1JFXA

Crystal structure of the bacterial lysozyme from streptomyces coelicolor at 1.65 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-beta-N-Acetylmuramidase M1
publication title A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
total genus 80
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfxA00
3AHTA 2E4TA 2C7FA 1H09A 1KQZA 2UY5A 2WK2A 3MV01 1E4NA 4QLLA 1E6XM 2ZXQA 3MUZ1 2YLAA 5JIPA 4N42A 5BCAA 4UFHA 3WD1A 2BHYA 4GZIA 3W26A 1FP9A 1XYFA 1K9TA 3PZTA 2YIHA 3LPOA 1ISZA 1VBRA 2WCSA 4AMCA 1EGZA 2VR5A 3FW6A 3IAQA 1FH7A 1JNEA 1UQZA 1MW2A 5FKYA 3FHAA 3WH7A 3U5YA 4HOWA 3W28A 4BZYA 2CHOA 3WEOA 2WLZA 1DWIM 1V0NA 4UQDA 1J18A 3SCVA 5AYBA 1QOXA 5D4YA 1XSIA 1WE5A 3WMCA 1KXQA 1J0YA 4AZ6A 4RE4A 5A6JA 1JNDA 1QI4A 1Q6DA 2O9OA 2DT2A 3PHAA 1U33A 4AIUA 4IISA 1YHTA 1LL7A 4DUVA 4LX4A 1MYRA 1XD1A 2JF7A 2D22A 1K6AA 2OSYA 4J7RA 5I5RA 1C3FA 3GH5A 4XB3A 1WPCA 2QPUA 3VD4A 4FMVA 2WPGA 2G3JA 4H41A 4GQQA 4WK9A 1VB9A 3LPPA 4PYSA 4Z2LA 4HZ7A 1ESWA 2JFEX 5M3WA 2EQDA 2YL9A 1JD9A 1J01A 1ISVA 5IFPA 1NOUA 1XSJA 1JI1A 3UR7A 7CGTA 5A8OA 1K9EA 2TAAA 1E6RA 2A3CA 1CTNA 3T2OA 2EXOA 5EBAA 1WZKA 1CENA 1GQJA 1V0KA 4CGTA 4IM4A 3B9DA 3F4VA 1V3LA 3RO8A 3UG4A 3ZSSA 3A6OA 2WSPA 2EO7A 4A3HA 1EDQA 2BY0A 2QV4A 3OA5A 1OB0A 3UESA 1CXHA 1TCMA 4CN4A 1OT2A 1JZ8A 5GNYA 1O7AA 4XZWA 1D7FA 1E56A 3VGDA 1B3WA 4H7VA 2ZUUA 4PTWA 1CGXA 1Q6CA 3BXWA 3W29A 1W1PA 3UETA 1IT0A 1GVYA 2FHFA 2XIIA 1LG2A 2ZOXA 4W93A 3KZSA 5I77A 1QNRA 2EPOA 1E5JA 4UQCA 2J4GA 4PMOA 4DWSD 2VQTA 4ATLA 4D6CA 4F79A 4GQRA 2EPMX 2CEQA 4AIOA 3VGEA 3T08A 2XUCA 2MANA 3AS1A 5IHRA 1DWHM 3AMCA 2E9LA 3OLIA 5M17A 4N0RA 2XYLA 4UFJA 1E71M 5CQ1A 2GJXB 3VIHA 4Z2JA 4W5UA 4J3WA 4B3KA 4TTUA 3ZOAA 4GXPA 4CN1A 3SUSA 1PZ3A 1HJUA 5A2BA 1HKIA 2VZOA 3NSNA 4QP0A 1GJUA 1Q6EA 2VRKA 1BHGA 1HX0A 1JYNA 1FHDA 5DO8A 4P8XA 4UFMA 1V6XA 1UUQA 5F7UA 3VX0A 3VIGA 1GOIA 4PMQA 1C7TA 2W4XA 1MFVA 7A3HA 3W24A 2GJPA 1JYVA 1KBKA 1R87A 5HDRA 5DEZA 1TMQA 2X0HA 3AXXA 1W2VA 4DWSC 1ISYA 5A69A 1QI3A 1VJZA 4P7LA 1NARA 3WF0A 2WMJA 1DWFM 1V0LA 5BXRA 2CBIA 1NOFA 3OLGA 4JL2A 3VUPA 3BMWA 4AXNA 1X6NA 2E8YA 2VX4A 1CXKA 5JBEA 5E09A 1K9FA 1HT6A 1B31A 1GHSA 1HL8A 2WVVA 4HZ6A 2IXVA 5FL0A 3ARWA 5HOSA 1J11A 1GNXA 5E70A 3K8MA 2ZXDA 1VJSA 1KCLA 7TAAA 4BS0A 1EHAA 4UOZA 1P6WA 1VEPA 3BAIA 5ABHA 3U7BA 3B9EA 2ZX7A 5E0CA 4Z2IA 4AZIA 1VFOA 4UOQA 1W1TA 1CXLA 3EYPA 1LLOA 2BY1A 4YPJA 4JFWA 1H2JA 5I0DA 4TX8A 1L0PA 1GORA 2D0HA 2CBJA 4W8BA 3WDQA 1QNPA 1TVPA 1W3KA 3O9NA 5I78A 1GQIA 2ZWYA 3WIJA 2AAAA 3MV11 2CBVA 1CLVA 2BFGA 4AD0A 3F5JA 1S46A 1OGGA 5I79A 3WDIA 1GZJA 6CGTA 4H8VA 1VBUA 1KCKA 3L2MA 5CPSA 1QVBA 1KBBA 1WDRA 2BVDA 4YN5A 2V3FA 5JBFA 4UFKA 5CSUA 2XFYA 1OBAA 3WNKA 3QHMA 2VR4A 1GJWA 1V0MA 3GTNA 3WBAA 1W3JA 2CETA 1KWKA 2DDXA 3EMCA 2CPUA 5ABGA 2ZWZA 4B16A 2PBOA 5CPQA 3BLKA 1UA7A 3N18A 2G3NA 2WMIA 1DTUA 2ZUSA 3MKKA 3RMEA 3IJ7A 2WM0A 4CD5A 3N15A 1UQYA 3GH7A 1E1FA 3ALFA 1GUVA 3WNPA 1E6SM 1OWQA 4JKKA 1QBBA 2ZUNA 4HPGA 2CYGA 3SURA 2FH8A 1QW9A 1G1YA 1UKSA 2Y5EA 4RE2A 3GBEA 5BYWA 2PF0A 1HIZA 4MNJA 3A4AA 2VC9A 1PBGA 4M24A 3NUKA 4B9YA 4WKAA 4RE3A 2ZUTA 3T2PA 3POCA 3CTTA 1A3HA 3VIKA 4CUCA 4H8HA 3WD4A 3W37A 4AISA 5HNNA 5A94A 3GXIA 1J9YA 4AD3A 1MQPA 2VRQA 1H41A 1KGXA 4MAVA 2J79A 3IAPA 5A6LA 1BQCA 1RP9A 4PN2A 3ZSTA 5CPTA 1VEMA 4ZENA 3QHNA 1B9ZA 3KL0A 3CZEA 1HL9A 1CDGA 1GOOA 4CCCA 3AJ7A 2F2HA 1MQQA 1FH9A 2UWFA 1XD0A 3CHCA 4K68A 1BLIA 3AIVA 2OSWA 3L4TA 1J0KA 4R5EA 5BXSA 2EPNA 3CPUA 3IJ9A 2O9TA 3THCA 4W84A 3BAKA 1JXJA 4PMDA 3VMOA 3WQ8A 3RJXA 1XGZA 4PSRA 3AMGA 2V3EA 3WL0A 2JIWA 1C8XA 2JE8A 2VOTA 5A6MA 2CNCA 4MB3A 1BFNA 2Y2WA 1E5NA 2BXZA 3J7HA 4BQ5A 4GKLA 3OLEA 3VNYA 2VVNA 2J7HA 3CUHA 1M04A 5EFFA 3FY1A 1XYZA 1UH4A 2WVUA 3AMDA 2EJ1A 5CLWA 1E6NA 4ACZA 2AMGA 4GPNA 4AC1X 3ZR6A 3VIIA 1N82A 2DEPA 1G94A 4J3TA 2XIBA 4U3AA 3ARZA 3ALGA 4JHZA 2WB5A 1AVAA 1JFHA 4UQAA 4Y7EA 3ARQA 4BCEA 1MW3A 1VFFA 3FN9A 1UOKA 4U5IA 3WQWA 5C71A 2XSBA 1FFQA 1ZBWA 3CBWA 2W63A 4MDOA 1E4LA 2DSKA 1X6LA 5AY7A 4DM1A 4GO8A 4LGXA 5CLTA 4AZCA 1UH3A 1TA3B 2WNWA 3T09A 3SUWA 1GQLA 2DSVA 2XG9A 3DYMA 5LA0A 3VDCA 2WW5A 3PZVA 2Z1SA 2E40A 4EE9A 2A3AA 1CWYA 1RP8A 3CUFA 4YHEA 2DIJA 5HPCA 1J0IA 3UEQA 1GONA 1W1VA 3POHA 5EMYA 3CZKA 4ZXOA 4HU0A 4LPCA 4OOZA 1BVNP 1CPUA 4PMXA 2NT0A 3TA9A 1RPKA 1HJWA 4H8UA 5BXTA 1E6QM 3QR3A 3AXHA 2ZIDA 4CD6A 1G5AA 1UD3A 4W8LA 2ZXBA 4TXEA 2FH6A 1QI5A 3WDRA 1TZ7A 1UH2A 2J47A 3VILA 3U57A 2WVTA 3T0AA 4MB5A 3WQ5A 4V27A 