1JFXA

Crystal structure of the bacterial lysozyme from streptomyces coelicolor at 1.65 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords 1,4-beta-N-Acetylmuramidase M1
total genus 80
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfxA00
4EE9A 4GZJA 3F5LA 1AQMA 2VCBA 3KE0A 5M3WA 3VKKA 1M03A 3AROA 5DT5A 3QHNA 1CGXA 2EBNA 3AZRA 1DEDA 2WZHA 7TAAA 2NT0A 2WVSA 4PRWA 1UD5A 1EO5A 2XWDA 1OIMA 1CYGA 2YL5A 3W82A 2VX4A 1GQLA 4D6CA 2JIWA 3SUVA 3NIYA 1QHPA 1KBKA 4J3XA 4B3KA 3QHOA 3THCA 2WLYA 4LXFA 1IT0A 4GO9A 1JZ8A 1B90A 4A3HA 4MB5A 4JFTA 2XSBA 4AZHA 1RH9A 2F8QA 2OYKA 1V0NA 3TTQA 3WY1A 4GI9A 1UQYA 3WDPP 4TX8A 3SURA 4HU8A 4ML4A 1M01A 1OWQA 5AC5A 3NCOA 2CHNA 2CNCA 4A3YA 3UR8A 1XSJA 2A3CA 1OBAA 2D0GA 1HP4A 3U5UA 1TR1A 4GXPA 4XZWA 5D8ZA 4CN1A 3FHQA 4NI3A 1UZ4A 4AIEA 2EJ1A 2E0PA 2D1ZA 1XCWA 1W2VA 2W63A 1WE5A 2EPMX 5BXRA 4GQQA 1NOFA 1UH2A 4FLSA 4UQDA 5I6SA 3G6LA 4QLLA 3NUKA 5BROA 6A3HA 4D6HA 2W61A 4EANA 2ZXQA 2VTFA 3U7BA 5ABGA 2WMKA 1GOIA 4PMZA 1ITXA 2BHUA 3LPPA 5BXTA 1CECA 3SCPA 3RILA 3AHZA 4B15A 1QI2A 1GHSA 1KR1A 3VGHA 1H4PA 3VGGA 3VDBA 3L4XA 2PBOA 1QHOA 2ZXAA 5CXPA 1KFWA 3IJ7A 1QHZA 5BYWA 2J7GA 3SCSA 2X0HA 2CERA 2BY1A 4CVWA 3ARQA 1CPUA 1ECEA 4LPCA 3CO4A 2PWHA 4UOQA 4R5EA 1WZMA 1LG1A 4A4AA 1UD2A 2ZUMA 3CIVA 1E6RA 1H2JA 3B9DA 2QPSA 1HJSA 3NDYA 4MB1A 3K8LA 4H04A 1E6QM 3MUAA 2OYLA 5JUVA 4UZUA 3OGRA 3WNOA 1WNOA 4J3SA 2V3FA 3T0DA 2DSZA 1R87A 4TVUA 2XYLA 3T09A 2OSXA 1UR4A 1DWIM 1UA7A 2YIHA 3EDKA 4MJ4A 5D9PA 2WK2A 3O6AA 2QPUA 1CXKA 3GZAA 3O2LA 4UFKA 2WZIA 3CZLA 1QBBA 4BZYA 3T2QA 1J0IA 4DUXA 1GQKA 3WH5A 3GNPA 1ITCA 1H3GA 3DECA 5EB8A 4Q22A 2DDXA 3D3AA 1US3A 5GNYA 5A8QA 1CTNA 1SFSA 1OGBA 2FHBA 3FY1A 1PAMA 1UKPA 3VIJA 3A6OA 1E70M 1VFUA 1DWFM 1EH9A 2WMJA 1TMQA 4MB3A 1QNOA 1OD0A 1MFUA 3W27A 5HNNA 2J78A 1BSIA 2V3EA 3VX1A 5A6LA 3HU7A 1UR1A 4QLKA 1BF2A 1GZJA 1WP6A 1AQHA 1WPCA 1BYBA 1UHVA 1MQQA 5A6JA 2GJXA 4GZIA 3GH4A 3EDEA 3LPGA 1MXGA 1E6XM 4MADA 1W9PA 4GKLA 1L8NA 1Y7VA 5GNZA 1OM0A 2OWXA 2WBGA 1VFOA 3AHVA 2VVSA 3VIMA 4P8WA 3ZJKA 3MS8A 3AZTA 4FMVA 1HJXA 3RIKA 3VIOA 1XYFA 1VENA 4DM1A 2YLAA 1JL8A 3LMYA 4YN5A 2W67A 2PB1A 1C90A 3AYRA 1J11A 1BQCA 4AEEA 4RE3A 5ECUA 2CHOA 1JAEA 1TVNA 3ALGA 3WNPA 1W3LA 3U57A 2F61A 2VURA 4QCEA 3T2OA 1K9DA 4WKFA 2D3LA 4ZXOA 2XG9A 2XSAA 2JALA 2BY3A 5E09A 3ZO9A 2VC9A 3OZOA 2V38A 4U33A 2VQTA 3MV11 3WDJA 5BCAA 5EMYA 2WMFA 1Q6EA 3KL3A 1GOMA 1A3HA 1WZLA 5A6KA 5A6AA 5D4YA 1HL8A 3WNLA 4MDOA 5I0DA 1OB0A 2PF0A 4JIEA 3W6MA 1C7SA 1UWTA 1CWYA 5DFAA 3WDHA 3OLIA 1GW1A 1C8QA 1HJQA 3BAXA 2DT2A 2FGZA 3M6DA 1OCQA 4JFSA 1HX0A 3AMDA 4MPKA 4F79A 3WN6A 5IFTA 3K8KA 1FH7A 1JFXA 1UUQA 4P8VA 5GPRA 2ZUWA 1VBRA 4JL1A 1EQPA 4ZFMA 1UD4A 1KGUA 1WDPA 1R7AA 1KR0A 1CXIA 1V6WA 5CGMA 5BRQA 4LX4A 5A2CA 3L4YA 3BAWA 4YHGA 2JE8A 3IAPA 1FHDA 2FHFA 3L4VA 5JBEA 4W86A 5A1AA 3WL1A 4GPNA 4J3UA 3L2LA 1JYNA 4E4PA 1FFQA 3ZSSA 2BHZA 4W85A 1NP2A 3MKKA 2C8NA 3I3EA 4Z2HA 2CXGA 2WB5A 1JF5A 2O9TA 4LYQA 1GCYA 1XH2A 1ZU8A 3RM4A 2WVTA 2WWDA 2XM2A 4WLCA 1HKMA 2EQDA 2EPLX 3ARPA 5BRPA 4PN2A 1JDCA 1UKSA 3NSMA 3WF4A 2ZX6A 1JZ7A 1B3VA 1P6WA 4HZ8A 3WQ8A 4GZEA 1E15A 2E8ZA 2V3DA 4DM2A 4EAMA 1GPFA 2WAGA 3ZT5A 1X1NA 4F8XA 5CJ5A 2ZUNA 1UOKA 2O92A 3PZOA 1QBAA 2D22A 4N42A 1L0PA 5JBDA 4MJ2A 3BCFA 2WMHA 3WNMA 1VAHA 1E4NA 4NRSA 1NWTA 3WF1A 3CTTA 3SUWA 2ZX8A 1D2KA 3VO0A 3VDAA 5I79A 2V5CA 4FLQA 2FHCA 2XVLA 1UWRA 3IJ9A 1E4IA 5TD4A 4UNIA 3CZEA 2YJQA 4QDMA 1H0GA 5A6MA 3T08A 1HT6A 3ZR5A 4HMCA 4PMXA 3POHA 3NSNA 3DYMA 4AZ7A 1V03A 2GDVA 3IANA 2OSWA 1CGVA 2VRJA 1KB3A 4UOJA 2ZIDA 2XPKA 2IXUA 2ZXBA 2C0HA 2VL4A 4P7RA 3W26A 1WB0A 2QMJA 5A8PA 4E2OA 1UH4A 2RGLA 4V2XA 1BGGA 4ACZA 1FFRA 5HXMA 1H49A 5LA2A 2WLZA 1XGZA 2Y8KA 1HL9A 3UEQA 4LQ1A 3VD4A 4D6JA 5I3DA 1TVPA 3AZSA 2W62A 5A6SA 2VVNA 4GI6A 3ALFA 3UG4A 2O9PA 1QNQA 1NQ6A 4J3WA 3L4ZA 3AMCA 3AXXA 1VEMA 1HKJA 1DWHM 1NH6A 5IHRA 1ZB5A 2W66A 4CD6A 1GOKA 4E8DA 3SCOA 3VVGA 3F5KA 2A3AA 2BXZA 1LL6A 1IZKA 2WCSA 1UR8A 2ZUSA 4AD1A 4BQ3A 3THDA 1JDAA 2X0YA 4PSPA 3VTRA 4FLOA 3WQVA 1XHGA 3ARSA 3TP4A 1CLXA 1JXKA 3CH9A 1R86A 5A8OA 1CGUA 1E40A 4CUCA 1LQ0A 1FHLA 2CITA 1MQRA 1V3KA 3LPFA 1EOMA 3VIHA 2VCAA 4QAWA 1JZ2A 4P8XA 2WZEA 3W24A 2J74A 2E4TA 2W5FA 1E4MM 1FH9A 2WPGA 2DT3A 3VUPA 1ISWA 2HVMA 5FL1A 3NDZA 2J7HA 1LF1A 5I24A 1MWOA 4TTGA 3CUGA 3CUFA 1W9DM 1HVQA 3RPMA 2WVVA 5I78A 5DO8A 3RM9A 1C92A 7A3HA 3IAQA 5D9MA 5FIPA 1KWGA 2XJ7A 3ZJ6A 1KXTA 1PBGA 1JZ5A 4ACZB 4CCDA 4W7VA 1MXDA 1ZS2A 3U5YA 1V3IA 3A4WA 1E9LA 1VIWA 1CGWA 4OBSA 4DWSA 3WUEA 3DHPA 6TAAA 3VD5A 1E0VA 4AW7A 1B3WA 4H8HA 1GNXA 4C7GA 1XD1A 4UFIA 3ARUA 2CKRA 4AMCA 1UKTA 1W1TA 1SMAA 1G1YA 2DPEA 1ISVA 1E6NA 1RPKA 3QOMA 1JZ3A 4JHZA 3RMEA 4WK9A 5LYRA 3NJ3A 4B9ZA 1UR2A 1BG4A 4JFVA 2WBKA 3CZKA 5CPQA 1QI5A 3OLDA 3UCQA 4YPJA 2ZX7A 3II1A 2EO7A 3WD1A 3AS2A 3RJYA 1TA3B 3PZMA 1LWJA 5EFDA 3GH7A 4TOQA 3PZTA 1H5VA 2WCAA 3T2PA 3WNNA 2E8YA 4D1IA 5EFFA 3AHXA 5CQ1A 2VRKA 2ZE0A 3VIFA 1EDGA 4FK9A 3ZJ7A 4CGTA 4AIOA 4BS0A 1BYAA 4AZGA 2VX7A 1OGGA 1DWAM 1W3HA 4GINA 3W37A 1US2A 2PI6A 1D7FA 3AOFA 2V3GA 2B31A 3FAWA 3N12A 1J18A 