1JFTA

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
340
structure length
340
Chain Sequence
b'ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDAGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jftA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jftA02
3LUJA 3JY6A 3F7NA 2PL9A 4YCSA 3QELB 1HF0A 2L2QA 3CROL 1AB6A 2JVIA 3KTOA 3OMWA 3QLVC 3HDGA 1YSEA 1DWKA 1ZVVA 3CTPA 3QEKA 1DCKA 2PLNA 2QSJA 2CHFA 3BRSA 4F11A 3O21A 3G7DA 3H6GA 4ZPJA 2WB4A 3GN5B 1GUBA 4OTZA 3HVRA 3RVSA 4RXMA 1APBA 1EWVA 3F73A 2XI8A 5TPZA 5C5EA 1FFWA 1NATA 2OR1L 3CLCA 1OXBB 2FQYA 3OO0A 3GBPA 4LE2A 4MR8A 4RV5A 2JK1A 1WETA 4YRZA 3NNSA 3E3MA 1GLGA 2WWVD 3DGEC 3OLVA 3HK2A 3FFXA 1VKRA 4GHJA 1MB0A 1PUXA 3Q15C 3LUAA 3H1FA 4JCYA 4MRMA 3DLBA 1GCGA 3DZDA 4QYMA 3VNAA 4D74A 3T6KA 3HEBA 1UDRA 3NHZA 4L4UA 1ZZ6A 5B3JA 4RDCA 3EJWA 3DLHA 4NV3A 2WMYA 1EFAA 3MYYA 3CFYA 4F8DA 2YHBA 4Z5DA 4EYGA 2PE5A 2HQBA 2MYPA 3CRNA 1YMUA 3OO1A 4MLDA 2WUSR 3BILA 5IX8A 3SQNA 4XFKA 4EY3A 3BREA 5TPWA 5IEJA 5KQGA 3HS3A 3IP6A 5FWYA 7ABPA 4F3TA 1LCCA 2LYJA 3F52A 4Y42A 3GBFA 1DCMA 3LFTA 4D6YA 4XXHA 4MLCA 2PAFA 4KMRA 3JXCL 3CG0A 2IPMA 4KQCA 2IVGA 3H5TA 3OLXA 1ZGZA 4I6RA 3FYMA 5BRJA 4RZSA 1Z25A 2YHAA 3EQZA 2KYRA 5KWSA 3PXPA 1ADRA 1ZUGA 1USKA 1TLFA 3GA5A 4NICA 4MS1B 5EWJB 4FB4A 5T7BA 4MPTA 4FBIA 1MAVA 3LKBA 3RVQA 1R63A 4OB4A 4YARA 1CJGA 1JFVA 3HZHA 2AXZA 2NZUG 1PERL 3MMNA 3QELA 4JA2A 4ZJPA 4IA8A 2IPNA 3A0RB 4OATA 1S8NA 3JXDL 3RVKA 3QWGA 4PU3C 1S7EA 4QYWA 3CNBA 5HKOA 4GQMA 4G0QA 4I6UA 1KMIY 2LYRA 1U0SY 4Q6BA 3EUSA 1QP4A 1EWTA 1GT0C 1DCFA 4TN5A 1D5WA 1KGSA 3OLYA 3GN5A 1H9CA 1YMVA 5T3YA 1L5ZA 4J1WA 1URPA 1TMYA 3G85A 4X4FA 3FGZA 3MA0A 1RXEA 4MCXA 1QP0A 2IUOA 4TLMB 3HJFA 1WH8A 3SCFA 1U2PA 2R48A 2VYCA 5FBKA 3FMYA 1GCAA 4D6XA 2E4VA 5JNVA 2OFYA 4PU4C 4X4BA 1JWLA 3FFWA 3OMXA 2PMCA 8ABPA 4KREA 3N0XA 1CEYA 3D1NI 4X4IA 1EHCA 3OLZA 1ZS4A 1R8JA 4FE7A 5CNKA 5IEBA 4IGAA 2FEWB 4HNQA 5EWMA 2FVYA 4KV7A 4W5OA 1XHEA 3H6HA 3T38A 1E6MA 3GWGA 2AXVA 3IDOA 1JDPA 1JFSA 1NXXA 4LDAA 1USIA 1P8AA 2QXYA 4Z4CA 4ETIA 1BA2A 1LLIA 3QX8A 3SCHA 1QMPA 2FSPA 3O1HB 4X4EA 1DZ3A 3N6VA 4S04A 2ID9A 2MQKA 1NEQA 2LYQA 2FTKE 5DLEA 2L17A 1EAYA 4YO7A 1LBHA 1YIOA 5DTEA 4OLBA 2IVQA 3SCGA 5KC8A 1LCDA 3JXBC 5KQMA 4RK4A 4G0YA 2LYSA 1JH9A 2IPLA 4MQFA 1QO0D 2PUEA 2LBPA 4G86A 4LZLA 1Z15A 4RK7A 2GRLA 4RKRA 4RY8A 1RZSA 2MSLA 3QEMB 3Q7RA 5JS1A 1D1PA 3H1EA 1NXTA 1TM2A 1B0NA 1MVOA 4N76A 2WJWA 2BGGA 1YS6A 2LPMA 3O1IC 5JNRA 4J1XA 3RZZA 3URMA 1KRXA 3BRQA 4MS1A 5EWJA 1WH6A 1RPEL 3LFPA 3C3KA 2A9QA 2DRIA 2AWIA 3S8QA 2PUDA 2JB9A 4NQRA 4G0OA 4IWRA 2E4ZA 3NBMA 3QYXA 4F8JA 1I3CA 3H5LA 1UXCA 1XWRA 4FN3A 1K66A 1K68A 1ZITA 3K4HA 3O75A 5TQJA 3OP9A 1A2OA 4WUTA 2MSWA 5TE9A 3U3WA 1SXHA 2AYZA 4MAAA 2O38A 4H60A 4F12A 2O4AA 4OBBA 3QLVA 4Z9BA 5TQ0B 2XSDC 3LUDA 2ZAYA 3OLWA 3MLFA 1IIBA 2PUGA 2QR3A 2QVCA 4MGEA 4IF4A 3F6WA 4JOQA 2LYKA 1ZZCA 2R4QA 4NCAA 1C0EA 3LISA 5IBQA 1PRAA 1ZZ8A 4EVSA 2TMYA 1FQWA 3HSYA 2JRLA 3UUGA 3KYJB 2GX6A 3GV0A 3Q7TA 1NXSA 3DBIA 1ZPQA 3BDNA 3A10A 3BBLA 4ETNA 4EUKA 1O4XA 3LUGA 3O2QB 3RVLA 1D1QA 4EYOA 3C3MA 1J56A 5IC5A 1IC8A 1LMB3 4H3KB 3EQ2A 4JB0A 1NXWA 2FEKA 3H75A 3S99A 1DBWA 2BNNA 5I4CA 2PUCA 3LUHA 1OCTC 1ZZBA 3NNDA 4W5RA 4JB2A 4PU7A 2KEKA 2R1JL 3HCWA 5ABPA 1A04A 2M1ZA 4RK5A 1JBEA 1ZH4A 4MR7B 1QO0A 3MF4A 4RWEA 2A9RA 2IV1A 1ISSA 3ZHMA 1QNLA 3GRCA 4RS3A 1ISRA 1T34A 5PNTA 3UK0A 4IMJB 4Z5CA 1POUA 4Z99A 4Y9TA 1Z2EA 3L1PA 4ZYLA 2R47A 3QX9A 4KQ9A 3B2NA 6ABPA 4W5NA 4WZZA 2GI4A 2FQXA 4RY9A 5DKFA 1FFSA 3LTEA 2A6CA 3QEMA 4G0ZA 5KQLA 1TJYA 3IVPA 2FW0A 4HNRA 1UXDA 3KHTA 3RQIA 2FKAA 4ETMA 4JCXA 1L5YA 3EODA 4XARA 5JNWA 4KRFA 3QQ6A 1KRWA 1LJUA 1DJMA 2BNMA 3LUFA 1U04A 5JNUA 2HPHA 1X2LA 2I6FA 4GNRA 1Z13A 3H5WA 1CYEA 1MIHA 2FLKA 1QKKA 2MEZA 3O1JC 5EWLB 4YP9A 3RVNA 5HQJA 2VUHB 4MCTA 2HSGA 3N75A 1M5UA 2KZ8A 3G5GA 1E6KA 3KCNA 3M9WA 1LQCA 3M6MD 2BJCA 2R63A 2PL1A 3E61A 3T95A 4E7PA 5CNIA 3JPYA 1NXVA 1RNLA 1RIOA 4M88A 3SNKA 2NZVG 4RK1A 3GBVA 5C5CA 3KLNA 3O2SB 2QVGA 3EAFA 1ZDMA 4LRQA 4B09A 3HXMA 2FMFA 1AB5A 5TQ0A 3RVRA 2LIVA 5DCLA 3W9SA 3GYBA 1R69A 4P98A 2LCVA 1OSLA 3ZKCA 1D4ZA 2WY2D 3CZCA 4MQEB 1SXIA 2IDMA 1PRUA 1BDHA 2FN9A 2IYNA 2PJUA 3ROTA 1MB3A 2L49A 2WIUB 1LBIA 3OQMA 4XAQA 3LKVA 3RVOA 5JNSA 1E2BA 2AXUA 2L19A 3LOPA 1YK0A 5KC9A 3HUUA 2EWTA 2B4AA 3M9XA 3N0WA 3CU5A 4UHKA 4Z5HA 3CS3A 3JVDA 3RH0A 3JTEA 1SRRA 4LX8A 3ILHA 4IILA 2XJ3A 3Q41A 1Z16A 1JDNA 2RJNA 1E3OC 3SAJA 3KJXA 3SY8A 4EVRA 5FWXB 2FN8A 3QLUC 4YR7A 2D5VA 2AYXA 3MIZA 3I42A 4HYEA 4KPYA 3B7HA 2H3HA 3CHYA 1DC8A 4ZMRA 2A9OA 4MR7A 3F6PA 1BDJA 5ED4A 3R0JA 1NY5A 1F4VA 2PUFA 1PNRA 3I45A 2H0AA 4JP1A 4LDZA 3QK7A 1ZZ9A 2ICPA 2E4WA 4E7OA 2KPJA 5JNTA 1UTXA 1DBQA 3EGCA 4N47A 5HM6A 3CZ5A 4N41A 2QU7A 1YK1A 2OQRA 1E6LA 4Q7EA 2PUBA 2JCGA 4S05A 1SQ8A 4X4CA 1P6QA 3TRBA 3HV2A 2QZJA 3RVJA 5BQ3A 5D2CA 2F8SA 4YG7B 1JHZA 3IP5A 3KS9A 4G97A 3KSMA 4Z4GA 4X4DA 2JVJA 4JAVC 1DP4A 3ZHIA 1XHFA 4KZKA 3OMTA 1NXPA 4ZMSA 5EWLA 4Z58A 5IUNC 3ILYA 1GUDA 4O1IA 3TO5A 2L8NA 5CHYA 2QW1A 1ZGGA 1PNTA 6CHYA 2NUBA 3TX6A 5HSGA 1DG9A 