1JFSA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jfsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfsA02
5IEJA 2PL9A 3UK0A 3QEKA 2ID7A 3GN5A 4WT7A 3GN5B 3IDOA 2MSKA 1DJMA 3IP6A 5C5CA 3SNKA 1ZH2A 1CQTA 3G1WA 4KMRA 4MS3A 2LYPA 4UHJA 3BD1A 5KI6A 4IF4A 1CYEA 3OLYA 2AXUA 3NNSA 3SY8A 3FYAA 3GYBA 2XIUA 2LYJA 4RV5A 3RH0A 4IA8A 1LCCA 1R69A 3H5TA 4YCSA 3TD9A 2YHAA 8ABPA 2JCGA 3LOPA 4DN6A 1E6LA 1B0NA 4KQCA 4IILA 4EYKA 2MYUA 2X7XA 3FFXA 2IVQA 1U8TA 5TPWA 3L49A 4RXUA 1E2BA 2O38A 1W9HA 2NT3A 3QELB 4Y42A 3KJXA 3B7HA 4J1WA 1SXHA 2DRIA 2P4UA 3QLTA 4EVSA 1WH6A 3LUHA 4JB0A 3O2QB 1L5YA 2BGGA 5K98B 3JXBC 4KPYA 5KQPA 1ZESA 3LFTA 5E3JA 3RVKA 1YMUA 2WWVD 3R1FA 3C3WA 2MEZA 3O74A 2IUOA 4Z4IA 3RVSA 3HK2A 3HSYA 1LK0A 4WZZA 1DBPA 3ILHA 2VUHB 4MS1A 1OSLA 3ILYA 4ETMA 4ETIA 3CS3A 1VKRA 1IC8A 1PUXA 4TMYA 3H1FA 5GQSA 5KWSA 2J48A 1Y9QA 4RY9A 4YG7B 4PU8A 1LBIA 2PUEA 4G0XA 5JNRA 1Z15A 1X2LA 4MPTA 4XARA 2Q5CA 1U2PA 3ROFA 4MYRA 3NBMA 1YIOA 1PEYA 1QQBA 2LP4Y 3O21A 4LE0A 5EWLA 3I45A 2GKGA 1UXCA 1JFSA 4P98A 2NZVG 5JNSA 4OLAA 4YS6A 3CHYA 1ABEA 1C4WA 3DGFC 1PNTA 3K4HA 2ZAYA 1LCDA 3QEMB 3W9SA 4EYOA 1JWLA 2IVGA 2MYTA 5IC5A 3KG2A 1GCAA 1RXEA 2EWTA 1PHRA 2RJNA 2L2QA 2PUAA 5TPZA 1GT0C 4MLCA 3GBFA 4UHKA 5ED4A 3H5OA 1ZDMA 4Q6WA 5EWJA 3HDGA 1DCFA 3DBIA 3OLWA 1EWTA 1Z17A 3LUAA 1BVHA 5IX8A 3D8UA 2OENG 2PE5A 4MS4B 2PL1A 6CHYA 1ADRA 5B3JA 2EBYA 4E7PA 3KZ3A 1QP0A 4Z59A 2QV0A 3RVMA 4PYRA 3D1NI 1YS7A 2LYQA 4G0QA 4W5QA 1QO0A 1P8AA 2ID9A 2PMCA 1RZSA 2JVLA 1E6KA 2FEKA 3RVQA 3MQ4A 3HJFA 1QP4A 4H60A 2ICPA 3T6KA 5KQLA 4RWEA 4OLBA 4D6XA 2HPHA 3RVLA 1MAVA 1WH8A 2XCJA 2A9OA 2PUGA 4ZMSA 1UDRA 3M9WA 2FQXA 2A9RA 1GUBA 5JS2A 1LJLA 1DC7A 3N8IA 3E61A 4MQFA 4RU1A 5KC9A 2AYZA 2WJWA 4JCYA 1X57A 1IIBA 2R25B 3GT7A 3KHTA 3HO1A 2L17A 4X4GA 4YARA 1YK0A 2JBAB 3CFYA 4Z9BA 3LKVA 4FE4A 3T95A 1TJYA 4G0MA 1CHNA 3L6UA 4RY8A 3GRCA 1APBA 4G0YA 4RDCA 5CNMA 4PU3C 1SQ8A 2XI8A 2HQBA 4MQEB 1YMVA 1JL3A 4O1IA 1J56A 3IP9A 1E6MA 3KTOA 3OO1A 4YV7A 2A6CA 5EWMB 4YP9A 4Z4HA 5TQ0A 4I6RA 3RVOA 2L8NA 4GHJA 3BDNA 3H5VA 4JP1A 4NV3A 4RXMA 5TPZD 3OQOA 1PNRA 1KMIY 4Z9AA 3F6PA 5T3YA 4LE1A 5BRAA 4N03A 5I4CA 4Z4EA 1JH9A 4JASB 4RK7A 2KZ8A 1B00A 1PEAA 3N75A 4MR7A 3TX6A 5FWXB 1NXTA 2IPAB 1P2FA 1Z18A 3GWGA 3JY6A 3G5GA 3Q15C 3EODA 1U2QA 3CROL 4G0PA 1EHCA 1UXDA 2B4AA 2QZJA 2RDMA 2LBPA 2AYXA 3QLUC 1NXXA 2E4ZA 1R63A 4WUTA 3QX9A 2HSGA 4YG4A 2NZUG 3OLXA 3KS9A 2MYPA 2CHFA 2OFYA 3CG4A 4MS3B 3DZDA 3O1HB 1QO0D 5TQ2A 3KYIB 3KYJB 1RNLA 1L5ZA 3HDVA 3HS3A 4MRMA 3TB6A 3SM9A 3JXCL 3EQ2A 4Z4GA 1FSPA 3F6WA 3OMTA 4IMJB 1U0SY 1YK1A 4N47A 1P6UA 1QNLA 1DCMA 1ZS4A 4NQRA 1A2OA 1RPEL 3TRBA 2FLWA 4EUKA 4I6TA 1XWWA 3RVPA 3H75A 5TPWB 5JNUA 5KQGA 1A04A 2JVJA 1SXIA 5CNJA 3O2SB 2JB9A 3SQNA 4EYGA 4F3TA 2R63A 1JF8A 1FFGA 1MIHA 1URPA 3HUTA 3SCHA 2GBPA 4ZYLA 2F8TA 3QX8A 1VRVA 3UUGA 1AB6A 2GWRA 4KK3A 4ZPJA 1ZAYA 3RZZA 1EAYA 3MMNA 1ZZBA 1RZRD 1NATA 3GBPA 5TE9A 4EVQA 1EFAA 3DNVB 2LIVA 4X4HA 3GL9A 1JX6A 3F6CA 4QPJC 1Z2EA 1Z26A 4KQ9A 2VK2A 2AXZA 1R8JA 3BRSA 4MS1B 4EGSA 4FB4A 2FJRA 1CJGA 2IPLA 2ZWMA 3A0RB 3GBVA 3S8QA 1ZITA 3Q7SA 4N41A 4JCXA 2EF8A 1ZY2A 2FQWA 4KRFA 1JYFA 1O4XA 2CHEA 1Z25A 3CLCA 3CECA 1BAPA 1ISRA 1U04A 2FMKA 2KEJA 4W5OA 4NICA 2MSWA 1I3CA 3HZIB 4IMIB 5FBHA 4JB2A 2CWDA 1MB3A 4FBIA 4NDWA 2PIJA 4G0ZA 2WIUB 2XSDC 1C0EA 3KSMA 4IGAA 3UFDA 2RJOA 3MF4A 4TLMB 4WXEA 4XAQA 1TM2A 4RZSA 4D6YA 3O2JA 4IRXA 2L49A 5EWLB 1NTRA 3CNBA 2F8SA 4Z5CA 2MSLA 1NXPA 4G0OA 1Z16A 1GUDA 2L19A 2O4AA 1OCTC 4OTZA 4YR7A 1EWVA 1LJUA 3I42A 4Z0NA 3HUUA 3U3WA 5IUJC 1LLIA 3OLZA 3HZHA 2A9PA 5D2CA 1NXVA 3CZCA 1TVMA 1M2FA 3S99A 3CRNA 4RK4A 1PRUA 4MR9A 2FMHA 1JYEA 1BDJA 3GV0A 4N0QA 3ZKCA 1NEQA 4EY3A 5EWJB 2LYRA 2B1JA 3GA5A 2E4WA 2VYCA 4XFKA 2IOYA 4MCXA 2KYRA 2JRLA 2WMYA 1JHZA 2PLNA 3A3KA 1H9CA 4X4FA 2IPNA 3OM0A 5JNVA 2H8RA 1JDPA 3HM9A 3QQ6A 3HV2A 1F51E 2FQYA 4FE7A 1M5UA 4GQMA 1F4VA 1Z13A 3FGZA 3OMWA 1ZGZA 2YHBA 1JLKA 1SD5A 3ROTA 2FTKE 1QMPA 2FEWB 4HYEA 1HEYA 2PUDA 3E3MA 3I09A 3FMVA 3N6VA 3ZHIA 3LUKA 2IKSA 3A0UA 2FVYA 1Y1LA 3IPCA 2RGYA 4YLEA 2LCVA 2BNOA 3BREA 3KLOA 4Z5HA 2MQKA 3SG0A 4W5RA 5HSGA 1JDNA 3HEBA 4MQFB 1NY5A 4ZMRA 4H3KB 3F7NA 2GRMA 3LFPA 3QF3A 2HINA 3H1EA 3IP7A 4F06A 2CD7A 2ICTA 4QICA 4LDZA 5IUKC 3BILA 3TO5A 2NT4A 4N76A 1XHEA 3H5IA 5IEBA 5ABPA 3JTEA 1FFWA 2FLKA 4CBVA 1DW9A 3CLKA 3G7DA 3LUGA 1KRXA 2OR1L 4YBAA 3EULA 3VNBA 1DCKA 6ABPA 5T7BA 4O1HA 2O20A 4O5AA 1MB0A 3T8YA 4YG1A 1WETA 1DBWA 3JS5A 2JVIA 2HQOA 2JK1A 5DCLA 5TQ0B 1TMYA 3A10A 4W5TA 2LPMA 5CNIA 3M6MD 3OO0A 3LISA 2BNMA 3H5LA 3VK0A 3HCWA 2FSPA 4OATA 1DWKA 1D1QA 1DBQA 1USIA 5DTEA 1MVOA 4RXTA 2FKAA 4HNSA 4MR7B 1D5WA 2LYLA 2FMIA 4G86A 5PNTA 4NCAA 2FXIA 3LUCA 4PEVA 4EYQA 2WB4A 2XJ3A 4RKQA 4X4EA 5C5EA 4EVRA 1ISSA 4RY0A 4MCTA 3T38A 4MAAA 2IPMA 4LZLA 3JXDL 1KGSA 3QLUA 4PU7A 2IU7A 2JVKA 3OMXA 4RKRA 4MGEA 4X4BA 1S7EA 1ZZ7A 1DRKA 4WXMA 5DGCA 1USKA 1NXOA 5KQMA 5TQ2B 3DGEC 4TN5A 3FDFA 4MR8A 1FQWA 3HVRA 4KZKA 4MRMB 5FWXA 3JPYA 2AW6A 1LQCA 2AXVA 2CROA 2LYSA 4OB4A 3JVIA 2IYNA 2B5AA 2A9QA 3I5AA 