4PSRA 3VM5A 1CXFA 3MU7A 2BVTA 1MW1A 3GTNA 4Y7EA 1IV8A 1J0KA 3DHUA 4PMOA 1PZ3A 2VX6A 1EOKA 2ZUVA 3K46A 1NP0A 1HKIA 5ABEA 1ZBVA 3VMNA 4UFLA 1GOOA 1GUVA 2VOTA 2VZVA 4M82A 3AIEA 2ESCA 1Q6CA 3WF0A 4JAWA 3W53A 4Q7NA 4ATWA 4OIFA 3ARZA 1EA9C 1EHNA 4U31A 3NYDA 3VINA 1WDRA 3WIJA 4TVCA 3ARYA 3AISA 2PWFA 4W5UA 1JYVA 4R27A 3RCNA 1CGTA 1W32A 2WXDM 1R85A 2FGLA 4PMDA 4TUFA 3K4AA 3APGA 1BG9A 3TONA 3M07A 4UQBA 3I3DA 3CHDA 5DMYA 1MW2A 4J3VA 4MTVA 3W25A 1JZ6A 5GNXA 4W88A 4UOZA 3SCVA 4V28A 2DEPA 2ZWYA 1J12A 4J27A 4LYPA 2ZUUA 3PBGA 5LA0A 3LPOA 2FH6A 2WHLA 2VR5A 1CBGA 1PJ9A 5GQBA 2DH2A 3AIQA 3WEMA 1XV8A 1CIUA 3GXMA 1B1YA 1GVIA 3VD7A 4AD3A 1EDQA 4M24A 1DTUA 2BNJA 3CMGA 4U5IA 1E72M 1HN1A 5IXEA 3L4WA 2CBVA 2YOCA 3AQUA 3WH7A 1KXHA 3ECQA 1JD7A 1RP9A 2CYGA 3KL0A 1UR0A 3MMWA 3N04A 4KMQA 3AI0A 5AYIA 1K9TA 1JGIA 4CD4A 2J47A 2JF6A 3ZT7A 3OLEA 3W29A 1E0WA 3S2CA 4JCLA 2UY5A 5CG0A 3VX0A 3RO8A 3EDFA 3W0KA 4L4PA 5IHSA 3WFLA 1OT2A 1FH8A 4TTUA 2GK1B 1PPIA 1W1YA 2J7CA 5D9NA 1J9YA 4H7VA 1ODZA 2Y4SA 8A3HA 4AYSA 4UR9A 2DSVA 4W89A 1X6NA 1LL4A 3BAIA 3AFBA 5A3HA 3UERA 3KL5A 2PWDA 2XFYA 4QFUA 3OIHA 3G6MA 2GK1A 3MV01 4XZBA 3OZPA 4D71A 4MNMA 3AS3A 1LLOA 3VDCA 3VILA 2X09A 3ZR6A 4B16A 3N17A 1H0IA 2ZX9A 2YL6A 4U3CA 4DUWA 1NARA 4HMEA 3WUBA 5I23A 2CESA 2WC7A 1ZJBA 2WSKA 2GJPA 2G3MA 3AMGA 4L4OA 3ZMRA 3VOCA 1WO2A 2YDSA 1SMDA 4U2ZA 2EXOA 4CN4A 1E5NA 3NSXA 4UZSA 3RDKA 3WD0A 1UH3A 5A95A 3BAKA 4OBRA 3AICA 1Q6DA 9CGTA 3W81A 4XX6A 3WH8A 1CLVA 4Z2GA 1QI4A 3GDBA 1QW9A 1O6IA 1DWGM 2JEQA 1R7OA 5M03A 4DWSD 3UR7A 3WMSA 4X9YA 1M7XA 1XH1A 3GNOA 3TOPA 1WDQA 2DT1A 2YL9A 1UA3A 5A8NA 1E1FA 2OWCA 4H8VA 1H09A 3WDRA 1DHKA 5LA1A 4KGJA 2VNCA 3N13A 1JNDA 4CU7A 4D6DA 5HPCA 2UWFA 1SYTA 1KWKA 3E1F1 1K6AA 3KEHA 3UG3A 1ESWA 1B3YA 4P7QA 1G0CA 2BXYA 3WEZA 3CHCA 2QV4A 3SEPA 3AIWA 2WC3A 3PTQA 4DWSC 1G9HA 4Z2KA 4J28A 1OSEA 4OJYA 5I5RA 2O9RA 1VRXA 3SCQA 2QLYA 3CHFA 3BMVA 1KCLA 1FP8A 2X1IA 1KBBA 4N0RA 1VBUA 2BVDA 3HMCA 3PZUA 3K4DA 3WF3A 5ABFB 1M04A 3CZ8A 4F9JA 2WW5A 2BVYA 7CGTA 2FDMA 3OBAA 1MW3A 1ZBCA 3UG5A 1B2YA 5CSYA 2VZTA 4AXNA 3CPUA 3WQ6A 3AIUA 3PTKA 1E73M 2YDRA 5E9AA 1ZBKA 4MDPA 1YHTA 1ISZA 2VX5A 3VNYA 2V5DA 1V0LA 1HIZA 1E6PA 1QW8A 4M29A 4PUDA 1E6SM 3DYOA 1ZBWA 3MUZ1 2AMGA 1TFVA 5C71A 1UD8A 3CUHA 2E40A 2D23A 2J7EA 4UFHA 4Z2LA 3WBAA 2GVYA 4RE4A 3BSHA 3ARXA 2DIJA 2XVPA 3CHEA 2G41A 1VEOA 1LG2A 4BQ2A 4P7NA 4XB3A 2VJXA 4NF7A 2YA2A 5JIWA 1W3JA 3L2MA 1CXLA 5DT7A 4PBGA 5A94A 4CN6A 2X8RA 3WQWA 5FL0A 2XHYA 4CD8A 5E6ZA 2XVNA 1DP0A 1VEPA 1F4AA 3N11A 3A4AA 2E9MA 3ARVA 2VZUA 4JHOA 4X0VA 3FAXA 4PYSA 1E55A 1N82A 4BA0A 5M5DA 2XGIA 4OZOA 1G5AA 1W1VA 4Z2IA 1OIFA 1G94A 1WKYA 3EBVA 1PZ2A 4HZ7A 1TG7A 3B9EA 3VGEA 2WKLA 1BHGA 1C8XA 3BXWA 1LL7A 1UWSA 3GH5A 3N1AA 1HP5A 3GXIA 1KGWA 3WBEA 3WMBA 2G8ZA 1H11A 2OSYA 1W91A 4HTYA 2IUZA 1V08A 2OYMA 1HJWA 3AMKA 4P7LA 4HOXA 1HVXA 5I77A 1MW0A 4W5ZA 3VDHA 1U33A 2GJXB 2Z1KA 4M80A 2D2OA 4IISA 5A6BA 2F2HA 4AWEA 4EKJA 3FN9A 1HNYA 6CGTA 2C7FA 2ZUTA 4F9DA 2J7BA 3SUSA 2VZOA 1PX8A 2WVVB 2YBUA 1UQZA 1UD6A 2G3NA 1BVZA 4AZIA 3WL0A 4QP0A 2YA1A 2EPOA 4W87A 4B9YA 1E1EA 3WEOA 2CBJA 4JFWA 4D6EA 3PTMA 4UQAA 2VR4A 4M8UA 4J7RA 2QHAA 2W92A 1V02A 4P8UA 3B8SA 1E6ZA 1UWUA 2WMIB 2CETA 3CMJA 1OGSA 1TZ7A 1SR0A 1HXJA 5CPTA 1GQJA 2GUYA 4MAVA 2EPKX 1CZ1A 1QOXA 3F5JA 5E70A 4BQ4A 2OWWA 1TA3A 2DGAA 5C8BB 5IFPA 2RGMA 1MVYA 4UQEA 1UD3A 3U7VA 3WFZA 1E5JA 1DWJM 2X2YA 2WMGA 3RJXA 2MANA 4ATDA 2XIIA 4B3LA 5ABHA 1PIGA 3IJ8A 4HPHA 1BFNA 3L4UA 3L4TA 4MAZA 5HDRA 4AZBA 2JFEX 3KWXA 3JUGA 3FHAA 4S3JA 3EMQA 5KEZA 2DT0A 2WVUA 1B30A 3WD4A 1JNEA 1EQCA 3ZT6A 4CD5A 4HA1A 3AYSA 3I3BA 3UETA 4AD5A 2XWEA 4BQ5A 2XVGA 5CLWA 1XYZA 1W9XA 4OOUA 2BFGA 1FA2A 2O9OA 1EHAA 1AQ0A 4IUGA 5F7UA 4JKKA 4H8UA 3BAYA 2J62A 3MMUA 4HZ6A 4W93A 3FXYA 3RM8A 1CGYA 4P7OA 1JYXA 2WKGA 1GJUA 1JXJA 4ZE5A 4PMUA 4QLJA 5A8MA 2VUYA 4U5KA 4CCEA 1JYWA 1B3ZA 4CCCA 3ARTA 4LYRA 3VD3A 5AY7A 1H41A 3J7HA 3ARRA 1NWSA 4KGLA 5M17A 2D3NA 4BF7A 3GYCA 2Y8VA 2D24A 4PMYA 5JBFA 3PZQA 1CNVA 1MYRA 4PTWA 3DC0A 2WHMA 1W1PA 4KRTA 1B9ZA 1WZKA 1JF6A 1V3MA 2E3ZA 1NOUA 1I1XA 4NSBA 3GNRA 4UFMA 1ISXA 1VJZA 1QNRA 1B31A 2WYSA 1RP8A 2PC8A 4AC1X 3MO4A 2E9LA 4KWUA 5BXPA 3VIIA 1EIBA 4YHEA 4W8AA 1KXQA 4JCMA 5HBFA 2ZX5A 3AS0A 1JG9A 3N15A 4TX6A 4DUVA 1K9EA 3BMWA 3VNZA 1HF6A 3MANA 3CGTA 3OG2A 1QNSA 1BYDA 2BS9A 1I75A 2XIBA 3BCDA 3CBWA 5FD0A 2Y2WA 1J01A 3ZSTA 2QMKA 4WIWA 1JDDA 1W9VA 1C91A 3IK2A 3QGVA 4NZCA 3WENA 1J0ZA 2YBTA 3AIBA 3GM8A 2J8FA 4AD4A 1QI0A 2A3HA 2HISA 2JIEA 3EDJA 3VU2A 2J77A 4S3KA 2XFRA 3ZM8A 1OT1A 4WJXA 4E8CA 4AD0A 1PEZA 2NT1A 3AXIA 3EDDA 2WMIA 4RL3A 4W8LA 4IPNB 4GIAA 3AIRA 2BY0A 4H2CA 1WDSA 4WF7A 2DH3A 2GJRA 2VI0A 4JKLA 1TCMA 1UR9A 3K1DA 4CD7A 3POCA 4WSKA 2G3IA 1TE1A 2VZSA 4UTFA 3FW6A 4PMNA 1K9FA 1JI1A 1ZJAA 4U3AA 1W9UA 3BLKA 2A3EA 5IDIA 1EXPA 1BYCA 4UFJA 1NWRA 1KQYA 3WUGA 4AY1A 1CXHA 1BAGA 1W9BM 2ZWZA 3DYPA 4CVUA 2TAAA 2WHKA 1ZL1A 1GVYA 1WAWA 1GJWA 4GQRA 2D0HA 2IXVA 3WDQA 4PMVA 1JAKA 1ODUA 2XM1A 4AISA 3WUFA 5EBAA 1M53A 5HOSA 4PTVA 3WMCA 5JIPA 1C7TA 1BLIA 1UWIA 3FNDA 3QHMA 1XRVA 