1JFTA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
340
structure length
340
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDAGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jftA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA02
4ZMSA 1JH9A 5K98B 2H0AA 3LFTA 2A6CA 3D02A 3QYXA 3DBIA 5D2CA 1ABFA 3F6WA 1QP7A 1FFGA 3FFXA 3LUJA 2AYXA 4MR8B 5JNRA 2NZVG 3CRNA 3M9XA 2LYLA 2LYSA 5IEJA 2OQRA 3F6PA 3LUHA 2P4UA 1NY5A 4CBVA 4X4EA 1ZAYA 4F12A 3VNBA 2EF8A 1RZSA 5TQ2B 1BA2A 3PXPA 2PUEA 1U2PA 3LTEA 3BS3A 3NBMA 4KK4A 5KQLA 6ABPA 1WH6A 1MVOA 3A3KA 3LUFA 1NXPA 4JB2A 3MIZA 1Y9QA 3SNKA 1GLGA 1B00A 4MQEB 1U0SY 3C3WA 1Z15A 1ZZ7A 3I09A 2AXVA 4MR8A 4ETIA 1PRUA 3R0JA 1YS6A 4KVFA 4Z9BA 2IYNA 4YO7A 3RH0A 4KQ9A 1XWWA 5KQPA 2R4QA 1ZZ9A 3RVLA 4YARA 3H6GA 2BGGA 1SQ8A 1JWLA 5TQ2A 1GCAA 5GOTA 1FQWA 3ZKCA 3CG0A 4KV7A 4Z4GA 2FVYA 4LE2A 3L1PA 2OR1L 2HSGA 3QX8A 3FYAA 1LLIA 2N9UA 3OO0A 9ABPA 4MQEA 1FFWA 4Z5DA 2NUBA 4IMJB 1PERL 2WB4A 4OB4A 4HNSA 4HYEA 4Z9AA 3IPCA 4YS6A 5GQSA 4EYOA 3HM9A 3HK2A 2R48A 1MB3A 1NERA 2LYPA 1ZUGA 2PUFA 3L6UA 4PU8A 2HJ9A 2LP4Y 3F51A 3E3MA 3O74A 1DJMA 2FLWA 1DP4A 4NICA 3UK0A 1ZITA 2FEPA 2FEKA 1YMUA 3O1HB 2PIJA 2VK2A 2E4UA 2NT4A 4G0YA 2QU7A 2V0NA 1Z16A 4FE7A 1BVHA 2O4AA 3JXDL 2VUHB 4WWHA 3FMVA 4RK0A 1E6LA 1KMIY 4N0PA 1Z13A 2MSKA 3CROL 4MLCA 3IP5A 4N03A 4W5OA 4EY3A 3GBFA 1M5UA 3GRCA 3QWGA 1GUBA 2FSPA 4E7PA 3T38A 3TB6A 4GPAA 5IULC 5T7BA 3NNNA 4RY8A 2QVCA 5TPWB 2D5VA 3A0UA 3DGEC 3CNBA 1XHFA 3KTOA 3EUSA 3H5TA 4JA2A 4Z4FA 3GN5B 4RXUA 4Z5CA 1DG9A 3NHZA 3RZZA 1CQTA 3GL9A 1DRJA 2J48A 1YS7A 2QZJA 2L8NA 1DC7A 2YHAA 3LUGA 1ABEA 4J1XA 2PJUA 3Q9SA 2BNOA 4MLDA 1P6QA 4X4GA 2IPNA 3OM1A 2KPJA 3Q41A 3EQZA 4KQCA 5CNMA 4ZPJA 3MYYA 2R25B 2FQWA 3CTPA 5TPWA 4XARA 3O2JA 2BNMA 1TLFA 2MEZA 3URMA 5JNVA 4GNRA 1ZN2A 3LMKA 1W9HA 3GN5A 1D5WA 4RY9A 2ICTA 1R8JA 4MS1A 3ILYA 4RU1A 4YR7A 5JNUA 4KNYA 3LUDA 3S8QA 3BDNA 4MS1B 2LYQA 1X2LA 4KREA 3LUCA 3KG2A 1P2FA 2FN8A 3C6QA 3TMYA 2LPMA 2R1JL 4OG2A 5BRJA 4PZ0A 4P98A 4TMYA 3RVRA 2R47A 3JS5A 3KXAA 1EWKA 2JVJA 4W5QA 2M1ZA 2VUIB 2IVBA 3DGFC 5EWMB 4RXMA 4LZLA 1SXIA 1Z2EA 3QLUC 1SD5A 2CSFA 2PMCA 5IUKC 3HVRA 4X4HA 2IU7A 1B0NA 4MS4B 5IX8A 5ED4A 1LK0A 1IIBA 3HZIB 3U3WA 4I6RA 2CHFA 3EODA 4KK3A 4I6TA 3N6VA 2PUCA 3QLTA 4QYWA 4S05A 4PU4C 3CZCA 5KC8A 1DRKA 1JX6A 2IPMA 3QEMB 1EAYA 3CKMA 4WUTA 4EGSA 4DADA 3SG0A 3GT7A 5I4CA 5EWMA 1PHRA 2F8SA 3C3KA 4XASA 2TMYA 1ZESA 1EWVA 4MS4A 4RK5A 2JBAB 4ETNA 1JL3A 4KRFA 1DC8A 1KGSA 2I6FA 1ZS4A 3Q7RA 4X4BA 1RXEA 2FTKE 4D6XA 4J1WA 2B4AA 3RVNA 3KHTA 5KC9A 3QEMA 3DZDA 4WZZA 1SXGA 3JTEA 3H5WA 4S04A 4UHJA 2LYJA 1VLZA 3NNDA 2PUBA 3MLFA 4LRQA 4OLBA 3KKEA 4G0PA 2NT3A 4JAVC 2JBAA 3BREA 2GX6A 1YMVA 5HSGA 3CZ5A 2HPHA 1QQAA 3E61A 4RKRA 2A9PA 5TE9A 3O9XA 3TX6A 2WUSR 1QQBA 4O5AA 1YK1A 2DRIA 3K9CA 1ZZBA 2IV1A 1R63A 3JY6A 5FBKA 4Z0NA 4FBIA 1LCCA 5B3JA 3KYJB 5JS1A 2O38A 3KYIB 2GBPA 2HQOA 3M6MD 3OLXA 4IRXA 5HM6A 1URPA 4RDCA 2L2QA 2FQXA 3OLWA 3G5GA 1YVUA 2QVGA 4E7OA 5TPZD 5JNSA 2L18A 3CHYA 5IEBA 3SM9A 3OQOA 2KZ8A 4QPJC 4MAAA 1PEYA 3FMYA 3K4HA 2CHEA 4G0QA 4IA8A 4IILA 1Z2DA 2RGYA 3IVPA 1QO0D 1TVMA 3QF3A 1QP4A 4MRMB 2MYTA 8ABPA 1OXKB 1RZRA 2LCVA 4Z58A 4OTZA 3GBVA 4Z4HA 7ABPA 3S99A 2FXIA 2B5AA 2IVGA 4Z59A 1D1PA 3H1FA 5CNIA 1JDPA 1JF8A 1UXDA 2PUGA 1TJYA 3I5AA 2FLKA 2ID7A 5KWSA 1EHCA 4F06A 3EDCA 4MR7B 3N0RA 3JPYA 4L85A 3C97A 3T6KA 4I6UA 4W5TA 1P8AA 5JS2A 3CLKA 1PRAA 3NNSA 4OLAA 1J56A 3EULA 2IDMA 2MYUA 4G0MA 4MRMA 4Z99A 3GA5A 4Z4IA 4YCSA 2AUWA 3ILHA 2XCJA 4N76A 5DTEA 1JBEA 2NZUG 3RQIA 4MGEA 4RZSA 4WXMA 2MQKA 3JXBC 2AXUA 4MR7A 3BILA 1ZZ8A 2IVQA 1D2AA 2PKXA 3LISA 2KEKA 2Q5CA 3CS3A 4G0XA 2CWDA 4RK1A 2GRLA 4LDAA 1ZY2A 2JVKA 2LYKA 1UXCA 4RKQA 3SQNA 5E3JA 4JOQA 2GWRA 3OQNA 3MMNA 1D4ZA 2HQRA 3GBPA 5F64A 4F3TA 4O8BA 2AXZA 2PUAA 2FMKA 3BD1A 1Z26A 4EYKA 1RPJA 2RJNA 1E2BA 2FMFA 2JK1A 1APBA 1R69A 3OO1A 3B7HA 4G97A 4D74A 1FSPA 4F11A 4LE0A 4RK6A 3RVQA 2O49A 4MS3B 4RY0A 4YV7A 5KQMA 3DLBA 4N41A 3CG4A 1U2QA 2IUOA 2FMIA 3O2QB 2FW0A 3QELB 1Z17A 2FQYA 4NCAA 3W9SA 2E4YA 2QR3A 6CHYA 2JVIA 3HO1A 3O2SB 3HXMA 4OBBA 4PU3C 4I8TA 1EWTA 3UKJA 4IVZA 4YLEA 3CECA 2QXYA 3N0WA 2LIVA 2ZAYA 5JNTA 1Z12A 4DQDA 1QMPA 4YRZA 4P1ZA 1DCMA 4MS3A 2MSWA 1YK0A 3N75A 1DBPA 4GQMA 5DGCA 3OMTA 4XXHA 4ZMRA 1H9CA 1Y1LA 2ID9A 2E4WA 3QELA 4JASB 1C4WA 2L19A 1A04A 1UDRA 2A9QA 3I45A 3O1IC 1MIHA 1USGA 4FN3A 4PEVA 2XJ3A 4PE5B 3DNVB 1CHNA 3OMXA 5IC5A 4RWEA 1TM2A 1E3OC 1TMYA 4MCXA 1RPEL 2OENG 4G0OA 3A0RB 2IKSA 3QLVA 4JCXA 1MB0A 3EJWA 3HCWA 4IMIB 1ZDMA 4YWHA 1VRVA 4H60A 2EBYA 4GHJA 4NDWA 1ISRA 2PE5A 2LBPA 4F8DA 1L1MA 5A7LA 4YG4A 1NATA 3UFDA 1ADRA 4IGAA 1C0EA 4B09A 4EUKA 4O1HA 4L4UA 2LUOA 3O21A 3BRQA 3F7NA 3HEBA 4YBAA 3NHMA 1KRXA 3CFYA 1NEQA 1BDHA 1QP0A 1LBIA 2O20A 2JRLA 4Z5HA 1GT0C 3JPWA 3LOPA 1BDJA 4XLTA 3H5LA 3I42A 4EVQA 2HINA 1ZH2A 4Q6WA 2KEIA 2WJAA 5DLEA 3H5VA 4RV5A 3QLVC 4PU7A 3HV2A 3QX9A 3OP9A 2GRMA 2IOYA 3D8UA 3TO5A 4Z4CA 2BJCA 1L5ZA 3F52A 2WY2D 5EWJB 5C5CA 2A9RA 2GKGA 5CHYA 1NXOA 1ZZCA 5TPZA 2AW6A 4RS3A 1LCDA 1LJUA 3D1NI 2QW1A 4XFKA 