V1MA 3OE5A 4K8OA 4XEUA 4Y6SA 1K6XA 4HO1X 1IMOA 4Z6KA 2M1ZA 3B5IA 1APBA 1W4ZA 1JAIA 3BXPA 2C20A 1DO0A 2XIUA 1X80A 3GEIA 4DWOA 1C1XB 3VDXA 3RYCA 1QUFA 3DE1X 1ZD9A 2DTEA 3OM9A 1Q74A 4OX9B 1NUQA 4GVXA 4JEMA 5IVPA 5K8JB 1UMKA 4P92A 4HGZA 4Y9RA 5FI0B 2QG6A 4MYRA 1EXVA 3OHSX 3M1YA 2VJBA 1VG8A 4MW6A 4II3A 1ODLA 4NBSA 3SX4A 4Y9UA 1E9RA 2A0XA 3VR4A 3FPSA 2EWMA 1HORA 2WHXA 3KLPX 4G0OA 4YQZA 5JCXA 3U3OA 5C35A 2ZCVA 4KP7A 3VZPA 3BS3A 3ZDZB 1YZHA 3AUKA 3ABSB 3PTZA 4PX2A 2P5SA 1X74A 3L4BC 2H7VA 1M2GA 2BRUC 1JWBB 4KIWA 1Z4LA 4Q4DA 1E0KA 3KSAC 1VLJA 5JCJD 3BE8A 1S7EA 3PFBA 1U5AA 2X0NA 1XJQA 4TKVB 4FS8A 1L8LA 3IQFA 3DOIA 4INOA 2XCTB 1XROA 4DCSA 5IVIA 1GAJA 5EJIA 2YZNA 4EDFA 1ESEA 2WVAA 3VWSA 1Y89A 3GJ4A 3WNCA 4BO9A 3WI7A 1UFKA 2C95A 4BNFA 4D9KA 5AJYA 2A6PA 1O9BA 2YYZA 4K86A 4URXR 1E2JA 2YV3A 4DYHA 1EK2A 1YQGA 2FR1A 1XVAA 3BB3A 2OB1A 3CLUD 3E6AA 3ADCA 2GK6A 2R25B 1FP4B 2WIBA 2H2FA 4DLKA 1PJBA 3WQQA 1X19A 1AF7A 4RY0A 5IABA 2E82A 1LCIA 1P3JA 1M2OB 2C77A 1UBTS 4OXXA 3SSAA 2C83A 3I76A 1DC7A 5EJ5A 1G18A 4JVSB 4BYGA 3PD0A 4ZQBA 1F14A 4XVQA 4ZDKA 5K3FB 5JNRA 2ICAA 3G23A 2VSFA 2CJPA 1CF9A 2HNAA 2LIPA 2RFLA 3JWHA 1O94C 1W88B 3NWEA 1FNSA 4I9UA 1HRDA 1V9LA 2WWIA 1ZMOA 2A7QA 3IAS6 3R09A 1ISSA 2TRSB 3EGCA 4GEGA 3MCAA 3KM0A 3GT0A 1YACA 3GNTA 2CL6X 4ER7A 5KJ6A 5F3WB 4Q4JA 5DSXA 1NF8A 1DKPA 2WAOA 1HLFA 3KUUA 3KYIB 4JJ4A 1ARZA 3VKVA 3OQNA 4MKHA 1XVVA 3SFVA 4REOA 1ZIYA 2YOGA 1TJ4A 3C3XA 1S89A 3O8RA 3CNHA 5F9HA 4QNNA 3MAGA 1XQ6A 2O2EA 4EL0A 4NDWA 3WLJA 5J4LA 3B2NA 2H9IA 3QWFA 2P3LA 4YG1A 2G9RA 2IOYA 3A05A 1NSTA 2WAXA 4DCVA 1KZ6A 2RKOA 2WSLA 4O4HA 3DWEX 1EP2B 1L4MA 3FFBA 3AR7A 4HDNA 5JJCA 1VHJA 3EYAA 1PYDA 4JENA 3SF8A 1S8AA 1PWXA 2VOEA 1JJVA 3DZDA 1B6RA 3WL6A 4R2IA 4XQCA 5K8TA 1JSCA 4L5CA 5AUPB 1XTBA 2N1MA 1HNXB 2RKBA 2NO6A 2EF0A 4U8HA 4YYZA 3ZZUA 1A5BB 1RAAA 4LZJA 4MGYR 1RHMA 5K0ZA 2XE8A 3G2PA 3R3SA 4MULA 2K2QB 3U81A 4ZI2A 3NHZA 1THTA 3BK7A 5C32A 3VISA 1KFJB 3ZGYA 1MJ5A 8GPBA 1CBUA 4LF9B 1DWQA 3ZNOA 4F3RA 1NBMA 2GH1A 5DSTA 4CKXA 3NHJA 5LP1A 2FVYA 4Z4QA 1E69A 1R50A 1XWFA 2D59A 3AUSA 4G5XA 5IFKA 3ZHYA 2FEWB 1TO2E 3I01M 2CNLA 3GZDC 1U0JA 3OCZA 4NESA 3M3HA 4GWLA 5JNLA 1RYZA 4IIGA 4R5HA 4ZI5A 2OC9A 4KHZA 1UK7A 1XRJA 4OHMA 1GKLA 3ABIA 1CEXA 4MA5A 2G08A 4KACA 2JHAA 2PKRA 2VPYA 4PLGA 4AYWA 1J25A 4UNIA 1M66A 3AY7A 3QUQA 1FU7A 2B4TO 3UUEA 4BFCA 2CXNA 5D3MB 3HVRA 3R24A 3LHDA 4BJ1A 3HO6A 4LJ9A 3QUAA 3NPAA 1XZJA 2D0OB 