2CKSA 4MNJA 2A3BA 4UQ9A 1QI3A 4XV0A 2AAAA 5A2BA 1BGAA 4WKHA 4PMRA 1V3HA 4PCTA 3TA9A 1JFHA 1V6XA 3PN8A 1H1NA 3O9NA 3WF2A 4ATLA 1EO7A 1KXVA 1AMYA 4RE2A 2PWGA 3M46A 2WC4A 1C3FA 2DSUA 3SCUA 3WH9A 2BV9A 1LJYA 5A2AA 3VM7A 1PX3A 4M1RA 1E4LA 4M56A 4KRUA 3W4RA 1O7AA 2Y5EA 3SCTA 3A3HA 1XSKA 4JL2A 1NOWA 5BWFA 3TTYA 4WSJA 2DSKA 2WSPA 2GDUA 2ZICA 3CZGA 4QCFA 3OGVA 3WSUA 1JI2A 1KGXA 2J8GA 3K8MA 2QF8A 4IM4A 3PZGA 1V0KA 3CUJA 4C7DA 2DSWA 4HOZA 3OB8A 5ABFA 5DF0A 1HKKA 2EEXA 1QNPA 2J75A 2NSXA 1V6YA 2J25A 4UCFA 1WZAA 3BH4A 3BLPX 1EGZA 2CIPA 1KQZA 3N9KA 1U30A 5FCZA 2VRQA 2WCGA 3PZNA 4XUYA 3F4VA 1U2YA 3OGSA 2UY2A 5C70A 4HOWA 4CU8A 2XVKA 3PZIA 3GBEA 3BGAA 2YKKA 4JZ5A 1E43A 1XC6A 5A69A 3WH6A 5D8WA 2XUCA 2AOSA 1NWUA 4MNKA 4W8BA 3WQ5A 1UZ1A 1J10A 4OKDA 3WQ4A 1VJSA 1VF8A 3BAJA 3ARWA 3MMDA 1A47A 2GSJA 3B9AA 3VMOA 1ISYA 2WHJA 1Q6FA 4D72A 1FOBA 1NM9A 5BXSA 4AZCA 3VGFA 1G01A 1PIFA 2YA0A 3TTOA 1UKOA 4F66A 4U2YA 3WKZA 1JZ4A 1F4HA 5HPOA 1GHRA 4PCSA 1UG6A 4AD2A 4ZENA 2G3JA 2XGBA 1QVBA 3BC9A 2VO5A 3CZJA 5I2UA 3PHAA 2FH8A 3D5HA 4JFUA 1XSIA 3VIPA 4AZ5A 4V27A 2CCRA 3SCRA 4TVDA 8CGTA 1MQPA 1V6UA 1GQIA 3W28A 3GXFA 3KZSA 3VD9A 1E3ZA 4LGXA 3A4XA 3SUUA 4CKQA 4IPLA 3N18A 3UESA 4UQCA 4TXEA 1XH0A 4M81A 4PMQA 1VFMA 1VB9A 2Q8XA 5E6YA 1GOQA 1WCGA 1J0YA 2WWCA 1B3XA 1VFFA 3WNKA 1E56A 4OOZA 2X05A 2OLHA 3M7SA 3MUIA 3PZVA 2D20A 5CGTA 3VMPA 2CPUA 3ZIZA 4PTMA 4D1JA 2D0FA 1D3CA 1YQ2A 4BCEA 2WANA 3WD3A 4ZE4A 4AIUA 1CENA 2UY4A 2J7FA 2WNWA 2YDQA 4NRRA 3ZOAA 4W7UA 5DEZA 1GONA 4FLRA 4GO8A 1HJUA 4HMDA 1W3KA 1V02E 2ZXDA 1Z32X 1CEOA 3SUTA 4H41A 3MSGA 4FF5A 5AC4A 1EDTA 1E3XA 3AJ7A 4C7FA 4X0NA 5A6BD 5FKYA 1OINA 1W2PA 2Y24A 4HP5A 2GFTA 4PTXA 4HA4A 3W38A 5D9OA 1E71M 1B0IA 1R8LA 3MSDA 1FP9A 4AZCB 3HJEA 3ZJ8A 2PWEA 4D6GA 2UY3A 1C93A 3EMCA 2VMFA 1XCXA 3QR3A 1OD8A 3EMZA 1Q6GA 1LWHA 2BHYA 1V3LA 4HPGA 2W91A 1PX4A 1I1WA 2J4GA 2G4FA 3VGDA 3AHYA 2JF7A 4HU0A 1Q4NX 3OLGA 1MFVA 4K68A 3WD2A 4GI8A 3BSGA 4CU6A 4PUEA 2CEQA 3A47A 2DQXA 3PZ9A 2XFFA 5CPSA 3AXHA 4EK7A 4ACYA 4ZXLA 2YLLA 1V3JA 3VGBA 3WDIA 4AEFA 1JIBA 5E0CA 2VQUA 3QOKA 1UWQA 5AYBA 4Z2JA 3AHTA 4MNLA 1C8YA 3OA5A 4D6IA 2Z1SA 1IZJA 5CZKA 3SIMA 2VT0A 3SCNA 4W84A 3AS1A 3T0AA 1X6LA 3SCWA 3W6LA 1UYQA 1JD9A 2EPNA 4W7WA 1GORA 3HN3A 2CBUA 2YL8A 4HA3A 2NW0A 2J79A 1UKQA 1BVNP 4ZEPA 1J0JA 1RD6A 1KCKA 1V6VA 2E9BA 1S46A 4OUEA 4MB4A 2XTKA 4D6FA 3CUIA 1XD0A 2WM0A 5CLTA 4J3TA 3AIVA 3AMLA 2ZOXA 3GXDA 2JEPA 2J7DA 1AVAA 4KH2A 1J0HA 3WELA 1V0MA 3T0BA 3VIGA 1TUXA 2W4XA 3VIKA 5FOOA 4URIA 5KZ6A 3MUY1 4PEEA 1CXEA 2PBGA 1HJVA 4WKAA 4DWSB 3EYPA 2VCCA 4JKMA 5CSUA 2CBIA 1GOWA 1BPLB 3TTSA 3VPLA 2DIEA 4AZ6A 1CDGA 1QPKA 3CLWA 5E0FA 1BTCA 1E0XA 3S6TA 3GBDA 2BY2A 3ZQ9A
chains in the Genus database with same CATH superfamily
4EE9A 1XLGA 4GZJA 3F5LA 1AQMA 3KE0A 2B7PA 3AROA 5DT5A 3QHNA 3VZYA 1DEDA 1EBHA 4QBXA 2DJLA 2NT0A 3B06A 2WVSA 1SZEA 1UD5A 3QQWA 1OIMA 5CJMA 1CYGA 2YL5A 2HXUA 4X22A 1GQLA 3H4XA 4F4RA 1ZRQA 3K4WA 5MF5A 3RNDA 1YXCA 4IF2A 3ABRA 4B3KA 4LUJA 4BKNA 1R0MA 4IICA 1XIBA 2ACSA 2NX3A 5LNVA 2BGQA 3SO7A 4MB5A 4JFTA 3GTIA 4HYRA 1RBOB 1V0NA 4IGMA 3TTQA 3WY1A 3G0UA 3A22A 4N9CA 4ML4A 1M01A 1YTKA 2EF9A 1JEZA 2CHNA 3T42A 1W5QA 5G2HA 1JCYA 1OBAA 2D0GA 5C5YA 4LW7A 1TR1A 4RNJA 3BLIA 2EJ1A 3W2KA 2E0PA 1XCWA 4REQA 2PDMA 3C0LA 1A5MC 4TR9A 3UZZA 1NOFA 4UQDA 4G9PA 2DJXA 5I6SA 3G6LA 1UCWA 5BROA 3GS6A 4GXMA 5H8PA 2W61A 1PZ1A 4EANA 2ZXQA 4UMAA 2WMKA 2O55A 1HO1A 5IBXA 1TB3A 3JVAA 3NQEA 4GYPC 1QK2A 1EJWC 2OLAA 2P3ZA 3N34A 3NZRA 1QI2A 3CV1A 3V35A 1TJPA 1QHOA 1IEQA 2QCCA 1KBJA 2ZXAA 2QV5A 3IJ7A 4HTBA 1QHZA 1OX5A 2DORA 1ECEA 4LUTB 4UBPC 1TMLA 5LIXX 1SGJA 3L7RA 2X16A 1LG1A 4H9UA 3N2BA 5EMLA 3S0CA 4R3UA 2O4MA 3GO2A 1E6RA 1H2JA 2QPSA 1HJSA 1V8EA 4MB1A 3K8LA 1AA1B 3MUAA 3VA8A 4UZUA 1WNOA 3MPGA 4AAJA 1VCFA 3HBLA 2PWVA 4J3SA 2GGJA 1FHVA 2XYLA 2Y6ZA 1DWIM 2X40A 4MJ4A 3EDKA 4ILSA 3SJ3A 2QJMA 3O6AA 2IQDA 2PDKA 4AIBA 3CZLA 1QBBA 1DHPA 2PF8A 3P82A 2B0MA 4LALA 2HQAA 4DUXA 4C6KA 4N2YA 2FZNA 3L5LA 4EPDC 1A3WA 4Q22A 1OF8A 4YS1A 3GD6A 3KAOA 2ZADA 1US3A 4PRRA 3N73A 1CTNA 4DJDA 3C52A 1OGBA 3FY1A 1MSSA 5FF0A 4U28A 3Q65A 4O11A 1MXSA 3QJAA 1VFUA 1EH9A 3ITTA 1TMQA 3W27A 4HHLA 3U2OA 3O3RA 3HPSA 1FDZA 3HU7A 4QLKA 6TIMA 4B4HA 1BF2A 3A21A 1GZJA 3FYYA 1WP6A 1AQHA 1WPCA 5FSDC 4Q8TA 4IX0A 1Z3NA 1VC4A 2POZA 5F4WA 4IFRA 3HTWA 3OA3A 2YFOA 5E9XA 3AUOA 4Y90A 1MXGA 1IQ8A 1KFCA 2V5BA 4GKLA 3SM0A 3GTXA 1OM0A 4GNKB 4QJ5B 1O68A 1FRBA 1HJXA 3RIKA 4DM1A 1KM1A 2E09A 1JL8A 1HTIA 2YPIA 2PB1A 4RKAA 1C90A 1J11A 1K8YA 3ONBA 5HMDA 1JAEA 1TVNA 3ALGA 3QYSA 1KTBA 4H01A 4N9DA 4OTKA 4AHOA 1K8CA 1X1ZA 1A5UA 3T2OA 1K9DA 2F6KA 2D3LA 4ZXOA 2XG9A 2PDXA 2JALA 2HV5A 5E09A 4DZAA 2VC9A 1M5WA 1LRQA 1LROA 5DANA 3EWYA 3MV11 3F2BA 2PLJA 2WMFA 1Q6EA 4O0QA 1WZLA 5TF0A 5CBBA 5A6KA 5D4YA 3MYOA 4MDOA 3UYCA 1OB0A 2PF0A 4WHBA 3C4UA 4YWSA 3TYAA 1GW1A 4J35A 4ERIA 1JVNA 1G4TA 2E5DA 1OCQA 2GVLA 3O05A 4JIHA 5T9CE 3AMDA 3MHGA 2PDPA 3OTRA 1RZMA 4UUIA 4P8VA 4YCPA 1DL3A 3SB0A 1H60A 1WDPA 1R7AA 1AMKA 1KR0A 4I9TA 1ALDA 4S3EA 5CGMA 3IGXA 4P61A 4EPBC 3STGA 