2VUIB 4EGSA 2HJ9A 2E4YA 2LYLA 4MS4B 4PICA 4DN6A 4KFCA 4YBAA 3Q7SA 2ZWMA 4MS3B 4IVZA 3D02A 3Q9SA 2Q5CA 1WIZA 2P9HA 3H5OA 3HDVA 3C3WA 1M2EA 1C4WA 2MSKA 3LUCA 2CD7A 2FLWA 1D2AA 3C6QA 4Z0NA 4X4GA 5BR1A 5IUKC 1ABFA 2FEPA 4KK4A 3KZ3A 4RXUA 1Z18A 1LJLA 2XCJA 3IPAA 3KKEA 3NHMA 4KK3A 4MQEA 4WXMA 4DQDA 4ML3A 1ZN2A 1VPWA 3KG2A 1JYFA 4WWHA 1CHNA 2PIJA 1PEYA 3FFTA 4PYRA 4G0MA 1PEAA 3RVMA 4Z4FA 4MR9B 1FSPA 5BRAA 4N03A 2RGYA 3D8UA 4OLAA 1P2FA 3FMVA 3UKJA 4Z59A 4NDWA 2FQWA 3SG0A 1M5TA 1PHRA 2WJAA 1SXGA 2RDMA 1OXKB 3RVPA 2O49A 4EVQA 5B3JC 1DC7A 2E4XA 5FWXA 1LK0A 1DBPA 4CBVA 2H8RA 1ZZ7A 2CSFA 3G1WA 3CLKA 4RU1A 4FE4A 4RXTA 3SM9A 1DRKA 3H5IA 4G0XA 1ABEA 1XWWA 3TMYA 4O1HA 3L6UA 1NERA 2FMKA 3BS3A 4GPAA 1TVMA 2JVKA 5EWMB 2QV0A 2HQRA 1YS7A 2PKXA 3O2JA 1ZHHA 4H3HB 3CG4A 1AU7A 1FFGA 2B5AA 2P4UA 3OM0A 1Y9QA 2X7XA 3GT7A 3IP7A 3UFDA 3N0RA 4KVFA 5IULC 3IPCA 3F51A 4EYQA 3O74A 3LMKA 3CKMA 2IPAB 3N53A 2HQOA 1YTUA 5CNJA 2J48A 3TB6A 1ZH2A 2L18A 4RK0A 1DRJA 1RZRD 3MM4A 4MYRA 3CECA 2JBAB 2XIUA 4W5QA 1USGA 2EBYA 1F51E 1QQAA 4MQFB 2ICTA 5TQ2B 2GWRA 3KYIB 5DGCA 2BNOA 3HO1A 1JL3A 2FMHA 5A7LA 3N8IA 4WT7A 2FJRA 2PUAA 4F06A 5KQPA 4NCBA 5KI6A 2JVLA 1PRVA 4IMIB 4HNSA 4TMYA 4I6TA 1ZAYA 1RXIA 4MS4A 1Z2DA 4PE5B 4Z4HA 1ZY2A 1B00A 3FDFA 4MS3A 1DW9A 5GOTA 3OQNA 2E4UA 4XASA 3DGFC 1HEYA 1QQBA 3JS5A 4PEVA 2IOYA 4RSMA 5CNMA 4O8BA 2XDYA 3A3KA 3L49A 5E3JA 3KLOA 4N0QA 1ZESA 3VNBA 1Z12A 4Z9AA 1JX6A 3QF3A 3DNVB 3HM9A 3JPWA 1Z26A 2N9UA 4Q6WA 3JVIA 4Z4EA 1YVUA 2FMIA 2AUWA 4MR9A 4RK6A 2HINA 2F8TA 5K98B 2CWDA 4X4HA 4RY0A 2W42A 2GBPA 2MYNA 4MR8B 4QICA 4RKQA 2PPXA 1U8TA 2A9PA 2NT4A 2RJOA 4YGXB 3HUTA 4XLTA 3GL9A 1M2FA 4TLLB 3I5AA 4MRMB 4IRXA 5TPZD 4YV7A 2KEIA 2OENG 4LE0A 4WXEA 2EF8A 4YG1A 2GRMA 1NTRA 1W9HA 4JASB 4PZ0A 4YS6A 2AW6A 3LUKA 4O5AA 1BAPA 3H1GA 1U2QA 3NNNA 3OQOA 3QLUA 4Z4IA 1JYEA 2MYUA 3A0UA 1BDIA 2M98A 3I09A 2VK2A 4EYKA 4G0PA 1RPJA 3EULA 4W5TA 5GQSA 2GZUA 2IU7A 2LP4Y 1RZRA 1QPZA 2LYPA 1VRVA 4L85A 3ROFA 2CHEA 5JS2A 3QLTA 1L1MA 2B1JA 2CROA 1W25A 5IUJC 1A0OA 4P1ZA 3R1FA 1Z17A 3O9XA 2FXIA 5TPWB 1QP7A 5FWYB 1Y7YA 3FYAA 2O20A 2GKGA 4N0PA 3HZIB 1JLKA 4JQDA 1P6UA 1JFTA 2JBAA 3H5VA 1BVHA 4KNYA 1X57A 2LUOA 4DADA 1JF8A 2R25B 4YLEA 1SD5A 5TQ2A 2NT3A 3KXAA 2IVBA 3T8YA 4YG4A 3BD1A 2IKSA 3OM1A 4I8TA 3EDCA 4QPJC 1EWKA 3VK0A 3K9CA 2V0NA 1CQTA 5F64A 2WRZA 3C97A 1Y1LA 4LE1A 4PU8A 2MYTA 3MQ4A 3TD9A 3IP9A 4UHJA 4YWHA 9ABPA 1VLZA 2ID7A 5FBHA 1NXOA 4OG2A 2KEJA 3P9YA 3F6CA
chains in the Genus database with same CATH superfamily
3W9BA 4RIHA 3QELB 1XLTA 3PU6A 3QPCA 4R1PA 1RYHA 4UCFA 3SGLA 4RGVA 4WXRA 2HHHB 1MC1A 4PZPA 4KI7A 1ZVVA 4X8OA 3HP7A 2RH4A 5CBKA 1SKBA 2PLNA 5GGYA 4AC9A 5HZKA 2ETVA 3GMIA 1DLJA 1RYZA 1H93A 2ZIXA 3LC7O 4LJKA 1Q14A 4NFYA 5DX1A 4DCTA 1N6HA 3QXGA 4OTZA 1EB8A 2IHBA 3G2JA 1E1NA 1WS6A 5CMLA 3RVSA 5JEDA 1ZKMA 1QVZA 5K3OA 3P9QA 3AW9A 1GHTA 3KQVA 4IRUB 4JV5B 3OT5A 1VG0B 1DWQA 1V1MB 4TQAA 3DGEC 3C5CA 1MQAA 5JD4A 1Z4QA 3H97A 4UNIA 2BSXA 3G5MA 1KJIA 3G7UA 4JOSA 4JUAA 4BLSA 4F6RB 1Y3HA 2GBLA 1O1YA 3V8MA 2W2KB 5TXGA 1M76A 4G25A 3RK0A 3BJMA 1S2GA 1WDKA 3VNAA 2X40A 4MVXA 1AZLA 1N2GA 1WABA 1B16A 2B78A 3PK0A 3HUDA 3OFKA 4K8RB 1BD4A 1LPOA 5CT5A 1N75A 1HMYA 1V2HE 4WMLA 4JVSB 4F8DA 1WOYA 3R75A 2E82A 3GUHA 1UOEA 1Z4NA 4B3XA 4ACBA 4Y6QA 4PLWA 4KCGA 4IHAA 5C34B 5SY6A 5E2IA 1IBKB 2EIHA 2ORVA 1X70A 1CR2A 3T35A 1SA0B 5L6LB 3PUYA 1X7GA 1LCCA 4A73A 3MGAA 4IHKA 3T1HB 1QG0A 3ML1A 3VO1A 1RS0A 3N8NA 4Q3KA 4XXHA 4CGZA 2FMXA 2OECA 5FI3A 4HT3B 1N77A 2I2AA 1TCAA 2FEMA 2IZ0A 2ZT8A 1QVRA 2IXDA 1S02A 3RC1A 4RLFA 3SYTA 3RSOA 1VRCA 2C2YA 3V3TA 4EKDA 3OBIA 4ZGWA 1GTZA 2F43B 3EQZA 1XQXA 5KTKA 4J1NA 1ADRA 5CD1A 2X22A 4MV1A 1QIFA 1O95A 5BN5B 3TFOA 4LAFA 4EWLA 5BSEA 1J33A 5F4ZA 3IKMB 2Q27A 4DQLA 1R8QA 1N34B 3L01A 3R0ZA 3CF2A 2P6UA 5DHUA 5F7ZA 4YP7A 2IU3A 1Q7GA 4PTLA 5FI5A 5DNWA 4BEVA 3G2HA 4B3SB 5AK6A 4Q3OA 4Z2AA 1LVHA 1V0JA 1DEXA 4LXGA 2I6UA 2X7JA 3TECE 2JFUA 3VHXA 4KR2A 4BVHA 4M1QA 3EPJA 4ZTUB 1MENA 2BGTA 3KKOA 1W30A 1F8YA 1W44A 4L8LA 5HJ5A 5LWHA 4AQYB 4GQMA 4Z1MD 3VGPA 5K7SA 2X5KO 4AJNA 4BASA 2QLJA 1JIXA 3DLCA 1YWGO 2DWPA 3W34A 1PDVA 4GI3A 1NBMD 1H9CA 1QH9A 2K5UA 3KQWA 4KR6A 3PENA 4QYSA 3P5BA 1L2TA 2GNPA 1C9EA 1LTKA 1HLPA 3HU1A 5H70A 4CTKA 4X4FA 4P4LA 3C15C 1XRRA 3EXHB 3OU2A 4W9NC 1MNQA 4ZOEA 4N7RA 3NV9A 3ZHBA 1KO8A 5TEVA 1DADA 1UMCB 3IAM6 3OZWA 1IAQA 1UWCA 3AKCA 3I1YA 1EHCA 4BX0A 2YHIB 2FSUA 4LHWA 2BV3A 1L8LA 5DI3A 1IYZA 3OLCX 1XHEA 2VAMA 3I3SR 3ZW7A 3OZRA 4OJYA 2FV8A 2Q1YA 5DCYA 4TL6A 2Q9AA 3WFIA 3RFTA 5J5CA 2IEZA 4P7JA 2CDBA 1S2OA 1YZKA 2AN9A 4PCUA 1WXFA 4MGKR 4CODB 1LLIA 3PNPA 3ND6A 4LXTA 1DZ3A 2WFLB 2JGJA 4QTTB 1CB7A 3UH0A 2ERXA 4AMBA 4C22A 4XE5A 2UUOA 3HB7A 3WJ7A 2R6AA 4EATA 1W8DA 5E38A 1PG2A 2J3HA 3PFGA 2NM0A 2QDKA 1XZPA 5K3SA 3X2FA 2IHKA 2VP2A 3KQOA 1QO0D 3CWCA 3ESBA 4JDUA 5EOVA 2DFVA 2FKNA 3H9UA 3TD6A 5IKXA 4L8YA 4KNVA 1D1PA 1YR1A 2IWRA 1KEEB 1NMQA 3DMHA 5E7IA 1B0NA 4N76A 2AXNA 4FYVA 2VT3A 2ZJOA 4B3TB 1DAMA 1OLXA 2EGGA 3W9UA 2W98A 3OJFA 4D42A 1M8PA 1Y5NA 5IC4A 3IAHA 1NZDA 1RPEL 2Q9UA 