1JFTA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
340
structure length
340
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDAGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
total genus 119
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jftA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA02
3EAFA 2HQBA 1E3OC 2FVYA 2LYJA 2YHAA 3F6CA 3HV2A 3OM0A 4QYMA 4Z4FA 2HSGA 2CHEA 5CHYA 2A9RA 2KYRA 3HJFA 2IVQA 1ZPQA 5CNIA 1OSLA 3OLXA 2E4WA 2MYNA 3IP5A 1DBWA 1EHCA 2HINA 2NUBA 3BS3A 4KK4A 3LUKA 4ETNA 4CBVA 3QEMA 3SCFA 4Z9BA 5B3JC 3FMVA 3O1HB 4XAQA 3RH0A 1ZHHA 3EDCA 1Z2EA 4MR8B 1DRKA 4Q6BA 1JL3A 4N76A 4J1XA 5A7LA 2LUOA 2LIVA 5TPWB 5IEBA 3Q7SA 3GBVA 1VKRA 1PRVA 2PUGA 3QELB 5EWJB 4WUTA 1CYEA 2E4ZA 3JVDA 5KC9A 4IRXA 1ZAYA 1K68A 3OQOA 2OENG 1EAYA 4H3KB 4KV7A 3NHZA 5KQPA 4MQEA 4EYGA 1PEAA 1JFSA 1SXGA 2IDMA 5TPZA 5ED4A 1DJMA 1LMB3 3I45A 4F8DA 4MS1B 1AU7A 1NXVA 3EQ2A 3OLZA 1D2AA 1ABFA 3KLNA 3SAJA 5D2CA 3OM1A 3HSYA 4YLEA 4PU4C 3IPCA 2MYUA 5JS2A 1FFWA 4X4BA 2IOYA 2JK1A 3GYBA 2JVIA 4NQRA 1U2QA 3LISA 3O1JC 1OXKB 4W5QA 2TMYA 1YSEA 4HYEA 3UKJA 4XARA 2HJ9A 4QICA 5HKOA 3JXCL 1LK0A 3DBIA 1YMUA 1EFAA 1JBEA 4NCAA 2BNNA 1QMPA 4RSMA 5GQSA 2KEJA 1U04A 2QVGA 3RVMA 1HF0A 1ZGZA 4YG4A 1JFTA 1SXHA 3G7DA 4GQMA 1DZ3A 3JS5A 3HS3A 1PERL 4MRMB 4ML3A 4NCBA 2BNMA 2JCGA 4JB2A 5TE9A 3T8YA 3JXBC 3RVKA 1IIBA 3SCHA 4IILA 1L5YA 2R4QA 4EGSA 2QV0A 1NXPA 3QQ6A 3GN5B 2FLKA 2WB4A 3Q9SA 4JCXA 1ZZ8A 3ZHMA 4JOQA 1KRXA 2RDMA 4Q7EA 1DWKA 4TLLB 2QR3A 1L5ZA 3SG0A 4F12A 2V0NA 5KQLA 4IMIB 1BDJA 1DBQA 2FMHA 3H5WA 2GRMA 3DGEC 3OQNA 2D5VA 4X4GA 4Z4IA 4LDZA 2IPNA 4DQDA 1M2FA 3JY6A 4I8TA 3M9WA 3N0RA 1IC8A 1MAVA 1ZZ6A 4WT7A 3BRSA 3C3KA 1Y9QA 2ID9A 3DZDA 4E7OA 3LUAA 2VK2A 4IA8A 2PUAA 1QO0A 5BQ3A 1DG9A 2LYPA 1ZZCA 3CS3A 3CROL 5DTEA 5TPZD 3LTEA 4D6XA 3TO5A 4O1IA 4RKQA 4RV5A 3RVSA 4JASB 2IKSA 3O1IC 1QNLA 2GRLA 2LYLA 1Y7YA 2L18A 5K98B 4KRFA 4FE4A 1P2FA 3EUSA 1GCAA 5JNTA 4Z58A 2MSLA 3URMA 5HSGA 1J56A 3DLHA 1AB6A 2MSWA 5CNJA 2ID7A 4G0PA 1Z17A 5TQJA 4IWRA 1MVOA 1X57A 1RXEA 3EODA 4UHJA 4Z4HA 4XXHA 4O8BA 2WJWA 3S99A 2BNOA 2OQRA 4MRMA 4EYQA 3KLOA 1D4ZA 3LUJA 3GV0A 4ZYLA 4PU3C 4O1HA 1AB5A 1NTRA 4Z5CA 2PUCA 2IYNA 3C3WA 1UXDA 3IP9A 2GWRA 2LYRA 3HM9A 3CU5A 4JB0A 4KNYA 2A6CA 4Y9TA 3QLVA 3H1EA 4KVFA 4DN6A 2HPHA 4W5TA 3F6WA 3R0JA 1P6QA 3GBPA 3LUDA 4JA2A 4MS3A 1DC8A 4S05A 1B0NA 2OR1L 4N0PA 2WRZA 2HQRA 4JQDA 3H6GA 4RWEA 4FE7A 4MR8A 2FQWA 2FLWA 4Z9AA 1JF8A 3LOPA 1D5WA 2MYTA 3FGZA 2L2QA 1ZN2A 1WH6A 4HNRA 2PAFA 2R47A 3FMYA 3TB6A 4G0QA 1ZH2A 4RXUA 1Z25A 4RK5A 4RKRA 4X4IA 2FQYA 4FN3A 3N53A 1K66A 4X4HA 1QO0D 3CECA 1A04A 2JB9A 2Q5CA 1NXTA 2MSKA 4KREA 2NT3A 3HUTA 5HM6A 1UXCA 3LUHA 2BJCA 3A3KA 2GZUA 5DGCA 2LPMA 2WJAA 3O21A 2R48A 3SCGA 3K9CA 4XLTA 3VK0A 4LRQA 4X4EA 1P6UA 4X4FA 1EWTA 2LYKA 1PUXA 4YV7A 5KC8A 1F4VA 3F7NA 5IUNC 1PNTA 4GPAA 5TQ0B 3TMYA 5FWXB 2LBPA 1GCGA 1ZDMA 2WUSR 3EGCA 3MMNA 4YO7A 1T34A 4LX8A 3GL9A 4GNRA 5GOTA 4YR7A 4Z4CA 3KTOA 2KEIA 2XDYA 3QLUA 3N75A 4MS1A 2BGGA 4YP9A 3E3MA 1JH9A 2MQKA 4H60A 3T6KA 2AW6A 4RK1A 3HZIB 4LE2A 1APBA 3KKEA 4XFKA 3SM9A 3T95A 4EYOA 4D74A 4Z4EA 1LCCA 3KYJB 1NXOA 4X4DA 2RJNA 3O2SB 2PMCA 2CSFA 2IUOA 1NERA 1SQ8A 3BILA 4N47A 3HDGA 2ICPA 5F64A 5DLEA 5FBHA 2CWDA 3IP6A 4HNSA 4EY3A 3H5OA 4RK7A 5IULC 3QF3A 1FQWA 2FJRA 2H0AA 3JTEA 3KG2A 1HEYA 2WWVD 3GT7A 1JHZA 1X2LA 2M1ZA 3O2JA 4B09A 3GBFA 4EYKA 2MYPA 5BRJA 1E6LA 1ADRA 1P8AA 2F8SA 3R1FA 2JVJA 3SY8A 3H1GA 2VYCA 4MQEB 1QP7A 1FFGA 1NEQA 1E6MA 1ZY2A 4WWHA 1JWLA 1DBPA 1BDHA 2A9PA 3NNNA 1DRJA 3I5AA 4J1WA 3QELA 5EWMB 5EWJA 1ZGGA 4G0OA 4Z99A 2XCJA 1TLFA 4QPJC 5CNKA 1DCFA 3QLTA 2QXYA 3N0XA 3M6MD 3CZ5A 2PKXA 3BDNA 1D1PA 1RNLA 1ZZBA 1YK0A 4YBAA 2O20A 3KXAA 4F11A 3ROTA 2WIUB 3F52A 5FWXA 4MLDA 1YVUA 3I09A 3SQNA 3KHTA 2JVLA 4PICA 1GUBA 1TVMA 4WXEA 1DW9A 3QYXA 5HQJA 1Z12A 1DCMA 2LCVA 1W25A 1MB3A 1ZITA 2FEKA 2M98A 4Z0NA 5IEJA 2PJUA 1ZS4A 2QU7A 1W9HA 3EULA 2RJOA 4RK4A 1LBIA 3H5TA 3F6PA 5ABPA 2NZVG 4ETIA 4ZMRA 3CHYA 1YIOA 1Z2DA 2ICTA 3N6VA 2PUFA 4MR9A 2B5AA 3G5GA 3UFDA 3I42A 2L8NA 4RU1A 5IC5A 4Z5DA 3LKVA 1I3CA 4JAVC 3F51A 1R8JA 2ZWMA 5TQ0A 9ABPA 4MQFB 3U3WA 2AYXA 3T38A 2I6FA 4RK0A 3IPAA 4KMRA 5KI6A 4RDCA 5IX8A 1KRWA 2CD7A 1A0OA 2PLNA 4YG7B 1U0SY 3LFTA 2O38A 4H3HB 3MYYA 1LJUA 3W9SA 5JNSA 3E61A 5FBKA 1E6KA 4ETMA 4F06A 4IMJB 3QWGA 1M5UA 2FMKA 5EWMA 3RVPA 1H9CA 4P1ZA 2R1JL 3QK7A 1A2OA 3JPWA 4I6RA 1U8TA 5IBQA 4KPYA 1M5TA 5KWSA 3LKBA 5E3JA 3FYMA 2FEPA 1USIA 2OFYA 3ZKCA 2QVCA 4E7PA 3KYIB 3G85A 3HCWA 1RZRD 4D6YA 2PPXA 2XI8A 2QSJA 4IF4A 2GBPA 1U2PA 3ZHIA 4G0ZA 1JYFA 1RPEL 2IVGA 5DCLA 3UUGA 4MYRA 1NXXA 2RGYA 4NV3A 4LDAA 1YMVA 3D02A 3OO0A 3CKMA 2IPAB 3RVQA 1SD5A 1SXIA 2L17A 4IVZA 2HQOA 4IGAA 1ABEA 1JX6A 4ZJPA 4W5RA 2FEWB 4N0QA 2LP4Y 1XWRA 3ILHA 4HNQA 4MS4B 4F3TA 4M88A 4MS3B 1UTXA 5KQMA 1RIOA 2JRLA 3TD9A 1E2BA 4NICA 3HZHA 5DKFA 1FSPA 3MIZA 3HK2A 3LUFA 2WY2D 4RS3A 4F8JA 4NDWA 1JDNA 3O75A 2PUDA 4KQ9A 5JS1A 3A0RB 5EWLA 3IP7A 1SRRA 2LYSA 4I6TA 2GKGA 2KZ8A 2GX6A 2N9UA 3A0UA 3NHMA 1YTUA 1JYEA 1F51E 2FN9A 3C97A 1QQAA 1VPWA 3NBMA 