4PU4C 3QLVC 3HXMA 3EQZA 4PZ0A 2CSFA 5CHYA 4S05A 3QLVA 3LMKA 3RVNA 2QVGA 4Z5DA 4N0PA 1QPZA 1AU7A 1RPJA 1YVUA 1JFTA 2I6FA 5GOTA 5JNTA 1NXWA 3VNAA 4XXHA 3MM4A 3QYXA 1BDIA 1AB5A 1PERL 3RQIA 2BNNA 4F8JA 4DADA 2AUWA 3SCGA 1ZPQA 3OP9A 1BA2A 3FMYA 1ZGGA 4Y9TA 4QYWA 2PJUA 4JAVC 5KC8A 3OLVA 3EAFA 4OG2A 3URMA 2WUSR 3MIZA 5JNWA 4JOQA 4QYMA 3LTEA 2PPXA 4KV7A 5HM6A 2IVBA 3EDCA 1BDHA 3PXPA 4J1XA 1GLGA 1M2EA 4L4UA 4DQDA 1YSEA 1Y7YA 3Q9SA 3NHMA 5F64A 4X4CA 3QELA 1ZZ9A 1USGA 4YWHA 2FMFA 1K66A 1Z2DA 2R4QA 3MA0A 2FW0A 3F51A 1D2AA 2IDMA 3OM1A 4TLLB 2D5VA 3H6GA 4XASA 2FN8A 3CTPA 1RXIA 4PE5B 3CG0A 4RS3A 3NNDA 2PUCA 2QW1A 2HJ9A 1ZH4A 2E4UA 1NXSA 2MYNA 3IVPA 4RK5A 4NCBA 1DG9A 2VUIB 3RVJA 2KPJA 4ZJPA 5BQ3A 4XLTA 1Z12A 3FYMA 3ZHMA 3Q41A 3H1GA 3QK7A 3O1IC 4H3HB 4L85A 5DLEA 4F8DA 4JQDA 3N0WA 5FWYA 4PICA 2P9HA 3MYYA 3DLHA 5FWYB 1CEYA 1QP7A 1ZZ6A 1M5TA 2GRLA 4HNQA 3DLBA 3JPWA 4KNYA 2R48A 4YO7A 4MR9B 1RIOA 3CU5A 3SAJA 3H6HA 5A7LA 2N9UA 1A0OA 4O8BA 2WRZA 3JVDA 3KLNA 4RK0A 4RK1A 2PUFA 2M98A 2GI4A 3O9XA 4P1ZA 4Z4CA 1ABFA 4I6UA 3IPAA 3EUSA 2E4VA 2L18A 3LKBA 5IBQA 5TQJA 1E3OC 1JBEA 2H3HA 2WY2D 4IVZA 3G85A 2W42A 5CNKA 4S04A 3FFTA 3QEMA 4LRQA 5BR1A 4D74A 5JS1A 1WIZA 3H5WA 1FFSA 1ZZCA 2QR3A 3B2NA 4X4DA 2H0AA 5HQJA 5DKFA 4YRZA 1L1MA 3NHZA 4HNRA 3FFWA 4I8TA 1DZ3A 3UKJA 1DC8A 2R47A 1OXKB 3CKMA 1VPWA 2LYKA 4Q7EA 3EJWA 4MLDA 3RVRA 3SCFA 1NERA 1ZN2A 4M88A 3Q7TA 1SXGA 4GPAA 2E4XA 3KCNA 3P9YA 3F52A 2PUBA 4JA2A 4KFCA 1D1PA 4MS4A 4X4IA 1T34A 4YGXB 5B3JC 1XWRA 1ZUGA 2V0NA 2TMYA 1QQAA 4GNRA 1POUA 2WJAA 3O1JC 2M1ZA 4KREA 4B09A 1SRRA 4F12A 3C6QA 4KK4A 4LE2A 4ETNA 5BRJA 3EGCA 2AWIA 1ZVVA 4IWRA 3C3MA 2KEIA 3IP5A 3KKEA 3F73A 1D4ZA 3O75A 3Q7RA 2OQRA 2QVCA 4LX8A 3L1PA 1GCGA 3D02A 1S8NA 5IULC 3C97A 3TMYA 1EWKA 1K68A 1W25A 5FBKA 1PRVA 1DP4A 7ABPA 2PAFA 3QWGA 3CZ5A 1KRWA 2PKXA 2IV1A 1OXBB 1YTUA 2KEKA 4LDAA 2JBAA 1JFVA 3BBLA 1DRJA 4OBBA 2HQRA 2QSJA 2GZUA 4W5NA 4WWHA 4RK6A 4Z58A 1UTXA 4E7OA 1P6QA 2GX6A 2QU7A 1XHFA 4FN3A 1RZRA 3BRQA 4MQEA 3LUDA 4Z4FA 2R1JL 2XDYA 3LUFA 3M9XA 3OQNA 2O49A 1LBHA 2LUOA 3LUJA 3OQMA 5EWMA 2QXYA 4RSMA 3C3KA 3N0RA 2BJCA 3N53A 4Q6BA 4F11A 3K9CA 9ABPA 1QKKA 1VLZA 2FN9A 4KVFA 3NNNA 4MR8B 3KXAA 4ML3A 2NUBA 3MLFA 1PRAA 1ZHHA 1LMB3 3N0XA 5IUNC 1ZZ8A 1HF0A 3BS3A 1TLFA 3R0JA 4G97A 2FEPA 2E4YA 4Z99A 1YS6A 5HKOA
chains in the Genus database with same CATH superfamily
5KPJA 3ZDDA 1F9AA 1UJBA 5LLSA 3QBDA 1M0WA 1MB2A 4P3YA 3H3JA 3L8FA 4EUFA 5JSFA 2O8DA 2PZFA 4G5XA 1M6HA 4QXQA 4YRGA 2GHQA 1Y7TA 4OXYA 1OWOA 1PCXA 3DHVA 3TLMA 4FLEA 1OAOA 3VTFA 4QRDA 4H08A 3W6ZA 5IJ0A 4HXFB 1PZFA 2DULA 4XWKA 1HNZB 2CNBA 4Q18A 5DYGA 1CIVA 1E7SA 3Q1KA 1GQQA 4DJ5X 5LQUA 3DVSX 1VCHA 2PXBA 1VHJA 1UQTA 5DLPA 4YCSA 4WXRA 1AHHA 1G3QA 3ZU6A 4DN6A 4OREX 3DHYA 2HRRA 4KQCA 2BJWA 4XUDA 2QSUA 5TPWA 1SGWA 4Y7DA 4X63A 4CI9A 4C7VA 3P97A 1UEXC 2QN8A 1E7MA 3NIBA 3H0CA 3V2HA 5EE1A 2ZIEA 2G1UA 2QRQA 2MU1A 4OB8A 3JQ7A 2DRIA 1ADGA 1UK6A 5LP6A 2YIVX 4HPWA 1E4EA 4D9CA 4QYTA 4J90A 1UWLA 3EVTA 1VLMA 1QCYA 3SWWA 1WBDA 3R1FA 3SBXA 1MZVA 4YUVA 3QM1A 1LK0A 2XT9A 1EP2B 3L1HA 3TL2A 5JH7F 1MP0A 3L4BC 3LPMA 5DEOA 3K70C 3LCCA 4AS1A 2OHIA 5CTJA 1M72A 2WIJA 3NHAA 3HR4A 5E1DA 2ZVPX 2EFGA 4UNSA 3BJMA 5EC8A 5AUPB 2XB2A 3PRJA 4KU4A 2O8BA 4IH1A 1PK8A 5EIEA 3WL4A 2QTLA 3NTXA 2VUUA 4PX9A 3B1KA 1F1JA 2VHTA 4CLOB 3N2IA 1VMAA 2CUZA 1EVKA 3GLFA 1PT7A 2RHLA 4WVFA 1U7XA 3TRKA 3A28A 1UXCA 3KPUA 4OLAA 1NF3A 2NZVG 2OORC 5AHWA 1RYZA 1MGOA 2CXQA 1QCCA 1AJEA 3B1XA 1YDEA 5AQ1A 4TYMA 1KZGB 4OQDA 4Q0MA 2YV2A 4FC6A 4A8JB 1ULBA 1R3UA 2I99A 3SIPA 2C9OA 2LGJA 3EFHA 2Y67A 3KG2A 4KIJA 1FNBA 1GCAA 2ZW9A 4IO1A 3KQYA 1QIJA 1ZGJA 3HYLA 1K92A 4FFSA 3SZUA 3PDIB 4PFJA 1EUQA 4LSZA 3LA6A 3VFDA 2RH8A 1DNPA 1W8IA 2ZAOA 4TV8F 4BVKA 3ENNA 2CJPA 3D7NA 3WX0A 3PC8C 1YA4A 1QORA 1GTL1 4ZOEA 1KSHA 1P2TA 3Q3VA 1KOGA 4DNQA 3QYFA 1NOIA 3BRWA 2OHVA 3BGWA 4X66B 2QAGA 1K27A 2HAEA 3W8NA 6CHYA 1V43A 5JVDF 4DL9A 1L3CA 2BFFA 2EBYA 1SVNA 3AR4A 3ESYA 1W96A 4C01A 2JJ1D 4M87A 2RHRA 3DE0X 1YS7A 3O8CA 2EFEB 1Q0HA 3KVRA 4RE6A 3WLEA 3G13A 1GTSA 1M1NB 4JV5B 3GRAA 3SDSA 1A8SA 3AJEA 2JHPA 3C6YA 4GG1A 2ODPA 3PL5A 3SNHA 3UHOA 1P1CA 4KITB 1PZEA 4DM3A 4I46A 3RADC 1P18A 4JI6B 1NVTA 1T9CA 3DXYA 1PD1A 1MO4A 1UBRS 1UMBA 5FA8A 5C31A 1JN0A 2ACKA 3BFXA 3ET5A 1IM5A 4QOJA 3GT7A 4YUZA 1ADJA 1WCYA 3KQPA 5JDCA 3WK8A 3OM8A 2X1LA 4A0GA 2PXKA 1GUYA 3EWAA 1FE8A 4FM9A 3GRCA 1JSCA 3LVBA 3QE9Y 3OPYI 3BCRA 3T5TA 2XI8A 3IALA 3F8SA 3JQGA 4O1IA 5ERXA 2IODA 2A6CA 1CZUA 3LQ2A 5K5EA 4QVGA 4URXR 3WGLA 4JP1A 3G2OA 3SHQA 3WO0A 1AQ6A 1J5PA 1XCGB 2VAXA 3COPA 2ISQA 5BSHA 5JRJA 3P96A 3LX5A 4M0MA 5ES3A 1U2GC 5JQGA 1ZUNB 2ZWVA 1QFZA 4LTMA 1K06A 5FBRB 1JMVA 2W83A 2PKEA 4K9KA 2DSNA 4QQFA 3V8MA 3WLMA 4BKMA 4CJXA 3QH4A 5LQNA 2XE4A 4RTRA 2A1IA 3BRWD 4U00A 4OF4A 1T9GS 2I71A 5K0FA 2XUOA 3IUYA 2E4ZA 2ZQZA 2OXRA 3DLCA 4WUTA 3UC9A 2HSGA 2WC1A 2JDIA 1L3IA 4PANA 2CHFA 3PQ4A 3VKHA 2FFJA 3WWDA 2Q9BA 1RW4A 1HYQA 2R6GA 2P1RA 2QYSA 3F7TA 5TF4A 3WBFA 1PZXA 5JECA 3AIKA 4U5XA 4NMXB 1NE7A 4PRYA 3U62A 5AW6A 