1JFSA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jfsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA02
1ZESA 4I6UA 4OLAA 1L1MA 3T38A 1WH8A 3GBFA 1AB6A 1E6KA 3KG2A 4HYEA 2MSKA 1OSLA 3JY6A 4RK1A 1IIBA 3B7HA 3QQ6A 4LDAA 4KMRA 5T3YA 4O1IA 3TB6A 3C3WA 2AXZA 4PU7A 3KHTA 4JB2A 3HSYA 4J1WA 4H3KB 2WIUB 5KC9A 3LUJA 1LBHA 4RSMA 1BVHA 2XSDC 5B3JA 2FQXA 4B09A 1GLGA 1NXTA 4X4GA 2GZUA 5KI6A 3HCWA 4Q6BA 1ZDMA 3LUAA 3QEKA 1USIA 1P8AA 1QP4A 1YS7A 1U0SY 2FEWB 2HPHA 4L85A 4YV7A 2IDMA 5IBQA 1C0EA 4G0ZA 2I6FA 3G5GA 4JCYA 4RY8A 3N75A 5FWXA 2PUGA 3F51A 3D02A 1R69A 1XHFA 2NUBA 2E4UA 4EYOA 1JFSA 3I5AA 4F8JA 2FMFA 4MS4B 4QYMA 3LTEA 4OTZA 3CFYA 3R0JA 3TX6A 3GT7A 3OM1A 3FYAA 1EWVA 4N76A 1IC8A 3KXAA 1E3OC 1DG9A 3JPYA 3OLXA 4MR8B 4RWEA 1MB0A 4QICA 3KLNA 3HV2A 2A9RA 3LKVA 4MQFB 4L4UA 4RU1A 3A3KA 3OQOA 1SXHA 3NBMA 4XAQA 2MYUA 3N53A 2CHEA 3N0RA 5BRJA 5JS1A 3MIZA 2MQKA 2PE5A 3KCNA 2FN8A 1W25A 3DLHA 2EBYA 3KZ3A 1PHRA 4JOQA 1M5UA 2QZJA 3KS9A 1Z2DA 4YBAA 4RY0A 5KQGA 4F3TA 3ZHMA 2E4VA 5PNTA 5ED4A 3DGEC 2IUOA 4OATA 2JK1A 1D2AA 3CG4A 4G0MA 1ZGGA 4E7PA 5EWMB 2PUEA 1QO0A 1ZZBA 3E61A 4OBBA 5IUJC 4GHJA 1SD5A 4H3HB 2JVIA 3QELA 4MGEA 4RXTA 3RVPA 1JDPA 3SY8A 2BGGA 1JF8A 2FXIA 4EGSA 2JCGA 4Z4CA 2R63A 3TD9A 2LPMA 1UXDA 4NDWA 1LMB3 4EVQA 5BR1A 1I3CA 4Z5HA 4G0OA 3CECA 3SCHA 2QR3A 2KYRA 2JVLA 1Z16A 3GL9A 1L5YA 3ILYA 2IPNA 2NZUG 1Y9QA 4RV5A 4KK3A 4WUTA 3H5WA 1BDHA 3F6CA 1QP0A 4MR7A 4W5QA 2HQBA 2PMCA 3M6MD 4WZZA 2WY2D 3I45A 4RK5A 3SCGA 4Z59A 1R8JA 2KEJA 2VUHB 3OMXA 4D6XA 1PRVA 3HS3A 5JNUA 4EVRA 2NT3A 2P9HA 2LUOA 1DC8A 3D1NI 2E4YA 3HO1A 3EGCA 1P2FA 3C6QA 2FEPA 1MIHA 3KYIB 4WWHA 5IC5A 3EUSA 4FN3A 3CU5A 5TQJA 2FTKE 4ZMRA 4GQMA 4MLCA 3HVRA 4LX8A 1ZH2A 2XI8A 3U3WA 3CKMA 4MAAA 2PL1A 3A10A 2MYPA 4YR7A 3QWGA 3B2NA 5JNRA 3LFTA 1AU7A 4RK6A 3JXBC 2LCVA 1Z2EA 3ROTA 4I6TA 1R63A 3OLZA 2A9OA 3QLUA 4Z4HA 1X57A 1DCKA 2BNMA 1PUXA 1DBPA 2HJ9A 4OB4A 3FMYA 1OXKB 1QO0D 2IPMA 4LE2A 2LYPA 4RXMA 1JYFA 2L2QA 4IILA 1U2QA 1ZAYA 3Q7RA 4EYKA 1YVUA 1CHNA 3O2JA 5EWLA 2FEKA 3OLWA 1NXXA 3KKEA 4UHJA 3O74A 4G0PA 3KYJB 1UXCA 1NY5A 4G97A 2PKXA 3URMA 4FE4A 1D1QA 3CZCA 2D5VA 3QLVC 4KVFA 1NATA 3FFXA 4EVSA 1U2PA 3H6GA 1Y1LA 4P98A 3VK0A 3ZHIA 3MYYA 3S8QA 2R47A 5TQ2B 1YMVA 2P4UA 3T8YA 2FKAA 1JYEA 3DZDA 3Q15C 1ABFA 2L18A 2BNOA 2FJRA 3GYBA 5JNTA 2MEZA 1M2EA 1A2OA 5BQ3A 3BD1A 3IVPA 1NTRA 5HQJA 3RVSA 5A7LA 5GOTA 2AW6A 2FLWA 3E3MA 2ZWMA 1ZGZA 4I6RA 4RK0A 1RPJA 3H5LA 4YG7B 3DNVB 2VUIB 5KQPA 5CHYA 1B00A 2HQOA 4MS4A 4MYRA 3KJXA 2JBAA 1FSPA 2HQRA 2B1JA 2OR1L 3CLCA 1URPA 2QXYA 1RZSA 4FB4A 1GUDA 1O4XA 4MR8A 3RZZA 4N41A 4KQCA 3TRBA 3BS3A 5TPWA 5TQ0B 5CNMA 1KGSA 2ICPA 2M1ZA 4XXHA 4Z4EA 5E3JA 4MQFA 2MYTA 2B5AA 3IP6A 3JTEA 3RVQA 2JVKA 3HM9A 5C5EA 1ZZCA 1GCGA 2NZVG 1KMIY 2KPJA 2VK2A 3MMNA 1NXWA 3LOPA 3D8UA 4JQDA 2CWDA 4IGAA 2CSFA 2KEKA 2FW0A 1ZY2A 3UFDA 4TLLB 1PNRA 5B3JC 5CNJA 3RVMA 2O4AA 4YWHA 1PERL 1EFAA 2WJWA 3F7NA 2OQRA 3VNBA 3F52A 3GBVA 4F11A 3BRQA 3LKBA 5HM6A 5EWMA 4Z5DA 4G0XA 6CHYA 3IDOA 4JB0A 1VKRA 4GNRA 4IMIB 5I4CA 4LDZA 4FBIA 2E4WA 1JL3A 3M9WA 3T95A 4RZSA 2PPXA 2IV1A 1WETA 2LYRA 4EYQA 4Y9TA 4YP9A 3HXMA 4QYWA 4Z5CA 2VYCA 4F12A 2R25B 3HUUA 4Z4GA 2GWRA 2O38A 4IRXA 1NXOA 4O5AA 5FBHA 5IULC 3FYMA 4OG2A 4OLBA 4DQDA 1S7EA 5FWYB 3CZ5A 3HDVA 3S99A 3BILA 9ABPA 5TE9A 3C3MA 3OP9A 4JA2A 1VPWA 4KQ9A 3JS5A 4KPYA 1OXBB 1RZRA 5JNSA 4RK4A 1E6LA 2AYXA 3GWGA 2IPAB 3N0WA 4HNSA 3GRCA 1TVMA 2ICTA 1DJMA 3KLOA 2GI4A 1DCMA 2R1JL 1LQCA 3LFPA 1K66A 3FFWA 2WJAA 3LUGA 3Q41A 4ZYLA 2E4XA 4YLEA 3CTPA 3QF3A 2YHBA 3O75A 3OLVA 3SCFA 3FFTA 2CD7A 3A0UA 3OMWA 1DZ3A 3EODA 5DKFA 3P9YA 1POUA 3L1PA 1MVOA 1FFSA 1X2LA 4X4HA 1USKA 2J48A 1Z12A 4KZKA 4DADA 1DCFA 3PXPA 1BDIA 4MS1B 1P6UA 1ZH4A 2IYNA 2QV0A 4WXMA 1JX6A 3MLFA 1Z15A 3ILHA 4LE0A 1K68A 3BBLA 4MQEB 4N47A 4P1ZA 2MSWA 2FQYA 3HEBA 3Q7TA 1M2FA 4WXEA 3DBIA 1LCDA 2PAFA 2LP4Y 3CLKA 3CROL 4H60A 3H1EA 2LBPA 3LUFA 2L8NA 2LYJA 2OFYA 3HZHA 5KQLA 1RPEL 1C4WA 4QPJC 4MS3B 5IX8A 4RDCA 3SQNA 2PLNA 1SXIA 4S05A 1KRWA 4HNRA 2A9QA 4W5OA 2Q5CA 5TQ2A 4O8BA 2IVBA 4RS3A 1DWKA 1BDJA 2PUCA 4TMYA 3EAFA 5K98B 1DC7A 4Q7EA 4Z9AA 1ZZ8A 3TMYA 2R48A 1M5TA 1RZRD 4RKQA 3A0RB 1ZPQA 2IVQA 1JDNA 3EJWA 5CNIA 1YMUA 4F8DA 1FFGA 1H9CA 1D1PA 1LJUA 2QU7A 3RQIA 3CRNA 4N0PA 4YG4A 1EAYA 4M88A 3NHZA 3EULA 3QLUC 1BA2A 4KRFA 1TJYA 3JXDL 1JFVA 2B4AA 4PICA 3F6PA 4D6YA 3GA5A 5TQ0A 5HSGA 2WRZA 4YG1A 1PRAA 3GN5B 1OCTC 4XARA 2L49A 3OQNA 1RNLA 1ZUGA 3H1FA 3LUDA 4KK4A 3N6VA 3RVNA 1HF0A 3KTOA 3RVOA 3W9SA 4ETMA 4EY3A 2L17A 4NV3A 7ABPA 3RVLA 2XCJA 3G7DA 2BJCA 1BAPA 3O21A 3RVRA 4PE5B 1ABEA 2FMKA 2PUFA 4X4IA 2LYSA 1GCAA 3IPCA 2CHFA 3C97A 4YARA 3MA0A 3SG0A 1HEYA 3C3KA 3UK0A 3IP9A 3OQMA 3CG0A 1U8TA 3FGZA 3H5VA 4JASB 4IVZA 3H5OA 1Y7YA 1USGA 3HK2A 4KREA 2F8SA 1ZZ9A 1Z18A 5HKOA 2F8TA 4YO7A 2M98A 2HINA 1SRRA 4G0YA 4KV7A 5C5CA 3IP5A 1FFWA 4Y42A 3NNDA 5TPZA 4E7OA 4W5RA 4W5NA 1XWWA 1QPZA 3H75A 1B0NA 4G86A 1XHEA 4MRMB 4W5TA 4MLDA 4TLMB 3O2SB 4X4EA 2JRLA 3BRSA 2ID7A 2GBPA 4F06A 4Q6WA 4Z58A 3HZIB 2QVGA 6ABPA 5EWJB 5EWLB 3G1WA 