1JFTA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
340
structure length
340
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDAGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
total genus 119
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jftA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA02
1HEYA 1Z17A 4X4IA 1QP7A 3HDVA 3SCHA 1AB6A 4MR8B 3QF3A 1XWWA 3IP6A 1ZZBA 1QNLA 3GA5A 4IGAA 1YS6A 4MCXA 5FBKA 1JFSA 4KZKA 4MQFB 1GCAA 2CROA 5IEJA 3CG4A 2MYNA 2E4ZA 3OO0A 1Z12A 4TMYA 4NDWA 1M5UA 3LMKA 4WUTA 1GT0C 2FXIA 1RZSA 2FEKA 4MS3A 2XJ3A 4M88A 3EULA 2E4VA 2IPLA 4J1WA 4PU7A 3QX9A 1ZVVA 2WJAA 2IUOA 5IX8A 2KEJA 3GBVA 3HSYA 1WETA 4PEVA 2ID7A 3FFWA 4MGEA 7ABPA 3CNBA 4KRFA 4MPTA 4P98A 4PZ0A 4F8DA 3A3KA 4WXMA 4I6TA 3T38A 2A9RA 4RKQA 5FWYA 1EFAA 3UUGA 3JPYA 4X4DA 4WT7A 3O21A 3OO1A 4JCXA 5DTEA 4YWHA 4KNYA 2CHEA 3L1PA 2ID9A 3M9WA 4H3KB 4JASB 4Q7EA 1M2EA 5CNKA 4Z99A 1PUXA 2L8NA 2BNNA 1SXIA 3FFTA 1X57A 1JHZA 1ZITA 2NZVG 4MR8A 2L49A 3F51A 2RJNA 3C3WA 3IP5A 1JH9A 3LUFA 3OMWA 3QLVA 4G97A 2E4XA 2PUGA 1ZZ9A 3MA0A 2O38A 1ZN2A 2D5VA 4X4HA 1GUDA 2L17A 4MQFA 4LRQA 4XFKA 1QKKA 4RU1A 3TO5A 4Q6WA 1S8NA 1NEQA 3HJFA 5TPZD 2HQRA 4Z4FA 3IDOA 5IUNC 1P8AA 1JBEA 3DNVB 3MM4A 5K98B 1E6KA 1RIOA 1PRAA 2L19A 1JL3A 3SAJA 3BBLA 4ZJPA 4F06A 1TM2A 3QLTA 3HM9A 2VYCA 1Z16A 4X4GA 2FTKE 3OMXA 4Z5HA 1D5WA 3JTEA 4X4CA 1JFTA 4LDAA 3DGFC 1H9CA 3EGCA 5GQSA 5KC8A 5IUJC 4DADA 3SM9A 3O1IC 4RXTA 4YR7A 4EGSA 1A0OA 3IPAA 4O1IA 4G86A 2OENG 1L1MA 3M9XA 3KG2A 3RVKA 1ZZCA 3Q9SA 3KLOA 3F52A 3CROL 1YVUA 1XHEA 1ZH4A 1QP0A 2FLWA 2FVYA 2HQBA 2WB4A 2P4UA 3OLZA 1JYFA 3CFYA 4MLDA 2IPMA 3L49A 4MR9B 4TLLB 3MQ4A 4OG2A 4XASA 2FN8A 5EWJB 4RY0A 3LFPA 2JBAA 4Z9BA 3HEBA 1DZ3A 1UXDA 1NXXA 4RK7A 3HXMA 3HK2A 4GHJA 3HS3A 1AB5A 3A10A 4Z4HA 1B0NA 4NICA 4PICA 3FYAA 3OMTA 2FQXA 4XAQA 2HSGA 4B09A 3DLHA 2GI4A 1KGSA 1E2BA 3DGEC 3F6WA 2IV1A 3TRBA 2QR3A 2PUDA 1FQWA 1UXCA 2PUEA 1Z15A 2B4AA 3G85A 5BQ3A 4X4BA 2FN9A 5EWJA 2IVGA 1F4VA 1Y1LA 1BVHA 2R25B 1T34A 4RZSA 4N41A 2BGGA 3BRSA 4RDCA 5BRJA 1POUA 2XSDC 2H8RA 2JBAB 3LUKA 5HM6A 1ZY2A 4P1ZA 4D74A 4MR7A 2F8SA 3VK0A 1JF8A 3HVRA 1NXOA 4EUKA 3IP7A 3HV2A 4H60A 5CHYA 2QZJA 3RVSA 5JS2A 3R0JA 1U2QA 3H5LA 2QVCA 4ETMA 2KYRA 3QEKA 1JX6A 2VUIB 4QPJC 3PXPA 4RK6A 5JNTA 1J56A 1IIBA 4PU4C 4W5OA 4O1HA 4ZMRA 1BDIA 1QQBA 1YIOA 2JVIA 5FWYB 3BRQA 4LE2A 4GPAA 2LYRA 4IA8A 1C4WA 1CHNA 2JVJA 5F64A 3P9YA 1BDHA 1VPWA 2IPNA 2AYZA 1ZZ6A 4ETNA 4MS4A 3RQIA 4RY9A 2H0AA 2QVGA 1R8JA 4IF4A 4KV7A 2E4YA 4MR9A 4Z4CA 1PEYA 2FSPA 1D1QA 5C5EA 5FWXB 3NNNA 4MS1A 4KFCA 3JY6A 1QO0D 5A7LA 4YP9A 3LTEA 5KQGA 2IU7A 1QMPA 2E4UA 2LBPA 4MLCA 3KSMA 4XLTA 3OQOA 1M5TA 2IKSA 3EUSA 3E3MA 4MRMB 4N03A 2AXVA 3C97A 2KEKA 2O49A 3A0RB 1YTUA 2CD7A 1PEAA 3Q7RA 4LZLA 5KI6A 1VKRA 1XHFA 4RK1A 2V0NA 2KEIA 1Z13A 1L5YA 2R63A 1SXHA 3F7NA 3QWGA 4G0YA 4UHJA 4N76A 3I42A 2M98A 4F12A 3CECA 4N0QA 5GOTA 4F3TA 3QQ6A 2FQWA 4Z5DA 4HNQA 1HF0A 1E6MA 4OLBA 4QYMA 4O8BA 5IUKC 1USIA 3ILHA 1TLFA 1DRJA 1OXBB 2P9HA 3GV0A 2IVQA 4Z4IA 1JLKA 4S05A 1NXWA 3HZIB 3N0RA 1SQ8A 4G0XA 1USGA 3O9XA 3H1GA 1OSLA 5KC9A 1NTRA 1LK0A 3B2NA 2NZUG 4S04A 1SRRA 5EWLB 2FEPA 1QQAA 3NHZA 5PNTA 3FMYA 2WMYA 2LIVA 1ZGGA 3FMVA 3KHTA 5CNMA 3IP9A 1CJGA 1NERA 1BA2A 3BREA 1FFSA 4IRXA 4NQRA 3A0UA 4Z0NA 3LUAA 3H5VA 3N0XA 3NBMA 2CWDA 3HUUA 2FQYA 1PRVA 4Z58A 2LYSA 3VNBA 1YK1A 1K68A 3N6VA 2H3HA 1WH8A 3U3WA 3BD1A 4ZYLA 3IVPA 2NT3A 1W25A 3MF4A 4D6YA 5B3JC 3SG0A 3O75A 3GBPA 2MEZA 3KXAA 3FDFA 3O1JC 4Q6BA 3G5GA 4LX8A 1CQTA 3EAFA 2QW1A 3C6QA 4RK4A 4WXEA 4PU3C 3D8UA 2WWVD 5DCLA 4OLAA 2GZUA 2JRLA 4I6UA 2BJCA 3HCWA 3NNSA 3Q15C 1URPA 4ML3A 5JS1A 2WRZA 1D1PA 1S7EA 5IEBA 3EJWA 2PUCA 4YARA 3LUCA 2A9OA 5DLEA 2O20A 4EYQA 3ROFA 3NNDA 4ETIA 1CYEA 3RVPA 3Q7TA 4G0PA 3RVQA 1B00A 2MYPA 1WH6A 3O2JA 3UK0A 1MAVA 2M1ZA 1D2AA 1ZGZA 3MIZA 1RXEA 3O74A 5KQLA 1DJMA 1AU7A 3HUTA 1YMVA 4OATA 4MCTA 3RVLA 3CTPA 4XXHA 5JNSA 1W9HA 4RK5A 1QPZA 4KREA 3JVDA 1DRKA 3CS3A 1FFGA 4EYKA 3MMNA 5EWLA 3SY8A 4IMJB 3G7DA 3BS3A 2JB9A 3CG0A 3RH0A 4W5RA 1RZRD 3JVIA 2FW0A 4G0ZA 3TD9A 1M2FA 5C5CA 4YG7B 4Z59A 3LUDA 1Y7YA 2WIUB 1BDJA 1DBPA 2MSLA 3URMA 1U2PA 3D02A 4G0MA 1DCMA 4KK3A 1ZAYA 4MS1B 3VNAA 3OP9A 1YS7A 4HNRA 3CZCA 1MB0A 2R47A 3OLXA 5HKOA 3LFTA 2A6CA 2LP4Y 1DCFA 3HO1A 1ZHHA 4MRMA 2BNOA 5ED4A 1RXIA 3EQ2A 3N53A 4EVQA 1APBA 1SXGA 2ICPA 1OXKB 2GBPA 3H1EA 3O2QB 1DC8A 3RVOA 3F6PA 3N75A 1Z2DA 2FKAA 4PYRA 2AXZA 4UHKA 4JAVC 2CHFA 4YG4A 1TMYA 8ABPA 5BR1A 5TPWA 3GWGA 1R69A 1U0SY 1O4XA 4XARA 1RPJA 1ZESA 3KJXA 3SNKA 4IWRA 3H5IA 1D4ZA 2LYQA 4G0OA 4I6RA 4EVRA 3QLUC 3BDNA 3Q41A 4NV3A 5TQ2B 1LCDA 2FEWB 4EY3A 1KRXA 5T3YA 1ISSA 2PLNA 1EWVA 2HJ9A 9ABPA 2MYUA 1LQCA 3H5WA 1A04A 2XIUA 5TQ0A 1MVOA 5TQJA 5HSGA 1DBWA 3F73A 2PUBA 3KYIB 4NCAA 1LBIA 2HINA 5TPWB 2KPJA 3ZHIA 3QYXA 3JXCL 1I3CA 3CKMA 4CBVA 3KZ3A 2FMKA 4W5TA 1UDRA 3RZZA 3CLCA 1L5ZA 4KQ9A 3RVRA 4MR7B 1DG9A 2XI8A 2EBYA 3ZHMA 1F51E 4PE5B 5CNIA 4KQCA 2IVBA 2JVKA 4QICA 2AYXA 1ISRA 3CZ5A 4W5QA 2WUSR 2JVLA 3K9CA 2MYTA 3I5AA 3QX8A 1Y9QA 4KMRA 4MQEB 1TVMA 3K4HA 4F8JA 5TQ0B 