3Q41A 5I4CA 2EBYA 1GT0C 1QPZA 1C0EA 2PUEA 4G0XA 3B7HA 2FMIA 3JVIA 3KSMA 5PNTA 3RQIA 2CROA 1NATA 2VUHB 5TQ2A 3C3MA 1ZH4A 4G86A 4PZ0A 3L49A 4MPTA 5B3JA 3B2NA 4YRZA 4O5AA 4RY0A 4Z5HA 2E4XA 1TJYA 3MM4A 2GI4A 3BRQA 4MCTA 3N8IA 4MR7B 2JBAA 3VNAA 1LCDA 2WMYA 3CRNA 3O9XA 1OCTC 2B1JA 3P9YA 4WXMA 5C5EA 3Q7TA 4PYRA 4EVSA 4N03A 3GN5A 4YGXB 3SNKA 4OTZA 7ABPA 3KZ3A 3EJWA 4OB4A 1KGSA 2PL9A 5JNWA 3IDOA 4I6UA 4N41A 1LLIA 2PUBA 1DC7A 4G0MA 3D8UA 3OLVA 1KMIY 3F73A 2XJ3A 3NNSA 4YARA 2PE5A 1CEYA 1WIZA 5EWLB 1QQBA 1L1MA 1M2EA 1NY5A 1UDRA 2IPLA 3MQ4A 4KQCA 1RZSA 1DP4A 1XHFA 4MR7A 2KPJA 4FB4A 2FXIA 2B4AA 2R25B 2FMFA 3UK0A 3GA5A 3QX8A 3Q15C 1Z13A 5JNRA 5KQGA 4Z59A 3H1FA 3MA0A 5TQ2B 3LUGA 3K4HA 1ISRA 5BRAA 2AYZA 2E4YA 1R69A 1R63A 1USGA 1VRVA 2ZAYA 3JXDL 1Z26A 3QLUC 3DLBA 4KFCA 6CHYA 4X4CA 3OMXA 4OLAA 1MB0A 3KJXA 3GWGA 3CG0A 3DGFC 4MLCA 2AXUA 3KCNA 4RZSA 3TRBA 3RVRA 3LMKA 3OLYA 3PXPA 1XWWA 1EWVA 3CFYA 1YS7A 3CG4A 2IVBA 2EWTA 4P98A 2AWIA 5IUJC 3OLWA 2FKAA 4RXMA 4GHJA 4XASA 1Z18A 4YG1A 3H75A 2JBAB 3ILYA 4OG2A 1QP4A 3G1WA 4W5NA 3CLKA 4KK3A 3FFXA 2FSPA 2L49A 3MLFA 1TM2A 2X7XA 3QX9A 3O74A 2LYQA 5CNMA 3CZCA 2P9HA 1FFSA 1ZUGA 1ZVVA 1LQCA 1D1QA 4OBBA 1PHRA 3OMTA 2QZJA 4RK6A 3IVPA 4TMYA 1VLZA 1NXSA 2A9QA 2H3HA 1ZZ7A 4FBIA 3FDFA 1WH8A 3D1NI 2CHFA 4L4UA 3RVLA 6ABPA 3L1PA 1WETA 4YCSA 3HXMA 3HO1A 3S8QA 1JLKA 1RXIA 3HUUA 3H5LA 3BD1A 4LE1A 1URPA 2QW1A 3H5IA 2IPMA 1OXBB 1TMYA 2FN8A 3OQMA 1PRAA 3HEBA 3BREA 3H6HA 5TPWA 5BR1A 3H5VA 3CLCA 1PNRA 1LBHA 3FFTA 4MCXA 4PE5B 2DRIA 2JVKA 5JNVA 2O49A 1S8NA 1EWKA 4QYWA 2XIUA 4PU7A 1ISSA 1POUA 5JNUA 4Q6WA 4Z4GA 3FYAA 1BA2A 1GUDA 1QKKA 1PEYA 2VUIB 4MQFA 3DNVB 5IUKC 2PIJA 3QLVC 2A9OA 1LJLA 4G0YA 1NXWA 1ZZ9A 2FQXA 4LZLA 2H8RA 4Y42A 3L6UA 4EVQA 2PL1A 3RZZA 1C4WA 4MAAA 1S7EA 4YS6A 3ROFA 3RVJA 5FWYA 4MS4A 3HVRA 2EF8A 3N0WA 4MGEA 2W42A 2F8TA 1RZRA 1BAPA 1YS6A 3OO1A 3RVNA 3LFPA 1Z15A 4UHKA 8ABPA 3C6QA 2FTKE 1CJGA 2NT4A 3OMWA 1YK1A 4JCYA 4RXTA 5C5CA 4G97A 3GRCA 2NZUG 3QEMB 3LUCA 2L19A 2IU7A 2P4UA 3NNDA 1USKA 4TLMB 1Y1LA 2YHBA 1CQTA 2E4VA 3Q7RA 4DADA 4ZMSA 4W5OA 4KZKA 3JPYA 2R63A 4MR9B 4TN5A 1QP0A 2AXVA 1O4XA 1DCKA 5FWYB 5T3YA 5T7BA 3KS9A 3EQZA 2AUWA 4WZZA 4YWHA 4OLBA 4L85A 1JDPA 3RVOA 3FFWA 2AXZA 1XHEA 1PRUA 3HDVA 3VNBA 2E4UA 4PU8A 1B00A 1ZESA 4S04A 3CNBA 1Z16A 4LE0A 1JFVA 2MEZA 1BVHA 3MF4A 3CTPA 4PEVA 3O2QB 1CHNA 3QEKA 3A10A 4RY9A 1MIHA 2J48A 2KEKA 4RY8A 2IV1A 1RPJA 4OATA 3M9XA 1GLGA 4JP1A 4EUKA 3OP9A 4ZPJA 2O4AA 2FW0A 3BBLA 3TX6A 1BDIA 4EVRA 2XSDC
chains in the Genus database with same CATH superfamily
3D0QA 3DEFA 5JARA 2GKOA 4EGQA 2W37A 2DF8A 2CYAA 3SMVA 2HSGA 3HSKA 2P3SA 3MK31 3ZNQA 2PGOA 3HQ4O 1MQ8B 3MCVA 2NWQA 5CNIA 4Z7NB 3RSOA 5IRCD 4UBNA 3VX4A 1EHCA 1C3OB 2HINA 3GF4A 3M6IA 2CUNA 5I8WA 1MT0A 3BL5A 1ST2A 1BH6A 4BYGA 4WK2B 1G8SA 3PNBA 3A9WA 4GXTA 4UBIA 4BMYA 4ZYXA 3EIEA 2BMJA 3O1HB 4JEUA 4QJIA 2XCOA 3K3PA 1IJFA 2FN3A 2XUHA 3WGMA 1OT3A 3CRW1 4WGGA 3D0RA 3VC3A 5J43A 1I4EB 2QDKA 1KFBB 5TPWB 2JIZA 1NONA 2ZWPA 1E1MA 4EY8A 1RM0A 3QVTA 4PLZA 1DG1G 1OV6A 2WUEA 3X43A 1ZAYA 3Q8WA 3TVTA 4KV7A 2BKAA 3NHZA 3MEJA 4EFLA 2J87A 2WPDD 3P4YA 3B7PA 5ED4A 4PHCA 1L5NA 3TM4A 4IHAA 1C7FA 1E8MA 1QB7A 1U7OA 3TEMA 2Z6UA 1TFRA 4WY2A 4EYGA 3RUIA 2IOFA 3TEPA 1UC4B 4QTXA 3W77A 4D8VA 1TTPB 1QCCA 3GFQA 4OFWA 4S3MA 3ZVMA 1CKEA 4XJTA 1SUFA 1M6HA 1UKVY 1NQTA 2W9XA 3AESB 1WZCA 3FPJA 1SCNE 2O57A 3IP8A 1GYRA 5F3WB 4QJ4A 1G8MA 5KNCD 1OFIA 4W5QA 1D8AA 1WHTB 1MIOA 3QEOA 1GEEA 2SKCA 3LPDA 4FGJA 4FUQA 3O4RA 1CR6A 1JHOA 3OESA 4WKCA 2O2CA 1CHDA 1C7EA 4AY4A 4KWIA 1N2IA 2B34A 2GHIA 1R6TA 2YNMD 1C30A 2M6SA 4IFBA 1OFUA 1J09A 2FMXA 5B1EA 2X77A 2ZI5A 1SKUA 3N58A 1JBEA 5HFNA 4GECA 3SZUA 3SGLA 1N77A 2BZ0A 3AQIA 1GT91 4BUZA 3PQFA 1EGAA 1GN9A 4P5PA 4DCMA 2ADMA 4MRMB 4GQMA 3G1TA 3KQPA 3NLLA 2J3MA 2FZEA 1SQ6A 2GD0A 2JAWA 4I36A 3TBHA 2VNSA 4BWGA 3T9FA 3GDGA 1L5YA 2C96A 4UNRA 3SHVA 1XVUA 4BEWA 1TCAA 1QNFA 1XK7A 1QR2A 3MBIA 4JOQA 5F3DA 1BVRA 4EGFA 2DT5A 4KAJA 3ENZA 4YPOA 3RADC 1EIWA 1C9MA 3L1IA 1L5ZA 2H8KA 1UJMA 3AG6A 621PA 3ZDAA 3LXUX 5KOHB 2GRMA 2CL7X 3FKQA 1N6RA 1Z33A 4O63O 4J03A 4W63A 4P54A 5ADHA 4LWZA 3LX5A 4WT7A 4EFNA 4CHGA 1QYXA 3KZOA 2X8BA 5DSZA 4KPUA 5DHQA 4UOEA 1J99A 1HMYA 1XEXB 4NY1A 1DKQA 1LNZA 3HHEA 1ZZCA 3CS3A 1YI1A 1P9OA 1P4GA 4GYYA 3OX4A 1HQYE 5DX1A 3FHLA 3PVSA 3L0IB 5E95A 1Z07A 2W8ZA 2PWPA 3SWWA 3TQCA 1I2ZA 3ZQKA 1AKRA 2AMVA 3MRVA 3DOIA 3GXOA 1ZIPA 2CFTA 3L01A 1CJUC 1EG7A 4FYMA 2PXQA 3IAXA 4L08A 5TJHA 1ZA1A 4OHCA 1RKQA 2A0YA 2MSWA 1T3HA 2ZJAA 1MT3A 5K8UA 3TQQA 1P75A 4BFWA 4MRPA 1XNGA 2P30A 1H2BA 4BO1A 3JAMA 2JCXA 3BCHA 4NDZA 5DT9A 4BVJA 4LNUB 4A8JC 4YJ3F 5BSKA 1HNZB 1X1BA 4BNMA 3ZHQA 1RBQA 5IW8A 3C5EA 1KTIA 4D4LA 1W85A 3PNPA 2D4HA 1NTRA 4TVKA 4WCFB 1YIAA 3QNMA 5ARBA 5KVQA 4EEZA 4AG6A 1WW2A 3L8FA 3KL4A 2JJMA 2FW7A 3KE8A 4K9MA 1PSWA 1P6QA 3VPSA 1VJDA 3L6EA 4R3NA 4UE6A 4WLNA 3H1AA 4CV3A 2ZAGA 3ZZ1A 1YKGA 4FINA 4RLHA 5CTJA 3WK5A 3ZWMA 3HSSA 1WVIA 4MTLA 2O8FA 1OIXA 1EX9A 2GYUA 3V55A 2EJBA 5K8LA 1W47A 3K2IA 3LQXA 1CVLA 5EJ9A 1G16A 4D46A 1IM8A 3HVHA 1US8B 