5DCLA 2PL9A 3MF4A 3JVIA 3UUGA 4JB0A 5BR1A 4LE1A 1F51E 4X4DA 2PAFA 1Z18A 4RK7A 4QICA 4PYRA 1DBQA 1VKRA 5TQ0B 2GZUA 2JVLA 3MA0A 1ZHHA 3IP7A 5FBHA 1O4XA 1HEYA 5EWJA 5FWYB 1JYFA 1JYEA 1M2FA 3H1GA 2OFYA 3HDVA 1M2EA 5BQ3A 3RVMA 3KSMA 5EWLB 3H5IA 4O1IA 2AWIA 2KYRA 1YIOA 1QPZA 3ZHIA 1YTUA 2AYZA 2E4ZA 1JHZA 1HF0A 2H3HA 4FE4A 1D1QA 5KQGA 4NQRA 3SCHA 2FJRA 4WXEA 3HS3A 3Q7TA 5TQ0A 5T3YA 4N0QA 3G7DA 3F6CA 1JLKA 3Q15C 5FWYA 2KEJA 2E4XA 4MPTA 3HUUA 1I3CA 1EFAA 5TQJA 3ROTA 1LJLA 1AU7A 5EWLA 3KLOA 5B3JC 3LFPA 1NTRA 3M9WA 4M88A 2PPXA 1ZGZA 1PNRA 2FMHA 1X57A 3IDOA 4LX8A 5HKOA 1WH8A 1XHEA 3B2NA 2LYRA 3SCGA 4W5NA 1S7EA 3KLNA 3OLZA 3HUTA 4H3KB 4YP9A 3EAFA 3FDFA 2WIUB 3LUAA 1WETA 1SXHA 1T34A 2A9OA 3QEKA 2ICPA 3HSYA 2VYCA 4PICA 2W42A 1PRVA 2F8TA 5ABPA 3HZHA 4LDZA 4X4CA 1ZH4A 3R1FA 5C5EA 2RDMA 3SCFA 1USKA 4WT7A 2YHBA 1Y7YA 3Q7SA 2XIUA 4YG7B 4X4IA 4HNRA 4YG1A 3EGCA 5KI6A 1A2OA 2EWTA 1E6KA 5IUNC 1AB6A 1LBHA 4Q6BA 2L17A 1K66A 4W5RA 4JQDA 3KS9A 1VPWA 3H6HA 4OATA 5DKFA 4F8JA 1A0OA 1QKKA 1DCKA 1E6MA 5PNTA 1U04A 1RZRD 3KCNA 3HDGA 4RSMA 2FEWB 4IWRA 3FFWA 1NXWA 4JCYA 2PLNA 3FGZA 1BAPA 2CD7A 3L49A 1DZ3A 4TLMB 3DLHA 3GWGA 1QNLA 1K68A 3KJXA 2HQBA 3BRSA 2L49A 2M98A 3T8YA 3SY8A 2MYNA 5FWXB 4MR9B 4XAQA 2QV0A 3IP9A 2E4VA 1BDIA 1P6UA 1CJGA 3G85A 3RVPA 4EYGA 3BBLA 3A10A 5IBQA 1OXBB 1XWRA 3OM0A 3MQ4A 1DW9A 4TN5A 3RVOA 4KPYA 1LMB3 1W25A 4RK4A 4ZYLA 1GCGA 3LKVA 3H75A 1IC8A 3CU5A 4KMRA 3JVDA 5FWXA 3RVJA 5BRAA 4N47A 2R63A 3JXCL 2BNNA 3QLUA 4MR9A 4MYRA 2JCGA 4HNQA 3RVKA 2H8RA 2WJWA 3IP6A 4KFCA 4QYMA 3T95A 2WRZA 4IF4A 2XSDC 1JFTA 1JFVA 3TRBA 3FFTA 2MYPA 2PUDA 1LQCA 1SRRA 1DCFA 3GYBA 4Y9TA 2CROA 3OLVA 1ZPQA 2IPLA 2JB9A 3G1WA 1AB5A 1ZVVA 4MCTA 1NXVA 1GUDA 1PEAA 1RXIA 4RXTA 5IUJC 4D6YA 1L5YA 2RJOA 3QQ6A 5CNKA 3GV0A 1FFSA 3MM4A 2FN9A 4YGXB 1JDNA 1ZZ6A 3CLCA 1CYEA 3TD9A 4EVRA 2FKAA 1POUA 1DWKA 4NCBA 4ZJPA 2IPAB 1KRWA 4MQFB 3N53A 3RVSA 3N8IA 3LKBA 4G86A 1S8NA 3OQMA 1ZGGA 1CEYA 3QK7A 4EYQA 1OCTC 1PUXA 1F4VA 3FYMA 1Z25A 1NXTA 3SAJA 5HQJA 2WMYA 4FB4A 3KZ3A 1RNLA 3C3MA 4UHKA 1USIA 4Z4EA 1DBWA 4JP1A 3HJFA 1WIZA 1ISSA 1PNTA 3VK0A 1NXXA 3H1EA 1U8TA 3P9YA 5CNJA 1M5TA 1JFSA 3ZHMA 1MAVA 2XI8A 1OSLA 2MSLA 2ZWMA 3IPAA 3OLYA 2B1JA 2WWVD 3VNAA 4DN6A 4MQFA 1UTXA 1YSEA 4X4FA 4Y42A 2PL1A 4TLLB 4KZKA 4NV3A 4ETMA 1NXSA 3N0XA 1QO0A 3O1JC 3OMWA 1RIOA 4G0ZA 3H5OA 2GI4A 4ML3A 3ROFA 4EVSA 2X7XA 3LUKA 4H3HB 3EQ2A 5JNWA 2XDYA 3O75A 4Q7EA 2QSJA 2P9HA 3F73A
chains in the Genus database with same CATH superfamily
3DMPA 1ZA2A 1J1ZA 1HDOA 5HBGA 5ESWA 1MHTA 1ABFA 1KYXA 3KUDA 4MPPA 3LWBA 5G40A 4DRXB 1XWIA 2AYXA 1XRLA 1ZD5A 1HDRA 2NZVG 2LYLA 3MWDB 2GPYA 5KSPA 3V33A 5LFAA 1W36B 1QYWA 3R3JA 2Q0SA 4PRZA 4X4EA 3CN9A 5DN6A 1K8XB 3K8QA 2F3PA 3MQ2A 2NU9B 1YJ5A 1ODLA 3M7IA 1AF7A 4UDOA 4YT2A 4KDCA 4Q7LA 3JWHA 2ESRA 2OCXA 5TARA 2IX3A 3G0HA 1NXPA 2WSIA 1RYMA 2WQ6A 3NHWA 2FPLA 2VPPA 1K8ZB 1RMQA 2HA3A 3HKDB 1FLAA 3MTEA 4Q4AB 4MR8A 1AUPA 1V7CA 3K32A 3FXAA 3PQ4A 5B6JA 2VJMB 3H84A 4KVFA 1PWEA 5LN1A 2D6FA 1K27A 1TYZA 3AF0A 5KJEA 5TEWA 3WQHA 2O0LA 1YXMA 3EZLA 1Z3CA 2HREA 1MJFA 1NMYA 1G4HA 3BPSA 3JR3A 3VPXA 2DR0A 3N2ZB 4KQEA 1ZD2P 4MMZB 3T4UA 1OX4A 4NI5A 1HTTA 2HCJB 2A0UA 1F8UA 4Z4GA 4UUNA 4UDXX 2XNSA 1EWRA 2VNSA 4ZO8A 5B1SA 4TN1A 3TR0A 5AVWA 5AR1A 4WUVA 4MV1A 4LZJA 3ADOA 3U44A 4MQBA 1B2RA 5DGHA 4XLZA 3B3GA 1DEXA 2A9KA 3EXIB 1SG9A 1MFZA 2JAWA 4EYOA 2XDQA 1LS6A 1GXSA 1HMPA 2C8KA 1V1RA 2Z8YM 4GGOA 3ICVA 1FSGA 1U7ZA 2IHTA 3MJEA 4NV1A 3WYGA 5BXQC 5K4AA 4MUXA 1RI1A 1VMEA 3CR7A 5JIBA 2XLBA 4LRWA 3IIMA 4OQNA 4Z2AA 7MHTA 1XO1A 2GKSA 1YMUA 4AXXA 1ZM2A 2PX3A 1DBIA 2VK2A 3UWOA 1FP7A 1ZI6A 3UXHA 2W2KB 4UCXA 1I9CA 2NT4A 2ZDHA 1J0EA 2OV3A 4G0YA 4MGHA 5ICFA 5J2UA 4FR5A 2QX7A 1GKKA 1I1QB 3WYEA 5KKCA 1JJVA 3VC2A 3H1BA 1KEKA 1P5RA 5JASA 4AY2A 1TVKB 2ZRCA 3MLAA 3UGTA 4JL8A 1GG9A 2J9ZB 5FYDA 2HRCA 3CIFA 7ADHA 4EF5A 1KR5A 4C6HA 1TT7A 4AO6A 1QX4A 4ZARA 4HJRA 4YA6A 4R41A 1KI7A 2XQJA 2EF0A 4R3WA 3ZUPA 5HJEA 4G8CA 1U8XX 4YWJA 5LQNA 2X5KO 3UB3A 4AJ9A 2DLDA 3CV3A 4C0LA 1OFHA 4JCCA 2GZSA 1C8LA 5BUZA 3AZQA 4DA8A 4GYKA 5F7XA 2PJUA 3PQFA 4V0LA 4G1UC 3ZDBA 1POXA 3TLGA 2HU2A 4MUYA 3UT6A 4WKCA 5K0ZA 4ZANA 2ZRIA 1TECE 3E2IA 1JR3A 4XARA 2IUFA 2BNMA 1KZ6A 1EB9A 2V5VA 1EJ2A 3QTTA 2Q7XA 1ZK2A 3FUUA 3AKYA 3LO8A 4Y6RA 4AK9A 4YH1A 1NPDA 3RVDA 4MS1B 2PUHA 3ZCVA 5UKDA 4JXKA 1X2LA 1FQJA 1L8XA 1V25A 2QL5A 4NOKA 1U8YA 4WA8A 5FCDA 3U4CA 2BR4A 3REGA 4BNHA 4ZZ0A 4GPBA 5HE8A 1VCHA 2AEMA 2H5JA 2YN2A 4BRSA 3WX0A 1SXQA 1U0OC 2DGDA 1JI0A 2HYDA 2XH8A 2C3YA 3A6DA 3EZ6A 2VRBA 1D5CA 5CIWA 2X5XA 5T3UA 3SM3A 1WXHA 1IHXA 1Y4SA 1CLUA 4QG7A 2Q99A 2IX9A 3DHVA 3PA8A 1JSXA 5GVSA 5H8WA 4G36A 4HVAA 4DOMA 4PM4A 3VR2A 4F5WA 4ZYXA 1CC1S 1T5BA 2HADA 4I6RA 3EODA 1NURA 1PVVA 2XOKD 1IN6A 3DV0A 3N6VA 2C3PA 4BKUA 1K06A 1R5BA 5D5QA 4DGQA 1PQYA 4J7UA 4I55A 1JG7A 4A0QA 3BCRA 3HJRA 4MRVA 4RE5A 4YRLA 1N1MA 1W4AA 2A5GA 2P5YA 1XCOA 1L9XA 3AUSA 2HSJA 4CCYB 1X1CA 3M4JA 1EWVA 1NVGA 1PUJA 4HCJA 1N57A 3OUTA 5JD6A 1M3SA 1TMOA 4N18A 2I6FA 1ZS4A 2D2VA 2QRMA 1OASA 2ATVA 4X4BA 1XTPA 