3GT7A 4W5NA 1FSPA 1DWKA 1PNRA 2VUHB 2MSWA 3GRCA 5JNWA 3TMYA 4X4EA 1JFVA 4MS4B 4FB4A 1U8TA 4KVFA 2GRMA 3S8QA 2AWIA 5JNUA 1NY5A 1A2OA 5IBQA 3JXDL 2B1JA 3I45A 2EF8A 2W42A 4OTZA 1JDPA 2TMYA 2YHBA 4OBBA 2EWTA 2A9PA 4EYOA 4Z4EA 1UTXA 3FYMA 3RVJA 1Z18A 3OQNA 3CHYA 2A9QA 4JOQA 3LISA 1LBHA 3KKEA 4L4UA 4RSMA 4MS3B 1ZZ8A 6CHYA 2PUAA 4ZPJA 1GCGA 2B5AA 4LDZA 5EWMB 3H6HA 2OFYA 2MSKA 4FE7A 1Z2EA 3RVMA 3RVNA 3C3KA 2WY2D 4YG1A 1DC7A 2J48A 3MYYA 3G1WA 2AXUA 3C3MA 4J1XA 5IC5A 2L18A 4TN5A 2IPAB 2HPHA 4G0QA 5T7BA 4Z4GA 2VK2A 4E7OA 2ZAYA 2JCGA 2CSFA 2PAFA 4E7PA 3H5TA 4MAAA 4RY8A 1U04A 3CU5A 4RK0A 3ROTA 1KRWA 1DW9A 2FMHA 3OLYA 3BILA 3N8IA 1ADRA 2RJOA 4Z5CA 2PE5A 1NXVA 4YO7A 5B3JA 3LKBA 3LKVA 3LUHA 1PRUA 4IMIB 4JQDA 3GBFA 2Q5CA 3H1FA 4PU8A 5KQPA 2QV0A 3GN5B 1ABFA 3EQZA 5TPZA 1MB3A 1ZS4A 1JDNA 1Z26A 2PL1A 3CLKA 4IVZA 3KCNA 4WZZA 2LYPA 2FLKA 4YCSA 3FFXA 3QLUA 4EVSA 1GUBA 2ZWMA 2XDYA 4JP1A 3R1FA 4N0PA 2LYLA 1LCCA 4RS3A 5TQ2A 3FGZA 3SQNA 2QXYA 3QELA 4HYEA 2NT4A 4Z9AA 4DN6A 3L6UA 1ZDMA 2R1JL 2PL9A 2HQOA 3OM1A 4F11A 3SCFA 2GX6A 2IYNA 1RNLA 3OLVA 2ICTA 3GN5A 1ABEA 2R4QA 5CNJA 4RXUA 3EODA 2IOYA 3N0WA 4LE1A 4D6XA 2BNMA 3KS9A 3GL9A 2LYKA 1EWKA 5I4CA 5KQMA 4IILA 4YRZA 2YHAA 5D2CA 1PNTA 3IPCA 5FBHA 5ABPA 3EDCA 1WIZA 4Y9TA 1PHRA 2MQKA 2LYJA 2PUFA 3OQMA 4RXMA 2RGYA 1JYEA 1NXPA 3ILYA 3UKJA 2OR1L 1LMB3 3QELB 3W9SA 2PMCA 4DQDA 2FMFA 2N9UA 2PJUA 2LCVA 1EHCA 1NXTA 1VRVA 3CRNA 4MQEA 4RKRA 5DGCA 2PKXA 4FE4A 3DLBA 2I6FA 5HQJA 4TLMB 1DP4A 2QU7A 1P6QA 3QEMB 2OQRA 4GQMA 3I09A 3HDGA 1C0EA 3S99A 1ZUGA 4YGXB 4ZMSA 4H3HB 1DBQA 5BRAA 2PPXA 1BAPA 4X4FA 3T8YA 4KPYA 2AW6A 6ABPA 1X2LA 1VLZA 1PERL 3T6KA 3B7HA 3DZDA 2XCJA 1YMUA 1RPEL 1RZRA 3O2SB 1ZH2A 4QYWA 3JXBC 3MLFA 3OLWA 3JS5A 3NHMA 3KYJB 4YS6A 5IULC 5EWMA 1KMIY 4FBIA 2IDMA 1K66A 2LPMA 2F8TA 3QEMA 4RV5A 4WWHA 1EAYA 2NUBA 3DBIA 1CEYA 2O4AA 2FJRA 1GLGA 5DKFA 1OCTC 3TB6A 2DRIA 3H75A 1QP4A 3GYBA 3HZHA 4L85A 4YBAA 1LJLA 4JCYA 1QO0A 4RWEA 1IC8A 1P2FA 3QK7A 3KLNA 3SCGA 3M6MD 3O1HB 5JNVA 1EWTA 3UFDA 3E61A 4FN3A 2X7XA 4YV7A 4JA2A 1R63A 2R48A 1NXSA 2KZ8A 2GRLA 2AUWA 3D1NI 3JPWA 4YLEA 3TX6A 1FFWA 4I8TA 3H6GA 1Z25A 3QLVC 1USKA 3F6CA 4NCBA 1MIHA 4MYRA 5JNRA 2L2QA 5FWXA 1DCKA 5KWSA 4N47A 2LUOA 2FMIA 3KTOA 2RDMA 1P6UA 3LOPA 4LE0A 3ZKCA 4KK4A 1TJYA 3OM0A 4GNRA 4Y42A 2GWRA 4OB4A 2JK1A 4HNSA 1E6LA 4JB2A 2GKGA 1YK0A 4O5AA 1LLIA 2QSJA 3H5OA 1YSEA 4EYGA 1ZZ7A 3Q7SA 1ZPQA 2PIJA 3T95A 1SD5A 5TE9A 2WJWA 2E4WA 1NATA 1XWRA 1JWLA 3LUGA 5E3JA 1E3OC 3LUJA 1LJUA 4JB0A
chains in the Genus database with same CATH superfamily
1YT5A 3T34A 1Y3AA 3JVVA 3TTYA 3SCHA 1RM3A 4V38A 3EXEA 1UIRA 2W6QA 3A9RA 2NU7A 3SZMA 1BS9A 1OWNA 3MHTA 1N2XA 1E7YA 4IGAA 4QYXA 2PEYA 4B7CA 4ESOA 2W8ZA 1RT9A 4R84A 4YTEA 3ZD8A 2AMLA 2CXTA 4D3ZA 1GNTA 4FLEA 1QUFA 1RYBA 2C2WA 2E4ZA 2WU3A 4L51A 3MTQA 4URZR 1KBZA 2CNOA 3A2LA 1Z4JA 3I9JA 5COQA 5JC8A 1MJGM 3BMCA 3T3PB 1N1DA 2QMYA 3N59A 4AF6A 4AG6A 4HG2A 1W93A 3EZXA 2QL6A 1DC4A 4KWEA 1IZZA 1NLYA 4KG7A 1ACMA 4MDYA 5EVCA 4L8YA 1Z5OA 3CE9A 2IUOA 2WIJA 1XZCA 3MRVA 1L7PA 1O58A 1TA0A 1UIMA 2ZREA 3LHIA 4PC7A 3HUEA 1PJZA 3ROMA 1ATIA 4IIJA 2PV0A 4MP8A 4TKVB 2V58A 4ZI7B 1WHSA 3VR0A 4GWGA 4NF2A 5K0FA 2PWZA 1W44A 1UZMA 1MHTA 4LYJA 2R6JA 4UDNA 1B15A 5LYJF 1OF1A 3NEJA 1ZEJA 4LWZA 3TGPA 1DAPA 1O94A 4TSFD 3VUEA 4TMXA 4BLQA 4DCSA 1DIRA 2H8KA 3IAAA 3ZU2A 3WGLA 5MDHA 1R16A 3BWCA 3VR4D 5ICGA 5KCMA 3WV5A 2JDIA 1ISGA 2Q3DA 2QNIA 2GETA 4OQPA 3T5MA 4E08A 1FC0A 5JISA 5KU7A 4IWXA 4LTNA 3AUKA 5AXAA 2JIMA 3DL4A 1FLVA 4BUZA 3TQRA 1ZOLA 3NHRA 4WKCA 5KINB 2YASA 3PD0A 5C51B 1JDUA 2QVYX 1OFHA 2CFSA 4MQFA 4PAOA 1H8HA 3R7WB 3OWQA 1POWA 1X9HA 3R6LA 4RMJA 3GJ7A 3T3NA 2I1LA 5MGBA 2BCEA 3QXGA 3CZQA 2DH6A 4OQDA 2EJUA 3TMAA 4HRYA 3NIFB 3OZDA 4WBXC 3MM4A 3AETB 4TMFA 1WCV1 4K6KA 5BNWA 3FPSA 2FPGA 3HDTA 4J7UA 1R8YA 1VOTA 4TYPA 1DAOA 1Q1BA 4CKCA 1SOMA 2C2KA 4QODA 5FCDA 5HMLA 1ID1A 2AQIA 1O95D 5BYAA 1IUKA 1CF9A 1XQ6A 3V00A 4UZEA 4ZEOA 2XB4A 1JIKA 3EGDA 4F84A 3QKRA 1BD4A 1L2TA 1GRVA 1N7GA 1VPTA 1RXYA 1VSVA 4O4LF 3UH0A 1NFFA 5L4SA 4L5AA 1CEQA 1WUYA 2IEBA 2IJGX 2ZRFA 1OFVA 2WB4A 3DE0X 1AUPA 3QFCA 4MA4A 4MLDA 5C1IA 3CUTA 5JJ5A 2J3LA 1DAGA 2IH2A 3ZWMA 3SHQA 4ALJA 2G09A 4E4YA 1GDHA 4QUIA 5JD3A 3ZDCA 4R0MA 2HRDA 1XZFA 1WOYA 4FHDA 4ZAGA 1XNHA 3FHLA 3S44A 2DULA 3I6QA 4Z4HA 2Q8NA 2WTAA 3AQ4A 4C5AA 4O2BB 3TW4A 5HGXA 4QHYA 2EGUA 5AJVB 4EO7A 1SOVA 3DDZX 4PBTA 1KQOA 3PP8A 5FBZA 2R9VA 1XXLA 3REFA 1P1KA 2V6FA 4AMGA 3W8NA 4MMXB 5AW3A 4CIYA 1GDDA 1XVLA 3TSAA 1JQBA 2HHLA 2QSYA 1NJ5A 3OZEA 5LA6F 1QIMA 3AFGA 4MVXA 1NF2A 4WZAE 1D2EA 4OJMX 3CVUA 3JASB 2O57A 2F8SA 4YJ3A 1NXOA 2RKBA 3HWWA 3R0JA 1DQPA 1TD1A 1E1CA 3GGSA 3GZCA 3H4IA 5CB0A 3EBPA 1UOQA 2PG3A 4AZSA 2C07A 5CYOA 1PVDA 3PEYA 3LBFA 1GZ4A 2DLDA 2JVIA 3IUBA 2D5CA 2QT1A 3P9QA 4WOBA 1Y7IA 2PIAA 4EPVA 5MGNA 1C0PA 4HEQA 4QEKA 5JECA 1E69A 2ZSIA 2PXDA 4X84A 3H9BA 1R4AA 3PC8C 2I9KA 1J5PA 2VP0A 4BCBA 3E81A 3PL1A 2XYPA 3HN6A 1Y1PA 1QO0D 5A7LA 3OSUA 4IIXA 4MS1A 3LY8A 2IU7A 2GBLC 4TTVA 5B53A 3HB7A 3LC0A 4C0QC 3CSDA 5HP4A 2UUBB 4EUEA 2IX9A 4HRVA 