3FMYA 4CM4B 3GJ7A 2EJCA 4M1SA 1KI3A 2QGFA 1JHDA 4HRVA 2ATCA 4YRJA 3MWYW 4R2LA 4DCTA 4EO4A 2J5QA 1JDVA 3E15A 3TW8A 4X4HA 3G02A 3CECA 1JHMA 4I50B 1A04A 1DVRA 2FWJA 1NXTA 5BQOA 3WB2A 2AT1A 5KOHA 1SJ9A 1OCEA 3NTLA 1LF0A 5DU2A 5I9NA 4TTSA 1FLDA 1N3LA 3O82A 1W2GA 4PY2A 4S0XA 2PYDA 3VI4B 1WDMA 2GFIA 1K8ZB 2B21A 5TY0A 4ZMSA 4V0LA 4X3PA 4RTKA 1F4VA 2AH5A 5TMDA 3U80A 5KTKA 1U28A 4GPAA 3BL8A 4M9ZA 5DHAA 4MARA 1M2JA 3NVMB 2A8YA 3MMNA 3QUCA 4LX8A 4YO7A 4GNRA 1VMEA 3F3SA 2O8CA 5KJFA 4H0FA 4B1FA 1JH9A 4I1UA 4NBSA 3CF2A 3N2EA 5BV7A 3FI9A 4FX5A 5CBKA 1WR8A 1C30B 5ED0A 1Z6GA 4EYOA 3VVLA 1CR1A 1O3YA 2ZTVA 3CN7A 3W5CA 1CUXA 4R1PA 2VNKA 1J4AA 4CEIB 1CZOA 3LA8A 1EJ0A 2YZMA 3E4CA 3Q87B 2VJCA 2IUOA 4IEFB 3CIOA 4J6EA 3DOFA 3RARA 3B8HA 3HA7A 4D9HA 4FKBA 1F0YA 2BFEA 5A06A 4E4RA 1NBIA 3H5OA 5TEVA 4JVMA 1W29A 2CXNA 1LK5A 4DNQA 3DZCA 2XOEA 5H3CA 2H5IA 1PSZA 2EGUA 2HLDD 1SVUA 4EZIA 2G9ZA 5L7TA 1Z88A 4N5HX 3HN2A 2X9QA 2J09A 5KJ6A 2BI8A 2Q5IA 4RAOA 3SBXA 1QV7A 3N6RA 3I9V1 4XTCS 2X58A 5D5PA 5DBOA 1N2JA 4EFKA 4V3CA 2PYZA 3CVXA 3V00A 1TUBB 1W4AA 3KD3A 3N28A 3TAXA 1RZVA 2XSZD 1R2QA 2G8NA 2I4LA 3ROQA 1N7GA 1QVRA 5B6IA 4PFSA 1DIOB 1M1YE 2XVYA 4R40A 2RI0A 2H8GA 2ZYRA 1SZPA 4PS1A 1IAQA 2G71A 3X1MA 3F96A 4OK3A 5IVKA 4E13A 1DZIA 4D8UA 3BH6A 4MINA 1G7SA 1YULA 3EZ6A 2Q3FA 2J5KA 3S55A 3KQHA 3VZCA 3V4PB 1P9NA 3DFMA 2XBLA 4QTZA 4KO4S 2M98A 1T8UA 2MOKA 3DG9A 3Q2OA 2NO7A 2FPLA 5CLGA 3GH3A 4EX6A 3ZDDA 1ORDA 2WM3A 2H06A 2NYRA 1ACJA 1M8KA 1BE8A 2AI1A 3CHYA 3HKBA 5JYCA 1A9YA 1LLCA 2HHCA 3F47A 1AM4D 2W6ID 3PDWA 1VLMA 1G38A 4RU1A 1MRNA 1XUOA 2VS1A 1PGOA 3OQPA 5FO0A 4AZ3A 3F51A 1MU0A 2VQSA 8OHMA 2BWJA 4NE7A 4AVYA 4H7DA 3WGVA 1PGQA 2BBTA 4B3RB 1E5TA 1CNFA 4ZEVA 3J7AC 5B36A 1JJ7A 2YQZA 4H3HB 2VK1A 4C7VA 2D0DA 2NV0A 1OGJA 2DWOA 2YHIB 2Y6VA 3CLUC 3JQGB 3OQJA 4GO1A 4J91A 3OZUA 4LCJA 4KQMA 4BFCA 1SB8A 4DV4B 3RTGA 1IN1A 4FONA 3MOGA 4YDRA 3F5FA 3K6SB 4E4TA 2R1JL 1CK4A 1OLSB 2EBUA 2W2VA 3COPA 1F2TA 4WEQA 4OLJA 1V6CA 3QKUA 2C00A 2CJYA 4U3JA 3L82B 4LGMA 1VG9B 3TG8A 1P7ZA 1PQYA 3L7IA 1K2VN 4RQAA 2NGRA 1ESNA 2R8EA 4TV8A 3SSNA 1DKRA 4JITA 4E5SA 1Y33E 3GH1A 4GSKA 4V3BA 5KYTA 4IF4A 2VYQA 4KYIB 1LEHA 4WK6A 2NZWA 4MYRA 3W4KA 2TECE 4NV3A 1QONA 3WV5A 1USWA 1JU3A 2C61A 4RTJA 5G4KA 2BISA 4GBJA 2ERXA 4V1CI 4MS4B 4MK4A 1FJHA 2DGDA 2I62A 4F3TA 1AV6A 5HILA 5A9SB 1UTXA 2VAPA 4JL6A 3SIPA 2GRJA 5K0CA 1V8FA 2P75A 4ZO9A 4B3MB 3MGGA 2ZB3A 3K0BA 4MB2A 1HZZA 2OKCA 2YV3A 5LBIA 4B3JA 4Q18A 3IXMA 3F71A 3PC4A 1T6XA 4K9SA 2V9CA 1ETHA 2GM3A 4QELA 2D7CA 4A5SA 3QU5A 4AZTA 3K0SA 4CEJA 4ENTA 3HU1A 4PNHA 2D0IA 3DAFA 5KTMA 2BUBA 3NHFA 4MO9A 4G0WA 3NBMA 4I14A 4R16A 5H4GA 4Y6QA 3GAAA 1SULA 5CU7A 1QPZA 1AA6A 4X9XA 2OY0A 2ILTA 4F93B 1NSTA 3NWJA 2WFLB 1B2LA 3A9CA 5DULA 3C6XA 3RQIA 1PQWA 2VUHB 2NSHA 1TU4A 4IOLA 1WZIA 1W4ZA 3EOAI 2PQ6A 2WTNA 3Q3VA 4ZRDA 3L4BC 5FUVA 4EUNA 4P3OA 1UFRA 1XJCA 2J9FA 4C0KA 1SIWA 1CU1A 2GZ1A 2P69A 5CG1A 1L3BA 3NIDB 2C31A 5CX4A 2A5GA 1JE1A 3Q7TA 1CF4A 4UKDA 1ZONA 1VXOA 3AYZB 4WW0A 4DY6A 1B0UA 3IGFA 5EN4A 1GAQA 3MTGA 4QARA 2OEPA 3PG5A 3SPXA 2WT9A 1ARZA 4N41A 3NASA 3C70A 4JLVA 3VAAA 2VQDA 2BFBA 1FPQA 1O1YA 4I5FA 4DA7A 1GPAA 1G4HA 2VCYA 3MMPA 3KYDB 1RZSA 1EUCA 1E8DA 2C4UA 3FRHA 2GJ8A 1WPGA 4ZEOA 2QLMA 2CLKB 2FMFA 3DO6A 4B34A 4LBZA 4MUBA 3HCOA 3VTZA 2Q0QA 3Q7IA 2AW3A 1S1CA 2QE7D 3V4RA 2X8LA 2EW8A 4W4TA 1KU6A 1XQWA 3REQB 1N9GB 2W6ZA 3OI7A 3VUFA 3OE5A 2AUMA 1HR0B 4X4CA 2ACKA 3OC0A 5CT6A 2HMSA 2BGNA 1QG4A 3KJXA 1VI6A 3TOZA 2JFFA 2DFPA 1K08A 2GN1A 2J7KA 3OECA 2HWUA 1D2CA 4V0RA 5AWFC 3IMEA 1RD4A 4KXNA 1EWVA 3AF0A 3HPQA 3LO5A 5IWAB 3DP7A 2ZBQA 2NO0A 2AWIA 2M9MA 1HTWA 1XRNA 3OTQA 4IXWA 4G9EA 4XM0A 3UMGA 4O29A 4RXMA 4XASA 4P4SB 3NBQA 5CHEA 1P3DA 4OG2A 4TVSA 1U28C 2WF9A 4HNAA 1KMHB 4ZOCA 1WDKA 5BW4A 4DGSA 3A4MA 3DAYA 3IEUA 4PONA 2LYQA 1VYVA 1Q1QA 3R41A 5KWVA 3WICA 4HDRB 2QZJA 1I1QB 2PUVA 4PR0A 3QE3A 4TZTA 3TW0A 3H9EO 3NONA 3ZVNA 4X95A 2PMDA 2ZSIA 4R1LA 2RHWA 4ZAGA 3LDGA 1NI5A 3ON5A 3IALA 4KIUA 5IMSA 3EB9A 4YCSA 1Q84A 4G85A 3KX2A 4P4TA 3MXOA 1JHAA 3UT6A 4DLTA 1WEKA 3E1KA 2ZI7A 5CEEA 5LDHA 3I9LA 4TYWA 1OTXA 2YIMA 3G2JA 4IFEA 3HEBA 2FDRA 4EHLA 1I7LA 1XN1A 4FX2A 5H0IA 3ZDZB 2DRIA 3SHOA 3ZZNA 2W2LA 5A9SA 5JNVA 3EMBA 1ISSA 1AQJA 1LW6E 4O0MA 2FUG6 2ZT5A 2XD4A 1N1MA 2VSFA 4W82A 4C5AA 5LZ7A 1JTFA 2D6FA 1PEYA 4MQFA 3U4QB 4RJIA 5BMOA 1UINA 2D62A 3URKA 1JECA 4GPIB 4DCGA 1KQFA 4IIUA 1N32B 1ADFA 2A9OA 1AXEA 4LZLA 3AJRA 4TV8B 4C20A 3B1FA 1XIVA 2HIGA 4YDSA 4D92A 2H0QA 3PC8C 4NU8X 1S7EA 4Q4LA 1LU9A 1ZVQA 2Z9BA 3S2YA 4PXAA 1F2TB 3F5MA 1IN7A 4LY3A 2WVJA 5EE3A 2ZM6B 3DB1A 1E3LA 4BLQA 2QVYX 3EJ6A 1JSLA 4MVJD 4YJ2B 4K6OA 2CJPA 3B1KA 5FJJA 3VAYA 4BX9A 1DPGA 3H13A 4K28A 2G77B 3L7YA 3DBVO 1ZCBA 2CXOA 3NHKA 2FTKE 3MCZA 3IUNA 4X44A 3RTBA 4PG5A 1Q0LA 4V0SA 1ZNXA 3PSHA 5FYQA 5C5CA 5J47A 3QPCA 5A6VA 3BPSA 4XJVA 5C8YF 5EP3A 5FYDA 2QYSA 4LF9B 3I6BA 4RE5A 3PNKA 1KEKA 2QTHA 1RLUA 4HDKB 1PG5A 5AVQA 3AVWA 6REQA 3NHAA 5CFQA 3TPCA 5KYWA 2RHTA 2C7GA 4BRUA 2QP4A 3AI2A 1T5LA 3L8HA 2VJPA 3JPYA 1JXAA 1QLJA 2AV6A 1QPGA 2AEFA 2BHRA 