1CF2O 2WW8A 2ZR9A 3OPMA 4FUTA 2AR7A 3FNIA 1MB2A 4IDQA 5CH3A 2A5DA 3IJPA 4KE7A 3OD5A 1GPBA 2J07A 2IWRA 4MWOA 5HZMA 4G9BA 1U28C 3KYDA 2PSHA 4PAMA 4EVSA 1UAAA 2PL3A 2WSIA 1BOFA 2ERXA 3AQIA 3H3XA 4I6RA 1D1QA 2YWEA 3EZLA 4IQ8A 3QVVA 4D42A 1HE5A 3UNXA 4EPRA 3B2QA 1BXRA 2XB4A 3JYHA 4ESHA 4ZI7B 3N53A 5ARBA 4LRWA 5JC8A 3SJAA 4YB8A 1ILWA 3PNYA 2P9GA 5AVTA 3GMSA 4HT3B 4B0PA 4PSCA 2G25A 4A0FA 1DELA 3ZTWA 2PL9A 4JASB 3IYLW 5LP6B 4ENTA 3CFYA 1QIJA 1Z0IA 2RGXA 3M3PA 1YF3A 1E0AA 4PVDA 1LU9A 1H5NA 1CUVA 3HB4X 3KOMA 1HSZA 2RDMA 1EM8A 3A2LA 2ZE6A 2C4HA 1WUTA 3A4YA 4V2UA 2IKSA 3PE5A 3WMWA 4Q7KA 4D81A 3KD3A 2VBGA 4FX5A 4WNAA 3K1AA 1IJKA 5C52B 4G97A 4HKTA 3N05A 3SLRA 3THYA 2B5AA 3DZHA 2NN3C 2BTEA 3ESXA 2AK2A 1EWVA 2RAFA 1CTQA 4QEZA 3TE6A 3RHFA 4JOBA 4G0QA 3EG9A 3IJRA 4KWIA 2BUAA 2B8WA 4PX3A 1FS5A 3WGZA 1ZM4A 4R54A 3E22A 2YFHA 3BSWA 3CEAA 1G8AA 3JQAA 2IPLA 4X4GA 4MVJF 2XIQA 2B21A 4LJLA 4ABTA 1BCSA 2SECE 2CFCA 3CPSA 3Q6NA 2OK8A 3PTLA 1TCVA 4CLEA 1CJKC 3PFCA 5AHXA 3JQAD 3PC3A 4FGLA 3CLSD 4TXNA 4A16A 3R3ZA 1VZ2A 1YB7A 3SX2A 1S4MA 2VHQA 1LDMA 3JTMA 5AW7A 1LLDA 2GF2A 1QGAA 4OKNA 4RSGA 5KWJA 5G3ZA 4LPKA 3H4IA 3ZTTA 4R3WA 2VQDA 3COJA 16PKA 2Q46A 1TYAE 1JG2A 1PK7A 2QX8A 1Y4SA 5DI3B 4EHBA 1Z4JA 1GM5A 3GJ3A 3K8OE 3HJBA 1CX9B 1MV5A 1MW9X 1T15A 4G8CA 1FL9A 2PWAA 4Z3OA 5TVKA 1Y3HA 4IIJB 3H3JA 4DFDA 4RVDA 5EJMA 4I1PA 2RGCA 2DBRA 3RUPA 4E3ZA 1UBNA 1QUEA 2EZTA 4NOKA 1IXYA 1MOSA 2D1YA 2YRWA 4GPIB 1XAGA 1JDVA 4RLQA 3DVRX 1DADA 2CYCA 4GPD1 1SUAA 1K9SA 5BP7A 1EA7A 4Z1MA 2Y0CA 2Y4OA 1DXYA 5FWYB 3AR4A 5LMUB 4NBNA 1P0QA 3FHLA 1KARA 1XMIA 2IDJA 2RHRA 3OA2A 1B8PA 3QHPA 4JJKA 4ND8B 4C7OA 2GJSA 1NL3A 3FBGA 3JV7A 3K16A 3LCJA 5J9FA 5I7HA 1QX4A 4O3FA 5BY2A 5G4KB 2ZIWB 4M1EA 4NYMR 5B2FA 3ZPXA 1A5ZA 1NXVA 1YH3A 2WT4A 4PPGA 2H06A 3W5UA 4XXHA 1Q91A 4PCUA 1R69A 5KTMA 3PPWA 4YLGA 5G0WA 3H8JA 4CG0A 1YT5A 3ET4A 4M54A 3L6CA 5AD1A 2ODPA 2LRHA 3A0UA 4E2FA 1G5RA 1KORA 3GUCA 5B6PA 5F2NA 4Z9FA 4BNZA 1UJMA 2R96A 3DEHA 2XI8A 4AG6A 1F7UA 4C3VA 1O8BA 4CJXA 4EFKA 2KB0A 1NV9A 1AT1A 1UF9A 3IHTA 2QX9A 3ND6A 3OOSA 2R65A 4J4TA 3R5TA 5LXTA 2OXRA 3E35A 1ZXXA 4TWJA 2P3SA 1TK2A 1GGFA 3GMIA 1HEYA 4U2DA 2I4IA 5LJLA 1B23P 2O7NA 4GHWA 2PRJA 3FTQA 3HG7A 3D31A 1MB3A 4BWGA 1XZDA 1RSZA 2IYQA 4BAZA 3KXKA 1EP3B 2OOSA 1QHXA 5FL7A 1H9CA 3S2YA 2LYQA 2BZ1A 4DG9A 1X7HA 1IM2A 3QWHA 3LDUA 5EIFA 2FH5B 4DTIA 3H04A 4ENRA 3QW2A 1RVV1 2D3TA 3EGDB 3O4JA 2C7PA 2IV2X 3KOUA 