3C3KA 1DIGA 3H9CA 3OQ1A 3R0QA 2A9QA 2CNWA 1AKMA 4B0OA 4QRDA 1GKUB 5J40A 3FSGA 1ZU4A 3ROMA 1PCXA 1OLSA 2E4ZA 2I1LA 3DL7A 1NJGA 4E5DA 5K0NA 2OV6A 4MGYR 4RPIA 3B1ZA 3BULA 3AP1A 4RESA 1D6NA 1E9EA 1KDVA 1XCPA 3AB7A 2F8MA 1JIUA 1KBZA 1SXHA 5HIMA 1W0KA 1KYQA 5IKOA 3S2GA 1MRNA 3IIMA 4FN5A 3IAAA 1DX9A 3AFGA 3COJA 3ND7A 1M34A 3CUTA 4MHTA 1ZA1A 3WAGA 1PYGA 4XWGA 5DHFA 4DTIA 2PUGA 3VC7A 3T9FA 3HBNA 2NADA 3DVLA 5BXYA 3SVLA 5SYMA 4D8TA 2V1XA 9ATCA 5DBFA 3NEPX 1X1AA 2JIRA 4ZQIA 5IBQA 2OB2A 1JSCA 4MOWA 3AC0A 4DMHA 1FUKA 4C06A 3HR7A 2AR7A 1YCDA 2GX6A 2NTVA 1YJQA 1CZNA 3D6UA 3ON5A 3DBIA 4MJLA 2ZIWB 4MUFA 4EFMA 1GLNA 1E7MA 4Y18A 4CQMB 1H6AA 3LH5A 4P83A 3DDNA 1CY6A 4BMSA 4A8TA 3C3MA 3V1LA 1FDWA 3DZBA 1KZGB 1C30A 1TT5B 4JNKA 2DBRA 3IV9A 4L4XA 3OOJA 5EZSA 1KBQA 4B5KA 3GI1A 5GADl 3KYDB 2IHVA 3MELA 2NUPA 1WUJS 1XQYA 5LN1A 4BMOB 2V7QA 4S1OA 3R5KA 4YP5A 4YR9A 1VKNA 3IUQA 4OUDA 5JAHA 3P2EA 6REQB 4RHYA 5DVZA 4HZUB 2X76A 5AM2A 1TQ2A 4Z99A 4FWBA 3T9AA 2OHXA 3O9MA 4PPGA 3CR3C 5AOAA 2O0KA 5CLHA 4A36A 3AM4A 3R44A 3SXPA 4JXXA 3PSHA 2EBUA 3B2NA 3HKEA 4N3CA 3R8XA 4RBNA 5A3QA 3UJPA 5KYWB 3OCVA 2GO1A 3OF3A 3ZCTA 2BF4A 1FFSA 2G3YA 3EZYA 1ZHFA 1VJTA 2JAXA 3OX1A 1SKUA 3OZAA 1PJCA 4BX8A 1AKQA 1WSWA 2C2WA 2YICA 3BL8A 1SY7A 4R2KA 4O33A 1K5PA 1XTBA 5A6SA 3V4VB 1TRKA 4Y2GA 3F5MA 2IX3A 1G8PA 1HTBA 1NUSA 3L8CA 4DBLC 4OHCA 4DGQA 4P08A 2PANA 1GTSA 3THYB 3PRHA 2ODWA 4YJ2B 4DUGD 2R63A 2XRFA 4YCNA 3KM0A 3A06A 4EI7A 4CIAA 3CLRC 2NUAA 1QQ6A 4FWIB 4E7PA 1RWXA 1USVA 1PJLA 1X3LA 2VYFA 3AUSA 3OSZA 5E6RA 2MT9A 2J08A 2OQVA 4HMPA 4E6EA 3WQQA 3D3WA 3T0FA 3RVRA 1SEVA 4QA9A 4DANA 1BC5A 3BXHA 4ROSA 5SZKB 1D0IA 3HR8A 3GYBA 2JGRA 3ECSA 5HWSA 3O4JA 2JFPA 1AY0A 5CVVA 1W6RA 821PA 1P9LA 4RMIA 4ZAYA 1SN7A 2ERCA 1WV1A 2W2LA 4NXMB 3NTOA 1WXWA 1ZMTA 2POQX 3LOPA 1YZVA 1Z7GA 4GUAA 5FBWB 4C0QC 3TQOA 2GUWA 2QR2A 2EWTA 4ZCSA 3RHFA 5BWNA 1W0JD 4HGOA 3GCWA 1XQWA 4PPQA 3LXXA 1A98A 3R3SA 4XA8A 3HXTA 3LIIA 1Q0RA 5CW2A 3ILHA 3HWSA 2DULA 4TV9F 3RV3A 2BFBA 3KJXA 1FPMA 2B1IA 2EHJA 2GOYA 2IBMA 2WA1A 3AJ8A 1X3SA 4H7KA 3R76A 5I8WA 3R7WA 1EJ6A 3OESA 5KUTA 2UVQA 5M2QA 3JQ9C 1OA0A 4HMOA 5J5AA 3CX3A 3A6PC 1BH6A 2G25A 3BWYA 3CLSD 3U4IA 3ESYA 4MRAA 4X3PA 1DBIA 1UBOS 2CNBA 1JG1A 3F7TA 3RKSA 2CVQA 2PXBA 3WL5A 1H3NA 4JEHA 2QT9A 4FJ1A 3K4PA 4HNAB 3EISA 3BK7A 4W82A 4EHLA 4GM0A 2MINB 3PT9A 4KRYA 5DWQA 4X4CA 5CFMA 4S12A 3O9VA 3PNSA 3SJUA 3DE6X 3IXMA 3AOGA 2PWBA 1R6UA 4IPTA 4RLQA 3VYTB 1E0JA 2GRJA 5DGHA 4QO8A 1T2FA 2BHTA 1A88A 1WA5A 2QI9F 3ES9A 3GOHA 4MIOA 4XI9A 4C6TA 4ETNA 1FMCA 3UVEA 1T9HA 5TMEA 1T1RA 4ZN6A 4L5AA 1M8FA 4V1CB 2WNSA 1SU6A 2ZANA 4FHEA 5BVGB 2F9FA 1GL3A 1W85B 1HOTA 1JQLB 1ZEMA 1EVJA 2JC3A 1IQPA 1KE2A 3GXBA 1T6YA 4QGFA 2O2DA 1X42A 2EJWA 1T10A 2EATA 2VF4X 2DOKA 3RTGA 5FV7A 2VEOA 1Y8RB 3P52A 2A67A 4HJXA 3HDVA 2ZRBA 1OXMA 3Q4GA 3KZNA 3UAWA 1D7OA 1OYYA 2HRQA 1OLOA 2FLWA 2OCXA 2ONKA 2X23A 3IT3A 4GM4A 1KJ9A 1QHXA 1UBSB 2HSWA 1V5GA 4M1OA 4GI7A 2X4LA 1R0WA 3RS7A 3VO8A 3KZ3A 1I4DD 4BATA 5EJEA 5ICCA 2V4MA 3T5AA 3NOOA 4DRXB 2WOOA 1QHGA 3C8MA 1VPWA 2KE5A 2GYWA 4DCMA 5IP5A 5AM4A 2OD9A 4KIWA 4LVUA 1XZHA 5JSYA 2BKVA 2A9VA 1DO8A 2IUEA 2P65A 4PIVA 5TT0A 3VSBA 1KDOA 4WLOA 4ARUA 4BO4A 1CEEA 1FEZA 3G88A 4H7JA 1KHHA 1W8IA 1BQ4A 3P2JA 3WK8A 1NI4B 4UZFA 1O4WA 2WF5A 2P3LA 3GRYA 4PG5A 1D07A 4V0RA 3D4LA 2DHQA 2WTUA 3D54D 4Q9IA 1SHUX 4ITVA 4PLYA 4QQ8A 4LC9A 1F1BA 1I7QB 2NTYC 4ZVSA 1F12A 5DTQA 1HETA 2BIFA 3UMBA 2PZ8A 4CKYA 2FF7A 3TWOA 2XECA 2FG5A 1U0LA 3EZLA 2BN4A 3G82C 4H3HB 1QPGA 3VZPA 1P1KA 1V5IA 2BUAA 2OFWA 3LP6A 4GX1A 4YEDA 1G4AE 3RF7A 5GIPE 1Q1EA 4RPKA 1ZOIA 4UXJA 5IH3A 5T4HA 3TQTA 4WINA 4B75A 3DOHA 4CW7A 1QF9A 3CUSA 3FPKA 2D2FA 3MQFA 4ZU6X 4M4SA 4RZ3A 3NJ8A 2HB6A 2FPMA 3A32A 3A6ZA 4M83A 5LOVF 4A8JB 2ZUDA 1RXCA 4NMWA 4DR5B 1LPPA 3Q88A 3B89A 1ZQ1A 4M37A 3N1UA 3LHDA 4IMPA 5ALHA 1ZM3A 5TT1A 4A2CA 3Q7IA 3ZHCA 1T1GA 3LX4A 4XUEA 3V1TC 5KQPA 1UINA 2O23A 3ADCA 4BWFB 2OAP1 3USZA 3ZOZA 4I5FA 5BORA 1E9DA 3EZGA 3MJHA 3D6HA 1QH1A 2C4VA 2HHCA 4BWYA 1K7FB 5ALGA 1ULUA 5GZ1A 3L0CA 2A0FA 1GXSB 3MMXA 2O59A 2BGIA 1KO1A 3MCZA 4TUYA 3TQCA 2RKWA 4CCSA 1GUFA 3QTLA 3QVUA 3NFYA 1JLLA 4ZT6A 2JAPA 2FUKA 1ZESA 4M36A 4MKRA 4XW2A 2H3EA 4X1IB 4Q1CA 5ERYA 5EHGA 5FR2A 4KL8S 3UAYA 3RUAA 5CUQA 5AJHA 4DLRA 1QG6A 1RI4A 2R66A 1YOBA 4HGPA 4QSMA 2Z08A 2VRBA 1HDZA 1TZ2A 2CXRA 1SK9A 4LFCB 1NVBA 4CV1A 4RE6A 3K9QO 2UYGA 2YYZA 2CYBA 4WLNA 1BDMA 1FLDA 1W1WA 1IHPA 1ZPDA 2GBPA 3PXXA 1E0SA 1JEOA 3QYAA 1ZUHA 1TYAE 1X15A 4E5MA 4DKJA 2A9PA 2W6IA 4Q66C 1KO4A 1L7OA 5AM1A 4DE5A 5K8IA 1SCAA 3VC2A 1KJYA 3QY0A 2D7DA 1SQGA 1W5FA 4EDHA 1W96A 3FR7A 3H87A 4EPWA 2VQ6A 4BNMA 2V7XA 2WJGA 4I5IA 1W9HA 5ALYA 1GZVA 2OHFA 4MMXB 1Z3CA 5ALWA 2VP3A 3QLUA 1R2QA 4JT9A 1B23P 1XMSA 3FPCA 3PNQA 1QFSA 1VYUA 1IDOA 1HX7A 1RPJA 2AD1A 4H1VA 3S5JA 4N7MA 3UBMA 3SE7A 1VRVA 3ZZUA 1DFIA 2Q62A 5B7GA 4JJ6A 5BSKA 3EC2A 4RF4A 1EIWA 4RPCA 4RPLA 1F8XA 2ESRA 4ZCIA 4RTJA 1L5QA 2ZB3A 1H2FA 2A1UA 1I3KA 2G09A 4MICA 3W0LB 4F84A 1ORWA 3QPBA 3H65A 5ER6A 1YE8A 1T2VA 1MC4A 1QGZA 3CVJA 1PFGA 4GIBA 3ZCVA 