2VF7A 5LQNA 3NT5A 4DV6B 1Z4LA 1JIXA 1X8LA 4BFLA 1QIKA 3MAJA 1AS0A 4S1OA 1TGVA 5G2OA 2FZCA 2AXZA 4TZKA 1RJFA 1SPBS 1F8XA 4QLAA 2BHLA 1BXGA 1IC6A 2XCLA 3C6YA 3LHIA 3RKSA 5T41A 3RFXA 1TT5A 4KWEA 2Y1CA 4LE0A 1ZMBA 2ZT7A 2PH5A 1VL8A 3CTPA 5IDXA 1K6XA 2VHVA 5EZ6B 1I9GA 3FW1A 1AUQA 2PIDA 4KJXA 3OP4A 3IAAA 1B7GO 2WTAA 5C0OE 3L6CA 4B17A 2O4AA 4Z7JA 3BBLA 2FDXA 1R8YA 1LZLA 2RK3A 1QDUA 3UB3A 2XSDC 2CXRA 3AEUB 3W2IA 3P96A 5AVTA 3IPXA 3EPKA 5AKKA 1PNQA 4G65A 2VP3A 1MZPA 2NO9A 3R7SA 3SDBA 1Z2AA 3Q5EA 4HQ6A 4EQ6A 3OQIB 2X8WA 2ZBPA 3T5CA 4E2ZA 1NLUA 3BGIA 1PO7A 1RDFA 2RKBA 4UE2A 4FBLA 3U9LA 5HM8A 1KH1A 1G20A 3FMIA 3JQ8B 1FNMA 3KB1A 1P0MA 1YS1X 2ZXUA 5I9LA 3OTHA 3NKFA 4IKOA 3AETA 3G13A 3SEFA 3AIKA 2ZQ5A 3OCCA 3CVYA 5LBUA 2CXTA 4NECA 1QCYA 4FMCF 2IEBA 1Y1QA 5IEBA 3BULA 2JHGA 4DF3A 1VQ1A 5BWBA 1VE3A 2J9ZB 1KOGA 4B6PA 4K9QA 2ZSBA 2PGIA 1MJNA 4QXAA 5T4EA 4WDQA 4BAUA 3N7TA 3I9KA 4MMZB 4DHEA 2ZITA 5TPZA 4JCOA 4BRZA 1CUUA 5JZOA 4LFBB 5B57C 1LMB3 4WXYB 4QICA 4LZZA 3SS7X 1QAOA 4UMVA 2HHLA 4DJAA 5GGXA 2QPAA 1R4MB 3EVGA 4Y2JA 1T8SA 1NMZA 3OIUA 4ZQGA 3HXPA 2H2AA 1AUOA 2OGZA 1NX9A 3UMBA 1MFPA 4QA9A 5DRTA 1XLTC 3G9XA 2YJTD 3UBMA 2I71A 5A6SB 1NUQA 3DVRX 4G5RA 2HMAA 4WX2B 5TV2A 1G64A 2BM1A 3IO3A 3SHFA 3V3KA 1DX9A 5AKYA 1A9OA 1PE0A 4XARA 3I58A 3RCBA 1N9ZA 2EERA 4EAAA 2CSXA 1YRLA 3HP1A 4LYHA 3DXYA 3I4LA 2PV7A 2BMAA 3KKKA 4MUFA 4PWYA 5TMEA 1YC5A 4EKDA 4ER5A 3GJ0A 4FZVA 4M55A 4J0EA 3U9TA 2R4UA 1NT4A 2J4FA 3U3RA 4FNOA 3WMXA 4CM4A 3T4XA 1M5RA 3MJRA 4L9AA 5JAOA 5IYZB 5JIBA 3H9QA 3MW8A 1PS8A 3DR3A 1V45E 2QD5A 4CM9A 2HJRA 4JY7A 1J1ZA 1ZOSA 2RK6A 1NNLA 4P34A 1B8NA 3CLRC 1FUIA 3DGEC 4E08A 2DCUA 2D5VA 4A73A 5FI1B 1J8YF 4MITA 2VZ8A 3RDPA 3ZD9A 1ZG3A 2ESRA 4FHCA 4DCPA 4V02A 1A9TA 3P71T 1HFWA 4OOFA 2OILA 2LR0A 5I7FA 4WESB 3S7ZA 5K20A 4AN1A 5L53A 2W93A 3IE2A 5LQJA 4ZRNA 3ZOZA 3UJNA 3LY5A 4H08A 3PEVA 1IPEA 2VYNA 4PWZA 3H0KA 4Q82A 3MSXA 4L5JA 3ZZUA 3QNUA 4LNUA 1XAIA 5F9FA 1HE3A 5JY1A 1B74A 3H2IA 2YVUA 3LGSA 4L4YA 1PGJA 5K4GA 4RV5A 2AQ8A 1T4CB 3C98A 4W9NA 1FIUA 3FJ1A 4EJSB 2WSIA 2VT7A 4BEVA 2HEGA 4C1BA 5KX5B 2RG1A 3MUOA 4ZCSA 1HY3A 1ZVJA 2A86A 2JI7A 3AIMA 4ROSA 2JBHA 2WTMA 1J2YA 3L43A 5EMHA 3URMA 4IJMA 4FCTA 1PW7A 2F9FA 4PGFA 3ER8A 4P3XA 5TQJA 1LDMA 3CW2A 2I2AA 2J33A 1NC3A 2G5PA 3A36A 4BFTA 2NUPA 3UGQA 2EJUA 1IN6A 4NBKA 5A3QA 2INGX 4O8BA 2XF8A 3D7NA 3NCTA 4HI0E 3RABA 3S99A 3VAZA 2EW1A 4AZ0B 2J3KA 4FE3A 4QGSA 2DLCX 2OM6A 3W5DA 4XVQA 4KE7A 1SCBA 4FDLA 1K3FA 1TQ4A 4YRQA 4AY3A 3SIXA 1U0FA 2GCNA 2PFSA 3UN1A 3IB6A 4CKEB 5EIXA 2QL9A 2IYNA 2V7UA 4X8HA 2FPMA 1HFEL 3AEYA 3TKYA 3T15A 5LYJA 3J7TA 3I01M 1LI5A 3QLVA 4KVFA 4MCJA 2ISQA 4MGHA 3GCXA 1Q7TA 5A0FA 3IERA 1VLJA 2O3TA 4S05A 1WUJS 4V38A 3DWIA 5DM70 2G88A 3GP8A 4QUGA 3H4VA 1KAEA 4UAUA 4DR6B 2N3ZA 1GHTA 2ZU0C 2JCVA 4TWZA 3A4NA 4JXKA 3NH6A 3KSBC 4HDNB 5EQTA 4BIIA 4DMKA 1K4YA 5MN6A 3Q5DA 4DWVA 1HG0A 2XCQA 4G4SP 3UXHA 3S81A 5FJIA 5JAIA 5L40A 1EQAA 2YOFA 4KQWA 1Y8RB 2BZ1A 4Q3AA 5K1ZA 4RSHA 2WNSA 1W4BA 5HJ2A 3UJ9A 5JFGA 1LPSA 3GQBB 3EGVA 4WMLA 4XSHA 4HOYA 5B1YA 3U3DA 4P7GA 3UV6A 1R0RE 1XVTA 5BWLA 3TJZA 4KXWA 1WNFA 2ZSFA 3O38A 2C04A 2GLUA 4PHFA 4C43A 5H3HA 2P9BA 4FC6A 1SHZA 4BOYA 1FU8A 1NJFA 2KSQA 3P19A 3OICA 4PCAA 1CZUA 4G6ZA 4WVFA 4F91B 1HK7A 3F7NA 5B4TA 3AUTA 5IUNC 1UPUA 4PYQA 1H66A 3HY6A 2E49A 2YC4C 1I7DA 2NVWA 4W8OA 1SVIA 1FDTA 4I08A 1JAIA 1NP6A 3TW6A 3IKTA 4OQFA 2RKWA 4QQFA 3UAOA 3R7NA 4BVFA 5E3IA 1IBLB 3ABRB 3A3PA 1G19A 3E03A 4NZYA 4IJQA 2P0YA 3SDZA 5BWOA 1UKCA 4DV0B 1Q95A 2AZTA 1Q3TA 1TU3A 3COYA 3IDQA 1O94D 4QEZA 4RQBA 3WI7A 1SHLA 1EFLA 3CUVA 5KDOA 3ELBA 2IS2A 2ICPA 4LRWA 3TUJC 1R0WA 2CWDA 5JSKA 3DB2A 3A1DA 5JU6A 3HXKA 2D2XA 3EGIA 2GJ9A 4CLHA 5CM8B 2QE7A 4UVGA 3O9ZA 1CRLA 1AS2A 1UFKA 2KHZA 2IPOA 3IIJA 1ADRA 1L7PA 2NXCA 2VP9A 5AVRA 4X7MA 2FFJA 4ID9A 2ZRLA 4OHXA 2EFGA 2IP2A 3A9ZA 1DBPA 3N0VA 3BD8A 3WGIA 3P0JA 1M34E 2H4ZA 2GYYA 4Z49A 3EOBI 4R8RA 1DCFA 1KZ4A 3U81A 1XEWX 4Y8VA 2Q21A 2XYQA 3EH1A 1Y3DE 3N0XA 3TB4A 1MEJA 1NMYA 2I3GA 3IE0A 4K81B 2IVZA 3EE6A 3HYNA 2Y1KA 2J7UA 1YGPA 4TL9A 2JLZA 1V4VA 1PLKA 4RJKA 4AJ1A 5IBCA 3L4EA 2I87A 2R8OA 3OPYA 1AZTA 7YASA 1AURA 3G5MA 2YQ5A 5KWJA 4CI9A 2JVLA 3Q3GE 1NUTA 4I4IA 3U31A 4BWYA 4Y67A 1ES9A 2J7PA 4BMZA 4Q7QA 3IKVA 1OSNA 1I1HA 1QV9A 1ADCA 1N5RA 4AJOA 2HO5A 2HMYB 1Y5IA 1KC3A 3K7EA 1V35A 3CRZA 4R0NA 2ATIA 4RPJA 2JGAA 5ES3A 4FYHA 4HVLA 3PEYA 1PDVA 1M1YB 3NWBA 2XGGA 5A03A 5BWNA 1R8JA 1W2HA 2AC2A 1QM5A 5AXCA 1N0IA 1DBVO 1ODSA 3HGMA 4HN4B 3ZX4A 2FF7A 2WFMA 3OU2A 3ZJTA 1CY4A 2VBFA 2YOHA 3DOJA 1FTGA 3VVBA 1WPRA 2RHJA 2R68A 1MFZA 2YYZA 2PKWA 3ICPA 5ULLA 4C06A 3ENWA 5JWRA 3AB7A 1QH1A 1IHXA 3L07A 2FB9A 4IYRA 2P9TA 3SXUB 1STOA 2QAIA 3ILSA 5FBZA 1PT6A 1A95A 4ZQHA 2OCAA 4RVCA 2CLOB 4ZAWA 4ISBA 4BUJA 4WACA 2JD2A 5EXDA 1J8FA 1GNVA 1U7ZA 4UBJA 4K9RA 1TLLA 4YROA 4PZYA 1B26A 3C3CA 4JI3B 4A82A 4D6YA 2YVLA 4BNUA 2GBPA 1E77A 1INLA 2QYOA 1JAXA 3CEJA 2XGMA 1GAJA 2ZJ4A 3EFBA 4F9FA 3TDKA 1P3Y1 2H17A 4LV8B 4ZJPA 1ABEA 1FDVA 2H63A 1JDBB 3PXDA 4XE5A 2A35A 3ESZA 4IDCA 2QMOA 3WBFA 4AXBA 2JRLA 4PINA 4BQNA 