1GFWA 5EP2A 5AVQA 2AF3C 2PANA 5BUCA 4BNNA 1XU4A 4FD2A 4PLPA 3UFBA 3NBAA 3L7AA 2H4XA 2HF7A 4Y2TA 5CW2A 4G5SA 3EPPA 4P08A 3W5HA 1FSFA 1ARZA 2YHIB 3NBKA 1F2UB 3TOVA 1YBAA 1BN7A 4HDRB 4P8RA 3GUCA 3MLFA 1ZUD1 5BT8A 3BE6A 1WA5A 1YH3A 3KKEA 1QS0B 3PPXA 4EH1A 4TTJA 2BHRA 1QR6A 2OECA 1EGQA 5K3EA 2GXUA 5HF5A 4D3ZA 2JFYA 2AG5A 3GMSA 3NZLA 1E9DA 1XKTA 5CBKA 5LD2B 2ASVA 4O5AA 1VJ0A 3F5MA 1QIHA 4DY4A 3A26A 1WU8A 2GBFA 2I80A 1HTWA 3KYIB 4BO6A 3OLXA 4AMVA 4DUGD 3FCYA 3HY6A 4JN6B 4OXRA 3HN7A 3MGCA 4JHXA 1XRNA 4RL4A 1E2GA 1XZBA 3CVOA 4URFA 4YJ3B 2XF8A 3IVAA 1V95A 3IMGA 3U9LA 3BORA 5AM1A 4UVIA 4X84A 5E7QA 3D6TB 2BBOA 2D8MA 2JAHA 4A03A 3TLZA 1XTRA 4MQ5A 4OQXA 3WJAA 2AMFA 4O8CA 1V43A 5JVDA 4YAOA 5CFMA 2WJ3A 2AWNA 5LDGA 1HORA 3TRHA 4AB1A 1OZHA 1EGAA 1OUMA 3DHNA 2QN8A 4LNHA 4BMDA 4MMXB 2VP3A 4EQ6B 3HM2A 1WMDA 1P2TA 4HUJA 1WBBA 2HL6A 3DHWC 1F8YA 3FZYA 5B7PA 3PQDA 3B12A 2IYOA 3NVMB 1AGRA 3WWZA 3ZI0A 2WAOA 3BAZA 3JQ8B 3V4LA 2ZLBA 2VA9A 1H8EA 1M9NA 5JS6A 3QPWA 2AZMA 1XDBA 2HV9A 4ZRNA 3L0BA 5F4BA 2MQKA 4JXZA 1N6KA 4RSMA 1ZZ8A 3QVUA 5FPTA 4KSBA 4Z49A 4QHYA 1PFUA 3EB9A 3EZ9A 5ARCA 5IH3A 1TU0A 4XRRA 3RBAA 3NX4A 4IFEA 3WBBA 4F5YA 4EY6A 3I5XA 3MTQA 1SUEA 3CIOA 5CGQB 2HDHA 4FGWA 1SCDA 3DL7A 3IMCA 2ODEA 3NKFA 1N92A 1W6UA 1RQGA 2GS9A 4HWKA 4EYKA 1JU9A 4FFPA 3R4VA 2J7PD 1RTKA 2AXEA 2FEXA 2FV8A 4KP7A 4G97A 1FSPA 4FZRA 4RM3A 4C43A 4GZ6A 3OU6A 4NEHB 3W2TA 1QSGA 1OYVA 4DCNA 1RBQA 3TBHA 5BV2P 3KKOA 1JA0A 2HXYA 2GUWA 4TLBA 4Y30A 1V7QA 2W58A 3O9VA 2BGIA 2DSTA 4QUDA 1FNCA 2BCEA 2I6GA 4WN3A 5EA2A 3M3DA 3A3NA 3VH1A 5JEEA 5MGNA 1T8PA 1XD9A 4CI0B 3UJHA 3HCAA 4BQPA 1PO7A 3N0WA 3V1LA 1XKLA 3DZIA 1K63A 3B2QA 3HJAA 2CHUA 4EEZA 2BGJA 3MFQA 3R23A 4ZXPA 2MSWA 3PRJA 5HKAA 3JSAA 3SQLA 2ZBDA 4G5OA 3V8RA 1W47A 2ZWPA 4PG5A 4E88A 3GWZA 3EEQA 3R3ZA 1P4GA 3KZNA 4DILA 1WB4A 2VSQA 1C3XA 2FPXA 1QDEA 2HFKA 1PJTA 2HIAA 3WLLA 5JNRA 4Q1EA 2DH6A 1Y3CE 3MOGA 2G6BA 2G0TA 3A7EA 4Z3DA 3ZQ4A 5C8YA 3C5EA 1YGPA 2IHKA 2GBCA 1FSSA 3PQCA 3QLJA 2KQUA 4HDSB 5DK4A 4KO2S 2VLIA 3MUNA 5A04A 3UWPA 3EJWA 4JVOA 5KWVA 2CFRA 2Q6VA 3CUKA 2RGDA 3E9MA 4L1KA 1WMFA 3I01M 4JIGA 4RD1A 3WADA 4ESOA 4QGSA 3MCZA 4E5DA 2RHBA 3O4FA 1QCDA 4ZIRA 1GOTA 2WKRA 4U6QA 1SKQA 721PA 3UFDA 4LMBA 3N39C 1C29B 2PRKA 1VA4A 4O1HA 3IESA 4NY1A 3NTLA 1QGED 3F7NA 4YBAA 1R0WA 2BMFA 3KDSE 1PTJA 3DDSA 3NHMA 5DMHA 4L9AA 1E79D 1ZJ6A 3KR1A 2ZXEA 5EPEA 2FN3A 3H5LA 3BGWA 4GH5A 5BW4A 1KKMA 3K9NA 2P4QA 3BIOA 4LJ9A 4ZAFA 2Q8QA 4DA9A 1H4SA 3DAPA 3IQWA 4DM3A 3AQIA 1KH2A 1RBMA 4AROA 2C5EA 5CW1A 4ARBA 3TVYA 4Q9LA 2ZRQA 2J7UA 2A9JA 4JLAA 1H94A 3T7SA 3LZCA 4C5AA 3ZWYA 3OZVA 1NJ6A 3EG9A 3GLHA 5D3KA 3MTDA 1LJUA 2XMGA 3O8LA 4YGYA 2UXDB 1SHZA 1U98A 3MXOA 2FUG1 1N1EA 3REQB 4X4DA 3GRZA 2HO5A 1XCPA 3X1YA 2QD5A 1D4FA 5DOVA 1R50A 3ROGA 4YX9A 4C2UA 3ONVA 1NUSA 2ZE7A 2G9NA 4REQB 4G8DA 2P2LA 3C3XA 5ALOA 3W5IA 4UBNA 3WGGA 5JCOC 4BB9A 2V59A 2QE7A 2QG9A 4H7FA 2HHCA 1S7GA 2FPRA 2IEGA 3QBDA 3KSMA 4FC6A 3H5IA 4ZV7A 4O4IB 1LPSA 2CDBA 2Q0QA 3R3VA 4OHVA 4ZO4A 4DE9A 4OIMA 3C6KA 2PVCA 4AX4A 2I8LA 4IWNA 2F4NA 2P69A 3SIWA 1YVDA 2G04A 3DVAA 5G3YA 4X71A 4CR8A 5C5IA 3AZPA 2ZROA 1RZUA 5A6SB 5FPKA 1CYDA 5IW8A 3OEED 5KTMA 4L8YA 3H0KA 1WF3A 2VDWA 3COZA 1MRNA 1WQ4A 3RK4A 3T3EA 3MT9A 4FYMA 5AW4A 4KGXA 4QO7A 4CYMA 3K0SA 4NX2A 2BM0A 1JJIA 1NTRA 3QWAA 1QGUB 1J9EA 2FU5C 4E21A 5LOVF 4IEFB 2IYFA 4JNCA 4LJYA 4ZQCB 3GJ4A 3OIVA 4CKXA 3S2SA 3PL1A 4RJJA 3ZWKA 4W5NA 4ZD6A 1YR2A 5LQCA 1FRVA 2WV9A 4CPDA 4O8ZA 1KJWA 2RHMA 4FDVA 1QF7A 2BFDB 2A5YB 4DDTA 4IIHA 1WXQA 2GRJA 3R1IA 5I5EA 1M2OA 3WLRA 1PRVA 2G72A 3BMXA 4KTTE 3STXA 3V8PA 1USWA 4A8PA 1KI2A 4CM1A 1Q1ZA 3EFOB 3ISJA 4F71A 4XGRA 4C7XA 1L6IA 5D1NA 4GR5A 1PFQA 1HOTA 3RBXA 4B0OA 2XB6A 1ESZA 2P6UA 3TLXA 2XUKA 3BWEA 1WWKA 1NE2A 2O19A 3MINB 2R84A 5FV4A 2BI4A 3TNYA 2OFOA 1FX1A 4HLUA 4P7BA 1I4OA 4MROA 4A6PA 1PP4A 3HBFA 3QV2A 3Q9UA 3EN0A 5FAXA 1J21A 2CFTA 2Y0CA 2ZTVA 1X9IA 3JAWA 1E20A 2ZKLA 3SMQA 4C0JA 3HDGA 4LY9A 1U31A 3HO6A 3I1YA 4DLZA 5AW0A 1U0GA 1FEZA 1QAMA 3QEOA 1XWFA 1BAPA 3HV0A 4PFKA 3A7DA 3VZSA 4E3WA 5K3DA 3GWGA 2RE8A 1OT5A 1XNGA 1RKXA 1XMIA 4YDSA 4ZEWA 3T9CA 1JGTA 1KI1A 2G06A 1GL3A 1U3CA 5EJ2A 5TSDA 2XKKA 2R60A 3WIOA 5DTRA 3K1TA 1K5HA 3B13B 5FWXB 4IVPA 4LBZA 1EXVA 4F72A 1GNVA 3IP9A 1N6RA 3FNFA 4JIMA 2E4VA 2JCYA 4IS3A 2R8XA 1U0BB 1A4RA 1U9ZA 4ESEA 2DSNA 5JANA 3A10A 1H0KA 1XQWA 3R5FA 5AMXA 4TN5A 5KUTA 1GKUB 4QUHA 5EMJA 2W6CX 1RC1A 2Z4TA 4LC0A 2B3TA 4BU1A 1S3SA 2HRBA 3NUGA 5HXAA 5KWIA 3CX8A 1BGXT 5FA8A 3W2IA 3UBTA 1PS0A 2HBRA 2WNSA 1UAAA 2OVFA 3H1TA 3IP6A 4ACAA 1UMDA 4PX5A 3HWX1 4AY4A 2QRVA 1MFPA 3H2HA 1H6BA 1NVVR 1OU4A 2J9YB 2NPIA 2Z3ZA 2OUKA 4FKBA 4HX2A 1EZ4A 4XIYA 4DV0B 1SRRA 4AYXA 2ACKA 3C39A 2B21A 3GT0A 3F7MA 1A2KC 2YL2A 3GYBA 1MH9A 4P58A 4AP5A 4AZVA 5FOUA 2FETA 3LLCA 2II6A 2ZBUA 3A6GA 5JRDS 5IPFA 2XMBA 5MDHA 3FVWA 2X19A 3U0BA 1G55A 3IKTA 1POUA 1DWKA 2BKVA 3NWOA 3CRRA 2IXTA 4WFIA 4J7XA 5CA1B 1C9EA 3VU8A 2HJWA 2PV0A 1ECJA 2C7QA 4G1BA 2BFEB 1NOJA 5AJVB 3B1KA 1O1YA 4BVKA 4WN9A 5B30A 1C7FA 1PGOA 5LCXA 1OLXA 3TELA 1WIZA 1GJRA 4C4AA 