4FYKA 1NQ5A 2I71A 4YAUA 2YC4C 1K8RA 2WE7A 4F71A 1KE1A 3N8KA 1GRNA 2COUA 5DYWA 4QYWA 4X85A 4EI7A 2AJBA 5AVWA 3DMTC 3TW8B 1CQXA 1O6BA 5HTOA 1MAAA 1A97A 1J1IA 1GYRA 1M7GA 1VTKA 4IDDA 4ITRC 3V8RA 2O57A 1C8LA 2P9YA 3PJDA 3B8HA 4MDEA 4MA4A 4ERXA 4TS9A 3LBHA 3RQSA 4EB0A 1IBKB 4GRDA 5EN4A 1H85A 1MP0A 1U0LA 1Z2AA 1M3SA 3FUWA 5E6SA 3H5NA 3ETEA 3LHKA 3LXXA 5KSYA 1E3MA 1G8PA 4P36A 2V55B 3Q6MA 1NYRA 3TNLA 4JYBA 3LPDA 4NU5A 2W2TA 3LC7O 2B6NA 4OBMA 1RWQA 2AW5A 1TVEA 1Z7WA 2ZIAA 3RYFA 1AMNA 4H3HB 2Q8PA 4HB2A 5K0NA 4IDHA 3OUUA 4ZV9A 1BGWA 2BMWA 1RJDA 4FWBA 3V8NA 3FYDA 5J2TB 1YS1X 2VRCD 1E1KA 5EIAA 4RTKA 2BSAA 2UAGA 4LHSA 1NXOA 4ZOAA 5IM5A 4A8HA 4YRNA 1PBNA 1KU6A 1E32A 1KEUA 1H4TA 5HCNA 4F7WA 5IULC 2J7UA 2CHEA 3RNLA 1J1ZA 2PS1A 1US8B 5DISB 2OCLA 3KOYA 2YIDA 2JZNA 3HKBB 4I3HA 1TNDA 1JDBB 1EKXA 3KTOA 2D00A 5JBNA 4CEHA 1S01A 1LPNA 2YZKA 2KHZA 3R3XA 2KYRA 3L1KA 3B9BA 2H8KA 2Y6VA 1UBFA 4P98A 1QQ6A 3D7SA 1B73A 2UYYA 3AG5A 4TS4A 4CM9A 3EEYA 1JTFA 1DHRA 5IDQA 4W6QA 3DOCA 1Y82A 4XAQA 1X1DA 2NOAA 1SUPA 4FYMA 3CU5A 1I1QB 4H3KB 4JBWA 4V0LA 4E2YA 1HLDA 4YLYA 3IP9A 2BFNA 1U94A 2FETA 1NUPA 4BMSA 3QFCA 2ZK7A 4TKUA 2I4LA 3CUEF 3WWPA 2G1PA 3IVRA 4ARCA 2HW8A 2OMKA 2N0SA 3PDHA 3T12A 3UOAB 3E05A 4YECA 1W88A 3KOZA 2N42A 2Q1UA 3S68A 4ED9A 4PSUA 1VL2A 2NWQA 3ASUA 3EZ9A 3W4JA 3CW2A 3BD1A 4MGIR 3MJRA 3N7AA 1XO1A 3ETGA 3JATB 4TMTA 4F1JA 2YOFA 2BF7A 1JKJA 2ZWIA 3IESA 2ZKLA 3N9IA 1ISRA 1FP7A 3IAM6 1FXWA 4W4TA 1QIKA 3T3HA 3U13A 2OT3B 1ZUD1 3Q9NA 1Z3IX 3CSUA 1AUOA 3EXHB 1V7PC 4QFMA 4YMUA 3KJNA 2W6ID 2D0IA 3MJTA 4GPAA 3C3PA 4IOLA 2QVBA 2EERA 4BFYA 3IBTA 3RC1A 1P9LA 3PKJA 2EZ4A 2QD4A 2E4VA 1XP5A 1KP2A 2G8NA 2WIGA 3CG0A 2XPCA 3W7AA 3KXAA 1GNQA 1GKIA 2B4RO 2W6IA 1ISHA 2O5VA 2Z5FA 3ENNA 4HAXA 4HAYA 2XGGA 3EXIA 4G63A 3SYNA 5BMVA 1F12A 1WG8A 3IC5A 4H4DA 4NENB 4RBNA 3ROFA 2Q21A 5ALRA 3W6PA 3LUGA 5F33A 1F17A 1Q11A 2EATA 5EIBD 4HPWA 5KBYA 3TUZC 4D9GA 4O02B 4V0RA 4HVTA 3C0KA 3KKPA 4F0JA 3AEQA 3NHSA 4LSMA 5CK4A 2AFIE 3VPHA 4ETMA 3U09A 1QG4A 1ZL0A 5FOVA 5FOWA 4WZAB 4DGSA 3ZWQA 2P0AA 4B4VA 2IKQA 1WKBA 2GFQA 4QTXA 2OPHA 4DV2B 4BB0A 4LVCA 3R7NA 1G21E 1SUSA 3U7HB 3CUKA 1W44A 5C34B 2V65A 1B26A 4UMVA 1QIMA 3IPLA 5FA6A 2C4WA 3ROGA 3INTA 1MD9A 4NAUA 5EWLA 2FZGA 3RIXA 1PZHA 2WYWA 3STYA 1IN4A 5CTJA 1F51E 1RYYA 3DQQA 3MN1A 1XXHE 2UUPA 4EABA 4HVCA 3ZWNA 2HUPA 4G9EA 4EKDA 1Z38A 1HLGA 2PQ0A 4JJFA 3NTLA 4XVCA 2TMKA 4CLOA 4DCUA 2OGTA 3C3KA 3NORA 1ZICA 