4HYVA 3BAWA 2JE8A 1VHNA 3HURA 5BZAA 1FHDA 2FHFA 4G1KA 3F2CA 1WAUA 1X1OA 3N3MA 5BMXA 1ENUA 3M16A 1KRBC 4NNAA 2V30A 3L2LA 1XIGA 1FFQA 2BHZA 3NGFA 4DY1A 5ENLA 2C8NA 3TFXA 3UFYA 1H51A 5F1VA 5F4XA 3UYIA 2Y61A 1ZU8A 3RM4A 5I3JA 1NFBA 2WVTA 4AY8A 2WO5A 1XYAA 1XLAA 3C3UA 4NZFA 4PN2A 4LFYA 4GC4A 4EIVA 2QDDA 3QW3A 2RJHA 1JDCA 1UKSA 3NSMA 4RK8A 2Z29A 2PGWA 3L67A 3WLOA 1P6WA 1JZ7A 4GZEA 5KTLA 1E15A 4DM2A 4EAMA 1K7XA 3NQGA 2WAGA 1SSGA 1X1NA 5CJ5A 4DXKA 3PAJA 1UOKA 3PZOA 1T0OA 4O8RA 3UVAA 3PPFA 2D22A 1RAKA 4N42A 1H63A 4FHAA 1L0PA 4MJ2A 5JH1A 3DIPA 3EA3A 3H7RA 2BWGA 4PB5A 2WMHA 1IXPA 3WNMA 1VAHA 4NRSA 1NWTA 1D2KA 1W5PA 4FLQA 2FHCA 3PB2A 3THUA 3CWHA 3W84A 8TIMA 2XIOA 3CZEA 1P1XA 2YJQA 3DG6A 4G8TA 5KINA 1H0GA 3HB9A 2J6VA 4HMCA 2Z1WA 3DYMA 4AZ7A 3IANA 2HJPA 1X6UA 3PANA 1KB3A 3QY6A 2HMCA 4KEVA 2ZIDA 2ZXBA 3NGJA 3PJUA 1XLJA 1BKSA 4P7RA 3CB8A 4NIRA 4AHPA 4H6RA 1XISA 1OCNA 1UH4A 2V2HA 1MNSA 5LA2A 2PP0A 5H1WA 4C6EA 4LY8A 3LBCA 4LQ1A 3IEBA 1K7FA 4D6JA 3AZSA 3H2FA 2DQWA 1QOQA 2GOUA 1KFJA 3SY8A 2F38A 2O9PA 4D8LA 1XIEA 3L4ZA 3AXXA 1VEMA 1DWHM 1XDJA 3PULA 3W7IA 1P5BA 2E5BA 3NQBA 2V8ZA 2BXZA 3DFOA 2PZ0A 4AXKA 3EB4A 2WCSA 1UR8A 4O1FA 1XCFA 4PFMA 4C6IA 4O57A 3VTRA 3ERPA 4PR4A 1XI3A 3WQVA 4GD0A 4L6OA 4L7ZA 1YW1A 3TP4A 2QVNA 3BSMA 1JXKA 3S9ZA 5K9DA 3APTA 1CGUA 4CUCA 2ZZ2A 1FHLA 3R0UA 1V3KA 4FXJA 5TQLA 3KLKA 4P8XA 3P67A 4AUBA 2W5FA 4HK5A 3HQOA 2W6RA 2WPGA 3DERA 3TN6A 2J7HA 1LF1A 3MC5A 3LHVA 4TTGA 3CUGA 3EWCA 2XU2A 4LUTA 5DO8A 1RCXB 2R24A 2ZC1A 1TWWA 2XJ7A 3ZJ6A 1BRLA 3SJNA 1PBGA 1Y5XA 3UY7A 4ACZB 2V81A 1ICQA 3PNZA 4FXRA 3GRIA 1UB3A 1CGWA 3FA4A 1VD6A 3WUEA 3DHPA 1MUMA 1GKPA 4AW7A 1GG0A 2R6OA 3ARUA 3B8DA 4O10A 4AMCA 1UKTA 1W1TA 3LGGA 2PTXA 1G1YA 5LIUX 1TIMA 1EGMA 1EJXC 2D2GA 1LZOA 4B5SA 2PDYA 1FWSA 4WK9A 2CW6A 4B9ZA 1X7FA 1UR2A 4W4QA 1VBJA 2BXVA 2WBKA 5CPQA 1A3XA 1LCOA 4NZ4A 4ZGYA 2I7GA 4LCQA 3WD1A 4LT9A 3MVTA 1LWJA 4TOQA 2WCAA 2HK0A 3WNNA 1PIIA 4HCDA 5EFFA 3DAQA 3JR2A 1I60A 1U1UA 1H7NA 3VIFA 3WJXA 3NXFA 2PDLA 3NL2A 5FJIA 3AU6A 1RQBA 1YPIA 2AQOA 2VX7A 4NJIA 3HIJA 1US2A 1PKMA 1CB7B 2XINA 2EKGA 2VEGA 2CC0A 2B31A 3FAWA 3N12A 2NQHA 2QZRA 3RU8X 1TX2A 5AC6A 3FLUA 1J0KA 3DHUA 4PMOA 5AC8A 4IMDA 3K46A 1QRQA 1BWKA 2P3EA 4ZQOA 4MY8A 3IARA 4LV9A 1R38A 1HKIA 2CLPA 3NURA 3DFYA 4KS0A 3QZEA 2YX0A 2PWUA 2C6QA 1XR2A 1VCGA 4GG9A 2ZC8A 1EL3A 3R43A 4RJEA 5M1TA 4XKMA 3T40A 2Z00A 3RU6A 4Q7NA 3W1UA 3WLLA 3H2CA 3A3XA 1W1B1 3E0VA 5J04A 3VINA 1WDRA 3EOLA 4TVCA 3H2EA 4JXCA 1EX5A 3UWWA 4D2JA 4UB9A 1K7EA 4RNFA 1BG9A 3BGGA 5BU6A 1PB0A 5DMYA 1MW2A 1PO9A 3P5ZA 3G1XA 5FJRA 3SIZA 4J9JA 4HCHA 4V28A 4J27A 3PBGA 1ONEA 2WHLA 4GUHA 1CBGA 1PJ9A 5XIAA 5GJNA 1GZ1A 5EMMA 3WEMA 1WV2A 4K8HA 2YB1A 1XUZA 3PPHA 1GVIA 4QIUA 2YCLA 3CMGA 3UG8A 4FNTA 3WK1A 3SDOA 4HPNA 3I6TA 4IIEA 3KBVA 4PL1A 1AJ2A 1O5RA 1UP0A 5IXEA 1W3TA 2FPYA 5HINA 3W23A 3AQUA 1EJVC 2E5CA 3T05A 2PEVA 3ECQA 1QPOA 2G5WA 3W7JA 1RP9A 3NO5A 3KL0A 2Y88A 5AYIA 1J6OA 1V6TA 4CD4A 4NHVA 2JF6A 3WQCA 2XSXA 2C91A 1SZGA 2Y85A 4PBEA 3PUOA 5CZ0A 5HNTA 1DJQA 3M0LA 1TCDA 1OJXA 3C6CA 3PUGA 5CG0A 4U4MA 2OB3A 2B7QA 3VX0A 4QEEA 4NZJA 1JGMA 1P4CA 4ZFCA 4LBSA 4YL2A 4Q4SA 1H1YA 2GLKA 1P43A 2DP3A 4MWAC 3COTA 1GW9A 3A24A 4PTDA 5HJLA 1HGYA 2FTWA 4TTUA 4AWSA 2GK1B 2YR1A 8A3HA 2Y4SA 2VKZG 4I7UA 3NZGA 1PHWA 3DG3A 3UZYA 3MZ2A 3KL5A 4QFUA 3WLKX 1ZP3A 3MV01 4LS0A 1H62A 3AXMA 4BEQA 1I2RA 3QSTA 1EX1A 2DFAA 4GACA 4DNHA 4BF5A 2X09A 3ZR6A 1OFOA 4DLMA 3SRFA 1U22A 4U3CA 3P8JA 1TWDA 4HMEA 3O6DA 5AHFA 3W87A 3ABQA 2GJPA 4IWWA 2G3MA 1FWTA 1Y8BA 3ZMRA 2QVHA 3NPXA 2A5HA 2ALDA 2NV9A 2FPVA 3U8GA 5IDZA 1E5NA 3WQDA 4F2BA 5HWMA 3BAKA 5D2YA 2AKMA 3W7KA 2DZBA 4IGSA 4N4QA 5CCZA 3R58A 4XX6A 3BV7A 3B0VC 2ZKMX 1G67A 3GDBA 3KRZA 3TJXA 2VC7A 1SW7A 1GVQA 3G3DA 3GHRA 3GTHA 3K1GA 4X9YA 2PAJA 4RW3A 3PK7A 1KFBA 2R1LA 3NQCA 2DT1A 5J5RA 2WJZA 3LB0A 4BI5A 2P88A 1E1FA 2OWCA 1DHKA 3DC8A 5LA1A 4KGJA 3N13A 4YJ5A 1POKA 4GIYA 3VK5A 4QEHA 4R9XA 2H3BA 3RLGA 4QM1A 4NJKA 2YZ5A 1B3YA 2HXTA 3CHCA 2QV4A 3AIWA 2WC3A 4JIPA 1EYEA 4FNRA 4GCAA 1G9HA 4Z2KA 3ABOA 3QPZA 2GGEA 2O9RA 3BE7A 2QUVA 4MPQA 3HJZA 3DCPA 3B4YA 1VRXA 5ECVA 3DFNA 1PDZA 3DZ1A 2X1IA 4DX3A 4FIRA 3HMCA 5ABFB 3K4DA 2BVYA 3Q2DA 2P1FA 2PP3A 2VZTA 2P0IA 1RVKA 2YW3A 4C6OA 3WQ6A 1DXFA 4X9SA 2YDRA 3E0WA 3LI0A 3VNYA 1IEVA 3I4KA 4LVBA 7XIMA 1V0LA 1VPYA 1B4KA 3PFRA 4PUDA 1MUCA 1ZBWA 5HJYA 2E40A 1XFCA 3ZWSA 3IJLA 1KRCC 4Z2LA 2OZ0A 1GT8A 3BSHA 1JDFA 3ARXA 3N9SA 4QG6A 3MI2A 1JQVA 1XINA 3LRKA 4P7NA 2YA2A 4FO4A 3W1NA 3TN3A 2I5IA 1CXLA 2OKTA 3HQNA 5DX7A 4JQ1A 2QCNA 3LTSA 4PBGA 5A94A 1K1DA 2X42A 1W3NA 3QPEA 4UCGA 3WQWA 1KCXA 5FL0A 1N7KA 3LQGA 5E6ZA 1VEPA 4PZVA 3LG3A 3ARVA 2OLSA 2QPXA 4X0VA 1Y0EA 3H6OA 3IVSA 3EX2A 1LOSA 4ORMA 1N82A 4BA0A 4DXVA 5BWAA 2XGIA 1G5AA 1W1VA 1OIFA 5HQEA 1VHCA 3FA5A 3OVGA 4GKTA 3SFKA 3BXWA 4NJHA 1MZHA 2MUCA 1I2QA 4LANA 1DPMA 1HP5A 4LRTA 3WMBA 3EWZA 2FVKA 4HK7A 1L6FA 2VGIA 1W91A 4IQEA 3ZLHA 1HJWA 2WZTA 4P7LA 3GB6A 4HOXA 4WGXA 1HVXA 4ADSA 3PWAA 1GQNA 3G0SA 5B7YA 2TSYA 3QZ6A 2F2HA 3M5ZA 4MYXA 4AVNA 2J7BA 3XINA 1P7TA 3HFYA 3BG5A 