2QUIA 4ZCPA 4DDHA 5K3BA 4HATA 4E32A 4EUSA 2FGJA 2I33A 1U9IA 5LXTF 4AD8A 5AI0A 2H5LA 1GRCA 4AFNA 3AR9A 3KJHA 4D92A 1GNSA 4GGPA 3ANXA 4JCOA 4NV3A 2F17A 1NBWB 4ETMA 1ZD9A 1YUNA 3F5DA 5K0LA 1WXXA 3CZQA 3TINA 5DWQA 4FX2A 4Z2YA 3D6AA 1YJBA 3V8QA 4KXWA 3FWZA 4RKYA 4L5JA 4ROSA 2NUTB 3LZDA 3PS9A 1NJ2A 1REQA 3BWCA 5D3ZA 1O0CA 3EVBA 3CPSA 1FFGA 3E7WA 4WGFA 5A03A 4XDZA 5CFNA 1IG0A 2TS1A 4BNDA 1DIOB 5DW0A 4C21A 1TQ6A 2X23A 1JIUA 2ZAIA 5AT1A 3RU9A 4EPWA 1WEKA 3U5TA 2PXBA 2LLVA 3CJTA 1QO7A 3LDUA 3PYLA 5F1KA 1OU0A 4MIEA 4DV4B 5JXGA 2H52A 1QR2A 3NKVA 3GQBA 3N3BC 1DTWB 3C3WA 4PZZA 5DHUA 5KVQA 4XM2A 4CLOA 2NP7A 3H6KA 3LRXA 2FOLA 4PSAA 1GYQA 4XFDA 4YC7A 1R74A 4PNHA 2ZU0C 3G2HA 2VP2A 1L4UA 1WMBA 6NULA 4YP6A 1RWOA 1YE5A 2I7XA 2ZBEA 3WZMA 2P9CA 4IKOA 4QUKA 1Z0DA 3VU0A 2ZULA 4JU8A 4JBXA 4KV7A 1KZHA 4NCJA 3TSAA 4ZJUA 1P33A 2QZ4A 1P4JA 2YXEA 3AEKA 2JEOA 2J5QA 4E14A 3IBYA 4D9MA 4RJLA 4OXQA 1Z6PA 1YL6A 3UANA 2NXNA 1Q0HA 2QYTA 5IT4A 2GCIA 2WB4A 4NMHA 4KX3A 5GQSA 1HE1C 1OTXA 3HHEA 1M83A 1T2VA 2ID8A 4MKXA 4ZYUA 1JG4A 3OZWA 3ZHYA 3L0SA 3LDFA 1B1AA 3TQFA 3IEMA 4L73A 3KX2A 3P0JA 1L5WA 2VWQA 2X7HA 2GHRA 3E0QA 1MP0A 4NG4A 1O77A 1T4CA 4GI2A 1NW4A 3E3MA 4CIDA 1IM5A 3FCCA 1T15A 3LX6A 2VDVE 3ZTTA 1YQEA 1QOQB 3OZIA 4XDYA 2C2MA 4GOXA 1G20E 2ZJFA 4X7MA 2AJLI 3UMCA 3FDIA 2C07A 4GKKB 5E4YA 2HA6A 3GUVA 2EX0A 3OKCA 2VP9A 3RWMB 3JXDL 2X1VA 2X0KA 1P4HA 4RMJA 5COQA 1HX7A 2IYUA 2JJ2A 4Q3DA 1T2AA 3K09C 5ALSA 3IP5A 5FFFA 4M0LA 4Q19A 3S2GA 3GBFA 2B1IA 2OO5C 1S2GA 4EY3A 3TZEA 1S02A 1DWQA 3TB6A 2RH9B 4BO8A 4DJTA 4Z3KA 5KSYA 3PXUA 5BO5A 1ULSA 1CEEA 3I30X 1UZMA 3MT0A 3K0EA 4ZI5A 1XALA 2F3UA 3H5TA 1T3SA 1B16A 3P45A 1ZUNA 3FWNA 3PUHA 3EQ6A 1L1RA 3NIDB 2PO7A 5HE9A 2E1PA 2F3SA 3PIIA 4UVEA 1M6EX 2I54A 2QMQA 4KX5A 2AN3A 2DUUA 1B8NA 1ABEA 1KAEA 2P9GA 3AI7A 1T10A 3LUGA 1UT6A 2DH5A 3JATB 4FGZA 2YIJA 1SKYB 3O3CA 4MLDA 2V03A 5EERA 4JA0A 16PKA 5FPPA 1GKLA 2K87A 2H3EA 1LGYA 1P8JA 4RY9A 4D80A 2IYYA 1NF8A 2PN1A 1GCUA 2Q5LA 1UKBA 2CVHA 4N39A 4OFBA 2O23A 4LZZA 3MJDA 3PQ7A 4JEHA 4RU1A 5F52A 1KQNA 4RHCA 2LYQA 1W581 3IOYA 3KPYA 2J87A 3OIYA 4H27A 4LMPA 1GRQA 4O4HA 3TMYA 4OAOA 1DC4A 5BWLA 1Z5PA 4P98A 1L1FA 5JI2E 1QQ7A 4YJ3F 6Q21A 3GLGE 1J0XO 3UTDA 2BONA 2GN6A 1XZHA 3G49A 2NLOA 2KHZA 5I7VA 5EN4A 2IVBA 2QPLA 4EBFA 2OORA 5A5GA 4BC0A 1G2IA 1L5HB 2F1IA 2Z2ZA 3DKIA 4R1LA 2IWHA 4JZYA 2FF5A 4OXKA 4RADA 2WM2A 1IULA 2ZPAA 3Q3JB 1OX6A 1E3SA 3LP5A 3R76A 1M2NA 5NULA 4HPWA 1GFZA 5HGJA 1ZAKA 5FT9A 1T4BA 1UC5B 4INAA 4U2FA 1FNBA 1GUAA 4ANFA 1EAYA 3RQSA 1ZSVA 3P32A 1W30A 4TKUA 3ZGVA 4Y98A 1TLTA 5GV7A 1FVFA 1LLQA 4XASA 5EMKA 2HO4A 3RTGA 5HW0A 4PXAA 2JAUA 2O50A 4PX3A 5HZGA 1RXEA 4EHLA 1N2EA 4CNQA 4MVJM 4KB5A 5ENDA 4DT1B 2O8FA 5IDXA 3S2YA 3PUZA 2ZRFA 3ZU4A 4CL3A 3I1IA 1SIWA 4OB7A 4N8DA 3Q3VA 1X7HA 2G17A 4DCJA 1G3RA 1C3VA 1OE0A 2IHYA 4LRQA 1I2DA 2FG5A 2OSBA 4UNSA 5LQRA 2R96A 3Q10A 2O05A 5FBWB 1Z6ZA 4DLTA 1XMVA 3B6EA 4HN9A 4GQIA 4RZIA 3DE3X 4YCLA 1G42A 1K8YB 3I2HA 2I66A 2GD2A 2P3QA 3MCWA 1EZZA 1ZJYA 1YK1A 3KKKA 2F55A 5L3ZA 1PD0A 4TVKA 5JZSA 3QOFA 1ZEJA 4QU8A 4TRJA 3SYKA 5JS1A 1Y3DE 4N7MA 3ABQB 2E48A 2XEXA 3PFWO 4BKRA 2DCMA 5JMWA 1SPXA 3FPEA 2DAPA 4WADA 2LRHA 5TPZD 4YAUA 4EHFA 4RFLA 3MRVA 2H48A 3A6LA 4G5GA 1WCIA 2HV8A 3CEPB 2D5AA 3BTVA 1RFLA 3C0KA 2NVUB 2SECE 4EA7A 3S8YA 4MYUA 3FMYA 1XTVA 1ZGCA 2XDAA 3PHHA 4R54A 2ODBA 4TMXA 3GCZA 1Z2DA 4BL5A 2FDRA 1ECPA 3O84A 2L82A 4K8OA 3L4BA 5IFKA 5KTKA 3JZIA 3DMRA 4IP0A 1GVHA 2GHQA 2H2HA 2FXIA 4W8GA 3M6UA 1Y81A 2GJ8A 3P8ZA 4BEWA 2DKFA 2PUGA 4L78A 3FR7A 1QMGA 1Z2AA 2BFMA 4TS4A 5KMGB 3KNZA 4MR7B 1B6TA 5JAQA 1OBVA 5HUHA 1D8TA 3P96A 3LYUA 2P0AA 5BR4A 3D4PA 4Y2HA 5H4GA 1SCQA 1W36C 1QKIA 4LXGA 3C8DA 3NNSA 3CUSA 4MKHA 1TIPA 3DO6A 3HC7A 2POCA 4CMEA 5K4HA 1OB2A 2PY6A 1U2SA 3HYNA 1YRYE 1NYRA 3AUJB 4FCCA 3R4CA 1QRUA 1ZICA 5BN3B 1XZPA 1ZC3A 3V7YA 1EM6A 4I8XA 2UYGA 3T1QA 5DN9A 3DUFA 2OR3A 1TT5B 5IS2A 2KEKA 4YEDA 2LCFA 3G7UA 3QTBA 4BLOA 2QUHA 2XCTB 3QFCA 3K94A 1W36D 2JVKA 5EIEA 4OX9B 1ZH6A 1M34A 2IIVA 3GEHA 4JOQA 5SV2A 2NVBA 3C8ZA 3TXAA 2G67A 2XXQA 3GAZA 4LV5B 2HI0A 3P4UA 3PGMA 4B40A 2CLOB 4QZVA 4UEOA 2GJAA 4M38A 4MPRA 3U3KA 1RPJA 2AR0A 2NYUA 1JBKA 1X92A 2RJNA 2KW5A 4P0TA 4XX0B 5DEIA 2ZUWA 3HEAA 3B7HA 4RO0A 4BVAA 4WVFA 1M5RA 4JBNA 3K2IA 4MS3B 3LNCA 3PG5A 4UU0A 5A0FA 1N9KA 2BFCB 5HK8A 5M7EA 4AQ7A 1WPXA 2AZDA 3PIDA 1TU4A 1VSTA 2GCOA 3WKCA 4J0JA 2IYRA 3H2GA 1TM3E 1QRDA 1ZMXA 2G5GX 2QBYA 4CT0A 3HGQA 2B0CA 5F2OA 4QGFA 2XRYA 3CF4A 3HL4A 2H1HA 5FI5A 4CQJA 3ZHBA 1SHKA 2X13A 5BR7A 3WHPA 5BQ5A 1G0OA 3WWCA 2D7JA 3P9XA 4K9DA 5HUJA 3U7FB 4U7JA 1VRWA 1WE2A 1MW8X 4GQMA 5T64A 3U1TA 4JYCA 3U49A 4L8GA 3EBLA 5AVXA 1K2WA 5JYCA 4NLLA 3CF2A 4KR0A 1TUBB 1E5DA 1XP5A 3GCWA 5TMDA 3ND5A 1USGA 3QHAA 3TW8A 4ED9A 1X87A 3HYLA 4MUBA 4YB8A 5HRAA 1UXHA 2GO7A 4PO3X 4C4OA 3BB3A 1TM4E 1TMYA 2VC2B 4YAEA 3RSFA 4ZCMA 1V2GA 3LX5A 1ISHA 4I14A 4BB6A 2ZE5A 4PPGA 2GAOA 1X77A 3G89A 4NFLA 2JKVA 2IT1A 4NDWA 5B1YA 3T52A 1KIAA 2XMDA 4TL6A 1L1MA 3SOZA 4U2EA 4MUKA 1NATA 4WDRA 4JYBA 1TGYA 5EYPB 2P0YA 2V45A 1SU8A 1SWVA 