2BFOA 4BUCA 4YV0A 2BJCA 1RRPA 5I45A 1H42A 4WE3A 4NCKA 1N7GA 2WBLC 3BMQA 1KEPA 4YJ2F 2HCBA 3SDBA 1WS6A 2EVWX 5DDIP 2QUKA 4ESEA 2B92A 2PUBA 1FDWA 3L8EA 4Y2PA 4ZPJA 5AVRA 1KEEA 1Y48E 3EISA 4YBAA 3BG5A 3FWZA 2YJ6A 3YASA 3W9SA 2BN4A 1KY3A 1VPLA 3F7MA 5F35A 3KZNA 5TPZA 2FDXA 3OZ7A 4RMGA 2B30A 4EYOA 1Q7BA 3WJ1A 1XFAA 5H3HA 4B33A 1XZGA 5EXEA 4ZVPA 5ANRB 3U62A 1XKXA 2GYVA 4IMPA 4QRDA 4DJ5X 1PW5A 2GK3A 2PXBA 4BKRA 1FFEA 4GLFA 4ARSA 5IZCA 2QPTA 1Z56C 1BA2A 1TVKA 4TN5A 2VCHA 2Y77A 4Z0TA 1T35A 2VRBA 4EG6A 1X7DA 4C3ZA 3AHFA 4O5OA 5JW6A 1MDBA 2FX3A 1JEOA 5EJ6A 4BVGA 3EXFA 3EVTA 4C43A 3LUPA 1VECA 1JEJA 3KTAA 1IEWA 4DJFC 2QE6A 3OPYA 2PLRA 2J5KA 3EGXA 4NDNE 5A5EA 3G0TA 2GERA 2WD7A 3U4QA 2Q9AA 3ELWA 3GHYA 3F96A 4HS4A 2CUNA 3L02A 3OZAA 1N4AA 3RF6A 3RSZA 3GLHA 4M0EA 3IP6A 1Q83A 3GLKA 1HTBA 3VTFA 4L8VA 1T8PA 2O7VA 1PNTA 3ANSA 1RBZA 3B7HA 3VU0A 2AJDA 2VTBB 3PGKA 4JBGA 4XTCS 4KJZA 4ZVUA 3DQZA 2RGUA 4BLVA 4U7GA 2XVMA 4ZTUB 1XTPA 2FMIA 5FOXA 1XZCA 4N5IX 2BGJA 2ONKA 4Q1CA 3X3HA 2MSKA 3OOWA 1JWLA 3Q11A 2H1HA 2OZEA 1T34A 3P0JA 4KQHA 3S0JA 5B55A 5HKAA 1W30A 2P11A 3GQBB 5B2ZA 2WVGA 4WUTA 3IDFA 2GFHA 4AF7A 5IWCA 1YK1A 2C4MA 3H1PA 3N8DA 4MV5A 2MTBA 2OD9A 4FGKA 4DPLA 3KLOA 2JCVA 3MBKA 5JNUA 3I04A 3CZ4A 4R2KA 3KB1A 1Y5IA 5H3CA 4Z5HA 4FHZA 3EA0A 3LFPA 3QV1A 3R7WB 4C4AA 5BYAA 3FYAA 1HNWB 1JN0A 3OQ1A 5KVCA 2DFKB 2FDCA 4BCCA 3K70B 2VHUA 2WFMA 1QGED 3I23A 5IC5A 4M9ZA 3PYMA 1W47A 3BHIA 1SO8A 3E1GA 5K3FA 3V97A 4YN3A 2JKZA 4ZD6A 1TZJA 2MHCA 4RQTA 2VP2A 4V3CA 2RAVA 3WJAA 4L3VA 3HJGA 4ECAA 1TAUA 1WNTA 2NTJA 4W63A 1WXWA 1YJ5A 4ZO8A 2B7LA 1L4NA 4S1NA 4ZCLA 3VPXA 4DV6B 4M21A 1UZUA 2XYPA 1NI5A 4JL8A 1PK9A 2JS7A 3V46A 2DGDA 4Q4HA 2BH2A 4D3SA 5KWEA 1LBHA 1NNSA 3D2BA 5MN5A 2ZDHA 3BVPA 4WASA 4E5MA 3F78A 2W4MA 3ROKA 4O2BB 3TD9A 5ICGA 2Q6OA 4E08A 1LNQA 3ISVA 1WHSA 5F9MA 4EHKA 1IVSA 4F4DA 4RJKA 5J4KA 1UP4A 4K0KB 1D2GA 3L77A 3HB7A 4CKZA 3Q3IA 4MWZA 4Y8VA 1C1DB 3LPLA 4U7HA 2ZT6A 3PSHA 2E4ZA 1J0AA 1YZUA 1T5DX 3JCZA 2WKWA 4RZ2A 2WILA 4P7KA 3MLBA 1T5TA 3L7OA 2WY2D 1KVTA 4DIKA 2E6UX 3LQFA 4N4AA 4EF6A 1H8HA 1E3JA 1PG2A 4M7PA 5KVAA 3M6UA 3SBXA 3A37A 4IJUA 3F73A 1P17A 4UCQA 3LUDA 4TTIA 3FNRA 4WXMA 2X3UA 1PS8A 1PLJA 2PIJA 3W3AA 5HK8A 4BXOA 4WK2B 2QTVA 2DXIA 5G2OA 4IDAA 1IWOA 1YZGA 3NC1C 3VPGA 5MN6A 2AHRA 2QI9C 1HUQA 4EEKA 1JEQA 4QL3A 3VOSA 4FINA 2UYQA 4NDZA 5AVQA 1AJEA 2BBOA 1EIZA 2PZFA 2VDLB 4FR5A 1G8JA 1ZRMA 4FEYA 4LI0A 3RYHA 1IUKA 