8ABPA 5DTEA 2FSPA 2WB4A 4Z0NA 3H5TA 2E4ZA 3HUTA 3MM4A 5FWYA 1NXVA 3NNNA 2EWTA 1ZHHA 4J1XA 1QP7A 1CEYA 4Z9BA 2O20A 4MCXA 2AUWA 4LZLA 3RH0A 4PZ0A 4ZPJA 2IKSA 3OO0A 4RK7A 2LIVA 4MR9B 1DRJA 4PYRA 3Q7SA 3T6KA 2H3HA 2PJUA 5CNKA 5DCLA 3QEMB 4PEVA 5JS2A 1LJLA 1LCCA 1ZN2A 3O1IC 3VNAA 3JVIA 1E2BA 4Z4IA 3SNKA 1QKKA 4LE1A 3JPWA 4Z99A 4ZMSA 4X4FA 1NEQA 3JVDA 2LYKA 1ZS4A 2PUDA 3CS3A 2WWVD 5IUNC 5TPWB 4YS6A 1QNLA 1JWLA 4MS1A 2JB9A 3R1FA 4XASA 2JBAB 3NHMA 1JFTA 2FLKA 2RDMA 2JVJA 1E6MA 3M9XA 4MQEA 1UTXA 4EYGA 1JH9A 3DLBA 4CBVA 3DGFC 2QW1A 3LISA 3RVKA 2WUSR 1PEYA 5TPZD 1TLFA 1PRUA 1U04A 3GBPA 4D74A 2XIUA 1FQWA 2IVGA 4X4CA 4I8TA 2PL9A 4RXUA 2RJOA 3N0XA 3OLYA 3RVJA 4YCSA 1GUBA 1RIOA 4FE7A 5JNWA 2LYQA 3MF4A 3CNBA 1A0OA 2H8RA 4MS3A 3GV0A 3HJFA 1ZVVA 4ML3A 4YGXB 5IEJA 3EDCA 1YTUA 2LYLA 2ZAYA 3G85A 4Z4FA 2AXVA 1ZZ6A 3QLTA 2AYZA 2GX6A 5FWXB 2FN9A 1MB3A 1UDRA 2FQWA 4RY9A 4ETNA 1NXPA 1NXSA 4JCXA 2MYNA 3OM0A 2FVYA 5DGCA 4UHKA 2WMYA 1SQ8A 3QK7A 4MPTA 3FDFA 5D2CA 1EWKA 2TMYA 1WIZA 2IU7A 3NNSA 2IPLA 5IEBA 1T34A 4HNQA 2PUBA 3BDNA 1RXEA 2ID9A 1PEAA 1TM2A 1P6QA 3ROFA 3UKJA 4S04A 1JBEA 1PNTA 5JNVA 4XFKA 2A6CA 5BRAA 1QQBA 2H0AA 2DRIA 4XLTA 1CQTA 1J56A 2L19A 1Z26A 3FMVA 4IF4A 1QMPA 3F6WA 3JXCL 1DW9A 3GN5A 3LUKA 4MCTA 4ZJPA 3LUHA 4KFCA 1KRXA 1RXIA 3Q9SA 4PU3C 2NT4A 2R4QA 2V0NA 3BREA 2GRLA 5KC8A 5ABPA 1CJGA 1DBWA 4NCAA 4G0QA 4GPAA 4LRQA 1D4ZA 4IA8A 1ISRA 1MAVA 4WT7A 3SM9A 3EQ2A 2GRMA 1LBIA 4TN5A 1Z17A 3QYXA 3QELB 2W42A 3O1JC 1SXGA 2YHAA 3K4HA 2O49A 1DRKA 4O1HA 2QSJA 3K9CA 1L5ZA 4RKRA 2BNNA 1EWTA 4IMJB 3QX9A 4NQRA 1YK1A 4EUKA 3MQ4A 1LK0A 1DBQA 2X7XA 1ZITA 2PIJA 4N03A 1APBA 3TO5A 1YS6A 4JAVC 1GT0C 1YK0A 4NCBA 3I42A 5GQSA 1LLIA 3HDGA 2A9PA 2HSGA 2FMIA 4X4BA 4MR7B 4N0QA 2QVCA 3QLVA 4MRMA 3IPAA 1TMYA 2RJNA 1Z13A 3CHYA 1CYEA 4JP1A 3ZKCA 2CROA 3H6HA 5EWJA 3IP7A 3I09A 1NERA 2KEIA 2GKGA 2PUAA 4YRZA 1VLZA 1ISSA 2XJ3A 1ZZ7A 2N9UA 3N8IA 5T7BA 4IWRA 2EF8A 1JHZA 3KSMA 3H1GA 3LMKA 5FBKA 3SAJA 5KWSA 3F73A 5F64A 4ETIA 4NICA 4PU4C 3QX8A 1DP4A 3O9XA 2XDYA 3H5IA 4X4DA 1EHCA 1D5WA 2AWIA 1VRVA 1JLKA 2IOYA 3O2QB 2AXUA 1QQAA 1ADRA 1F4VA 3OO1A 2OENG 2KZ8A 3L49A 4MR9A 5IUKC 1XWRA 3UUGA 2MSLA 2RGYA 3QEMA 4PU8A 3L6UA 1WH6A 1AB5A 3EQZA 4DN6A 5KQMA 3O1HB 1YIOA 3LUCA 1S8NA 4KNYA 2FMHA 1W9HA 5DLEA 3OMTA 1F51E 1YSEA 1Z25A 1A04A
chains in the Genus database with same CATH superfamily
1BJKA 4ID3A 4WXEA 4Z0PA 4KI7A 3HACA 2JLWA 1KSFX 2EBWA 4W6QA 1WE2A 4B48A 1IQUA 2NZ2A 4F4UA 4CLDA 5IH3A 3FUCA 4RA9A 1R15A 2ZBGA 4FCWA 4HX5A 4NU6A 2IRWA 5KC9A 1WLSA 3AM3A 1FFXA 1HEIA 2Q3JA 3E9QA 3ORQA 4RSMA 4ZANA 2XCUA 2VKQA 2ZBQA 3HJTA 3VJKA 3DB2A 4PZUA 3F8WA 3QTLA 5I7AA 3RS3A 2V9PA 1P4GA 4KE9A 5JRDS 1QP4A 1U0SY 3GUCA 4N8SA 1XL1A 4TRJA 4YC7A 3SVTA 1P1RA 2HHLA 3L7CA 3ZGNA 2VDVE 1V16B 1LI7A 3U4DA 1EK1A 1ADYA 3ESDA 5FWXA 1XHFA 1L8AA 4Q7QA 2IXEA 5EG5A 3HRIA 1LDGA 2V3WA 3UB2A 2BEWB 4MS4B 1N2BA 1XA3A 4XCVA 5ALLA 3RAJA 3TL6A 4X7BA 2I9KA 4S3MA 2WIBA 3KXAA 1MQ8B 2GCGA 3O8QA 1J22A 2C5SA 3AUKA 1ZIYA 3KLNA 4D4LA 1VZ3A 4AM8A 5D3KA 4JQYA 4JJ7A 4YJFB 2HX1A 1GFWA 2JLRA 4MIOA 5MFZA 3UMBA 1IUOA 1VGRA 2DWOA 2O8FB 2MYUA 1FNBA 2EP5A 4CR6A 1EFLA 1FRVA 2HHAA 3NRJA 5J59A 3AL0C 3DTVB 1B0UA 1VPLA 1ZH8A 4Q3OA 3HE3A 2VZ9A 4AUNA 1F7VA 2PZMA 4L51A 4ZYXA 5K8VA 4CMEA 3KELA 4DAOA 3UWPA 1IPFA 4MKRA 2L0XA 1FZTA 2FEOA 4YK7A 3A9SA 3VZDA 2J9RA 3NVAA 4AKTA 1CQIB 3F6YA 3MJ4A 4PG5A 1WW3A 1YSCA 4C0HA 1JSXA 1UPBA 1VI6A 3RC7A 5H80A 4BMZA 1JI3A 1FPQA 1QIKA 1KEVA 2H4HA 2P2SA 2R62A 4GW3A 3HDHA 3O3MB 2CC2A 3QUQA 1RAAA 2NUPA 2X3FA 3VJRA 2ZYGA 2PRYA 2JVLA 1D8TA 1XNHA 3LY7A 2GN1A 4I50B 4TVKA 4UAGA 2OFOA 1G38A 1RJGA 5DN9A 4Y1FA 1M7GA 1UPAA 5LNK1 2WHQA 2ZIVB 1JKJB 4FDTA 3M6MD 2NN3C 1UOEA 1U9IA 3MB5A 4EJSA 2VUHB 1A2KC 1TF2A 2JJYA 1LD3A 2I2WA 2XMSA 3GUZA 3I9KA 2OP1A 5AJYA 5AQEA 4CXMA 1I1OA 2QHXA 4N3AA 4YCJA 4EKDA 4LHVA 4NAHA 4TV9F 2ENUA 2F1IA 1PZNA 2GZSA 1BRTA 5DGIA 4CM5A 3PNQA 3U7QB 5K0GA 5LLTA 5LU8A 3EUSA 3PDIA 1M1ZA 1ODKA 2FB9A 2W4QA 4K9NA 4BNWA 4C4YA 4INPA 4LX8A 2Q62A 4Y2TA 3RUAA 4AF7A 5TY0A 2QTCA 1ZL0A 1MX9A 2VK8A 4F5DA 4LKOA 3H13A 3QVMA 4JIGA 3TNFA 2G0AA 4RK6A 1I3NA 5IXJA 1AZSC 1RRPA 2EBUA 2LE0A 1K3FA 1YHNA 1ZBDA 2PGLA 1VPVA 2CL7X 2H6EA 1DCKA 2I6GA 2VDWA 3QLUA 3KETA 4LX0A 3GLGE 3ZWNA 3NIBA 2EFGA 4KIWA 1QO0D 4F92B 1AH2A 2Z5GA 4AS3A 1JSCA 1KS2A 4G5RA 1D2MA 2L2QA 3UAOA 2R44A 3VUFA 4C3UA 1R0CA 5THQA 4CGYA 1TZ2A 4LQ4A 5E1DA 4PSDA 5EC8A 3V1MA 3TXYA 1V7CA 3L4SO 1F8GA 2PSDA 3ZGLA 2W2XA 1VFNA 3EFOA 5EIOA 1AT1A 4BGVA 1KEPA 2IYFA 2W6OA 1DWOA 1E8DA 3JATB 2YICA 5C8VA 2ONYA 2UYGA 2DTDA 2Y05A 4UVHA 1JWAB 1JYEA 4K3VA 2X13A 2ZUCA 4MWTA 4OU5A 1N6LA 1N7JA 3GYBA 2HF9A 5K0BA 3BD9A 4M9SA 1MZVA 4QVGA 3KJNA 5BT9A 4RZXA 4DJAA 4NFHA 5H9VA 3COPA 1D5CA 1SVNA 3BWBA 4J3NA 4U02A 2ODEA 4CEHA 3RSSA 1TQDA 1Z73A 3F4BA 4IIDA 3KJXA 3OIYA 3UWDA 3UMYA 2OR1L 2WZQA 1CF2O 3WLOA 3JQEA 1ORTA 3HKBA 4HJRA 2YFHA 4BNFA 2MCFA 1EWRA 1J49A 4RMJA 2O8EA 4ER0A 2M1ZA 3I28A 1ILEA 1S2OA 3P0HA 2GILA 4PIVA 4ZCSA 3P9NA 4Z49A 3HM9A 5J47A 4YRKA 1I2BA 1C3LA 1I0LA 1WHTA 2W2MA 