3J7TA 3KOYA 3LPNA 4ND4A 5ALXA 5FHRA 1V4VA 3NASA 1FCJA 3K1ZA 4D9KA 4EVQA 1U0LA 1NQOA 4I99A 4D4IA 4BB0A 1UM8A 1DELA 2EWVA 3H5VA 1TQ4A 1KC1A 1WZCA 3R5KA 3FUTA 2FSSA 1BXRB 3JRWA 1ACMA 4JP3A 5FWDA 1WCXA 4LQDA 3R9IA 1T9GS 2ZI3A 3MT7A 2DFVA 2WY2D 4GKJB 1G8YA 3KL4A 1WX1A 2ZSKA 4FSXA 4RS3A 3G2PA 3WGNA 5K8CA 4YUYA 5EKSA 1YC2A 3MF4A 3UUGA 1N8TA 1PEKE 1BFUA 2I2DA 3FM9A 3NBQA 4KJXA 4H18A 2DERA 5T4EA 4HTAA 1FYDA 3UWKA 5I48A 1EBBA 4PYRA 4D9NA 3TEPA 2B2CA 1ZCBA 1H5QA 1Z6YA 4C7JA 2W4IA 2YH2A 1NZJA 1O4XA 1CY0A 4A8TA 2C4KA 1TYCA 1YWGO 1H93A 4N4AA 4ISBA 4KWEA 9LDBA 1XTBA 2ONYA 4IKPA 4EJMA 4EYSA 2PZFA 3V8EA 3ZC3A 1GRNA 3B52X 3ZHIA 2R68A 4GSYA 1AMOA 3OVMA 3AKEA 1KAMA 3SCHA 4JY7A 5H9WA 4YT4A 5B5SA 1EUQA 3D5EA 3UB2A 2B1GA 4RYDA 5KNDD 5TQ0A 5DTMA 3PYMA 2OWDA 4YRRA 3U3JA 1L5MA 1JQ5A 3BIFA 4RIHA 3U3OA 2MSDB 1ZBDA 3TTSA 1X1AA 2HPAA 3KTDA 1HT0A 4NXNB 2OHIA 2CWWA 5CVVA 5G53C 3C1AA 1M0EA 2C2KA 4Z7QB 4J0GA 3UWSA 1QFXA 3R7FA 2C54A 2EKQA 5JH7A 3PKIA 3DDUA 2X6QA 5L7TA 3QY0A 3IL2A 3RAPR 1WETA 5CLGA 3QEKA 5LD2C 4V3CA 2Y8EA 4GX0A 3C3JA 4BQQA 8OHMA 2Z2KA 1XLVA 4LF4B 1I51A 3E7XA 1U2DC 4MI9A 4JI5B 1YB1A 2ZSIA 3RRJA 5ABPA 4E07A 1FMJA 1FRFS 3SCFA 2Z1NA 4MEBA 5EY5B 5AJXA 5F33A 3T5DA 1ZINA 1XEXB 1CY7A 1SPBS 5SICE 5CEFA 2R1VB 2V96A 2WAXA 3AFOA 3FZNA 4TLDA 4YMVA 1DSSG 1JDVA 4AJEA 2Q21A 4D4HA 4H1UA 4MWEA 3CX6A 1ND5A 2DJIA 3UJ6A 1K66A 3A1WA 3KS9A 3F7TA 3DOIA 2EGUA 3FVQA 1PR5A 4PFSA 1SURA 2AUMA 2CJWA 3IXQA 1ZRHA 1B23P 2ZUUA 4YO8A 1UXIA 3MERA 1O7JA 5CIQA 3ZBTA 1IY1A 1DEHA 2Q0XA 4KJZA 4AS2A 4H77A 4CU5A 4D5GA 4ENQA 4YUXA 2FPWA 4CQMB 5AVVA 4KFTA 2EKDA 3R5SA 4PLZA 4F91B 3B89A 4BQSA 2XVZA 3AEQA 3DLAA 4WTOA 5D01A 5LA6B 2QQFA 4HUQB 3SYMA 2PG3A 1HH4A 5LB2A 3QXJA 3X2SA 1G3MA 1H8HA 3TAUA 4F4HA 1A9XB 3GJXC 1KFCB 5IYZA 2X9QA 1M8GA 3JQQA 4L4SA 4LXTA 5FWAA 3ECCA 5SY9A 4X65B 1XDGA 4Z53A 3MAAC 4ZKEA 3OM0A 4D8TA 3AERA 4RSGA 3EXHA 2VBCA 4BS9A 4KPYA 1RP7A 1LMB3 1P7CA 3EF0A 3H75A 4P3OA 4EHIA 4BNYA 3QFTA 1KEEB 3TSOA 4FCWA 3ZCQA 1LPBB 1PTKA 2EQAA 2JZOA 3QLUA 4FFBB 4MR9A 1EIWA 1E79A 2WZCA 1T4MA 3RT7A 3SJUA 1OB5A 2B8NA 2IBTA 5FNVF 4KFCA 3BHJA 1V1MB 3PJGA 4YRIA 5C0OE 2UUOA 2I3GA 1IZ8A 1XEFA 4LVUA 3HDTA 1H9BA 1DCFA 1B74A 1C7EA 1ZCJA 4HPJB 4E08A 2VJAA 3EWSA 4YAGA 3FSRA 3TIXB 4KIFA 3D8HA 3ODGA 3IFSA 4HZGA 3BFPA 3ZGZA 1FE8A 3JQAA 3KIPA 4U1RA 3WLAA 4BO4A 2C1EA 5D6OA 5J4VA 1FYXA 2H2GA 1CFJA 3KB2A 2OD9A 1J97A 1IOZA 3FUXA 2JFHA 5DP1A 4QU5A 5TRTA 4CLXA 2P27A 2QTFA 5JSUA 1Q50A 2WWIA 1I4TD 4HDKA 2NAPA 4M7RA 1L4YA 3GMDA 1RNLA 4P81A 2FR0A 4I9FA 1Y48E 2QDXA 4YONB 4CGZA 1I33A 1ZJWA 4JR2A 3IEXA 1X1DA 1JFSA 2XB4A 4TTRA 3SSAA 3WNQA 1O9GA 1Z7EA 2ACEA 4BFSA 1XYGA 2B8JA 2ZIXA 2Q5JA 4FEAA 4GS5A 4W5WA 1CS0A 4AZ3A 1PFWA 4FU0A 2Y6UA 4DG5A 1J2EA 2WJZB 4H15A 3S8MA 2EWMA 4KGVA 3ZQJA 1OT3A 1U7UA 2JFVA 4EP1A 4EVSA 3LUKA 2IP2A 3LBNA 1S96A 3BD7A 2PQMA 2R8PA 1KOLA 1W0JA 4BZZA 4DCMA 1Y1SA 3JWIA 2CUKA 5DTIA 5HF6A 4EAQA 3DBIA 4UBLA 2VQDA 3MD9A 1C7RA 1Q0TA 4FW8A 1ADBA 3SF8A 3MMZA 2OQRA 4ISCA 3Q3HA 3QP9A 1MORA 1O6CA 1E3EA 4EI9A 2JLBA 2OT3B 1PFKA 3PI7A 1BJKA 4HR7A 4NH0A 2E9SA 1RJ9B 1NBOA 2QSYA 4RTOA 1KK1A 1IAQA 2JF0A 3Q7QA 6ABPA 1PK9A 1MVNA 3ICCA 3UT5A 4DEXA 2YV1A 4PCLA 3GUHA 4AZTA 3PV0A 4MOWA 3LBIA 3DEYX 2Z4SA 4ETIA 5F1PA 4LX0A 1BW9A 1K8QA 1EZ1A 1XZAA 2OCKA 4DB2A 3LRPA 4LEIA 3QPCA 3O7MA 2VZ8A 3MG9A 4D4KA 5KQPA 1YDGA 3F7OA 2PXEA 2DJ5A 3TOCA 3PNLA 3VMFA 1R6UA 3BEDA 5HQ3B 2IE8A 3IP3A 4H1TA 2UZAA 5JAIA 2ZIZA 3NHLA 4DA4A 2B35A 2HSDA 3QGMA 4IIFA 4B4UA 4GR9A 4Q9IA 2QLMA 3R7WB 3OZBA 3GEBA 3M82A 3IPLA 4UUQA 1UBRS 5TX7A 1P5HA 4Z5DA 2H85A 1L3CA 5B7QA 2I65A 1O9HA 4U5QA 3CLVA 3SXPA 3WVNA 4WZBE 1HKHA 4X91A 3HM9A 3DOCA 4AJ4A 3OT1A 3I9NA 1LZLA 4C14A 3G2KA 5E6UA 3NOXA 3SFVA 3NT5A 1P9NA 1RWQA 3GU3A 2XIJA 3L1JA 4HQRA 4ZALA 2ODWA 1D2EA 1R0CA 3VPDA 3B3FA 1NF3A 5KO2A 1JUDA 3GGDA 3TR5A 3O74A 2AXNA 1MU0A 3M3HA 4EHJA 1IRIA 2EZ8A 2BFFA 1SZJG 2LIPA 4G89A 2X0NA 2PV7A 2WYHA 3IKLA 4WNIA 5FV7A 2F59A 3CLSC 2Q5OA 2HJRA 2NQ8A 2JNWA 3L0CA 4BGVA 1BVHA 1GSHA 4M6WA 3RTCA 3CEHA 3BE8A 1KMHA 5F73A 1DBVO 4FZ5A 5MN6A 1CUGA 4HX9A 4WESA 3TJRA 2FFHA 4FYXA 1LPNA 4TT8A 4ZQGA 3ZV3A 1BSVA 3CO5A 2XI4A 5FIUA 1DOHA 4I08A 1E64A 1HDIA 5C34B 3T38A 2EKZA 4EOGA 1JDBB 1DIAA 1PGPA 4YRAA 4V2IA 1QFMA 1EP1B 2QZSA 2W2QA 4GKVA 5EZYF 3CLSD 1SBTA 3WGJA 3B9PA 4R84A 3RIMA 2RGGA 4A82A 3EGVA 5IK2D 2PQ2A 3EARA 1PW5A 2QRPA 4NNPA 4RJKA 1CQTA 2XSZD 4N7RA 4TSFD 4TV8F 3VZPA 2JI4A 3STTA 1GPAA 3RADC 3PQEA 1YS7A 2E18A 2WEKA 2ZE6A 3IA7A 4NU5A 1QFZA 2WU0A 3NETA 4MQMA 4RHYA 3WRYC 4BDSA 3WAJA 2X15A 1WUYA 3QYPA 4ITVA 3VR4D 4F3CA 1HDGO 1MENA 3O2JA 1F9AA 2A88A 2DWQA 2NO5A 1CJMA 3H2SA 4KWCA 4R31A 1E3WA 3LMKA 2GHTA 4R1OA 2LXNA 5AHWA 3ZWPA 2IH5A 1E2FA 1VBFA 2ICTA 1N25A 3DMHA 1CT9A 1JHYA 5ALFA 3IEKA 1TD1A 2GYYA 3SJAA 2BYTA 1WZNA 3LHFA 4IDCA 1VG9B 5F3WB 1TKRA 4Z7JA 4XPZA 4ZWNA 1I7PA 2WNHA 4B47A 4TVOA 5KYUB 2V98A 4AJJA 2GN0A 3A6ZA 3CVUA 3SZUA 1Z56C 4J0IA 1ESDA 3CNEA 3MCTA 3TG2A 4N5LA 4WNAB 3EW7A 3QG1A 1ISMA 1SB8A 4EMSA 4NZOA 1E5LA 1QOPB 4PR0A 5TNXA 2WG2A 5IX8A 3FWKA 1DIRA 1Q84A 4KK3A 4OM7A 