4UNQA 2HYIC 2FR8A 1BGXT 2AN4A 3MIZA 3D8HA 4BC0A 1LY1A 1X94A 4OHUA 3TLGB 5JVDB 4RS3A 1NWHA 2V3CC 1UXHA 1BGWA 2ID4A 3A26A 1C1YA 4CTKA 1ADBA 5J23A 3I5UA 3W6OA 1SRRA 1K5PA 3AFMA 4ISCA 4F8YA 2XNDD 1E6WA 4XQGA 3D8SA 1JYEA 1QX4A 2GK4A 1MPTA 2I7VA 1SC9A 4AKTA 2FMTA 4N3AA 1AUVA 3CC8A 4F96A 1XCOA 3KDPA 3FTDA 1LK7A 1WBBA 2WAAA 4OUDA 2IIBA 2B7LA 2CFOA 3I52A 4OOEA 4AD8A 3C3MA 4ZJZA 5HKBA 4JLPA 1TT7A 4BBAA 2OKGA 3JR7A 4UOQA 5H82A 1O96B 4DWOA 1FJGB 4J0IA 2A0KA 1U7TA 1AUXA 2GGSA 4C0WA 1LS1A 1OAKA 2BONA 3B1XA 3KTAB 1R5BA 4C30A 3W6PA 4MVCA 1Q1NA 3A6JA 3JSXA 4Z4IA 3QKTA 1X92A 3PUKA 4RX1A 4JX8A 3IYLW 5AI6A 5F4BA 3SNKA 4CKEA 4UTZA 3KPUA 3GDOA 4U63A 4F56A 2P2SA 2PL9A 5LVAA 2OMEA 3FBWA 3IDOA 3MJCA 4G0MA 3ZXSA 4CKWB 3OLVA 1ZN8A 1ZNWA 4AZ0A 4EJMA 5JCOC 1HOXA 5H68A 5JY6A 2IPLA 1KVSA 2I78A 1XHFA 1UK8A 1GSOA 1UBNA 2G5TA 2VRWA 2W90A 3JD3A 5HJ7A 2XF2A 3IEMA 1DV1A 1NR1A 2DECA 1U1DA 1FCJA 3V1TC 1G8GA 1GNPA 1THZA 2O1EA 2YXDA 3M4YA 4I4TA 2JFUA 5LJIA 3W5SA 4RA9A 3GOQA 4DS3A 1FQOA 4RESA 4Q16A 2QRMA 1VRVA 3GIDA 2B78A 1BHJA 3UAXA 3W1WA 2BMWA 3T3OA 3EXG2 3WISA 4WLOA 3E3LA 1E2GA 4M49A 4MQ6A 4H3VA 1D0SA 3D81A 3KCNA 3HA2A 5DNDA 3K9QO 5DP2A 4I1PA 2XADA 2EP7A 4X0EA 3V1UA 3EUFA 1P2GA 1YBAA 4MX8A 2HSJA 4DA0A 1M7HA 2PX2A 1ETUA 3UNXA 4GYWA 3REFA 1CJKC 4NHEA 2AR7A 4FW8A 2IF2A 4G1VA 4CIYA 3AB8A 3LQQA 1M1UA 4KK3A 3NU1A 4LOHA 5DBFA 3SZOA 5M2QA 2FN4A 4BECA 3GRYA 3L4BA 3AW9A 2OO3A 3O74A 4OJQA 4D6PA 1AKWA 1FFSA 1VSUA 1FLAA 2UYYA 4QGFA 4TTIA 1LQCA 4YJ2F 3RYFA 2PQ0A 3ZS9A 2G09A 5DCYA 4ENRA 1MQ9A 4PPQA 4NEHB 5ES4B 1B6TA 4OGFA 1BKSB 1YUNA 4QEKA 4RKFA 4X85A 5A05A 3HXMA 2IIQA 4KYUA 1U99A 1B0ZA 5BMVF 1XRQA 4I1YA 3LC1O 1GZ3A 3AIOA 5DW0A 4KQHA 4H27A 2J3QA 2XYHA 3JQBC 3B20A 3G2IA 4OYRA 2AE1A 2BFWA 2JFYA 1FRFS 1V37A 3LCUA 4OXKA 5BSMA 1KRHA 3GLSA 3O8DA 1ISHA 3KVNA 3PENA 3QMVA 2QRKA 2W00A 5FLYA 2Z2XA 4Q15A 3C4JA 2EZTA 3RT1A 1IXKA 2CDNA 4MHSA 2C4VA 1EWKA 1ND5A 1TVKB 3FTQA 3HB1A 2CLFB 5JNUA 1PVOA 2I22A 1H23A 1QKKA 1XROA 3ZCPA 2ES4A 5ALLA 3W9BA 5J2TF 2RCNA 3M7IA 4KCGA 4HRXA 3TTVA 3QWIA 2NVUA 4HG2A 1S0UA 3FLAA 2YWDA 1L5MA 2OECA 4IEIA 4L3WA 3USZA 1QFMA 1U2EA 2XI4A 3KEOA 3LDFA 4O2RA 3JW8A 4REQA 4BNHA 4ENSA 2VZLA 3RSCA 3SLRA 4F5WA 3HDJA 2DFDA 2P2DA 3BFPA 3KOZA 4OCZA 4YA6A 3EVCA 3KQSA 1NYTA 3AFHA 2EF8A 2GRUA 1V8PA 1YJBA 3KVYA 3L8CA 4L8YA 4ZA2A 5H7XA 3WK4A 3ZXYA 4BVEA 5E3HA 1RVDA 3EGWA 4U0KA 1KMNA 3E6AA 5JPCA 4HTFB 3DUWA 4KUEA 4M1OA 2VT3A 4EP1A 4C2UA 3OMWA 3U1TA 2RHDA 5FBVB 1FZTA 5K03A 2BAGA 1KAQA 4QU8A 4R1SA 5CM2Z 2R1ZA 4DKXA 2BI4A 5C5IA 1K98A 1PNVA 3OWOA 4JBLA 2P4UA 3HVKA 3CN9A 4N5LA 2C2OA 3BX1A 4Y2HA 1GGHA 2C7RA 3C48A 3OZEA 3ZV6A 3OEHA 2V9ZA 1KQGA 1P5JA 1CS0B 4ALIA 2CJWA 4M0LA 2GS9A 4X54A 5C8DA 3AU9A 3GAMA 4XWWA 3PEWA 1T3GA 2GM5A 2Q5EA 2PG3A 1NHGA 1BEEA 8AT1A 1CUCA 2ZYAA 3PQ4A 4L85A 1OF1A 1XCPA 2I33A 4LZPA 4TTQA 2WSMA 2HC9A 2WEKA 3HCNA 3B2QA 2BIFA 2E4UA 4MUNA 3FPSA 4ARZB 5LLDA 3LHDA 1XPJA 2VAVA 1B00A 1F8YA 2PRZA 3TZQA 1Z16A 2C9YA 2RK4A 3HJBA 4DBLC 4OQQA 4YUXA 3IQFA 3ZUPA 2LTAA 2Q2WA 4EKIA 1THTA 2XVMA 4HGRA 4GKJB 5JAQA 3BB1A 4BO6A 2VDWA 3VNRA 4L28A 4CT4B 3IP1A 3GELA 4UUOA 1XCMA 4AMYA 3W5AA 4KR2A 3F90A 3I2FA 1U3UA 3WZLA 1Q0UA 4J0KA 2QA5A 3O3MB 3TKAA 3KVOA 1Q7RA 3EEQA 3G8YA 3U7GA 1WJGA 5TB5A 3CWCA 1KPIA 5A9TA 2CHEA 5THXA 2A9RA 2GCGA 3ORQA 1ZPQA 2H18A 1OSLA 2PPVA 4UU7A 1KIAA 2MYNA 2WUDA 4YIKA 2ZOSA 3CB4A 4IUBS 1ZM2A 2O2SA 2WU4A 4FDUA 3SCFA 2QZSA 4BV9A 4ZZ3A 1E61A 5B3JC 5D5QA 4Z1OA 3GNQA 4CLOB 1JL3A 3C3JA 4J1XA 5A7LA 1ACMA 1SKQA 4HRYA 1Y42X 3AY7A 4KXQA 1SCJA 5IH3A 5FI5A 5ESRA 1EVEA 2GN4A 4H35A 5ALMA 2O2YA 1JPUA 4QDUA 1QRSA 4L5YA 3Q6IA 2YJ6A 1QK4A 1H0KA 1BKDR 1GZ7A 2ZCUA 3PYLA 4GNKA 4GZ3A 4MVWA 5GV8A 3PWKA 5H70A 3Q7PA 2WSYB 4EHHA 1NZDA 1UKBA 1TAUA 2C5AA 1YBHA 1OBOA 2Z98A 1TJ4A 3Q7QA 3UAGA 4LSGA 4NJMA 4EUHA 2IS6A 2YJ4A 1GXSA 3QV2A 4ZI7F 2MSDB 1DFHA 1ATIA 3FPEA 4LWOA 4TKLA 3S28A 1GRCA 3B6IA 4CR8A 4OB7A 3HSYA 4J1SA 7MHTA 4HB4A 4GMXA 3DT6A 1TUGA 3HRKA 3OE7D 1LI4A 3R8CA 3B1JA 4BCCA 1O7JA 2JAXA 3OPQA 4YT5A 4ZOLB 3VHQA 1A5ZA 1MO2A 4ZQBA 4BB6A 4OXNA 3DCNA 2Y0DA 1CUWA 1IJBA 4H1HA 2E6UX 3S2EA 3P0IA 4PO8A 3DBIA 3PRJA 4JIMA 1EFAA 2V3WA 5CB6A 2GCPA 5GQSA 1MW8X 4JLOA 3CH4B 3AY6A 1YVDA 4D96A 1ZGZA 1MX3A 3VR5D 2GPBA 3P2OA 1WZEA 3JS5A 2OD7A 2IZ6A 1NFRA 1XRRA 2Z5VA 1O54A 3GUYA 5DMHA 3RB8A 1Z06A 4GRDA 4CWAA 4IILA 2VH5R 1DG3A 3WQBA 3OCVA 4RHUA 3AF4A 1I7SB 3ER9A 2XUGA 2QL6A 4I5EA 1O95C 3GLIB 4M86A 2C4KA 2RAUA 2V7QA 3PC3A 1BD4A 3SI7A 1USVA 5BQPA 4ICIA 2IIPA 4F12A 2CLCX 4L9SA 1SG0A 4M8LA 2VCEA 4CODB 2EF1A 2OPHA 4FR2A 3UATA 3WIBA 2QROA 5B3KA 1X80B 3D3WB 5T3UA 1E7SA 1O89A 1BMQA 1RYDA 2B30A 3FDZB 4KIGA 4BFSA 2NTVA 3HP4A 3NANA 3WLMA 1KKLA 4CMEA 4DV2B 2PNJA 1GYQA 3WNZA 4JBWA 2HXSA 2XWSA 4ND8A 3SZGA 2A14A 4HV4A 2XEDA 3H2BA 3HR8A 2QT1A 2OV3A 1Q7EA 2X2FA 3KQWA 2X2PA 1C14A 1OMOA 1Y37A 2PV0A 1E1LA 1JXMA 4C0BA 1HYBA 4DRYA 1M6VA 1TMGE 1HSZA 3BIXA 3GDFA 3HCFA 5EGSA 5B2ZA 3TN7A 1ENYA 3QE2A 3OEED 5FWNA 3GD7A 4RADA 1EE1A 4CM7A 3Q40A 2CXPA 2REQA 3D3JA 4YUAA 1D03A 1UQUA 4Z54A 1KJZA 1UUFA 5D7NA 2GEDA 1CR4A 1Z17A 