4B2IA 4ZJYA 2RCNA 2G76A 2WAAA 3A0RB 3I1FA 2QRNA 1FXWF 2ONYA 3G2MA 3AMVA 3AR9A 4QOSA 2B20A 2OV1A 4CT4B 3OZFA 3CZ9A 2FRXA 4L3WA 1NBME 2P5YA 4JKIA 2ZWOA 3I9LA 1O8BA 2E5WA 1YQXA 2ZI6A 4CKYA 2IXAA 4XOIA 4ZZ0A 2PZ8A 4GHWA 4IQ4A 1AKYA 3ESYA 4EZEA 5CU7A 2IYXA 1JQKA 2O7RA 2OB2A 3KOOA 2HAEA 4M46A 3V34A 5IK2D 3FNBA 4EUHA 1ZWKA 2NSJA 1V8DA 1MEJA 2DKFA 4BGIA 1L0BA 3TMKA 4H0CA 1IY9A 5AVSA 5EWLB 4DCPA 3WAGA 3NTQA 3DFKA 2H4FA 3PZBA 2F8LA 3SVTA 3VZPA 4RA6B 3MBIA 2B4TO 2PXHA 2X2FA 1EVIA 3DLCA 5ALYA 5KHAA 1S9DA 2QU8A 2C59A 2ZTMA 5CRIA 4XCXA 5H82A 4ZZ2A 2X86A 1C1YA 3KJZA 3N0XA 1QYWA 1JEEA 1V7QA 1V2GA 2ATXA 1PBNA 5REQA 2BZSA 3SS8A 3WGMA 2UZAA 1WH8A 1P18A 4MQ6A 4PQGA 3C8DA 1RQ2A 3G49A 3A14A 2SECE 5AKGA 3U9LA 3BZUA 3SG0A 1KEVA 1QHYA 3HVKA 3C7KA 4YCMA 5HRUA 2GRUA 2K2WA 4LJSA 5GVRA 1X7DA 1VXRA 2O5VA 2V97A 2MSNA 1EUDB 1N75A 1SVOA 2ZYGA 3EWAA 1F8XA 4OAQA 3TRHA 3VXKA 4YRKA 1Y6GA 2IH4A 2JNWA 2C5EA 4PM4A 3KUCA 4M0LA 4QWWA 5CA1F 5FPKA 4LJRA 2O8BB 2IEGA 2PUCA 1FFEA 4RL4A 3V8VA 4CEHA 5AKYA 2ZVQX 4B3JA 1RKQA 4G56A 1U5BA 3OOJA 3KOXA 4EG1A 4MMYB 2FE1A 4JLPA 4M0CA 4QBIA 3D43A 2O3TA 4NR0A 2XB8A 3AR8A 2CUNA 5AW6A 1U0BB 4JP5A 1D2AA 2CLDX 3U44B 2H2IA 4EZBA 3RCBA 2AQHA 4LDQA 5AXCA 1VMAA 2BRUC 2VT7A 3FX2A 4KQMA 4RS4A 1ZO8A 1ZBQA 1L4NA 2EKBA 3EW9A 3T5TA 3KTDA 3HCRA 1EVZA 1MPXA 3W7VA 1F0NA 1RKVA 3BK2A 3D4BA 3CG0A 5E6UA 2FW7A 3AIIA 3QNWA 4EF6A 5HUQA 4GP9A 3H9GA 2ECKA 4TZ6A 1R6TA 3CUUA 2ZR7A 3LUDA 2CXPA 2VP2A 2ZZKA 4KFRA 4RPHA 4ZYVA 2VTEA 1KFBB 3T0FA 3MSXA 1SVSA 4AF7A 2YFQA 4N49A 4UM8B 5EJ9A 4RAQA 2Z58A 2CXOA 1TGYA 3OJEA 4JYCA 4EFKA 5L7TA 4MVCA 1VPDA 5GGXA 5J63A 4DILA 3GVCA 3FWYA 4DZZA 1E3IA 3MINB 4RELA 5B12A 2ERYA 3ZVLA 1SB9A 3LLCA 3RGWS 1YHZA 1H2AS 4IR7A 5H02A 3RVOA 2ZRBA 1XMSA 4KXNA 3AIKA 4LDRA 3HN7A 3DVRX 3FCOA 8ABPA 4JI6B 4Q9DA 4J6EA 6PFKA 1RACA 1KOFA 3KYBA 2ZTVA 1JSCA 3RJTA 1F5NA 3LDAA 1DXHA 1PWYE 4FLFA 4IBOA 4RQBA 1QHEA 2BGRA 1JTEA 1X86B 2FPPA 2QR2A 4GVXA 4JLWA 1BG6A 4NV3A 4FGJA 1E2HA 4L9AA 4TYYA 2XUGA 1NAHA 5JCJA 4ESEA 4XW2A 2ODWA 4RNDB 2BGTA 3SHOA 1W36D 4DMGA 4X92A 5AI6A 2MU1A 3HACA 3ZN2A 5FOUA 3UJ7A 1ZK3A 5FPHA 1N7IA 2F43A 5FLEX 1R9MA 1CZRA 4UUMA 5BWOA 2AOVA 3HCCA 4F45A 1LLCA 4UBIA 1L5MA 1ZNZA 2I67A 3GDOA 3N2YA 3A9VA 3OCCA 4KYVA 1GTRA 1B23P 1FQKA 2UV8A 2CEKA 3I76A 2ILVA 4NMMA 3NC4A 3T94A 3EYWA 3ED5A 3OCWA 2CNNA 2YMMA 1XRQA 4P4NA 1AD2A 4O08A 2D5AA 1WVIA 2A4KA 4JL5A 2BM8A 4ITRC 4LDNA 3TLXA 4NG5A 1LNQA 3QX8A 4O3FA 5FPSA 3KHUA 2HFJA 4IKPA 2OO3A 1X0VA 4O2AB 1CJKC 2I3DA 1CWUA 2I3ZA 3O3MB 4J90A 5NULA 2BFAA 4A0HA 3ANTA 1ZR4A 3IEUA 5CK5A 3HHPA 3EFEA 3LQQA 4OJTA 1H3NA 2XV1A 1DJPA 4Z53A 3DEYX 1PLJA 5D3ZA 2J85A 6GPBA 1OBFO 3D7RA 5FOSA 1IFXA 3RWMB 4LPKA 3OZBA 3OY7A 3R20A 3NORA 3NT5A 4P3XA 4ZQBA 3KR1A 1G2IA 3FPGA 3OJ0A 4H6WA 1P73A 2Q5FA 1DC6A 4TYQA 3H6HA 2WUVA 1TU3A 3HLTA 3RVNA 3G2NA 2VNAA 5IHPA 5EYPB 1DC7A 4JI0B 3ZJ4A 3RBZA 4XGKA 3D3NA 1F4PA 4M54A 5FA6A 2RH4A 2CHGA 2OD7A 5BV1A 1P9LA 3EA0A 3R3WA 1L5VA 2XUPA 5DMXA 3SI7A 3GFTA 3J7AC 1PZGA 4AY3A 1OCEA 1XZGA 2G0AA 4RK0A 3OECA 4OCZA 4P35A 3OLYA 3UG7A 3ASVA 3O4FA 4D26A 3LKVA 4NU6A 1ST2A 3WRVA 4JQDA 2F1RA 4QYTA 1Q16A 3V8MA 2H3EA 2DQZA 3TKYA 3VKFA 2GGSA 1RJDA 4PU8A 1JFLA 1KWKA 4LZOA 3BC1A 3W04A 2QK4A 3TSCA 4V03A 3H86A 3U62A 1MFQC 1D2HA 1A4IA 2B8EA 3ZEIA 3IMKA 4ILKA 4LHVA 4QELA 4D0GA 4BQEA 4YCSA 2YWGA 1FYWA 2YN0A 5IC6A 1UPAA 4AO7A 3RSGA 3OP1A 1KZ7B 3R1IA 3MJRA 3CKLA 3SGLA 2DSNA 4FEEA 3MT9A 4UDYX 4OQNA 3CLTD 4K2AA 2FY8A 5TX7A 2NV6A 5A04A 2W0MA 2FDRA 2QN8A 4S2UA 2EDAA 3QPUA 2V7WA 4C6TB 5JSHA 1JSXA 3L6UA 1W7AA 1C0IA 4REQB 3OZSA 2IQIA 3K7EA 2IYNA 4W7IA 3PQ5A 1TVKA 2GD2A 3OLVA 1UT6A 4G9EA 5LP6F 5CIQA 1OH5A 3EXEB 3V4OA 3X43A 4EY4A 3ORQA 2HMWA 3EOAI 5IWCA 4OQ4A 2F1JA 2VLBA 2J7WA 3BSSA 1YB2A 3CONA 5CIWA 5I4CA 2ZIZA 4BKUA 4NS4A 3G0HA 4OKNA 1JZSA 3V4LA 3WY9A 3LWBA 1YIAA 1RYEA 2FRVA 2YW2A 2Z3WA 1U7OA 3W9UA 1GT91 1NXPA 3DMPA 1S0UA 2BTOA 3CUVA 3H2ZA 2EFJA 3F74A 1B16A 2OGUA 1W29A 1PS8A 3CNLA 3MAAC 3UPTA 2P2YA 1NXTA 2XA1A 4QVKA 1WDLA 4TV9F 1D3AA 1Y9DA 2C94A 2N47A 2PQ6A 4XFJA 5IDYA 4BO6A 1UM9A 3F90A 4YX9A 3WSTA 5FD8A 1WY7A 1ZVKA 2GCOB 1Y1RA 2VRNA 2YVLA 3PQDA 3RSHA 4P7JA 5CLJA 1KEKA 3U60B 4DY6A 2ID4A 3DZCA 1DBQA 3BL5A 1M67A 4NARA 1OVGA 3R7SA 1YRHA 3R0IA 1FCJA 4XM2A 5EZYB 2EKDA 2HO4A 2ICAA 2Y71A 1L5QA 2NUPB 2R1UA 4YI5A 2J0SA 5THXA 4GPBA 3VR5H 2DCMA 3PUJA 3O2SB 3D8SA 4MCIA 3EQ8A 3D81A 3K31A 3OX3A 3AEZA 3S7ZA 4A6XA 4JYZA 3MMZA 4CLHA 4PPFA 4JGIA 5L3QA 3SFTA 1OYWA 3O8QB 1FUYB 3TLYA 4AS1A 2GEDA 3QBTA 4IH1A 4RGYA 3L77A 4Y2JA 5FTKA 3RPEA 1ISMA 1FJ2A 4QM6A 5A9TA 3CRZA 2R751 4B0PA 4B40A 1E2FA 1VL8A 1VA5A 1ZXLA 4EGQA 5K8CA 1L5RA 4L85A 1MDFA 4L1KA 1E18A 3MD0A 4G8DA 1YJQA 2NACA 2VJDA 3DAFA 4WA7A 5CURA 1NULA 3UUWA 4DS3A 5I7SA 4JA0A 3PE6A 4LYAA 3ES9A 5A1JA 5H4GA 4NHOA 3DQZA 3PXEA 4EB6B 3NOQA 1FFCA 3P97A 5FP0A 4ZVQA 4V1CA 3SXUB 2CNWA 1N9GB 2OG1A 5JMPA 4JN6B 5FDFA 3N8DA 1EJ0A 1DCKA 1A4RA 1QYIA 3DAPA 3HG7A 1KH1A 4GG1A 2X6QA 3ZJTA 3W5IA 4QBTA 2AZTA 3GNTA 2NOAA 3E4CA 5EKSA 5J2UF 1IBLB 2IOFA 4IZ6A 4JQCA 3O3NB 1XALA 2HMTA 2XQJA 1M0WA 4N5MA 