4RZUA 2JGDA 1RWWA 2ZYUX 3IGFA 3NAQA 5GGXA 1L8LA 2JD1A 3VV3A 3AMVA 1JX6A 1JEQA 1RYFA 2PJDA 1IMJA 3GDFA 1FJGB 4WVLA 3GEIA 2Q27A 4NZZA 1OH8A 2VAWA 1L7NA 1TK2A 2HTEA 4KRGA 5FP0A 1FFHA 3G5TA 1UQUA 2G0NA 3GLIB 1BS1A 3A6FA 2J7WA 4WXYB 4LHSA 2CJYA 1IZ0A 2F3QA 2GAFA 3NAGA 4JVSB 1W1UA 4ZVLA 4OHZA 4ZI7B 1NR7A 2PWZA 1W87A 2JBAB 3DQPA 2VDNB 4TWZA 3ZOKA 4P9NA 3RT1A 1J2RA 2JD0A 1IHDA 2DLNA 3IDQA 3O4HA 1C1YA 1S4MA 3S5UA 3U6BA 4KLRA 1BGWA 2XB8A 4XR9A 3GP8A 1SZDA 1JHRA 2FYTA 2KBFA 2P9BA 2VAXA 3DBOB 3EVGA 3Q4GA 4L9SA 1UJBA 3BHMA 3DZHA 3KL2A 5K3FB 3UJBA 9GPBA 1FX0B 2Q9AA 1J99A 1VLZA 3BJRA 3NNDA 4PHCA 4X93A 1VJTA 1YCHA 4R2KA 4BNXA 1J39A 4LNUA 2EBFX 4D42A 1DAHA 2QLFA 3WL7A 3NJ4A 4Q48A 4G01B 1JRLA 1C2TA 1TF7A 3W34A 1E2JA 2MU1A 1N9GA 4RQUA 4WZAA 3KSZO 4GE0A 1Z07A 3K2EA 1AUVA 1I10A 2FJPA 2F1HA 4RC9A 4A4DA 3WDKA 2B78A 3FFBA 1US8B 3WBJA 3M6MD 5HM6A 4TTAA 2W2LD 1GQSA 1BHO1 2EP7A 3K20A 4GHWA 4EG3A 3HQ4O 2VPTA 4DA6A 1UJCA 2DHCA 3IMFA 2ZXFA 4NJMA 1BE0A 2XJ9A 2DULA 1OZ0A 3JR7A 4YXWD 3LS2A 1OIWA 3L82B 5JZVA 1ZSNA 2KZ8A 1L4FA 3HDYA 3C5HA 3FLBA 1QVVA 1MA3A 3ROZA 1Q7RA 2GWHA 8ABPA 1QO0D 1P4SA 4MRMB 4LDNA 4Q3AA 6ADHA 1M73E 4TQ9A 2P62A 1BEZA 2FWIA 4UDNA 3G8DA 4BO1A 1L4MA 1NW5A 1MZPA 3RFVA 2OP0A 2Q5IA 1D1PA 2H7XA 2YVQA 2PT6A 5GJCA 2RGXA 4JFAA 1J49A 3H2BA 3I5AA 3OD1A 4IZHA 4F60A 2IXFA 2WPDD 3G2NA 1Y4AE 1FNDA 1XU9A 1UPCA 2C9YA 3JAKA 4TT3D 4M1WA 5AI9A 4C06A 4MPJA 4BX9A 4A91A 3D5QA 1SOMA 1ZN9A 2O0HA 3QU2A 1T4DA 3A25A 2E5FA 4QEDA 4U7FA 4L7VA 1OWOA 5BN1A 2UVPB 5C1BA 2Z8XA 3O4JA 4Z99A 2OFXA 4LXYA 3EHEA 4DBLE 3KE8A 3D8SA 2R8BA 3VGJA 3IB3A 1CUBA 4EHDA 5KOIA 4YALA 3ZNQA 4WASA 3C5CA 3DMNA 3HPRA 3HZRA 4IMRA 3S7TA 1A8UA 3MJVA 3K70B 4E3ZA 3M6AA 1MA0A 3RYFA 1NU8A 3E81A 1KP2A 2WFLB 4FYYA 4WKPA 2C2YA 4XDHA 5REQB 4PC2A 3ZCXA 4QREA 1UJMA 4CRWB 1PGJA 3DHYA 4GVPA 3DW3X 4PX2A 1Z06A 2ZAGA 3EVCA 1E5XA 2WLTA 1VL1A 3PSHA 4UREA 1NW3A 2J3JA 3RTEA 5JI3E 4C07A 1UDCA 1DB3A 4RSRA 3BSYA 4Z8XA 5ILGA 5A9SA 2O4UX 3FTFA 2JAXA 2QENA 3KT0A 4COOA 3T1HB 2JARA 2FMIA 4RMIA 3Q5EA 3L7BA 4X3PA 2CXOA 4KPUB 3QJYA 3R3SA 2ZIEA 1RRGA 3KJZA 3M4ZA 4A9AA 3ORSA 2IXGA 4HSEA 3HKEB 3OCVA 4LSWA 2G07A 3AVPA 3QA3E 3GJ6A 4I66A 4LOHA 3PHJA 4D9JA 3ROPA 2GEVA 5DF1A 1QAOA 4L7QA 2ZJYA 1P2SA 2Y1OA 4NYMQ 3O8CA 2ZSUA 1OWMA 2L19A 2GESA 2NSHA 1IL0A 1C1XB 2AMVA 3QUTA 2BHTA 4K9KA 3EA4A 5TLSA 1VIMA 5IWCA 2Q46A 2AZTA 4O2BA 4PEVA 4Q12A 2GN4A 3U1BA 3MUOA 3MLEA 3OPYB 4CJXA 1T9KA 3WBKA 4EB6B 1IJEA 1EGMB 3BMOB 4TXMA 3H2KA 5G4LA 1CR0A 3LPMA 1HV8A 4RLQA 1A9SA 1GQRA 1GZDA 1O6FA 2GDZA 4PAGA 3O8BA 2D54A 1T2EA 2WJHA 1DC3A 5JAOA 1XDZA 1IRXA 3QYFA 4KKVA 4ZVKA 3QUBA 2I3AA 3IAAA 4RV4A 4EENA 4JUIA 1T26A 2AS0A 3TJZA 3GRYA 1RHJA 3K5PA 4B09A 3AVXA 2YZNA 3WL4A 3RNLA 2GCGA 1UZNA 1IONA 4MVJF 4TLEA 4C1NA 2XCQA 1LBIA 4QXQA 5E6RB 2Z5FA 2PQ0A 3N8HA 3G8CA 5IJAA 3UCXA 5L3VA 2VTBB 2WOOA 5E1DA 2HINA 3S70A 3HKCB 2KEIA 1PJQA 1WHSB 3H16A 3HVUA 1U1DA 1Q0UA 3ANSA 4PLYA 4WJZA 3NDJA 1LI7A 1CUVA 1HT1E 3OOWA 3QLVC 2R751 3NW9A 3OHSX 5K5EA 3UHJA 1T2NA 1FYVA 1HRKA 1Q3TA 3ZHRA 3WK7A 3EUEA 2JIRA 2N47A 3AVOA 1TCCA 3GGGA 3N8GA 1RWNA 3PFCA 4MUJA 3DXFA 5TPZA 4C0AC 5DNUA 4ZOLF 2KE5A 3D8BA 3RS3A 1JMKC 2HX1A 2EWWA 1O96A 2C5GA 2C2HA 4CLDA 3OZUA 3JQDA 3U62A 1F0NA 1W9MA 1Z18A 1YSCA 1ZH0A 2CW5A 2XKAA 3HN2A 2DR3A 1FUEA 3UW3A 3NWJA 4IDHA 3QOXA 1F5SA 5A4MS 3F9RA 4RF5A 3MA0A 4O0LA 5L3QA 3I2FA 3HNOA 3L41A 5KSOA 1NHWA 1MRSA 1X7YB 2BMWA 3A6EA 1M2EA 4G23A 2PXXA 3W2FA 4Z7NB 5I8ZA 3E5NA 2A35A 3VJRA 5LA6F 1R0BA 2QTAA 3TNFA 2AYZA 1DUSA 2OLKA 2WR8A 1FW8A 4Y2XA 3LK7A 1D1QA 3ZIAA 1L7XA 2H29A 4B3RB 1E94E 1RVDA 4E6PA 1QHFA 4YRQA 1V16B 1GUFA 3W79A 3WSWA 3ZWWA 1ZGJA 2AI2A 2QTGA 5CAEA 4EIWA 2G76A 5GONA 6LDHA 2RHDA 3VUFA 3DBHA 3M33A 2XF2A 1ZNWA 5FWYA 1HDYA 3KV3O 1EFAA 3CJQA 4AO7A 5EWLA 1Z68A 3PUIA 1O9BA 1T5SA 4UVHA 2PXVA 3KCQA 5DOZA 2OP1A 3F67A 3WKAA 4D3DA 1KJZA 4E2WA 2PD4A 4AO8A 5B3JC 2PPXA 2R65A 3IDOA 1U28C 3OY2A 2PHZA 3USZA 1EDEA 1JFFA 2XWPA 3D7RA 4CHGA 1T9GR 4CKEA 1GSIA 3KLNA 4LCBA 5AXBA 1SVUA 4GICA 2B7LA 3EAFA 3AKDA 3T1VA 2D2FA 2A33A 3LUAA 2CC2A 4LBVA 4C3VA 4J43A 5JCZA 1CDZA 1K08A 1MBZA 2RIPA 1H4TA 4MHSA 4PICA 3D7MA 4CIYA 3HZHA 4LDZA 1QHHB 4Y2JA 1TRKA 1ZGHA 2RI6A 3B1YA 4UQLA 4HXEB 4FJ1A 1Y42X 3EIFA 4R2MA 4UM8B 1VIAA 2JFWA 3LK6A 5HF8A 1AA6A 1HI9A 2VSOA 3GNSA 2WB2A 3MYRA 2M6KA 1RRPA 3BT7A 4BMYA 3HVJA 4FB5A 1E1RD 3RU7A 1G6HA 3BE4A 3KUCA 4W6QA 3T94A 1F06A 1JHDA 1SHJA 2G9VA 5ALVA 2CF6A 3LL4A 3TLEA 2VJDA 2LNDA 4CIXA 3B82A 3IP1A 2K6GA 3ANNA 4ITRC 3EPLA 2FEMA 3C41J 2ORED 2FQQA 4CDNA 4JVLA 2IF0A 2JQEA 3K0AA 4B46A 1PX0A 2PPLA 5FUWA 1P1HA 1QOZA 4B1FA 3JRXA 3DTTA 1ZWKA 1SCUB 1A8PA 4Y2QA 1IB6A 1X7DA 1E7QA 1QDUA 1YJQA 2W4QA 5I51A 3ENKA 5ADUS 1KDZA 1TKBA 2CMHA 2XITA 2O2EA 1DEAA 4DCPA 2QV0A 3QWHA 2UUBB 3W6PA 2H57A 2O8BB 1VHLA 3M4NA 5IT9A 1GAJA 3LC1O 2OZKA 1P3DA 1BX3A 1ZVQA 3MOIA 3RNOA 3V4ZA 4OHYA 5AK3A 4KE8A 3LOUA 1YNOA 5IF3A 3I64A 3RC9A 1SRQA 1AQIA 2FR8A 5BRAA 4N47A 2R63A 2WTMA 3G1UA 3OESA 4MYRA 1CK4A 3DE6X 1VBKA 3UH0A 2F8LA 4GKBA 1D2MA 4BX0A 3ZYZA 2QORA 1T9ZA 2ROQA 4RUKA 3NV7A 1VP9A 