2V5UA 4HEHA 4M9SA 1SHTX 4QJ3A 4LHSA 4N12A 1WV0A 4YRRA 2BFBB 3B53X 3GP3A 3TX2A 2RH5A 1CQIB 5CDUA 4KE6A 4EYQA 2C57A 3GGPA 1TIKA 3GARA 1FUYB 1UJ2A 2W6CX 5CXQA 3V6LA 1E0JA 1AB5A 3PXEA 4GKAA 5ALHA 4KX5A 1UXDA 1HE4A 5L51A 2X9NA 1XQXA 2IYQA 2HWKA 3H1EA 3U4IA 1L4BA 2I2FA 4BMNA 3THXA 3DTVD 1DCTA 1W5TA 3D8TA 1MW9X 5DX8A 2F3UA 4NX2A 4KQFA 5FULA 1HL3A 2OR1L 1QGYA 1R3UA 3L7OA 3NHBA 2IBSA 4JQDA 1Y1RA 4MO2A 3ROEA 1XPUA 1COZA 1JFRA 2FLVA 2BFNA 1AF7A 3N2NA 4QFDA 2BEVA 2R0QC 1VLVA 2UZ0A 2YIJA 2WM8A 2X76A 1YV9A 4PYMA 2FSFA 2PJDA 3TB6A 3UKOA 1N2XA 4DNXA 3QUTA 1MR3F 4KO2S 3RSSA 4DTCA 1TW3A 4LFAB 4IQ4A 1EK5A 2XXJA 4GI5A 3IVAA 2A9FA 2RGCA 3SZMA 3WYDA 3U4GA 1KWKA 4XWAA 4URFA 1CY6A 1SQ5A 2IZ5A 4C14A 1T4DA 4MUIA 1XMXA 5D01A 5JADA 4I3GA 1LC0A 5DM2A 5K6AC 4OHOA 5HKKA 2BCEA 3UPDA 2J31A 3U37A 3NM4A 4QQRA 1UZNA 1V7QA 4KE8A 3NOVA 4B6RA 3DV0B 5T8KA 4D9CA 3KJHA 4BN5A 5KC8A 3N2GB 3GJTA 5TRTA 2V98A 1UZLA 1ZJZA 5TQ0B 1YL7A 3L40A 4LOLA 4NARA 3T5MA 4CI0B 3K71B 4AC9A 2HDHA 4PSUA 2NXEA 4KO8A 1CWUA 3QLUA 4LV6A 2R60A 4LF6B 2WJJA 5AW4A 3E3MA 1EVQA 1O8CA 3LWBA 2AW6A 4RK1A 3UK7A 2HF2A 4XFKA 1ZC4A 4D9NA 4QOEA 3BCSA 2IV7A 4B46A 3O5AA 4YWJA 1E0DA 2XDAA 3VR2D 2JLYA 4BTEA 4BVBA 5CAEB 3S0JA 1Z0FA 3AR4A 3O8OA 3ZX5A 2LKCA 2ZJ5A 4G84A 3MJTA 4XQEA 5EXXA 1XZBA 2A88A 3DPIA 5IULC 3I05A 4FT4A 1QWSA 2IPXA 4J9UE 1XD9A 3GUUA 2F1IA 3QPUA 1X2LA 1JLLB 4I6EA 3ZBQA 3RS3A 2Q6VA 1QFSA 1E6LA 1LI7A 1U94A 2Q8QA 2YXPX 3QENA 4O2BB 3K70B 1GG5A 1UMDB 2XW6A 3NI2A 3Q2KA 4H6XA 4XYLA 1Y3BE 4AZ3B 2ZIZA 1SC3A 1FFGA 1E7WA 1TL7C 1A76A 2FK8A 3IEXA 1P0FA 2CFCA 2RGWA 3GG9A 1DRJA 4G1MB 1E94E 3SM3A 2P9GA 3FCXA 3ICVA 3D43A 4GGMX 5BVHB 4D4KA 2JATA 3AJ9A 1PU2A 5I8ZA 2EFCB 5CNKA 4BU1A 3QLTA 1E4VA 4YH1A 5GTDA 4HAOA 4BNLA 4TWJA 4F4HA 1TK9A 4ZO7A 2EKZA 3W8FA 4UJ3A 4CKBB 2EJTA 2J9RA 3BMNA 1T8TA 1VHQA 1NQOA 1F1JA 2OYRA 4JLMA 3QXCA 3ZWBA 2IWRA 3WXBA 5BW5A 1R9MA 3LSTA 5A5EA 1UZMA 4ZI2A 3RUFA 1MB3A 2I2CA 3GFSA 1I2AA 4MMYB 2VP0A 4ZCLA 1LPAB 1M8GA 3H2ZA 2P6NA 1FNBA 2ZBVA 1HETA 1YXMA 4JP8A 1D7OA 1A9RA 4P6VF 1V7PC 3G68A 4RH0A 3GP5A 4H59A 5FR2A 1KBQA 4MR9A 4F1KA 5JHGB 1A1SA 4RY2A 1ZYUA 4Z5DA 3CSDA 3OZTA 3PXAA 5P8WA 3R6GA 3V8MA 2J3JA 5DGTA 4AN4A 1TQDA 4TQAA 4YK7A 1P0CA 2P11A 2WILA 2Z8YA 4M46A 3WGLA 3AHEA 4IJUA 1BVYF 1NRWA 2Q46A 1CW2B 4LDJA 5COQA 3OHPA 1KMMA 5G3YA 2PLNA 3WLOA 2X4IA 2ZYSA 4COKA 3GNLA 3ODPA 3N2KB 1UMCA 3FRIA 3D54D 1U8YA 2G7MC 2WAYA 3G7NA 3ZDQA 3A1NA 2CL6X 4C78A 2OB1A 2YYSA 3LVBA 3JPWA 1H1LA 1NRXA 1WY5A 3U7QA 1U8TA 3ORHA 3A6LA 4NI5A 3FYDA 1ISIA 4ZK2A 3LKBA 1XRPA 1P29A 3HZRA 4LKRA 13PKA 1WULS 2QVCA 1L5LA 2EL9A 2OD2A 3C16C 1KEVA 3S1LA 1W19A 3KUCA 2Z2JA 3FFAA 3RC7A 4LJSA 2D3TA 1DRVA 2XQFA 4N3NA 3T5BA 5M29A 1HX7A 3B3GA 1G6KA 3SX0A 1F3LA 2EWVA 2OG2A 4NMHA 3U5TA 3M6XA 2OCKA 3WNQA 3AHDA 3G2MA 3MWJA 2L17A 4FFOA 3ZHRA 2I91A 4JODA 1Z35A 3ETHA 4XQCA 1NVGA 3IMCA 2FPOA 2W6QA 4QGGA 3V1LA 5LSAA 2OYSA 3AUSA 3AHIA 3PUHA 1R9JA 4NICA 3LX4A 3PITA 2PRYA 1N6KA 3K2QA 4J0DA 4ZVOA 4TXJA 5CXUA 1C8VB 2HRBA 1H6DA 1OT5A 1PQUA 2XKBA 3GDHA 1NSYA 3GN1A 3JYOA 2BPOA 3O75A 5EWLA 3CR8A 2GVZC 5JWOA 4NYIR 4NXNB 1TYCA 1U7XA 2XE7A 3JQRA 1QQAA 1DIAA 1L7DA 3DEZA 2JGDA 1ZP6A 2ZULA 5GPBA 4F2PA 5E6UB 5J1TB 4D25A 2QSYA 3KSMA 5C8VA 5IJWA 4KSBA 2VSXA 3C3PA 5TQ2A 1RCUA 4D81A 3LWZA 4KFUA 3IOBA 1P74A 4MEBA 4UTVA 2O50A 1GPDG 1OFUX 3RKRA 2EC5A 2ASVA 2F1HA 1Q0HA 4NAVA 1U1GA 4MR7B 3M5PA 3VI3B 1EUQA 1XJ5A 4E5MA 5DI9A 5K8JB 4BV2A 1LCDA 1YAHA 4IH9A 4OIMA 2O8EB 1XZPA 1OB2A 4BFXA 3K0AA 3G8AA 3KOWA 4Q48A 5FTWA 3JRWA 3F9CA 1OH5A 4CQNA 3EXG1 5EJ7A 3FVRA 4L4SA 1JBQA 5FL7A 5JYBA 3LLVA 1VCOA 2OCIA 1CUJA 2OXRA 2PMKA 3K96A 4MUKA 4TLBA 4WQMA 4MV3A 1KMIY 1QV6A 3PGXA 4YXFA 3BXGA 4UDYX 1RXVA 3SJCA 3VKWA 4LBVA 1UT8A 2EVWX 3L0BA 3H9CA 3LT5A 4KMMA 1RYBA 5LA6A 3QWHA 4S24A 5AHRA 2QN8A 3JYNA 1Q0SA 2IYRA 4LJ4A 1B8UA 2DSNA 3U56A 3WK9A 2XVZA 4PYNA 1V7CA 4DIFA 3QV1A 5A3JA 1L4HA 4YCLA 4LEIA 4M1KA 2LW7A 4RKEA 2FR8C 3NEJA 3LC7O 1QGUB 1CZNA 3BFKA 1RYHA 2VJKA 3AJAA 1HT1E 3DLBA 3C74A 4G1EB 4D0LB 2P9FA 4MZXA 4IP0A 3Q88A 4OQYA 3GWGA 3AEKA 2QN2A 3R75A 4MLCA 2AXUA 4O2AB 2GUWA 3TRBA 3JTMA 4G01B 2P5UA 4KPUB 5K0BA 3PUZA 5BT9A 1O8BA 4RTRA 4I4TF 2IYUA 2CWWA 1BDMA 4FMBB 2NO5A 1XMQB 1YTLA 5DYGA 1AHHA 1UM8A 3AHFA 3ZE2B 5L45A 4NJEA 5HMMA 4IX1A 1XTSA 3NZEA 3QVGA 1GNLA 4HQFA 1Q2UA 2OC4A 1ZUGA 5JMPA 4IHKA 1ZVVA 3CUTA 5D3MB 2GNPA 3RU3A 1GTZA 3DUFA 3VU3A 1NXSA 2WV7A 4M8NE 3UOWA 5B55A 2VFAA 3WSVA 2PMWB 1XZJA 1G3QA 1SKMA 3R4CA 3BRCA 1FDWA 3L93A 1S9DA 4M1WA 1L5WA 4YCJA 2C07A 2FN8A 1GUAA 3AKYA 3L8DA 5ALFA 5IKXA 4KLZA 3BREA 4GVLA 5BR1A 2XD9A 2ET6A 4MQ5A 3OY2A 5K05A 4EG7A 4RO0A 4OLHA 1WHTA 2A57A 1OY1A 4MDYA 2ZETA 3UB2A 2AJBA 2DFVA 1V0JA 3WXMA 4G36A 4RGBA 2ATEA 1I4WA 5AOAA 3ZV7A 3DPUA 4DDTA 4DSZA 4GI3A 3EVBA 3QLVC 3G2PA 2AD1A 2ZZKA 3CR3C 3QW4B 4IV0A 3ZHTA 3NPMA 4MKFA 5DWDA 5LU8A 2EFJA 5MN4A 1ZUWA 5G0TA 2IYAA 1ODCA 3N3AC 2V1UA 5C52B 5AVYA 1J2UA 4UZEA 5AIAA 5K51A 1GUYA 4X00A 5IJ9A 3QFIA 1NQVA 2WC1A 1U7UA 1DFIA 3E7WA 3FGOA 3SKVA 4AY2A 3VNVA 4PS0A 1R00A 4X1OA 2CFSA 3R6TA 4H15A 2ZJ3A 2PMBA 4IIFA 4YRBA 2DETA 