1PX8A 4QJ4B 4GWEA 1S3TC 3QR1A 3GHSA 2G3NA 3G5EA 5E0KA 4ICCX 3W07A 4GIRA 4W87A 3I7SA 1C29A 1Y5WA 1J2BA 2BB0A 3VOJA 2RFGA 2CBJA 4JFWA 4D6EA 4UQAA 4DZIA 2VR4A 4DBDA 4JQAA 5D30A 4G7EB 1K8ZA 3CAWA 4P8UA 3HQ1A 1Q6OA 5D2VA 1QPRA 1PKLA 5H2ZA 3UWQA 2D2JA 1GQJA 3B8VA 1P0EA 1TPUA 7ODCA 3OYZA 2G95A 1QOXA 4H7ZA 3GKFA 4MHBA 3B3DA 1PCWA 4UQEA 2QULA 5HUPA 2OKOA 2X2YA 2OEMA 4L4MA 4PFHA 4NT0A 1DJNA 5H8MA 2DVUA 3GAYA 2ACRA 3URNA 1PIGA 4OGZA 1S2VA 4C5ZA 1BFNA 3L4UA 3OW1A 3L4TA 4O52A 2EG8A 1M1BA 2OZTA 2BLEA 4S3JA 2RDTA 4XQ6A 5KEZA 2DT0A 2WVUA 3WD4A 1JNEA 3TNBA 2CLEA 4NZ1A 3S5SA 4F48A 1IGWA 3GXPA 3AYSA 4PUJA 3I3BA 2NZLA 4GX8A 2Z0IA 1OF6A 3N14A 4O12A 3E3HA 5HR6A 2I16A 3IV8A 5T9BG 3UY8A 5EGRA 1MI3A 1K3UA 3ICJA 4H8UA 4HZ6A 3T7VA 4W93A 1UIOA 3EZ4A 2QJJA 5CPMA 3UZXA 2W27A 3BG3A 1GJUA 4ZE5A 1E1CA 4PMUA 2HE5A 4O15A 4U5KA 3URAA 3C61A 3KHDA 2QAPA 4CNOA 4A05A 5HR7A 4O8AA 4PCNA 4IPPA 5C9RA 4KGLA 5FF2A 5D33A 1VPXA 1A5OC 4YWIA 2PA6A 3NL6A 3PZQA 3OIXA 1DYSA 4S39A 1SSDA 3CQJA 1CNVA 4PTWA 1I0BA 1JUKA 2OVLA 1X39A 3OQ8A 3TR9A 2E3ZA 2HEJA 4NSBA 1UJPA 1QNRA 2WYSA 2VGFA 1Z8AA 5CAHA 2YXOA 1LWIA 3PBVA 4NXSA 4Z17A 1X8CA 3EA2A 1EIBA 4HD5A 4WOQA 5HBFA 1AG1O 2ZX5A 2BSLA 4L65A 1IGSA 1K9EA 3ABSA 3OQEA 2Q3OA 3OG2A 2BS9A 1X97A 2XIBA 1H7PA 2OQLA 2O7SA 3FS2A 3NR0A 3G8EA 3VNKA 3PY2A 4PBFA 1AUSL 4PULA 3WENA 1AW1A 2DZXA 1NTHA 4L1GA 4H6QA 3DESA 2A3HA 2E6YA 2JIEA 1Q7MA 1S5WA 4E8CA 3EOUA 3AXIA 3EDDA 4XD4A 3HF3A 4BI6A 2BY0A 4TIMA 4HCLA 4WF7A 2FJUB 3QV7A 2VI0A 4Y9MA 2C0AA 1D8CA 2OELA 2WSQA 4A8IA 4CD7A 4WSKA 4UTIA 3PBMA 5DRCA 2WNNA 3MYPA 2G3IA 3S6OA 4KRZA 3JU2A 4UTFA 5EA9A 5LXXA 1JI1A 2GVJA 4U3AA 2WPBA 3WQFA 1W9UA 1DJYA 3ZYZA 3MKVA 5HNUA 1BYCA 2H8XA 1KQYA 4RXGA 1CXHA 1K4GA 1W9BM 4CVUA 3KVJA 2EGZA 1V93A 2WHKA 1EP3A 1GVYA 5LHEA 2D0HA 3CIWA 4PMVA 1JAKA 3LCHA 3USBA 2XM1A 1Y65A 1EP1A 1M53A 3TVAA 3NQAA 3WMCA 4E3VA 4XTDA 3UGVA 1BLIA 1UWIA 1O5XA 4RDZA 2CKSA 1ONXA 3EKGA 4MNJA 1WXZA 3L5MA 3TYEA 2FKPA 3T4CA 1H1ZA 3M7WA 4J2PA 1EJRC 1SO3A 4HGXA 3V0SA 1BGAA 4WKHA 4TU1A 3PM6A 4O1CA 2GQ3A 1N8IA 1H1NA 2MNRA 2NLIA 3O9NA 4Q4PA 3KP1A 3W7NA 4RE2A 4HNCA 1UUMA 1C3FA 2DSUA 2WC4A 3SCUA 2BV9A 4ROPA 8XIAA 2VUNA 1J5TA 1KTCA 1F2JA 2C14A 2HTMA 2VXNA 3TWAA 1ZCCA 1WDWA 1W1A1 4KRUA 2I57A 1ZJIA 3W4RA 4YNGA 3SCTA 4GVIA 3E0LA 2A21A 5BWFA 3TTYA 3PPGA 1XJBA 3EB2A 4JYFA 1FWBC 1CT5A 2A7PA 3CZGA 2C1HA 3JZEA 5G2WA 3OGVA 1DJWA 3UZJA 3K8MA 2E67A 4IM4A 3OG3A 1SO6A 1FCVA 1MEIA 3C86A 3CUJA 4C7DA 1YE6A 2DSWA 4RV8A 3V0TA 2Y70A 4DZHA 1TPWA 1XBZA 2EEXA 1DQWA 2J75A 4WSHA 2J25A 4UCFA 1WZAA 2CFFA 3BLPX 5FCZA 2UY2A 4HOWA 4Z1BA 3AALA 4CU8A 3LCLA 3TOYA 3UD6A 3VC5A 3P0XA 1KLZA 1TJ2A 3BGAA 3VDGA 1E43A 5LNWA 5A69A 4YCOA 4AVFA 3UJFA 1I0DA 3QH2A 4ZO6A 4W8BA 5CEWA 4NI8A 5EPDA 1BKHA 3WQ4A 1VF8A 3HG5A 3GAKA 1GK8A 3B97A 4HNOA 3UWEA 2RHGA 1WQ5A 4A35A 1G01A 1PIFA 2YA0A 5CC3A 4NYUA 1RCOB 2GQ9A 1GEQA 1EEPA 1E1CB 1F4HA 4AF0B 2PCQA 4AD2A 3ABXA 2G3JA 1Z42A 1PZ0A 2AL1A 3D46A 2XGBA 3BC9A 5I2UA 3D5HA 4JFUA 3MHUA 4AZ5A 4TVDA 1ME7A 1MZRA 4KBXA 4BI7A 1YNQA 1Q8JA 3KBMA 4O17A 1F6YA 3UESA 2QJNA 1WA3A 3TR2A 2WWCA 3U3HA 3WNKA 4E4FA 3GUGA 2DW6A 6REQA 4C60A 1X98A 4A22A 2OLHA 3MUIA 3KVMA 4BWLC 3W74A 1DXEA 2BODX 3VMPA 4GX9A 3MZNA 3RRXA 1YQ2A 3EX1A 4LB4A 4HJFA 3GW3A 1Q4WA 1Z89A 1CENA 1KM2A 1B5TA 2J7FA 2PDBA 3ZOAA 4Z0JA 1LOLA 3NEHA 3GLCA 1C9DA 4RPPA 1YNPA 1Z32X 3MJMA 3TQVA 1JUBA 1VZWA 3BVJA 5AC4A 2VC6A 2BOFX 1D3GA 3TXVA 1W2PA 4HP5A 3E49A 1F3XA 4JTKA 3W38A 1E71M 1ZHAA 3MSDA 2NQZA 2WQDA 5FF3A 4D6GA 1TPFA 1BWLA 3GZ3A 3TLLA 1P6BA 1OD8A 1XLCA 2QCDB 1LWHA 3C0QA 4XIAA 1PX4A 2J4GA 3BOLA 3T81A 2C1IA 1LBMA 9XIAA 1MFVA 1M41A 1Q6QA 2EKCA 2Y7GA 4NYYA 4UTMA 4ZQMA 3GC5A 5M2FX 4EK7A 3TTEA 3GXNA 3MJYA 1V3JA 5E0CA 2VQUA 1JCXA 4ZCWA 3QOKA 2HBXA 4HSNA 4I6VA 5AZ1A 3OA5A 1IZJA 1SR9A 2PC4A 2VD8A 3IRSA 3FGCB 1EWDA 3AS1A 2W0UA 3T0AA 1X6LA 1HG3A 3I7RA 1G4SA 4M7TA 2PSNA 3U6WA 4IH3A 4JNYA 4XD3A 3WMLA 5I3HA 3W7DA 3NZQA 3KOZA 3WLJA 2NW0A 1I45A 2DZTA 2J79A 3V36A 3JZUA 3LV6A 1J0JA 4O1EA 3NWRA 4C1NB 1S46A 4Z1DA 1IEWA 5LNUA 3CUIA 1XD0A 2CLIA 3THAA 4EPKA 1K02A 4LVDA 3DENA 1SJAA 1A5BA 4J3TA 2ZOXA 1EC9A 1T5AA 3G2GA 2PGRA 4KESA 3KRUA 3T0BA 4LC8A 4L5ZA 1TUXA 2W4XA 1ADOA 5FOOA 1B9BA 2ZZ3A 1IXOA 3V18A 3MUY1 4PEEA 2PBGA 1HJVA 4WKAA 3GFZA 4XZ9A 4DWSB 2XN2A 3EYPA 1E0TA 3E2VA 5XIMA 5CSUA 3GR8A 2C71A 1BPLB 2OR2A 3R12A 1CDGA 3CLWA 2ZRYA 5PTDA 1RLCL 3GBDA 2BY2A 4TQTA 1YDVA 1Z7AA 4YTTA 5M3WA 2BOGX 4Z42C 4F0RA 3AZRA 3HG2A 3C56A 4M6VA 3W2MA 1NEYA 1EO5A 4RDWA 4J4KA 3QV8A 3W82A 1GVEA 4D6CA 3MSYA 2FYMA 4EXAA 3NPWA 3EPNA 3FX4A 1SJBA 2VFDA 3TROA 3QHOA 1G7VA 3THCA 1VFLA 5AYXA 2ZVIA 4FF7A 3TSBA 1ECQA 4LXFA 3GWQA 1JZ8A 3TYUA 1GEHA 1FHUA 4GY0A 4IP7A 4AZHA 1FDJA 2OYKA 1RSCA 1KBIA 1OYCA 3BZGA 1UJQA 3WDPP 4UNKA 1OWQA 1EGVA 4I5XA 1MO0A 3D0CA 3CJPA 1ZFJA 2CNCA 1FXQA 1XSJA 2A3CA 3FKRA 5ABTA 1HP4A 1VH7A 2GPTA 4CN1A 5FESA 5D8ZA 4NZ3A 4NI3A 3S5NA 4A3UA 2AAMA 5BOEA 4J3ZA 2QDGA 1WE5A 6REQB 2EPMX 4GQQA 4FLSA 3TCEA 5SWUA 3BANA 2ZRXA 5C2XA 4KKXA 3D47A 3U7BA 5ABGA 2Z27A 1S5MA 3C8FA 1AH4A 2FGBA 2X7WA 3AWNA 4JEQA 1ITXA 