1XJ0A 2OLKA 3IUNA 3EK2A 1JEYA 5DEOA 1VC2A 5DLYA 4F91B 1ZUWA 3CLKA 2ZIFA 4LV5B 1CY4A 4MLPA 4C05A 2I1WA 2PS3A 1BVHA 1KBZA 3FNQA 3H9BA 1OLXB 5D84A 3U7RA 5L3SA 3J81A 4TKVA 2IHUA 4KH0A 1NQTA 1SVNA 3AZOA 2JFPA 3RSFA 3WG9A 4LOKA 2O59A 3OURA 3UWSA 1VBMA 1R10A 2Y0BA 1NBIA 4O6VA 3TFOA 4L5BA 4WADA 1O0SA 3WGQA 1SUFA 1E2IA 3BF7A 4AIIA 4QUIA 3MIZA 4V0SA 1XZEA 5HKLA 2WIAA 4FOOA 3AM4A 2O8DB 3IPXA 4J43A 3TTXA 3TTWA 3R6GA 4RO0A 4DVGA 2AWOA 4NEQA 4DWWA 4FE7A 3OQ6A 4DADA 3MUNA 1QAQA 2AXZA 2YIJA 3GRKA 2R87A 5HGJA 3AHIA 1GSAA 3BGOS 4HGPA 2PKQO 3IILA 5E6UB 5AVSA 4NOJA 1UC4B 1DRWA 3MS4A 1CFJA 1E98A 1E1CB 3GARA 2BBTA 3H8WA 2JAXA 1U5CA 2WR8A 1E77A 3I09A 2P4EA 5KS2A 1KK1A 1PWHA 2IS2A 2B25A 2HXGA 1QCYA 2JFGA 3W1VA 4F84A 1JG7A 2XYGA 3FFTA 1DWUA 1AV6A 1RABA 1JHAA 3J7TA 3TSZA 3D3JA 4JLMA 4Q9NA 2P2NA 3GZDA 1SVWA 1GAWA 3GX1A 1VL6A 1MAWA 3BN3A 4WESB 5DNEA 2Q50A 3HKBA 4OQFA 4HAOA 3RG8A 2VNJA 3K6SA 3Q41A 2VCEA 4NBUA 2OTCA 2EFJA 2PZKA 3LV8A 3PNPA 3Q9SA 5EZYA 1K8ZB 1D7AA 1QOPB 4NMMA 2YZ7A 2W00A 2ZZNA 4OQYA 3WC4A 3JRNA 2D1TA 4FFMA 3VK0A 3AMVA 1JX6A 3EUAA 2OE2A 3OZCA 5EKTA 5I9TA 1FFHA 2J1LA 1W36C 1SG6A 2B9VA 3BDIA 4JODA 4YUYA 5JHGB 4QC2A 3CZQA 2DKOA 3DPSA 2FMFA 4R0MA 3GDOA 1GN9A 3GZCA 2ACWA 3BBPA 1O95A 5IJ9A 2QNRA 4TX1A 5AVUA 4RCVA 1BHSA 1HRKA 3FE2A 3O1JC 2ZJ5A 2ZJ7A 1PD0A 4HD8A 3OJOA 4J1TC 5FUMA 3Q8LA 3MS2A 1P1FA 4MVJG 3ESZA 1MVNA 1TU0A 3VO9A 1VJTA 3A9XA 2DKNA 2COKA 4DF3A 1NFQA 1O08A 3W2TA 3W5DA 1A9XA 1YHYA 4NR0A 2WEKA 3E1SA 3B1YA 4QEDA 3E03A 4KXVA 1LTKA 3ZBTA 2BMAA 3EIUA 3BAFA 1UMDA 1E7SA 5IVKA 2FYTA 1TJ3A 2BE9A 5LQJA 3EPRA 1AB5A 2A1UB 4XM2A 3WYCA 1KJ8A 1XKTA 4LWPA 4OJNA 4PCLA 5GOZA 4PAGA 3TSYA 3T1YB 1GQRA 1P1HA 4OTZA 3QU7A 2Z9DA 3W1EA 4E32A 2H07A 4RTRA 2IYFA 3RSSA 4JT9A 4DVJA 2HFKA 2F1KA 4Z1OA 1DB3A 1Y7HA 2XLCA 3MMPA 2GNPA 2J41A 4UTVA 4F7DA 3JD4A 2DQ4A 3P7MA 1OXSC 3IT1A 1VYHA 4P54A 4C21A 1CE8A 3K0AB 1NKSA 1TVCA 1WW3A 2AQKA 2FWJA 2FR0A 3PCTA 4CIXA 3CX6A 4HPXB 5ECDA 3ORQA 1NN5A 3VVBA 3X44A 3DBLB 1T6ZA 4L15A 4Q9HA 5HILA 2FFRA 5CDUA 3DZIA 4P4SB 1GCUA 2GYWA 5GPBA 3PGLA 5AXDA 4GYYA 4WIAA 4JDPA 4LDQA 1LNSA 3CONA 2X5JO 1K8XB 2GEUA 2PKEA 2IEDA 3BWXA 2SHKA 5C5DA 4TMXA 1JFLA 2V9CA 4Q66C 4QDTA 2Z2IA 4GX5A 1N9KA 4AZ0A 1JR3E 3P0EA 2I55A 3OZBA 2ZIVB 4Z0PA 1NA5A 2I8AA 4WTOA 4C6RA 1Z4KA 4CIWA 1QRUA 2FK7A 3D8HA 3F49S 3FW1A 1YZKA 1P7YA 1Y1QA 5EWMA 1NVVR 5BW5A 2F3QA 2QENA 2BKUA 4FT2A 5CVTA 4C5AA 5BXQC 1VKZA 5CDGA 2H17A 2YMMA 