3DC2A 3HKDA 3I9OA 1BFKA 4N39A 3WDKA 4IHQA 3WXMA 3V9PA 1FXWF 4M89A 4QODA 5FRDA 5DTRA 1TYBE 3D3NA 4J16A 2NUAA 2QRUA 3A3OA 1O5TA 3SP1A 3RBZA 4JENA 1OZFA 3GEEA 4UNNA 4BNDA 4ZKDA 1DU4A 1YXMA 4JI5B 3T52A 4X20A 1EP1B 3R8XA 4HLUA 1BH6A 1R0ZA 4KU4A 4P81A 2I0FA 3NXKA 3S1AA 3DMFA 5HM6A 2C0QA 4HTFA 3IDOA 5LA6F 1KEUA 1SKUA 3KVOA 1V96A 5L7YA 4QTYA 3PC8C 2XBUA 1DWQA 1NI4A 3G0TA 2E4WA 2Y0DA 3NJ4A 4I55A 1C9NA 2VO1A 3UWMA 3CZPA 4GYYA 5CT9A 4B8YA 1XWFA 3AHDA 4QXOA 1B6SA 2E6UX 3RIHA 4BQRA 1YI8A 1ZGHA 4O4JA 2WU1A 2VDRB 3HUUA 1JDJA 3SFVA 3BZWA 4GM1A 4BNJA 2GCPA 1ANKA 2K5UA 1MTOA 2VTVA 3GJ6A 4OG2A 5FPQA 5HK8A 3OE4A 4OX9Y 3CZ5A 1QGZA 2Z2JA 1XDZA 4F93B 4OXNA 2YV1A 4U7PB 4PO1A 3OE7D 3V1NA 4IDNA 3RABA 4C3ZA 2QPAA 3IUSA 1W6UA 3TSAA 1V95A 4YECA 3AIIA 3ZU4A 2CMKA 4UOQA 3RU9A 1AKEA 3CNLA 3KB2A 4KKVA 1DJMA 3ABZA 4BWGA 4MRVA 2E4XA 2Q1SA 1PDWA 1C8VB 1W93A 2W0SA 3CNNA 3FMOB 5C80A 5HKAA 4K9SA 4Z7JA 1U6JA 3JRWA 1MX3A 1POUA 1H69A 2GPTA 4PXYA 2ZIFA 2J48A 3U1VA 2WMOB 4N5DA 4OI0A 3D0RA 4RVDA 4MVJM 4MS1B 4CUJA 3DE3X 4I7EA 5TT1A 1OI3A 1Q22A 4QLAA 5AHXA 1TUBB 1QZXA 2VDUE 2OC4A 3JQFA 3O92A 3K30A 5DNEA 3WGVA 4JUBA 1Y9AA 1TZBA 2ZP1A 1GZSA 3ENZA 2ZAMA 3GJSA 4JJ4A 1UXKA 3G89A 3HI6A 3ICWA 5ES3A 5FNVF 3ZY5A 3AERA 3EUEA 1W35A 1IJFA 2FVXA 2H4XA 4UNPA 2B6HA 2JHFA 1ZW1A 2JF0A 1E60A 1GQ2A 2LYJA 5FUBA 3PFGA 1U1EA 3HZHA 3IEUA 5ALIA 1Q0TA 3KZ1E 1BXKA 5K8JB 2E4AA 5LWQA 4KQXA 2ISQA 5F9FA 4ZYYA 2VJAA 1ZQ9A 4TYNA 4FYVA 2B35A 3OY7A 4M8SA 4PC6A 3N6RA 1RR6A 1YS1X 3KJZA 1DBRA 1JE1A 3C5CA 5AR1A 4XE5A 4CYMA 4M53A 1C7QA 4EFMA 4N48A 1MRNA 1VHQA 3MBOA 4ZFNA 1P77A 1DXHA 4X90A 3JVEA 1D8AA 3F7OA 4KXMA 5T8KA 3QVVA 2E49A 1E2FA 1E98A 3A6ZA 3IAS6 5GPBA 4WBNF 4CKCB 4NXNB 4OP1A 4RSGA 4LJRA 1TRHA 3N07A 2B4AA 3JXDL 5KTMA 1DPFA 1JIVA 3EC7A 4DSTA 4HGOA 5HVNA 2QRNA 4C4SA 4KH0A 3G0BA 4TKVB 3ICVA 2VUTA 2AG5A 2WD9A 1KO1A 4JQZA 5KHAA 4F7WA 5EHIA 1U7PA 4OMCA 5BO5A 4QM6A 3C45A 1Z7GA 3WLRA 5E95A 1IXSB 3I32A 1ZEJA 2Q4DA 2R0QC 2QNBA 3KQMA 1RAFA 3EC1A 4PSCA 2OPHA 1W8DA 2VWGA 2ZIAA 2XRFA 2QMHA 2JGNA 3PQEA 5A6SB 3T9CA 4Q3LA 2HLDD 4X8HA 3O21A 2B69A 4HDKB 4JKYA 5EJAA 4DUPA 4KQWA 4GRAA 5AKLA 1CC1S 5GAHi 1EBFA 1YGPA 2NZXA 2RH8A 1NQUA 1P3JA 3OQIA 4MGIR 5T57A 4EJ0A 5JZOA 2XCTB 4ETWA 1A9QA 1J00A 1ZUHA 1XKQA 1Z18A 3HXTA 4BU0A 2Z1MA 3NOXA 5E6SA 4WNCA 2WAOA 4YCBA 2HCNA 1EVIA 2CB9A 2VLBA 4RE5A 2FR8A 5D86A 4B0OA 2FFQA 4DCPA 2Y2VA 3PPWA 4E7OA 1QVAA 2IHJA 1IN6A 4L27A 1PLJA 1U5AA 3GA0A 4FGLA 1VJ0A 2FW7A 4C21A 5FUQA 1SZDA 4XTCS 5H68A 2PQ2A 1DDGA 3VR6D 4RA6B 3WA6A 2VS1A 3DMTA 1Y80A 2ISCA 2ZVJA 1N8KA 3LYUA 2C07A 5CFOA 1WBBA 4FIZA 4UXJA 3NS7A 3MM4A 4NNOA 3NHYA 4TTIA 4Q9KA 1V11A 1T3TA 1FW6A 2YWCA 2JFVA 4WVFA 3SSAA 5LD2C 3TLYA 4RV4A 5ABPA 4Z9BA 4L0CA 4IP0A 4MCXA 2H1OA 4GH5A 1QGED 3GT0A 3A3PA 4LZLA 1Z4MA 4ZPJA 3RH0A 4EWLA 1SG0A 5JXGA 1ZNWA 2VHJA 3QQPA 2GN9A 1AUOA 3AZQA 4HN4B 5DWVA 1CR6A 4JJZA 4N18A 3SZOA 1KY4A 2WSBA 3GU3A 4NZPA 5DPMA 2GYWA 4ZT7A 2B5WA 1NZFA 2X5JO 1UK7A 1EUZA 2PUDA 2JGDB 3HU2A 5IUNC 2O8BB 3AUUA 2NTNA 4R16A 1YB5A 4DR3B 1WDKA 1FUUA 3PRKE 5DHSA 3IL2A 1ZGCA 3ROPA 1IQPA 3LK7A 5CHEA 5I7RA 1G9SA 3LQRA 3FW1A 1HT3A 1KMMA 3D4IA 4IOKA 4J7XA 1R64A 1OLUA 2YZ7A 4L6CA 1UC9A 3ORHA 2JGAA 4S0ZA 1C1HA 5EE5B 1ODCA 1XEAA 1ORVA 2ZEJA 5K6TA 2IVGA 2XWJI 3L93A 1EDBA 4P34A 4PQFA 1REQB 3RVJA 4M55A 4UMEA 4YCSA 1YJBA 4U4AA 4A0SA 2LYQA 4MWEA 3TINA 9LDBA 3OETA 3PJDA 4GOOD 4I36A 5K0NA 4DDKA 4K9QA 4EUEA 4Q39A 4Z4FA 1TK3A 3M1IA 2HKIA 1ZZ6A 3I53A 2CUZA 3BXZA 3C8HA 3DPIA 3QLTA 5CLGA 4BYGA 3WA7A 4GM4A 3Q7EA 1NXPA 1MHPA 1J8DA 3HCCA 2I2FA 1E2HA 1L5QA 4MVJD 1SXJD 1Y1RA 3W5BA 3GW8A 2X8JA 5HZKA 1EWKA 5DHPA 4OJMX 2B2CA 2IU7A 4E22A 2LZ0A 5DJ5A 3ZDAA 4I8XA 2IEGA 4HNQA 2BV3A 3R7DA 3KDAA 3I8OA 4HNGA 4ZGBA 4LGYA 2NV2B 4Y8VA 2PH3A 3OWOA 2C2YA 2OD9A 3G2LA 1G2OA 3P19A 3HJCA 1FRZA 2A6CA 4IGKA 4TYQA 4F6RB 4ITVA 3KWMA 1LLFA 1I7QB 1P3DA 3HCPA 4FFWA 2J3EA 4IJUA 2IZ6A 4EYSA 1KJJA 3F6WA 1EM8A 4G36A 4YA6A 4CODB 4DW8A 2NP7A 1DKOA 1NYLA 2JL1A 3LFUA 4H7PA 4X0EA 2MINB 1FTWA 4JJKA 4MVXA 5CDFA 5DSTA 3QXHA 1HTBA 4IA8A 2QM0A 2C2BA 3RLFA 3VAYA 3IHWA 4QELA 5K0LA 1R27A 3PE3A 3ND9A 4B3GA 4G6ZA 4XLTA 1V5IA 2VHTA 5JPCA 1AE1A 4IDGA 4NZOA 4Q4CA 3GYGA 3ZE7A 5A9SB 4H31A 2P9QA 1UAYA 1YR7A 1NN5A 4O1HA 1USWA 2R86A 4CWAA 4U2FA 5DT9A 3AVXA 2BNNA 3BXEA 4KYTA 2H08A 2DPHA 1ID1A 1QVWA 2J5XA 3DD1A 3KKQA 2FP4A 3ESQA 1EUQA 4R2JA 2X7XA 1CUFA 3G0OA 2VBGA 1W34A 4BE9A 1J25A 1T8UA 5JH7A 2V7QD 1SUPA 4P6VF 2TMGA 4N0QA 2Z2IA 4Y9DA 2EHJA 3E7XA 3IAM6 4DSUA 1J07A 3PXBA 5HRAA 3CJQA 2CVQA 2LWIA 3ZBTA 3KXLA 4GLOA 3D5EA 1Z0JA 1Y8QA 1A7JA 2DSNA 2HJWA 2XUGA 4MRPA 4P54A 3TWOA 2QG6A 1JKMA 4ZREA 2R6FA 2V4MA 4H0FA 3QBTA 4N4AA 1RACA 3L6RA 2RONA 4BNHA 5CDUA 5L45A 4HFNA 3R74A 3CW8X 3TNDA 1NP3A 1MV8A 2GD0A 1LRJA 4TKZA 2FN3A 3OT1B 1VIAA 3USCS 4R2XA 1WRBA 4FLEA 4KBGA 2VTBB 4BO9A 4KYVA 4MQBA 4D3ZA 1A2QA 1W44A 5JO9A 2P75A 1Z08A 3PVZA 2QQFA 4ILEA 1PD1A 1W9HA 5CH8A 3IHLA 5F35A 3BXGA 2DG2A 3GLHE 1VI2A 1LV8A 3RV3A 1NPDA 4B47A 4GLLA 4WXYB 1PK7A 4ZZ1A 821PA 5AW6A 1A9XA 3ZVKA 3GI1A 1LF5A 1OSLA 