1GYRA 4MAFA 1B1CA 1HL3A 3QPVA 1T8YA 1TQ4A 3D59A 5D87A 2QJOA 3TE7A 5JIBA 2GZ3A 5IKOA 4S0ZA 3GNSA 1FXWF 3Q9UA 1UUFA 4UBKA 1E1DA 3O4JA 1QTRA 4WV3A 5JNUA 2COKA 2DFDA 1FZQA 4ZRMA 4XIIA 1Z6QA 2J3HA 4ROTA 3AETB 1KPIA 1MIHA 1NLUA 3HUTA 3KX2A 4RGBA 5HDBB 4CCYA 3HFSA 4Q82A 1A71A 2BMFA 2EBHX 5HJ2A 2DYKA 4OB7A 4W7IA 5KU7A 3M3DA 3ZV5A 3NHKA 2PUWA 2VFAA 4C6HA 5AW8A 4CFYA 1N2ZA 1IBLB 2V1XA 2QV7A 1J8FA 4EVQA 3T7SA 5B1DA 1G20A 2DFNA 2FGKA 2HMVA 3F6CA 4OGWA 1K6JA 1EFPA 1JJVA 1PR5A 1Z26A 4J4BA 1DULA 4NXMB 3OECA 2AXZA 3WNZA 4MS1B 1HT0A 5IHXA 2IUSA 1NN0A 1V1RB 1ZITA 2CEKA 4TL6A 3TIIA 4D0GA 1ZW6A 1YUMA 4K9MA 4UD6A 3B13B 3QVLA 4WFQA 3DOEA 3O93A 4C07A 4CM8B 5I9LA 1RC8A 1ISRA 2KB0A 4W5OA 4MIOA 3TKLA 3NPAA 4NICA 2FUNB 5HPYB 4G1VA 1K8RA 3Q7QA 4ONEA 3N8HA 3SIWA 2CWDA 1XRLA 2DY1A 5CA1A 3UHFA 4G0ZA 2XSDC 3WLQA 2OV6A 3SIRA 1B8PA 3EXFA 3OOWA 1UPCA 2I66A 2WG0A 2JDID 3PNOA 1NXPA 5M04A 5B2EA 3GP8A 4C0WA 3HWSA 4GKKB 1IN8A 1DJQA 4F2DA 1KQPA 5EPEA 1VYVA 3AIOA 3U3WA 4FBMA 1WF6A 3ZU3A 4D4MA 4QDZA 5CVTA 2AOTA 3GJRA 4B3RB 3LZ6A 3ZHZA 1KU6A 1R8XA 1XTSA 3OQPA 1CRWG 4ZDKA 3KK0A 3CEHA 1FYFA 3H2ZA 3R8XA 3VO1A 4A73A 2O8EB 3OG9A 3ZKCA 1NEQA 4EY3A 2H07A 3JZMA 2YKGA 1XPRA 4YV1A 5JAPA 1QP8A 3CIOA 2O3JA 3WBKA 5HNKA 4XFKA 1RE1A 2AR0A 3CURA 1N0HA 2QUKA 2AR7A 3QKSB 2B94A 1HWYA 3D8NA 1V41E 1XKLA 3FR8A 4Y0NA 4DJTA 4LNUB 4IQGA 1M2KA 1YB6A 3AUJB 4GWKA 5P21A 4AKEA 5AD1A 4LHYA 2QGNA 3FM9A 3OQHA 3QU4A 4JJ4A 3D81A 2NU6A 3QKWA 1TZKA 1Q15A 2Q3CA 4HYEA 3U2QA 3W34A 4E30A 4DIFA 5FKJA 2W8ZA 1T3HA 3O3OB 4TTTS 4AJIA 2C7BA 3VI4B 1R0RE 4KBFA 5FULA 3BQ9A 4G8CA 4OJTA 4E6PA 4X3CA 1EM8B 2JGMA 1H42A 2WVHA 5CDFE 1NY5A 1C7EA 2AWNA 1II8B 3FW1A 3EFOA 4BQFA 4AJNA 3WDLA 1DDOA 4XI9A 3OOEA 3N6RA 3WGZA 4QVIA 1PNOA 2HA6A 1KFJB 4N7RA 3THXA 1G2OA 2PBZA 4BN0A 1WOYA 1HDIA 1CG6A 1K8XB 4PXSA 5E8RA 1PWHA 3R4CA 5GJWC 2VWGA 1CUSA 3L6DA 3GR6A 3UWSA 1J8MF 4RTKA 3T1QA 4AROA 3JAKA 4C4SA 1PFKA 4R9VA 1QV7A 3UANA 2QENA 2CVPA 1U2DC 2DHEA 2OBMA 5EHQA 3CPEA 5I9IA 4MGKR 1TVEA 3AEUB 4W8GA 2CL5A 1BOOA 3GLQA 4MX8A 3RQSA 3L0YA 3JQBC 3EYWA 4LJ5A 5BYJA 2BTOA 4R6XA 4C7OB 1REQB 2AV6A 3FMOB 1MVOA 3K16A 3AFIA 5B53A 3ZZTA 4EG6A 3VQTA 3KQHA 1E3TA 1P5JA 3O03A 4ZI7F 1KQGA 1X3SA 4XJTA 2PWAA 3D6MA 3GD5A 2JGFA 2VSNA 1DAGA 1GO2A 1KGSA 3J7AC 4HLCA 1E18A 5AHRA 4JVNA 3TNJA 4FFWA 1N0WA 4D4KA 4EZIA 1B3BA 1HFWA 2FETA 3KU1A 5L7TA 3DYIA 2A30A 1XZCA 2PH7A 2APJA 3EEQA 4KC0A 2WTNA 3FJOA 2LYSA 1Z7WA 3RJTA 2XCRB 3KD2A 1L9KA 1MV8A 1Q0UA 2J46A 2KQUA 2PCLA 3KOOA 4PHCA 1NHWA 3BMNB 3FMGA 1QZZA 3DE2X 4ER3A 2DQ4A 3DMFA 3QLVA 4Z51A 2VZEA 5FPKA 5A7GA 3R7AA 3RRJA 4EZEA 1RPJA 3BIXA 5EJAA 4ZWNA 3HXQA 4LMPA 1V26A 2Q5QA 2OHXA 4HB4A 3PYXA 2GN6A 1KZ6A 2WUWE 3DV9A 3GMDA 3I6BA 2AE1A 3VHXA 2PGNA 4XDGA 1H23A 2IJGX 3ZWAA 4ZZIA 3I0NA 5IKPA 2RAPA 3D54D 4RTNA 5ALQA 3R3HA 1ANKA 5HG0A 1ZGBA 2ZUUA 3PQ6A 5EY5B 1L4HA 2WJ6A 2V5VA 1JR3E 4HDQB 1M2VB 4WBNF 5KYXA 4JAVC 1UJ6A 1YB1A 4OG2A 5AI4A 1DKNA 1Q1AA 1QUEA 1GR1A 4IUCS 5E1BA 1F06A 1GNRA 1XZQA 1SMKA 3H7IA 1O0CA 2QAIA 2ZRKA 1FFBA 4E15A 1I7LA 1Y7YA 2AFIB 2OM6A 2LWIA 8LDHA 2AC7A 4K8OA 3TQFA 4BWYA 4OBWA 2XCQA 5KTKA 1MOSA 1P45A 2CFSA 2XYRA 2GD2A 1XZHA 1ZX1A 1OH8A 2WZBA 4YA6A 1LBSA 5I8WA 3WKCA 4OXIA 1JKJA 1A9PA 1T1IA 1J49A 2O8CA 3IVPA 4GU5A 5EFZA 4G89A 1IM2A 4AJ9A 3V1NA 2HKIA 5C8VA 4G84A 4RHTA 4P93A 3DMHA 4HCJA 3FYMA 1Q7TA 5TIIA 3G2LA 3H1GA 2RGRA 3FNRA 4AJLA 3H1BA 1T9AA 2C00A 3PFHA 1NWHA 1QK5A 4KHZA 1UWKA 1QSGA 2RB4A 3UGTA 1K8YB 3PQEA 1M5TA 1PJCA 2GRLA 1MC1A 2C97A 3BD6A 5AW4A 1R4NA 1G8KA 2H57A 4JP5A 3WB9A 1C8LA 4PAGA 3SAJA 5ALZA 4TROA 3W9UA 1RVV1 1CUDA 1RJ9A 2AXNA 2W2TA 2G40A 2OBYA 2WRZA 1JJAA 5J59A 1JHYA 3THWB 2HEGA 1TLTA 2M98A 5J3JA 4MI6A 4TV9B 4B31A 1KDPA 2X6QA 4B6JA 3VR4D 1PDWA 4AJ4A 1EDDA 1FEZA 1T36A 3E5HA 3QKIA 3UEOA 3IS3A 2NAFA 3TI9A 4MUXA 2A0FA 1DSSG 1IEVA 2Q2VA 1U7UA 1JDBC 4FMDB 5U4QA 4RQUA 4HYYA 4XLLA 1ZICA 2OGTA 5IVKA 2ZM5A 5TGDA 1OXXK 1X7DA 4BEWA 4PS1A 3F1KA 3KR9A 1R88A 4PNEA 1DKPA 3FYTA 4E2YA 5I4BA 4JXJA 2XKBA 3P2IA 3X43A 4PYKA 1T29A 1P5ZB 4BGEA 4BNNA 2H4ZA 2UZIR 3AB7A 3O6VA 1FMJA 5CXSA 5ISMA 3ZV6A 3E48A 5HKAA 1AS3A 2VZ0A 5G53C 3ZJUA 5HX7A 3B1FA 2HIAA 4YCAA 1POUA 5EEGA 3BEOA 3BQMB 3DHWC 4PRZA 3OJ0A 4DKJA 2JGIA 1K5HA 1CY0A 1FP1D 4BVBA 4A27A 5JAZA 3T1HB 3WLTA 2ODNA 4WNYA 5AW3A 3DLTA 2PTHA 3O3NB 3IAUA 2F4NA 4N7JA 1J8YF 1JT2A 1PBTA 1QGUB 1QKIA 1WD7A 3T3GA 4ZDJA 2W71A 4BFWA 4DXDA 1HZZA 1FU4A 2BHRA 2WUVA 5C4IA 1NR1A 3TRFA 1KK1A 5FYDA 1R6VA 4R5HA 1MJHA 4LI3X 1Q7BA 1ZNYA 3UA4A 1VC2A 1CRQA 1PJRA 4I1YA 2BBSA 5BOSA 1YFZA 3L7LA 1KO1A 3BDAA 1L5LA 1BCSB 2YDXA 1SKMA 4G0VA 3QUQA 1I13A 4OKIA 1MXFA 2QEQA 4RVCA 2TSYB 4WWHA 1C9YA 3RARA 1ODJA 3K6KA 4CEHA 1JEYB 3SC4A 4MKRA 1Y34E 3EQ6A 4J0JA 2NVUA 3CISA 1S3SA 1Y9EA 5ITZB 4BKPA 1M3SA 2R8YA 1KIAA 2CLHB 3LUJA 1E1KA 1OX5A 1P9LA 4KUGA 2PX0A 4N40A 5KKAA 4B3GA 4W63A 3P0JA 4X7PA 5JCZA 2ZTSA 2G28A 5FHQA 2B37A 2L42A 1VCOA 4A91A 4EATA 1RKQA 3QX3A 1LEHA 1SBIA 4JELA 4BGUA 3LQFA 4C78A 4KV9A 1NULA 1XK7A 3GGDA 1RJGA 1K6XA 3GGGA 1UBJS 3W90A 2YY7A 3A6HA 3ZK7A 4L02A 5IEJA 2VJQA 