1X39A 3CRMA 4HDQB 3PUWA 3MS4A 3RWMB 5LXTA 3JQQA 3NHPA 1SD5A 5TQ2A 1ZL0A 4UAUA 2WSLA 3RAGA 2IVBA 2XT6A 4LSWA 5A5FA 3T8YA 2CSUA 2IKSA 2JFOA 4PQFA 3SE0A 1MPXA 2AYYA 1Q6YA 1GPH1 4LE1A 2OXTA 3RSSA 3LL4A 4HAVA 5DYWA 2P9BA 2W2MA 4GW3A 2PXLA 1HQ1A 5EIHA 3REOA 2VZ9A 2Y0EA 4I2NA 1KYIA 1KE1A 3PFWO 3T7IA 1WRBA 2ORYA 1YR3A 2V7TA 2EG5A 5DHPA 4DIUA 2C7OA 3AUUA 3NDIA 4G67A 3DQQA 2X9NA 2VIIA 3CTPA 3H0CA 3HL4A 4ND6A 3FNEA 4HNTA 2YVKA 5C9ZA 3ENQA 1G8SA 1IQRA 5LMZA 4OHMA 3OKPA 2Q9BA 4N5LA 1V1JA 1Z6AA 1RRFA 3EXHC 4X7PA 3B9PA 5F23A 1ZR4A 2H18A 2HXYA 3OEWA 1O0CA 3F96A 1NATA 3S0JA 4Q03A 1WETA 2LNDA 3E3MA 1CJBA 3HO6A 3KJIA 3LOQA 4TRRA 1NR7A 3FNQA 3BWCA 1AGPA 4WLFA 5KNBH 4AZWA 1Z0AA 5IM4A 1E7YA 3RJ9A 4EZBA 2R11A 3LUAA 3WMEA 4JCYA 5JFOA 2AFIB 2WUFA 3Q2KA 4IXNA 1BCSB 1ORTA 1XK7A 5LKRA 1RC8A 3OZFA 3P4XA 3BXOA 3K0AA 4M9QA 5BNZA 1HE5A 3IPRA 1AF7A 2LWIA 2XMRA 3DONA 4KR0A 4LZPA 2PXQA 1O9HA 2JIPA 3TAHA 3U4AA 4G9GA 4IIVA 4LKOA 2C9OA 4QASA 5K3AA 4CUZA 4JLUA 4KR9A 1ZH0A 5AK0A 1C2TA 3WLTA 4HFJA 1I2CA 4EHJA 3AUJB 2JLWA 1C9KA 4DSNA 3UA4A 2NO1A 1AK1A 3T3NA 2OD7A 1EHYA 2NYUA 3KAJA 2YRXA 3GMTA 4DYDA 4JKOA 5F33A 6AT1A 3ISJA 5DXAA 1IHDA 2EBWA 3PA8A 2O57A 2OPBA 3ZWPA 2EQAA 4F5EA 2OCAA 2QX8A 4ERXA 1S8AA 2P2DA 3AF5A 1Z75A 4RELA 2WMDA 5FH9A 4KE7A 3GRUA 5KWJA 5EJMA 2X3FA 2ZRFA 4X1OA 4H4EA 2FSGA 3H99A 5JXHA 3HVIA 5DHSA 3FZNA 3IELA 2KYRA 5C51B 3FMFA 1Z63A 3WADA 4DLNA 2WQ6A 4BUCA 1JXAA 3DZKA 3DQPA 2ZJ3A 4R54A 1ZAKA 1HSOA 2DU8A 2OZKA 3D0RA 4FJ0A 3RHTA 4DLWA 5KDDA 2GZRA 3KKZA 3L6CA 4FBIA 3OTQA 3G2OA 3SQOA 3TLYA 3LKBA 2FCAA 3OAAA 1NSYA 3RVQA 1K7YA 1CJGA 1OLSB 5JYCA 4ALJA 2HLDD 1OBHA 5EMJA 1W4RA 4KPGA 1DIBA 1K3TA 1FA9A 3LSYA 4OATA 1ZJ5A 1XTTA 5BOVA 2Y4NA 3W8EA 4F96A 2L0XA 3K0EA 3KUKA 3O93A 4B73A 4DCUA 4QYWA 2GTHA 5CX4A 5F3RA 2VCEA 2J8ZA 3C0KA 4MCJA 5BSWA 5SZHB 2BAGA 2QJWA 1M34B 5BO5A 1GT0C 1DCFA 4J3FA 4D80A 3HLTA 1D5WA 2A6PA 2QTZA 2YZGA 3OLYA 5AVOA 2PMEA 5T3YA 1Q1QA 4URFA 2PZEA 2WIJA 4YPVA 1SC6A 1L3IA 3G85A 2HRZA 3PJDA 4OHFA 2HADA 2YV2A 3LT0A 2IS4A 4ZC8A 2HL6A 1YI8A 2XZPA 3VUEA 2E4VA 2SICE 3KCQA 2JIOA 3LVQE 3MMZA 1SMKA 4FDTA 5BMOA 4V39A 1WW8A 3K35A 4FC7A 1U3CA 4KOAA 1FUYB 5AJZA 4DBVO 3T34A 2GCGA 3T4PA 3FI9A 4P7FA 4IGAA 1SQ0A 1C30B 2I7TA 3K1ZA 3RE1A 4HFNA 3T3DA 3H6HA 2ISSD 5IG2A 2BBOA 3I12A 2NUPB 4RJKA 2B20A 4TLBA 5COAA 3RU3A 3SBDA 5ADUS 3VH1A 2XTMA 3NDBB 1TVKA 5HIKA 2EV9A 5I5EA 4OUDB 3ASYA 5E1MA 4KVZA 3N2KA 4CMEA 4URWR 2XKKA 1Z7YA 5HGJA 1JN0A 3Q72A 5TGZA 3U37A 5JRDS 1LBHA 3C6XA 4F9TA 1EP1B 3DA8A 2V58A 2JCVA 3CX8A 2C84A 3HKEB 3NM4A 5IMSA 2PUEA 2LBPA 5ALDA 4LZLA 1OAOC 1YQUA 2FOIA 5JS1A 5T64A 2V7VA 3F1LA 2J9RA 3N8GA 3P71T 4FK8A 3VSAA 5BWMA 5B30A 3GRZA 4R1OA 3JD0A 4B8ZA 1VFNA 1IY8A 4A1FA 4J1XA 1RM5A 2NVUA 5A6SB 2QSZA 4ZJZA 4ZYZA 3WICA 4DWJA 1IXZA 4TMWA 3EJ6A 2CK3D 1VIDA 3OM8A 1FJXA 1RYMA 1YACA 1YL6A 2CYAA 1JBQA 2EFCB 4IWRA 1YASA 1MUUA 3NHJA 4Z3KA 3KQKA 3OZEA 5GAGi 1I3CA 4JWTA 1XWRA 1R0RE 4NBRA 4TMTA 3UT6A 3EFOB 5FT9A 2V5AA 4WUTA 3TRJA 4BN0A 3T06B 4MAAA 5E6RB 1YA8A 3DMGA 3KEFA 4K6OA 3I6BA 4F12A 2O4AA 2GBCA 3GT0A 5JCJD 4LPSA 4DY6A 4GS5A 4XIGS 3KC2A 2QAJA 1B15A 1F9AA 1T29A 5JAMA 2RONA 4QU5A 3DDCA 4NCAA 3JQBC 1PRAA 1ORDA 4IZIA 1RAFA 2VHUA 4LRXA 3ADPA 4D98A 2NVWA 4B3DA 4TTTS 3SZLA 1KFKB 1N9ZA 4WFQA 4ZVRA 3I9FA 4M1TA 3OIFA 3AESA 4OPMA 3L7AA 4NDNE 4C3OB 1ZPQA 3AF4A 3DMTA 4PHHA 3BBLA 3DEIA 3VU0A 2C1XA 4E15A 5K0EA 3AINA 3N76A 4RFVA 1O0BA 3K8ZA 4CTJA 2XUGA 3VKWA 2HA3A 4M9XA 1J56A 5EJ5A 5D7NA 4S1WA 1NXWA 3ACDA 3WGUA 5IYZA 2BFBB 1Z0DA 2ZSKA 5L3ZA 2QVZX 4ALLA 2BJHA 2V3VA 4BVBA 4KMMA 3R7WB 2KEKA 4AP9A 1TKCA 2D5AA 2GLTA 3IKLA 4HD8A 1T3HA 4RK5A 4Y0VA 3TN7A 3UMSA 1NP3A 1YFJA 5IDYA 3MWJA 4HS4A 2AMFA 16PKA 4NOKA 1D8TA 1JKJA 2PYIA 3EA4A 2ODEA 1I1OA 2W43A 1E77A 4WNAA 2BBSA 1PR4A 3DDWA 5TVGA 1A1VA 3NHLA 2R6JA 5G3ZA 3DCJA 5JOQA 3V9AA 3TUIC 1LDYA 4P8RA 4IOKA 4W5NA 2I2XB 3M6LA 2X77A 4GE3A 4MPRA 2FZWA 5FF9A 1CW2B 1Z33A 3RKUA 3QEMA 4D8YA 4BVGA 2CEKA 3NP9A 2XVMA 3CVVA 2FKAA 2GWHA 3KQQA 3PVZA 4D02A 2F55A 1FQKA 5CW1A 3WKDA 1KH2A 2HIMA 2Q7XA 3LUFA 1H8ED 4BKOA 2GTIA 5BPHA 4LZAA 4HWOA 3KT0A 4RIEA 1QKKA 2QX9A 4C6TB 4ER7A 1NRXA 2ADMA 3X1DA 2J5QA 4B34A 3ZIAA 1VA5A 1OWLA 4UJ3A 4MB2A 1XTVA 2I99A 4FMCB 1O9GA 4KFUA 4CEJA 1GV1A 2PRJA 2XB6A 2GEFA 1NJ5A 3QBDA 2GDJA 5DJ5A 1N6KA 4WKNA 5EUCA 3SBEA 5JUWA 5FUQA 4WUVA 5SY9A 4YUYA 1BKYA 1DAEA 3TELA 2ZYTX 4M88A 5C4IA 1DKOA 4DA8A 1KMMA 1ZDMA 2Z2IA 1R5BA 1QC5B 2JLBA 2P9FA 3G0IA 1LGYA 1TU4A 4MVJI 4XB1A 3P9RA 1EA7A 5HFNA 2YL2A 3ILVA 1VQ1A 3D5TA 4JB8A 4MV4A 2WZCA 1GGJA 2BR3A 3DW3X 2XF2A 1ZGBA 4JBNA 5DN9A 4AJIA 5A4FS 1XZGA 5AJVB 2AOTA 4X94A 1R5JA 1KAGA 2D5CA 4NYJR 4D4JA 5J4YA 3WC4A 1CR4A 2W4QA 4MCAA 4IIFA 4FGJA 4KXFB 3MERA 3RRFA 4CIVA 3IQIX 4N5NA 4MV6A 3SAJA 4IEIA 1ZNQO 4IF6A 3C6YA 5F12A 3AY7A 5B12A 2PFKA 2RHGB 1JE0A 2EKLA 3R6DA 4OJQA 3EIOA 3GFRA 3R1IA 4PAOA 4CCYB 4E09A 3HJBA 4AQ7A 4YR7A 4JI2B 3KKQA 4LXUA 4H35A 3ZHXA 4UZSA 1OI2A 1ZH6A 3QV1A 4C88A 2C2GA 3C74A 4U7TB 1CZHA 3UMVA 4A0SA 1GQFA 3KOZA 5J63A 4EW1A 4I9UA 3JD4A 2PGJA 1EE1A 1ISFA 1B8UA 1YDWA 4DJFC 1GQ2A 