1LLIA 4QOEA 5ALZA 3OZXA 2XZPA 7MHTA 1AK2A 2C57A 3CB2A 1H22A 2WKRA 3WWEA 1NJ6A 3NDBB 2W2VA 2WWXA 3I30X 1KJ9A 4ND7A 5CPFA 1H1LA 4B4UA 1FP7A 4BKOA 3PBKA 2A5JA 1R0LA 4X54A 4O2AA 3DJFA 1TJ5A 2ZUSA 3QITA 1P0FA 2XUFA 5JAMA 4YAGA 3H6KA 4MV5A 2WAXA 3BSWA 1NBOA 5SZKB 1I4EB 3PDJA 1CIVA 2Z3ZA 4ENUA 4BVGA 1QH0A 4M49A 3C98A 2ZUDA 1PJ8A 1P17A 4OYYA 4RA9A 3UN1A 4ZDIA 3OO0A 4HEHA 1P2DA 4TMYA 4JODA 3SK0A 1DKLA 3A11A 3HL4A 1FNCA 4TQUS 4EY7A 1IEWA 1OFIA 5FB3A 1NG1A 1SQ6A 1JI3A 1VHDA 3IPXA 4TXNA 5DFAA 1L9KA 1C9MA 4K9MA 1BS1A 5KJEA 3TQTA 5A4KA 2AK3A 1LPMA 4UULA 1O0BA 3PHHA 5EFOA 4GU5A 1OYOA 3DM9B 2ECQA 4MWZA 3UWOA 1G38A 3A1VA 2NVBA 4II7A 5B7QA 1YB6A 4F5YA 1K5PA 3M6LA 3U4IA 2Z8YM 2OXRA 1VB5A 5K5EA 1LRJA 3K4PA 1YZUA 2XNDD 2WSBA 4EECA 3UUGA 2OCYC 4BN0A 3GPLA 2HF2A 3AV0B 5ITVA 3WE7A 5ALPA 4U63A 2F48A 3VAAA 4CFZA 1TLTA 1JS1X 3GVIA 4JASB 4Q7MB 4HLQB 2FPSA 1XGKA 2CXHA 2FEAA 1YH3A 2L8NA 4QGGA 5IAOA 2YTZA 2QTHA 2D6FA 3NM5A 2DOKA 3IP5A 4NJEB 4G97A 4M98A 3RK4A 3MA0A 4ARAA 3O93A 2VPWA 3I04M 4HH0A 1I3MA 4W6QA 4LRQA 1EDEA 5EMNA 1DO0A 2GVDC 1C2YA 4WBNB 2QLMA 3MUFA 1J0XO 1ZKDA 4DWWA 3NOOA 3P9XA 2RC6A 4JWKA 5H1YA 2GZ1A 5ALEA 4YJDA 1JBEA 5CVUA 2GD1O 3AZOA 5LZ4A 2BH2A 2CD9A 3BBLA 2I2XB 2B83A 3QLTA 4WK4B 4GUDA 3ZG6A 1RQNA 3OMXA 2YRXA 2O4UX 4PGHA 4HGNA 1UQTA 4FSHA 4HNUA 5A6SB 3ICEA 1PK7A 2DE0X 3KQSA 3N39C 1TAUA 3KQTA 2PH3A 5FBLB 4RXTA 3RIXA 4CNBA 3H0KA 5DHAA 1FSGA 1AA9A 1B0UA 4JI2B 3X1WA 2XXAB 1YL6A 3FDJA 4XDGA 1Q5PA 5EMMA 2EATA 1E3DA 1ZZCA 2X0DA 2VRCD 3CROL 3H2SA 3VZSA 1KFCB 4GZ6A 1QP0A 2HQBA 1BRMA 3B9PA 1NT2A 4CHGA 4B3RB 5AKEA 3O83A 3A3NA 3K0EA 1H2ZA 2A92A 2FZEA 4HEJA 1AT1A 2Y1XA 3JQ6A 4OEHA 5TR9A 1RLOA 3KOZA 5A5VA 1LNSA 5A6SA 4Q39A 2CC2A 5IFLA 4QQKA 2WVGA 4KJZA 3IKVA 2PZAA 3HWX1 1GYPA 3IQZA 1GTMA 2H07A 3VJRA 2ATEA 2J3EA 1Z0JA 1I1NA 1JU9A 2PUJA 2OBXA 1C7IA 3TRBA 5FTWA 1KC3A 1RTTA 2QR3A 1OTXA 1W49A 4KVGA 1DAIA 1Q91A 5C18A 5C8YA 2CGEA 1R0WA 1I1HA 2CF5A 4FGLA 1FNNA 5J4VA 2BGGA 1L3CA 2HMAA 2PXAA 1X3LA 4QUDA 5DYWA 4A0RA 4OI0A 2JBAB 4YQFA 3TRDA 1P2BA 4E4RA 3G3EA 1RABA 3M4ZA 1NV8A 3HZOA 2OXCA 3JQ8A 1OIVA 2DEUA 3NQ41 1JX6A 2OD9A 2B99A 2QNRA 4L4XA 3U7IA 2LKCA 5AKLA 2VCHA 5EHQA 4AJHA 2P4HX 3IBSA 1BCRB 3AW8A 1FEZA 1LPOA 2W6IA 3SYLA 1ZS9A 1E77A 5A6VA 4JLUA 2YMPA 5FBQB 5GM2A 3QXCA 2G8LA 4RTMA 2MXDA 2PKEA 4G4JA 5FWXB 2QY9A 3PHBE 1I9CA 2O3RA 1DB3A 3P4UA 1POXA 2HUNA 5CTJA 2VH1A 4PVDA 4YP9A 1XVVA 1YB1A 4G5GA 1DIGA 2G36A 3HRIA 2ZTSA 1NJ8A 4LVCA 1JDVA 5DT9A 2JJ2D 4MWTA 3T7CA 3WIUA 3EXFB 2VEDA 3JARB 3LPMA 4IUDS 4N01A 3ZIAA 2Z9DA 1EUQA 3D3WA 4OHYA 1O2DA 1Z7EA 3BTSA 3LC1O 5KB3A 3CIFA 1G1AA 4K3UA 1HZZC 4NK4A 4QATA 2EZ8A 3RRYA 5KVVA 1BQEA 8AT1A 5HE9A 1SXJC 2VCEA 5I7UA 3UIEA 3CECA 4OBEA 1WZCA 2GVZC 2V0GA 3Q87B 2H1SA 1HF0A 1NYTA 4BQFA 3WNQA 2QTZA 3L7LA 1SXJE 4X7MA 1EZ1A 1WW8A 2ORED 1YWGO 3T1YB 1G21E 1WSWA 2F17A 4L5JA 1NSYA 2NU9B 3WYFA 4DIUA 5DGTA 3ZJYA 5KC9A 1Y1QA 3QU4A 4WZBE 3M5CA 2NZUG 4HCJA 2WSIA 4I1OA 1TF2A 2FVXA 4PIVA 1KDYA 1BWSA 4J7XA 4PU0A 2BFCB 1ZUIA 2K2QB 3IP9A 5EE9A 2YZ7A 3O9MA 1RVV1 4WXRA 3UHFA 4DT1A 1KK2A 4J0JA 4Q01A 5BQOA 4RIEA 4D82A 1DINA 2QLBA 4N7JA 1I7SB 2D62A 2LYSA 2HX1A 1QHXA 2WIFA 2J0UB 3ZS8A 2CVQA 3PQ6A 3G9QA 5J2UB 3IVPA 4P86A 2RHTA 2JLXA 2D8AA 2YZ2A 2BIFA 2EBHX 3PUWA 3I8OA 1A97A 4FKBA 3BAFA 5DTJA 5PGMA 5B3JC 1MTOA 2CDBA 5JDIA 3WNCA 5CEEA 1Z6TA 3NO4A 2WZQA 1SO8A 2QA5A 5JAZA 4A5OA 1E9VA 1GR0A 2CLFB 1QJ4A 4ML3A 3TLGA 4AP9A 3E9NA 4Z5XA 3WIEA 5KWJA 4AI6A 1NVDA 4BFTA 1IXRC 1PT6A 3ILSA 5DHRA 4CEHB 2PFSA 1CYEA 3RVBA 5F23A 5BN3B 3ACBA 3IIJA 4WACA 2VZ0A 2PGLA 1PVOA 2HCFA 1XTJA 4CU5A 1ZGZA 4D4GA 1G8MA 2BEJA 2D1QA 2QUBA 2AMYA 3ORFA 4QL3A 2WILA 3QKTA 3RVLA 3EQ9A 4DREA 2ZB7A 5AVXA 2E3JA 5AKXA 1R6DA 1XZ8A 2ZE7A 4LKOA 1EIZA 1OPRA 1SKMA 4XDYA 3ZUGA 4C6SA 3TS1A 1X8XA 2IRWA 3NGXA 4ZOBA 3TZQA 1C30B 1Y6QA 2GM4A 4UM5A 2HCSA 4B6OA 4EEXA 2MSLA 1PGQA 1KETA 2QTAA 2W71A 3CPEA 1B8OA 4PGFA 2VFAA 3PEEA 1KE2A 4ZFNA 3DZIA 1R0SA 3QUSA 1N5OX 2VYQA 3TINA 3RRFA 4QJ3A 2FF5A 1FRNA 5B36A 4KPEC 4KO4S 3TR5A 3ZW9A 1R6UA 2LP4Y 2PUTA 1IY0A 3JZIA 1DCFA 4NEGA 1FDTA 1R5JA 1RQPA 1YQQA 3UAWA 2CV2A 5A4DA 4UEWA 3N53A 5EE0A 4B31A 3G79A 3GRAA 3HDJA 4H0NA 5DB4A 5FBVB 1YKSA 3GFFA 4FJ2A 1U6KA 3NHBA 1HTBA 4YG4A 4DUGA 1ZAKA 3L0BA 4DZRA 3H2KA 1AHHA 1ZESA 2XZOA 2A7QA 2PD3A 4QUGA 4G0OA 5A4FS 1HQDA 5LXTB 1SA0A 2NZYA 3CURA 4FNMA 1XVAA 4B45A 3HH8A 4W5HA 2NO5A 3ZOZA 4E09A 2DETA 4WVFA 2FMUA 5CVEA 5JQGA 1Z4MA 3U3KA 4BB0A 1N6HA 3O4VA 2PRYA 2QVZX 2IYWA 1YOBA 5HQ3A 1SC9A 4MIKA 2EP5A 2VBFA 3COWA 3MGAA 5CVDA 4CHTA 2UVDA 4DSNA 3B89A 3GZJA 5TQJA 4A91A 2QJRA 3A1UA 4QKQA 2AZXA 4OJNA 4EOGA 2PRJA 1V11A 1II8A 4YK7A 2H9YA 1FDWA 3FNGA 2VQDA 1O95C 4HT3B 4UVEA 2M6KA 3PA8A 4KQ9A 1T0IA 3FFAA 2CJXA 3LK6A 4PE5B 3JQ8B 5GZ3A 1U1IA 2NV2B 3IMEA 4UU7A 2F1IA 4I4TF 1INLA 8LDHA 5GONB 5I7OA 3UTCA 1DO2A 4HNGA 4C0SA 3FOEC 1XMJA 1YZVA 5KOJB 1QFZA 2MYTA 4NE9A 1KY5A 1BCRA 3M70A 5AOVA 3V3KA 3BH7A 4XYBA 3GT7A 3RFVA 2J46A 4YLGA 3ZNNA 4XB2A 5JNWA 4FGWA 1NBHA 5ECDA 3AI7A 4MS4B 4BAZA 3VRHA 5LD2B 4YMWA 1CKEA 4AMZA 4C01A 3S8QA 2ERCA 4KQJA 4LJ4A 4D79A 