5BRBA 4M0XA 1CECA 1YPFA 3AHZA 3S5OA 4BFAA 2ZRWA 4YVXA 4JTFA 3VGGA 1H4PA 2PBOA 1HZYA 2VOMA 3GQYA 5BYWA 3SCSA 2X0HA 4CVWA 5HJXA 1CPUA 1LT7A 4Q8QA 1IXNA 2PWHA 3CO4A 4UOQA 1DIOA 1OK6A 3NNTA 2YCLB 4GYPA 4FNPA 3T6CA 3BLLA 2Y7EA 2YBVA 4GUJA 1Z6KA 4M7SA 3IIVA 2VFHA 2A4AA 5JUVA 1NSJA 1BEUA 3MA8A 2V3FA 1UR4A 2YIHA 4FALA 5F4SA 3GZAA 3O2LA 1YXYA 4UFKA 2WZIA 4C6QA 1N55A 3B9NA 1GQKA 1TELA 1Q6RA 2QCMA 4PUKA 5JH2A 4YTRA 4K3ZA 1H3GA 2B7NA 3DECA 4Q8WA 3EWXA 2DDXA 3D3AA 4XAZA 5GNYA 5A8QA 1UOZA 2GWGA 3M47A 5EMUA 1PAMA 1VYSX 3RN6A 3LLXA 5D37A 3WJZA 4JOMA 5HNNA 2J78A 1BSIA 3VX1A 1J8VA 5A6LA 2W79A 2AKZA 1EP2A 2HVOA 1E0UA 2GOKA 3WK0A 3NOYA 2R14A 1OFRA 3CM4A 2J24A 3IIOA 1UHVA 1MQQA 3KS5A 1YIXA 2QT3A 3G22A 4A2RA 2GVEA 3SRDA 4WEVX 1VLIA 4H9TA 2Q02A 3AUJA 3MB9A 1E6XM 3E38A 3Q67A 3T0TA 3MI6A 4M6PA 1KV5A 1VFOA 1F9CA 2Z6IA 3VIMA 3AZTA 4I8DA 1ZLPA 2JQXA 4GJ1A 4LAKA 3VIOA 1XYFA 4C6NA 3M0MA 3NXLA 4QSHA 3LMYA 4YN5A 4U10A 1GKQA 3AYRA 1YBQA 4RDYA 1BQCA 4AEEA 3L65A 2CHOA 3OO2A 3WNPA 1YTEA 1W3LA 2VURA 1QFEA 1LQ2A 1XBYA 3F1QA 3L23A 3OZOA 5JVLA 2A2IA 2VQTA 5AZ0A 1WXJA 5GVJA 1T40A 1M65A 1A3HA 3HG3A 3R13A 3B40A 4JIEA 3W6MA 4JX5A 3GDKA 1C7SA 3P3BA 3OLIA 1HJQA 3BAXA 2E25A 3ITVA 3IPWA 4JDYA 2YCIX 5I09A 4H19A 1NF7A 3GR4A 3DGBA 4E2VA 1QJWA 3ITGA 5GPRA 2Z4GA 1VBRA 1EQPA 4ZFMA 2GSHA 3RYSA 1ELSA 2A85A 1MDLA 1UD4A 1TV8A 4J2MA 4F0SA 3IIPA 2BASA 4OBTA 1CXIA 5BRQA 2XH4A 1M7PA 3L4YA 4YHGA 4Q32A 3IAPA 3L4VA 5JBEA 1EPXA 1L2UA 2P0OA 3WL1A 4J3UA 4MY9A 3PG8A 2Y63A 2DUXA 5HAOA 2PTWA 3KZPA 3R6IA 2E6FA 2QCHA 2O9TA 4LYQA 4E3TA 3EWBX 3TSMA 1EFZA 2XM2A 4HA0A 2EQDA 5BRPA 4IPJA 3AWOA 1AH3A 3P61A 3BWWA 5EU9A 3WF4A 2ZX6A 3IUHA 4EPEC 3ZLFA 2FVMA 4O16A 2E8ZA 2V3DA 3LM7A 4LRSA 1GPFA 3N6HA 3ZT5A 4JN8A 2P8CA 3U9IA 4KF1A 1LQAA 3NQDA 2YDAA 3BDKA 5BOOA 5JBDA 3G8RA 1XLMA 1DVJA 4KCTA 1E4NA 1YMYA 3CTTA 2ZX8A 3VO0A 1UPMB 5I79A 4Q33A 1F05A 1E51A 2NWRA 2ZZ4A 2FB2A 2JKPA 1E4IA 5TD4A 1UBSA 4LSBA 2PRLA 2FTPA 3MP4A 2X30A 1HT6A 3ZR5A 3UA4A 1V03A 2GDVA 3CEPA 3M5YA 3BG9A 2OSWA 3VNLA 4UOJA 3OHIA 3LRMA 3R25A 3UZ5A 3CYVA 3W26A 4H9ZA 4V2XA 2BGNE 2R94A 4GYKA 3N29A 3W1TA 5HXMA 1S2UA 2WLZA 2A0NA 3SN1A 4E2DA 2Y8KA 3G1AA 1V51A 4GVGA 5I3DA 2W62A 4J40A 5HMFA 4NL1A 2VVNA 1N8WA 4GI6A 2X1SA 1FWRA 3UG4A 3EA1A 3Q94A 3FJNA 4AQLA 4B2DA 1NH6A 3UPMA 2PDNA 1GOKA 1OABA 4CD6A 3TXZA 2R1MA 4ADUA 2OGYA 1LL6A 1A5CA 3UWUA 3VYLA 2FZBA 2WJEA 5FEPA 3VAVA 2Z7GA 3QV9A 1LLWA 3ARSA 4O0ZA 1CLXA 4Y8FA 3ME3A 1O94A 4A21A 2NQ5A 3BK0A 5IM51 1PTAA 1MQRA 2VCAA 4QAWA 5C9XA 2BDQA 2WZEA 4FXSA 4UXDA 3LBMA 4H9VA 3DXIA 2DT3A 4GUIA 5I24A 2VENA 2DUAA 2ISSA 2WVVA 5I78A 3KM8A 3SQSA 1YYAA 3DG7A 4GC3A 4N6FA 4MWAB 1DORA 3IAQA 2ZRUA 5FIPA 4UTTA 1KWGA 5LGXA 3GVWA 1XLIA 1XIIA 2VC5A 3JRKA 4WXZA 3G1HA 4W7VA 4DBEA 1AL8A 1V3IA 4FOJA 3A4WA 1VIWA 5B80A 3OVPA 1TV2A 1GYLA 2HPMA 4N4PA 2VEFA 4Q6XA 1B3WA 1A0CA 1YKWA 4C7GA 2I17A 3OP2A 4LH8A 1SMAA 3KLLA 4NUWA 1E6NA 2V68A 3QOMA 1IT8A 1JUEA 5U4NA 4JNZA 4GNVA 2GGIA 3FA3A 1BG4A 1WXYA 3OLDA 1HQTA 4DBSA 2AL2A 3II1A 2EO7A 3L66A 3AS2A 3LNMA 1TA3B 1BXCA 3PZMA 2VDIA 3PZTA 1H5VA 1XG3A 2E7FA 4WDXA 2FDSA 4PCPA 4ORIA 1TJ1A 4HNVA 3S9YA 4DO6A 3PNUA 3S6DA 4CGTA 1ADSA 5DQPA 2QXWA 4AZGA 1OGGA 3GXTA 1W3HA 4GINA 2QJIA 3I6EA 4L6DA 5FAGA 2PI6A 5K9CA 4DO7A 3C2EA 1XPYA 3LHUA 3TC3A 4O13A 1J18A 1FWEC 4RX0A 2DZAA 1Q3NA 3VM5A 3SRKA 1RLDA 3CL6A 4HNUA 2W9MA 3EKZA 1MW1A 3RR1A 4Y7EA 4B91A 1FKWA 4UMCA 3LDVA 3OBEA 1RQHA 5ABEA 2XIJA 3TH6A 1T8QA 4KWSA 2I1OA 1GUVA 4AU0A 2VOTA 2VZVA 4M82A 4GGHA 4TMCA 2ESCA 3E5PA 1HL2A 3EOSA 4IT1A 3WF0A 4C6CA 4OIFA 1GYNA 2XH0A 1EA9C 3TQKA 4U31A 3AJXA 2V0TA 4IG2A 4ECLA 1RY0A 1TWIA 5EY5A 3LEPA 2PWFA 4W5UA 5HMSA 1W32A 4I3GA 2WXDM 1JPMA 3ES8A 1F3WA 4HBKA 5EKYA 5A8GA 3O1NA 3N6QA 4PMDA 4TUFA 3LTYA 3K4AA 1E9IA 3APGA 4GGBA 4MTVA 5LKYA 1JZ6A 3GVRA 7REQA 4IUOA 4N7QA 5AECA 3CT7A 4S38A 1G4EA 3WQPA 3LPOA 3SSJA 3R94A 2FH6A 2VR5A 1Q8AA 3ORWA 5GQBA 2NX9A 1XV8A 1EJUC 3I7QA 4OT7A 1B1YA 3DGRA 1F7BA 1F8IA 1VR6A 5BU9A 1W1IE 1DTUA 1UROA 4Z1AA 2CLFA 2PDFA 4H6EA 4U5IA 4Q4KA 1E72M 1HN1A 4LV4A 2Z7KA 3HFTA 2YOCA 3WH7A 3B0UX 1KXHA 3AAMA 3FGCA 1JCJA 1RVGA 1JD7A 3GKAA 3H2NA 1UR0A 2QNEA 3FDKA 3KBSA 3RPTA 4MJZA 4G5DA 4UTTC 3B0XA 1JR1A 4FA3A 3ZT7A 3O0KA 1NVMA 5C7VA 4ZQRA 5HMEA 3W29A 3RRAA 3WLRA 1I6NA 3RO8A 4MY1A 1NIUA 1EZ2A 1VFTA 4WY0A 3W0KA 3B05A 4L4PA 4I7VA 3MDUA 1FH8A 1PPIA 3W88A 3GVGA 5D9NA 1OADA 4GJJA 4W89A 1A49A 3QGKC 4ZVJA 4ADTA 3U4FA 2VEKA 4LUSB 4XZBA 3OZPA 3AS3A 1LTDA 3T8QA 2VHLA 3WJWA 2VGGA 4B16A 1H0IA 1JULA 1H7XA 4GLEA 2RDXA 3T9PA 1NARA 2RJGA 2CESA 2WC7A 3W01A 1V77A 3DFSA 1ZJBA 2ACQA 1TMHA 2WSKA 4JTIA 4MLRA 1VQTA 4N9EA 4C6BA 1FVPA 4DPQA 4QRNA 5HK4A 1NDWA 3MWAA 1Q66A 1SMDA 3QVQA 1ZUAX 2EXOA 3NSXA 4UZSA 3RDKA 3VOHA 4UTUA 2LLEA 1P7TB 1A4MA 4WXYA 3F4CA 1KM0A 1T96A 4Z2GA 2V69A 3H22A 3NEVA 2V2CA 5KZDA 1OCJA 4CQ8A 3FXGA 4DWSD 1OX4B 4Z1CA 1M7XA 2EPHA 4EXBA 1WDQA 4AVOA 3K30A 4WD0A 4XSLA 5CAKA 4ZTYA 1TYGA 1UA3A 2Q09A 3WJSA 5A8NA 4H8VA 1H09A 2ABAA 3WDRA 3IRDA 3CT2A 2C3ZA 2NV2A 4CU7A 2DZSA 3VXGA 2UWFA 3TAOA 3MT1A 1KWKA 2XH2A 3VOIA 1R3VA 1G0CA 