1DTWA 3JAKA 4NU6A 4YVFA 2G71A 2W22A 3BZWA 3CZ5A 3B5EA 1BD3A 1BGWA 1P7YA 2G9VA 2OQRA 4AG6A 4BE9A 2OM6A 3ESAA 4FCTA 3PC7A 5LSAA 3RRNA 2VSYA 1XZEA 4XDZA 3TB4A 4S05A 3BWVA 3UAZA 3A14A 3PWZA 3TCKA 3AVTA 4OEHA 2AKYA 4PQEA 5E9JA 3RWOA 5HQ3A 1VMAA 5AJTA 5IT5A 4UNPA 4I8XA 1U3UA 4GOOD 3C3EA 4DHEA 1IPEA 1E1QD 4L16A 3E8SA 1XCOA 1ZC3A 3EOBI 4ZXPA 3GF4A 1X94A 2AX3A 1HNNA 4E2YA 2RAUA 5IUNC 2G0TA 4E1BA 1NC3A 4FD2A 1YDEA 3PZBA 4MK4A 4H7EA 4HDAA 5HSGA 2Y27A 4FNGA 1XLTC 1EVKA 4Z9YA 4GMKA 5J4LA 1OB2A 2E4YA 3D6FA 2B2XA 3VX3A 3VSDA 4O5AA 3KPUA 4UULA 3GH3A 3OJLA 5DLYA 1SUEA 2Q5JA 4NYJQ 3O8CA 1K92A 3D9QX 1FRZA 3AIOA 4UMDA 1PV4A 4X4GA 3GP8A 2B5OA 1YJCA 2G1AA 1A3CA 2HHJA 2WWXA 3CH7A 4ZVKA 1E89A 2HM7A 4PQGA 5AKHA 1I94B 3IQGX 2FVXA 3FW1A 5F51A 1PD1A 3JWJA 1V8BA 2D0OB 3CRRA 4PIMA 4MDEA 1EX1A 4G0MA 4S1NA 5AKIA 3SKYA 3FKQA 1OXSC 1Q7EA 3D8UA 5KJ6A 5JRZA 1Y7IA 5DNCA 2GBLC 1FPQA 4Z59A 4JI3B 2A94A 4AJ9A 5CDYA 2WJAA 1SOMA 3SMQA 2X19A 2CJPA 4E4RA 1E66A 3MZ0A 3TLGB 1N9KA 3LCCA 2ZE8A 4Y0AA 1D03A 2REXB 3NM6B 3L2OB 3GP3A 2D6FA 3HABA 5EPUA 1TJ3A 1K6EA 3WRXA 3PTZA 4Q47A 1W88A 4OU5A 5CM8B 3VM6A 2WOJA 3HCBA 1J24A 4PLTA 1ZJWA 3N5KA 2XOKA 4K9KA 2HQRA 1NUTA 3O2JA 3TOCA 4D8VA 2P4UA 5LQRA 3FPAA 1Z5VA 10MHA 3I1JA 1M0WA 3UFDA 4KVFA 1EK1A 1SUBA 3EUAA 1OW3B 2P90A 4ZGBA 1FYEA 3THXB 1TMKA 1OWOA 2D00A 2D54A 2C94A 1M6WA 1ONSA 4NU8X 4MW7A 1CS0B 3RDPA 3FWKA 3ZBUA 4G26A 3K7EA 1O95C 2ZYAA 4TWBA 1M74A 4MQFB 2ICTA 2QZPA 2ZJYA 3QE0A 4X92A 1CIVA 4P2GA 5TQ2B 1PT5A 3D59A 3WGNA 1YKSA 3ZX5A 3DAFA 2F7SA 1C8VB 2WAYA 3B7PA 3N6XA 4ZDWA 1XDWA 3PQ3A 1FF9A 3I76A 5L3VA 1GM5A 2VT6A 2NXCA 5KI6A 2JVLA 3I4CA 2VKQA 2A78A 5K03A 1TUIA 4PE5B 3KR2A 2XZDA 1A9YA 3GRRA 1Z2OX 2EWVA 4QQKA 2BRUA 5AHRA 2DP4E 2DMRA 5EXPA 3TLAA 3L02A 4Q37A 2FWNA 3IOYA 1NGSA 5TF4A 1SKAA 4N7BA 4PGGA 2VYND 3IB6A 1H0RA 3A1NA 4L3WA 2CBZA 3A3KA 4HDRA 3NROA 1UJMA 1U81A 3K9LA 1H9BA 4PWYA 4TXJA 4G8CA 1MG5A 3QF3A 1L7MA 4MHOA 3BB4A 4N8EA 1CNFA 4ARAA 3ABRB 4M7OA 2GSDA 4EB8A 1C3LA 4J0DA 3DB2A 3D3KA 3V7YA 4ASUA 1I2MA 1NVKA 1JDTA 1OC2A 1ONPA 1OH7A 3GLGA 2X4GA 4AMYA 5LDGA 3I58A 4RABA 4KQKA 3WIEA 4BX9A 1Z37A 1A9QA 2VK1A 4TKMA 2W4IA 3HUTA 3KV1A 2IT1A 1NOIA 1WY5A 1PU2A 4FBMA 3R74A 4TLLB 4FBGA 4INOA 3F8WA 2Q7OE 2ZAGA 2Z8YM 2NU8B 1E3TA 4LE0A 5GZ6A 3S27A 3AONB 1T9KA 1JSZA 2OGUA 4HQKA 2YNMD 3K0AB 4RD0A 1TL7C 1A5AB 3G6KA 4NONA 1CXZA 5CJ2A 2E2WA 3VPHA 5JQGF 5CXQA 2R7KA 2QRPA 4TTJA 4KXQA 3NS7A 2JI8A 4JODA 3QA3E 2PYZA 4ZCMA 4J9VA 4WFJA 3ENWA 5ICGA 3DHYA 3R8FA 2X86A 4RACA 3ROFA 1JIQA 3ZLTA 5JADA 5H1YA 2HMSA 3ZJVA 3GJ3A 3R1FA 1M6YA 1MC8A 4E11A 3WYFA 1COWA 2A4MA 2O20A 3PXCX 3UJDA 4ZU1X 4HGNA 1UBKS 5E95A 1DKUA 3PUIA 2DWCA 4DZTA 3A9RA 2AK2A 2Q1WA 5DDIP 1Q83A 4LN1A 1N1DA 3CE9A 5DBIA 3H2YA 4EP1A 5JY1A 1R10A 2WU1A 3FKSA 3UH1A 3IAS1 3RUCA 5EHIA 4GZ6A 5FI0B 1R6XA 1UMKA 5IUKC 3CLHA 1WKVA 4Q19A 2PUTA 2VDJA 1XQVA 3HCNA 4R7TA 4N0EA 2CFIA 2RGAA 5AW5A 2C1EA 3K4QA 2XXQA 2KEJA 1BFUA 4C3VA 2QQEA 5F3DA 3U3DA 2C3MA 4XIFA 4UAVA 4RKYA 2NZXA 4Y3UA 4ITUA 3KTOA 4I9GA 3UXHA 3L6BA 4JBWA 4I1VA 4NHEA 3WQSB 4AULA 4HQRA 1NBMA 2R6ZA 3H2IA 4LRSB 3H2ZA 3BRSA 2A2ZA 4CG3A 3G7DA 1X13A 2BGNA 1TO2E 2W2VA 1HT1E 3KSRA 1ACJA 3R5TA 3TG8A 3TL2A 5IASA 1JZSA 4H4CA 2C2BA 4CLDA 1EYZA 1R6AA 2EZ8A 3GEPA 3GLQA 1Z6TA 3IVCA 3P4UA 4MR8A 3W79A 3HCDA 1A72A 2Z83A 3P1JA 5TDHA 4HY3A 4E2ZA 4ER6A 4GG1A 3OMLA 4BNUA 1BGXT 1NF8A 3H9EO 3U4QB 3BHJA 1OIWA 3MGBA 3FE2A 3CRZA 4B84A 5FWAA 4LGCA 3GLGE 2NWQA 1QFZA 4MUHA 5FEUA 4QJ5A 2ZPTX 4A5SA 4GR9A 2YZ2A 3UC9A 1M1UA 1ISPA 4BQPA 3WKBA 3I01M 1P9NA 2E4AA 4BVEA 2RI0A 2RIRA 1IM8A 1C4XA 1N9GA 5EZ5A 1RMTA 3A4VA 3U2QA 1E8NA 1JGTA 1Y3AA 4RW0A 5JEEA 5KU7A 3AWDA 2EP8A 1O6BA 3I9NA 3EFBA 4U2GA 2I4MA 4NQZA 2GMWA 3N2KB 5IX8A 3ZW9A 4GBED 1CB0A 2Z3ZA 1EH5A 3VXKA 4C07A 2RK6A 2AXPA 4Y2RA 1Z82A 3DV9A 5ARDA 1CSEE 3B2EA 2VPWA 2NU9B 4V3BA 1JEDA 2HNKA 1H6BA 3HWX1 4GRAA 3WYCA 4DSZA 1HDYA 3R6WA 4O2AF 1Z8DA 1CUVA 1E1RA 2GJAA 3MSCA 1ID8A 4AN1A 1X38A 1WMBA 4I8IA 4ZTBA 1WQ3A 3W78A 5KWSA 1P4GA 5EAIA 1OLUA 4PSDA 3D4OA 2NVUB 3FOAA 4KU4A 4KZPA 1G4HA 3TFQA 3K70D 2NO0A 2OHJA 1YQGA 4GRIA 3RT9A 4HNUA 1XO1A 3ZE6A 4B79A 1ZO8A 3KB1A 5ADWA 3TQIA 3BIXA 4OB4A 2XHZA 2VTBA 3WLHA 3HN7A 1AUQA 4KACA 1JE1A 4KXUA 1SWVA 4B7ZA 2AXZA 4YXWD 4QECA 5JDCA 4QEZA 3FKJA 4R7GA 1E79D 3CX7A 3L8FA 3MAJA 3V7WA 4M7RA 1S9DA 4ZI7F 5I8PA 4AQDA 3EVGA 1GP2A 3OPYA 2VNJA 4RX1A 4BQNA 2LYRA 1U0SY 2BFCB 1TUGA 1QP4A 4Q6BA 2Q29A 1MEJA 3F0TA 4MVYA 1CDZA 4AUNA 1QRAA 3GN5A 1GGFA 1GUAA 1DV2A 2XCOA 3JYLA 3Q0EA 5CA1F 2XKBA 2Z43A 2BW0A 4PLPA 3L1HA 3BH6A 4GBJA 2YY7A 3TEJA 3ZD9A 2DUJA 1JHQA 1QJCA 2JGEA 4URHA 5K3CA 1CUFA 1KC1A 1U2PA 2UUPA 4PG8A 2FHSA 4S1VA 4KJXA 3HNOA 4G8BA 6LDHA 4F60A 3R9WA 2Y1EA 4PU4C 3P9PA 4N6OA 3BN3A 4UVDA 2ZRHA 2FAXA 3OOYA 4RUKA 3GDWA 3PGMA 3G9XA 1EJBA 3WNVA 5J3JA 4X4IA 1C4KA 1OYWA 1YIAA 2YRFA 1V9CA 3NAQA 2J3KA 3U7RA 3U48A 3KJHA 3T38A 4BE7B 5IYZB 1KY4A 3ESQA 3MEQA 4WZBA 3CVXA 3LTNC 3IDZA 1XZFA 1P8AA 1I6KA 3FRIA 2HCSA 3ZDDA 2JD2A 1PO7A 2I7VA 3QX8A 3D2LA 2B4KA 4H1HA 5KNBD 3OE7D 1ZUIA 1RXYA 2ZOSA 3DF7A 3DOJA 4G24A 