3LY8A 1IVNA 1IIBA 3QVTA 3KEQA 4YAFA 1E2GA 1Q5PA 2XCIA 3I5UA 5JDIA 2D3TA 1GIAA 3BFKA 1DINA 2PMDA 5CFPA 4G84A 1KYYA 4KIJA 3PX2A 4TM8A 1L9KA 1NXTA 5ALTA 1IRIA 2PZFA 3GLSA 1FDOA 4GRDA 4ZCPA 1BS1A 3IUBA 5M7EA 4DR5B 4NMMA 3ITEA 1VKJA 1BCRB 1M10A 2AI2A 2UYOA 2G77B 2GM4A 1QK4A 4C87A 1K8XB 2I6FA 3WKBA 3WBKA 4R71A 1X1SA 2HJRA 4LGMA 5BOVA 3TD2A 1F17A 5LP1A 1CVRA 3O4GA 3CC8A 4P31A 3C4VA 5B4TA 1R69A 1QRDA 2DPMA 4TSFA 5AHRA 4LAFA 2GM3A 3OEWA 10MHA 5C7LO 2O1SA 4LZWA 1FQJA 2V58A 3R0JA 1R8QA 1ZD2P 3DE4X 4GR4A 5CT6A 3ZW9A 2WIAA 5ANRB 5LOVB 2OC9A 4BFUA 3MWKA 1XJ5A 1X80A 3I2HA 3OEHA 3QPAA 1QOPB 1UFKA 3BEOA 3THSA 3SJAA 4DQVA 3T4EA 5G0TA 2J67A 2J9FB 4E15A 1PS8A 3HV2A 3R9XA 3HXKA 1Z29A 2GLXA 2IOHA 4AMYA 1JP7A 4WESB 2PS9A 3GNTA 3CA8A 2QT1A 1P2UA 3ETNA 3G0IA 4OM8A 3MWJA 4TKMA 3OZUA 3RG2A 1SCDA 1A5AB 3MIZA 5SY9A 4PRKA 3SCZA 4BB0A 4EOGA 2C2XA 4Q18A 3MUFA 3CX7A 3JQAD 5A9TA 2EBYA 2GN6A 2YRWA 3PDCA 1PHRA 4IZIA 2XODA 1GEEA 3D9QX 2J7PD 5E7JA 1HFJA 2R6GA 2Z08A 1GPBA 5FTWA 5EJ5A 1X74A 4NU8X 3CF4G 2IHVA 2R9VA 4HEA6 1CFZA 4DJJA 1VG1A 4M46A 1XZMA 2DCUA 3EEYA 2C83A 2R63A 4HGZA 3RT9A 1ULUA 3HFGA 3X43A 5EKDA 1OWOA 3P7MA 3IFSA 4EVQA 1BKDR 1JU4A 1N0WA 2GEFA 4IOJA 3O4FA 5BQXA 2WMNB 4KIGA 5H3LA 2PLAA 4B31A 3PK0A 1JTFA 3OCYA 1JQDA 2AA3A 2F1HA 2CXXA 1FDWA 1GNRA 3RJ5A 2HUPA 3GIWA 3G23A 2R87A 4HFRA 4LZZA 2HT1A 2AI3A 2REOA 5SZKB 3I9FA 2JIOA 1GN8A 4LBWA 4F4IA 1SAYA 1ZA1A 5E6UA 2XQFA 3FCXA 3GNSA 4DKXA 2CT8A 4A0FA 2F90A 2EJUA 4OY3A 1SFRA 3ANNA 4RK5A 4TS4A 2KEJA 1IAQA 2RGRA 3EK2A 2H0QA 1ZIDA 3QG1A 4NU5A 2XGSA 4MW0A 1H94A 4PSVA 1RCUA 1TVKB 3E5HA 1Q14A 3NT2A 2Q9UA 2CE2X 2OFWA 4Y6PA 1W5SA 3O3OB 5FO0A 3HN7A 4OGKA 2YJ4A 5A3SA 3ESRA 1PT5A 3HJHA 1TPZA 3D4OA 3HKCA 2K4MA 3D64A 4MLCA 4RFSB 1J09A 1B4DA 2QMQA 4MAAA 3M3DA 1RBYA 4DRXB 2QMOA 1N6IA 2NVBA 5F73A 1VP9A 1Y5IA 1Q7GA 1V4BA 4QQ8A 4CKWB 5GWXA 4CLOA 1Z4JA 2GESA 1I5RA 1KERA 1F2VA 3HDTA 4LE2A 4RZHA 1UMCB 5CW1A 2JA1A 2BR4A 4QGBA 1JYFA 2OO5A 3AR4A 3MWFA 3NEYA 1GEGA 2P9YA 3OCJA 4FYKA 4JBYA 4N5LA 1PK9A 2X40A 2VAWA 5ALHA 3L0BA 1PT9A 4KNWA 1Q57A 3O2JA 1KC1A 3DE7X 4ZI7A 2R97A 5H1YA 4GDFA 1MIOB 2WILA 2O48X 1XZ8A 1YR9A 2XXAA 2EJWA 3KKEA 3O74A 3VR4A 5FBRB 4ABTA 1E3IA 5DLDA 1FU7A 5LP6F 1E0JA 1H6CA 2DAPA 5DBFA 1SWWA 4NCIA 2OFFA 1XTZA 4D8VA 4JFAA 1GV1A 4WJLA 4V0ME 4QHSA 3MYYA 1QX3A 1YMVA 3QU9A 1HF3A 3BGIA 2XYHA 5AXCA 5I9BA 5SYAA 2HCJB 4R9UC 3KQVA 3O47A 1CETA 3UUFA 2G07A 5JNTA 3LY9A 2KW5A 5I4BA 1DO2A 1IDN1 5HQJA 1PG5A 4UC0A 1TQ2A 1T0HB 4J6EA 2V96A 4BLVA 1VSBA 3EGDB 4FEYA 1XVIA 2PMEA 2COKA 4JSTA 5G1PA 3H2JA 2RI0A 5CHYA 3I9MA 4UBJA 2LGJA 4C4TA 1BXRB 3HDJA 5ALMA 3BGDA 3A1EA 1WLYA 1URPA 1E7SA 4I9UA 3TRIA 3UA4A 3A9RA 1GUDA 2D1QA 4LRXA 4KQCA 1VE3A 3FHOA 1DRUA 1EVEA 2OAQ1 2VP2A 1AMUA 1YDMA 2J4CA 3CZ9A 2FSHA 2NLOA 3H2IA 3NPMA 4KAFA 4MA5A 2CJXA 3IR5A 2Z95A 4AJ2A 5A4JA 4X00A 1E1QA 1GCGA 4HUQA 4IUDS 2QN1A 4N82A 4F97A 1O6BA 2PD3A 2FZWA 2O3JA 4KN5A 3RJ9A 3D6VA 4DPLA 4ZZIA 4XDYA 3WOVA 4GQAA 2JCVA 5ELXA 2YXEA 3NJRA 2G8LA 5FOTA 3UGKA 2IDKA 1U3DA 3O7MA 1A72A 2BMDA 2I4NA 3KTAB 4GRIA 4QARA 2C1ZA 1EFAA 1WVIA 2WJWA 4TV9B 3K2BA 4UATA 3F52A 3A1UA 2R2GA 2NTYC 2H3EA 3BHNA 4G0XA 2X2FA 1M1YB 1WNFA 3DEIA 4WDRA 1I6MA 4GBED 1RWKA 1MCZA 4J49A 1I30A 5IF9A 4LDZA 3ZE2B 3OESA 3M9WA 3QM1A 2PKRA 3TAHA 4HAZA 3V33A 1Y3FE 4L9RA 4J4HA 4JB8A 4X60A 2WUWE 5DDIP 4WOPA 3R7SA 3IE2A 4CLRA 1TEHA 1M2GA 2YZGA 2IUEA 2EG5A 3D8HA 5HIJA 4UW9A 2C1XA 2OOSA 4HDAA 1VZ2A 5FI5A 4DILA 1AMNA 1YFLA 3U3DA 3ZDDA 3COJA 2HDWA 3P9RA 1FA9A 1RE1A 5L6MB 2WVJA 4WDQA 3UK2A 4C20A 5K8TA 5M34A 4KQ9A 1EP9A 1C9JA 2VP6A 5B64A 2IYWA 4NJEA 4D5GA 5HKBA 1KVRA 2Q6KA 1YT5A 3STWA 3OIWA 1K86A 2O07A 3LPNA 1K6MA 2AFRA 3OJCA 1JZQA 1FFBA 1K5PA 1NSFA 1DC4A 1PGNA 1U2SA 2OBLA 4YLEA 5AW0A 4RW0A 5T6MA 3AT1A 4WFIA 2DE0X 1BQ4A 1KVUA 5CDYA 2Z6AA 4IO0A 2HA0A 1X39A 2J45A 4QDJA 4URWR 1USKA 1KJZA 1Z12A 3G2OA 1DG3A 3HBLA 1U2EA 2JIQA 3O8NA 3R6DA 1U94A 4KO3S 4FYXA 4R7TA 2OPBA 3WNZA 4E88A 2E89A 1NAHA 4ENPA 3CCCA 6NULA 5IWCA 4JL8A 1ETHA 2TMKA 2C4HA 1KI6A 1NW6A 3OBIA 1H05A 3AKYA 3DBIA 3K1AB 1O77A 4L9AA 3EAGA 4QGAA 3MTGA 5A0VA 3OM8A 3FYHA 1XMJA 1GPJA 4KMOA 1KMHA 2QJTA 1J9ZA 3I30X 2B83A 3ROKA 3PWSA 3H8VA 4U5XA 1Z33A 3B5EA 1VJTA 2XMQA 4F2WA 2EFDB 2G09A 4K81B 5KYWB 2QZ4A 3EVTA 2PJRA 2D13A 1Z4IA 3O95A 5KJ1A 4LHXA 4OLJA 1K8ZB 4Z9AA 3TMYA 3KV3O 2J32A 3AH8A 4LNUB 1RZRD 3AZOA 5I8WA 3K9WA 1E4EA 5FCDA 5LA6B 5THKA 3HXLA 3EE6A 3W79A 1GUAA 2IOQA 1EXVA 4O3MA 1D1PA 1XTRA 3C24A 3G3EA 3OICA 2I8AA 3THYB 1TW3A 1YKSA 3QJGA 4UUBA 4KMMA 3VHQA 1XU9A 2BH9A 5AXDA 4RMNA 3PC2A 1SBTA 3ZY2A 4DC9A 3N70A 2XI4A 2QE7A 1U8FO 3M5DA 4RTMA 3EIFA 1GGHA 4FX2A 3F6PA 3RRXA 1P73A 3L1IA 3RAGA 4UBIA 4P0PB 1H2BA 2Z2YA 1JXOA 3L7IA 4RLFA 1IZ8A 2IH5A 3ZWWA 4XWAA 1OR8A 5C7IO 5DP1A 4DCVA 1F4LA 1OW3B 4EEXA 3A6DA 4IWNA 2LKDA 2O2DA 4ETMA 4LY9A 2X19A 1ES9A 2EFEB 2FPIA 4NV3A 2WABA 3U62A 1H2WA 1U2DC 2OR3A 2RHLA 1UDBA 3KZCA 3WL7A 2BFFA 4NMHA 1RJ9B 3VAAA 4X4IA 4B87A 2BM9A 3RYIB 1LFDB 5AVTA 5JCOA 2GASA 2XTJA 3FWYA 4UULA 3SG0A 2PNJA 4HB2A 2DVMA 1U8TA 1PFYA 1VKNA 