3VIPA 4CKQA 4QDMA 3VOCA 1V03A 4LXFA 5GNZA 2EEXA 1M53A 4BQ2A 1OIFA 2OWWA 1EQPA 1PJ9A 1UD6A 1QHZA 1JZ5A 3NSXA 1JDCA 3ZJ8A 2VJXA 1WAWA 3EDJA 1CNVA 4PMRA 1QHOA 3ZO9A 1ZBKA 1KXTA 2Y8VA 1V6UA 1WDSA 4PMUA 4EAMA 1UD2A 3DHUA 3GNRA 3ARTA 1E3XA 2YKKA 1CXFA 3EDKA 4GI8A 1G01A 3BSHA 5ABEA 4E8CA 4UZUA 4QAWA 1EO5A 4LYPA 4W85A 1CEOA 3VX1A 5FIPA 1W9BM 2BNJA 5A6BD 4W7VA 3CMGA 3SCNA 4LYQA 1QNQA 1BSIA 1MWOA 3I3EA 3VTRA 3K4DA 3MSDA 4CD4A 4EK7A 4EANA 1SR0A 3NSMA 4MB4A 4HOZA 1VF8A 1WDQA 3AHXA 3B9AA 4D6FA 4D1JA 2WZEA 3DYPA 3SCUA 3T0BA 4AZGA 1UD8A 1KR0A 1B3VA 1JZ3A 4OJYA 4NI3A 2X2YA 3L4UA 3K4AA 2WWCA 3VGBA 4QCFA 5BXPA 5IFTA 4W8AA 2WMFA 4ZFMA 4DUXA 3WUEA 1HN1A 3M07A 1SMAA 3AI0A 4JFTA 5C8BB 4OOUA 5GPRA 4M56A 4P8WA 2ZE0A 4MB1A 2ESCA 3FNDA 3WF3A 4B3LA 1B2YA 2VX7A 2C8NA 5CZKA 3WUBA 4KMQA 3ZT6A 1AMYA 1QNSA 5I6SA 5DT5A 1XH1A 2VURA 2J78A 4BQ4A 5D9PA 4IPLA 4FLQA 1W9PA 4TX6A 1QBAA 4F9JA 1AQ0A 1W9DM 4TOQA 5CGTA 1OCQA 5FD0A 3WFZA 4AYSA 2X05A 1KWGA 3BH4A 2DQXA 4JKMA 3GZAA 3CZJA 2BXYA 1VAHA 3N04A 4EKJA 2XFFA 3PTQA 1C91A 1BF2A 4WJXA 3OZPA 3PZQA 5IXEA 3W38A 3WD3A 4JHOA 4KWUA 4D6HA 3EDEA 1MFUA 4M8UA 2J7EA 1CGUA 1QW8A 4L4OA 1HXJA 4MTVA 1XSKA 2XVKA 1I75A 1OD0A 1UR2A 2YBUA 2WBKA 3W0KA 3W25A 3WUGA 1SMDA 3APGA 5D9MA 1WDPA 4U33A 4M80A 1NQ6A 3SCSA 2IXUA 1US2A 3VM5A 3QOKA 4MAZA 4A3YA 4W7UA 5HBFA 4ZXLA 3A3HA 4UQ9A 4A4AA 4UQBA 3ZR5A 1ODUA 2J8FA 1EHNA 3NDZA 1M03A 3E1F1 3II1A 2FHBA 2A3HA 3VIJA 4DUWA 3SCTA 2ZUVA 2WVVB 2VCAA 4PMVA 3T2QA 1M7XA 1R85A 3WEMA 1V6VA 1UZ1A 2XHYA 4FLRA 2WYSA 1UHVA 1PPIA 4JZ5A 2D3LA 1HKJA 4XZBA 1LJYA 3U5UA 1UWTA 2O92A 4PMNA 3D5HA 6TAAA 2PWEA 1WZLA 5A2AA 1E9LA 4X9YA 3AS2A 4CU7A 4UCFA 3WDPP 2OWXA 2J8GA 3VNZA 3PZUA 1NWSA 3CIVA 2YDSA 1WO2A 4OIFA 1DWAM 2J62A 2J7GA 2J7DA 4ZE5A 2VMFA 4PCTA 3WUFA 1JYWA 3NCOA 1WZAA 4UOJA 3BC9A 2GFTA 1MQRA 4V28A 1E55A 2VZTA 3ZMRA 2GJRA 4UQEA 3OZOA 4PTXA 4NRRA 1V3KA 1Z32X 3MMUA 1V02E 3WQ6A 2NW0A 4J27A 3MSGA 4TVUA 3BCFA 1LQ0A 3VIOA 2JEQA 2UY4A 1DHKA 4R27A 4E8DA 3WH9A 1WB0A 2E9BA 4HZ8A 3VIFA 2ZUMA 3CHDA 5A8QA 1UYQA 2J7CA 3ARSA 1BYCA 1TR1A 3QGVA 2CBUA 3FAWA 3CZ8A 4S3JA 3UERA 1BAGA 4MNLA 2GK1A 3W4RA 1I1XA 1HJSA 3A4XA 1A47A 1IZKA 1HKMA 2V3DA 2WMIB 1E6ZA 3OB8A 3VINA 2WWDA 4NF7A 2DH3A 2RGMA 2OYKA 3RM9A 2WXDM 1H11A 2WZIA 3AS3A 4X0NA 4AD5A 4AZ7A 4P8VA 4CD7A 3RPMA 2VUYA 1JZ2A 2QMJA 4JCLA 1F4AA 1SYTA 5GQBA 3TOPA 5CJ5A 3OLDA 2XPKA 3PZIA 1YQ2A 4MJ2A 1OD8A 3WF4A 3PN8A 5CXPA 3WEZA 3ZJKA 1W3HA 2J25A 4PSPA 4QLJA 4DWSB 1JL8A 5FOOA 3MS8A 2EPLX 3GXMA 4GINA 1GHRA 1GPFA 2V3GA 3LPGA 4PCSA 1CXEA 3WH5A 4B9ZA 4IPNB 4CCEA 1JIBA 3AROA 2G3IA 3K46A 1V3MA 2Y24A 4AD1A 2V5DA 3SCWA 3ZM8A 4PUDA 1GCYA 2VL4A 4FLSA 1EIBA 5LA2A 1HVQA 1O6IA 1NM9A 1H0IA 4PMYA 2JF6A 3MUY1 3AIUA 2DT3A 3W6LA 1PZ2A 2J75A 3AMKA 4WSJA 2CXGA 4M29A 3CZGA 5ECUA 4HPHA 2V38A 2DH2A 4Z2KA 4F8XA 2WKGA 2ZX9A 1UKQA 1GOQA 2GSJA 3U7VA 4D71A 4WSKA 4OBSA 1VFMA 2NSXA 4U2YA 1H4PA 4D6GA 1WP6A 4KH2A 3VMNA 2PB1A 4DWSA 4PTVA 1JAEA 3SUVA 4MADA 1PEZA 5DFAA 3AIQA 3VD5A 4ACZB 1IV8A 2BS9A 2YOCA 4PBGA 5JIWA 1JZ4A 1KQYA 4HMDA 3WNMA 1UR9A 3ARUA 5A8MA 4ML4A 2E8ZA 3VD9A 2X09A 1OT1A 1XCXA 3THDA 5D9NA 3LPFA 1F4HA 1XC6A 3WKZA 3ARRA 1BYDA 4LYRA 4HMCA 5LYRA 3GYCA 4P7RA 1W3LA 3HU7A 4U5KA 2W91A 1BYBA 1LF1A 5EB8A 1JYXA 1AQMA 3MANA 4CVWA 3VGFA 5BWFA 2BHUA 4MPKA 1B1YA 3AIBA 4D6IA 5E9AA 1V3JA 5E0FA 1Q6FA 4C7DA 4AZCB 1ZJBA 3L4YA 5ABFA 2BVYA 2FGLA 3SUTA 1V3IA 4MDPA 4HU8A 1EOMA 1G9HA 1LWJA 2XM1A 5AC5A 2AOSA 2PI6A 3VU2A 4U2ZA 4U31A 3CHFA 2CESA 3K1DA 3W82A 3LMYA 2VO5A 3FXYA 1BYAA 3MUAA 4J3SA 3WDHA 2WANA 3I3DA 1TUXA 3RIKA 4M82A 4V2XA 1E43A 1RD6A 1UG6A 2WKLA 3O6AA 1XCWA 3BGAA 1ISWA 3MMDA 4CVUA 1TE1A 2EPKX 4P7OA 2XGBA 2D24A 2VZSA 3AXIA 3EDFA 4YHGA 2QF8A 3IANA 2E3ZA 1FP8A 3OBAA 5HPOA 2YDRA 1UR8A 1JGIA 2YL8A 3N1AA 4F9DA 1VFUA 3K8LA 2WCAA 1PX3A 1ZL1A 3EMZA 2Y4SA 3RJYA 1HJQA 4AIEA 1NWTA 3BAYA 1XV8A 3L4VA 2GDUA 1W32A 2BY3A 4JFUA 2ZUWA 3WL1A 1DP0A 3HMCA 1TVNA 3CUIA 3MUIA 3VDHA 3VVGA 5D9OA 3VMPA 2ZICA 3VDAA 1LL6A 3G6LA 3AHZA 2V5CA 5AC4A 3OGVA 2ZXAA 1V3HA 1V02A 1WCGA 1CBGA 2CIPA 2VZVA 5BRPA 2X0YA 1GVIA 1E4IA 4TVCA 1V6YA 3OGRA 5GNXA 4F66A 2PC8A 3W81A 1E3ZA 1KXVA 2WMHA 1NP0A 1KXHA 3S6TA 3KL3A 2F61A 1CGYA 1HP5A 3HJEA 2DSWA 5CSYA 1Q6GA 4P8UA 4X0VA 4QLKA 4E4PA 1B90A 4W5ZA 3JUGA 4P7QA 2XVLA 2VVSA 3RM4A 5BROA 1HF6A 1I1WA 5A1AA 4JCMA 1UD5A 2PWFA 4D1IA 1VIWA 4AZHA 3PZOA 3VDBA 1C8YA 3OIHA 4D6JA 1WKYA 1J0ZA 4ZEPA 3PBGA 4KRTA 3RDKA 4HMEA 5A95A 1UWIA 2VX6A 