4FSHA 1JKJB 4IJWA 4QUDA 3RKRA 1V39A 1QG2A 4E14A 4L76A 2UVDA 2PUVA 4JQZA 3KQNA 1CLUA 4TV8B 1T3LA 1E69A 2FUEA 2FZGA 4WBSA 5EXXA 2ZTLA 4C3ZA 1F4PA 4G0YA 3UB4A 2IPLA 4LFBB 4G86A 4XGQA 4MDFA 2AF4C 3C85A 4N8SA 3QEMB 4R9VA 3UWDA 2YZNA 5BSFA 4ID9A 5J4KA 2J6CA 1NXTA 1N5DA 3DVSX 4LA4A 4YT8A 3MTDA 4XVRA 3NOXA 5FB3A 4BNFA 1RQ7A 1XD8A 4OAQA 2DPMA 3BMOA 4QRHA 3ZGVA 2FRXA 3ELBA 1KRXA 5BY2A 1XNQB 4BLUA 3EVNA 4Q34A 2H1SA 4EKYA 4G9EA 5IK2D 1MMFB 3CM0A 3ELUA 2B8NA 2QYOA 3II6X 5AMXA 4CEJB 3I0MA 3O4HA 4BBPA 4CF4A 1K8XB 1T43A 1LWOA 2R5NA 3O5AA 5CXSA 4BXOA 2ZBRA 2EJCA 2GASA 4HBGA 2XE7A 4PANA 3IAS6 4P38A 3DE3X 4Z7OB 4L28A 3SX2A 3UM9A 4ZO7A 2H59A 4D96A 4EEZA 1SIUA 3ZX4A 3TAXA 3MRSA 3VPFA 4Y0NA 1P75A 4ISBA 3SQDA 3FPSA 3VH4A 1EG7A 1SBYA 1G17A 1C81A 1WCIA 3F6RA 4OL0A 2ADFA 1ND5A 1S3FA 2EWWA 3U62A 3KIPA 1DXHA 1MOPA 3C4JA 1SUFA 3VRHA 2QUJA 1UPTA 3B5IA 4BMCA 4EVSA 3Q8XB 4YI3A 3VUFA 2XTZA 3NQ41 5LQAA 1CQXA 1WQ4A 3TH5A 5EKXA 3GV0A 3MRXA 3CZQA 4FEGA 4EUFA 2Z3VA 2XODA 1JKMA 1N92A 3I6IA 3I9V6 3FAKA 1C41A 1P9WA 2A0YA 1RRPA 4OFBA 5ECGC 1Y6FA 2Z2ZA 4KLZA 4BLVA 5EJ4A 1XF9A 2KWIA 3GLUA 3LWZA 4X45A 2I5PO 2WV9A 5A4MS 4R8VA 2GK7A 3LQQA 4IP0A 1DBWA 3GQBA 5K51A 4W9MC 4JI6B 2PQMA 1UMBA 1X2BA 2OAEA 4W5RA 2QN8A 3LT4A 2R4UA 2DF8A 1UKEA 4D79A 3RADC 4B3MB 1UPUA 1AS2A 3MGKA 1KMNA 3MT7A 4Q4AB 4RWEA 4D41A 5E1OA 1KARA 3K6JA 5G1NA 3PTLA 1ISRA 3FPGA 3KHUA 4ND1A 4IXMA 4MW4A 4Q93A 1RHRA 4Y1EA 3L1PA 1K5HA 2X2PA 2XH8A 5KSPA 3JAKB 5EIWA 1Z34A 1J9EA 5G0TA 3GJZA 4X71A 2E6UX 2G1KA 1OUMA 4HWSA 4OHVA 1X0XA 4OM7A 4QARA 1QOZA 5EE9A 2XSZA 2XMCA 4MVJA 4ZOBA 1K9VF 4N6NA 2X15A 4GKKB 4RMNA 2M6LA 1DCTA 2CCJA 2OC4A 2MSNA 4HQ6A 1O97C 5A9SA 2DC1A 4Z4QA 1CC1S 4CEIA 1YE5A 1LJUA 4PY2A 4BJ5A 3MGGA 2PXKA 1VSBA 1Z13A 3H5WA 2PGLA 3T3GA 2VUHB 4IO0A 3I23A 2VDNB 3VR4A 4QXMA 3WIUA 2F3SA 1KFBB 3WGTA 2BELA 2TMGA 4J16A 4RHUA 4DLBA 1I1NA 3ZDXB 4QUHA 2Q3EA 3CLTD 2FK8A 5B55A 5BYKA 4AD8A 1VCNA 3BRWA 3D1JA 3SVZA 4YMHA 4RK1A 1AQLA 4G5RA 3N2NA 3PLRA 4J29A 4KR7A 2Y67A 5AKEA 3TLJA 3W2EA 1J1ZA 2QTCA 3FHCB 4EX6A 4JI8B 2HX1A 1GJRA 3WIDA 3FSJX 3OF2A 4LTMA 1HDCA 1WCV1 5LNK6 2HW8A 5HMLA 2PT7A 4O4JA 2LE0A 2QL5A 3OQMA 2RCNA 3FUXA 5AM3A 4HSEA 1Z22A 4D3ZA 2B69A 5LWQA 1GTRA 2QAIA 4NJOA 1P9RA 3H9GA 4EPXA 4A7PA 5KTNA 3JVDA 4LZJA 5REQA 5KTTA 4WI1A 4CT4B 4ES6A 2XJ3A 3EF1A 2J9ZB 2JBHA 4IIJA 1IQUA 2INGX 1CDDA 1E2IA 3FIUA 1R0CA 3Q11A 4FZ5A 4MWGA 5A6VA 3FG9A 4MP3A 5BOSA 3QLUC 4M8NE 3HCEA 2CJXA 3WJ2A 5F9MA 5ITVA 1SCQA 5A04A 2FCRA 3UZUA 3CHYA 1VE7A 2GERA 4Q01A 4ZMRA 3HO8A 1E0KA 2XQGA 2VJAA 3V2UA 4DM3A 2PUFA 3QKSA 1YS4A 5JTUA 1YRBA 2I9KA 4BU1A 1CV2A 1J07A 3G8AA 3ZXIA 2ICPA 3B5JA 2IXFA 1JH8A 4BFZA 1XR3A 4PZEA 1SZJG 5HM6A 2Y0DA 4YJDA 3S1LA 3VV3A 5A4JA 1T8RA 2NXJA 1PHPA 4FR2A 4QIHA 2QRHA 3R5XA 4IGKA 5DB4A 1FQJA 2Q3MA 2VJBA 3T15A 3OCXA 1G5PA 4ABTA 2R87A 1UZUA 1MTZA 3HP4A 1XJCA 4JAVC 3EF0A 3EXEB 1YRYE 1DP4A 2AMVA 1DAIA 3ZHIA 2ZE5A 3IS3A 3C5HA 3P9XA 2YHUA 4P36A 1ENZA 1D6JA 3R6LA 4Q5IA 3ZUGA 1QRUA 1H8HA 4P3XA 1NMEA 3C70A 2JKVA 1Q91A 4ZK6A 3IBCA 5JSKA 4DMGA 1ADCA 4I55F 2EFEB 2VSXA 2XIQA 3QEJA 5T6BA 1IE3A 1LS1A 3ME5A 1RMQA 1TX4B 2QW1A 4P58A 4I4TF 2IF0A 5AI4A 2O8FA 2NUBA 1G2QA 1JI3A 3CZPA 1N2HA 4BO2A 2LYLA 1ESZA 1X7DA 2YQ5A 3GLHB 4F4JA 4IGEA 2ZWMA 4N8DA 5CIWA 4AZTA 4ARIA 2Q5CA 1CJVC 1TTTA 3A04A 2G9NA 3TGWA 5IABA 3V5NA 3QU2A 1AJEA 2DVMA 4HDRB 3VA7A 1EUYA 3FBGA 3ZWWA 1ABFA 4ZRDA 2WP8J 1FX0A 1H1DA 4QOSA 3MCWA 1X9IA 4RAOA 4DQDA 5AFSA 2ZRJA 1T8WA 1IBCA 4IFIA 4MQ4A 3TL6A 3M4ZA 4QUEA 3WR5A 2GZSA 1N2BA 2PZMA 4N0MA 3N7UA 4ZALA 4MMYB 1IWPB 5BR8B 3VNUA 2FN7A 4B1FA 4AN0A 1SG9A 5JAUA 1MR3F 1DRWA 3DTTA 5KYXA 1Y81A 3N07A 3QFSA 3IE0A 4RORA 3R0IA 1JHRA 2K6GA 3GLVA 2IEDA 3IXQA 1TKRA 1NF2A 1ZJYA 3E7PA 3O3MB 3OCWA 4PPNA 4CXMA 5JH7A 2GRUA 3DE5X 3MD9A 2IOFA 1HLFA 2DZDA 5KJFA 4FE4A 4D9EA 5IHXA 1H2XA 4YP1A 4EFDA 1S2DA 4G5FA 3TMYA 3PC6A 2YW9A 4UUMA 2LCFA 3L6UA 2VO1A 3ODPA 5I4BA 2XV1A 4DLLA 3RBAA 5KVSA 3Q8MA 1IJKA 1XVTA 3IV7A 3QJ5A 4WERA 1Z8NA 1GU1A 2C97A 3CN9A 1QRSA 3OM0A 3GT7A 3NM5A 3BXPA 3B36A 4I66A 1ZMBA 1LUAA 3VOBA 4GPIB 2J48A 3TB6A 4DRYA 1WB6A 3R9XA 3NHKA 3TKYA 1BEEA 1L4YA 13PKA 1U4OA 3BCRA 2C7GA 1F51E 4MPJA 2PRYA 3TM4A 3DL4A 5B4TA 1O96A 2H54A 2Q0SA 2X6RA 3KYIB 4WECA 2IY8A 3WG9A 3ZVLA 2VNHA 2P2LA 5A7LA 2HRCA 2GN4A 1KS9A 2AJTA 2OORA 3ZWBA 3VC1A 4J76A 4LXQA 5K4GA 4F06A 4RADA 2JJ2D 4DFDA 1VB3A 4ETWA 2PWAA 4P4UA 4JLWA 3TE7A 1NUUA 2FPPA 4OP2A 4CETA 1RXIA 3DG9A 3VPGA 1O57A 1YB4A 3KUXA 2FDXA 2QRGA 1B00A 1JFLA 1GPJA 1XRNA 2IHJA 3W5SA 2B4TO 2IHUA 1HGXA 2R7LA 4YT5A 3QVJA 1QV9A 4M0FA 1T8PA 2C5SA 3KLOA 3IKJA 3SFVA 5CFRA 5CDFE 4A0RA 1J9GA 1KSGA 1AMOA 2CLFB 3ZW8A 1JEQA 2UZ1B 1XDGA 4C2AA 1PQPA 3LP5A 4FCCA 4Q6WA 4A9AA 5SYNA 3L6EA 4FGWA 4V2UA 2B8WA 1FJGB 2AUWA 1AXEA 2B30A 3DLAA 4RK6A 4ZO9A 1PGJA 1SM4A 3LVRE 3OQIA 4MR8B 4RKQA 4KIUA 3U09A 2PPXA 5C8ZA 3QLJA 5K8UA 3GJXC 3DP9A 1Y6RA 1AV7A 1CY7A 2QX6A 2R44A 3O47A 3OU6A 1KJ8A 4CIDA 3NHYA 4S2EA 3QPWA 1XTKA 3B1FA 3MS7A 1D7AA 1ECGA 2H6EA 2H9AA 1ZJJA 3D7RA 3OJEA 4Q3AA 3PR2B 2FPGA 3IUJA 1UDAA 4GLOA 4RA6A 4WZAA 1GSHA 4UEOA 