2QD2A 2ZBQA 1P1BA 4B6GA 4YPFA 5GJBA 1KAOA 2XA1A 1J8MF 1GFZA 2WYHA 2Z5VA 4RA6B 3BEDA 3C15C 3M1IA 3G0BA 3N6VA 3QXGA 4KQXA 3IVXA 3UJPA 5C4MA 2FW0A 3G7NA 2TS1A 1Y7LA 5A3RA 1GILA 1OFTA 2Q0QA 1ZZGA 1E1QD 2OFYA 5JLJA 3DAHA 1JDTA 4QPZA 1YR3A 1DC8A 2FQ1A 1Y1LA 1RYEA 3QX7A 1ZVQA 1W87A 1Y6ZA 2C94A 5TMPA 5ITVA 3UPUA 3OM8A 3K2EA 8AT1A 4XWWA 4Z4EA 3X0DA 3HA3A 1ANKA 3LP6A 1D4FA 4DR6B 3AZQA 4PSDA 3Q7SA 1XI2A 1CERA 3C7KA 2I99A 3S7TA 4DSUA 4X6XA 3AYXB 2AMJA 3AERA 4WUVA 3JWJA 4F93B 2J9XB 5H0IA 3RIMA 3OIVA 3FTFA 1NPTO 5KNCH 1NNEA 3VI3B 3MQ2A 2OGZA 4GEKA 4IMIB 4AT1A 3D3QA 3H5AA 3O8DA 3OIWA 4LW8A 4BNJA 5FOUA 3I8SA 4A0GA 2NTVA 2VJPA 1H94A 4C01A 4OMCA 5DIFA 2DWUA 1DAOA 2OPBA 2H51A 2XMDA 3OCXA 4G09A 3FA2A 1X6VA 3Q3CA 4IS3A 1E20A 1V4BA 4LVOA 2TMYA 1CNFA 4PQGA 1GAXA 4Z5XA 2V7EA 2QN7A 2CWDA 2GZRA 1M6HA 5JPIA 3F5FA 3IQEA 2DKFA 1R8JA 4PE5B 4AD8A 2RC5A 3O82A 4HDQB 1XQ9A 4I6UA 1ZLXA 2HI0A 2TYSB 5DV9A 1J23A 2WHPA 4DV3B 1Q0TA 4UHKA 3RGWS 2BSQA 4AY2A 4MGKR 2CXRA 1U7XA 4BTLA 1MO6A 3R3JA 1PX0A 3RS5A 2AQHA 3BH0A 4DR2B 2QN1A 4UW9A 1GJRA 1JQ3A 3PFFA 1Y8AA 2WK1A 4XYEA 2ADMA 2EIHA 1F60A 3HYTA 2J9GA 5G4KA 4LRXA 5ALGA 3AHEA 2WUVA 4MRVA 4PC7A 1JXQA 4WPGA 3BAZA 3FYSA 3OZWA 1F38A 4BQEA 3ZWWA 3QVUA 2D54A 4AAYA 4OGFA 4K5QA 3UB2A 3W90A 4Z2YA 2CMHA 1RQNA 3PS9A 2IFTA 5BPHA 1MGPA 1RMYA 5LM3A 1YMVA 4IH1A 5JQGF 1WR8A 2VVTA 1JI3A 1EEHA 5L8VA 3ICEA 3IUMA 4TKUB 1PK8A 5DIZA 5F2KA 4YMHA 2PLWA 3SNKA 4UHBA 3A1UA 3SICE 2PIDA 1Q20A 3U4HA 1XJCA 4KODA 1RJ9B 4AN4A 3CM0A 1V5WA 4BMNA 1RYFA 5EGNA 4PHGA 2ID7A 5TT1A 2YS6A 4KN6A 4MW9A 4MW1A 2PPXA 4QGBA 3BIXA 3WIDA 4D9NA 1WZIA 2DZDA 4RWEA 2OYCA 1KDRA 1FJGB 1PYOA 3UWKA 1V5FA 3WGUA 2DWCA 3BGSA 4DLTA 1C0LA 1G3IA 3NVKI 4YV1A 1GNTA 4MP3A 3ZGNA 4Q00A 3RQIA 4CU2A 1N9GA 2VHVA 3NH6A 1G98A 2VXBA 3F97A 3PFHA 3D8NA 1A2BA 1N7IA 2ZJ1A 4R4JA 4BQNA 5CFPA 1YU9A 4JI4B 2HYIC 1E6EA 1H05A 3LDGA 3QVJA 5DLQC 4B09A 3OE7A 3ON5A 4OX9Y 2QNBA 3O8QA 1XLTC 4OATA 3VUFA 4OVKA 2IIBA 4AJ1A 3IVPA 2UZAA 3GLGB 1OLSB 1RKVA 2EP8A 1M6YA 2QHXA 1QB2A 1SC1A 3HNOA 3OTHA 5DWVA 3WNDA 3ZUPA 3ZW7A 3OJXA 4NOLA 4KPFC 4C29A 3IMKA 3W78A 2C8LA 721PA 4RTNA 1XZIA 5A7GA 4C6HA 5LKRA 5F4ZA 4X62B 1JALA 2OO5A 3QFRA 4GAEA 2YXPX 2PYIA 5FBRB 3WTCA 1P75A 3KE8A 2C84A 2HYDA 1QH0A 1QIHA 2RHJA 3LNCA 4MJ7A 1E4VA 1X86B 1KJJA 2QTVB 3NKFA 1A1SA 2CFTA 1KQPA 2HJRA 4WXRA 3MEQA 2ZJFA 2X0EA 1KOFA 1PGPA 3GI1A 2HXYA 3FYUC 3PUXA 4C20A 5CAEA 1VKJA 1VCOA 4HJRA 1A7UA 3K5WA 