4GO9A 4JAWA 5BRQA 1R8LA 2X1IA 2HVMA 5I3DA 1CIUA 3F5LA 3WN6A 4AZ5A 3N12A 2WMGA 4D72A 4BA0A 4PTMA 4NRSA 2UY2A 3IK2A 2WHKA 3W53A 4J3VA 1B30A 1NOWA 1MXDA 1PX8A 4UNIA 2DIEA 4KGLA 3AYRA 3WBEA 2JIEA 4WKFA 1E70M 2WHJA 1Y7VA 3BMVA 1OM0A 1B3XA 1VENA 5KEZA 1QNOA 1U30A 3EBVA 2CHNA 4CD8A 2A3EA 2Q8XA 4AD4A 3VGGA 3WQVA 2PWGA 2HISA 1E4MM 1KGUA 2VQUA 3PZMA 3VM7A 3N9KA 3WNLA 3CHEA 2O9RA 2ZX5A 2YL6A 3W6MA 4RL3A 4JFSA 4GZJA 3UCQA 5A6SA 1E72M 3A4WA 3TTOA 1PX4A 3VPLA 4GIAA 3ZIZA 2D1ZA 1E40A 3SUUA 1H0GA 4E2OA 4D6DA 2X8RA 3DHPA 3BAWA 3T0DA 2VRJA 4GI9A 4GI6A 3DC0A 1JDAA 5KZ6A 1EO7A 4B15A 1X1NA 3CLWA 2JALA 5FL1A 2E9MA 3M6DA 3QHOA 1GOKA 3EDDA 2VI0A 5C70A 3FHQA 3FAXA 2PBGA 4FF5A 1ZS2A 1GOWA 3QOMA 1E6PA 4W88A 4OKDA 3WENA 3DECA 4XUYA 1ITCA 1Q4NX 1UKPA 1FOBA 1CGWA 2OWCA 4Q22A 1KFWA 1V08A 1UWRA 5TD4A 1CGVA 3ZQ9A 1G0CA 4AY1A 4J3UA 3KEHA 2OLHA 2EBNA 2YBTA 1LL4A 3ARPA 4AWEA 5A8NA 1NWUA 1HNYA 1MW1A 2VT0A 1U2YA 2PWHA 3L2LA 4PMZA 2FDMA 3SCQA 4MJ4A 2WCGA 2XVGA 1CZ1A 1GW1A 3BCDA 3WY1A 1NWRA 1XRVA 1D3CA 1UD4A 2XVPA 1IZJA 3AZSA 2J77A 3WF1A 2WZHA 3N13A 2WBGA 4ZE4A 1XH2A 5A6KA 1JAKA 1H3GA 2VTFA 2IUZA 3K8KA 2RGLA 3WH6A 1CYGA 2DT0A 1ZBCA 2WC4A 4AD2A 3BAJA 1NH6A 4PUEA 3AHYA 1E0WA 3TP4A 4AEEA 1BVZA 2WLYA 3TTYA 2UY3A 3WMSA 4UZSA 2WC7A 5A3HA 1KGWA 5AYIA 4HTYA 5IDIA 4NSBA 4S3KA 1QI2A 1PIFA 1BTCA 1J12A 1EA9C 1EXPA 1D2KA 1LWHA 1FHLA 4WLCA 4JKLA 2YDQA 1KR1A 3UG5A 1E0XA 2DSUA 1SFSA 1UA3A 1BGAA 3ECQA 3CUJA 1W9UA 3N11A 2XM2A 1JG9A 9CGTA 3RCNA 2VCBA 3MU7A 1R86A 3VO0A 2GK1B 4J3XA 3KE0A 1ZJAA 1B3YA 1E0VA 5HXMA 3GBDA 3NDYA 1K9DA 4HOXA 1UWQA 1EQCA 2YL5A 2CKRA 2QHAA 3NYDA 5CG0A 3UR8A 2W5FA 1JZ7A 2B31A 4OBRA 1UR4A 3M46A 3KWXA 2WMKA 6A3HA 1C93A 4BF7A 4MNMA 4FLOA 1B0IA 1H5VA 3WD0A 3AIRA 3AMLA 2CKSA 1E1EA 1ZB5A 3NJ3A 1VEOA 2J74A 5M5DA 1R7AA 2OSXA 1FH8A 2G41A 3CO4A 5E6ZA 5I23A 4GZEA 5A6BA 3AFBA 4AZBA 4OUEA 5FCZA 2J7FA 2W62A 2GJXA 1C90A 1DWJM 4C7GA 1FA2A 4HA1A 4WKHA 2G4FA 1B3ZA 1R7OA 1ISXA 3CGTA 3AZTA 4Q7NA 3WH8A 2WC3A 3IJ8A 4MNKA 1AQHA 1TG7A 3SCRA 1H49A 2W66A 4HP5A 5E6YA 3I3BA 3WSUA 1J0HA 3ARYA 3RM8A 4TTGA 1OINA 4OZOA 5I2UA 4JL1A 1OGBA 3WMBA 1EH9A 3CZLA 4HA3A 2PWDA 4C7FA 3WQ4A 3ZJ7A 1MXGA 3WF2A 1TFVA 4ATDA 3BSGA 1UKTA 2BY2A 4PRWA 4W89A 3EMQA 4W86A 1WZMA 2F8QA 3GXFA 3N17A 3O2LA 1PIGA 1XHGA 4HA4A 1ODZA 2QPSA 5JUVA 2DPEA 4QCEA 5A8PA 2OYLA 3GXDA 3AICA 1UWSA 2D2OA 2D3NA 2FHCA 2XSAA 3A47A 3AS0A 4BQ3A 3CUGA 3VKKA 3S2CA 1US3A 3VD3A 3W27A 1XH0A 1MVYA 2BHZA 5A6AA 2D0FA 3AYSA 4H2CA 3WELA 1JF5A 2XTKA 2ZX8A 2DGAA 2GDVA 3HN3A 1ITXA 2VNCA 5IHSA 3AISA 4D6EA 1DWGM 2C0HA 2YA2A 2XJ7A 1DEDA 2W92A 1QHPA 5ABFB 1JD7A 2WVSA 1W9VA 1C7SA 4XX6A 2A3BA 3VD7A 3MMWA 4LQ1A 3PZ9A 4UFLA 2E0PA 1UR1A 1PAMA 1JI2A 1MW0A 3GNOA 5DMYA 4ACYA 4TUFA 1EDTA 5D8ZA 4UR9A 1GQKA 3SCPA 2GVYA 1UR0A 4AEFA 3CH9A 3WNOA 1ECEA 5DT7A 1VRXA 2JEPA 2Y8KA 4W87A 1GOMA 2XFRA 4WF7A 2D23A 3PZGA 3SCOA 8A3HA 1BGGA 2WHMA 3UG3A 1RH9A 1H1NA 4AW7A 2D0GA 2DSZA 3D3AA 1QPKA 4Z2GA 1LG1A 3TTQA 3DYOA 1JDDA 5CGMA 5DF0A 3CMJA 5LA1A 1M01A 5JBDA 1CXIA 4IUGA 2CITA 4CN6A 2GUYA 1CGTA 2QMKA 1ZBVA 2XWDA 1BG9A 3MO4A 1W1YA 3GNPA 2CERA 3PZNA 1OGSA 3GH4A 1V6WA 3AIEA 1CECA 4UFIA 1UKOA 5EFDA 2FGZA 4FK9A 1BG4A 3TTSA 1OSEA 4QFUA 3SEPA 2O9PA 2QLYA 2W61A 3WD2A 1J0JA 1EDGA 1J10A 2Z1KA 3ZT7A 1BPLB 1E15A 3AQUA 3OGSA 2NT1A 3OG2A 2YA1A 3F5KA 2D20A 2G3MA 4Z2HA 4DM2A 1UWUA 5D8WA 4P7NA 4WIWA 4J28A 4CCDA 4H04A 3VGHA 1ZU8A 3M7SA 4KRUA 3RILA 2J7BA 2W67A 1KB3A 2WHLA 3SIMA 1HJXA 2YA0A 1CLXA 1JFXA 3L4WA 1HVXA 3ZJ6A 2VZUA 3AHVA 1W91A 1UZ4A 2VCCA 3L4ZA 3ARXA 2YLLA 3ZT5A 2ZX6A 1JXKA 2BV9A 4M81A 3ARVA 2DT1A 1HKKA 2XVNA 4PEEA 1HJVA 1FFRA 3B8SA 4JFVA 4TVDA 4URIA 3WFLA 3AIWA 3WDJA 4KGJA 3AZRA 1JF6A 4U3CA 4CU6A 1QI0A 2OYMA 4ATWA 1OIMA 1W9XA 4JIEA 3PTKA 2XWEA 1WNOA 2BVTA 3GDBA 3G6MA 3AOFA 4M1RA 1W2PA 3BAXA 8CGTA 1JZ6A 5A2CA 1E73M 3VIMA 4L4PA 3GM8A 3KL5A 3PTMA 4NZCA 4UTFA 2XGIA 3L4XA 3BLPX 1NP2A 4CU8A 2G8ZA 1L8NA 3NIYA 4W7WA 2VX5A 4XV0A 1C8QA 1EOKA 5M03A 3WNNA 3TONA 2YJQA 1C92A 2WSKA 2CCRA 1HP4A 5I24A 2WAGA 1TA3A
chains in the Genus database with same CATH superfamily