4PNHA 1Z6PA 2P4QA 3USZA 2CVFA 4LZAA 1X1AA 1QS0A 4Y1RA 3QPDA 4RIIA 3ZHSA 1UXGA 2C99A 1JHMA 4B9EA 3DJFA 4UHJA 4Q1EA 3BHJA 4IVPA 3WSTA 1OBHA 2JGKA 2OOSA 1CIJA 3BF8A 2WD7B 2H9AA 2B0CA 3DFKA 4I50F 4O29A 3RWMB 1IN7A 3AHHA 1BKDR 2OZKA 3NYWA 3E9DA 4BQIA 3K9FC 2CNLA 2OXIA 2KX7A 2XUJA 4LVUA 2ZYTX 1LCCA 1UIRA 3H5TA 2BGRA 1IBRA 2H18A 8ABPA 1XEWX 2ZSHA 3NRJA 3DEKA 5BO5A 1SOVA 2I5PO 3KTAB 3M6FA 1J1UA 3TZEA 4PLHA 3PDJA 1NLMA 2OKCA 1LWOA 3INNA 4MW4A 4HVCA 4AXBA 2D2FA 3GEGA 1B7GO 1RHMA 1UBNA 5ALGA 4PC6A 2ERCA 4JKOA 2B2CA 1QR2A 4Q3NA 2N47A 3HA5A 3U26A 4J1WA 1L1RA 3GXOA 4ND8A 2AYYA 2FQ1A 3OURA 1WVIA 2HLHA 4PN3A 1R1DA 4JQCA 3SFVA 1AE1A 3JYHA 4AURA 5JTTA 1Q1QA 2FW8A 5KSOA 4LXHA 1PR0A 3AL2A 3DDNA 4KYIB 2A35A 1J7KA 1JB9A 1UK8A 1BCRA 1CY7A 4I50B 1DXOA 1FJ2A 4HXEB 4ITUA 5IP5A 4N12A 5LUAA 1CY6A 1YKFA 4MAMA 3W2EA 5LWHA 3LBFA 1Q14A 3LLCA 3CS3A 3IOEA 4WDRA 4YJ3A 4V24A 3MWDA 3EIFA 4TMYA 4XGRA 3SU8A 3WZMA 3ET4A 4C89A 2EAUA 4IHQA 4DJJA 2LLVA 1CJKC 3FUUA 4B1FA 5DRYA 1K3UB 4AY2A 1FS5A 1KI9A 5FV4A 5GAHi 3MOGA 2X14A 5DGTA 2X0FA 2H6EA 1IIRA 1AF7A 1THTA 2J1LA 2OWEA 3I6QA 5CK4A 4Y0VA 3OJFA 5DGHA 2GAOA 2HMWA 3BXHA 3Q6MA 2GM4A 4N5DA 2F8LA 1YR9A 4GM4A 2IOFK 4LYFA 4ARCA 1PEYA 1ZJ6A 1ZMBA 3O21A 3U81A 4YRNA 1DB3A 5HZHA 1DX9A 4D8XA 2O23A 5M34A 1A7AA 3AM4A 3O7WA 3WAJA 4C3OB 1O4WA 4K0RA 3K1YA 4PLTA 4Y2PA 4D44A 1JWLA 1F6BA 3OIYA 4F8EA 3S2UA 4BY9E 1JXMA 4WY2A 1AT1A 2ZZNA 4C5AA 4JLJA 5LQKA 1GFZA 3LWBA 4MLCA 1RHRA 3SFZA 1WJGA 3DB2A 4RZQA 2ANCA 4BZZA 4CM5A 1F4LA 1MRZA 5DNWA 3LQKA 2RONA 4MWGA 4KFUA 4DLLA 3PQ5A 2H00A 4JT4A 4TVSA 2OHHA 5CDSA 3OT4A 4MUEA 1AUQA 4TXLA 4K3VA 1U8UA 1FUYB 5DRTA 2BGNA 3KEMA 3PT5A 4BLSA 3R9XA 3SSNA 1QH8B 2IFTA 4FNMA 4QJIA 1RWXA 1ZRHA 3SN6A 3L8MA 5A2QA 1ESEA 1GG2A 3K09A 1QP0A 4MVWA 4ZT6A 1HR0B 1Y7LA 5HMMA 2QV0A 1Y3IA 5CEFA 2P2NA 4W5QA 2NGRA 5EZYF 4DC1A 1OIWA 2BSQA 1VLLA 3SF8B 1QR6A 2PJDA 4DNFA 2QQEA 3HJFA 2HRZA 1UZAA 5K99A 4R4JA 1EB8A 4CR8A 3I9FA 1U4NA 5HYVA 5KWVA 3SJAA 3C7DB 4JMLA 5CVDA 1KZYC 3LTNC 3ADDA 2F67A 4YJFA 1Q0ZA 1VRCA 2Q1WA 2PXHA 5COAA 4B4VA 4YXFA 4BC1A 4MK4A 1CF2O 2PS0A 2PXAA 4RKWA 1XK6A 2NO1A 3E61A 4IJQA 4YFYA 3INGA 2RAFA 1K5GA 4R7ZA 5KTMA 3NAGA 2BM8A 4FQ7A 1WXDA 3KHTA 5FD8A 3WLIA 3UJPA 1IVYA 1E5LA 2WG2A 3QUAA 3DD1A 1T1JA 4BE9A 1KKMA 1AKUA 3RHZA 3PYLA 5I9BA 3L8CA 2I54A 3ER9A 3ED5A 2HRBA 5TVKA 4IH9A 2ZE7A 4I6RA 1M0EA 2IGTA 2RHWA 4N0EA 2AT1A 3FTQA 1RYBA 1MRNA 1VJRA 3WBBA 5LN1A 5T3YA 1FFEA 5FI3A 2PRSA 2C9DA 4RZHA 3QQPA 5LQRA 1UPFA 5ALTA 1SPBS 1YOVA 2IF2A 3V8BA 1QVWA 2Y2UA 2Q2QA 2O8DB 3T4UA 3H7AA 1XQ1A 1BWPA 2BRUC 3I1FA 4GI1A 4ZQHA 1XUOA 5AM0A 3CG4A 2WSBA 4H4EA 1Q7EA 2K2WA 4I1SA 1N5JA 3CE6A 2EZTA 4BNLA 5HRAA 5IJ0B 1WSDA 5JS6A 3S28A 3EQ2A 4NZYA 2A5LA 2Q1TA 2UYHA 3BYZA 2IUYA 1NN5A 2YBEA 5GJCA 4HS4A 1T8PA 4JLPA 4QGBA 5KU1A 4D43A 1QF7A 1YK1A 1LW7A 4N3CA 3PR1A 5AJWA 5CVCA 1G8YA 3QV2A 5J4LA 5TPWB 3ZXYA 2DBRA 3P5SA 3U0BA 2DWUA 2ZT6A 1A04A 4MMZB 3HXLA 3O2SB 4IS3A 3L1IA 4I2VA 3LK7A 1ATIA 5GP1A 3JQ7B 2VTVA 3DAFA 5K0GA 2GA9A 5HILA 3IAS1 5LP6B 3MMNA 3RZZA 3UK7A 1E4EB 2F9FA 4MUYA 2VA9A 3D6HA 4KXNA 3EYAA 1JX6A 3EEOA 5J58A 2DC1A 4KXYA 1Q0TA 1Z6GA 2GYVA 3HXKA 1VLJA 4G9GA 2FHSA 2QDKA 1WDLA 1GKKA 4TLEA 1EA7A 2GFIA 1CXZA 3DV0A 4V2IA 5D3KA 4B82A 3L4BA 1A69A 2QL5A 2B69A 3G8DA 4LYDA 2FMKA 4U02A 2XW6A 1A1SA 3RLFA 1U11A 3BTSA 3ONWA 5FBZA 5KYWA 1YC2A 3ELDA 2Y1DA 3PEFA 1E9FA 1MB3A 3IL2A 3UW3A 3T1YB 2XUZA 2BZGA 2GPBA 3ECAA 2IU0A 2FEXA 1TZCA 4UZEA 2VHWA 3KOXA 4KAJA 4UM9D 4ZT5A 3GLFB 5JFOA 1NTRA 2PO7A 2JCVA 4Q3LA 1H0HA 4ZXPA 5TEVA 4MQBA 5KYKA 1HTBA 1U1GA 5SYNA 5AXCA 3WY9A 3EVZA 4P4GA 3ZGZA 4Q1FA 2D6FA 3ESBA 2Q1SA 4RW0A 5A4MS 1IHUA 3TLKA 2J3KA 2GHTA 5F7JA 4Q37A 1HLPA 4EJ6A 3TZLA 4ARBA 4RGVA 1CPYA 4LVNA 3WXBA 3KCQA 4HDOB 4RK4A 3O4RA 4KRXA 4XCXA 1XTBA 821PA 2AK3A 3JASA 2VJOA 4GWLA 2WF5A 1R0ZA 4GOJA 4XCQA 2B25A 1OV4A 5EOVA 3ER8A 2CL7X 3B9QA 2YOHA 4PY2A 1L7VC 1J00A 1GPJA 2NO5A 2I2FA 3PC8A 2PYDA 4TL9A 5AW2A 4B3FX 1OFTA 5JBIA 5FTNA 4KN9S 2QAGB 4IIGA 3X1KA 3A3KA 5DM2A 3C1UA 3ZE9A 5DYWA 1MT0A 3EZLA 1ETUA 1RSZA 5KQSA 1Q17A 2W2PA 1QYCA 3D5QA 1QOQB 4RQTA 3Q72A 3DC2A 4F6LA 3R9IA 1XRSB 2FEWB 3N6VA 3FMVA 4D9EA 4B3TB 1XRJA 4OFXA 3K70D 1CJCA 1RCTE 1O08A 1X2EA 1Y1LA 2HDWA 4R51A 1JZSA 2P4HX 2QX4A 4I4TA 5CGZA 3GJ4A 4UBNA 3GLVA 4YV2A 5JQGF 1Q6YA 3AB8A 1Z38A 3KAKA 4IDPA 2TS1A 4YROA 4AY3A 3SLKA 4ZMRA 2BFOA 1UMBB 3LFPA 1H85A 2VDQB 2YXBA 4HWGA 4LF4B 2EW1A 5CT9A 2ZT8A 2NT4A 3BXGA 2IUEA 3RU2A 1WABA 4P84A 1HF3A 1ONOA 1XTVA 1L5SA 2Q8PA 1DC4A 1FFWA 1B8UA 2OD2A 2VQ3A 2IZ7A 2ZUDA 3QLEA 4C2AA 5F51A 2YFQA 4JX8A 4IINA 2WUFA 3MRTA 4D3FA 4FFDA 4NFYA 3L01A 4P92A 3TWOA 3DE7X 3CJRA 1DBWA 1JHOA 2EZ4A 3RCBA 2JK1A 2ACEA 1W35A 3LBNA 2ZB7A 3IO3A 1Y89A 2FR0A 3IQXA 4H3VA 4WA7A 2CE7A 2A5FA 2JCXA 1YHZA 2YQ4A 3HJBA 2Q0HA 1FLDA 2ZFUA 3JTMA 4KBYA 1Q0PA 2IDZA 2IBSA 4GM1A 4EYSA 2AN1A 4A6XA 5LVAA 1U2GA 2EQAA 2HO5A 4RXTA 1VI2A 1GUFA 2PDAA 1BH2A 2CZQA 2ESRA 4UEKA 4DA6A 4Q48A 3N8GA 4PIPA 1YV9A 5BPFA 1EX6A 2NV6A 4HQFA 1BTOA 3A1TA 3CKLA 4RJTA 1ZZ7A 4UTNA 5ADUS 1CUJA 3OESA 2YFYA 