3CKYA 2FOIA 4LECA 1QX3A 5LYYA 3KTAB 2LWIA 4X62B 5CB4F 1V11A 4KXYA 3OLVA 2WSBA 2R1ZA 1RVV1 1T9HA 1GUDA 1YS9A 4OHWA 4V3BA 2OZEA 4D6YA 1OLSB 5HOQA 2HBYA 3NVKI 4OA8A 4YGXB 3SC2B 3EGWA 4S2UA 2PL5A 2F3TA 2JD2A 3VA7A 3HA2A 3SE0A 3ABSB 1Z45A 1LWOA 2O8NA 1WULS 4O4JB 3GXOA 4UHFA 5I01A 1KKUA 2XMCA 3PEEA 3VWSA 4G86A 1QV6A 3ELWA 3OQMA 3QK7A 4FT2A 3I6IA 2ZRBA 2FWPA 5KDLA 2JFZA 5BQXA 1Q7EA 3SAJA 2UYOA 3U7IA 2BUBA 3P2YA 4UQOA 2G88A 4FUQA 4UHKA 4Q5IA 5AKYA 1UBMS 2AJCA 1ETHA 1R0RE 4WH0A 4RA9A 3REOA 5D7BA 4P4SB 4I2VA 4WKGA 3W3AD 1NBHA 4Q47A 1H6CA 3HUFA 2AX3A 1B43A 1E2HA 1NU6A 5H1YA 1CB0A 1XVLA 3TMKA 5K8VA 3WNCA 2PL1A 4XVCA 3ESQA 2PSFA 4RDXA 2I91A 4EM6A 3MLBA 3BMNB 4RKEA 3TDNA 5TIIA 2PRIA 3DLIA 2HF9A 4GWGA 4H3HB 1DHRA 5JNWA 1T36A 1U7DA 2XDYA 1ZRNA 4E1VA 1QHSA 1YZKA 2J09A 1JHXA 3V1UA 1ND6A 5K98B 2IWRA 2JLRA 2Q49A 5C4IA 2OQIA 4ENUA 4ZYTA 1MAHA 5JDCC 1QPGA 3GZCA 4ZK6A 3SC4A 2X4GA 3I0NA 4NJEB 2RI0A 3UOGA 1MNAA 3GQVA 1YB7A 2VG8A 5ILQA 1SU6A 2QW8A 4OXNA 1DIBA 2NIPA 4XQEA 3OJCA 1NM5A 1SBQA 3NYIA 1DQSA 4PRYA 3I72A 3S2ZA 4GYYA 4NYIR 1NNEA 1JPVA 3HCDA 2P35A 2FZVA 2Z0MA 1U0SY 5DWDA 3R7DA 3FBWA 5FOVA 2EJBA 5T4HA 3IOMA 1J0CA 3R9KA 1JR6A 3O8QA 4M9XA 1XP8A 4M21A 4JV5B 2AN4A 3FRIA 4HS9A 4IH4A 3ZQUA 3ZK9A 3ABZA 1T3GA 3C87A 1EA5A 2WSSD 1SQ8A 3A11A 2R6R1 4D46A 3RABA 4EA9A 4JXJA 5H7XA 2XBUA 3FHOA 3IIEA 3EBOA 3KK0A 1SXJB 3A6HA 3QX8A 2OFWA 1OXTA 4QYIA 4MQEA 4EMUA 5M29A 1E7WA 2CXTA 5IJ0A 4O4LF 1ZIYA 1MC5A 4HGQA 2QRLA 1FFWA 3HFGA 5KKAA 4ME6A 3HZZA 3CWCA 4EG0A 3GDOA 4IMJB 4Z9AA 1WVIA 4AP6A 3E9DA 4HNAA 4B4KA 1DV1A 1TEHA 1NERA 1YCGA 4JLJA 4QXMA 2QNIA 4UD2A 1HY3A 1E3MA 5AM2A 3PC2A 1UOPA 4YI3A 5K3SA 2IDZA 2WQ7A 1P61B 3ZD8A 2BKUA 2XB2A 5ICCA 3O2NA 4QM6A 1E9FA 2I1LA 1JN0A 4Y9SA 2BFPA 4QLOA 3QVLA 4W7IA 1I80A 4HDNB 1YZ3A 5H70A 3CNOA 1J22A 1IWOA 3OTWA 2H4HA 2OUIA 1E99A 4GC9A 1Q1QA 4U9HS 5KQRA 2MMGA 4C3UA 4EF4A 4NE7A 2DT8A 1OTYA 1DAIA 2QL9A 4LDQA 4HVTA 4L8WB 4US0R 3W8EA 4AN1A 1O4WA 1KMIY 1V96A 4M55A 1Z13A 5DBEX 1PT7A 4ZQIA 2WG0A 3TTTA 4QKQA 1UJ5A 2XCLA 5C2JB 1AXGA 1W49A 4EFMA 5KBYA 4W5OA 2FSPA 3BRWD 1CIVA 2OAGA 3QF4A 2QUKA 1CNEA 3HJTA 3I2YX 3QMWA 5SYMA 5T7BA 4RY8A 3JASA 4Q2JA 1E0SA 2F8MA 1W2GA 1U0RA 2X4IA 3IELA 1JHOA 4FBLA 4M89A 2B92A 2VFAA 4MV3A 4YROA 1G7TA 1JVSA 1EUDB 2VTKA 3HNRA 4P5DA 2OXTA 5K01A 1Z47A 1U80A 4ZCSA 3WGZA 2W93A 3Q8WA 2PIDA 3JVEA 4YASA 4IJUA 4ICIA 3ZXSA 4LDRA 3WJ7A 3HB9A 2Y1WA 3NYWA 1I0ZA 1GG8A 4MW5A 4YS6A 3N2IA 3P9NA 3RJ5A 5KNLA 4XB2A 5J47A 3THYA 3WB1A 4YO7A 1L8AA 2ZRMA 2DU8A 4LGCA 4JQYA 4OMDA 2J4DA 2ENWA 5ALWA 4FK8A 5COAA 4CEJA 5ALYA 5EUBA 1R8JA 2IYSA 5IAEA 1Z22A 1IC6A 3KZOA 1W52X 2PT9A 3C6BA 2DQSA 4OUDA 4XWOA 2EAUA 2J0QA 3BTOA 4DNQA 2VWHA 3KG2A 1YU6A 1NKTA 3UAZA 1JNYA 5AUQA 1NSYA 2QTVA 1P39A 3AHFA 2R47A 5CCBA 1MC4A 1UBFA 4WI1A 3BWDD 4Z9XA 3UHPA 3WS7A 2CL6X 1KK0A 3ZG6A 2GD6A 1N2CE 1X9HA 1ZIDA 3QVVA 3U4AA 1KI6A 3RC3A 2Y05A 4FYIA 4V2UA 4ALKA 1DPFA 5DRYA 5ED4A 3ZCRA 3EPKA 1RACA 1NL3A 1WDWB 2GO1A 3U7RA 4YCMA 5HIKA 5DEOA 2QD3A 4UUMA 4PU4C 2I8CA 3E23A 3Q2IA 1U7OA 3TZKA 1RRMA 4CQMD 1PJRA 2Z3WA 4DJAA 1XTUA 1AKVA 1MZVA 1LDBA 3GJSA 3ZI7A 5JJ5A 1W88A 2H00A 3N7TA 1I24A 4X20A 4EI2A 2A4MA 2FUEA 4HH1A 1NN5A 2KM1A 5EWMA 1AZSC 3B6IA 3PFKA 3NEJA 1UQRA 3GT4A 1CQZA 2QD4A 2QF7A 3Q7EA 4GD3Q 2JCVA 1ELOA 3V1TC 2V9CA 1BGVA 2Y27A 3MOSA 4ARAA 3EXFA 3UXYA 1KOGA 2R7AA 3GPIA 4GMXA 2Y0EA 2VT3A 1VG0B 4X3OA 2PX5A 3PR2B 2ZGVA 4C0HA 5JWOA 1E8DA 2PX6A 3HGTA 3HPQA 3ZJ5A 2O6LA 2CVZA 4PGGA 2X8JB 4HX5A 4DCCA 2XE8A 5CYGA 4YRPA 1H1LA 2RAUA 2ZJ0A 1E89A 2PUBA 1EWYA 2JIPA 3STHA 2AUNA 2C2WA 1MOZA 1N6OA 1T3TA 4G0PA 5AW6A 5I7OA 3G2QA 1H5UA 1QYCA 3PCXA 4OGGA 2H51A 2FWJA 3BREA 1VHDA 4RX1A 3E61A 1GG2A 4QT0A 3IBSA 4CQLB 3D6NB 5AVKA 5A5DA 2HW8A 3V46A 3SJ7A 2ZXUA 4AI6A 1QC5B 3T7KA 1R63A 1NVBA 3HYTA 4I9HA 4NBSA 2J33A 1LU9A 1Z75A 2VAMA 5C7LO 5U4QA 1HDEA 2HQOA 3OFSA 4UFOA 4HHEA 4QUEA 5AJYA 1JPNA 1URPA 3EIOA 5A3QA 2X4DA 3GGSA 5ERYA 3FPJA 1RAEA 4PHHA 3AL0C 4UPEA 4K9OA 5K0TA 2NYAA 1IN5A 1Z38A 3F6BX 5B1DA 4DDKA 4DLAA 3FR8A 3OMLA 1LX6A 3KJIA 4XDGA 5IBPA 4G0QA 5IJ9A 4EFNA 4B81A 4UTRA 4K0KB 1V8ZA 3ORQA 3QF3A 4N65A 1YVPA 1OXKB 1RZRA 1A7AA 4O2LA 2ZBPA 1FFXA 2WMNB 5EEGA 3MILA 1FQKA 3AM4A 3PE5A 4N49A 3SSNA 2BM9A 3GY0A 2NGRA 4X90A 3ECAA 4Z1OA 1TJYA 1JYSA 2YW2A 1W4BA 3KHUA 3S55A 5LU9A 4JKIA 2FSGA 1WPQA 3KE9A 1ZXXA 1V7ZA 3IHTA 4F5EA 4JI0B 1QVWA 4N1AA 3OTIA 4BLSA 1NQAO 1D2RA 1Q44A 1I3KA 2G5TA 2ZW9A 1IIRA 1R0LA 3MBIA 2WAAA 3ANMA 4GFDA 4MW6A 5DM2A 2ZPTX 3CX3A 2VRWA 1SZCA 4QOHA 5CU7A 2NU8B 3URKA 1YB5A 1IG3A 1SCAA 4ZAYA 5MN5A 3KEFA 4P82A 1TADA 2V7VA 3L05A 4BRZA 5K6RA 1KDOA 4UBKA 4TKMA 1DKUA 1F8GA 2NZUG 3EGDB 5H59A 3ABOB 3OE1A 4J49A 1FUIA 2GK4A 5A0TA 4ND7A 3SS9X 2G6TA 3CVWA 2XE7A 2OCDA 2AOVA 2Z3VA 1EM8A 3EW9A 4GI7A 5HDBB 1YI8A 1AZTA 2XJ4A 3N3AC 3TQQA 1W6RA 2AXZA 1DADA 3T5TA 5IDVA 5I3CA 2GAIA 4K6GA 3LM8A 1KPHA 1G8HA 2LDBA 3RG8A 2HA4A 2VDQB 1J2YA 4XM0A 4D74A 3GNQA 4F11A 1G6KA 3DLBA 2P41A 2BV3A 3IUSA 3KPJA 3P0HA 2IUOA 2B8TA 4NKRA 3QELB 2NUPB 4UTZA 5BSEA 1CUEA 2LKDA 3WOHA 2ISQA 5GAHi 4V0RA 4EPYA 4JEMA 