2H8ZA 2E4TA 3NL2A 3C52A 1XLFA 3UW6A 3MV01 3LM7A 1E6XM 2B7QA 4H9ZA 2OGYA 5JIPA 3E12A 5E5CA 4C1KA 3PJWA 1EX1A 4AMCA 5C2GA 2X1TA 4JOMA 3IAQA 3GHRA 1JNEA 4LYKA 3LB0A 1MW2A 2YR1A 3LS9A 3U5YA 4HOWA 4GGHA 4NKCA 2POTA 4BZYA 2E28A 2HQAA 2VDHA 4XO6A 3WEOA 3CL8A 3HV9A 3ABXA 1DWIM 4OU1A 1V0NA 3SN0A 3UGRA 2KAUC 1QOXA 1IT7A 4AZ6A 3BWWA 1ONXA 1BRLA 1Q6DA 2FZNA 1FBAA 4IFKA 4IISA 4OE7A 1YHTA 1KFLA 1LL7A 1QPNA 4DUVA 1MYRA 2QJJA 3GVGA 1DOSA 3SJ3A 2OSYA 1UP3A 1Q66A 3VC6A 5I5RA 3NQAA 4DHGA 1JCNA 4I9MA 5FAGA 3CHVA 3WQDA 4GQQA 3LPPA 4GQ0A 4O28A 3CQJA 2JFEX 3HPZA 5M3WA 2PF8A 1T8QA 2OPJA 3UR7A 7CGTA 4L64A 5A8OA 2TAAA 3ZWSA 3DG6A 1TQXA 2BDQA 1UZHA 4L9XA 5CSSA 4ROQA 5C54A 2YYTA 2EXOA 3WQEA 1TMLA 3LRLA 4HYWA 1V0KA 2RDTA 4S3EA 3TN4A 3WK3A 2F9RA 3B9DA 3RO8A 2TSYA 1REQB 1IEWA 1XIDA 2P10A 3UG4A 5J5RA 1LQAA 3ITOA 2YB4A 1EDQA 5CC7A 2QV4A 1WOAA 3FA5A 4CN4A 4JQAA 4MM1A 1O7AA 2TODA 1D7FA 4XZWA 3N6JA 2PDFA 1B3WA 4PTWA 3MP5A 5FSEC 3LCXA 4R9XA 3EPOA 3WJXA 2E25A 3UETA 1IT0A 3HG5A 4GJIA 2JGQA 3LHTA 2J4GA 2EPMX 4AIOA 3VGEA 2MANA 5FF2A 5IHRA 4NZJA 1DWHM 2BASA 4DJFC 2E9LA 3C2EA 4UFJA 2I14A 4IGMA 5CQ1A 3CQ0A 1XBXA 4GISA 5I7GA 4W5UA 4Z2JA 3W7HA 4GACA 3TYBA 3GTHA 4HPXA 4WZHA 4RDYA 2VZOA 3RITA 4QP0A 3ZLGA 3UXLA 2MNRA 1TWZA 2QF7A 1FHDA 1PO9A 5DO8A 3AALA 4P8XA 4UFMA 4QRNA 5D2TA 3GUGA 3STGA 3URQA 2Y7GA 1C7TA 2OKTA 3VDGA 4D8ZA 3UNDA 1TMHA 2GJPA 4YCOA 4XAGA 4LC8A 3EPNA 1W17A 1KBKA 1R87A 3K13A 4LF1A 3MBFA 1KBJA 4Z08A 2V2DA 2EF9A 1ISYA 4GJJA 2PMQA 1M7PA 2WMJA 5BXRA 2CBIA 1NOFA 4XWUA 3C0LA 3UQNA 1U1UA 3LENA 1HL8A 2WVVA 2CZDA 4PH6A 2IXVA 5FL0A 5HOSA 4LALA 5E70A 2ZXDA 3VNDA 3E2QA 4GQBA 4WUIA 7TAAA 4O54A 1EHAA 1P6WA 3BAIA 3PSWA 4KBXA 2PDWA 3B9EA 1SZEA 2W6RA 3T81A 4Z2IA 4K8GA 2RDWA 4B5NA 1ZAIA 3B0YA 1I2PA 3HF3A 3RLUA 4IIGA 4IOTA 2REQA 3EYPA 1LLOA 2XFWA 1H2JA 5I0DA 4A29A 1W6TA 2ZZ6A 3TSBA 1MUCA 3B8UA 5C7VA 5HR7A 1ZNNA 1I45A 5K7JA 3UJRA 2BVWA 3AUJA 4WY0A 5I78A 1GQIA 2ZWYA 3PB0A 3V18A 2AAAA 3MV11 3MTWA 1OGGA 3R25A 2WQDA 1TO3A 2X42A 3DESA 4LB3A 4LUTB 1AW1A 3DFNA 2ODOA 4POCA 3C3UA 3EWZA 1KBBA 4NXSA 4ZOAA 4YN5A 2AL1A 4FX7A 5CSUA 3GK0A 3RK8A 1MDRA 3STEA 2VR4A 1W3JA 2DDXA 4B16A 2PBOA 2VD9A 1OC6A 3FDKA 1TVLA 1NDYA 3MDWA 4N6FA 4PBFA 4O18A 1XLKA 3ZXWA 2Z1WA 3H70A 5M2FX 5D2VA 2ZC1A 5HNTA 5D2WA 4CD5A 1K03A 1E6SM 1Q6RA 4B4HA 1QBBA 2ZUNA 3DENA 4HPGA 3SURA 1QW9A 1G1YA 3S83A 1Z6KA 1UZDA 3WX7A 2HE5A 1ENUA 1HIZA 3DX5A 4MNJA 1EJWC 1T96A 6REQB 4RE3A 2ZUTA 1A3HA 1OYAA 2G97A 3KTSA 3IVUA 5HNNA 1Q65A 4QSHA 2DQWA 4XK2A 3GIPA 1ONRA 1XYAA 3BTNA 4LANA 3BANA 4MAVA 3IAPA 1LBMA 4PN2A 3ZSTA 2GQ3A 4DJEA 1B9ZA 4CCCA 1CDGA 1YXCA 1GTEA 1IGSA 1XRFA 5AFDA 2J13A 1GVEA 1TTIA 3UG8A 4K68A 1XYBA 3AIVA 2G37A 3PFMA 1VD6A 4K37A 3R8GA 5BXSA 2EPNA 2HMCA 2O9TA 4A3UA 1JXJA 2D2JA 4O13A 4OWGA 2BZNA 3AMGA 2V3EA 5A6MA 3ES8A 3HPFA 4RK8A 4ZR8A 1JRCA 1PS9A 1BFNA 2Y2WA 3P84A 3J7HA 2OQYA 2R1PA 1FWIC 2J7HA 3NZPA 1XYZA 3KHJA 2ZC8A 4IPJA 4ZGYA 4OFCA 3VIIA 4WJ8A 3IRSA 2DEPA 1G94A 3ONBA 1NFBA 4ZSUA 3HZ3A 1NDVA 5C2XA 3ARQA 4GC3A 3OHIA 3PUOA 1V93A 1VFFA 3NQMA 3UJSA 3KZPA 3P0WA 4KCUA 4U5IA 1F7BA 1SFJA 3ICJA 5DELA 3BJFA 1FCQA 2XSBA 1ZBWA 4B5SA 1LT7A 3IIVA 3WLSA 2VEGA 4MDOA 1TZZA 2OQLA 1E4LA 4WY0F 4AZCA 1TA3B 2WNWA 3RPTA 5DQPA 1TTQA 2ADAA 4Q6XA 3Q45A 4Z17A 2XG9A 2X7VA 5H2ZA 3DYMA 2WW5A 2AKMA 2IKIA 1XP3A 3LDVA 3IUDA 3P93A 3MB9A 4YHEA 5HPCA 1EPVA 2OB3A 3HG3A 3AUOA 1GONA 3POHA 3Q37A 4US5A 4LPCA 1HJWA 4H8UA 3UWWA 4BWLC 1XIMA 1G5AA 1UD3A 4W8LA 3MDUA 4YS1A 2FH6A 3R0DA 4C1NA 1TZ7A 3WQFA 2Z4GA 1UH2A 1HL2A 5G1YA 3T0AA 4QE5A 3H8AA 4CKQA 3KS6A 1KCXA 3BLLA 3VOCA 4LXFA 5GNZA 4RNIA 1LRTA 2EEXA 4NAEA 3P6LA 5I09A 5HUOA 1OIFA 2OWWA 1EQPA 1JZ5A 1R47A 1WAWA 3EDJA 2H8XA 1QHOA 3I6TA 2Y8VA 1VCVA 2A0NA 4PMUA 4EAMA 3HQPA 3NO3A 4FIRA 4MJZA 3GNRA 3ARTA 3PAOA 2ZVRA 3R0UA 2QKFA 3EDKA 1UPMB 2ZRVA 1UMLA 5ABEA 3W22A 4UZUA 4L4MA 1LUCB 3BLIA 4AEOA 3W1PA 5FIPA 2BNJA 4W7VA 2Y8UA 1SPQA 3VNKA 4LYQA 3BVJA 4YVVA 1TTJA 3MSDA 4KEVA 5CBBA 4O0KA 4EK7A 4HT3A 4FI4A 3UWYA 3DG3A 4MB4A 1VF8A 1WDQA 4LNCA 3AHXA 3E38A 4D6FA 1WKDA 4X61A 4GYPA 1M6JA 4AVOA 2X2YA 4XAZA 2VGGA 3N34A 2WWCA 3VGBA 5IFTA 2V2HA 3BLEA 4LAOA 4W8AA 4ZFMA 3TW9A 4PUJA 3M07A 4OOUA 3T8QA 4LVDA 3V0SA 3SGZA 4P8WA 1FHVA 2HRWA 3HIJA 2NWSA 2C8NA 1EP3A 2ICSA 2VR2A 3V35A 3KXQA 4ZFCA 4Z1DA 4S3CA 1AMYA 5I6SA 1XH1A 3U0HA 3H55A 4IPLA 5D9PA 5DRCA 4TX6A 4F9JA 4FEZA 1W9DM 4LRSA 5FD0A 3EX4A 4JKMA 1DHPA 4E8GA 2BXYA 4DJDA 3R79A 1NTHA 1UBSA 1IYXA 3KM8A 1BF2A 1MZRA 4WJXA 3OZPA 3GFYA 4M8UA 2CFFA 1QW8A 1FUYA 4L4OA 4GCAA 3ME3A 5D38A 2YBUA 4C91A 5BU9A 2YSWA 3DG7A 1JUBA 3HO8A 3DIPA 2A7NA 5D9MA 3NA8A 4M80A 1I8JA 2IXUA 1KM1A 3AWNA 1WA3A 1US2A 4H83A 5IRPA 1P4CA 4A3YA 1H7NA 5BU6A 4UQ9A 3B8IA 3NQ7A 3MWAA 3UT0A 1TPH1 1VGAA 2OODA 4LNYA 4FB7A 3SCTA 4C6OA 3ATZA 5CPMA 2VCAA 1YKWA 3APTA 3WEMA 1V6VA 