1PBTA 8ABPA 1WP9A 1PDOA 5KWEA 1AGXA 1LV8A 4MV8A 4PGAA 4OI0A 2AF4C 3E82A 1CVIA 3BDIA 5M5BA 1YQTA 2CT8A 2OFOA 5DGXA 4YRLA 3BE8A 3MAAC 2VJQA 4GVXA 2O9JA 1MOPA 4I1RA 4FKZA 1M34A 3KJEA 4IG9A 4G5XA 3DWEX 4A0SA 1ZMOA 1V3QE 1EA7A 2R63A 2QX7A 3DDWA 1H5QA 4GXQA 4TN5A 3L1UA 4TWBA 3SS8A 1DEKA 1U7HA 3UT0A 5JSFA 1B8PA 5DP1A 4WERA 2VDMB 1AU9A 2B6NA 3M6FA 4J4HA 2XXQA 3ZXIA 5E0KB 2GR9A 1P6XA 2GM9A 3VZSA 3Q0IA 3HZZA 3VPGA 4ARVA 3K9HA 3E22B 3DD1A 4OHYA 4NMWA 1TJ5A 1AGNA 2Z95A 3CURA 3PFKA 3AYXB 1A7AA 4LXXA 5C4MA 3MF4A 4PEVA 3QEKA 5CLIA 2PR7A 1U0HC 4IF6A 1NNSA 4EUKA 4HLQB 2GPSA 4FYVA 2X22A 1N7JA 1SC6A 2RAPA 1N6OA 2QI9C 2QM8A 4IJWA 4F3CA 4G9GA 4RMGA 3EGXB 2IHNA 5IYZF 3PU6A 4B5KA 1Z5VA 2OGUA 4OQZA 5HW0A 4R8VA 3HL4A 1DXOA 1WX1A 2HQBA 3R9IA 1KMCA 1DJPA 3UG7A 1XEWY 1EFRA 2YHAA 1WXFA 3PIDA 2PLRA 3BH7A 2KYRA 1M0SA 3A05A 3OJCA 3L79A 3UIEA 1VPTA 3QKSA 2RGGA 1CP3A 3Q4GA 4OXIA 2E4AA 3VX3A 1ESEA 1KJ9A 2G72A 5GJVC 3ZYCA 4A2QA 1PX0A 3E9EA 3QEMA 5CJPA 2JLAA 3OPXA 4DWJA 1YZKA 4UAJA 1KBZA 3LYUA 3TCXB 1DRKA 2OUKA 4ZDJA 1RCTE 3HM2A 4LW8A 4BTLA 5LOVF 4D9KA 2ZDQA 4YJGB 3QELB 1X87A 3EWAA 4DR2B 2ZUSA 3I3SR 1XK6A 3TLAA 4KN5A 1DUIA 2QD2A 3GEPA 3L7NA 1PD0A 5J58A 2PWZA 1O2DA 2ZQYA 4DUGD 1DTWA 1DJMA 3KJZA 3VR2A 4Q47A 5KTRA 3G88A 4BKRA 1L1RA 5JZVA 4C7OB 2DERA 1RLJA 4J2TA 5THKA 1EX7A 1ABFA 1KIFA 1M1XB 3W8NA 1GA1A 5FOVA 3DHYA 4AP6A 1UJ6A 4B85A 3CO0S 3BSSA 2JJ1A 4TQGA 4ARSA 9ATCA 2R1TA 4A15A 3O1JC 4J43A 1EM8B 2BF4A 4LMAA 1Q91A 5ARDA 4ETWA 4R0VA 4PIPA 3VYVA 5IZCC 4KN9S 5K3FA 2IQ5A 5KNBA 2EWWA 2EP5A 2E5WA 3IVXA 4P0QB 1NRIA 5DYWA 1SOUA 2E55A 2XBUA 3CKYA 4Y0AA 1II8B 1TC2A 5CX1B 2FUG1 3B3QA 1SD1A 2ONYA 3MD0A 2VHWA 3GRPA 2O7RA 1X7HA 4KU4A 2UZAA 4Q3DA 4CKCB 2FZVA 2BNMA 2AJTA 3I23A 1MJFA 5TE9A 3JXBC 2QTVB 2BGLA 4K87A 1ULSA 4LC0A 4N48A 4HAZA 2IYLD 2ZIXA 3GN5B 3PCRB 3PPVA 4HQOA 4Y6LA 3RK0A 5DIZA 3ZHMA 2JFPA 3EYAA 3TD2A 1O6BA 1P4AA 4YI3A 2XCIA 2H2GA 4QYXA 1KBOA 5AUQA 2VDQB 2EEPA 2XUQA 1C7QA 3ZH9B 2X4DA 4IMIB 1T1IA 2C4MA 3OD5A 4IDNA 4BVGA 1O9HA 2O1SA 1IRIA 4ND3A 4YRMA 3LTNC 3V6MA 2DKFA 2HF8A 3O8RA 5AK0A 5C81A 4MIEA 4MVYA 1GL6A 3N6XA 1V39A 3UJ8A 5HMLA 1IZ0A 4M0DA 4MAFA 3HLYA 4ZVNA 4GZLA 1TEVA 2O8DB 2II6A 4L4XA 5BSWA 4JDPA 3BGDA 5LC1A 4AI6A 3I6MA 3EPPA 2HH9A 1P7PA 4O1IA 5EJ6A 1Q74A 3DO5A 3ZGZA 1NJ6A 1QNLA 1RZUA 3AM5A 4KRFA 1Y7HA 4MVJF 1GCAA 3TK1A 1QC5A 4TS1A 2BGUA 4LZAA 3C8UA 1KORA 4EEKA 3WBJA 2B1QA 3IT3A 1F7UA 1XDUA 1Y3AA 2O8BB 3GJ8A 2CZCA 2PLWA 4X61A 1TVEA 5D3QA 1K5HA 2UXBB 4ZAZA 4Z4HA 1L8QA 1KYQA 4LG1A 4TXLA 4OSOA 1H85A 1E9RA 3I2IA 4L16A 1QQ5A 1T1SA 2V03A 3GV0A 3FTCA 3LUJA 3I9NA 3IEKA 4XJXA 3DPSA 3VHXB 3ZCRA 3N7UA 1N2GA 3O31A 4K9KA 1W5SA 1D4OA 4KNYA 2HMVA 4RHYA 1N2CA 1MBZA 2A6PA 4YJFA 4RM2A 2V45A 2QPLA 1Z4IA 4EH1A 1F9EA 4N5MA 5A7GA 2NG1A 1E1QA 1ST3A 3DBRA 1SVKA 1OWNA 5AJHA 5TVKA 1BO6A 4HLCA 1MVLA 3NTOA 2GRAA 3PB3A 4AJJA 1E3IA 5HCNA 5TX7A 3C39A 2O2JA 2XMZA 4FE7A 1OVGA 1Q16A 4GSLA 2I9KA 2V7TA 5EE9A 1C29B 1PVDA 521PA 3LLCA 1G60A 3R3XA 3CW8X 4Q3BA 1JIVA 2C8VA 3EFHA 1MUUA 2CVFA 4ZV4A 4ZU6X 2Z43A 1D2GA 1B6SA 3D4NA 4MUJA 4RKRA 1X3LA 1K66A 1DFGA 2WVHA 5JRDS 5FFFA 4MEJA 3EDOA 1UIRA 3A2LA 5CA1B 2F2TA 1WB4A 3STUA 3VVMA 5IANA 1Q1BA 1SMKA 2Q3CA 1WTAA 1MRSA 4YMHA 2WYWA 3A1CA 5LMZA 2YZ2A 1ESDA 1I6KA 1NR5A 1SQ0A 1XDZA 2ZVDA 3EIQA 2QJFA 1Z75A 1PUXA 2QD4A 3CBGA 1WKBA 3CRMA 1MOQA 1X1QA 2AN5A 4RYDA 5KHAA 5JQGA 1OASA 3ZK8A 2WU0A 1U3FA 2NXJA 1BMDA 1N6IA 3BF7A 5FWXB 1Y8QA 3T5AA 1SA0B 2WUSR 3E05A 5A5GA 1OILA 1GU1A 4FS8A 4WDRA 4G56A 4NU6A 2PSFA 1TW2A 3EASA 1A82A 3FOFC 1QYRA 3BGOS 4DRXB 1IY0A 2WJ3A 4IJ5A 3H11B 1FBNA 2EKDA 3HJHA 4TLAA 3KKEA 4XIIA 3NYWA 4N3CA 3TZ6A 1H2WA 2ZUWA 2X1LA 3R24A 2PO5A 3ESXA 3RWBA 1YF3A 1QG2A 5HKLA 3TJMA 3QYJA 1GKUB 1JSZA 1RRMA 1OBHA 3NV9A 4NYIQ 1CB7A 1E0KA 1SBZA 4YI5A 5EIBD 2NU8A 4MVJI 2BZGA 2OESA 4G63A 4TPKA 4CLOA 4YB8A 4X65B 3TIFA 1KJIA 1JEAA 5H59A 1ECLA 3ERCA 1FQWA 4KNVA 2H0AA 4M0EA 3BMQB 1S2DA 3M49A 5KYYA 4LI0A 2POCA 1IE3A 2VJOA 3O2JA 1CQZA 3NOOA 1CUFA 5J4LA 2EGGA 4KBFA 3H42B 3FJYA 2FJUA 4G8BA 1UBUS 4IGFA 1GT6A 1BHO1 2W6JD 2QTTA 1YRYE 3BJMA 5F3RA 3K16A 4G37A 4PG4A 1Z5NA 4YR9A 1XN4A 3RC2A 3V46A 4WBNB 1PR6A 3FCAA 4TXHA 5DN6A 5EG5A 2QX6A 5CVJA 1RIIA 3PHCA 4JLWA 4OYLA 4H0NA 3DE4X 4GKKB 1GL3A 3TUZC 2DAPA 4I50F 3AOEA 1YK0A 4GS5A 5BYKA 1DKPA 3A3YA 3CJQA 5AJVB 4F11A 1KY4A 3QRWA 4JU9A 1ZD8A 3F52A 1E64A 1SBQA 2F1JA 1SHUX 1X0VA 2XDQB 3GD5A 4I1IA 4Y7DA 5EHGA 3MJDA 3O8BA 5P21A 4AF6A 1ND6A 4WXEA 4IDOA 2O3JA 1V2HE 1Z12A 4IS2A 3R7LA 3T9AA 2LE0A 4BFZA 3GRVA 3FMPB 1KP3A 1EXNA 2HI0A 3GC6A 3LQRA 4UMEA 3KT8A 4RVOA 2LV8A 3WJ7A 2BW0A 1N2HA 4BNDA 4DC9A 1EEHA 4ZMRA 4IWYA 1Z2DA 3ZDBA 1XHLA 1UKEA 1ODKA 2FP4B 2PR2A 2P0AA 1MG0A 3MFQA 4Y9UA 4C0AC 4F6CA 4Q9HA 4L2IA 1TVCA 1WB6A 4JAVC 3PFIA 1AQYA 1WLYA 2JBWA 2QM7A 4I81A 2Q07A 4JP1A 4LPSA 3KO8A 4AF7A 4BO5A 2W48A 1FW6A 1NSFA 1UP7A 2QJOA 5CEFA 4RDCA 3MVEA 1KEZA 1QJCA 1VZ3A 2V55B 4R8SA 4COOA 3RK4A 2Z3VA 1KFCB 2GCIA 3QI7A 4L0MA 4XOUA 2I29A 5DO9A 4S1VA 4FGWA 5A9RA 1M5UA 4WLEA 1T1RA 3OQ6A 3SEQA 1W30A 3NGXA 2ZRJA 5AM1A 5EXEA 4D3DA 4H1WA 1JR3A 