1S3SA 5HF5A 3IEMA 1MX5A 4Z3OA 2FRDA 3EIFA 1PJAA 1I7PA 1N9GB 5AJWA 5F2OA 1G66A 4CMEC 2CUTA 4TTVA 5DZSA 5LD2B 4NPCA 4DQVA 5A3JA 1BMFD 4NS1A 2GZUA 2NTEA 1TAHA 1Z62A 3VZCA 2OK8A 2AMJA 4RNCA 2AI3A 4LRUA 1EVZA 4MQ5A 1A8IA 1LPMA 2ZT6A 4M0UA 5I7AA 2QRVA 3G2QA 4KXLA 3U1BA 4IJUA 5BXQC 3GIWA 5BR4A 1F0KA 5FCDA 5C7LO 2GCNA 3L8HA 3IPLA 3C4QA 3Q7PA 4KODA 2GBIA 5KQRA 3IHTA 1F14A 4JN6B 1ZONA 4H1TA 2FP3A 1FNNA 3M0EA 5DEIA 3DE0X 2NO4A 4EITA 3H4TA 3MTJA 2A1TR 1W2HA 4Y2QA 4EH1A 4MULA 5F7XA 3DKVA 2F62A 4BRWA 1KJWA 1C9MA 1C3OA 3A9VA 4IRMA 1OVMA 1Q15A 1WQ1R 1OLUB 4V0KA 3WBJA 2ZREA 3OFVA 4AZ0A 1JHMA 2I3GA 5ALZA 3RSQA 3BGSA 3R7DA 1RW4A 3FPLA 1O6FA 3FRHA 4G3XA 4IV8A 1EM6A 2J7KA 4ND4A 2RI6A 2BUBA 2ID7A 1CVRA 4U3JA 4JLDA 4U4AA 3FZYA 3ND9A 3LUJA 5FLKA 4CM9D 1ZUWA 5FO1A 5FFFA 4AP6A 4YCSA 3AILA 4D99A 2MMCA 4TT3A 1ULTA 4DC0A 3ZBPA 4AJHA 4EG8A 1NMZA 2W93A 5KTPA 1J0CA 3DTNA 1O8CA 3OPYB 4GMDA 3EHEA 3IE1A 2XOXA 3WGZA 4NCKA 4KPFC 4F1WA 2B21A 2CYCA 3QENA 4JSYA 4RIIA 5IW8A 3TRDA 4AWBA 3GN5B 4R4JA 5CU7A 4WL0A 1CUJA 3CEHA 4H7IA 4DSUA 1GPBA 1XMVA 2Q8QA 2DKOA 3E15A 3QWBA 2BYTA 3DMTC 5AUPB 4LE2A 4OQNA 3LQYA 4BLPA 3V2IA 2WYOA 1ENOA 2WWVD 3ENZA 4M21A 5A4AA 1J21A 1KMCA 1QIGA 2AEEA 2QLBA 2F3PA 3ADOA 4JSRA 2JFVA 4PF1A 4JT2A 1MT3A 4R1SA 1JW9B 5ALXA 4W1SA 3ZXXA 1JWBB 2XUHA 4KXYA 3RSGA 4QYMA 2I1WA 3N74A 2QPLA 1GG8A 5M04A 2ZSHA 3GZNB 4C7OB 3PXUA 2FYTA 3E35A 4YA6A 3WVNA 3A2KA 3PX7A 1PDOA 1HO3A 1WMAA 3M49A 1W1IA 4WZBB 2DLDA 3ICPA 4BV3A 2PY6A 3PQ5A 4CL3A 1BEZA 2P7HA 4Z5DA 1CUCA 1VHJA 1UPAA 2ZB8A 4TL8A 5BN4A 2GVDC 3I6ZA 3OO1A 1OFUX 4HJRA 4WZAE 5DF1A 5H5JA 1I6MA 2X0RA 4K3VA 3L8EA 4ANFA 3SQNA 1DINA 2D7JA 4MQLA 5B6IA 5D00A 5FLXA 3A11A 1IH8A 3FVQA 1WDTA 3QMPA 2UZAA 1PGPA 4D45A 3PHBE 5DBHX 3D4PA 3BDAA 5GONF 1XCMA 4MLCA 3KDSE 2PIDA 4G1BA 2IPMA 1EDBA 2W8BA 3NBFA 3H5TA 4YROA 3UAOA 4ERNA 5BUCA 5F9FA 4CMJA 3CZRA 4KFTA 1N2ZA 3D4BA 3PEVA 5HGXA 4K5QA 1J49A 5IZ4A 1SH7A 2GA9A 3PXPA 3K5HA 3T4EA 3BMOB 1TLFA 4LBWA 4YGYA 5KSZA 1IULA 1P1HA 4GM1A 4JLSA 5G2OA 5IJXA 5C0OE 5T7BA 2DCMA 1MGPA 4GYJA 1FW6A 1UDBA 2CLIB 3B9BA 3EMVA 4FZ3A 2HMAA 1R63A 5TQVA 2GN2A 5F2NA 1R4NA 1WMEA 1MOSA 3P27A 1CWUA 2QJOA 4MUKA 4JA2A 2O8CA 1Y63A 1D2MA 4DG5A 2G36A 4J2OA 1DTEA 4NBTA 3L1UA 5KEIA 3W5BA 3LPAA 3B13B 1V26A 4RA9A 1KC3A 1IQ0A 3DMYA 2C4MA 1HT3A 2YH2A 3FDJA 3I61A 3WMFA 3ZV4A 3NBQA 2N42A 1BRTA 3GVHA 4NBLA 2FP4A 5EZYA 1WCIB 3TGPA 2JIMA 4LV5B 3H1PA 3NWEA 3WRVA 5J4VA 4BUZA 2PKEA 1NW3A 1K2WA 2VA9A 3JVVA 2FFQA 4TLMB 4YDRA 4CM7A 4EY8A 2IKQA 2QWXA 4R71A 1G7TA 4R2IA 1AQJA 1OVGA 2DSNA 3MJRA 3DBRA 2JAHA 1PQYA 3HDTA 221PA 4JMLA 4LOHA 3EGEA 3U7GA 3X1JA 1G3QA 4UCWA 3OLZA 1XRPA 1XTPA 3WLKX 4PRZA 1ONOA 2NPFA 3V4SA 3L3BA 1AZWA 2ZRPA 4Y6PA 3Q2OA 3WIOA 3GWGA 2I66A 2O7RA 3GQBB 3OEED 3ZJTA 4WBNF 3LQXA 1UMBB 3E84A 4IY1A 3KR9A 1JHVA 2B82A 4B83A 3FNRA 3EGOA 5C8DA 3UB2A 3W4JA 4S04A 4LDPA 2ZI5A 3L0YA 4PZ9A 3W5DA 3S7TA 4RTRA 4OLBA 1LTQA 2RHCA 3TSOA 3OF5A 5E8RA 2O3JA 5F5NA 2C4NA 2C9ZA 2OCIA 5CLIA 2H08A 1Z0ZA 1VI5A 3CWZA 3RNLA 1RZSA 1R00A 3Q7RA 2R6HA 2JFZA 5BNFA 1TM2A 1H8EA 2DPGA 2K87A 4L08A 4UBJA 4BNIA 1MVOA 4YV1A 5A9SB 6PFKA 4EGFA 1ATIA 4IJ6A 3EH1A 5HOEA 1EGHA 3X1ZA 5HPYB 3FVRA 3PDHA 3E2IA 1MJGA 2ID8A 4NJMA 5IDWA 4GPTA 1RHMA 2P6MA 2LNMA 2Y6UA 4G0OA 4DEYA 3C7AA 2WT4A 3EY9A 3L5KA 1TEZA 4YAJA 4Y2TA 1E2UA 4H17A 5H9VA 3NVKI 1DOHA 3EBPA 3KAPA 1C1DA 2CY0A 3KT3A 3NETA 4YLYA 3S2YA 3NKFA 1Y8ZA 4HVCA 5JSZB 2D2IA 1WZNA 4MRNA 3VYWA 3UT5A 1NUAA 4UHBA 1X1BA 5LBIA 4Z6KA 2H65A 3PE6A 3HKCA 1E6CA 1QE3A 5H8WA 2YWEA 2QVCA 1QU2A 1OX4B 2FUCA 2VQEB 3WP1B 4JOQA 2IY7A 4FBLA 1T35A 3U6BA 1VC2A 1PS9A 2Z09A 2JJQA 2HJWA 4O4JB 2JCXA 3GFVA 3RTAA 2R751 1V7ZA 1NF9A 3IEKA 1FXSA 2D2EA 3CBGA 3B9QA 1IDN1 3I2GA 1OWNA 3SNHA 1NUHA 2A0UA 3CKKA 4D2IA 4ESEA 4E88A 2FPWA 4IS2A 5FOSA 3NRBA 2H4JA 1EFPA 3E9ZA 4PC1A 2JFXA 2Y8EA 1R6TA 4A82A 1XDZA 2ZM6B 5BSVA 1Y7PA 1LMB3 1B76A 1H05A 4IIJB 1KGDA 4FLEA 3ST7A 5CDGA 4L57A 3WRXC 5BOSB 1EDDA 4MQBA 2BNNA 3C1AA 1LLFA 3GWZA 4FYHA 4L15A 3FOWA 3QUQA 1M33A 1RQLA 1F6WA 2BFMA 2L42A 2QN1A 3CN7A 4J9UE 4WE3A 4P0PB 2ZWOA 1BE0A 1K5GA 2RHOA 4NYMR 3KVNA 3MF4A 4ONEA 4XZ3A 3M3HA 5CP8A 2VK4A 5PNTA 4CN8A 4I46A 4YCLA 3A9UA 3QKSB 2ZT7A 5E6SB 3SR3A 4WCFA 1A8HA 2YWGA 5T3UA 3TNFA 3WFJA 1Z2EA 1UT5A 2IP2A 3T1YB 3AI1A 1ZMOA 4CE6A 2R47A 1MIOA 2A5LA 5DBOA 1THMA 3HVJA 4P5PA 3J7TA 4KAFA 4M0CA 5DSTA 3KZKA 4AXBA 4YPOA 1KK2A 1EXDA 2F8LA 1N2XA 1TJ5A 1U2TA 1T2DA 3OIDA 2X3UA 1Y8AA 3GGCA 4OFXA 4UVHA 2H8KA 3UPDA 5A1JA 5EQDA 3COSA 3FOCA 2RI1A 5T4FA 2YKGA 1UR5A 4LYFA 2JA1A 4BMYA 4D3YA 3QQ6A 4JLVA 5B3LA 3SP1A 1NLFA 1RKBA 3V9PA 2O7VA 4NL4H 4IUCS 1DTSA 4G6ZA 2C5FA 4NBKA 2XXAA 3JQDA 4DJEC 1KI6B 3QRWA 2KZ8A 2VHXA 5EIOA 3MOSA 2O7QA 2BRUC 2Z8XA 3KHSA 2YTZA 4QG3A 4NBUA 3CJTA 1UM8A 1NJSA 2FZ4A 2Y1OA 5DHAA 3RS9A 5FLEX 1QZTA 1ULHA 4LSZA 5JALA 5KSWB 3ZWNA 3FTDA 3ER9A 2BR4A 4W7SA 5HEKA 3LGXA 3ZDFA 4CCWA 5IVPA 3AF2A 2FMFA 3ADKA 4TWZA 5DK6A 2DTEA 4WHMA 1PT7A 4FHFA 1RCFA 1FX0B 2W48A 3EZXA 3FTQA 1JEYB 4NEHB 2WY2D 3W5IA 1YD7A 3ROTA 4J0CA 2I1VB 1OIVA 4ZHQB 4RTLA 2VTDA 3BFXA 4OQMA 