1XPGA 2NQ5A 1UHVA 4BI5A 3ATYA 3CMFA 2D3LA 1HKJA 1S5MA 4LTSA 1FQ0A 3GIQA 4FNRA 3MUCA 4Q6JA 4MFEA 3AS2A 3WDPP 2J8GA 4YVXA 4QGCA 3CIVA 2YDSA 3W2NA 1QCWA 4C65A 5G4EA 4ZE5A 2I16A 3P67A 1LRQA 3NCOA 3FVDA 1VFSA 2WO5A 1E55A 4PTXA 4NRRA 1O12A 2R82A 1ZAJA 3MT1A 2VGFA 3U4AA 2NW0A 1Y5XA 1ZRQA 3QYSA 4J27A 3V36A 3T78A 3WJSA 3BCFA 2JEQA 1TJ1A 4LU0A 3WH9A 1WB0A 4M5PA 3GDRA 3OPSA 5LSMA 4PODA 3TV8A 5E93A 4J40A 4M0XA 1UUMA 1Q85A 2J7CA 3LNMA 3FAWA 4IP5A 4S3JA 5K9CA 1AW2A 4QBXA 4TV6A 3U4FA 5K4ZA 1GVRA 3A4XA 3GXTA 1A47A 4MKSA 2V3DA 2WMIB 3L65A 3OB8A 1WXJA 1Y8BA 3RM9A 4ZBCA 3E6EA 1H11A 1KFKA 4E4UA 3MCMA 4AD5A 1WAUA 4CD7A 3C2RA 4HBKA 1BTMA 5GQBA 5CJ5A 3TLLA 3W1LA 3QC3A 3LI1A 4HYVA 2PDIA 3BARA 3PN8A 1DIKA 3ZJKA 4W9TA 1JL8A 5FOOA 3JZUA 5EMJA 2EPLX 4M6VA 3HGSA 4AVNA 1LZOA 1JPIA 4GE8A 4FZIA 1ICPA 4B9ZA 1PZ0A 3UWQA 2INZA 1TWDA 3ZZ1A 3AROA 2G3IA 3WG6A 2P88A 4JN6A 4A8IA 2BTMA 4AD1A 8XIAA 3TQPA 2OXNA 2V5DA 3ZM8A 2R8WA 4PUDA 3IACA 3G24A 3QPYA 4FO4A 1HVQA 6XIMA 1H0IA 4ROPA 3AIUA 2DT3A 3BG9A 4L7ZA 2J75A 1TWWA 1XWYA 5LGZA 2J27A 2V38A 3M1ZA 4OBSA 4D6GA 4KH2A 2XIOA 1XFBA 1KD0A 3K2GA 3H2NA 1IHIA 3EGJA 3SRFA 1YTEA 3OEXA 3W83A 4MADA 2I5QA 3BGJA 3FYYA 4S2CA 4PZVA 3ZVHB 4HHMA 2V81A 4HMDA 3WNMA 1UR9A 2E8ZA 3VD9A 3D0CA 1OT1A 1XCXA 1F4HA 3LMZA 1BYDA 3NPXA 3GYCA 1VRDA 1SZRA 5CPLA 3E0LA 4Q8PA 1JYXA 3GW3A 4CVWA 3VGFA 2BHUA 5KITA 1B1YA 4D6IA 3NR0A 1I2NA 5E9AA 3LQGA 2VEFA 4H6QA 4UTLA 1MNSA 1Q6FA 5K3VA 1ZJBA 3QC0A 1V3IA 3QH2A 3TIMA 1LWJA 1G9HA 2XM1A 4LW7A 1XXXA 4KETA 3W1RA 2RDUA 4KFPA 4AX6A 3CB3A 2AAMA 3TJ4A 4NZ3A 3S5ZA 3VNJA 1W1B1 3NFUA 3KS5A 5LNWA 1ZENA 3A24A 1E43A 1AA1B 2QIWA 2OZ3A 1U5JA 4DAIA 1GGOA 4Z42C 3GC2A 3AO0A 4QDPA 2WNNA 1FP8A 1JVNA 4A2SA 3N1AA 1VFUA 2WCAA 1ZL1A 2J66A 1Q4WA 5EBUA 3RJYA 3TA6A 5RUBA 5DX7A 1E0TA 3BAYA 2YXOA 1W32A 3RU8X 4H19A 3BUVA 2ZUWA 1DP0A 1TVNA 3NQBA 1QPOA 1X96A 4ZQNA 3NQ2A 1TWIA 3VDAA 1LL6A 5D33A 3S1XA 3SRKA 5AC4A 2ZXAA 4KEUA 2QT3A 2VGIA 2VZVA 3TXVA 4TVCA 1K1DA 2FFCA 1W5QA 5IBXA 3FKKA 4JEJA 4PCFA 1V51A 3H4WA 1XIFA 3S6TA 1XGDA 4K2SA 2F61A 1AQFA 1Z69A 3NPWA 4GI4A 3HJEA 3WK1A 4K1GA 2L5HA 3GNXA 1T8XA 1SUXA 5CSYA 3MUXA 4P8UA 4X0VA 4E4PA 2DZPA 3IV8A 3TZFA 2R94A 5EY5A 5AHIA 4NJHA 5BROA 1HF6A 1LLWA 3M6YA 4JCMA 2HCVA 3ONCA 3WBWA 4D1IA 2O4MA 1VIWA 3VDBA 2DW7A 3SSZA 3ITLA 3OIHA 4D6JA 3IJLA 1J0ZA 4K6AA 5AKQA 4ES4A 3N14A 2P5NA 3OBKA 4JAWA 4GVGA 1IGWA 2PDNA 5I3DA 5IDZA 3CO8A 3RHGA 4PTMA 3LM3A 3CUZA 3QZ6A 3FS2A 1B30A 4UNIA 4LBUA 1VKFA 3GKAA 1E70M 4FNTA 1Y7VA 4I5UA 3BMVA 3TNBA 1QNOA 1U30A 3O3RA 2E7FA 2A3EA 4UNKA 2PWGA 1E4MM 3GXNA 3PZMA 3RLGA 3S6DA 4YTSA 3O07A 3BICA 4S3BA 4RR4A 3QYQA 1ZGDA 2YL6A 4GZJA 5A6SA 3A4WA 3IRDA 5REQB 4GIAA 3W02A 4KW2A 5AHLA 1E40A 4E2OA 4IXXA 3DFTA 3DHPA 4GK8A 2XIQA 4GI9A 3DC0A 2A7RA 1JDAA 5KZ6A 1R3QA 2WJZA 5M1TA 3V0TA 2OVLA 1E51A 3KX6A 1X1OA 4A35A 1KM3A 2Y1HA 4WX2A 5C70A 3LGEA 1RXOB 3FAXA 2PBGA 4FF5A 3GHTA 1ZS2A 2JQXA 2J9ZA 4CEUC 1OK6A 2PWUA 1QU4A 4Y96A 1UWAA 3HPXA 4BWLA 2QULA 1WBHA 3RUBL 5FJPA 2CLKA 3ZQ9A 1G0CA 3WLRA 3TZNA 1HO4A 4IUOA 5H8MA 2EBNA 1JULA 4QXIA 1MW1A 3N6HA 3IJQA 2W9MA 1U2YA 4PFMA 4CCZA 2PWHA 3LCHA 3IJ6A 2QCFA 2Z2BA 3NAVA 4Q4KA 4XKYB 1PIIA 3GR8A 1GPWA 4A21A 2OR2A 2ZRZA 1F3XA 1UROA 4KIRA 2GJNA 3K8KA 3TQKA 1CYGA 2DT0A 3B9OA 4IICA 1NH6A 3AHYA 1E0WA 2UY3A 2FMNA 4UZSA 5EYWA 2BX7A 3GAYA 4C5ZA 4HPNA 4KCTA 4QSFA 2Y88A 5D02A 1TV7A 1F05A 1DXEA 1Q5MA 3EWDA 2I17A 4G7FA 2GVGA 2ZFAA 3N11A 3TFXA 4CEXC 4TIMA 2XM2A 4UTMA 3AAMA 1JG9A 1NDWA 3UNTA 2VCBA 3W7EA 5C9UA 1REQA 1OQFA 4QTGA 2QVHA 4Q8TA 4JGDA 4QS5A 5I07A 1LTDA 4OTKA 4IQJA 5I02A 5HXMA 1PCKA 1SW7A 3SO7A 2PE4A 3OQEA 4F2BA 4DLFA 1ICSA 5EU9A 1QUMA 1SSGA 3M46A 3P14A 1DJYA 3LLXA 5LNVA 2GZXA 4BF7A 4LUJA 3QV7A 4HK5A 4M1BA 1S1RA 4DX3A 1P0KA 2PUZA 1DJWA 5DMLA 3B4YA 3H6OA 1K7EA 3I7QA 3U2CA 3AMLA 4A8NA 4UR7A 2AQVA 1R7AA 2PTYA 3RO6A 3RMJA 5A6BA 1L2UA 4JHMA 1RY8A 4C7GA 3VC5A 4I9TA 4HA1A 4FOKA 2G4FA 3G3DA 4K39A 4Q7NA 3WH8A 2C14A 3UZZA 4MNKA 1K7FA 3EKZA 2VUNA 3SCRA 3NXFA 3PS7A 3E3HA 4Y90A 1OINA 4GD0A 2V30A 2VWSA 5HUPA 3AJXA 2PPGA 1EH9A 1EUNA 4A2RA 2QJGA 1P48A 3ZJ7A 3WF2A 3MPGA 1W56A 2F8QA 4UMAA 3PFRA 1XHGA 3CEPA 1W5PA 4LS0A 4KWSA 1RQEA 1OYBA 3RX3A 1IF2A 1UWSA 1JRBA 5JU6A 1AL8A 3GWQA 3CUGA 4LY4A 3BG5A 1MVYA 1L6YA 3AYSA 2Y7DA 3WELA 3IIPA 3BW2A 2Z0IA 2XTKA 4EPKA 1ITXA 2GWNA 2VNCA 3UZWA 4LCQA 1MSSA 3A21A 1A5AA 3AISA 4D6EA 1NVMA 2C0HA 2YA2A 1DEDA 1P0BA 2ACSA 5U4NA 2GOUA 1AK5A 3PANA 4XX6A 4ZCWA 3H7RA 