4UU7A 1GOTA 1E9VA 2ECOA 2ORYA 5GMOA 1A5AB 3WWOA 5D3MA 3HVRA 1IXSB 1ODSA 4IDAA 4NMMA 1JAYA 1GRVA 3I4CA 2HV8A 3AHFA 4IICA 4ENQA 3B1YA 5IJWA 3BDVA 4M9CA 4PZ0A 4LFBB 4YIHA 3GQBA 3N86A 2YUTA 3H2HA 2B92A 2ZYUX 5DHUA 2O14A 1XX6A 2VDOB 4XWOA 3VKUA 1JFTA 1RLJA 3TAXA 4WJLA 1NXWA 2GILA 3E5RA 5C1IA 4JI2B 1IFXA 1Q2XA 1I2BA 2OCXA 2CT8A 3MS4A 3TW4A 1MAAA 3W2TA 4UFPA 5IBCA 2BNNA 1PT6A 4LX0A 1NLZA 4D4HA 2NADA 1PJ8A 3CNNA 1GVHA 5TJ9A 2BAGA 5JRDS 4B2LA 5F7OA 2NMVA 4A0FA 4KXVA 1G20B 2WV9A 3G0CA 1JDUA 2CK3A 1WTAA 3HHPA 1EFPB 3ONNA 4C0XA 3UT5A 3PUWA 4LFAB 2J3DA 2BFNA 3CCBA 3Q40A 1EIZA 1SN7A 4QFCA 3A4IA 2YH2A 2FX5A 3JQQA 4FJ0A 1XTTA 4NZOA 5DTIA 1R6TA 3TH5A 3W7BA 1OX4A 3B6ZA 3D4NA 4YT2A 4X8HA 3MA0A 2JZCA 3L9XA 3QXJA 2IDMA 1D2AA 3OM1A 1JJ7A 5FL3A 4HNTA 2XD4A 4D81A 4JYZA 5LYJF 1VBKA 3E2IA 3KOYA 1CZHA 4NP6A 2BFEA 1KY4A 3HCAA 4S2UA 2QW0X 5CA1B 5L9AA 1WB5A 1WCWA 1RXIA 1PJBA 3QV1A 4BMPB 5IPFA 2OCLA 2HJ9A 4L4SA 1FMTA 5I5GA 4LV6A 4E3ZA 3R7NA 1K2WA 3QIVA 3AWDA 1G5PA 2C3YA 2MJLA 1M1XB 3KR1A 2FOLA 1V6AA 1TLLA 4NE7A 3I52A 5MN6A 2DUMA 4I3HA 4LF9B 1EUYA 5DFAA 1P17A 3FPJA 1X3LA 2UUPA 4OEHA 3AW8A 3A6PC 4B4WA 4BO7A 1A0OA 2ICAA 4FQ5A 3COVA 2UYOA 1OXMA 4CM9A 4TWAA 3BSWA 3KSBC 4OHRA 1NA5A 3TJMA 3WI7A 4LCEA 5DCYA 3WLJA 2VP4A 3EGXB 3ZCUA 1CK4A 1CJMA 4RORA 3ZQKA 2HV9A 1DV1A 3KLBA 3NT4A 4I9GA 1XVIA 1G8FA 3ZYZA 1WIZA 1AKYA 2O0MA 2C94A 2BGTA 3C8HA 3DPUA 1WKBA 2CK3D 3FVQA 1E89A 1RLTA 3KVOA 3NHBA 5E2BA 4ZCPA 5CIWA 4BKUA 3IR7A 2VJAA 1AK2A 1JEOA 4BDSA 1QE3A 4CETA 1SB8A 2CF6A 5TS3A 2QN6A 3GC6A 1JBQA 1XRRA 2HWXA 2NU6B 4NPAA 2QTMA 3DZJA 4LZZA 1KQFA 1RZVA 3EJWA 2VR1A 3G59A 3KSRA 2ZTLA 1J2JA 3NBYC 4JN6B 1NERA 5AK6A 2ZRDA 2FFHA 3Q7TA 4TTPA 4KODA 5F2NA 1Z63A 2I9KA 2LCFA 3EEYA 3LLSA 2O2YA 2ZIUB 1Z8DA 1JXQA 3VU9A 3I64A 3GLHE 3C2QA 5F33A 4A2CA 1T8UA 2TMYA 1K86A 3HO8A 1UBHS 3EFOB 2WWHA 2O2XA 1NG1A 3O1JC 4XIYA 2XUPA 3GGOA 4DR7B 2ORIA 2XTAA 4OYHA 5BRJA 2NSDA 1E2UA 1L7BA 4A5SA 3IDAA 2NZ2A 1KC1A 3JAKB 2I34A 1IJBA 4MV9A 5EMNA 4AO7A 5A9SA 2C0QA 1PFQA 3L2OB 3DS8A 1IH8A 1U2DA 4FJ2A 4CQLA 3WAKA 4CW7A 5BN3A 4I5EA 3SS7X 4IMRA 1FK8A 3QA3E 1KRWA 3CBGA 2HDHA 2C83A 3IVRA 4IFBA 2ZYDA 4CMKA 4GP7A 1JVNA 4CM9D 2ST1A 3U5TA 3ACBA 2WTMA 3KB6A 3VR1A 3T3OA 4UM7A 4KHPB 1UBOS 2VP5A 2YMQA 4E7OA 3CLTC 3FNQA 3KZXA 3DOIA 3RBXA 1Q44A 3V00A 2JD1A 2DB3A 1DKMA 2DJIA 5TEWA 3NBAA 3CRQA 3BTUA 2CFTA 3OQNA 1ZKDA 4ICIA 2HGZA 5JSZA 2Q5FA 3MRSA 3OOJA 1G42A 3MTAA 5AK5A 5FOWA 5EMMA 5DHPA 3KHKA 4RYLA 3RSHA 2O1WA 2RGBA 2WD9A 3EZGA 3TLYA 3BQNB 1ZZ8A 1DEOA 5GAGi 1G4AE 1QYVA 4NAHA 4PTZA 2YQZA 1FFHA 5AW9A 4O2BF 2BCGY 3P8ZA 1PGJA 4KN8A 4QBTA 2HLNA 2NTVA 2I62A 5IU6A 1PU2A 2HSEA 2MSKA 4OMUA 2QOEA 3NH6A 1TAUA 5BURA 1AMNA 4KPGA 2W0MA 5KX5A 1MTOA 4WVLA 3TPZA 3VHXB 4PPGA 3UOGA 4CU5A 3GPDG 4BGIA 2VJBA 3NNSA 4BCBA 3IJRA 3L82B 2CNDA 2IYRA 3WYNA 2A0KA 2X15A 1HV8A 3HWWA 4TZ6A 3LOPA 2Z5LA 2UYCA 1WP9A 1LY1A 2DKFA 1ISJA 4I9HA 1OLSA 4QBKA 2IH4A 3DNFA 3WNCA 1O58A 3FE2A 3T06B 4YRAA 2YV4A 2WHEA 4BRSA 2EX4A 1H6AA 4QHYA 4A1OA 1USWA 1DX6A 4QU5A 1MQSA 3QJ5A 4XR4A 1LSUA 3KR0A 1BSVA 4M9ZA 4H77A 4Y2VA 2BBWA 1C1XA 2TECE 3VDMA 4LNHA 1YXMA 2XQKA 1HYEA 1JKJB 4MQ5A 3W5IA 3QWAA 3ITDA 2O8CB 3ZCVA 3JCZA 2GERA 4G85A 5H02A 4ZC8A 2L0XA 5K2OA 4B47A 1WD5A 3MS2A 2ONKA 3BAZA 1NF8A 4UHDA 4UXJA 3NT2A 5KTRA 4G8JA 5DBEX 3VVLA 1AZTA 4HDAA 2QZSA 2FYTA 4QXMA 4R2JA 1QF6A 2RHMA 2LV8A 1IULA 3DDZX 4QJ4A 4Y2TA 1LBIA 2DPLA 4A2PA 5CDGA 2PUEA 2EC5A 3QVWA 3HDHA 3S0JA 1U0NA 1R4NB 2EGUA 3HDYA 3M5CA 3ZU5A 2QUZA 4Z0TA 1RJ9B 1SOWA 2VSFA 3KXDA 3M4YA 4FNOA 1P3DA 4IUDS 2C9YA 1NQXA 1TRKA 1HOXA 4M89A 4EPRA 2GKGA 1CY8A 4YREA 4OY3A 4YS6A 1ZCZA 3VR0A 3U6BA 5F7XA 3BIOA 4L08A 2ZAYA 2EHDA 1JU3A 1T36B 2B82A 2Q4TA 4JLVA 2O50A 4UBMA 1UKBA 1WM1A 1D07A 2QP4A 3L0OA 5IM5A 1VKOA 1SIUA 1AF4A 1W8DA 3GH3A 1KJNA 4TLDA 3UIEA 4AX4A 4LZNA 2BMAA 4MH0R 3TFWA 5TNXA 2O2GA 5IVIA 3G79A 1NMQA 1A3CA 3PI7A 4GC9A 4GE0A 4KIGA 1I8TA 2GS9A 3QKRA 3R24A 1ZEJA 2VDPB 4A3SA 2XA2A 5CU7A 3T3DA 3IIIA 1W5AA 2JJYA 4G25A 1LD3A 4RD6A 1ZDMA 5PGMA 1LLQA 2DQZA 4B45A 3WGIA 4FMPA 3ESQA 1LSSA 1POWA 4ECEA 4IIBA 2OV3A 3RRMA 2Z4SA 4FS3A 2XGOA 4B79A 2VHEA 3VTZA 1ID1A 2OENG 4WUVA 1X7YA 4NZMA 1FJXA 4CEJA 1W4AA 4KEAA 1Z73A 1XG5A 5ALRA 3TRDA 2EF0A 4FR2A 1M10A 2KLBA 5IBRA 3GRVA 3PF9A 4E7PA 1NBOA 2C57A 1IDOA 1YDGA 2IIQA 3OQBA 3H4VA 2R7LA 3LUBA 3DUFA 1QO0A 2QLLA 3E4DA 2EZUA 2YJ5A 1L6IA 4NOLA 2IC5A 4YRFA 4XTCS 4ZOCA 2NXCA 3BEDA 2J6BA 2HPHA 1J2TA 1L5GB 4QYSA 4XIJA 2ZROA 3ETHA 5T5QA 2Y9MB 1YFKA 3ZU4A 4L3VA 3O95A 4PLWA 5BWOA 5DXJA 3RHTA 3V2UA 3I9OA 1JIJA 2HR1A 3PHCA 2J7KA 1QONA 2X0DA 5LU9A 1SBQA 4TS1A 5BOSB 1OIXA 5BSRA 3P94A 1TJYA 2J5QA 3EG9A 2IXAA 1SIOA 4F5YA 3FF1A 4TTIA 4CEHB 1ENOA 3KKZA 3PT9A 4S35A 5KYUA 3ZNPA 5JQWA 1S2GA 2A6PA 3DEJA 3IP9A 3R3YA 1RFLA 2EBFX 1LI5A 3ZLTA 3KQSA 4WAUA 4GL4A 1MQAA 2PRIA 1ODFA 5BV1A 5A3VA 4DG8A 1QH9A 4KVZA 3UAGA 2OCIA 3WNQA 4UUMA 1QHNA 1QFSA 1X1BA 4MWOA 4QODA 2VNHA 2M6KA 4LE1A 3L4JA 1E3QA 3LW8A 1U3CA 5C18A 4Z4EA 4IZIA 4EUNA 4CKBA 4I1IA 3AGQA 2BJHA 3B8EA 3D6AA 2UYYA 1NXTA 3H9JA 5FEMA 