1LBIA 4OQEA 4JUCA 1K3FA 1T9AA 3RVOA 2CDAA 3IR6A 4X97A 3U3KA 2GPAA 5C18A 3PQDA 4CU5A 5IKPA 5F1PA 4NZPA 4FDMA 1L5RA 5JD5A 1OZAA 4ED9A 4PFJA 1I7LA 2BF7A 3DAPA 2A58A 1W2GA 1N36B 5KYXB 3NT5A 2G7ZA 4NYMQ 1SRRA 5CDHA 2RAFA 3FROA 3Q41A 2JARA 3CMCO 4H2DA 1MPTA 3SY8A 1QDUA 3HB4X 2VF2A 1XA3A 2FN8A 4TM8A 2ZYIA 5EN4A 5JH7B 2DERA 1NLYA 1TJPB 4XLLA 5IVKA 4IVRA 3RVBA 5BSGA 2B4YA 1ZCJA 4FR5A 4FUTA 1G8AA 1WSDA 4I8DA 4M46A 2J3EA 4KB5A 1LCIA 2JD1A 3I45A 3OKAA 3GRPA 5FOUA 4DLVA 3RS2A 2VDMB 4HG2A 2F67A 4O8CA 4E7OA 4D3XA 4D9BA 1U0RA 3LLVA 1KK0A 2Z5FA 5D51S 2GDZA 2AZ4A 4HXYA 3EWNA 3ZZMA 3CUYA 3I73A 1ES9A 1CX9B 2QORA 2R5FA 3MJCA 4NI5A 1HE4A 1JXMA 1KI7A 2ZUWA 3TRBA 3HJUA 4L22A 4YG7B 1JHZA 1LBEA 1Q3KA 1P7PA 1TK3A 1TU3A 1Z5PA 2NVOA 2R6GA 3ACBA 3K1TA 3KS9A 1YZGA 4UTOA 5CYFA 3TTTA 1UKZA 4H6PA 1CIPA 1LNQA 3ITKA 4PVCA 4WOBA 5JPIA 1NXPA 2CC2A 4AX8A 4DREA 1U63A 2ZUFA 1CUYA 3GCZA 3ZQUA 1JEJA 3MWLA 4JLAA 4EFKA 1PR2A 5MHTA 3COWA 2WHRA 2GAOA 1UBJS 2W6NA 3VPBA 3ZE2B 2NO9A 2FPPB 1NDHA 2X6TA 3AEKA 3PRJA 2OKGA 1KYWA 3D7KA 4JVNA 4L5IA 1B6TA 1PJ8A 2JW5A 5C8YA 4B2YA 4TV9A 3HU5A 3H86A 1XEXA 2OBLA 5BPFA 5JATA 2XYVA 4B2PA 5LQMA 2VL7A 3C6QA 3X1MA 3DBHA 4KK4A 2B0CA 3DZ8A 4UM8B 3F3SA 5GV7A 1FNBA 4YHHB 4MQEA 5L7TA 5ESWA 2KPOA 3CNOA 2C4TA 2Z58A 4P7KA 4TN1A 1A8SA 3CLRD 1DMRA 1BWRA 1Y3FE 2A14A 5BRAA 1Z5ZA 4JVOA 4TMFA 3OQIB 4LOJA 3VO9A 1TLTA 2KBFA 4EHIA 4YXFA 2BFFA 2EFYA 4KDCA 1SXJA 3ESXA 5LP6B 1H2EA 4LW8A 3T3PB 4E07A 5A2GA 2YN2A 3ZEIA 2W6JA 2DHDA 1EXMA 3ICVA 4U39A 1HE8B 3U4DA 3QPDA 3FVTA 3EBLA 1W59A 2J41A 3G1WA 1DAGA 2MSEB 2B2CA 4RA6B 4COKA 2FPGB 2VLBA 3ONWA 5LD2C 3SBXA 2XNKA 3AFIA 2PX6A 5T5QA 2O8EA 3ZLBA 4HDMA 4O1HA 3OEHD 1N7JA 5EWMB 3EYWA 2PUHA 4GMXA 4YRBA 1R66A 1RCTE 4O59O 1G8FA 4PZDA 4BNDA 1PFKA 4MV3A 4ALNA 3EUFA 4DCVA 5MGBA 3GHYA 3PNOA 2QRVB 3CEMA 3UW3A 1FFHA 3NPAA 5KVVA 3IESA 4PCVA 1KKMA 2R1TA 3VVCA 1WB9A 1OFUA 2ISQA 3DKKA 1IXSB 4RK0A 4S35A 3ZHTA 1DXOA 4Q7QA 3E18A 4LCEA 2C42A 3HJGA 3OPXA 4XUDA 1T5TA 3PJEA 3R9KA 3W2TA 1WDMA 2NN3C 2AN3A 3RC9A 2X0DA 1R0SA 2RHLA 2JAQA 2WG1A 4DCNA 4DA4A 3FD8A 1DU4A 3IQZA 4WK2B 3ZWVA 4QJ3A 2BHSA 3A9TA 2PV0A 3ZXSA 1C3OB 2GM5A 4V03A 4Y2YA 2N0SA 4PC3A 2WSMA 1CUSA 5JDCC 2FY8A 3EWIA 5G0UA 5LB2A 3TF5A 2QTWB 1R64A 1PS8A 2P8JA 1AMUA 2AL7A 1R37A 2QNBA 5DNEA 1LEHA 1XN1A 1ZY2A 2JH8A 1SULA 3FDFA 4MS3A 1QJ4A 4O4HF 4YLGA 3OQNA 2NXWA 4MTLA 5CLJA 1XT6A 1QF7A 1HEYA 3QWAA 1BS1A 1M6VB 4G1CA 4OGKA 4G4SP 3UGKA 1RLJA 3OZUA 1FY2A 1Z12A 1LH0A 3DYIA 4Q1DA 4MAMA 1G20A 4IHJA 4J8PA 1ZUNA 2XZTA 4REQA 3EWSA 1TDJA 3JVIA 3M6AA 2Y71A 4O4IF 2NLOA 1E3WB 2QTHA 1WB4A 2ZITA 4R9UC 4BP8A 2F8TA 3SLKA 4QICA 4CCAA 2JQEA 1U8TA 2PKQP 4ZC1A 4CV3A 4LUCA 3NHRA 5B7PA 1X8KA 4NU5A 2GHTA 2ZPAA 2PZGA 1U7UA 3R7FA 2QJFA 1ZJ6A 2BCEA 3OPQA 5K4AA 4AY4A 2PRSA 2RD2A 2BI7A 3PTAA 2PSFA 3I5AA 3QU7A 2PL3A 3HXKA 4IM7A 4PGFA 1WE2A 5LOVA 3D8TA 4QUIA 1BVYF 3QUBA 1ENYA 1WF6A 4FYXA 1IM5A 4YS6A 1SXJE 3A58B 4QNNA 4Z86A 5KSYA 1PUIA 2GZ2A 5H80A 3F78A 3WLEA 2P3QA 3ONVA 4HH1A 3AERA 1WCWA 3JTMA 4M9RA 5BSRA 1KIFA 2GLUA 3EAQA 4GSLA 4KWIA 5JVDF 1HL3A 1UL1X 2C9CA 2D8MA 3TFWA 2LYPA 4XYGA 2CJWA 3IDSA 2Y1FA 3IIEA 3T5GA 1W5AA 4PRYA 2VPTA 1SHZA 5CBPA 3P2MA 2RBEA 1N2IA 5HZGA 1JR3A 2WTMA 4DIDA 5EA2A 1XU9A 2RHWA 3HZIB 2EFHB 2BP7A 3HB9A 3CEAA 3NAMA 4TS9A 2EVWX 5I7FA 4HFRA 2PTGA 2W8BB 4QAJA 1JIJA 2B83A 4N49A 4GP6A 1TA4A 4ZT4A 4R40A 2IIVA 3NHBA 4L6IA 3MNFA 2WWYA 5I9TA 1GYRA 2ZJ1A 4G65A 4I8TA 2P2ZA 2WQZA 3VK0A 2GD6A 3RC8A 4RSRA 5LZ7A 2R86A 1ZX1A 3UMYA 4CM8A 3MS2A 4UHJA 3E9MA 2ODTX 3A1TA 3R5HA 5EC8A 1N0HA 1Z4PX 3AT1A 3TDKA 1E79A 5B2EA 1RR6A 1PNOA 4FPXA 1ZJ4A 1H4VB 1R4NB 4K1XA 1QU3A 5CXUA 3PFKA 4C5BA 3T9DA 4EB6B 3AF1A 1RYEA 3AK4A 3DHEA 3O8QA 2O8CB 2YRWA 2SBTA 1FUEA 1DWKA 2D06A 2Z5LA 3HP1A 5EERA 1AQUA 1ZZGA 3TSZA 4BNNA 3KLPX 3LUPA 4O63O 5C32A 2PNJA 3C6MA 3GGJA 1EFUA 3JXEA 3KJZA 1CETA 3CO0S 4YJKA 2QUKA 4ZPJA 5DLPA 2FP4B 2X9VA 4EFLA 4EZEA 2EAUA 4XFJA 5EZYB 3AR2A 3ZEAA 3BSFA 4WA8A 1E2KA 1KVRA 2EJBA 4PX3A 1FFWA 4XYBA 3TLXA 3ZGNA 4BNKA 1M1NA 2C99A 1A9XB 4YWJA 4NCJA 3DOCA 5ERXA 3EF3A 2DR2A 2XDQA 1CRLA 1B41A 2I3AA 1JHPA 1FYDA 5JBNA 1EDEA 1SELA 1Y3CE 2IJGX 4NFLA 2E1PA 3TYXA 1MB0A 5ARBA 1U9CA 3IP3A 1VMEA 3SOZA 3DBRB 2AFHA 3OA2A 3DLBA 3KXDA 4HRYA 1NOJA 2VXYA 2WHQA 3T6KA 1E9VA 2XOEA 3U6KA 1HFEL 1UDRA 3M89A 5FTKA 1OD6A 5I47A 2QM8A 4C0KA 4GH5A 3T1TA 3V4OA 1IY1A 1L3CA 1P19A 3H5AA 3LXUX 4QTUB 5FJJA 5K2OA 2GCOB 4RTPA 4BLRA 4R8KA 3RSLA 4EY7A 5JISA 1OKKD 3KETA 1QIMA 2WUSR 4LF8B 3FCUB 3LPDA 3EN0A 3N9IA 4O4LB 5DK4A 4CLRA 1HDOA 1YS9A 2HBZA 3K9GA 5TPWA 3W3ZB 4DIOA 4GMFA 2YWRA 4OA5A 5E9QA 5JSUA 1GFIA 3RTBA 1YCFA 4UBOA 2AIRA 1Z4MA 3TQFA 4MA4A 4CV2A 5JAPA 1QR2A 1FJHA 3K2EA 4R0VA 2A5DA 1NUQA 4F91B 1EGAA 1T9CA 5BR7A 1NR5A 1FXWA 5AXCA 3QNUA 1JR3E 2VNAA 2DCUA 1N5MA 3L46A 4JJ4A 4RZSA 1YZQA 1HA3A 3GRVA 3ETDA 3QX3A 5IK2A 1GADO 2WTXA 1SIBE 1YQWA 3A4YA 4QD3A 1USKA 5DOVA 4BWVA 3SQXA 3BD9A 4N5DA 4PYJA 4FR0A 5KTRA 2NP6A 2HUPA 2YFKA 5DP1A 2D5IA 4J16C 4NJMB 1G8MA 1VA4A 2I71A 2JIZD 5LQCA 4YARA 4J94A 4LJ9A 3PFBA 3PIRA 1SFRA 4X1YA 1KWGA 4Z0TA 1C7EA<