1US0A 1D9EA 4DBUA 3SEPA 5I3IA 5EMJA 1SFLA 3MP5A 1XQLA 1AJZA 3CWOX 4DJFD 3CHFA 4CNUA 3BMVA 2HNEA 3IIXA 3FVDA 1KCLA 3DEQA 1FP8A 2F6UA 2VFGA 3LZ5A 3QLLA 3N2XA 1F61A 3WF3A 4RE0A 1M04A 4HNLA 3TE9A 5AYZA 3F03K 3OVQA 3SN0A 2FDMA 4LVGA 3MBFA 1ZBCA 2IQ0A 3UG5A 1B2YA 3RAOA 2J8TA 4AXNA 4GVFA 3CPUA 3LCGA 5AC7A 3PTKA 1E73M 1ZBKA 1YHTA 2VX5A 1HIZA 3KOFA 2NQ9A 2PUZA 3V5OA 4S2BA 2ZDSA 3MUZ1 3EPMA 5JQ9A 5C71A 5CPLA 3IS4A 1C9WA 1EWEA 1W56A 2J7EA 3SADA 4PUNA 3U2ZA 1VEOA 5JMUA 3WLNA 5LGZA 4BQ2A 4V33A 3ATZA 1W3JA 1OZMA 3L2MA 4QISA 5DT7A 2Y7DA 4CN6A 3PF3A 2NUXA 2XVNA 1HKWA 5T91A 1DP0A 2ZFAA 2ZYFA 3N11A 1QK0A 3JW7A 5LNRA 2A79A 4JHOA 4W9TA 1XLLA 1HO4A 1SFTA 2Y89A 4LBRA 5AVNA 1THFD 5M5DA 3BO9A 4B92A 4OZOA 2V5KA 3KVLA 4QS6A 1U1HA 3QZAA 1WKYA 3EBVA 2Z1XA 3PSVA 2WKLA 5EMKA 3U48A 3HGSA 3O6CA 1LL7A 2IPFA 3VCNA 1UWSA 1TKKA 4XIMA 2G97A 3FSTA 2IUZA 1V08A 3QN3A 3SRHA 3ITLA 3RUBL 4LAOA 4GABA 1MW0A 4W5ZA 2Z1KA 4M80A 3BW2A 2DVTA 5HUOA 4LVAA 3GX9A 4EKJA 3FN9A 2ZQ0A 3LSCA 4HN4A 2QUMA 1JCLA 2C7FA 4CQAA 3W7MA 4F9DA 3T4WA 1QATA 1Q85A 1BQGA 4NJJA 2ATSA 3GSMA 2PE4A 2QCGA 4QP0A 2YA1A 1O1ZA 2EPOA 3W7QA 3T1GA 3WEOA 3CPGA 3O6YX 3W1PA 3FKKA 3C2FA 5E1QA 3LV5A 4J7RA 1DJZA 2W92A 1OG6A 3PWGA 3QPYA 3B8SA 3HPFA 3CV7A 2Y5JA 3CMJA 3QSRA 1OGSA 1TZ7A 1SR0A 4Q8VA 5T8GA 3F2DA 2Z25A 5AYYA 1SFJA 2E1DA 3A9IA 1CZ1A 3DI1A 2V6AA 4BQ4A 1PUDA 2D73A 2IPJA 2RGMA 3U7VA 5DCDA 3QLDA 2JGYA 4AHQA 2WMGA 4ATDA 2XIIA 1FCBA 1R5YA 1M68A 5JXQA 1TPH1 4B5UA 4OV9A 4ZZ9A 4I9JA 4MMWA 3GHTA 5F1UA 1EQCA 3ZT6A 4HA1A 3IJ6A 3UETA 4AD5A 2Y7FA 5CLWA 4WY0F 1W9XA 3RX4A 4D9PA 4OOUA 1EHAA 1AQ0A 3H55A 2GL5A 2VDHA 3EXSA 3R8HA 5L9FA 3BAYA 3MMUA 3STCA 4MWAA 3EX4A 3C2OA 1NDVA 2AGKA 1JXJA 1WOBA 3M9YA 3RXZA 1WBHA 2E6AA 2J66A 5A8MA 2VUYA 3WG6A 3ITCA 4L64A 1B3ZA 3LLDA 4CCCA 1K4HA 3ARTA 4LYRA 3QR0A 3DKJA 2D3NA 2PTZA 4BF7A 1S2TA 5JBFA 3LY0A 3R1ZA 1MEWA 4ASTA 3ZVIA 4KRTA 1B9ZA 3M0IA 3LX9A 3CV2A 1NOUA 3VNJA 3CV6A 1EYWA 1YNYA 4BR1A 3PFMA 3GNRA 5EBUA 1VJZA 2PC8A 4FIQA 3MO4A 4H4IA 2E9LA 4YHEA 1QPQA 7TIMA 1B3OA 4TX6A 4FZIA 4BHYA 4LF1A 3BMWA 3VNZA 1PYMA 3RX3A 1O95A 1IZCA 1UWAA 3RX2A 3NQ7A 1PXGA 5FD0A 5DELA 1J01A 3ZSTA 2QMKA 4WIWA 2ZDRA 3RLVA 3A12A 3IK2A 3QGVA 4NZCA 1NFPA 1J0ZA 4N6EA 3APYA 2YBTA 3GM8A 4L61A 4QR6A 4DF0A 1TSIA 4DNMA 4V15A 4K36A 3B8UA 3S8HA 1V4YA 4WJXA 2NT1A 5DXYA 4RL3A 2WMIA 4KWVA 4ZO7A 1OHLA 1XLKA 4GIAA 3A5FA 4HHMA 4R88A 1I2NA 1IYXA 1QW7A 2ISWA 2DH3A 4JKLA 4DELA 1BVWA 3CTLA 3K1DA 4ICMA 2GUBA 4G56A 1TE1A 1R2RA 4PMNA 4EF9A 4OVXA 2PTYA 1W3IA 4UFJA 4POCA 4AY1A 2OO0A 2TAAA 3LQLA 4P2VA 1WAWA 4GQRA 4NAFA 1EF2A 2IXVA 3WDQA 1EC7A 5F2IA 1OEPA 3NVTA 3WK2A 4QHRA 5EBAA 3TU9A 3VKCA 5HOSA 4NP7A 3PJTA 1C7TA 3H53A 3FNDA 5AN7A 1FWCC 1XRVA 4QQUA 4DJED 4UQ9A 5CSRA 2GDQA 1QI3A 4XV0A 2GVGA 3GU2A 4JTGA 3PB0A 1TO3A 1V3HA 1FY6A 3TA9A 2QR6A 4G1NA 3WF2A 1EO7A 3UCDA 1KXVA 4PE8A 3ID7A 1EJTC 3NVDA 3LM3A 4KEMA 4UWMA 4MJMA 1H61A 2NUWA 3A13A 3FJ6A 2GUUA 3TFCA 4Y6GA 3A3HA 4JL2A 3MVIA 3TW6A 3NPVA 5TIMA 5G4EA 3C2VA 3QKZA 2YW4A 3XISA 3MBDA 3WSUA 1JI2A 1Q65A 2J8GA 2PZNA 1PVNA 1FWGC 3Q4DA 1V0KA 4XG1A 2JGQA 5KZEA 5ABFA 3RCYA 4QITA 1RJPA 3S1WA 4RNHA 3OBKA 3ZFHA 5CG7A 4GQBA 4G7FA 3N9KA 2VRQA 4Q3MA 4XUYA 5AHEA 3F4VA 1U2YA 2UZ9A 3I10A 2I5QA 1V79A 1LRTA 3CXOA 9XIMA 2INEA 1R3SA 4JZ5A 3F7JA 3LCWA 3HM7A 3W70A 2XUCA 3IUIA 4C65A 4MNKA 4MYAA 3H2AA 1J10A 4OKDA 3GE7A 3GDMA 2GJNA 1ISYA 1Q6FA 1H7WA 1RA0A 4QJ1A 4D72A 3QKEA 2WZMA 1TJRA 1QASA 3RMJA 3LLFA 2Z26A 3MW7A 1ADDA 2A1YA 4PTNA 3MUXA 1JZ4A 1GHRA 4PCSA 1UG6A 1DJXA 3H2OA 4AFYA 4ZENA 3W9ZA 4J5NA 4MGGA 3FDGA 2VO5A 4CNNA 2CWNA 3TSDA 3VIPA 3SCRA 1XXXA 3W28A 3GXFA 3TQ0A 3VD9A 1S5VA 3SW6A 3A4XA 3SUUA 3BW3A 4CKQA 4UQCA 1XH0A 4M81A 1WCGA 3S2MA 3G0XA 4FPSA 2NUYA 3M7SA 5DY3A 1F76A 1XDMA 2BVWA 5CGTA 3ZIZA 4D1JA 2F7FA 2VYOA 1RBAA 2NSOA 2D0FA 3H21A 3H8AA 4L1XA 3E74A 1QOPA 3HZ3A 4BCEA 3BJSA 4NU7A 2WANA 3CUXA 4ZE4A 2UY4A 2Z28A 4AEOA 2YDQA 4EWJA 4K8EA 2E77A 1HJUA 4JX6A 1TVLA 4XAPA 4FF5A 3USZA 1EDTA 3WX7A 5BMWA 5G1TA 4C7FA 2WSYA 4C6DA 5A6BD 3RLUA 5LXEA 4EVZA 2Y24A 4PTXA 4V1YA 5D9OA 4IIBA 1B0IA 1R8LA 3N9RA 4IL2A 1FP9A 3V7PA 3W86A 3ZJ8A 3CQHA 4XISA 2PWEA 1C93A 4LAMA 5IBXC 4Q4RA 1CCWB 2ACUA 1XCXA 3EMZA 3MCMA 3GDLA 1MMFA 3V5CA 5CZJA 1V3LA 4HPGA 1TQJA 5HANA 5C2GA 3KOYA 3B04A 6PTDA 2JF7A 3DFTA 1Q4NX 3OLGA 3KUMA 3BLFA 4CU6A 4PUEA 1ZAJA 3ZVHB 3NG3A 2XFFA 2B4GA 1XICA 3M4HA 1WKDA 2OPJA 3QC3A 1F73A 1JIBA 2QEZA 3I68A 2PDGA 4GIEA 3AHTA 5D2XA 1C8YA 4D6IA 1DTNA 3FCPA 3QTPA 2Z1SA 3U2EA 4JQ2A 2VT0A 2G50A 3NOEA 4DAFA 3NZ1A 2Q71A 4OUIA 4CEUC 2EPNA 4FS9A 1GORA 3DOPA 4IMEA 3R11A 4YMZA 2YL8A 4HA3A 5IRPA 1UKQA 1BVNP 8XIMA 4CNPA 4ZEPA 1V6VA 4JTEA 1PV8A 4GUGA 3MTWA 4H3DA 3H54A 3R8RA 3P7YA 1UASA 2OT0A 2WNZA 3AMLA 4H83A 1ONWA 1UPPA 1AVAA 2J7DA 4KH2A 2V5LA 3VIKA 4URIA 2VWSA 4DLFA 4QE5A 2VCCA 1CLKA 2AGTA 5D2WA 3G3MA 2CBIA 1GOWA 5TNVA 6XIAA 2DIEA 1Q63A 2EG7A 1QPKA 3RG6A 1BTCA 3S6TA 3ZQ9A 4TX9A 4XAGA 2VCBA 1M03A 4R33A 1SJCA 3HOJA 1CGXA 1IE7C 4MVAA 4JIQA 1MDRA 7TAAA 1R2TA 1NU5A 1IWPA 3ZVHA 3WQGA 2C16A 2G3FA 4L9YA 3VC6A 5DRIA 4B5TA 1QHPA 5DBUA 