1N6LA 1A2OA 2ZWIA 1KMQA 2WE7A 2VZ9A 1SBYA 3UJHA 2W42A 2D4AA 2ONKA 2F2TA 5E8JA 6YASA 1RKUA 4TYWA 1I6WA 4KPUA 3MRSA 3PQ4A 4G67A 4KXWA 2QN2A 1M2OB 1T26A 4PTYA 4L4UA 2EQBA 2QRHA 4BUJA 1PHPA 2YY5A 4RSMA 4Z0HO 4R9NA 4Q12A 5EP4A 4R1OA 1G5HA 1W73A 1UXHA 2Z57A 4IIJF 1DKRA 1Y4AE 2O2DA 1GPKA 3HYTA 2R0QC 2EQ5A 2O5EA 5L3RA 3BD8A 2C78A 3ODGA 1LA2A 1WB6A 2I4MA 4US1R 4Z4GA 4IKOA 5AK6A 4I5IA 1TFRA 2QM0A 2JCGA 2COKA 5CBPA 3PC7A 2V1XA 3JCZA 3L84A 4MW0A 1JYSA 3QKUA 2B8NA 3H0CA 4PFQA 3N8IA 1HDOA 1U6IA 3A6HA 4YO7A 1QR6A 2FFQA 3EK2A 3PFFA 3SIPA 4RTKA 4WNAA 1CR6A 2B1RA 3H1FA 4RCZA 5M2QA 3L4BC 4F86A 1O03A 3DBLB 3EQZA 5DU2A 3IC5A 1OILA 3DWGA 5C4GB 3GCDA 4URVR 4FYHA 4DR4B 4MNTA 3LRXA 1AHPA 4PSCA 3T4PA 3KCNA 1TUBA 3LRPA 3F3YA 1YCHA 3PGKA 3ESCA 3O4HA 4BV8A 2BFPA 4EA9A 4H1TA 4LG1A 1FPMA 4JP3A 1J9EA 3MWEB 3TZHA 2Z2YA 5AW0A 1IB0A 4RGBA 1O8CA 1ACJA 1ZRHA 3EVTA 3PTAA 2KB0A 2H1OA 4HQKA 4GUAA 1FNMA 1PSZA 1TKRA 1ZD2P 3DBLA 4LXXA 1WA5A 4ROSA 4V0LA 2GILA 2AOXA 3D8NA 3DHVA 2R84A 4URUR 3RT1A 3QIVA 3MNFA 1UBLS 2ZIVB 2I1VB 3UPDA 1WDTA 4ZAXA 1X7GA 5I8ZA 1ENOA 1U0TA 2ENUA 5FUWA 3ZY6A 1TEZA 1XVUA 3K6SB 2ZJAA 3GLUA 5ABPA 2J31A 2P6MA 1PHRA 1QYXA 4IQ0A 3I3SR 2AW3A 2DTXA 2RGYA 2JIRA 1OYVA 2PZFA 2X4GA 4TQAA 5CFNA 4D81A 5AKHA 1VSQA 4OQYA 2POQX 4DQDA 1B3BA 5IYZA 1RDFA 5I5GA 2PJUA 1RAIA 4HZGA 1JV2B 2IHBA 3FTPA 4BQPA 3RAEC 1FX0B 1N8TA 1QDLB 5K8VA 1L5WA 2YVUA 3CRRA 3DLBA 3GA0A 2I6FA 3H16A 5AJYA 3R5HA 2QU7A 1D8AA 5FO0A 2OFOA 3ZWWA 4M9XA 4R2MA 4UU1A 2YIDA 3HUDA 3X3HA 3KUXA 4URWR 3H5NA 1RP1A 1UBEA 2GJ4A 3HXTA 4J0KA 3VI3B 1XPUA 3L8MA 3DPSA 1CVIA 1E61A 3BD6A 4U9HS 1TPYA 4FW8A 3KQYA 1F6DA 5K20A 4DQUA 4BV3A 1KJWA 4Q3NA 2E87A 1HUQA 1Q0SA 1H5QA 1HE1C 1WQ4A 1KXZA 2AFVA 4OMCA 3R5SA 1H6AA 2H1HA 2OGTA 2ZRLA 1MFPA 3KB1A 4M1SA 3JS5A 1CF4A 3BCSA 4QA9A 5AM1A 3KBOA 3I61A 1NI5A 2JCXA 3DHEA 1F1BA 1K66A 1IE3A 3EW7A 1GPJA 2NLOA 4KE9A 1TIPA 4OGKA 2B4QA 4RV5A 4M8LA 4XFDA 2B0JA 2NUBA 3D8TA 4COKA 1RHQA 3OF2A 4GI3A 1ETHA 3GPDG 1XPRA 2O06A 3A1FA 3U4GA 1GTZA 1QP4A 2ZW9A 2WJ4A 2GN6A 3RYFA 4H31A 2ZRIA 2G63A 1WDMA 1XA3A 3W6OA 4CYMA 1P2FA 2B25A 3OD1A 4NHEA 4Z1MD 4TYNA 5F9HA 3UFDA 5JQGB 5U9CA 3BHNA 3HJNA 4UCFA 2YV3A 1NIJA 1GP2A 1NXSA 1EVLA 4CQLA 3D1NI 2GJ8A 4I46A 4M0PA 5ALFA 2GERA 3WDLA 1P5HA 3DNMA 1NQVA 3FUTA 3NAMA 4GEGA 1KA9H 2VYVA 1WCYA 3BGIA 3UGKA 2Q4RA 1W5BA 5KMGB 4UD2A 3AW9A 3WP1B 1HDXA 1SC4A 5KZMB 2C88A 3I58A 2AR9A 4Y42A 5LBIA 3LTNC 3UOGA 1I51A 2PYZA 5IF3A 4TX1A 2P9TA 1N25A 4FOOA 1WE2A 4GP6A 5D7BA 3WWDA 3ADDA 1SD5A 4CWAA 3FPLA 4I55F 3RYHA 4BQNA 2VHCA 1QOPB 3LUGA 2O1XA 3QVVA 3K8QA 1LJUA 3PR1A 1XQ9A 2JAWA 3CPHA 3PUZA 1EHIA 1V4VA 5DTRA 1AB6A 2R6AA 1PZXA 5IM4F 1S9HA 2QPTA 5IVIA 1VKZA 3OU2A 4IUCS 4E4TA 1JU3A 3IL2A 3AERA 2GD6A 1RS0A 4YAJA 1NMZA 1ZUWA 4XIIA 4D5EA 2G67A 2IYTA 2CROA 1YU6A 4JUIA 3TH5A 4RV9A 4XSHA 4A9AA 1YACA 2FP4B 2WKQA 4B4WA 4WUTA 1EDOA 3IA7A 4TVKA 5EINA 3AU8A 1DAFA 1SCAA 1XYGA 4OQFA 1GTG1 1NOKA 1EK2A 3ORRA 1F48A 1I0ZA 3EULA 3LT0A 4JDUA 1C7JA 1F2TB 3ZH9B 2D3WA 3IQFA 3GI1A 1BW9A 3ONWA 5LMUB 3UJ6A 1CR4A 1I80A 3GBVA 3L7YA 2ZGVA 2ID7A 1R66A 2F3QA 3VR6A 2CKMA 3OFND 3ZDEA 1J06A 3L6OO 2EX1A 3H13A 2R62A 2XLCA 3IJRA 3QE0A 3PVCA 1W35A 1MLDA 1YAJA 3WJ7A 3WWOA 2IOHA 1G0NA 5JALA 2V7VA 2XCLA 2G7ZA 4OHBA 5U4QA 1KDVA 3X0DA 4XQ9A 1BMDA 1H66A 3WR5A 2BJWA 1EFAA 1H23A 2G04A 2OP0A 1UBMS 3G2JA 4JL8A 4ZODA 1KOJA 1J2YA 5BNFA 2FUEA 2IYAA 3EVBA 4OBWA 2I66A 1EZZA 1NUTA 4JJ4A 2F4VB 5IDWA 1K88A 3IDAA 3EMDA 2IV3A 1YB7A 3PSHA 1JALA 3W5VA 1PUXA 1RQ7A 2AJLI 2HYIC 4XIFA 2QI9C 1UQUA 3B7WA 3QMWA 4KQGA 2WMNB 1EFCA 2WF6A 5ALQA 5CXSA 4KRGA 4AJLA 1YQEA 4X4HA 1V8PA 4DLAA 3I28A 1OLXA 3BWEA 1N8NA 3ESQA 1CUUA 3MGBA 4MHSA 4R1TA 3WYAA 2QR5A 4B6PA 5BP7A 1RYZA 4G1CA 1L1FA 2VHUA 5IT9A 5KNBD 3WA6A 2R5WA 3TQIA 3HJFA 2Z2XA 4IZHA 1R0XA 1B2RA 2DYKA 1ZOPA 3LCRA 3ONNA 3PGXA 3KCQA 1S3SA 5JSFA 2REXB 5CYPA 3K53A 3AUJB 3H7AA 1NNLA 2ZYUX 5E1OA 4X4GA 4YPFA 4XYLA 1KQNA 2PBLA 2VSXA 3B3QA 4Y1GA 2Z08A 1PQYA 1XELA 3JWGA 4RJKA 4R8LA 1E2IA 3C5HA 2JLCA 1OB2A 5LQMA 5EJMA 2ODRD 1BS2A 4Q0MA 1U0OC 2ZI3A 3CX4A 3RUPA 3GCZA 2JH8A 3OFSA 1ZH4A 1XHEA 3HJRA 1L3IA 5LP1A 3KWJA 1NP7A 4DG9A 2ZR9A 4MR9B 4OG2A 5EJ5A 4AD8A 4AKHA 5ALNA 4DC0A 4W1SA 1H2WA 2HA2A 3THYA 4DUYB 4U2BA 2QQFA 3Q5GA 1KI7A 3QQPA 4LV8B 1OT5A 2C7GA 4BNLA 4CQMB 3EXFA 2EFYA 4YAKA 4GS5A 3M1LA 3QHAA 4BS9A 3V7UA 1FYDA 4E5SA 1LC0A 1WMEA 3VDQA 3LCJA 3VC7A 5CA0A 4BECA 2FPIB 3LNTA 2E5FA 1TCBA 3AR5A 4G4GA 4I7EA 2VZEA 3FNQA 3GQBA 2GYYA 4PS0A 2JJ1D 4ASUD 1V3TA 4QDKA 1LI7A 1OAOC 1YIDA 2D5IA 4GSLA 3ZZMA 1A5SB 3I1IA 3G5MA 4IWYA 4TXLA 4LWOA 5IMSA 2V3CC 2RIRA 3DC7A 1P2GA 2PTGA 5JXHA 2J9RA 3KKNA 3BCRA 2DHDA 5DNVA 3ID6C 3NFYA 2J09A 1ZUD1 5BYJA 3F6BX 4KTVE 2FW8A 4PZDA 4JJGA 1VI5A 4RD6A 4B3SB 3VOSA 3AR6A 1OLUA 3KFXA 4OB8A 4A23A 5JARA 2LR0A 3ESXA 4EBFA 2FFJA 5LFAA 1QU2A 3DAOA 3BFPA 3EWNA 1XZPA 4NECA 2Q7OE 3DMGA 4CMIA 1D4AA 1CHNA 4C6RA 4BMPB 5TNXA 5DOVA 2F1OA 3L79A 3OJCA 2RBEA 2P35A 2UZIR 2VDRB 4RY9A 5BSUA 1YUMA 3W3AD 3JYPA 2I2DA 2TECE 3R8XA 5EIBD 3U7JA 5KYKA 2O8DA 1WM1A 1WMDA 1SU6A 1VKOA 4ENVA 1Y63A 3DB2A 