4B8ZA 2N0SA 3TOVA 4AO8A 2J45A 3PICA 3TJZA 6Q21A 1Z75A 3QVJA 3DAOA 1JG3A 1C41A 1L0BA 1ZOIA 3A4NA 1QS0B 3MD0A 4NX2A 4PWZA 4Y1RB 1KDZA 3ZI4A 2CXPA 5EP3A 1RZ3A 4TKZA 2LDBA 1Z45A 1J2YA 3O4GA 4F71A 4OMFG 1QO0D 5IKXA 4KQIA 4MWDA 4Q3KA 3OKCA 1VG0B 1LA2A 3SM9A 5ERYA 1I6MA 3DAPA 3EDQA 1EFCA 1FDWA 1PS9A 5JSUA 5HZKA 1FSPA 1IUNA 1EK5A 4WASA 3E8SA 1W5BA 2VBGA 1GWNA 1ODKA 4NQRA 1RPEL 1FU8A 2V8BA 4ECAA 3RVPA 2B4QA 1LBQA 4MVJI 3KVNA 1OT3A 2IUFA 1WL8A 1DC3A 3B1VA 3GJSA 4LS3A 5DVZA 3U7FB 2YVQA 1W36D 2XCOA 1URPA 5AM4A 3IB3A 4M55A 4ND8B 1W6RA 3NBFA 3WIVA 3I2FA 1RAAA 3LT1A 4RPCA 3LCVB 4ZPJA 1EWYA 1RZRD 5E8JA 2PL3A 5H16A 3IUBA 2V1UA 1IY2A 2LNDA 4JCOA 3V97A 3TRHA 3CNHA 1G6Q1 2QQFA 1BCRB 4BFUA 4DLNA 3PHIA 2VK2A 1JHVA 4LW8A 3BRSA 5E7MA 4FB4A 3VZDA 1ZONA 5CT5A 2QKYA 2IIPA 2XRFA 4K86A 2G0TA 4MWSA 4JEHA 4YJ3B 4EO4A 3MWDB 1NTOA 1ZM3A 5JATA 5GONA 3X2SA 5MF6A 2OGSA 1HZJA 3ZIDA 2I8AA 1BX3A 2OGWA 1EZZA 1GZSA 3AKEA 3DL2A 3GJ8A 2C4NA 4NMLA 5IBPA 3ROKA 3PRHA 3MINA 1TYAE 2ZIXA 4RGQA 4EKNB 4AJJA 3VH4A 3WGHA 3V6MA 1DWQA 3R3SA 4FT4A 3MF4A 3ORQA 4B7XA 2GJSA 2Q2NA 3CF6R 3I04M 3DTTA 4Z86A 4YI3A 4D0RA 2BH2A 2YYYA 4I8IA 2P69A 1E20A 2IOFA 5HKKA 4Y2RA 2XUQA 4FWTA 3EC7A 1GUDA 2DBVO 4MDHA 1OCTC 2J9ZB 2R66A 4HWPA 4IVNA 4RSGA 3GAFA 3HCCA 1USVA 2DHDA 3JD1A 3H16A 4J16A 3RABA 3GNQA 3U31A 3X1WA 1Y6FA 3BTOA 4B3XA 5AI0A 2ISCA 3JQFC 4ND7A 2G6BA 1TGYA 1CUFA 2V4UA 2O8FA 2OTCA 3T0GA 3N2NA 3FZNA 2DY0A 2RGEA 2ZT5A 1VYTA 4KO8A 2F3RA 3EX7C 3DTYA 3ELUA 2GBLC 2OAEA 1F8XA 4ZRNA 4R1MA 3FFBA 2DFVA 4BB5A 1U8AA 1L7NA 3R9XB 2IUTA 3OCUA 3ZQUA 3ZD9A 2XTNA 2ZB8A 4FFVA 2G8NA 2ZWAA 1BQ4A 1E1MA 4TT3A 2VDVE 4R40A 3DMTC 4J4TA 1A4XA 3LY5A 3PRYA 5CLIA 3UATA 2OECA 3H0EA 3LY8A 2B1IA 2V6GA 5I51A 1L7EA 4ESEA 4OJYA 4D41A 4F38A 4B73A 4KPUA 4YLEA 3LCJA 1OIVA 3ND5A 1XD2A 3BREA 4MPDA 4YJFB 4BNVA 1HFJA 1DHRA 1O8CA 1CFZA 3L07A 1TK9A 1G55A 2FP4A 2QT0A 4GWGA 4UU8A 5DK6A 4H3KB 2AB0A 2NU7A 3ENQA 3DSRA 3H1EA 4NSNA 4LK2A 1ZM4A 5ICGA 5HKKD 1SEPA 2FG6C 1E7YA 1XZEA 4IIJA 4ERNA 2CDAA 3I28A 4B3BA 1QRSA 1P4AA 1DW9A 1TM3E 4G23A 4X6YA 4HSEA 1DC5A 2Z8YM 1KEEA 4YBAA 4CLHA 3TDNA 3RW9A 3IEIA 3G2HA 3HCPA 3T8YA 4GL2A 2HA7A 5CXXA 4JJ8A 1X70A 2B4KA 2XCUA 3AGPA 3HJAA 4XM2A 1WSBA 4D4JA 1T2CA 2PBRA 1BXZA 2IEGA 5EXEA 3DLPX 5EJ9A 1TGVA 1USIA 1X87A 4G86A 4FS8A 5IZCA 1YOVB 4JZKA 2HZBA 3OZFA 5KDLA 5KNBA 2F64A 5FLYA 3FSRA 2GN9A 3ZNOA 1E3SA 3OFNA 3ZWNA 2JJ8A 2JVKA 1QCZA 2ZUBA 2ZRJA 3OE7A 4YQFA 2BRUA 2PBLA 4AF7A 1G4UR 2J85A 4FYKA 4Z53A 2BI8A 3FDFA 2RGCA 4ALMA 1XALA 2FKNA 3CVXA 4NDNE 3LSYA 5CURA 5AOCA 2X0RA 1DV2A 3CC8A 4FEGA 4D6YA 2XQFA 3HXMA 4N7BA 2Y99A 3L93A 4PIMA 4COKA 5JAMA 4PXAA 1JR4A 3BERA 4BGVA 1Z35A 3VAZA 3A1WA 4NLLA 4A1FA 4CLDA 3NYIA 1R5BA 4P0TA 1YE8A 2HRCA 1BVRA 3RUIA 1GFSA 1CZLA 4TSRA 5BPHA 5ENVA 4GYJA 4OOFA 5K4AA 3VNAA 1XTRA 2F1IA 3WVNA 2Q7OE 1N2EA 3TZ6A 4F5ZA 3F5SA 4LHVA 4MVYA 3TTSA 1AURA 3KQOA 3SZGA 1VHQA 1V5GA 4X1OA 3FMYA 1P81A 2N1BA 2XMQA 4NMWA 1CUYA 2XVYA 2PPVA 3DOFA 4Y2YA 3EAFA 3WSVA 2RHHA 4HKTA 3EXAA 2A7QA 1VI6A 3GZ4A 4BTVA 1VP9A 3S1LA 4LC1A 3DV0B 1NAIA 2B6HA 2PGJA 2R5WA 1PNVA 3IC5A 2FPGA 4L4XA 4Q3AA 4XWAA 1KYVA 3WZLA 4CVNA 2V9ZA 3K70B 1Q3HA 3RU3A 4PBSA 2AC2A 2SECE 1AN0A 1EUDB 3DW3X 3MGKA 5KYWB 1RKBA 1DAKA 2QUBA 2V45A 3AF2A 4I9FA 4BFCA 3DT8A 5K4GA 3CH7A 4NOMA 5KNBD 3N8KA 1XCLA 1JU4A 1HE3A 3E7PA 2JQEA 3OFND 3EOAI 4GUAA 3OE7D 4NABA 3A3NA 2E4UA 1C3JA 2DT8A 1ES9A 5GZ1A 1C3LA 1X14A 1PR1A 3I4FA 2V54A 1E1NA 2H4HA 4HI0E 4UAJA 1IUKA 5DSZA 2ADOA 5HTKA 3ROZA 2R0QC 1QWSA 3TB4A 4L85A 3TM5A 4E0BA 3KPYA 2IZ1A 4PN7A 1Z4QA 2NUAA 16PKA 1G8MA 3B7WA 4A6EA 3EIWA 2YL2A 2BGMA 4RDIA 5AM2A 2CBGA 3U37A 3ILXA 1YUBA 4UOQA 2RKWA 3WDKA 3JASB 3UWDA 3GG9A 1I1NA 5LDGA 4JDUA 2ZP1A 2GZAA 1QAQA 4HQ0A 4UVDA 3QTBA 5ALXA 1BQ3A 2WY2D 3ZE2B 5LU8A 2C9BA 2VTKA 2PANA 1JRLA 3FFTA 4UMVA 1X6VA 3PE6A 4EFNA 5JAIA 1AGRA 4PZZA 5BR1A 3E03A 3OTHA 4JP2A 3MNFA 1JLLB 2GPJA 4QFDA 2ZQ5A 2GBFA 3HC7A 4D8UA 3QSGA 2XE7A 4OQQA 2EKDA 3IPLA 2ZBUA 4QT0A 5GPBA 5AVWA 3A06A 3HBLA 3BCUA 3NCTA 4GNKA 1NYRA 3DBRA 4Q7EA 3WL7A 3SVTA 1Q1GA 4D5EA 3U7IA 4B0OA 4LRUA 3ZZNA 1Z0ZA 4I4TB 3KT6A 3MCTA 2Q1XA 1Y6GA 3QW4B 1D1PA 1FPMA 2P2CA 4R9RA 3AOGA 3ZVRA 3C8MA 1XLTC 1VBNA 4H7KA 4HDNA 5LLTA 1QQAA 3RAGA 1V35A 3L46A 3H4TA 2AQ8A 2R68A 4NF2A 4KREA 1UMCA 5BV8A 3B3GA 4JR2A 4OAPA 4H2DA 2JKYA 4KW7A 2C88A 2OK7A 4KR7A 1L8LA 4UQOA 2HC9A 4K6CA 2BP7A 1YS1X 3BCSA 1D4ZA 2VT7A 1VTKA 3V7UA 3NUGA 1ZXLA 4TYQA 4Y1FA 1GCGA 4YJHA 5L6MB 1AUXA 2XE8A 5BNIA 4NIMA 3C97A 3VJLA 621PA 1XOIA 3S2GA 2H2DA 4B3MB 2Z2YA 1Q21A 2ZITA 2NZJA 4ABYA 4BNYA 3BE4A 2LCQA 5D8DA 1AZSC 4D3YA 5DTMA 2I7DA 2WJHA 1U0FA 1P7YA 1V1MA 2Z5GA 3LPNA 2GEVA 4L8GA 3KJEA 4PG4A 3VPXA 5IT5A 3JYLA 1KS2A 3LBIA 2FB9A 5IWAB 1HBJA 1LNZA 1XHFA 2QLNA 4B6FA 2AC4A 3OJCA 1JR2A 5JDIC 4R9UC 4W1SA 4EG5A 2IXEA 3M9XA 1KEZA 2DLNA 1JG7A 3NKFA 2C4MA 3FCOA 3G68A 1N5MA 4ENRA 5HJ7A 3NRBA 2PY6A 4EKIA 2SKDA 3MTBA 4KVFA 5D3MB 2FEOA 1ISPA 5CYFA 5CB8A 4HAOA 1DIGA 2WILA 3N2KA 4G97A 1QF9A 1A72A 1B2LA 4PZCA 1JNYA 3ROMA 4R8VA 1YB7A 2WA1A 2G9UA 5DE3A 4O3FA 4E4YA 