5DBOA 3L7MA 1AU7A 1ZRHA 4FE4A 4E5VA 4DC9A 4EG1A 2PWZA 4BFZA 1E4YA 1N25A 2BFCB 1YOVB 2N47A 2QF7A 3UIEA 3SG0A 4DE5A 3LWBA 1Z8DA 5JXHA 4L8GA 2VN8A 3EVNA 5TGDA 5H7XA 3EZ6A 2Q6KA 1F0PA 1YQUA 4RACA 1UEIA 1NT2A 4PZ0A 1QOZA 3K1TA 4DLVA 3PI7A 3FTDA 3RVRA 1VDMA 3SMQA 5HUQA 3CW9A 3DVLA 1V3TA 1VG0B 2P5UA 1BH6A 1X7WA 2G1UA 2YVAA 1D03A 3H2IA 3JQ9A 3FM9A 4H6PA 1F5NA 5IAKA 3S8YA 3SQDA 2VF5X 1UBSB 1E2UA 3QVSA 1Z12A 1H65A 4IJKA 1EXMA 4ZAZA 1TYCA 2P0YA 1DQPA 4TTRA 3U4IA 1Q1BA 3E3NA 4RDXA 2P9ZA 3JZAA 2YXDA 3EEOA 2X5OA 1Z0ZA 4B6EA 1VCNA 2JBWA 1KDPA 1DGQA 5DBFA 1RYBA 1LCCA 5KNCA 4KITB 2V7GA 4FFLA 1NAHA 2I2XB 4CLRB 4KR9A 2VH2A 2NXCA 4AQYB 4D8VA 5J4HA 1Q1QA 3P2YA 5A5GA 3X1YA 2X0KA 3UY4A 2A0WA 3ZX5A 3V4VB 5DFAA 2WKSA 4B6SA 1XPUA 5J23A 1PGNA 2FSIA 3NBXX 4EI9A 1GCAA 5EXXA 5GONB 4I81A 1I01A 1S2OA 3MC1A 4ZT7A 2JFYA 3CZAA 1I4WA 1CB7A 3DYBA 4XSGA 3QTLA 1D8TA 3EXFB 3SCZA 4S0ZA 4V0ME 4B6FA 1YQXA 2OZPA 3T7KA 1WXGA 3AL2A 2CJWA 3GDGA 1SVLA 3E15A 5CFRA 1I5OA 2IZ0A 4LF5B 1ZCJA 4JOSA 4H1HA 4AY5A 1I7LA 5KYXB 2W58A 3AW9A 3L6DA 1SN7A 1D3AA 1F4LA 2OO7A 4BGVA 4CMHA 5HS4A 3TOVA 1E18A 3M33A 3QEBZ 5L4LA 3LQ2A 4UTNA 5IVDA 2RHWA 5BMVB 1O96B 7AT1A 2JGMA 2HPVA 2VNAA 2ST1A 3CVWA 3HDYA 4NF2A 3U44A 1HQDA 3B3AA 1B6TA 5LOVA 3Q87B 1QPGA 1RI4A 4TUYA 3SHOA 4E09A 3R3UA 3TIVA 1F8GA 2O4UX 3AIMA 4QQKA 2AJCA 1M10A 1NXXA 1LK0A 2PTGA 2VNSA 4D92A 4RD2A 4PFSA 1AQYA 4RTSA 1R2QA 3INRA 2OOKA 4JELA 1DBSA 3FFWA 1KIAA 4HGNA 2XOKD 3WLQA 1USUA 3HGMA 5CPBA 4PZLA 4EY8A 2W2KB 1CRWG 2PR2A 4XR9A 5ITZB 4HWSA 4HSEA 2SCUB 4R5MA 1RRVA 2AKEA 3WAJA 1BDMA 2CD9A 1MC5A 3Q4GA 4A8TA 2QZJA 1BN6A 2GBPA 4DDUA 4TQUS 1UBHS 3R8CA 4B3BA 1AVTA 1MB0A 3DLTA 5SV2A 4JYAB 1UMBA 2BGMA 2DT5A 2EEZA 2W6JD 4QJ5A 3RKSA 3HJCA 2O49A 1K7FB 2HCJB 4M1YA 4CR6A 2VFAA 6REQB 3VR5D 2BFFA 3WYEA 3B7GA 4LQ4A 3IUBA 1UPFA 2K87A 4JFRA 4DMKA 2WQ7A 2G77B 2GM3A 2CBZA 2VDKB 4ACBA 5BR4A 1J33A 5F5LA 5A3QA 2NQ2C 5JSFA 4JV5B 2OV4A 3ZHSA 1N2CA 4HN2A 4KNWA 4UULA 3G5GA 5DMHA 4R9NA 5FV7A 3OTQA 3ZBUA 1MXHA 4WOPA 1Z3CA 8ADHA 1BWPA 3EY9A 3I4LA 3PQ7A 1I4OA 2PGDA 2CXQA 4AP6A 1IDN1 4MR8B 5CIQA 4XYLA 1X14A 5AM0A 4I6JA 4Q01A 4RHCA 3IALA 4FOPA 1P81A 3TF5A 1LKZA 1O5TA 1ICIA 5DBIA 4KYUA 5TE9A 1YDGA 1DCKA 2GM5A 3JQGB 3QWBA 4OHVA 4L78A 2G36A 5JD5A 3V3KA 4MARA 3ZY6A 4UVEA 5K3EA 4GLBA 4HRAA 1D5CA 1FUUA 3N5CA 4WECA 1XZAA 4ITUA 4J1XA 2F8TA 1M1YB 1TD1A 5CT8A 2L0XA 2VOJA 4PO1A 3FZEA 3ZIDA 3H8SA 1QZZA 4EF4A 1J00A 1RMTA 2AXVA 