4QRHA 3DFZA 1ODJA 3E03A 2F7SA 3P0FA 4CEJA 3C39A 1UWKA 3WGYA 2OQ2A 2PQ0A 3A26A 3LX5A 4N03A 4MRMB 1QF9A 1BH2A 2ORIA 3DSRA 1YTUA 2CD7A 4ZCIA 3PPIA 1C29B 2BHRA 4ZT6A 1GPWB 4A10A 1L5YA 1DC3A 3F7NA 3OE4A 3UAGA 2G72A 3ME5A 2XQIA 4KV9A 1DJOA 4WNYA 1BFDA 1S01A 1GV1A 2V55B 1E3WB 3P2OA 3E7WA 4L3OA 1DOHA 1P3DA 1TXGA 1DRJA 1HI9A 1OC2A 3GUCA 2IVQA 4FFOA 4MV0A 4PBSA 1RYHA 1ZJJA 1NXWA 3CLRC 1NMEA 2V45A 2WIDA 4QUBA 3OZWA 3RSZA 4A0QA 5CXUA 1VE3A 2O19A 2OAGA 5EQDA 4IOLA 5COBA 5H16A 5G1OA 3VVLA 1NVFA 1SRRA 4M76B 1VCNA 1RU3A 5LQKA 1ZK2A 3OJLA 5HXAA 1KIFA 2HJVA 1NERA 4D9BA 2C84A 2J7PD 2REQA 1ZD1A 3IVGA 1X1AA 4YCLA 2EEZA 4F9GA 2GAFA 4RAOA 1U7WA 3EE6A 4D8XA 1XDGA 1A5ZA 2H3HA 4MUBA 1BQ4A 4UBKA 4RGVA 4D0SA 3MF4A 4EG5A 5H4HA 5K8JB 3JZAA 1Z47A 1UZLA 3V3TA 4R2LA 3E9YA 2WWWA 4RK4A 4LX8A 3ESRA 4HLNA 1F2UA 3AVYA 3H9CA 3NVKI 1R18A 4MQ4A 4MQUA 1YR8A 5K9ZA 1W52X 5EE5B 1UEXC 3W6NA 4ZHSA 5I47A 3FCUB 3AUAA 3AWIA 4PNZA 4BO4A 3M9LA 3O3CA 1XZMA 1O1YA 2WUWE 1HO3A 3DEAA 3PFKA 1BROA 2IS4A 2VC2B 3CC8A 2ZQ5A 4G5SA 2PXTA 1MV8A 3HKCB 2ZAGA 4RVCA 3QF7A 3WO0A 1NZDA 2I87A 2ODBA 4D1YA 1CSEE 4EUNA 1QQTA 1RI3A 2DQSA 3JATB 4JC8A 4MAFA 5JH7F 2FX5A 1EE9A 3E22B 3PGA1 4LK3A 2PIDA 2P77A 1MB2A 3W78A 4DSUA 2EFHB 1YFLA 1M1YB 1HRDA 2Q3BA 1GRRA 2J59A 3CS3A 3DJYA 1AOXA 1H5NA 1FSZA 1EB9A 3OE5A 2ZPAA 3HBMA 3LUPA 3FOCA 3HU3A 3R2JA 3HVUA 4HZIA 1NW6A 2H5JA 2ZSBA 1S3GA 1NW4A 3PTZA 2M9MA 1IQPA 1U0FA 2YJ5A 5ILGA 4B8WA 3LX8A 3ZDXB 2BF4A 1ZAYA 3RBAA 3ZQ6A 1O77A 3C8HA 1ZYUA 3T0GA 4X95A 3BMXA 5CDSA 4JROA 2GN2A 3CNQS 3PE4A 9GPBA 1C0LA 3ET5A 4EHJA 1WNFA 3AIMA 4OSPA 3VR2D 5ED4A 1ZJ6A 3O8OB 1XA0A 3LU1A 4QU8A 2F4NA 2VNHA 1KAEA 1UP4A 3F6PA 3QI2A 2FKAA 4W5WA 3S8EA 3WLPA 2R11A 4PWZA 4YYEA 3HCDA 4X5OA 1JE0A 1MJ5A 2XXPA 2D1YA 2GAJA 1OAKA 3T5BA 3P5BA 5BR1A 4KR7A 3KJXA 3AB7A 3FPCA 1I10A 3MB5A 4AF8A 4XB6B 2BMFA 4HDOB 4I6RA 1PD1A 3Q10A 4EVRA 3TR6A 3NX4A 3Q41A 2D5LA 4EJSA 5A5EA 5B7GA 4R3UC 1N3LA 3MOIA 1KRXA 2LNDA 3D0OA 3NM6B 4ZQGA 3VSAA 1AQYA 9ABPA 4I4CA 2XR1A 1LQCA 3EZFA 3GEDA 4IIUA 2ZCVA 3T3EA 1LDMA 2WLTA 1Z88A 2DLNA 2EX4A 4R9VA 2O7QA 2WLSA 2ZK7A 3BL8A 3OX4A 3JXCL 4Q4LA 2BTEA 1G3RA 3NXHA 3KYDA 4D9GA 2C96A 2ANBA 2X1MA 4ZT5A 4KR9A 4R8KA 4LSMA 1OMOA 4YXFA 5CNIA 1G42A 1W581 5JMWA 5HIAA 1Z6PA 4EL0A 3FBWA 4PLGA 2YMLA 1OLUB 1RZUA 1J09A 1C50A 1J90A 3CZ5A 3VAZA 4TM7A 3N9IA 5K3DA 5B1YA 5IVKA 2BFWA 5FOWA 2WUSR 4Q5IA 1NW5A 4JVOA 2PJRA 2VXCA 4RD4A 4P82A 1TVMA 2IPXA 3PDHA 2JLWA 3FNRA 2VEOA 1X2BA 2GOYA 1PNRA 5AT1A 4B6GA 3PPVA 3L1UA 4F9EA 1PGOA 2C4WA 4H9GA 3EB9A 2FUCA 4NU0A 3EZ6A 1ZCJA 3QFSA 2IBMA 4GKBA 4D6PA 1H2EA 1OVMA 3I83A 1AKQA 4B7ZA 4OTZA 2OWEA 2J3MA 3QPWA 4ZOAA 5CB8A 4Z4EA 1I4WA 1JR4A 1XRPA 1KAMA 1XNGA 5DTMA 4DJ5X 1H4QA 2NUAB 4ZVKA 5EIFA 4XWTA 3AR4A 4TLDA 1Z4NA 2FOLA 4BLOA 4U0JA 3ETEA 4CUZA 4YDQA 3R3YA 4P5PA 4A0GA 1H0SA 3PNKA 3C3MA 4Q1DA 4DR1B 1J22A 1Z6GA 2IPAB 4G0QA 2LV8A 1K2VN 1V11B 1Q0UA 5IJAA 5TXGA 4MAAA 2GH1A 3K0SA 3I32A 3N0TA 2KJQA 3F9IA 1KRWA 1KKMA 2ODPA 1XDWA 2AJBA 3HBLA 4CG1A 3PGMA 1Q19A 2XUQA 3LKBA 4FI3C 1E4OA 3H1AA 4YJHB 2CY0A 2WUFA 2YQ5A 3FB4A 3T35A 1LPNA 3DLAA 4TM8A 4G37A 1HQKA 3IKTA 4B8YA 5LUAA 3KSBC 2E82A 1RI2A 1N2GA 5DLDA 2V9CA 3A6PC 4Q4JA 2VDWA 4DTCA 1M0SA 1CIJA 1QYVA 1TC1A 1WXHA 2ODAA 3BMOB 5DBEX 3ZDDA 4MIEA 2PL1A 2RI6A 2RH9B 1JIQA 3EA4A 2LYPA 1X92A 3FFXA 3TXXA 1X7WB 3THRA 2CNDA 4YUVA 4OHPA 2BP7A 5ITZB 1QWOA 3BIWA 4XX0A 2LYLA 6NULA 1JVNA 4BDSA 3IOYA 1FYFA 5FLYA 2JLSA 5A3SA 1XD2A 1RPAA 1GQSA 1T1RA 4NLLA 2PKQO 3OEHA 2HQOA 4G09A 1MIOA 1MVNA 2N1MA 5I4KA 1NW9B 3LCCA 3PNMA 3GLTA 1LC3A 1F8YA 3AESB 5IKXA 4W5JA 5B58T 4FZ5A 4GPIB 3I2KA 3C7AA 3UY4A 2ZBDA 1HL7A 3BWMA 1DULA 1T6ZA 4YRZA 3SF8A 3L1IA 4BHTA 1P3JA 4BVHA 5K0ZA 1YZKA 1DC5A 3K70C 1SOWA 3P94A 2PUFA 3PNVA 4OV6B 3FUVA 1N1GA 3HMKA 3WBJA 4RFLA 3IHLA 5DGXA 5GONA 3RK0A 5EKTA 5CK4A 2C2ZA 1KJNA 1UDBA 3ZZ0A 3TE6A 4MQEA 1VRVA 4ZAVA 4DCOA 5JJKA 2I7DA 2DJIA 2IUSA 4KCGA 3NWPA 3UXMA 2OQRA 4ZTUB 1EUCA 3HDGA 4C06A 2DFPA 3TJZA 3W5SA 1YR1A 1GPYA 1SURA 1II9A 2V4MA 1N0VC 3TUIC 2YY6A 3UWMA 1BAPA 4YHHB 4AFNA 3IVCA 3RJ9A 3T7DA 3NANA 4DEYA 1GZ6A 3OOYA 1PERL 4QZVA 1JHDA 1J99A 1CY7A 1JG3A 2ZJ6A 3HI6A 4X45A 1Z83A 4P7FA 3VNUA 3AO0B 5AHKA 3VMMA 1G8PA 2DHQA 3TF5A 4BNYA 5DYNA 1CC1S 1L5FA 1XEWY 1WR8A 2DBVO 2YX1A 3A37A 4LTMA 5CCEA 3B3JA 1T5BA 4CN9A 2BHTA 2HSEA 5LL6P 4RZXA 3MUEA 1UMCA 3H4MA 2R68A 1RFLA 3TB6A 2H2GA 4HQRA 5JATA 4GR5A 2C9BA 1O5TA 1CUJA 2OM6A 3Q7PA 3HXLA 1XZNA 3IYLW 4W1RA 3WC4A 4N5HX 1OLXB 5EIHA 2X13A 4JCYA 4JJKA 4KLAA 2A0UA 4D4LA 3TNLA 1U3VA 2XMRA 2X7XA 2YC2C 3TBHA 3TM5A 3MCTA 4OXQA 5LYJA 2MT9A 4JJEA 4IDPA 1R4MA 5JD4A 1HYEA 1NX6A 3FHOA 3WB1A 1HTWA 4UTXA 3IT2A 3UKDA 4MV9A 4PX9A 2Q6OA 3KAPA 4AX4A 1C7QA 1HURA 2ZJZA 3IO3A 3PCTA 3SVLA 4FJ0A 4B47A 1E5DA 5HR5A 3JQBC 4IWNA 4JNCA 1RMTA 4OFWA 4XVQA 1SQ5A 3QWBA 3RUFA 4Q4DA 5B1EA 3BXPA 1FSFA 1DG1G 5L45A 4LY6A 1RSZA 2J4CA 3GAFA 3OH8A 3RD5A 1C7FA 1MHPA 3MGCA 3OEEA 1RLTA 1BC5A 2PUVA 2JW5A 4JXKA 2GBLA 3SC3A 4RJLA 5I4IA 1C4OA 2YXLA 3BCUA 1CHDA 2P11A 5G53C 4BTEA 2OOKA 3UT5A 3VO2A 4GOXA 3HEMA 2YINC 3CF4G 4QHTA 2GCEA 4O4JA 