4NXNB 1JAZA 1Z4LA 3LA8A 3AR6A 4ZTBA 1JIXA 5DSXA 3Q5EA 4B32A 1OAAA 2JF0A 4ZJZA 2FN3A 1QCDA 2RHCA 1W0JA 1YQDA 4G4SO 1JEAA 1N7HA 3LXUX 1SVOA 5DHFA 2VPYA 1CQTA 2C59A 3BD1A 3Q3GE 2E85A 2AXUA 4HGNA 5K3FA 3QYPA 3LIIA 3TZBA 4NCIA 4DA0A 2I7TA 4BQPA 2Q3HA 4JBLA 4A0QA 3FUCA 3K6JA 3U4CA 2YHAA 1C7IA 4L7QA 1I7SB 4IILA 3UT5B 1XL0A 1EFTA 1HTWA 5EZ6B 1PTKA 4G36A 5HCNA 3MLEA 1E2KA 3GAZA 3L6BA 4MIEA 1U0LA 1R5NA 1OX4B 1FUIA 1KVQA 2ATVA 5ELLA 4ZZ2A 3OCYA 2D1QA 4QULA 3HL0A 4IXMA 1KI1A 4NARA 5K3DA 3ZK8A 1JEEA 1YKGA 4GLFA 2BFEB 4MKGA 2HU5A 3FZGA 4K9RA 1PUJA 4Q3BA 3RVKA 4E31A 1M7GA 1HEIA 2EWMA 4JQZA 3VA7A 4Z4IA 2VC2B 1FJGB 2PXPA 4PZDA 4AT1A 1MFQC 5BNZA 2V9PA 1DBPA 2CMGA 3L7OA 4E03A 1OSLA 2G3YA 1E92A 1FA9A 3A1SA 3AKYA 4LECA 3U60B 4RFVA 2RBGA 3KPJA 3B48A 1IC8A 4I5DA 1J0BA 5GVSA 2JIRA 4A92A 3MEQA 1VJCA 4G3XA 3VTKA 4Z3DA 3RTCA 4R16A 1A4UA 1R6AA 4RWZA 3L4EA 3NDRA 1D2EA 4KJZA 1NVMB 1P6XA 5FPPA 1U8FO 3FFAA 3VKVA 4QPDA 3IAM6 1KMHB 1EXWA 1N5KA 1W0JD 2WIBA 2Z8ZA 1O0SA 2VJPA 2Q5CA 3G02A 3MVEA 2C5GA 4XARA 2JLWA 4JB8A 4QOSA 3FSEA 1E1LA 4JT8A 3F9IA 2OG2A 3BGDA 1LSJA 1HLGA 4YRBA 3FGOA 1I4TD 1ULZA 2ZTMA 4KQHA 4LF6B 1Z0UA 2H0QA 2DWOA 2GPNA 3LPLA 2MYTA 1WXHA 2WT8A 3OOYA 4LYAA 4EQZA 5LOVB 2GTPA 4UHFA 5KAPA 2EWTA 4KFTA 5IM4A 2PJZA 4RHEA 1WDKA 1NIJA 3GLGA 2CV0A 4WZAA 1GT0C 3FETA 3E5MA 4AWBA 4TKVA 2X9NA 2Z8XA 3E0XA 2NO0A 1RRPA 2HSWA 2W6CX 3H18A 3RSLA 4DXHA 2RGNC 1G2IA 2D1TA 4BP3A 4B7UA 3AF5A 4C0SA 1JG1A 1RRMA 4B34A 2D0PB 4DLRA 3W7AA 4RTPA 4J7AA 3FMIA 2A78A 2HO4A 3VU9B 4YT4A 3KZOA 5U1PA 4M1WA 1J1IA 3GOHA 2P6NA 1I3KA 4Z59A 5DGXA 2PSEA 1ZMXA 4I9NA 4U6SA 3QJGA 5HVNA 2PZ8A 1GUZA 3JVEA 4GX2A 2P9QA 4QE3A 3USCS 4AN1A 3OP1A 3QI2A 4DF3A 3W5BA 3BXEA 3UUFA 1GPH1 4AQYB 3BK2A 5KQLA 4D9KA 4R1TA 2RAVA 5A9SB 1MAVA 3DVAA 1LQUA 1KZ7B 2CJYA 3IUJA 2ZSIA 3UXEA 2FFBA 5CCEA 2O2HA 4CQLB 4ZTZB 1Y48E 2A9RA 1Q0QA 4L8WB 1SQGA 4F56A 5JBQA 4F84A 2O0JA 1KZ4A 5FUQA 2XYGA 4JL8A 1QTQA 1AKQA 5M7EA 1N2JA 5IJ9A 4G0MA 3X0DA 1X0XA 3BH7A 1M34E 2YICA 4M54A 4DXAA 4L8YA 3VMFA 4RDCA 1W0KA 1PFGA 5KEIA 3B8HA 4JEUA 1RE0A 5FIUA 3ZX4A 5JCJA 2ETXA 1FNDA 4YP9A 5JSZB 3RVOA 2ZB4A 2JS7A 4JGIA 2H51A 3SYMA 3N58A 1PNRA 1I2ZA 1CDEA 3OHPA 2XF2A 1QOPB 2GJAA 4DA7A 1QJ4A 2W6JA 2PX4A 2G7ZA 2CYCA 1KBOA 1XDDA 2JCBA 1VIDA 2ATXA 4B75A 4QQKA 4DDHA 4F46A 1DVRA 1GL7A 5AFSA 5HUQA 3G5GA 2WV7A 4PX2A 3AWIA 4AKIA 4DREA 2BZ0A 3AP1A 4BO2A 1QGZA 3DPSA 2GXAA 4RKEA 3D9QX 1P39A 1MW9X 4OI1A 2WVGA 5KX5B 2ZSKA 3LL7A 2HIHA 3E27A 2WHQA 3M0EA 1NVKA 3IOBA 3FNGA 2DG2A 3HS3A 4ZMBA 4Z4GA 4EOGA 5BN1A 3V4ZA 3O83A 3WADA 3D8SA 3QMWA 3EEFA 4HK4A 1VBMA 3C6BA 4FDAA 1DIAA 4CHTA 1F8YA 3D6TB 4LMBA 4FMCF 2Q5EA 3M89A 4CTMA 2JNWA 4XDYA 3GJZA 1A2OA 5AIAA 2ZBQA 1F8GA 1OUMA 3GJYA 3OOSA 5EJ8A 2A9VA 4F3RA 4IQ8A 2FUEA 3TKAA 1SCJA 3N59A 4NHEA 1CX9B 2AW5A 3N2LA 3PCXA 1O1YA 4KWHA 2Y77A 1G1MA 4DSTA 3DFZA 1Z6TA 2A8YA 1IJFA 2BHLA 2D06A 2GWRA 2R5FA 2AW3A 4RV9A 1SG9A 4MVJG 3TFQA 2LIVA 3DNVB 1C1XB 1M75A 1TX4B 1EB9A 2H1VA 2VHJA 2Y1OA 3AVOA 4MOWA 5AM5A 2AXEA 4OK6A 3PYMA 4HFMA 4ZOQI 1RHJA 5F23A 5JCJD 1Z4IA 2IEYA 3FCEA 5KDDA 2X1VA 5FOXA 2Z1NA 3QZUA 5JPDA 1WY7A 5IASA 4KL8S 5DF1A 1P33A 2PG3A 2E5LB 1PEDA 1PIWA 2W6JD 5HE9A 2C07A 1SU6A 2ZYWX 1YMQA 4CF4A 1O6CA 4Y2UA 5TT1A 5HR5A 1W30A 2C29D 2ZIVB 3IA7A 4NBUA 3L40A 5TS2A 3SR0A 3UT0A 3ZWYA 2YWDA 4CV3A 4EB0A 4ZHQF 4DSNA 2ZJ5A 2P5YA 3W2IA 2YN2A 4WXEA 2NYAA 1ENZA 1SPXA 3OC0A 1R10A 2DTDA 2YS6A 1HYGA 2FFQA 2GN4A 1U1FA 2XYQA 3ISTA 5HOEA 3QE4A 1DQRA 3FTPA 5JXIA 5K2MA 5AJHA 2WWIA 2AN5A 1JR6A 1PG5A 4XJSA 3I73A 4OM8A 3HB4X 2O1XA 1RBYA 3GUYA 2ABWA 2VLIA 5U9CA 1NW4A 4C3VA 3K0AA 2G17A 3NXHA 1XWIA 3FWPA 4HNHA 4TTAA 3FXAA 2CUNA 4EY5A 3WTCA 1CU1A 3LGXA 4JT9A 4ZYZA 1BOFA 4DRYA 3I0ZA 3F3KA 3PUHA 4G63A 1Z82A 3QKRB 1MO6A 2VDUE 4RQAA 4GOND 2PEZA 3M70A 1RHUA 4GGMX 4IXTA 5KO2A 4CDMA 1TIKA 1BDMA 5ALIA 1DMRA 2XB4A 4Q24A 3UMSA 1P1HA 1X7YB 1BKYA 3GRFA 3T5CA 1EU1A 4XA8A 4CEJB 3NJ8A 2I76A 3RFCA 3MG9A 4D0SA 1VCMA 2R4UA 2WF6A 8GPBA 3VVCA 1NMYA 2IW1A 1F51E 3HV2A 1CETA 4HNVA 1B0PA 4GQMA 4N3GA 1A4RA 2YHBA 3DUFB 1JLKA 4R7GA 1YR1A 3UKDA 5E4JA 3HR8A 2RBKA 5G1PA 2EU8A 3GWZA 1SC1A 4OIFA 1HEYA 3I09A 4IOJA 4C4PA 5IDXA 5IN4A 3VU3A 2OP1A 5TLSA 1YHNA 5FWAA 1KR2A 2OV2A 3CRVA 4Z54A 3L02A 5AXBA 1J21A 3DEIA 1FUUA 2Z3VA 3FHJA 3HI6A 1QV6A 1TTPB 4JJ7A 1UBTS 3V42A 3SGLA 5JZSA 1UZLA 3KJZA 3E2MA 3EASA 4PZUA 3IHKA 4W1QA 2AK2A 1SU8A 3GEPA 2YZNA 1DOZA 4HH1A 1IHXA 1W36B 3CKYA 5EJ7A 3ESAA 3UPUA 4N76A 1QG0A 3EG9B 3IT1A 4OKNA 4I1UA 3WWEA 3FCXA 4HBZA 3HNRA 3RTDA 1DAOA 4EX6A 1TEVA 5KYUB 2O3UA 2AFRA 4NYMQ 3GRKA 2VPIA 1IY1A 3WDSA 1KEWA 2O20A 5CBKA 1K75A 1NN3A 1MB0A 2K4MA 3JS5A 3DWEX 4L6IA 4V0SA 3BKXA 3SX2A 3NP7A 2HHHB 2EVWX 4U7GA 1R4MA 4Q9IA 3D1LA 1J97A 2AKAB 2PIAA 1E98A 5F9FA 3LKDA 2P0YA 3CR8A 4S1OA 5F73A 4CKBB 4HNSA 2GDJA 1D5WA 1QO7A 2G25A 3NDIA 6AT1A 4UW9A 4DRXA 1LUAA 3S55A 3ZKWA 4KKXB 5LDDC 1Z2NX 4LHZA 2I8CA 3MWYW 4R0NA 4RY0A 3CR7A 721PA 1P74A 3WJ2A 4OP3A 4DIBA 2VH1A 5LL6P 1PR4A 3FDJA 3IDQA 2FPOA 1VIAA 1JI3A 4HP8A 1RLMA 4YQYA 5EQDA 1M74A 4ZIRA 5ESRA 4O4LF 