1NUAA 2HRQA 1ZCAA 5FTKA 2H7CA 4MP6A 2FPGA 1T9CA 3EWIA 4XM1A 1VJGA 5AM2A 4JXZA 2I6FA 4NH0A 3T7RA 3JARA 3HDJA 4HDOB 2FMHA 3D6UA 4BLQA 1R6BX 4EHAA 4BJ5A 4BNLA 4J9UE 2AE1A 1PR6A 5I4IA 3NJRA 1IK6A 3E9CA 3WAGA 2AB0A 2GBFA 1HF0A 1U3TA 3O6VA 3F4BA 1PJLA 2PH7A 5IZCC 2C2OA 4F11A 1RJFA 1X1CA 2W0SA 5GIPE 3CB2A 2X7HA 3TQFA 2AMLA 4YO7A 2QZSA 4CM1A 4CQNA 1IAVA 4U6NA 2WD7B 5C8YB 4KLZA 3U4QB 1NPDA 3EMKA 5AJXA 1J9EA 1KJIA 3D0OA 3HVKA 2DPGA 2FCAA 1QYVA 4N0QA 2AR0A 3LUAA 4WDRA 2J87A 2NXWA 3DBHA 1NERA 2BTQB 1ZUNB 3B13B 1AU9A 2APJA 4J6FA 3RSCA 4M8SA 1D7OA 1X9IA 1ONPA 3AP3A 5I7WA 2VWHA 1G1AA 1CQTA 4OIMA 3I0ZA 4QICA 4WVFA 4DPMA 3LECA 1K2VN 3TZEA 4OHUA 4INZA 2HBZA 3EQ8A 4HDMA 1E96A 1X92A 3QWGA 3D7KA 3TCXB 4OAPA 1EUDA 2BL4A 2F1IA 4LOJA 1KI6B 1XZPA 2IP1A 1TJ5A 4PQRA 1F8UA 1XMOB 3PQCA 1I2AA 1SUDA 3O9MA 3DLHA 5A04A 1ID8A 1O5OA 1OGYA 3RLFA 2Y0PA 3F1KA 2ZTSA 4MHSA 5JWRA 3JQ7B 3GAAA 4KDCA 2MYNA 2VWPA 3WP1B 4Q3BA 1W73A 4BWYA 2AZXA 2ZYGA 2AQIA 3O31A 4MS1B 4C4TA 4LGMA 1B2LA 1FEZA 3OZTA 1LX6A 5T5QA 2X8LA 1XL0A 5A9TA 1MHTA 3DLAA 4PX9A 4CMIB 1TM5E 2X9LA 3L5KA 1I8TA 2K2WA 2G9NA 3TPFA 1DOZA 3BCSA 4BZZA 3L0ZA 2KJQA 3DYIA 1E61A 5EP1A 1Z4MA 5KSPA 1RAHA 3V7YA 1EIWA 3T54A 2O2IA 4K05A 4I5DA 3H65A 1WXIA 5EFZA 1ECGA 4P4GA 4LRYA 1D9XA 4RMNA 9LDTA 4B80A 3D2CA 2R8OA 3ORRA 2JZOA 2B2CA 2D5LA 1OMOA 3URKA 1FDTA 2ZRLA 4HYQA 3BJEA 3ILVA 3AI1A 4FHFA 5A6SA 4DBVO 3DMNA 4BV8A 1D4AA 4LYDA 4QOEA 3JVDA 4PAQA 4OHFA 5DLPA 1UEJA 5SYNA 1G1MA 2D2IA 1ZD3A 1ZIXA 2Z6VA 3KQOA 4BMPB 2Z4RA 2EW2A 4GR9A 2JHPA 5JTTA 4WGFA 1QSGA 2OL4A 1GL7A 3A9TA 1SB9A 3INNA 3JD2A 4QODA 2J5BA 1NQVA 1XDDA 2Q9UA 3FCEA 3D5EA 3SE0A 4ZK2A 1EFVA 2UUCB 3K9FC 2CCKA 3HZZA 5AHKA 1WUIS 1XCOA 3EVCA 2PSJA 4ZCPA 4JWKA 5AK3A 5HS6A 5LDHA 2V4ZA 1R0WA 4R98A 4ZOCA 3QWIA 1M67A 2P4QA 1DBVO 2B94A 1MRZA 3BMOA 3F5QA 5G3YA 2AE2A 5GP1A 2JGRA 4ARUA 4EUKA 5ADWA 4AG3A 4KNYA 3GWZA 2FPIB 5DHTA 1H6DA 1U6IA 1EWRA 2ZSHA 1KIFA 1ZO8A 4MUFA 1L5KA 1F6BA 1RJ9A 1VL1A 1MUUA 2VCYA 1XMVA 3L0IB 1HEIA 1R0KA 3MWGA 4FR0A 5K6AC 4DLUA 2IYPA 1K7YA 2C7RA 2OZKA 4LXYA 1NBAA 3T3OA 3V80A 4DLNA 1LJLA 1W34A 3AX6A 1LFAA 4GKVA 4Q6WA 4KR0A 5BUZA 3CRNA 1FRZA 1Z6PA 5ALYA 5TF4A 4PLHA 4WAUA 4BNIA 1WTCA 5JV5A 3N7UA 2ZCJA 1YBVA 3BD6A 2PJZA 2X76A 2JI6A 3P52A 2YMPA 3B1JA 3AB8A 2DFNA 3HB0A 3TL6A 5E0OA 3WIEA 1I3NA 4CN8A 3LL7A 4DMLA 2XWPA 5CT6A 4RLHA 1MDFA 2XTZA 3EX7C 1PRAA 2W2LA 3IULA 3O4IA 3UM9A 1S0UA 1T8YA 1NXSA 4JJ8A 4ZC8A 3UJ9A</