1XU4A 4IVZA 3FOWA 4XYLA 3PVCA 1FDVA 1E2EA 2O4CA 3R6WA 2WTEA 2Y1DA 1AA9A 1JQAA 4A27A 1LGYA 2XE4A 2P8SA 1MN6A 2HINA 2VL7A 4KV7A 5E2IA 4Y42A 1IBRA 1Q1QA 1XWWA 2HSWA 2QT0A 2OYRA 5CBPB 2Q2VA 3W7AA 2WKWA 4M54A 2G82A 3PEWA 1K9VF 1G3RA 1WD7A 3L8FA 3RR2A 3HGTA 3M1LA 3HZIB 4IHKA 6ABPA 3I72A 1OIWA 2XNJA 3I58A 3DBHA 3FRIA 3L8ZA 1F0KA 3FB1A 3MRSA 4HLCA 4TYMA 4UEOA 1SHZA 3HUTA 3U09A 5CIQA 5IARA 1MR3F 1OUMA 4U3JA 4ATNA 1HG0A 5JJKA 2BJVA 2VPTA 3AJRA 3KCQA 4DR2B 5EXEA 4RHCA 4I4NA 3SHTA 4AW9A 2O20A 2XR1A 5ALFA 1PS9A 2HDNB 4ZD6A 1G4UR 4HDNA 2W2KA 3C5HA 3D6UA 3MMPA 4NBSA 2WUEA 4B6JA 1VL2A 5HIKA 2AOWA 1FNSA 3RS0A 3R5XA 2A14A 3T35A 1SULA 2ECFA 2ZXEA 3MJFA 5DCLA 1E94E 2V5AA 1NW9B 5B7PA 3JVIA 1A4XA 1UBUS 1OF1A 4URXR 3RRNA 5TJHA 1L7BA 2J0EA 3GPDG 4L72A 3NTXA 3VJMA 1SO8A 3V2GA 4AY6A 4F1JA 2A92A 2EVWX 4WBNB 2HA4A 3A9TA 3ITDA 5CFZA 3DBLB 3K9QO 4Y67A 1IBSA 3M9XA 1OWPA 3ON5A 1JH9A 3D8BA 1FTYA 3L1KA 1YRBA 3IR7A 4PX3A 3OE5A 5DASA 4LS3A 2BCEA 4EFKA 1KI7A 3QKIA 3ZZTA 4HNTA 3L9XA 4CIXA 2VJDA 3HGQA 4C4RA 2W6CX 2J3DA 3QWFA 2QSUA 3TG2A 3DE6X 3R4CA 4TXMA 4OA8A 3T8YA 1R37A 3MF4A 1GUZA 4FNOA 4MV1A 3MUOA 2W2PA 2YV4A 1EG7A 5AW9A 4XVCA 2ZSKA 5D7NA 2AXVA 4CIYA 3PHBE 3VV2A 1JIKA 3DNFA 1QGUB 4B4OA 4C76A 1P4SA 3X2EA 1HLPA 1TCBA 2IH2A 3PFKA 2W8BA 4NCHA 3ZVMA 2ZTSA 3BK2A 2I1QA 3QK7A 3HJAA 4IDFA 3FDFA 4V0LA 3HO8A 2P0AA 3ONFA 2LVBA 2W2NA 2XE6A 1Z82A 1OGIA 4MI3A 5AHOA 1ST2A 5CVCA 1KI8A 3PD1A 2QSZA 1YBHA 1SN7A 2I2DA 3LCMA 5FQOA 1PJAA 3LI2A 4IWXA 4FWTA 1JBEA 1GRQA 1MF7A 1VP3A 1WTCA 1LSOA 2UU9B 4BEBA 1AOXA 1JG4A 1COWD 1G5IA 3EUAA 3BK1A 2O06A 3MSXA 4ZDKA 1YKFA 1UP7A 1YV9A 1KL7A 2NP6A 1A98A 4GVXA 2DT5A 3BREA 5F12A 4YDRA 1F6WA 1JXAA 1GV0A 1RKVA 4YMHA 2TSYB 2VA9A 3H4TA 4ENVA 5AIBA 2PDAA 3G17A 1MAVA 1QFZA 1NUAA 2XWPA 4GWLA 1F0NA 2YMPA 5EQFA 4JQCA 2YY7A 1MRZA 3WO0A 3ZWYA 4GOJA 4TPKA 2R96A 2WIGA 4INAA 3UNXA 2JC3A 4A6DA 1X1EA 4IX9A 2HFKA 2P2ZA 3C0KA 3MTAA 4E70A 5I7SA 2ZJ6A 2AR7A 4HR7A 2HYIC 4BLPA 3WK9A 3SBXA 1TYAE 4HNAA 2EKBA 4HYTA 4BWFB 4QRIA 1U3VA 1W48A 5T67A 4ZIRB 2FMIA 3OX2A 4GI2A 2VHEA 1VMKA 2P35A 2TECE 4H6XA 4X44A 4MRMA 2GKOA 3SZGA 3LCJA 3UAWA 4JELA 2UUOA 5FL7A 1T9CA 5B6JA 5ADHA 1AKWA 2HAEA 1CCWA 1Q1GA 3U4GA 3B1JA 1XD2B 3H6HA 4AKHA 4MUJA 4BMOB 4BZQA 1AKQA 1MAHA 2VK4A 3SSMA 3EW9A 3LYAA 2PGAA 3WLPA 2APJA 5KOIA 5ENZA 3CXRA 1VJRA 1L7EA 2NPIA 1XC7A 1DP4A 3C43A 1ZVJA 3FYDA 3PE6A 4PZDA 3FRJA 1VL8A 1LTHR 1ADRA 4MGZR 2WF9A 2YOFA 3DO8A 4U9HS 4GZ6A 5WRFA 3M6VA 3BULA 2RGYA 1VPEA 1YE8A 5FBZA 5ECWA 5IVDA 2PJDA 3W2TA 1MLDA 4QULA 3KYDB 1O4WA 1M34B 3NC4A 5A4AA 2AKAB 1JHOA 1ZM3A 5K3DA 1F51E 1YSEA 1QH9A 2FW1A 3FXAA 1ZESA 3TN7A 3HV0A 1GAWA 4Y7CA 1QFSA 4CG2A 4YRJA 3IUQA 1OAAA 3R5TA 5DMXA 3QQ6A 2ADMA 3MCAA 3NZEA 4YHBA 3SC4A 1SPBS 2VDOB 1CUXA 3UFXA 2QMEA 4XX0B 4TMKA 4XVRA 2K7ZA 3OM9A 5K99A 5AK0A 1A9PA 5FYDA 4K40A 3FH0A 4YTEA 5A3RA 1LX7A 5JYEA 4JLAA 1KAQA 2C2GA 1A76A 1USIA 2P7HA 3IC5A 3K8OE 4NK5A 5K9ZA 4JL6A 2BN4A 1JEQB 2BFCA 1TT7A 3TL3A 3TQCA 3AVPA 5GMOA 3LA8A 2OCDA 4XM2A 1AXRA 3G5GA 2JLVA 3ELWA 1X8LA 4FFRA 4MULA 4QBTA 2NTEA 4RY8A 4BNMA 3ZUPA 1RZ3A 3AZPA 3REQA 2AC4A 4MVJI 3TUJC 4QYMA 5FA6A 3LTEA 2RHDA 4CTJA 5B36A 3CFYA 2YQ4A 3GFSA 3E27A 3KDSE 4JL5A 1QHSA 5FOUA 1DG9A 1QHHB 2A0XA 3EMVA 3FMIA 4D79A 1IUNA 2PXXA 4M76B 1H8HA 2MSNA 4XEUA 1KO4A 3DUFA 2SKCA 5B2FA 2A84A 4L3VA 3SIWA 5A0FA 5JRZA 4LC9A 2D4HA 2HHCA 3QFFA 1Z34A 1NW7A 2O3SA 2WJVA 1CUZA 3K32A 5TF4A 3SZ3A 3FOCA 1RAEA 2V8OA 2FPPA 2BVNA 3AHGA 3LCCA 2PWPA 1Q17A 2GK6A 1IY1A 2JAQA 1N77A 4YBAA 1HETA 4HAUA 1EGAA 5G02A 4CN9A 5KQGA 2C3MA 1W2WB 1FCJA 2JK1A 4QJ4A 1R4MA 1XTIA 2AFIB 4RH3A 4UEKA 4W1QA 4DJFC 3PNLA 2FH5B 3AEYA 4UAJA 3UMJA 3ZCRA 4JI8B 4DQ0A 3UW3A 3JAKB 4HOYA 5D5PA 5IJAA 7YASA 4D3XA 3P2OA 4ZOLF 4X9XA 4RQUA 5LB4A 3OWXA 4OYRA 3NVMB 4G0OA 4LTMA 2DR2A 4BP3A 4XM0A 1KBQA 1WMAA 2ESRA 3GJXC 4JOCA 3W3AD 3LP5A 1GR1A 2ZANA 3AJ9A 2C59A 2Y1GA 3MINB 5HKLA 3ZD9A 1P4HA 3QE3A 1S8OA 3DDOA 3IXMA 4R8MA 2KJQA 2PMCA 5HGJA 3A1TA 3DLTA 3HSKA 3C1TA 5ECYA 3G5LA 4O4HA 4FC6A 1CDOA 1JG1A 3T1YB 2CYAA 4QDZA 5JJBA 5LYJF 3W7VA 1DRVA 4CKXA 1M0EA 4YBZA 5J2UA 3N2NA 2FPGA 2GLUA 4WWHA 2G9UA 1XAJA 5IC5A 3T3EA 5JS8A 2FTKE 4PVCA 4G2TA 2VEOA 1U9IC 3HVRA 4TWJA 2HQ1A 3FNQA 4FXPA 1C1DA 3ROMA 2XNDD 2JNWA 2H11A 2C54A 3OA2A 5E6RA 1CUAA 1HOXA 4I6TA 3AL3A 4N7BA 2A9OA 5I4KA 4LRWA 1HT1E 3RUEA 2UUCB 5DNWA 2J08A 4OB4A 1O96B 1T3HA 4MLPA 4W82A 2ZR7A 5EMKA 4JBNA 3V7YA 1BMDA 3CCFA 3SR4A 2VLIA 2ZRHA 2QQ5A 1D04A 1K92A 1NVTA 1PR6A 3AHHA 3D3JA 2R7MA 3PFBA 1GZ3A 1SUSA 2K2QB 2YHUA 3VZPA 4JYAB 1U7TA 2PVSA 3DPSA 1CUUA 4NYJQ 3ZWXA 4FK8A 2YWJA 4MKFA 4K3UA 4LCJA 4EJ6A 5IN4A 2ZT6A 3PXAA 1NY6A 1U2PA 3N39C 3UJCA 3DVSX 4LJAA 3VK0A 3UMMA 3CW9A 4ZVOA 3O8OB 4BO4A 4DLNA 2ZBVA 2FQ1A 2C42A 5ECDA 2ILVA 3KXDA 1JTVA 1NU8A 1YQWA 5EMJA 3AYXB 4F9FA 3SICE 2PAAA 4AN1A 4D8UA 2XDQB 2MEZA 4UFOA 5H7XA 5HA5A 1AV7A 2F2TA 1QO7A 4CF4A 3GFRA 2WWRA 3U7FB 3IILA 3U2QA 1DNPA 4GWKA 4ND3A 1WZUA 2HR1A 3RIXA 1MB9A 1AKYA 1BHJA 1RPJA 3DVLA 2CV1A 4I4IA 5DSZA 1U4NA 1XZNA 4M98A 4ZALA 3LL4A 3IDFA 1DAIA 2GERA 