3MMWA 1LCOA 2R91A 2E0PA 3PPFA 1PAMA 5KTLA 2HTMA 3EAUA 1R3RA 4NG3A 4XVDA 4ACYA 4GHRA 5AZ0A 5D8ZA 4A3RA 3N2MA 4UR9A 1SFTA 4XBJA 2BOEX 4CNUA 4LUTA 4L1XA 5F2LA 3SY8A 2FGBA 4AEFA 1UBPC 3IVTA 3QR1A 5DT7A 1PCWA 5JVLA 2I7GA 2JK2A 2Y8KA 2D23A 4Q4PA 4JQ3A 4U10A 8A3HA 5AVHA 4AXKA 4N9CA 1W0MA 2PP3A 2D0GA 4AW7A 1NF7A 3ZR4A 1CLKA 1KLYA 1TPEA 3KHDA 4WDTA 3TR2A 3NGJA 1LG1A 2OCZA 1TX2A 3HA1A 4F0KA 1FDYA 4IUGA 4I5XA 3LCWA 2GUYA 1CGTA 2XWDA 3MO4A 1W1YA 2X1UA 3GNPA 3L68A 4AAJA 3PZNA 3TYEA 1DBTA 4YMZA 3ZYZA 2J8TA 5CC3A 3CWOX 1GVQA 1OFOA 1P0DA 3TR9A 4LV9A 4EOUA 3S2LA 2FGZA 2B0MA 4FK9A 6REQA 2DVTA 2VELA 4PUWA 3WBYA 2O9PA 4AHOA 3R7MA 5F1VA 3WD2A 1EDGA 3UCDA 2Z1KA 1BPLB 3AQUA 1A5UA 4MZYA 2NT1A 2YA1A 4JTSA 4HN8A 4DM2A 1UWUA 2V2CA 1EFZA 5LNSA 3K1GA 4WIWA 1WXYA 4CLMA 4CCDA 4H04A 3VGHA 3WQOA 5IM51 3T40A 5AZ1A 3SFKA 3RILA 4IQEA 2YFNA 1R3WA 3L5LA 4TMCA 1KB3A 4NZ5A 2WHLA 4XZMX 1PSCA 3GS6A 3SAZA 1RA5A 2F84A 1LT8A 2QXWA 4JTTA 4NY2A 4M81A 1KRBC 3M44A 4FXJA 4JTFA 1SFLA 2XVNA 3A22A 4PEEA 3B8SA 1I60A 3O6DA 4LVFA 4REQB 4GNVA 2DZAA 1T0OA 5LNUA 1DKWA 3TCEA 4F2TA 4JIEA 4JY9A 1ADDA 4D9PA 1B4KA 4Y9OA 2YX0A 2FMOA 4FOJA 4YTUA 1TSIA 3V16A 3IEBA 1YNQA 5CSRA 2ABBA 4EF8A 4M1RA 2V69A 1E73M 3KVJA 1BKHA 1IEVA 3KL5A 3UJFA 1X7FA 4UTFA 2DZWA 2XGIA 1I0DA 4E6MA 4DVOA 3LZ5A 3SN1A 4HHPA 2VX5A 3F03K 1GJPA 1O5XA 1C8QA 3TONA 4L9YA 3HURA 4CNPA 1TA3A 3AHTA 4K36A 1FY6A 1H09A 5DRIA 4S3DA 3G1HA 1V5XA 3MUZ1 1TRDA 2YLAA 3WD1A 2BHYA 4GZIA 1SJDA 2RHGA 1K9TA 3PZTA 3I7RA 3LPOA 1D8WA 2VR5A 3FW6A 3Q94A 5E0KA 3UP8A 4C6EA 2Z1XA 1WUEA 5K9DA 1FH7A 1J8VA 1YE4A 3FJLA 1UQZA 1N8IA 5FKYA 3BV4A 3FHAA 4H1ZA 1AODA 2Y0FA 3GG1A 3W28A 3CQIA 3UFYA 3CT2A 3GKFA 2C19A 4UQDA 5T8GA 4UMCA 3WMCA 1KXQA 3H2EA 4RE4A 3B8DA 1JNDA 3UYCA 2O9OA 3H26A 4AIUA 5F2GA 1NAL1 3VCCA 3W1UA 4GQGA 2AL2A 4US6A 1IXNA 1K6AA 1R30A 5AOUA 4J7RA 3QXBA 4Y6GA 3B0UX 3GH5A 2EAWA 1P6BA 1WPCA 3VD4A 4FMVA 2WPGA 4H41A 1PKLA 4Z2LA 4KWOA 1RJRA 2YCJA 1GQNA 1J01A 1ISVA 4NYUA 3GU1A 1NOUA 4JS3A 1JI1A 1H7RA 4RXFA 1LUCA 1K9EA 4GIEA 1SZGA 1E6RA 2A3CA 3UR5A 1TR9A 3C2FA 2C0AA 1CTNA 3M0YA 2DVUA 2HV5A 1B4EA 2OMAA 5EBAA 2P76A 1LOSA 1CENA 1GQJA 1KTBA 3TYZA 3UD6A 3B40A 2EO7A 4N02A 4CQ8A 3QR0A 1OB0A 4IPPA 3NQ8A 1H61A 2QUVA 1OT2A 2OO6A 2GSEA 4I7VA 3TC3A 2OFJA 3PBVA 5G4HC 1Q6CA 5LZLA 1W1PA 1GVYA 2FHFA 2XIIA 1LG2A 2ZOXA 3KZSA 1OY0A 3NO5A 5JH1A 2EPOA 3ZLFA 4Q8OA 2VQTA 4ZQCA 4IP4A 1YPFA 4LAMA 2Y61A 1VR6A 4GQRA 2CEQA 4RCXA 1XLBA 4DQWA 5GJNA 3ZWTA 1PTDA 1EIXA 3AS1A 1U1JA 4O1DA 1DIEA 3AMCA 3GZ3A 3OLIA 1XRSA 2XYLA 1E71M 3GRIA 4UTWC 1DXIA 3L2IA 1VPQA 3SUSA 3V1PA 5LIXX 1VIZA 3UCCA 4FR6A 5A2BA 5I3FA 3Q2DA 3DI1A 2ZCGA 3NSNA 1GJUA 2QCEA 3JR2A 5K9XA 1ZTVA 4F0LA 2H6RA 1AD4A 1V6XA 3VX0A 4IJBA 1US0A 2W4XA 1MFVA 4OT7A 3IGSA 1L6GA 2ZDRA 1J2BA 1JYVA 3EPMA 1PWMA 3ITYA 3UVAA 1O5RA 2X0HA 1CI1A 3WFAA 4PB5A 3H2CA 4DWSC 3HGJA 1VJZA 1V0LA 3GHSA 5IOBA 4DF1A 1I0BA 3OLGA 3VUPA 3BMWA 2E8YA 3R2GA 1CXKA 1V6TA 3W72A 4KRZA 3PG9A 2XZ7A 3IVSA 1B31A 2Q3RA 3DH7A 5GJMA 1EB3A 4ZZ9A 1I9CB 4H00A 4GYKA 1J11A 2VFGA 1TUFA 2Z00A 1YDVA 1VJSA 4I7UA 1NFGA 5AYYA 5C6MA 1J5SA 4UOZA 1VEPA 4QG6A 2OTDA 5ABHA 1H60A 3RCMA 1H5YA 1W1TA 5HQMA 1EZ2A 3JW7A 2ZZ2A 4S2BA 1ZCCA 3W74A 4TX8A 3M0LA 5FJTA 1L0PA 3EA1A 9XIAA 3KVMA 3UF9A 2Z2UA 3OZMA 3QQ0A 3WIJA 4YWIA 2CBVA 2BFGA 4AD0A 3F5JA 2FDSA 3WDIA 1GZJA 4HB7A 1VBUA 2VD8A 2ISFA 3L2MA 3TAOA 3PK7A 3LTPA 1WDRA 3A3WA 2FTPA 4Q4SA 4HCHA 4UFKA 2A6LA 1W3TA 3BQ6A 1V0MA 3WBAA 4QHRA 1JEZA 3EMCA 2CPUA 4C6NA 1A0EA 3D46A 1R2TA 2O4QA 4M19A 1LBFA 2ZKMX 3G0SA 4IIEA 3N18A 2WMIA 2ZUSA 3RMEA 4X63A 3VOHA 1UQYA 1E1FA 1XBZA 2HSAA 3WNPA 1OWQA 2CYGA 2FH8A 4B5TA 2Y5EA 2IPFA 4RE2A 3GBEA 5BYWA 5HINA 1ZY9A 3G1SA 1FWTA 2VC9A 4GYFA 1PBGA 2PDHA 4WKAA 1O5KA 2GSHA 2VFIA 1PYMA 3CTTA 3VIKA 3OTRA 2B7NA 3ITCA 3V5CA 1S5WA 3KLKA 3FK4A 1H41A 2ISWA 3HQ1A 2J79A 2CC0A 4JIHA 1HL9A 3CPGA 2F2HA 4OBTA 2UWFA 3OYXA 1XD0A 1BLIA 2OQHA 3FCPA 2FZMA 3BG3A 1B9BA 3CPUA 5DN1A 4W84A 2IPWA 3SZ8A 3K4WA 2GGEA 3CU2A 4UTTC 3WQ8A 2PU1A 4O8RA 3L66A 2YDAA 1O94A 4HVXA 3W1MA 3NQGA 4HU3A 4H9XA 2BXZA 3FX4A 1GTHA 3GQYA 4BQ5A 3KBSA 5DXXA 3EA3A 5CC5A 4UBPC 4C6FA 3CUHA 1UH4A 5MF5A 2WVUA 3AMDA 2EJ1A 1W31A 4RW3A 2E09A 3ZVHA 2DFAA 4HNNA 3KWSA 3UPMA 1Q7ZA 3XISA 5TF0A 4AWUA 4LBRA 5BOOA 3ALGA 1U5VA 3MYPA 1IEXA 2WB5A 4QNWA 3W1NA 3KCJA 1JFHA 2CLPA 1O60A 3B8WA 2HK0A 2YCEA 1EJSC 1N55A 3WQWA 2AQWA 3LCFA 2H9AA 2Z24A 1UB3A 2W63A 3C86A 1BXCA 2ZA2A 5AY7A 4B92A 4GC4A 4DM1A 