1QCYA 4R0NA 5JAHA 1F38A 4RNDB 2HLDD 1HZZA 2XB9A 5DM60 4YJGA 3JQ7B 3GROA 4E31A 3W1EA 3SC6A 1ABBA 5J2TA 5KYXA 1YK0A 4Q66C 3IQIX 2HT6A 3T9BA 5ALPA 3VO8A 5EJ5A 2C7RA 2BBSA 5JZMA 3MJRA 5HIIA 2PZEA 5AW5A 1P31A 3KQYA 2BM8A 5BW8A 3OH8A 2H4YA 1E6EA 4MW0A 4Q24A 2I9KA 4AF6A 3ZEIA 1KJIA 2B30A 1HZJA 3HN6A 2IS2A 4IZOA 4DJEC 1ODJA 2OB1A 1UWKA 4IIJA 4FD3A 4O2AB 1E4EB 3P2JA 1HM5A 1JDBC 4B0PA 1H23A 2B61A 3VAYA 5A3VA 1VBNA 1YC5A 1FPQA 2Z56A 2ZUDA 3AF6A 1TEZA 4YWHA 1P0CA 1L0BA 3DMTC 4KE9A 4N9WA 2YNMA 3PD7A 3CVYA 5FOTA 1N34B 5KVVA 3OAAA 2BF4A 1ZRMA 4FDLA 2EJTA 4WLFA 1L5FA 2VO1A 2X5OA 2A8YA 3ZWQA 1G8PA 5FL7D 2OD2A 4UMDA 1UFVA 3RU3A 4CLRA 1KEUA 2A78A 3BWBA 3C1TA 2A7XA 1VMIA 3EPRA 1DGQA 2HLHA 4RV5A 2QTCA 3T41A 3UGKA 2VPIA 3OP9A 1BU5A 1GKIA 2D62A 4BFCA 1E2PA 1B4DA 1Y4ZA 2R7MA 3HL0A 2Y67A 2A1UA 4BGUA 5BV7A 2NQTA 4WFKA 1J9GA 5CHYA 2YV2A 1QUEA 5AQEA 4QTUB 3EA5A 1DQNA 3KC2A 4NEGA 3D1NI 2QW1A 4XFKA 1S4QA 4TUYA 4BZPA 4ZV4A 3ZXIA 1O95A 4TYNA 3ONWA 1LLFA 1N0VC 1WUJS 3MTGA 3WAKA 1TM7E 2ONZA 2W5UA 5FUQA 2W0SA 4LZPA 2GZUA 3RYIB 1JWBB 3H65A 2VXBA 1TOAA 3FTDA 3GFOA 2PGOA 4U9UA 3V4FA 3D4IA 2RGBA 4Y3UA 1M2FA 3Q6MA 2X3YA 3GA0A 2ECQA 2OHJA 1A9OA 4JOBA 4YRJA 2AMJA 4BRWA 1HF0A 4HZUB 3T1NA 3HU3A 1RR6A 1AN9A 1Z0JA 3D4LA 3J80A 4MV0A 4LF7B 4BEBA 1G63A 2FJRA 2D5LA 3O8DA 3F9CA 5BW5A 2YWDA 2VWPA 1EVJA 1RWBA 3DT6A 4KQGA 3D6MA 1C3EA 2QTZA 3LT5A 4QTXA 4RVGA 2QL6A 1UMKA 3BC1A 4YCCA 2VRNA 4GZMA 3ROTA 1RI4A 2CFSA 1DQRA 1FMFA 4FFWA 1R3UA 1R4MA 2BE9A 4RY2A 2ZRPA 4J4HA 3M9WA 1GPNA 4FE3A 4DSUA 2G25A 5HKOA 5F23A 2V7QD 4AMZA 3GO4A 2HA7A 4TGLA 4JGGA 1DKPA 4HDCA 2AA3A 3FTQA 2B82A 4KRYA 1ODCA 4DLWA 1TJ4A 4BNUA 6REQA 1Q11A 1T34A 2QLJA 4F3NA 1XMSA 1I7LA 1C3OA 1XLTC 2ZYTX 3BSSA 3DM9B 3MCVA 1KSGA 1G41A 4KI0A 2Y1LA 4QQFA 2D4AA 1D07A 2YY6A 1UDAA 4ATNA 3BTUA 4F7WA 4S2EA 3SNHA 3VC7A 4O4JF 5FBZA 2BJWA 3WK6A 5IUNC 3TF5A 1QDLB 5EIBC 4YV0A 1S7CA 3WGVA 2NADA 2XZTA 3EYWA 3TVTA 1NF2A 1OJ7A 3C7KA 4LTNA 5F5NA 3UAYA 1SOWA 3HB0A 4B8WA 4BYMA 4EI7A 4HFNA 3TNLA 3EWIA 3L8EA 3RUCA 1U9CA 3I04M 1U04A 3TZQA 2R6DA 4DIDA 4ZHSA 1H3NA 1VSBA 5ELMA 5C37A 2ZIGA 3JARB 2ZAOA 5JAMA 4B9EA 1Z4JA 3K3PA 1IPFA 3L49A 5D5PA 3GLFA 1T2UA 1M0WA 1ORHA 1W1IA 5I47A 2YUTA 3BRSA 4JL6A 5CLJA 1Z0FA 3VPHA 5EIBD 3W9YA 1N6IA 4QBTA 2XGGA 5MFPA 1QU2A 4E30A 2Y1FA 2HQ1A 1R5JA 4M7PA 3VNVA 2C2GA 2HJSA 3SYNA 3V7NA 3OFVA 4BCCA 2B20A 4D0GA 4EFKA 1QWSA 3LHIA 1TJ5A 1N4DA 4A16A 3L4EA 4Q3CA 2AFRA 1R4NB 2WK1A 3HJBA 1JLSA 1YZQA 4MCJA 1TTTA 3DKRA 3PT9A 3R3WA 4L5IA 2X2OA 3DZBA 1DO2A 4URXR 4RF3A 2BD0A 7YASA 2ODPA 4D97A 3K70C 2O1SA 2WWRA 4XSGA 2FW8A 4ZAVA 1N36B 1PV4A 4OFXA 2J59A 2J5BA 3ECSA 3V2GA 2Z57A 4IHQA 5K0SA 2ODQA 1E2DA 2O5EA 3MMPA 2JLZA 2CLIB 3B9QA 5AD1A 2FJ0A 3BZBA 2YWRA 1T9CA 4NJMB 4FEYA 2G40A 5AKGA 3RT9A 3ODPA 5B58C 1NZDA 1L5RA 1Q14A 2I55A 2KSQA 2NU6B 5DASA 2P6PA 3ZLBA 5C32A 5JPCA 2XVYA 5BY2A 1PYOA 2J3DA 2OXFA 3OZTA 4ND8A 4C08A 4IIBA 1V8DA 3K70D 4R7GA 2C7OA 2JB9A 1DKOA 4P4LA 2HMVA 3HB7A 4YPVA 4BWYA 1MRZA 1MTOA 5EZ5A 1GY8A 4ZU6X 2HWYA 4WBSA 3U4DA 4C7BA 5KOJB 4G5XA 4LDPA 2ZYVX 1TNDA 1ZZ6A 5JD4A 1WL8A 2OBNA 4YIHA 3WP0A 4EK9A 1CXZA 1XRSB 2W00A 3M6FA 4CQNA 4WZBA 4TWBA 3RANA 4OJNA 3VU9B 1O0SA 1NXQA 2NZJA 2WMYA 1GZ3A 2CZCA 4X1YB 4N9QA 4D9CA 1SNYA 3TOSA 1USIA 1BA3A 2C7BA 2PMBA 3H1EA 3H17A 2NXEA 3I4FA 4I4TB 4ECAA 1VHQA 4EPVA 3V34A 1NVWQ 3AUFA 1N2ZA 4MB2A 3OLYA 4KH0A 4IXTA 1D0SA 1SHTX 4QPPA 1YBVA 3DL0A 4DN6A 2IK8A 4YRGA 5HK9A 4C9BA 3MS7A 3U17A 3P20A 5EI5A 2QU8A 2OCGA 4NCHA 4CTOA 1G1AA 3PUJA 4HYTA 4JD5A 4HNVA 4ML3A 5JSQA 4GE3A 3IUJA 3CY6A 4CG3A 2IFTA 4LZOA 3I8XA 3VYSB 1JH9A 1U2RA 1UEXC 1PR1A 2CK3A 4QYXA 1ULBA 4AG5A 3KUXA 3WGHA 4ZCTA 1NN1A 2HXGA 1ESEA 2GTIA 2X41A 4J0EA 4M1ZA 4MR8B 5JWRA 2LYSA 3K8ZA 3LUHA 3KRTA 3P2OA 1P7PA 2P2CA 1SOVA 3KOXA 4CBVA 1VM6A 4B32A 2XODA 2X9NA 3QITA 2GZDA 2VPXA 4LJAA 3F71A 3S0JA 3MBKA 1Y7TA 4KK4A 1OX4B 4TYQA 4XW2A 3UMBA 4MQLA 1Z33A 1WH6A 1R12A 3LUFA 3VAAA 2WIJA 4XUDA 2NG1A 1GLGA 1DKLA 1II9A 2OAEA 3BE5A 2R4UA 3F4KA 3FZEA 3I9KA 3FYDA 2VHVA 3V32A 3VNRA 3BFVA 3GVHA 1H2RS 3ON5A 3RCBA 2M9MA 1X0VA 4DRYA 3U44B 2ZYHA 4EJSA 2FRDC 3QVWA 4M53A 1PJAA 5TF0A 1K2VN 3DH0A 3PHBE 3QJGA 4EA8A 2XDQB 1FU7A 4KQ9A 1DC6A 1XNQB 1GXSB 1CQXA 1U1FA 4LY6A 1V1RB 2FX2A 2GTHA 5ESXA 4ND1A 5FTJA 3U9SA 3CG0A 3A04A 2P67A 5ESDA 4KAXA 2GEUA 2OR1L 1AVTA 1KORA 1XTQA 2PVSA 1P1CA 4K2AA 3GVIA 4C89A 4KPFC 1NLMA 1SH7A 3VSCA 3VH2A 2BISA 5CFQA 3L6EA 3TRIA 5J2UB 2H06A 1PERL 3IKMB 3M89A 4AJKA 4X54A 2PSEA 3HK2A 2DHQA 3GRKA 5EZ6B 3T34A 3ZVNA 2O7SA 1PZHA 1IQUA 1HLDA 2QYSA 2DETA 1ZUGA 1YDMA 3AETA 1EX1A 1BO6A 4WK6A 5AKXA 2LP4Y 3LECA 3O91A 2JHPA 4CXMA 4YJDA 5HF9A 1ZCAA 4RTJA 1ATZA 4R3UC 1R0XA 1ZQ9A 3FLMA 4HFMA 4WCFA 2Q6OA 1KR2A 1U3WA 4HD8A 3VJLA 2QU7A 3G2LA 3PA6A 4Y67A 3AR3A 4HDOB 4M4SA 5DI3A 4C6RA 3L5KA 4BVBA 2HK9A 4IF6A 1Q1AA 1TTPB 1QV9A 3DDWA 4DSAA 4EW3A 4IOMA 4DREA 1P1IA 2MSKA 4REMA 2J8ZA 3IBTA 1EUYA 1YQXA 1HT3A 4GX1A 4BHTA 1H3FA 3JYHA 1YIDA 3EZYA 3WG9A 2D1RA 4F4UA 4J2TA 3TLGB 1KXZA 3ZWVA 2CBGA 2WNIA 4BNJA 1CUJA 4Q37A 1EVZA 1XJWA 4LYAA 4L76A 5I7WA 3STWA