1UWLA 2RCYA 4CYMA 1BOFA 1CNMA 2FG5A 1HDGO 2YY5A 1G5FA 2BMFA 2Q28A 3LUBA 3UJPA 3BWDD 4RH3A 4MKIA 1ZGAA 2QNRA 2R1VB 2ZTLA 2WAMA 3FPLA 4JJIA 1RE1A 4QFBA 4URUR 4X1IA 1HM5A 3G85A 1E3WB 4OUKX 4GMHA 3DW1X 4KMOA 1Q6ZA 3E2PA 3QXHA 2EFYA 1YA8A 3LC2O 4O4HB 4ZHQB 5JAUA 4ZICA 1B14A 4IDPA 4WGFA 1NYRA 2Y9PB 3KNZA 4URWR 1N5JA 4TZ6A 2YJGA 1GR1A 3OX3A 3WGQA 1J9ZA 1T5BA 2Z9DA 1IBKB 5HQ3A 2BFAA 3F1KA 3K1JA 2R7MA 1K27A 4M88A 4WECA 2KI5A 3ZZTA 3ZJ5A 3NEAA 3DCYA 3P5BA 5HIAA 4TXMA 1CUYA 3DEHA 1U4NA 3SE0A 1FSPA 2GN8A 4JCCA 2EF0A 1QYDA 2VHQA 3HGQA 4NDWA 1Y1TA 4P3NA 1F3OA 2V6JA 3X2SA 2Q7OE 1OWPA 3DSRA 5AKJA 3MQFA 2N9UA 3NHMA 5ER9A 5I4CA 4P86A 1POXA 2FZGA 2EBYA 4HZUA 5MHTA 2C3OA 3EVZA 3MMXA 5JROA 5ELXA 3EXIB 3B7HA 1LSSA 1RLMA 2HRCA 2HRQA 1KI7A 2H1RA 2XAUA 4D3SA 3UUWA 1ZUNB 3MRSA 3L49A 4PZ0A 1XA4A 5D8DA 3RIMA 4DCCA 2VI5A 4IDFA 4EHAA 1CTQA 3DXFA 3QA9A 4QZVA 1WXDA 2HM7A 2JFHA 4KIWA 2H08A 5CBPB 1G3MA 3M6VA 4CM1A 1M6WA 2J6BA 3BBPA 3B5IA 4LQ4A 2JL1A 3OJLA 3VYRB 1Q0TA 1JG2A 2NZYA 4US1R 3P9YA 4R6WA 4BLWA 4RFSA 1I6WA 4EF4A 4B6SA 2WP8J 3SSMA 5C5EA 1WPXA 4YGXB 3SFVA 3O91A 5K8TA 4KBYA 4MUEA 1AT1A 1BE1A 2DE0X 3KAJA 2PT9A 3FUCA 3ZLUA 3TF5A 5JC1A 1U0BB 1O94C 1Y3FE 4EJSC 4XOIA 2BKVA 2R85A 4GX1A 4E2WA 5BOSA 3BMXA 3BZBA 1HYHA 3LXRA 4YN3A 1NY5A 3TXYA 5BW8A 3OTIA 1YKSA 1QIMA 4JBIA 3LX8A 1E20A 1VSQA 1TCBA 2NTNA 4QVKA 3FBTA 1QBGA 1Y4UA 5F23A 2OV1A 5TIIA 5K6RA 1SOVA 3GA5A 1MPXA 4C05A 3ZDXB 1YHZA 1XZFA 2VJYA 5KX5F 3IDFA 4B2YA 1R74A 4BRWA 1JU4A 1M1NA 1HDXA 1MMFB 2F1KA 2AYZA 3H4MA 4UARA 2N1MA 4WINA 5HE8A 3FSJX 1OROA 3WYNA 1GO2A 2DVMA 2X3YA 3TMKA 1DOAA 2J8ZA 1U90A 1JAHA 5E7IA 4R31A 5I7SA 3UZUA 1KK2A 3W8RA 2ZJ7A 4ZGBA 2GJAA 3BN3A 4PQEA 4RZSA 4KAFA 1XWWA 2AEEA 2CUZA 1RQLA 2F67A 1YZ3A 3LXMA 3HUDA 3QITA 4OHZA 3ZW7A 5LP6C 2M1XA 4E31A 2HCNA 4GHJA 4GOMD 4YV0A 2JJ1D 3SU8A 3PNVA 3AG5A 4L3OA 2XWJI 4CN8A 1CIVA 2O05A 3FE2A 4Q7MB 1UQTA 4UW9A 2E89A 2J5RA 1COWA 1Z0ZA 2O7QA 2P9HA 2PN1A 3ED1A 1D1QA 3JVVA 3NGMA 4EA7A 2FCAA 3CR7A 1C8BA 1T9HA 1TMKA 1TK3A 4X1KB 3FN4A 1U8EA 5EUBA 3HR4A 4MW5A 3GRZA 4Y18A 4HS4A 5REQA 1MX9A 1OJ7A 2JIMA 3R44A 2PZAA 3I6QA 3RC3A 6ABPA 3C4QA 4QSMA 3T94A 3MB5A 2PZKA 1ULTA 1W0KA 2AX4A 4UREA 1X13A 1TMYA 1JT2A 3OQMA 2Y66A 1ZMRA 3BDVA 3NORA 2AN3A 1XFDA 2GUGA 1E5QA 2AC7A 4BP8A 1XQ1A 3NTVA 2O49A 1Q77A 5JMWA 4C03A 4AJ4A 3QVVA 3EVAA 1RYNA 3VO2A 2QJTA 3TELA 2W4MA 2PLAA 4QD3A 4D79A 3P27A 3VSDA 1DI0A 2BEUA 1BMFD 1BYIA 5B3AA 3I9MA 1NQWA 1J0XO 2QMZA 2VHZA 4Y2TA 5AH0A 2QD3A 3AR5A 3EC2A 3OCZA 3MBOA 4LJKA 4N7JA 4RPHA 5AKZA 1DAOA 2IZZA 2XZTA 3TEJA 2QP3A 5I9BA 4QQNA 3FYHA 3IMKA 2WDZA 4Y1RA 1NF9A 3CX6A 4E2YA 3LH5A 4Y2PA 4JVSB 5FXMA 1SK8A 3HU3A 2DHRA 1BFUA 4REMA 1YRWA 1XMJA 4Y2VA 3FB4A 3MC1A 1HDCA 3F3KA 3OFNA 4DXAA 2DHCA 1RXUA 4WJLA 3V4SA 1W6UA 1BWRA 1T43A 2PRKA 4GEKA 4O4JB 1QTIA 5CJJA 3UVEA 3GLKA 4UJ5A 5E4FA 1W36B 3WRWA 1YZVA 4HFMA 4BNIA 3LGAA 2JGIA 1PZXA 5KYNA 4JVLA 4NYJQ 3I9FA 1QS0B 2L69A 3ZE8A 2YHBA 3WB9A 4B3CA 3WX0A 1MP0A 1GRVA 1CQTA 3E7PA 3AERB 1EWRA 1U1CA 2P2LA 4AKIA 1PFQA 2E2WA 5TT1A 4LNAA 1K88A 2AUWA 1ZK0A 3DVLA 4WEOA 1UBOS 3PX3A 2PU5A 2G25A 5ERYA 1B6RA 1U9CA 4KXUA 2GDJA 2IHUA 4IH1A 5IJXA 2GZDA 1ZESA 3TZEA 1WUTA 4IWXA 1E2NA 1XAGA 1YJAA 2EU8A 3Q11A 3SYMA 3V8EA 4Z9FA 1NR7A 1XVIA 3CSSA 3FYCA 4DNOA 1KI1A 1QRAA 3OCWA 4ACAA 4S2EA 5EPOA 2C2HA 3O7MA 1KDYA 3F2VA 3RSLA 2GKSA 1SQSA 2HLNA 2KPOA 2XHZA 2XQVA 5DMXA 4TS3A 5BSUA 2BBSA 2WD9A 4OM7A 4ZPJA 5KO2A 1HG1A 2WG0A 1OXSC 3JZFA 1AMNA 3R6LA 1E0AA 4KPEC 4B76A 1GGFA 2QTGA 4LYJA 5BV0A 3OUZA 1U3VA 4YHHB 1D4FA 2EZ8A 4J7AA 5KHOC 4CXMA 4B3HA 4Q4AB 2VH1A 1DBWA 4BLTA 1WSBA 3VU8A 2JNWA 1Z6QA 1XTBA 2HK6A 3F8SA 1FSSA 1QHHB 1K97A 3MT9A 2VDVE 1F2UA 3PPYA 4MWDA 3WMEA 4Z9BA 3PGKA 1ZRNA 1R8QA 4MH0R 5FQOA 3OJWA 2V8OA 4IOMA 3DHNA 4E09A 4HX9A 4DQLA 2PT7A 2A78A 3PQ3A 5DGDA 3LCVB 4QKQA 5SZHB 1U8UA 1E2PA 4ZO4A 2AK3A 5FPQA 2PUGA 2GYWA 3BWYA 1IJEA 3FYSA 3HVIA 4OMDA 4BATA 3RS4A 2GF9A 4HBZA 1OWLA 1PR1A 1I4OA 1X7YB 3JWJA 1IZ9A 3JR3A 1ZIYA 2XZOA 3I45A 1VA4A 5KPDA 3EXFB 2VYVD 2DR2A 2I80A 1V8OA 4BJ6A 2ABWA 3ZTTA 1U6KA 2WA2A 5E1DA 1TAHA 3DZHA 1W8DA 4YLEA 2ZEJA 4TKVB 1JEYA 4DY4A 3R7WA 1FFWA 2QK4A 5HTKA 1FB5A 3NVKI 3PJFA 3E8XA 3I4CA 3P97A 3PR3A 4ZXPA 4ENPA 3RGGA 3RU2A 3R3HA 3TUIC 3I1YA 1KZ9A 2P1ZA 1W0JD 2ZBEA 2W6JA 4TRRA 1UMKA 1V3VA 3IBSA 2ZJFA 3JD0A 4M87A 4B4UA 1YMUA 1A2KC 1E6CA 1ZD5A 2CNBA 2FZWA 2W58A 4H16A 5I9MA 3U0BA 2VHJA 2GBFA 4EA9A 2RC5A 2V5VA 3KC2A 5AJYA 2CEKA 1R0BA 3CEAA 4GC9A 3T5PA 2C0PA 5BVGA 2XYGA 4B7AA 2VTDA 3QVOA 4UEJA 4KRYA 2I2DA 3JARA 3IAUA 1J24A 3OTGA 5G1NA 2NV2B 4I8DA 1L5KA 1L7RA 3DLPX 3GRFA 4AKGA 3M0EA 4MW9A 2PS0A 4R41A 4OPMA 5EFZA 1M0EA 1KZ7B 1NI4B 2FMHA 3I01A 3QBTA 4ZOQI 4OI1A 3ZQ4A 3F4BA 4P7BA 4UHCA 5ERXA 1NE7A 3TOCA 1O0CA 2I8CA 2NX2A 2PJZA 2Q6LA 4HNGA 1EX1A 3AKEA 2VKTA 3EZNA 2PZEA 1L6RA 1ZH0A 3FPKA 3MLBA 4Q1AA 1I0ZA 3VDMA 1XCLA 3BIWA 3GOHA 4QG7A 4ZZIA 3HB9A 3L0YA 5CDFA 4AMBA 1L3IA 2AF3C 2PX5A 4OO3A 3K0FB 1AOXA 4MWGA 1RWNA 1MABB 3NDRA 4HNHA 3OWHA 5AI4A 5DISB 1FBTA 1LQUA 1HDRA 1CZKA 3FY4A 3IQEA 3N07A 4CV1A 4DVJA 1JA0A 4E5DA 1TD9A 2ZGVA