4Y2PA 3DQPA 3OZRA 3UK1A 4Y0NA 4B3IA 3BS3A 5ENVA 4L6IA 2B8EA 1YHYA 3QYJA 2I62A 1XQ9A 3RSOA 3L0SA 2V6IA 4EPRA 3A6JA 3JTEA 2FSVA 4A36A 4X6UA 1ZNXA 2GZRA 2JIMA 3U4HA 3N5KA 2HBYA 2IPXA 4YB8A 2JATA 4KGZA 4PNEA 5K2OA 1OH6A 5K3CA 1UBFA 1OX6A 1KYTA 3W6NA 3DT8A 3PNKA 4UCXA 3UFDA 3R24A 2Y77A 5L8VA 1SZCA 1T4CB 3RVMA 3PHHA 3VNBA 4F5ZA 1QJCA 4A03A 5TX7A 4IEIA 2IY9A 3TE7A 4UPEA 2GPBA 3KZMA 4FFSA 5HIMA 3W34A 3BRQA 3VNQA 1Y3DE 3T1VA 4X1KA 3BXHA 1KQPA 3NHSA 5CD1A 5DK6A 1YUMA 3CUTA 3IQHX 1V3QE 1KQOA 3OUUA 4OXIA 4GKKB 3RFVA 1W46A 1Y5NA 5C1OA 1EB9A 1ZKMA 4IHJF 2B9VA 2FZGA 5C8YA 2LYRA 1SR8A 3ID6C 4R4JA 5ALNA 3T3DA 5BURA 1E69A 4QPNA 3ZIDA 4XOUA 3I5MA 4O8CA 3GFPA 2PFSA 2VCYA 3GRZA 1S1MA 2Q6LA 3E05A 2DLDA 3JR3A 2G1AA 1B3BA 2WM8A 5BWCA 1IOZA 2JGRA 2VRWA 2J9GA 3FYMA 4JJGA 3IE0A 4O08A 4DQDA 2XRZA 3O4JA 4JC8A 4V1CA 5GZ1A 2ATCA 1U8AA 5LP6B 3OOSA 2WHPA 4NX2A 4MCJA 3I2FA 3LSTA 2HV9A 4EG3A 5F78A 2C57A 4H4DA 5KOJA 3CKYA 3S81A 2HIMA 1SUFA 1L7NA 2IPAB 2Q8NA 4WXRA 3VHLB 3UC5A 1N5OX 1J8FA 1CJBA 4PGMA 1CS0A 3IP8A 3CURA 1YDWA 3STTA 1XMIA 5LJIA 4J43A 5JIBA 3EWAA 2IQ5A 1WB4A 4CQMA 1AM4D 1Z0AA 1HT2E 3N9IA 4DLWA 1VA4A 2H06A 2NO1A 2Y76A 1NIJA 2ZRCA 3C5VA 3ZNPA 1OZGA 1PX0A 2LXNA 5IWAB 2OUIA 3T38A 3JAWA 2BBTA 4CTKA 2X8WA 2RHOA 4XJSA 4XQ9A 5DVZA 3RSLA 4I3GA 4QUGA 4F04A 3V97A 4FYIA 3LIIA 1V1RB 4BNUA 4BP8A 3AKEA 5ELLA 3K92A 1SK9A 2AFHA 3DULA 2FF5A 2NYRA 3PC4A 4GMFA 2VHWA 2G1KA 2HSDA 1XZBA 2ACVA 4K9LA 5LOVF 1YS9A 2OBMA 1PLKA 2GAFA 5EJIA 5MF6A 4K9OA 1H1TA 2L8NA 5TVGA 2OFYA 4NR0A 3WNDA 4PHFA 3GMDA 4J7AA 3DEJA 1GDHA 3EXEA 3RAEC 2D8MA 2SBTA 1O95C 3GJ4A 3JQFC 4ESOA 2QVZX 1E7WA 3BC1A 2ZR0A 2P9GA 1DWKA 5AVSA 1NUTA 1XEWY 3EAFA 5K98B 4L0DA 2QRZA 3ZLUA 2LLWA 1C9MA 4ECEA 2PWAA 3DE1X 1ZCFA 4QSHA 3SS7X 1A4RA 4AG6A 5LQKA 2UUPA 3G5AA 3V4ZA 3QVGA 3EJWA 4CUZA 1P17A 1T8YA 3II6X 1H9CA 2H2IA 1V8ZA 1XZEA 2HNBA 2QTMA 2R6CA 3BFPA 4JSYA 3ZNNA 5CVVA 1H2AS 3JRXA 4AJ4A 1K63A 1A2BA 2O0HA 1YJXA 3HP4A 4N0PA 4IGEA 3RQIA 2V0CA 1DCTA 3NHZA 4QTTB 3EULA 3M5CA 2Z8ZA 1BA2A 1E9SA 1JLMA 1L7XA 1FMLA 1PSDA 3NT4A 4WINA 4HAVA 3VU1A 2P77A 3PC7A 4GMXA 5TQ0A 3R3SA 1PKXA 3PDUA 3R09A 5C5DA 4MYCA 4F71A 1H0RA 1P5ZB 3LX5A 3I39X 2AQ8A 5EIXA 1X7YB 5T8KC 4JI4B 1C4OA 3ETHA 4KK4A 2RGEA 4XI9A 2ZQ5A 5KO2A 3PE4A 4FPXA 121PA 1JS1X 1V39A 5ICMA 3DDHA 4FGWA 4H7JA 1M8PA 3HLYA 4WXHA 4K6KA 1NF9A 2FZLA 2JAWA 4DIMA 3IDZA 3GY0A 1OV6A 2DBZA 1R1DA 4K26A 4MHSA 3OAAA 3C97A 4YARA 3RJTA 3SIPA 3SVZA 4C2BA 4EW1A 1OASA 2GPNA 5A4KA 4RY9A 3ADPA 3H5VA 1UBCA 3LLUA 3H86A 1Y7YA 3JD2A 2HA5A 4YAIA 2Q5IA 3RAPR 3OTHA 1ZZ9A 1DIRA 4OFXA 2W98A 1E63A 3ADKA 1NQTA 4IDBA 1HSZA 5TPZA 3WKCA 1J2YA 1F38A 4WA8A 4KR3A 3GZTB 1WHSA 3W1VA 3OOWA 3I1YA 2RGNC 3PLRA 1BWSA 4HXEB 1L7DA 4PHGA 1HO3A 1O94C 2GAOA 2QVGA 1LTKA 3SE0A 4AL4A 4HUJA 1T1SA 3KOWA 1LNQA 2WB4A 2E4ZA 2IX3A 3ZJVA 3EPPA 2A59A 1YR6A 3M6UA 1OXXK 3BQ9A 3CEJA 4K1XA 1FBTA 3E2MA 3BE5A 3K0FB 5IKXA 1R0BA 4HD8A 3DMTC 521PA 2ZYTX 3AETA 4MINA 1NVBA 1B6TA 2CJWB 2VJLA 3C8DA 3T6KA 3UOGA 4RF2A 2HU8A 3DMHA 4FSHA 1Y6FA 5FV7A 3L06A 5GJVC 1E0AA 1I4TD 2PZEA 2WTNA 3TJRA 4MUNA 5DFAA 3RWMB 5I9LA 1PIWA 1TA0A 2REBA 1S3FA 3D0OA 3D54D 4NS4A 3RHSA 5JHHB 4X4FA 1GZ4A 3R3UA 4BHTA 3ZV4A 3TF5A 3S1SA 2JBWA 1OLSA 2XUHA 4JGIA 2G83A 1JSZA 4QYIA 2AXQA 1V7PC 2AKYA 2PO5A 3B36A 4NE2A 2OVFA 4RO0A 2AQKA 4YS6A 4I3FA 4EPYA 4PNHA 4EJ2A 2I2CA 1HC7A 2V9ZA 2ZREA 1TYEB 1HL7A 1Y81A 4DQLA 3FOFC 5AVJA 1IBKB 5BN3A 3DVQX 4N6OA 1Q7CA 4L95C 4CV2A 1YVEI 4H3VA 3NWJA 5DNYB 1OXUA 4H1UA 4LSMA 2HPVA 3IEXA 2VHCA 1PRUA 2PPLA 4NESA 3GBPA 5BNIA 2DBRA 1YFJA 1IEXA 4I6GA 4PBTA 3U39A 4ZMBA 3ITKA 3KUCA 4EUNA 3RRBA 4CKEB 3FWKA 3H2SA 1H2ZA 3AUTA 2IIQA 1A0OA 2W2OA 3GV0A 1GGMA 3MCZA 3FOBA 4FMCF 3NLLA 1HDEA 1GL9B 1TNDA 2XUJA 4BMXA 1KK1A 4KO4S 4BX3A 2ORED 1NX9A 1Z6XA 1MMFB 1SKYB 2D1SA 2ZSAA 3QEAZ 4WKOA 1MGPA 5F98A 4BVEA 5IBPA 1II8B 3ZDEA 1DO8A 3ILXA 2PTHA 2RE8A 2R84A 3ESXA 5CCXA 2H5EA 4PFQA 5JWHA 1QTQA 3SHOA 3VHXA 1I7NA 2GCOB 2V7UA 1VSTA 2P4EA 4F5EA 4F85A 1CRQA 1QIEA 2FWJA 1PNTA 3BMQA 2HIAA 2P5SA 3ONDA 2OV8A 5CDHA 4CKWA 1EQAA 4PSAA 2C7PA 1NVVR 1QMPA 3C74A 3D5TA 4D9NA 3JXCL 1KJ9A 1Y8RB 2QM8A 5BNFA 3PGMA 1T25A 4HB3A 4AULA 1S01A 1NMQA 1XZFA 2Q1TA 3O7WA 2YVQA 1JAYA 3USES 5C37A 1CULC 4KSYA 4MEAA 4PQEA 3UTDA 5LQJA 4I46A 4QOSA 4TN5A 2ZRQA 5CFLA 2NZ8A 2PXHA 1CS4C 1V5EA 2H2FA 4IQ8A 4AX8A 3O1JC 5BV7A 1TFUA 4E30A 1JDZA 4ZOQI 4BEVA 1NJ1A 3GZNB 1ZXBA 2EL9A 3SC3A 3ZU5A 2H85A 1L5ZA 2OD2A 5D1NA 3GGOA 5KSYA 2B4TO 4B0PA 1W75A 3MTQA 4UM8B 3QYAA 3AP3A 4NYMR 4JAVC 5L4NA 1TGYA 4P3OA 4X61A 2HHJA 3I4CA 4FLFA 3F7TA 3ZHBA 1CKEA 1N6KA 1GKLA 1U31A 3R3ZA 4KDCA 1ZD5A 1DAGA 2ACWA 2FUNB 3DO6A 4L07A 3WYCA 4LF9B 3JRNA 2OYCA 1C7FA 4ND8A 2R5FA 3DXYA 2BF4A 3CLSC 4HKTA 5A06A 5I9NA 1GQFA 3ESYA 3ET5A 3ZBPA 4DBVO 4H6VA 3VYUB 1JMKC 2XWBF 4XEHA 4BNKA 4RPJA 2HLHA 5CPBA 3NBZC 1XHLA 2GUWA 1UM9A 1KZHA 4EHLA 2CSXA 1XR3A 2BWJA 1A97A 3SN6A 3JYQA 3OMLA 3TKAA 1G7RA 1C4XA 1R4NA 1U0TA 1D0IA 2CZGA 2WTMA 2YIDA 3U4AA 4BB6A 1WZEA 4N65A 2D4AA 1F4VA 3UQZA 4C9BA 2PKYX 4U2CA 5JQGF 3PKJA 4NPHA 3UUGA 4PLYA 