4LXTA 5HKKD 2Y1CA 3ROGA 2ZTHA 1QIHA 2RHJA 3OF3A 1WMSA 4D45A 1WXFA 1YS6A 4FYXA 4L5BA 1UKCA 2BE7A 2G06A 4P4TA 4X1YB 4F5ZA 3EPLA 3ZU6A 1MH1A 2KQUA 3BTVA 4O2BA 3OIVA 2YHSA 3NEPX 1F7UA 4BO9A 3EIXA 3SKVA 1JLRA 3JYQA 2B69A 1CY2A 1GT0C 1F4LA 2IXDA 5LQSA 4C7VA 2DQ4A 1GKUB 5LQJA 3KQNA 1DQYA 2NVUB 3C3XA 4OI1A 1RYYA 1DE0A 1K8ZB 1XDDA 3PCRB 4YECA 1Y5NA 2HA0A 5K3SA 3UH1A 3QX9A 1Q7TA 4CQNA 4YN3A 2YXDA 3IURA 2X19A 3HDYA 3L0IB 3R3JA 1WETA 2VDOB 3CWZA 4LBWA 3TKAA 2CV0A 3JQAA 3CEPB 1H9BA 3AY0A 2BI7A 2JFYA 3CVXA 1IOZA 1Z5WA 4FKZA 2REBA 3T1NA 1GZ7A 1BX3A 3LY7A 5JXJA 4R69A 2ETXA 4F8DA 3SHVA 4KACA 3T38A 1XFDA 4D44A 4V0ME 2NUTB 4Z86A 3GJ8A 2JL1A 4MKRA 5LMNB 2YZMA 4B35A 1Y3DE 1VE5A 1CDOA 2IU4A 1KIMA 1FOEB 4R7TA 2PXPA 3AG6A 3TLEA 3UAZA 4H3KB 1E58A 3EN0A 4G1UC 4AJPA 2NXJA 1DAHA 3LY5A 5FV7A 3NHFA 3IOMA 3ZGXA 4Q18A 1RQXA 1D4OA 3IBGA 2I4LA 2VIIA 4RHXA 1RC0A 4PIMA 3FW1A 1HMPA 3TG8A 3OP4A 3EIOA 4YRNA 2R60A 2O8CB 1PG0A 4PO3X 2IEAA 1MAUA 3NJ8A 3IJPA 4NBLA 2GFHA 3H1TA 4FYKA 3QFRA 3MQFA 3DTVA 1XR3A 2IUYA 3WIOA 1YZHA 4DNOA 3K96A 4QXQA 1J0CA 2YFKA 2G07A 4HK4A 5DXJA 4HLDA 3V1KA 1PR3A 4P4SA 1OXXK 4S0XA 2HGZA 1F2TA 3IUNA 4YRTA 4HSEA 3V7WA 1JQLB 1M54A 2ADOA 2O1WA 4IHKA 13PKA 3D6MA 4Z5HA 4X4CA 1FK8A 1FP4A 1QF7A 1A69A 3HC7A 1ZD3A 3ETDA 4CLRB 2C2XA 2B4RO 4QJIA 1EFPB 1D07A 4UEJA 2ES4A 2WTNA 3QEAZ 1YR3A 2WAOA 1JA0A 1KNQA 4OXRA 4KIWA 4F3NA 4KITB 3M9XA 5BN5B 1HT3A 5K0BA 3I0NA 2VK1A 1J0DA 2CK3A 3AEQA 2PZGA 3LQYA 4NBTA 3EDOA 1J70A 3AEKA 2FLWA 3COSA 4B8ZA 2C4UA 2VJOA 5J5AA 4EI9A 3U4QB 4PN3A 1ZXXA 5J4YA 1GNQA 4E5YA 4HP8A 2UXBB 3C85A 4AU1A 4XEHA 2XNHA 3DVLA 2X5JO 1HE8B 2XPCA 3HVHA 2JBAA 3JAWA 1Y5IA 3SICE 5AR1A 4Q15A 1VTKA 4J94A 3T9CA 1C8VB 2KW5A 7YASA 3HK2A 1QIKA 1HNXB 2G7MC 4WECA 4NICA 4S0ZA 1A72A 2FPLA 4M0MA 3V2UA 1IZ9A 1XKXA 2AUNA 3KKQA 4ZPXA 5C7OO 1REQB 1UPBA 3G85A 3ROEA 4HN2A 4DDHA 1VLVA 4CEIA 1VRWA 2FN9A 3L1HA 1MX9A 4IXDA 4PPGA 4IXTA 1SG0A 5KNCD 1U2ZA 4RZSA 2ZRCA 3LPNA 4WCVA 3ZXUB 3QEOA 2VPQA 2OMEA 3IXMA 2ZXFA 3PHIA 2KLHA 4RGQA 4G41A 2RKOA 3SHFA 3TLKA 1RXSA 4K9NA 5BWCA 4OLAA 2QZJA 1G7RA 4DLUA 2BC9A 2ZB2A 2G5CA 3B1FA 1JNYA 1IHUA 1B14A 1ZCAA 3JATA 3TEPA 1ISIA 4C30A 1G4HA 2CW5A 3V1TC 1J56A 4LUCA 2VP3A 3FTDA 5EAIA 1M2KA 3EHDA 3NH9A 1WIWA 1CK4A 4HNAA 4C6HA 1F0KA 3C48A 5F64A 2F3SA 4WGGA 1U0GA 3NP9A 1GSIA 1LFAA 2R8BA 2V7GA 3AONB 5D5PA 3RU7A 1M5RA 2JS7A 1RE1A 3TL3A 5B2FA 5DJ5A 2BR4A 2FSPA 3G7NA 4KN6A 4M4SA 2WJJA 2NPIA 3WNBA 2GBGA 3EUFA 3ON5A 5KYWB 2IYRA 1D04A 5I7WA 2EP7A 4QD3A 2NO7A 5IJ9A 4EPRA 1EAMA 5JANA 4DBZA 3OQOA 3FVWA 1E0SA 2GHTA 4D46A 4OL0A 3NVMB 3KSZO 4AXXA 3K9QO 5JO0A 3GGGA 1C3LA 4EARA 5LU8A 1ICEA 1E63A 1EFRA 3R7BA 1PS0A 1K5HA 2HSZA 1ISHA 3A6JA 1Z13A 3KEOA 4LYHA 1J39A 2R63A 1UH5A 3ESBA 4LX0A 2YXPX 4RKFA 1Q44A 1DEAA 2GJSA 3BJEA 4XPIB 5K1ZA 4ALLA 1ESNA 2HDHA 4NATA 4RVNA 4RWZA 5JMOA 4ENQA 1X1TA 2FPGB 3V1MA 5KYWA 5JAOA 4JI5B 4WCFC 3DWIA 4E6EA 5GAJA 3LPCA 4MKZA 4NMXB 4OM8A 1X8KA 3WMFA 4J1SA 4EJSC 1E6WA 2OCGA 2QPAA 4IS2A 1D7OA 3SXPA 5ECGC 1T13A 4IFTA 2ZATA 1XDUA 3UK6A 3RTGA 4ENRA 4E3WA 5ALGA 5EP2A 3NHZA 1UXKA 1T1EA 1ZVQA 2Y6VA 3EEFA 3MELA 3N74A 2W6NA 4RD3A 3HDHA 1UF9A 5EQJB 1Q7BA 3H05A 2UYQA 4CG0A 4C07A 5IAGA 1YKFA 5JJLA 3TUJC 5KTSA 3UWDA 3UB4A 2PU5A 1UBKS 1D1SA 3T4UA 1UP7A 2P2NA 2FUG6 1Q21A 4IGKA 2VDJA 1J23A 1DXQA 1VPVA 1UK6A 2RBKA 1JLSA 4GWKA 4D6YA 3M6UA 4Q93A 5KEIA 3E35A 1L1QA 3ZPXA 3I4CA 1DXYA 4OLHA 1OX5A 2QW1A 4MJ7A 4DIOA 5B3LA 1ORVA 1SC3A 3WL5A 4ZEXA 3Q15C 1J24A 3ZGLA 2Q4OA 1RVDA 1BYIA 4R1QA 1AO3A 4XOUA 3FZNA 4RZIA 4YWJA 3F0TA 3LGXA 2UZ1B 5I9MA 5B5SA 1IN8A 4J0EA 2Z98A 4FMBB 4F6CA 2O20A 2AD5A 1SVNA 3NNDA 3PFGA 4JIGA 3ETLA 2D06A 2EFCB 2EFGA 4PAMA 4RLHA 4C3ZA 5IWAB 2JGIA 3NWJA 1O94D 1EM8A 4M86A 3EFHA 4MVJF 4LZPA 1N2OA 3TZ6A 2QSUA 5DEIA 1ZNWA 4DV4B 1UZUA 2Q2QA 2ZS8A 3D7NA 3DW1X 3JD1A 4NJMA 2G8NA 3HA3A 1P2SA 1DRKA 2B7BA 1CUZA 2EBUA 2JDID 3B1KA 1TB4A 5EWLA 3SY8A 4IMJB 4R5MA 2MINB 3L06A 2NYRA 4IFEA 4JUBA 4ZVNA 1MZPA 3WLOA 1GNSA 1ONSA 1T35A 2HU7A 2XMGA 2QTNA 4FONA 3RS0A 5G4KB 5AHWA 1IC6A 3CT6A 1VI6A 5K2MA 1D2RA 4F1KA 1BFUA 1LI4A 2O2HA 2IQ5A 1NC1A 3QXXA 3VNAA 4EBBA 3P9SA 5JLJA 1KI4A 2QBYB 2ZEJA 5D01A 1EM8B 2OHGA 3C24A 1AMNA 2CSUA 2WD7A 1O3YA 1ODCA 3ILXA 4PZCA 4DGSA 2BTQA 1FYVA 1I24A 2GA8A 3GRPA 2D7CA 3GZNB 3GVXA 1SNYA 4BWFB 1FNBA 5EIEA 4GICA 2H11A 2C5AA 2E21A 1FJHA 1OXKB 1GU0A 1OD6A 1C3JA 1DV1A 2DSTA 4RX1A 4F2DA 1QTIA 1RLIA 4UHKA 1IOVA 4EPTA 4RTRA 3Q6MA 5ERGB 4OA5A 1O95A 1U0SY 5DM0A 3RLFA 1ML4A 5GJBA 3WL4A 2VTVA 1X3SA 2VHJA 4P58A 4JLDA 4EDFA 2X8AA 5J40A 4AVYA 3KLPX 3HB0A 5ILOA 4FMCF 4L6IA 5E7QA 2FSGA 1EPUA 1DWUA 4EY3A 5L53A 1KI9A 4MW7A 1GWNA 1QB2A 2QMZA 1P0PA 1U9IA 2OO7A 2PLNA 2X4IA 4R8SA 2FF7A 3UJ3X 3EUAA 3ZV5A 4DXAA 4QULA 3S2EA 5BWLA 1A04A 2MR5A 3JQGA 3KZOA 3ADBA 2ZRJA 3DFMA 2PUBA 1SCUB 2H7XA 4RJJA 4P3YA 3GDHA 3KV1A 1GCUA 5IKEA 1EGVB 2REQB 3GJ6A 5KDDA 1ZD5A 2G83A 1PQUA 2A35A 2GN4A 2IZOA 3EVCA 2YN2A 1CW2B 3NR2A 1JDBC 1UDRA 4N4AA 4CMAA 4EW6A 1H9AA 2QJWA 1PNQA 3FXAA 2OAQ1 3MWDB 3SZ3A 1T4DA 3DXXA 1CNMA 1SUAA 4PLZA 1CYDA 2R7AA 4MSUA 3ZHBA 1ESCA 3H2IA 