5CLTA 4G9PA 5AHFA 3T09A 4UR8A 1E9IA 1RCOB 4ZTXA 1B54A 2GQ8A 1P7TB 3PZVA 3GX9A 2E40A 3XINA 4NYYA 3CUFA 6TIMA 1ALDA 4H8NA 4RNFA 3R12A 3RLHA 3M64A 3CEUA 3UEQA 2BB0A 4GUHA 1W1VA 2HBXA 4ZO9A 1BWVA 1X8CA 4HU0A 4K7YA 4BR1A 1MEWA 3REQB 4HU4A 4PMXA 2NT0A 3PWGA 1RPKA 2XN2A 3M47A 4N9EA 3N4AA 3E5PA 1E6QM 3QR3A 4IMFA 1J4EA 3AXHA 2J6VA 4CD6A 2YGYA 4TXEA 4MZ1A 1W1IE 1H62A 3VILA 4B5WA 4FSAA 1L6FA 2V8ZA 4V27A 3U48A 4NJIA 3MWCA 2R24A 1ZALA 1BEUA 1VP5A 2VDGA 1M53A 4LOCA 2WOQA 4QM1A 1RK6A 1R6WA 2ZRYA 3NSXA 2VJXA 5BRBA 1CNVA 5ABTA 3ZO9A 3L5MA 1R38A 2OEMA 4QR6A 4N4PA 4S3GA 1V6UA 2PS2A 5BZAA 3GFXA 1IIGA 1KBIA 3BCJA 1DJXA 3UXIA 2YKKA 1CXFA 4HA0A 3URAA 5T91A 3TMQA 1G01A 4QAWA 2PGFA 5LXEA 3W71A 1CEOA 4LAKA 3VX1A 5AC7A 4OGZA 3GE7A 1R2RA 1W9BM 3SCNA 4JQ2A 3G77A 1QNQA 2PCQA 3VTRA 4IGHA 1Q8JA 4PE8A 3LV5A 4CD4A 4H01A 1IXQA 4HGXA 4I7WA 3VKDA 4H9MA 4EPEC 1M65A 2VEMA 4PTDA 2WZEA 3T0BA 4AZGA 3VZXA 3VCRA 1UD8A 1B3VA 4OJYA 3L4UA 4XTDA 4QCFA 3DKLA 3NWRA 3WUEA 1HN1A 1SMAA 3AI0A 3W7RA 4JDYA 2NQZA 3EX2A 3OQ8A 3FNDA 1XLHA 1XX1A 3WF3A 4ECLA 1XS2A 5CZKA 3MQTA 1A0CA 1WUFA 4XSLA 2Q6ZA 2J78A 4GXWA 3LCGA 4YL2A 4BQ4A 1GKPA 4Q8VA 1AQ0A 4MGGA 1RZMA 4JTJA 3W7IA 4UNLA 1X38A 1RQBA 4AYSA 1KWGA 4N9DA 4B3ZA 3DGRA 1Q8AA 3NVDA 4V15A 5G4WA 3CZJA 1VAHA 1BXBA 4EKJA 3KTCA 1RK5A 4MVAA 1X1ZA 4JHOA 1HKVA 1JCLA 2J7EA 2PDMA 3L7RA 3BGGA 1AFSA 4JX5A 4BI6A 2FZDA 2NVCA 3LN3A 3O0FA 3TJLA 1CCWB 2PURA 3W25A 1SMDA 4NNCA 2Q71A 3SCSA 4NQ1A 4NZ4A 4WQ6A 4MAZA 4QNEA 4W7UA 2VFEA 4ZXLA 3SY1A 1DPMA 2J8FA 1XYCA 3NDZA 2DIKA 3ZFHA 3II1A 3T0CA 2A3HA 3TX9A 1SR9A 4CNOA 5JXQA 1S2TA 4DUWA 3UGVA 1G6CA 1ONWA 2ZTJA 2DVXA 5XIMA 3C8NA 1UZ1A 2XHYA 4FLRA 2WYSA 1OHLA 4R33A 1KM4A 1S2UA 1IR1A 2RKXA 3I4EA 4JZ5A 4JX6A 1YDNA 4XZBA 2YB1A 1A5CA 4O1FA 2O92A 4A3QA 5EMMA 4ONVA 2Q09A 3TYAA 3VNZA 1TTPA 4DO6A 4J5NA 3N73A 5LKYA 4XKYA 1DWAM 2J62A 2J7GA 3DHDA 3WLIA 4LS1A 1XDLA 4PCTA 1XUZA 3WUFA 3CPRA 2GFTA 3PR2A 1MQRA 2E77A 4O53A 2VZTA 2NXIA 4TMBA 3OZOA 1XM3A 1SJAA 1XIHA 2V67A 3HM7A 3MMUA 2NZLA 3U2ZA 4DEFA 4E2VA 1FXPA 2C6QA 4JTIA 4XD4A 3UA3A 1DJGA 1EBGA 2UZ9A 3NQFA 1FWAC 1OABA 5AC6A 4FP1A 4ICCX 2BOGX 3CV6A 5FF7A 4IQLA 5HR6A 3ID7A 3VE9A 2CLFA 3VIFA 2ZUMA 3CHDA 3AC0A 4EP8C 1VFLA 1JR1A 1UJQA 1A3XA 1YYAA 5AHMA 4AVFA 4CQCA 1BAGA 1XLAA 4MNLA 2PSNA 3WK0A 2Y62A 2DW6A 5G2IA 2IKHA 5KZMA 4RPQA 1IZKA 1HKMA 3UY7A 3VINA 1B5TA 1IEIA 2RGMA 3EOEA 1TV4A 2WZIA 3AS3A 3SQLA 1Z8AA 1JZ2A 1KFCA 3DOPA 4JCLA 1F4AA 3TOPA 3PZIA 3W7QA 3K5XA 1YQ2A 4MJ2A 1QATA 3DFOA 1XPYA 5CXPA 4NILA 1W3HA 2J25A 1X8FA 2SFPA 4DXVA 3CAKA 1H7OA 1A4LA 3W7PA 4Q4OA 3M0XA 4WHBA 1GHRA 7REQB 3NQCA 2V3GA 4PCSA 3BE7A 3SDOA 1YIXA 4UTWA 4HNCA 5D03A 1ZJHA 4NUWA 4QG8A 3GR4A 4IPNB 2JKAA 1JIBA 4O1CA 4WCJA 3K46A 1EC8A 1V3MA 3I68A 5D09A 3GSMA 3MP3A 3GU9A 1RBAA 1GCYA 4JYFA 1XLLA 1S2AA 5LNRA 1EIBA 5LA2A 4Q4QA 2R1LA 1NM9A 1F07A 2CZVA 3MUY1 1PZ2A 5DMNA 3UXDA 1KO0A 3WLQA 3B3DA 3THUA 4EXBA 3Q4DA 2WNQA 4M29A 1RVGA 4HPHA 2A1YA 1AUSL 2WKGA 4RE0A 1UKQA 1GOQA 2GSJA 3HTWA 4WSKA 3B06A 4U2YA 2JKPA 1H4PA 2X7WA 2PB1A 4DWSA 5FJRA 1FXQA 5AYZA 1E9ZB 1P5BA 2Z6IA 5DCBA 1N8FA 3W7MA 3TTEA 3T4WA 1IV8A 4GUIA 3DAQA 1KQYA 5G1MA 2IQ0A 4ML4A 1JCJA 1XC6A 3VOIA 2QDEA 3DU0A 4UTHA 1WKFA 3QLLA 1QNVA 4NI8A 4HMCA 2C91A 4P7RA 2PDYA 3CLMA 1KA9F 2QAPA 2JBMA 1QK0A 3MANA 1R46A 3R13A 4XUGA 4DI9A 4Z1AA 1QXLA 1SO3A 5BWFA 4MPKA 4JX4A 4AUBA 1M5WA 1R5YA 3L4YA 1XIBA 1QMLA 3SUTA 1EOMA 3VK5A 3MHFA 4M6QA 5AC5A 3IS4A 2PI6A 5BOEA 1FVPA 4U2ZA 3HJZA 2ACRA 2R1KA 2CESA 3K1DA 4GIYA 4Q8UA 2Y63A 5FEWA 3FXYA 3GXPA 3FJ6A 3PP7A 3WDHA 2WANA 4HSOA 2OZ8A 1W3IA 3O6AA 1QT1A 1XCWA 3LLDA 2FLIA 3PNUA 1D8CA 3S1WA 4CVUA 5FI8A 2XGBA 3MJYA 2VZSA 2HJPA 3P2VA 4JD4A 1KM6A 3IANA 3W2MA 3OBAA 4Z0SA 2YDRA 2AQOA 1UR8A 1JGIA 1T40A 4NZFA 4GGBA 1FWGC 3K8LA 1RCQA 1PX3A 3B8VA 3KAOA 4XTIA 4HNLA 1XR2A 3CQHA 4YXGA 1G7UA 4HNOA 1E1CB 4RDWA 2Z26A 3S0CA 1UC5A 4S1FA 2ZICA 3G6LA 3HQOA 3R8RA 3KCLA 3AHZA 2BSLA 3TSMA 3PY2A 2PDGA 5CEWA 1T41A 2ZTKA 2IPGA 1WCGA 2QYGA 3N25A 2CIPA 5I03A 1E4IA 1V6YA 1XRTA 5GNXA 4F66A 1GT8A 2YXXA 1BXNA 3UWUA 1V8EA 3E5BA 4JDBA 1E9YB 1KXVA 1KXHA 4GABA 2PLCA 1HP5A 4JN7A 1W5OA 1A4MA 4QLKA 1A80A 1V79A 1TYGA 3C2YA 5C9ZA 4P7QA 3RM4A 3TK7A 5FJIA 4GY7A 2OGJA 1TREA 3PZOA 3RDKA 5HMSA 4UTTA 1J5TA 1LLZA 1ITQA 4PEKA 5BRQA 1GKRA 3MY9A 4V1XA 1RUSA 2X1IA 2HVMA 4GZ7A 3NL3A 4AZ5A 2WMGA 1K4HA 3SSJA 2UY2A 2WHKA 3W53A 4REQA 3WJWA 3PSVA 1KC7A 4J9JA 1NU5A 4KGLA 3WBEA 1OZQA 3EWYA 1WOBA 1W1ZA 