5KQMA 3RU2A 3UY4A 1RWBA 2NZJA 3JX9A 1OJ7A 2CXTA 1YCGA 3AR5A 3LUCA 1CVLA 4KVGA 3V8QA 5DI3A 1V3VA 3E22A 4UHCA 4WE3A 4EGCB 5AVRA 2A2ZA 3VKGA 3NW9A 2ZJ4A 3P9IA 5IJ0A 4RK1A 4MI9A 2XUZA 3DONA 1CSEE 4KQKA 1SOMA 2AYYA 3DOIA 3UKDA 4ALJA 1POXA 3A4NA 4ZHQA 4EPXA 5EE1A 4C7MA 5IJWA 3IQZA 4F4DA 3UHOA 3WQQA 4LC0A 3UG7A 4E21A 4IXDA 1BHSA 1LA2A 3LO5A 4LYEA 4Q6BA 4NY1A 1VLVA 1L1EA 3TEJA 5JD4A 3QEKA 1ACMA 2IY7A 1A3CA 3PYMA 1BZYA 4C43A 5JDIC 2FAXA 2ZWAA 4YRFA 3UOAB 1E4YA 2GM9A 2Y27A 4IEFB 3VZBA 4D82A 4KO1S 2JHGA 3JWPA 4NMXB 1LEHA 1FSFA 2BONA 2Z98A 3PUKA 2XGJA 3UEOA 3D02A 2IF0A 2VBCA 5ILGA 2VFAA 4F8JA 1SC4A 1KFCB 3NZLA 2ZE8A 3TIGA 5BR8B 3O03A 1QZUA 2F4VB 1SCKA 5BT8A 2PYDA 1KFBB 3P2IA 5AVKA 3K53A 2CVOA 2IV7A 4XRGA 1E3OC 2GF2A 3OLXA 4OF4A 2I22A 3OY2A 4CU2A 2WQ6A 1MQ9A 2IP1A 2PZAA 4DMHA 5KWIA 1YASA 3SHVA 4MP3A 3TTVA 4DNOA 3A3KA 1FRQA 4LFAB 1XTKA 3G82C 3OTIA 1R3DA 1SXHA 1E3QA 2ZU6A 1YBVA 3EB9A 1GJRA 3M6FA 1QPBA 3ADBA 3HHPA 4KB5A 3TTXA 4BVGA 3KLBA 6GPBA 3KB8A 4K46A 2Y3IA 2BSXA 4GZLA 3AYZB 4PAGA 4KLCA 2VJCA 1GYQA 3LY5A 4GNKA 2QUAA 1J8YF 5BVGA 4O2RA 1H5QA 4MP8A 1XGKA 5LIRA 1PAUA 5E7IA 4B40A 5IAOA 5JMTA 3UHFA 1W5FA 4MB0A 3HVJA 1EFKA 2MT9A 3CLRC 3QPWA 4H3HB 3ICCA 3UJ9A 1GY8A 2VSOA 4Z4CA 4AP9A 1DE0A 1ZD4A 2XF8A 4PINA 1Y1SA 3SSNA 1TEVA 3TD9A 4REMA 1HQCA 2JHPA 4NEQA 2P2CA 3ZN2A 2ZROA 3IKVA 2B8JA 5EVJA 3CECA 2QL7A 3AHFA 4AD8A 4F4CA 1HURA 5FA8A 1W5TA 4Z8XA 2OHHA 4BVFA 3KAJA 1FL9A 5C1DA 1G7SA 3MWLA 1E3LA 2FPRA 2IF2A 1AKTA 4OSEA 1S9DA 1TLLA 3BJMA 1BDHA 3HY3A 2YV3A 3DP9A 2GEDA 1GA6A 4L8YA 3ZK8A 3CRVA 5JV5A 5TIIA 1XCJA 3KB1A 1P0MA 2ZRGA 3BKXA 2VTKA 1LSUA 2ZU0C 3BGVA 3I8SA 3PGJA 3PTLA 4P4SA 3HS3A 4Q3EA 3TKLA 3SX0A 3IVRA 1A71A 1IXRC 4HZIA 4G4JA 2HWWA 3JD3A 4HK4A 1RQGA 3EGCA 1DX9A 1ENYA 3VFDA 1HORA 2GJKA 1QRUA 5KDLA 3E53A 4NFSA 3FY4A 1JLRA 1SB8A 3O93A 2FPKA 5G4LA 3QWIA 2XI8A 3U3WA 3AR9A 1P1CA 2V3CC 3GHHA 3A10A 1Q7EA 3K72B 4TSRA 4JI6B 4B83A 2VTDA 1JEYB 3BL6A 1KEZA 4HS4A 1ZX1A 1IM8A 1THTA 3CLUD 3GRPA 1PT6A 2B4RO 3F0TA 3IV9A 2CKMA 3IQDB 1OXKB 2DF8A 3NTUA 1C3EA 2LYPA 3P71T 5JZSA 2BF7A 2JGEA 4S12A 5L95A 5BSHA 4OMUA 3DEYX 4U1RA 2BHSA 3KSAC 2WPDA 3D2CA 4DV4B 2BFAA 3PHLA 3O9VA 1WULS 1P7PA 3V1UA 4EYKA 4XB6B 3ZGXA 1R4ZA 1UJ5A 2A9VA 2FY8A 5DWDA 2GK4A 2NV0A 4POOA 1B1AA 1MRSA 2C92A 5FOVA 3QVJA 2WR8A 4NS1A 4UU8A 4KWIA 4ZCLA 3H9JA 3ELUA 3WRWA 1PR1A 1IZ7A 1JQJC 3PF9A 4KVFA 2AUTA 3HU5A 3I64A 4G4GA 4PX5A 2WB2A 2ZTVA 4ACBA 4ENTA 4Y1RA 1EVZA 1G66A 1UCFA 1THMA 2Q45A 3A31A 3GCDA 1FPMA 4X5OA 2UZAA 1YZNA 1K6JA 3HBMA 2AMYA 2BEUB 4B4UA 1FNNA 2B5VA 2BM1A 2ZYDA 2C94A 2ONZA 2HREA 3QMMA 4KYIB 4KL8S 3FWHA 5KYUA 3LCRA 3RI3A 3F3KA 3JALB 4LMAA 1ZHFA 4GUAA 1CE8A 1RP7A 3H7AA 4CIVA 5JI3E 4UNQA 5BOSB 2NU7B 2IS1A 1AK2A 4HGQA 3SOZA 3KVYA 1M6VB 3FYUA 4ZOLB 3RUHA 5A5GA 4EG6A 2JJ2A 1NC1A 1SD1A 3TRBA 2O4UX 4HATA 1H9BA 5F52A 5JAPA 4Z4EA 2KSQA 2OHOA 3OU2A 3L8EA 5AJUA 1BGWA 1HE3A 3CBQA 3U37A 1LK7A 3EOAI 1AV6A 4OPMA 1CLEA 2ZE7A 2QTAA 3STHA 4C6TB 4DUGA 3VR5H 4IGAA 4K6CA 2LNMA 4KN6A 2B92A 5JZ9A 3KZVA 4Q7LA 2BAGA 2GN4A 2YWRA 3FJ1A 3M1YA 4H7DA 1YZKA 2VCEA 5AIAA 1SPXA 5LYJB 4L7VA 1NC3A 1E99A 4DLLA 4YMTA 4U5QA 2XYGA 3WMEA 5CTAA 3J80A 3U60B 1KQ3A 3IAEA 3P94A 5MN5A 4BEWA 1YE5A 1L4YA 2QUKA 1XXHE 4IAOA 4TTPA 1RBQA 4KQHA 2WI8A 5AKEA 1KDVA 2GHTA 3FSGD 3V34A 1DKRA 4LJ8A 3DDNA 3TRDA 5E4TA 2GDJA 5LD2B 2UZ1B 3AF6A 5IK2A 5KSPA 3QOXA 4AB1A 1GTSA 1MW9X 1QYWA 5HCUA 4NQZA 4X1YB 4EB6B 1CIPA 3FVWA 3O0TA 4YMLA 5CAEA 1I1QB 2O38A 1ZSYA 4IXWA 3L77A 5IULC 3FSJX 4FS8A 3VKWA 1MZPA 4ESHA 2IS6A 2LCQA 3SDZA 1LKZA 2VP3A 1YB2A 4EUHA 1QC5A 4UHHA 3LWBA 3R3YA 1K0FA 2DBYA 3X0DA 4V0NA 5LPNA 3UPTA 3L7JA 1KHTA 3H5AA 4LN1A 4PR0A 2AYXA 3RYFB 2PLRA 4DCGA 4HUTA 5HQTA 5LSAA 2VYVA 1O5IA 4Q4AA 4FYHA 1PJQA 1R0WA 3HUDA 3KLOA 1KYVA 1LQCA 1N6NA 4M9XA 5FPPA 3HN6A 2Q9CA 4MV9A 3SIXA 1SWVA 3GFOA 4JQSA 2LTAA 3I9V1 3V4VB 3QVLA 1O57A 2NYAA 1HGXA 5ALKA 2W71A 3JQBA 1UZLA 3F6EX 2RHWA 3TR6A 3ZE1B 1Z5VA 2R79A 3WKDA 1CJSA 5HF9A 2BY4A 4U6SA 5SICE 3M6XA 5DNUA 1J0EA 2QV0A 4CT0A 3UZUA 2IUFA 5DT2A 2EJTA 5HQ3A 4AAYA 1W49A 1XZQA 1R0LA 2C84A 2CK3D 5IZ4A 2KLHA 5GAGi 4FHGA 3HEBA 5DE3A 1FJGB 4MQ4A 2R1UA 3DXXA 3EQ6A 2J1LA 2PBRA 2DPGA 3ORSA 3NALA 4RETA 5AM1A 3RTDA 1Y82A 2NTJA 3CLKA 3EZ9A 3SU8A 4CT4B 4TOIA 3IPXA 4HBZA 1NDHA 2BGLA 1VKOA 4LVNA 4YREA 4BFXA 3ZKWB 4FFOA 1NLUA 3WRXA 4OLAA 4C04A 1I51A 4CQLA 3B82A 4RDCA 3SQNA 5DW3A 1TUEA 4HNRA 3DD5A 3LX8A 4ZT2A 1ZUIA 2IX9A 3E5MA 3L8YA 3UATA 2G8NA 5J9FA 4CLEA 1DXOA 4TMYA 5IJ0B 5JVDF 3AF4A 3LBAA 1GKKA 2IODA 3L40A 3OEEA 4I1OA 3WB1A 4EF4A 4KHPB 4RZ2A 1XFDA 1NW8A 1W8IA 1MPTA 4O25A 1EJBA 1NMXA 1II9A 1NI3A 3KDPA 1YMUA 4OI1A 3U40A 1DB3A 2RBEA 4DPMA 1LJUA 1X8XA 2QU7A 3E3NA 4L1KA 3TVTA 4BZPA 4ZI3A 9GPBA 5A2QA 3NR2A 1N7HA 2QJRA 3GDHA 2NWQA 2EKQA 3GJ8A 1PNOA 3N05A 4F5WA 4IHJB 4ARZA 1W85A 5AM3A 3ROQA 5KU1A 3K6RA 1LY1A 2PM8A 2IU3A 1Y9DA 3ANMA 4D6YA 1AUPA 4HQKA 3VOSA 2ZJ7A 3G8CA 4IDCA 3B85A 3CLVA 3ETJA 3PYXA 2F1RA 2DHEA 4Y1GA 1GYPA 1ZUGA 1X6VA 4K9KA 2FQQA 3N6VA 1PG2A 5F2KA 2OB1A 2ZR8A 2NTVA 4K6MA 5I8ZA 3KTOA 