2NYUA 1AQIA 3I5AA 4BLSA 2XDQA 4HZUB 3ZWBA 2HQSA 2XGGA 3G7SA 1SCUA 2QP9X 1QKIA 2VUHB 1UM9B 3GROA 4OXNA 3VV2A 1M0EA 1USWA 2Q5IA 3D8HA 3ANLA 1FTNA 1U0LA 3GVHA 4Z3DA 4CM6A 1AKNA 2O1SA 3N7AA 5EMLA 4H1VA 3RBVA 3RT9A 3TEFA 4CVNA 3VPAA 2GEUA 2JGKA 2YUTA 4MARA 2EF8A 4YRDA 4JR0A 4ZHQF 5K05A 1VMEA 1CJSA 2C82A 5LDGA 4F46A 1YR2A 1NN0A 2B7LA 4PRYA 3FLEA 2ZM5A 1OH6A 2DWCA 1J1UA 3CHYA 3DAHA 2C4MA 3LISA 2QN3A 4RZ2A 4A36A 3DT9A 3RTEA 5EWMB 1THMA 3G17A 3AKZA 3TD6A 4LNUA 2XXQA 4ARUA 3PJDA 3MMXA 2FV8A 2JD2A 4CV1A 5K4HA 5LSAA 2JQEA 2AXUA 1LZKA 4DMHA 4IINA 4KUEA 4LC1A 1J2RA 1GZDA 2Q6LA 4E7PA 1E3SA 1WLYA 2DPMA 3CU5A 4FD2A 4MVJD 2PXEA 3CT4A 4FHZA 2EF0A 2QTRA 5F4BA 5AESA 5ES4B 4IG4A 3IQGX 1WMBA 2REOA 3PXDA 1LVGA 3JYNA 4A73A 1JDZA 4IIEA 3MEJA 1WXXA 5KX5A 3FGPA 2AJTA 1DEKA 2Q5EA 4BP3A 4JI8B 4H2DA 4GAEA 3EUWA 5KQPA 1U7XA 3MTEA 3OQ6A 1Y1KE 2JC3A 4QUEA 1L4GA 1JJBA 3CRMA 5LNK6 4FD3A 1V2HE 1E2LA 1V7CA 1XC7A 3BWDD 4X41A 4FCCA 4UTOA 1HYBA 2C7RA 3A4YA 3EEYA 4OFXA 1BXKA 3FSGD 5LLSA 3SQNA 1MBZA 2RGUA 1YQTA 3IMCA 3OKCA 4P0TA 4AYTA 1GDTA 1N6KA 4X90A 4Z9AA 1PW7A 4Q66C 1J20A 3EGXB 4IJVA 3GEPA 2PL9A 4M1MA 3LD9A 3D4OA 1DIOB 4OQZA 5JBQA 1PFWA 5B57C 5L4LA 3GN5A 4BB9A 4HHEA 5IABA 3L4KA 1GKKA 1SXJA 3N0WA 1SQFA 4KGDA 4LE1A 2A78A 1L5GB 3Q0TA 3AVUA 3TX2A 3EC1A 2J6HA 1SUIA 1NVVQ 1HE4A 2PH5A 1QFYA 1L5NA 2FQ1A 2GF0A 4LMPA 1TZCA 2J30A 1L8AA 5J2UA 3EXHB 4JLJA 5EPOA 5LYJB 3G0BA 4TTQA 2PTHA 3UHPA 3I2FA 5FI5A 3AY3A 2LIPA 3GR6A 3JD4A 4Q7KA 1L7VC 4BLWA 4CM7A 3R0VA 2V6BA 5EHXA 1KKLA 1XEAA 4AM8A 3CNNA 1BKSB 3LOUA 2BKLA 3VQTA 2HWWA 4L78A 3VV3A 2W58A 4ZDKA 3TVTA 4YMUA 2ZJ5A 1N5JA 4PGAA 4AUEA 1VE9A 2JCVA 1V3UA 3EF0A 4OHUA 5TEVA 4BN4A 3I6BA 4F3CA 1XCGB 4QQ8A 1GGNA 4Y30A 3MWJA 2WE8A 3H9UA 3BQMB 3OTIA 1T8SA 1ZSYA 1SH7A 1V4BA 2N75A 1SZJG 1IAVA 3JQFC 4CKZA 2Q45A 1AN0A 2FPIA 2JGAA 4L5IA 4Y6GB 3ZD9A 1C3XA 1FFAA 1BX1A 3IP3A 2BJVA 4A16A 1U63A 3R3XA 4AO8A 3SSOA 4QDUA 2WYVA 4BU1A 1MABB 4TL6A 3KHSA 1G7CA 3IP1A 5FA5A 5L9AA 2X6TA 3RARA 5LQDA 3UT0A 3FTQA 1H42A 3QEMA 1OHHD 1UL1X 3JQPA 4OFZA 4X85A 4XUDA 4ZXPA 2JG3A 5HIIA 1V16A 1I14A 2YL2A 2EG5A 1OCTC 1NBEA 1ULTA 3KZVA 5LQNA 2I6TA 4N1AA 2I4TA 1ZMBA 1IDOA 3FJOA 5AJUA 2NADA 3HJBA 3UF0A 3UHOA 1WABA 1RWOA 4Q2JA 1Z28A 3K0KA 4U6NA 3C74A 3ZDRA 4NDAA 5LP6A 1FTYA 3NDRA 3JPWA 1TTQB 1CU1A 1ZD4A 3K9HA 2EW8A 1FFWA 2HSDA 2GAAA 2R2AA 3O84A 3P9PA 4UBMA 1TT5B 1DO8A 2HWKA 4R81A 1SVUA 2HEGA 1KYXA 3SYMA 4CXMA 1LH0A 3O4JA 1NU6A 4KODA 3EVAA 5AYVA 2JGLA 4MITA 5CM9C 3RG2A 4GNRA 3WRXA 1KY4A 2ZI4A 1JMKC 4G4IA 4HN4B 3N2NA 3WIBA 1BJTA 4AMYA 4O5AA 4AZVA 1G8HA 5B3AA 2XXAA 2HCBA 2PT5A 2PRZA 1U2DA 1T43A 2FR0A 2GCIA 3BFVA 3C7DB 3DQPA 2NUTA 1CCWA 4B79A 2D2XA 4MYSA 1JVBA 3WAJA 1IJBA 4ZZ3A 5KQRA 4W1PA 4P4UA 1YRWA 1HEYA 1TVKB 2I6SA 2H8GA 3VPGA 1EP2B 3DOIA 3FOAA 3PEFA 3FOWA 1PGNA 4OUDA 4TUYA 2CMDA 3TGLA 3FTEA 3JRXA 2PPLA 1I0LA 3KBBA 2JLUA 1PV1A 3GA5A 3F2IA 4H16A 3IV7A 4MCXA 1GD1O 4GLLA 1JMVA 4R8VA 3D2BA 3ZCQA 4CF3A 4F5EA 1WBBA 4AKSA 3LYUA 3M4NA 1Z12A 3FG9A 4HGZA 4EHAA 4YMSA 3EXG2 3GJZA 1T0UA 1HDRA 1XJ5A 2IWHA 4G25A 5ILQA 4B3GA 3QFIA 1XZBA 1X7XB 2NZJA 4YP6A 2EERA 1LF5A 2HMUA 3HE3A 1EXMA 2QI9F 3OT1A 4DPKA 2Q41A 3DTTA 4QFMA 3ZC3A 2IK8A 4F4HA 4RCYA 1CUSA 1VHJA 2Z1MA 4PSDA 2VQSA 3TNFA 2WJAA 1X9IA 5REQB 5IJ0B 1BDMA 3L0SA 1UWVA 1O96B 3LLUA 2WVAA 1EUCB 1HLDA 3M7IA 5MFZA 5BWBA 2I4NA 2PU7A 3TL2A 3WNZA 2J3IA 4RQTA 1OJLA 5SYNA 4K87A 3ZBTA 5TMBA 2ATCA 1T9BA 3WFZA 3RKUA 1YFJA 4NBNA 2AN5A 1WB9A 2JBWA 2XQVA 4U9UA 5CB4A 3M82A 2GD0A 2PVSA 2OCAA 2WFAA 3S1AA 4LJ5A 3U4QA 2H1RA 2XDAA 5TMEA 1RJWA 3DOHA 4KR3A 4E15A 5HK8A 3AETA 1KSFX 2GBFA 4RH1A 1ATZA 1WUJS 4UAJA 3FUCA 4WQMA 2H00A 4IEFB 3PF9A 1X1EA 4EVIA 2B2XA 1F6WA 2G9VA 5IF9A 1JECA 1Q7CA 3WGGA 4MKHA 1MOPA 4J4TA 1Z07A 3CO5A 4PO1A 1Y5LA 4UNPA 1JKJA 4HB0A 4KYIB 2QG6A 5D1HA 3GJ3A 4CE6A 1GUDA 5FNVB 5I9NA 1PAUA 4JC0A 5EN4A 1NP3A 1I01A 3NHSA 1KZ9A 5HF8A 5L7WA 4BB5A 4IMPA 3DDUA 3RYCB 3VOAA 4C14A 3PHJA 4YAEA 4DMLA 3P9IA 1BHQ1 1I6MA 1P8AA 1U8UA 1F9AA 1T4CB 2ONCA 1RIOA 2L19A 5EP1A 5L7YA 1DFHA 3C16C 4BNJA 2YV2A 3N3BC 1IQ0A 2C92A 2C98A 2PJZA 4ZI3A 5ICEA 3HM2A 5DX8A 1PFKA 3GJ5A 4CCYA 4GKVA 4PNPA 4KGVA 2Y77A 4K0RA 1GOTA 1Q3HA 2QTVA 1O9HA 2J9YB 4A8TA 4B32A 4MA0A 1MO6A 1FTQA 3OC0A 4FUQA 2C3YA 2OBFA 4PZZA 3MS7A 3ADCA 1PT5A 3GG9A 4BYMA 5AD1A 3QU9A 1W59A 2RHMA 3MGKA 3WFIA 2YOGA 3EY4A 4CBVA 3SR4A 1OZFA 4LRYA 3WHKA 4DRXA 2P4UA 2C99A 5EUBA 4F5WA 2P1DA 1SC1A 3DO8A 4PLYA 4PLFA 3PB3A 3H3JA 4JVSB 2PNFA 4MUJA 4N6GA 1M2GA 2QTBA 4RY0A 3SSNA 3LFPA 2ZQZA 1VMIA 3HEBA 1HQYE 3K5PA 4K9DA 4M8SA 3HXMA 4EB0A 5P21A 4D92A 5KDOA 4X7PA 3HS3A 1CZLA 2PS0A 3IAS6 5ELLA 4YAOA 1LPAB 3RS4A 3V1NA 3V4ZA 4DDKA 4D9JA 5T6BA 1JG4A 1VCHA 1UKYA 3FYAA 1E1CB 1PG2A 1JB1A 1SBTA 1Y48E 2X41A 2X58A 2RB5A 1V35A 3DWFA 2QJTA 3F6EX 3B1VA 3TLAA 3KT8A 4LJ6A 1C9YA 5F73A 1UXCA 1FQWA 2LCFA 2W2PA 3PX2A 4KMMA 2C0PA 2NVUA 1AA6A 4GL4A 4F8YA 3OZIA 1O57A 4DPMA 4ZO4A 3WHPA 5K3AA 2D8MA 1KF0A 3LWZA 2C5FA 2VR1A 4JB8A 1K7YA 2CL5A 4EKYA 4Q19A 4GZMA 1KZHA 3OPMA 5EHNA 2PD4A 4NAUA 1K6MA 4MJ3A 4ANFA 4B7AA 5KYYA 2VF2A 1DKUA 2NZXA