1KBKA 1H7OA 1A0DA 4DO4A 2PODA 3CH0A 4IJBA 1OYBA 1IT0A 4ZOBA 4A3HA 5T26A 2XSBA 4GFSA 2KX9A 4HT3A 1TQXA 4IQDA 4Y9PA 3QFWA 3OPSA 3S47A 4O1BA 4Y9AA 1UQYA 4TMBA 5C7HA 4HU8A 4NASA 4O54A 4PODA 5AC5A 3NCOA 3WLMA 3CHVA 3UR8A 3O7UA 2X0SA 4KETA 4CQCA 3FHQA 4B90A 4AIEA 4IQJA 2D1ZA 1VKFA 3S2NA 4HHHA 5BXRA 1UH2A 3L21A 1SM9A 1TTQA 4MZ1A 4QLLA 1N8FA 4D6HA 3TAKA 2E28A 2VTFA 2QUUA 3CAVA 4E6MA 1E9YB 4JYDA 1GOIA 3H2MA 2QGYA 1YEYA 4G2DA 5BXTA 3B9OA 4JX4A 4PUWA 1SW3A 3RILA 4LC6A 4B15A 2JKAA 1GHSA 3T55A 1KR1A 3M0ZA 3VGHA 3L4XA 5CXPA 1KFWA 1F74A 2OT1A 2IKIA 2CERA 3ARQA 4I8YA 2PDJA 1LRNA 4LPCA 2Z2AA 3DFPA 1XDLA 4R5EA 2DUZA 1WZMA 1XRFA 4KPLA 3BCJA 1ZPTA 1UD2A 4S1FA 3KCJA 3CIVA 3B9DA 3GY1A 3RGTA 3YPIA 3V75A 3NDYA 4H04A 9RUBA 1FX6A 3WNOA 1PS9A 3TIMA 4HN8A 3T0DA 2DSZA 4L9XA 3NL3A 3T09A 4IIFA 4MWAE 3UGRA 5D9PA 4DXXA 2Q3RA 4IFOA 2CLHA 1U5JA 3NQVA 4BZYA 3T2QA 2J9ZA 1J0IA 3CLMA 2QQ6A 3GNPA 4K1WA 3SECA 2H9AA 1ITCA 2QGHA 1ZQ5A 1IIHA 4P5UA 2FHBA 3CL7A 3RITA 2EJAA 3VIJA 3A6OA 7ENLA 2WMJA 1H5YA 4R7OA 1OD0A 1MFUA 2V3EA 3HV8A 5CJNA 4YIWA 4GE8A 1UR1A 3INPA 3C0JA 4OWGA 5FEZA 3THQA 3GH4A 4GH1A 3FV9A 3EDEA 1B54A 4G7EA 4Z0SA 4MADA 4CLMA 1LOQA 3LHTA 1F3EA 1VGAA 2WBGA 3ANUA 1LUCB 1ZSXA 3ANYA 5D05A 3C8NA 2EAWA 2Q8ZA 3NAVA 1F6PA 1VENA 2YLAA 3CQ0A 5F2MA 2W67A 3NL5A 4JICA 4FOKA 1YDYA 3GG7A 4RE3A 5FJPA 3GNXA 1RD5A 3O07A 3S5ZA 3U57A 3VKBA 2PD5A 1XIFA 3WBXA 3XIMA 3PWIA 2BY3A 4IP4A 1UUOA 3B8TA 3CNYA 3AC0A 3TQPA 4U33A 1OCBA 3KWSA 1DIEA 1X8FA 5EMYA 1GOMA 4I90A 1XW8A 2J6XA 3H7VA 4UNLA 4ZOEA 2FPTA 3WNLA 1UWTA 1CWYA 1MRQA 4OQVA 5DFAA 2REQB 4XUGA 1BD0A 3L0KA 6ALDA 4BF9A 4IG2B 4F79A 5CKSA 1JFXA 1UUQA 3BICA 3P81A 1SJDA 2ZUWA 2XN0A 4PB3A 1DIDA 1V6WA 2YCEA 3W22A 3FFSA 3W1LA 1Q45A 5C54A 4MIMA 1JPIA 4C90A 4W86A 5A1AA 4I9AA 2VP8A 2PRHA 1JYNA 4E4PA 3W71A 4W85A 3CASA 3WLTA 3I3EA 2VFFA 2HNHA 3NO3A 3UJSA 3F4NA 2WB5A 1KM5A 3LOTA 2PU1A 3GK0A 1QPNA 4KCWA 4PB4A 2WWDA 3GNDA 4WLCA 3M1ZA 1HKMA 2C1GA 3TK7A 5DMLA 5E5CA 1XX1A 4NNCA 2DW7A 1U83A 3WQ8A 2F6XA 4DYEA 2IW0A 4F8XA 4KIEA 1EB3A 2O92A 2OTDA 1OC5A 1KKRA 1VFHA 3M43A 1KM3A 2HVNA 4ZOCA 3WJYA 1N2VA 4IP5A 4DJDD 1LYXA 4JBRA 3AYVA 3WF1A 4GBUA 3VOFA 4Q8NA 4XZNX 4YVPA 3UR2A 2OCZA 2PGEA 4S3BA 4EX4A 1A4LA 3M0VA 3MDWA 4DJEA 2PFHA 2Z1VA 4IXHA 4IQLA 5FEWA 4GA8A 4PMXA 5CH9A 3POHA 1OVDA 3CL8A 3NSNA 3V4BA 1CGVA 3QGAC 3DDMA 2FTYA 4JTRA 3TYZA 4XAFA 2IXUA 5G4WA 2VL4A 4TV6A 3ZZ1A 4BEUA 2QMJA 5B7ZA 2RGLA 3AYTA 1BGGA 4O4WA 1FFRA 1H49A 3W7GA 3KBWA 2CHRA 1SVDA 1XGZA 1TR9A 4AWTA 4OE7A 1DXIA 2X2GA 2XGZA 1TPVA 1TTIA 3UEQA 2OX1A 2PU0A 3VD4A 1UW9A 5A6SA 3RLHA 4R9OA 1OFQA 1QNQA 4PCFA 1NQ6A 4Z08A 2NVAA 4L1WA 4B5VA 1TTPA 2P50A 5IHRA 3PBUA 4E8DA 3TV8A 3SCOA 3VVGA 4FB7A 3F5KA 2A3AA 2H9AB 1M7JA 1KW1A 4WCJA 4KT2A 2ZUSA 4AD1A 1IR1A 3KVKA 3MI3A 2X0YA 1ME9A 2DU2A 1Z41A 3BLEA 2XIMA 3IJIA 3CH9A 1XLHA 5A8OA 1E40A 1I2OA 1LQ0A 2CITA 3HQPA 4JIRA 5C2CA 3LPFA 4Q8PA 3VIHA 4QSFA 2C15A 4DJFA 2HK1A 2E4TA 3NO1A 4XD5A 1OFAA 4Y96A 4E8GA 3VUPA 1ME8A 5FL1A 3NDZA 4RR4A 1MWOA 1XLBA 1B57A 3EXRA 1MUWA 5HULA 5LIYX 1ZGDA 4E4UA 3RPMA 4HHPA 3W6YA 4KERA 7A3HA 3ITOA 5D9MA 3EOEA 1W8SA 4LS2A 4NY2A 1SO5A 1KXTA 3D6NA 4IIDA 4CQDA 1GOXA 4PGLA 1ZS2A 1QDSA 1XWYA 4GJIA 4DWSA 5AHMA 4XZIA 3VD5A 1SO4A 2D2HA 3DI0A 3BGJA 3QQ0A 4F3HA 1GNXA 1XD1A 1DJHA 2CLMA 4UFIA 2XDFA 3P62A 4WDTA 3P80A 4CCZA 2DPEA 1ISVA 4QDWA 4ZSUA 1RPKA 3M5VA 1OC6A 1JZ3A 3N2OA 4JHZA 3RMEA 4RZ5A 5GJPA 5LYRA 4Q6JA 2DVXA 3TZFA 2IKJA 4JFVA 3PPCA 4ALDA 1TV7A 3ZS4A 4EACA 4YPJA 4ZB5A 2ZX7A 3ITYA 1RA5A 3L5AA 5EFDA 3O16A 3T2PA 2E8YA 4D1IA 1ICPA 2OG9A 3IK4A 3R89A 4KCVA 4JY8A 2VRKA 1EDGA 3ZJ7A 3STEA 4AIOA 4BS0A 1BYAA 4JTSA 4CEXC 1DWAM 1VYRA 3E6EA 7PTDA 1D7FA 3P6LA 4JTQA 3AOFA 2V3GA 4QJ3B 4XSMA 3V1PA 4XVDA 3W7CA 3R79A 3CUZA 3GTNA 4UC5A 3H70A 1PZ3A 2VX6A 1A5AA 1EOKA 2ZUVA 1MEHA 4XO6A 4ZO9A 3NQ6A 4XWUA 4DEFA 2C79A 4DO5A 1KKOA 1XKJA 4MSSA 4UFLA 5D38A 3QM3A 5EL1A 1DOSA 4EAYA 2G37A 4QE4A 1VYPX 1Q6CA 3BJTA 3QFEA 1O12A 1H50A 1XIHA 4ATWA 3AO0A 1EHNA 3S5YA 3DUGA 3NYDA 1D3HA 2Q01A 3ARYA 1JYVA 1JQXA 3RCNA 1CGTA 3BQ6A 1KA9F 1KD0A 1R85A 5K3VA 2FGLA 1FWDC 3NQ8A 2GSEA 1TWSA 1M3UA 2CZFA 2PDQA 3L12A 5I3FA 3TONA 5LZLA 3M07A 1LUCA 3BLOA 1YXDA 4UQBA 4ONVA 2HWGA 3W25A 3IGUA 4W88A 2PLMA 3SCVA 2HCVA 1KTNA 2DEPA 2ZWYA 3FSUA 4LYPA 4KFNA 2AQWA 4KFPA 2YCJA 5LA0A 3W7HA 2V2DA 3AIQA 3W7EA 1CIUA 3VZZA 3VD7A 4DN1A 4AD3A 1VFSA 3DHFA 4RCXA 4M24A 2BNJA 1ZY9A 4DQWA 2VEMA 4M6UA 3L4WA 2CBVA 3N4FA 3S4TA 3KTXA 2E1WA 3KCOA 3W00A 4L9ZA 3MMWA 3N04A 4KMQA 5I7GA 3AI0A 3N4AA 1JGIA 4AYGA 2NLYA 4IMFA 1Q2RA 3VKJA 2J47A 3WZ0E 2X1TA 4HU3A 3FYOA 2UY5A 3UPBA 1G6CA 4WVXA 2QCEA 3WBYA 3QQ1A 5IHSA 3MWCA 4ZL1A 4KW2A 1W1YA 2J7CA 4LUYA 3MO7A 4MKNA 1ODZA 1EUNA 3WLQA 4AYSA 4ROQA 4UR9A 2ADAA 2NX1A 1X6NA 1YDOA 3AFBA 2XFYA 2R1KA 2I56A 3G6MA 5REQA 2GK1A 2TMDA 4C1LA 3QY7A 4WGHA 4LUSA 3N17A 2ZX9A 1U5VA 2YL6A 1FCUA 3S46A 4XO7A 1ZENA 2Z2UA 3SR7A 3WUBA 1Q2SA 3UXLA 3AMGA 4L4OA 3VOCA 2XN1A 3R2GA 1WO2A 1AZ1A 1K03A 2J13A 1IR2A 2YDSA 1FBAA 4RUBA 2GJLA 3O15A 4Q8UA 2I9UA 3AICA 3T78A 1Q6DA 3W81A 3WH8A 1QO2A 1CLVA 1RV8A