1GTZA 2WIFA 1J0DA 1XNQB 4UVEA 3LBHA 5G3YA 4K7JA 5G1NA 1UPAA 1VXOA 2OC4A 3N0TA 4IYJA 1XZNA 1Z5VA 3S99A 5JWHA 1NVXQ 1ZMTA 4TN1A 4E07A 1RQNA 2KLHA 2PZJA 2QVGA 3IX7A 3AI3A 1P9OA 4MV6A 2PGLA 3WIDA 5BSTA 3AXTA 2Q0XA 2BEWA 2XNKA 5AUOB 3MM4A 3RUFA 4R2WA 3KQQA 2H4WA 2J3MA 3VZCA 4EHHA 5BV2P 4D8YA 5A71A 2AUWA 1ZPQA 1XDBA 3PITA 1X1CA 4MB0A 4BXOA 5F35A 1S2OA 1DHTA 1R8YA 4A8HA 4COOA 1UBMS 4X00A 2QTWB 3T4XA 2FPKA 4P86A 2E1PA 4GPEA 1GNTA 1AU9A 3CLUC 4JI8B 2FQQA 2HJWA 3PNLA 1VE3A 4YX9A 2AJ8A 1W4ZA 2FPWA 4LJ4A 5GONB 2H2IA 1UDAA 3C5VA 3G0DA 4IJUA 4IRMA 4MWCA 4XSGA 4I81A 3TLAA 3B6IA 4TLLB 2DZDA 5C5IA 5D7BA 5DOZA 4HDSA 1XO1A 3MINB 2ZIXB 3FY4A 2FXVA 3RJMA 1Q95A 1R6XA 1I3NA 5ICCA 3NLLA 4QTTB 2VRBA 3IEKA 4X1YB 2X0KA 4EG1A 4JT2A 3LYAA 2XIQA 4XLTA 1ZQ9A 2O2DA 4JBIA 4EJFA 5KNCA 1KJJA 5L53A 1Z5ZA 2IKQA 1M34A 2VPZA 3LQXA 3GJ6A 4BB9A 1AXEA 1KI3A 1O8BA 5AXDA 2HRDA 2Z9BA 3B3FA 3BGOS 1QP7A 3UC5A 2PV7A 3JQFA 4XDHA 1K89A 2ISSD 1OBOA 5A7LA 4O8BA 5KOHA 3MT8A 1V7QA 5I7HA 2YDYA 4MRSA 1XROA 3BUSA 3K20A 4KTTE 2I6UA 2XB6A 2PX2A 1NW8A 1SKBA 1PFYA 3QRWA 4FT2A 4I7EA 5K0BA 5DXFA 1Z5GA 1JBEA 2GBLA 3QITA 4BNGA 2W42A 3AL0C 1DUIA 1EX7A 2OCPA 1EFVA 5SY4A 4S04A 3A36A 5BP7A 2AVDA 5K8JB 3UHJA 3Q0IA 3A27A 5H0IA 1EESA 4EMTA 1D4OA 3QVOA 5F12A 4BCCA 4X4DA 4HY3A 1J42A 3QMVA 4BVLA 1KI7A 1P5RA 5DKFA 4BBPA 4H27A 3T35A 1MO3A 1Z0SA 4LQ4A 1P3JA 1C0IA 3ZWVA 1BMTA 1ZOSA 5FUXA 3OBIA 1DC8A 2WP0A 2V6MA 5KAMA 4CF5A 2KW5A 1K7YA 2B5VA 4QC2A 1DFHA 5THQA 4TMFA 4D9NA 5JYBA 2AKEA 2FWBA 1N2GA 3RR2A 4KPUB 1XAGA 1JLHA 2ZRLA 4ZVKA 5ALSA 3C45A 4DFDA 4MGZR 1XD2B 1Z07A 3FBGA 3KCNA 4GAEA 4JSRA 5JVDA 2ZI7A 1ZK1A 3PPIA 3K9QO 1YS2X 2FP4B 2P2ZA 3FB4A 3R7BA 5C37A 2WLSA 3L7JA 2NU7B 3BSFA 2PX8A 5HIIA 4YLGA 3N05A 2J31A 3LHDA 1H5UA 3EPKA 4BPRA 4WGFA 3DBLA 4ZJUA 4IIJB 5KNCD 1TRHA 5F1OA 1T8SA 1U8CB 2JLVA 5LJIA 2EKPA 1KEEB 2VHCA 3D31A 2ZUTA 3K0HA 1H94A 1XVVA 3RIHA 4BQSA 4E2WA 6YASA 4CLRA 4B81A 1C1HA 1OPRA 4OUDA 3VKGA 3CEPB 2C2XA 5DGDA 2ZWPA 3O8BA 2VP6A 2WOJA 4UUNA 1S8NA 1MX9A 1OXTA 1Y3BE 1N2HA 1Y7PA 3K5PA 4IZOA 3A6DA 3CX6A 2YS7A 2ZBVA 3AQ4A 1PZMA 4EO9A 3IQEA 4P38A 4IZHA 1OMOA 4K2AA 3FUXA 3E3OA 4LDAA 2PXEA 3VV3A 1GV0A 2G1PA 1ORVA 4CG2A 4TM7A 4TQGA 1Z7YA 1RAFA 3COYA 2FFRA 3IEPA 4FYPA 4XD7A 1H05A 4UU1A 5K3BA 1NNLA 3F97A 1US8A 1E6EA 1NQWA 2XDYA 3BHNA 1OWLA 3LUFA 2BHTA 2O49A 2FCRA 3KC2A 2VNKA 3TW6A 4JWTA 1FFXB 5F3RA 1UAAA 3MBIA 2FN9A 1R8SA 1I5EA 2QLJA 4HR7A 1V9LA 1XJWA 4OL0A 4PO8A 1NUQA 4UHBA 3C7TA 1MO2A 3GN2A 4MJ3A 1J39A 2RC5A 4LJLA 1DTEA 4Q1BA 3T61A 2Y0CA 3N5KA 1SJ9A 1V5FA 3O8QA 2NSYA 3K8QA 1SKQA 1Z29A 1C1YA 4O2AA 2ZJAA 3GN5B 1XELA 4I4NA 3CVVA 4OHVA 5GM2A 3D8HA 2H48A 4PBTA 4RIHA 3K71B 4KMRA 1A88A 2O7VA 2OLEA 3N28A 4WMLA 4Z6KA 5BNTA 2UUBB 1QVZA 1ILWA 3KKQA 1V11A 2I3BA 2DHCA 5DNCA 2ODQA 3LT2A 4QUIA 3TQCA 5BXYA 4KE6A 4UAUA 2F3PA 3W5UA 3GT0A 4GF5A 3TD9A 2E1RA 1X1QA 5EERA 4M38A 4NQZA 1Z62A 3IODA 5YASA 5CYGA 3K05A 3BA1A 5MN5A 1DELA 3I6IA 2Z9DA 5JANA 4RXUA 3MEJA 2JIPA 2FPGB 1P2GA 1W49A 1DEAA 1S7GA 4DQLA 4F3YA 1XR3A 1VPLA 2HFKA 3V3KA 2FA9A 4LUCA 3QLTA 3SC2A 4YRMA 4HDMA 1M8FA 3NTQA 4INPA 4P35A 3VR4H 2ZCVA 2JD0A 4Q66C 2ZQYA 1YRWA 2OD7A 1IQUA 3E18A 4DIOA 4KPYA 3U3KA 3QW2A 4DCOA 1E6CA 4OKSA 4YRPA 3S68A 2EKQA 3AJ9A 1J99A 2H0RA 3OTWA 4LPSA 4PR0A 1EBBA 4UBJA 4YAOA 2H65A 2JLBA 3T52A 3ZQ6A 3HU3A 1PQUA 3KXLA 4NPHA 3STVA 4LRWA 2PH1A 1U94A 3DE5X 3NCHA 4MEJA 4CCWA 2O2JA 4M1QA 1M1UA 2J48A 3L8HA 1UBCA 2NUAB 5IYZB 3ABOB 5H80A 3UB2A 4OHZA 3SR3A 4AX8A 4BX3A 1T1SA 1CRZA 1BMDA 4N65A 1X8KA 4H0FA 5AI5A 2C3OA 2H16A 3RWOA 3KAPA 3VPSA 1WXXA 5BMOA 4H1WA 2F1OA 2IXFA 3SSAA 2WUDA 3I2IA 4ZOBA 5ELMA 1IOVA 1KK2A 2IIBA 5INTA 2PU5A 3ORYA 4D26A 2WG1A 3ICWA 3HVKA 1C4WA 4P4TA 4JENA 2EKZA 2PR2A 3B7GA 1CYDA 3KWJA 1DWPA 5CX1A 5DBOA 5CH5A 4YJKA 1GRNA 2C7VA 1CR2A 3ETJA 2EIHA 2VSYA 3PFBA 5F2KA 1WS6A 4IW3B 4L76A 2C61A 3RYTC 2GFQA 4M76B 3M6XA 1MUUA 3A7EA 5DBGA 3VDXA 2FE1A 1W88A 2VH5R 3EEBA 4QSMA 5DMXA 3TTUA 4WOCA 4QUKA 3MBKA 1RQ2A 3H8JA 5E2AA 1RCFA 5TPZA 4DRZA 1T5DX 1N2IA 3TSZA 1YONA 3DBRB 4XWWA 4JYBA 3KZNA 4KWTA 2OO5C 3PE3A 5GJBA 5DW3A 5GWXA 1TECE 3DHEA 1SU4A 2IEZA 3JRXA 4IQ0A 3ZCXA 4XX0A 3HWX1 3LUAA 3PJFA 1B6TA 2AJTA 2WU3A 3F4BA 3W8FA 4BO9A 1KWKA 1KFKB 1N9ZA 1T3ZA 4UHEA 4EY7A 1H2HA 3VKWA 4DGSA 4HDNB 3AIIA 3NV7A 1A5BB 3K9LA 1EWRA 4ZEOA 4XFJA 4CMEC 2X6TA 3U7HB 1OYWA 1BHO1 2WK1A 3EB9A 1UMCB 1V95A 3HCBA 2Z58A 1N36B 5AVKA 2JVLA 2F17A 3JQRA 4I6EA 3RRYA 3VYWA 1T6BY 5DWQA 3AO0B 1XMOB 2BP7B 1ELOA 2PN1A 3T6KA 1I7PA 3IUQA 2GCOA 1P8JA 1VFNA 3GK3A 4FX2A 4KDCA 4MUBA 2O8VA 1AKVA 4NY1A 1E9EA 1BS1A 4KBGA 4YJHB 5CT4A 1JQJC 1U0BB 5C3UA 2O5CA 3HZZA 3G2JA 1EP1B 5KTSA 1YF3A 4Z9YA 3NVAA 1N25A 1HUQA 1KARA 3O8NA 1HDRA 2QT9A 2ZRQA 4WNIA 1CLEA 2YQ5A 5E9AA 4DR2B 1RYMA 5KWJA 2X2PA 3PIRA 3T41A 3AVQA 4NNOA 1ZVMA 1V1MB 2IYLD 3M3HA 1HQKA 1QUFA 2ZLBA 4S0XA 2ORWA 3RK0A 4YJ2A 1X86B 1YOBA 1EXMA 1OI3A 3VAYA 3IUEA 1PG2A 4GZLA 4R05A 4B43A 2WPDA 1P0FA 2PMEA 1G16A 5AVRA 3TTXA 1G64A 4AZ0A 4RABA 5JDIA 3AQIA 3IJEB 1NVBA 4M8LA 4ZAVA 1TADA 4MMXB 5E1OA 5TQ0A 5TV2A <