3ACBA 1CLUA 4L50A 2JDID 2OCAA 1MW8X 2O3QA 1SU6A 3WX0A 1UKYA 4JEMA 4PVDA 1N6PA 4L3OA 4Q0MA 1RYDA 3S2YA 5J2UF 1W1UA 2M6RA 3RVRA 3WV4A 3KOZA 2R1TB 3IIKA 4HX2A 3VO1A 2H7VA 5HBRA 3MS2A 4CE6A 3O3CA 3WYFA 5FORA 1PHPA 3ONEA 3FOAA 3WGYA 2G25A 2WKSA 5SZIA 1BROA 4FI3F 2GF9A 1DIAA 2NU8A 1Z3CA 4DZRA 4YO7A 5EI5A 3DBRB 4RTOA 3HU3A 5C5CA 4G4SP 3BTOA 3VR2A 5KYXB 4W5NA 5GJBA 1HNWB 2GNOA 5CVEA 3TSOA 2Y67A 2ZBEA 5L4SA 4JV5B 1ZIPA 3QKUA 1L4HA 4MLDA 3KPWA 2UXCB 1OI7A 1E2PA 3MWDB 4BQQA 1XEXA 4E5VA 5JAZA 3GT4A 5A0TA 1MP0A 2B8NA 4GKJB 2BE7A 1E7YA 3WBFA 2I91A 1EGMB 1SVMA 3ZHVA 4KZPA 1QHEA 4WTOA 5I51A 1JFFA 3RGGA 4BQPA 3HB5X 3Q3EA 1JEJA 5CB4A 3DAFA 4G89A 2JCSA 3MS4A 2H7CA 4B6PA 1T10A 1W29A 4L74A 1VQ1A 1U2GC 5L40A 2IKSA 3GLIE 4PYRA 1DRWA 3BJRA 3AEZA 4QQNA 2EZ4A 2ZVDA 3QEMB 5CDSA 1ZG3A 2QR5A 1Q1NA 2B1RA 2I54A 3DV2A 3FX2A 5BSKA 5BMOA 1RM4A 3LBHA 3O1IC 1QFJA 3BCUA 4HDMB 4HL6A 3S2EA 5TC4A 1QKKA 2ZOSA 4J4TA 2QVLA 2OILA 4YONB 3GN1A 4G1FA 3LC0A 5M2QA 3CS3A 1TZKA 1YRYE 2G9QA 4TV8A 4CM9A 1OHHD 3EZGA 4EPVA 3JSXA 1P2SA 2QW0X 5TR9A 5FPYA 1XPUA 1CWUA 1E7RA 5TMDA 3WISA 3KQWA 3SZUA 1KPIA 1YQEA 2I6XA 3BUSA 5AUQA 3CUSA 5JPIA 2WINI 2QW1A 4DEXA 1PEYA 1BJTA 2P62A 1NXQA 1Q0HA 3CN9A 4JXKA 4OL9A 1EA7A 1PFVA 1X0VA 2I2AA 3CF2A 1J5PA 4EQZA 4FCTA 4URUR 1FQWA 1B43A 4OHKA 2YOGA 3TI7A 1WCIB 4IIGA 5KTRA 4XD7D 4PLZA 4LXUA 5F3DA 5JANA 1NN0A 4R8RA 3N2IA 1JWBB 1DT3A 1UWCA 2ZAYA 3G85A 3VR5A 2PX6A 1MC8A 4YCAA 4PTYA 4KN9S 1DFIA 1NUQA 1QDLB 4QAQA 2P90A 3QW2A 2C2KA 2GZHA 1RRVA 1RWNA 3TE6A 4F5YA 4M0MA 5F4ZA 4HWRA 4MQ5A 2BEVA 3I4FA 2CNDA 2JEYA 1O6GA 1JKXA 1CG6A 1V9CA 1ZEMA 1Q12A 1N5JA 2ATIA 3FKSD 4XSVA 3ZDYB 1XMVA 3U5TA 3L8CA 1EZ1A 1K1EA 4Q5IA 2QMUA 4ZCIA 2O19A 1UM8A 2RH4A 2XECA 3R8CA 3K6SB 3O8BA 2QYSA 1RXEA 2R4UA 2VRNA 3ROFA 1NBOA 2ZRDA 4Q12A 5I3ZA 3KPVA 2ZUUA 1SZJG 5ALJA 4EZBA 3CE9A 1U65A 1E5LA 1SG9A 2YJ5A 1E79D 2O57A 2VUSA 3WNCA 1TQ8A 2R8EA 1VMEA 3FMVA 4WCDA 4E4RA 4ZHSA 1CJTC 3GR6A 1BW9B 3LUHA 4KFCA 1OVMA 1KYQA 3Q9SA 4W5WA 1T0IA 2PXAA 3CUVA 2O1XA 2IXGA 5FAXA 2WP8J 1LLCA 2H1WA 1DIBA 2UVPB 1YQDA 1B3RA 3IS3A 3KJHA 4XIYA 5K0EA 3GGCA 1NJ6A 4C78A 4WT7A 3TDNA 4F2GA 1KWGA 1GADO 3EXHB 3SHWA 2GRMA 5JATA 3MUEA 3QV2A 2MXDA 4PZCA 3KHSA 2H4WA 2J46A 2DBVO 4MV8A 5F23A 1TJ5A 2VQ6A 1N2SA 1QQ7A 4GT1A 5JHGB 4Y6LA 4LF5B 4NDNE 3EZNA 3BMOB 4JU9A 2Q1YA 3AVVA 1GNPA 3OFVA 2H1RA 3QPUA 5JD6A 2PIJA 2H1FA 3SHQA 1XL0A 4A1FA 2NMVA 1ZD8A 4O2AF 2DMRA 1SHTX 3HDGA 5ITVA 1S2NA 4AZ0A 3IO3A 3MFYA 3HJFA 3BD8A 3HCBA 3L7BA 4A8JC 1XZPA 3NGLA 1LDNA 5TGTA 5EJ2A 5J4LA 2OVBA 2G9VA 4U39A 2HMYB 4YRGA 1VBFA 3UAZA 4MUYA 3L92A 5DSXA 2FOLA 1HL3A 3IERA 3K09C 5KVAA 1ZZ7A 3REGA 5T7BA 1TKAA 3LMKA 4QDXA 5KMGA 5EQDA 5IU6A 5F64A 4CEJA 4MW4A 4M1KA 4NZZA 1H66A 2PNFA 4G9EA 2OCKA 4QE3A 3LW8A 2X0DA 4FMCB 3UJBA 1H2RS 5EHGA 3DNMA 5HZHA 4IH1A 4K8RB 2KZ8A 3L49A 4J7CA 3NDPA 4I55F 4AMGA 4E5NA 1DGQA 2EZ9A 2ORYA 3L6UA 4C7OA 1E3SA 3E35A 1ULZA 3SQOA 5LNK6 2GFQA 1Q6YA 3TYXA 4KFUA 4QA9A 4KNYA 4G5XA 3O9MA 3GLFB 1H8ED 4O4JF 8MHTA 2CJFA 3HRKA 5GJCA 1VC2A 5CJ2A 1YZQA 5GP1A 1WH8A 2GETA 3LKZA 3U0VA 2BGRA 2XBMA 1QXSA 3GRYA 3TD6A 5HS4A 5MHTA 2H4FA 3ZZMA 2DJIA 1I36A 3A6KA 1DELA 5I01A 4WCFA 1JFRA 4OO3A 3RE1A 2Z5FA 4J1WA 1V3UA 1AQJA 2XNHA 3UJPA 1DJLA 3WLJA 3FPKA 3GEHA 3T0GA 4CM8A 2FQXA 4BQIA 1V8FA 3X1XA 3HCWA 4H08A 1MORA 4C01A 3FMGA 5DH9A 1W0CA 3S2SA 1FK8A 4PLPA 2WK1A 2X0IA 3A25A 3B1ZA 2IDMA 3IO5A 2ZR9A 4BB5A 2XGGA 4J3JA 3KP1A 4E5YA 4LQCA 1G20B 3A8TA 2XKAA 2IGTA 1L7VC 3G9QA 3FLMA 3ESAA 3Q6MA 2ZUFA 4UQPA 1KJYA 2C3YA 3ADOA 1JE0A 2B3TA 3LVFO 3I5AA 4HY3A 3GVIA 3WIOA 4ADSG 7AT1A 4M7WA 2RFLA 3T1HB 2DETA 1QVRA 5HK9A 2Q9BA 4G85A 1UPCA 2ZG6A 3B12A 1M1NA 4P33A 4BNLA 2PT7A 4BMDA 2IZOA 4F4JA 3H3JA 4RZQA 1VPTA 4G5YA 1N2OA 3K5HA 3JD0A 3PUWA 2XWSA 4C7BA 4YCMA 4TL8A 4FTWA 4ALNA 1R3UA 1OT3A 4XH9B 1XE3A 3GOQA 3A1SA 4HVTA 5BWLA 3UH0A 3RKUA 2X1VA 4ENWA 2VAPA 1B2LA 3ZZ0A 1N3LA 1ZGBA 2ZJAA 3C3EA 2P4QA 3G9TA 4AKSA 4PO9A 3N0RA 3DLAA 1RPAA 4JBLA 1G3UA 1UKVY 3WWYA 5B4VA 2A33A 2FJUA 1E9VA 3AEUB 1U8YA 4KQGA 3WLTA 4E31A 5KOYA 4WZAA 3M9LA 4L3WA 1E2IA 1FLDA 4DCOA 4F3TA 4X6LA 1XDSA 3LK6A 4NK4A 3V1TC 4ZEMA 2BYTA 4QQRA 3THWA 1UMKA 3NUZA 4V0RA 2P79A 2GAJA 2LDBA 4TQUS 3ZWKA 1AKVA 3E61A 2QSYA 4OBBA 3EXAA 3TIIA 3U4QB 3QELA 4CQJA 1EUDB 1JDPA 3PSHA 1VBMA 4EGSA 1UJ6A 3PIIA 5CUQA 1X7XA 3WAGA 5BMVA 2J09A 3BAFA 3OECA 4OQNA 5CEFA 2C4UA 1T1JA 3DE0X 3DEKA 3HMKA 2BR5A 4E1VA 1T8SA 2NADA 3HA7A 1MVLA 3DHYA 5M5BA 4KK3A 4BTEA 1H3EA 3LX6A 3U61B 4OJYA 1J70A 1ZM9A 4XFJA 1MJNA 2Q4OA 4V0OA 5DNVA 3ELBA 2ZITA 1VHJA 1II0A 1X1DA 2F17A 2IFTA 4C6SA 4CM4B 4DHEA 5EFZA 4GP6A 1GFZA 4EG5A 3LPAA 1QDEA 4PYOA 4YP5A 3GN2A 5CVTA 4OXYA 4QYXA 2ODBA 1QHIA 3EVFA 4CFSA 1Y7PA 1PFGA 1HBJA 3C15C 1M2OB 2FRXA 3LHFA 1J24A 4B7ZA 2HBZA 1WMSA 1YOVA 1XQ6A 1S8FA 1V1MA 2ATEA 4O02B 1W581 2WWTA 4W1PA 4YR7A 5JNRA 2JAUA 1Z0KA 2GHQA 2LCVA 2ZBFA 4UAVA 3LIPA 3SQLA 2H17A 3ELYA 1K88A 3FFAA 1L4NA 1V5WA 3TLCA 1TU3A 4E4YA 2OQ2A 3P52A 4UM9B 2WJZB 4JT9A 5G4KA 3RTGA 1KH2A 4KAXA 4JVMA 4N9QA 3LT4A 1WW2A 5NLLA 3KR1A 3SF8B 3WLMA <