4DBWA 4Q4MA 4AD4A 3VGGA 3WQVA 4JYDA 4C6KA 3C0JA 5CH9A 3VM7A 4LFYA 3WNLA 1N8WA 3CHEA 2O9RA 4OV9A 4Y9NA 1R3YA 1A5LC 2ISSA 3MZ2A 1PYFA 1F6PA 3LEPA 3L67A 3TTOA 1TIMA 1PX4A 3MKVA 3VPLA 3VZZA 1KV8A 3ZIZA 3LCLA 3PBWA 2X8RA 3BAWA 3T0DA 2ZA3A 3P0XA 3TFCA 4GI6A 1JQXA 2CZFA 1EO7A 4MG4A 2C79A 1W8GA 3CLWA 2JALA 2E9MA 2P1FA 1GOKA 2VI0A 1WX0A 2Q02A 4W88A 1UUOA 1Q4NX 1YDOA 2F6XA 1XIJA 1UKPA 5B80A 1FOBA 3RNDA 1DJHA 4HK7A 4H9UA 4O1EA 4LF2A 1V08A 5KZEA 2GGIA 1RQHA 3KTXA 1OX5A 4J3UA 2OLHA 2PTZA 3QKZA 1NSJA 1NWUA 1MXSA 3FEQA 1SO4A 6XIAA 4S23A 2GYIA 3B4UA 2CLLA 3L2LA 4PMZA 1QOQA 2FDMA 1RR2A 2XGZA 4MJ4A 2DZSA 2XVGA 1CZ1A 1GW1A 3BCDA 1D3CA 5CBJA 1UD4A 4HJWA 3MZNA 4A8LA 5I3KA 3WF1A 4IIDA 2PZ0A 2WBGA 3GNNA 4ZE4A 4PCNA 3UJEA 3AXKA 5A6KA 1IEQA 1GK8A 2ASHA 2IUZA 1XIGA 1H50A 4AD2A 5HWMA 3TP4A 4AEEA 5GVJA 3SRDA 3WMSA 2VDIA 3MSRA 1KGWA 5BMXA 5AYIA 3V5FA 3LY0A 5IDIA 1DIOA 1J12A 1EJXC 1D2KA 1DJQA 4WLCA 2C1IA 3E49A 2YDQA 2X0SA 4IIHA 1E0XA 1SFSA 4RZBA 1W9UA 2A79A 4P2VA 2FJUB 2ZRXA 9CGTA 2OLSA 4IIBA 4DJED 4JTLA 3OIXA 3AYTA 3RPDA 3VO0A 2GK1B 4J3XA 2NUWA 3ITGA 1XDJA 1B3YA 2HDJA 1VBGA 3HMJG 3LK6A 3GBDA 1YPIA 3KP0A 3ABRA 3DBNA 3VOGA 2G3FA 2RH9A 5CG0A 3UR8A 3KBNA 4KPLA 1FKWA 1PE1A 2C1HA 4IG2B 1XQLA 4MNMA 1RHCA 4FLOA 1B0IA 1AZ2A 1H5VA 3AIRA 2CKSA 1E1EA 1ZB5A 1VEOA 1W1A1 3O0KA 3QBUA 1P0EA 4F0SA 3CO4A 5I23A 4R53A 2QCGA 4XAPA 3M5VA 4AZBA 4DZHA 4MKVA 4OUEA 2NV2A 2W62A 4U4MA 1VLIA 5F1UA 2PDUA 3GFZA 4GOAA 5BMWA 3UWVA 5AECA 1W37A 1MZHA 1R7OA 3CGTA 3AZTA 4C6BA 2CLHA 1GYMA 4XKMA 5U7SA 3YPIA 4OV4A 3NURA 3CV1A 1TG7A 3FGCB 1H49A 2HPMA 1TV3A 1SSDA 3N9RA 4HP5A 3PBMA 1J0HA 1XG4A 3WSUA 1J6OA 3ARYA 1KBLA 3RM8A 4UUIA 3DN5A 5I2UA 1Z41A 3SI9A 3WO8A 4WDUA 3P3BA 4C60A 4HA3A 2PWDA 5CBIA 2E5CA 5KSWA 3FDGA 2GGJA 3SQMA 1UKTA 1DE6A 4W89A 3EMQA 4W86A 3S5NA 1WZMA 1KFJA 1TZ9A 3DHFA 5HATA 3N17A 1PIGA 1ODZA 2QPSA 2EKCA 3GU2A 4S3FA 1A49A 4QCEA 3BJSA 3GXDA 4JYEA 4US5D 4JBRA 3C56A 1XIIA 2FHCA 1G67A 3A47A 3QKEA 1K7XA 3AS0A 1K6WA 3VD3A 3GD6A 2ZADA 5HMEA 3SB0A 3CAQA 4Q7BA 4R34A 3TROA 4QDWA 9XIMA 3IGUA 4H6RA 1UPPA 5IHSA 1I2OA 1DWGM 4O16A 2ZZ4A 2XJ7A 1QHPA 4O12A 4E0CA 1C7SA 1Z42A 2A3BA 1UOZA 4LQ1A 2X41A 1UR1A 1JI2A 4A6GA 1X98A 5DMYA 3KBMA 2RUSA 3LBMA 3T1GA 1XKJA 1GQKA 2YBVA 3VAVA 3MHUA 4MY9A 4ZVJA 3T6CA 1EF2A 3SCPA 1UR0A 3L23A 3LBCA 1ECEA 1VRXA 1EGMA 4AG0A 4GFSA 4XO7A 5I00A 3CM4A 4W87A 2Y5JA 2D69A 2P50A 3SCOA 1FWBC 4OUIA 4L1GA 1XLJA 3FIGA 3UG3A 1RH9A 1H1NA 1LM1A 3TWAA 1QPKA 2ZA1A 2OT1A 3UR2A 3TTQA 1JDDA 5DF0A 1M01A 4J2PA 2C13A 4HTBA 3BSMA 4WEVX 3W7DA 5I3GA 3CH0A 1XJBA 4B5XA 3F2DA 2CERA 3CQKA 1EGVA 1OGSA 3BV7A 4IIFA 3ITXA 3TN6A 4UFIA 2EG6A 4NVTA 1F73A 5EFDA 4EWND 1XLDA 1OSEA 2FZBA 4QFUA 4I90A 2QCDB 4MLJA 3H4GA 3B04A 3LYEA 3OG2A 3F5KA 2D20A 4Z2HA 2PDCA 1R2SA 4P7NA 4DJDD 3DC8A 2J7BA 2W67A 4XD6A 1V77A 3P5YA 1HJXA 4MYAA 3L4WA 2VZUA 4KFOA 3AHVA 3PAJA 1S3HA 2EPHA 2VCCA 2PAJA 1FCVA 3L4ZA 1XG3A 3ZT5A 3W7KA 2P8CA 2ZX6A 3TE9A 3H4XA 1D9EA 2HVNA 2DT1A 1HKKA 1YDYA 1NIUA 2O55A 4JFVA 2C18A 4KGJA 1DVJA 1JF6A 1XLEA 2NSOA 1QI0A 1S5VA 3HB9A 2FZ9A 3PBUA 1CX9A 2FPTA 4DBEA 3A3XA 1OFAA 4Y9PA 5T9CE 1GKQA 3GVWA 3S5OA 5CAKA 1JPDX 4I8YA 3H2AA 1GZ1A 1W2PA 3BAXA 2Y6ZA 2G5WA 3S9IA 1JZ6A 4MLRA 3VIMA 3VUSA 1FCBA 1IZCA 4NZCA 1RBLA 3CC1A 3WLLA 3E2SA 3A5FA 2WQPA 1NP2A 3OO2A 4CU8A 1L8NA 1BD0A 1KTCA 1LBLA 3V4BA 3WNNA 4UTIA 2YJQA 1C92A 2WSKA 2INEA 2H3DA 2WAGA 2B4GA 3I6RA 4BJHA 2C7FA 2DZTA 2WK2A 3T4CA 3CL6A 3RXZA 2AL2B 4AX7A 1P7TA 2ZXQA 1GWJA 3NQVA 4UFHA 1O5QA 4PB3A 1XYFA 4ILSA 3H53A 3UWEA 3FXGA 4LT9A 5L9FA 3PF3A 3REQA 3C0QA 2NUXA 2FB2A 4ENLA 1SU5A 1VHNA 1ML1A 2CHOA 4L65A 2WLZA 2X1RA 1J18A 3SCVA 5AYBA 1ZP3A 5D4YA 4M7SA 4KESA 1J0YA 4Z0JA 2UBPC 5A6JA 4CNTA 1QI4A 3JRKA 4ZOEA 3PUGA 2DT2A 3GHUA 3QW3A 5CC6A 3T42A 2BGSA 1U33A 1Y5WA 1NFPA 3SGUA 4UCGA 2FKPA 4JNYA 2PRHA 2D22A 1U1HA 4IMGA 3IIXA 2Y85A 3HG2A 3O6YX 1C3FA 4H4IA 3VFCA 4XB3A 1WBJA 4DO4A 4IXHA 4WK9A 4PYSA 3U2OA 2ZQ0A 3OODA 2O7SA 4HZ7A 3P82A 2YL9A 3R8HA 1JD9A 1R9YA 1XC4A 4C6DA 1XSJA 4DJFD 3RX4A 5HMDA 2PC4A 1KTNA 4BK9A 2H90A 5I3IA 3GIYA 1LYXA 2D2HA 4Q8QA 4LAZA 2C15A 1WZKA 6ENLA 1DL3A 2BOFX 4KWVA 5JMUA 5K2ZA 3EWXA 4IM4A 4NP7A 1XICA 2AGTA 1UC4A 2BP1A 2WSPA 2W3ZA 3PTDA 3OU8A 3UESA 1CXHA 4DBUA 1TCMA 1FDZA 2GVLA 1JZ8A 3OYZA 4X3ZA 2CZEA 4ZOBA 3BXWA 3UYIA 3W29A 5FEPA 3HG4A 3Q67A 4R9OA 4D8AA 3LHYA 3LRMA 5D30A 3OBEA 3DFQA 5F4WA 4UQCA 4QG9A 4PMOA 4FX8A 5H8UA 4F79A 3RN6A 4FXSA 3SADA 4KWWA 4PL1A 2XUCA 4GX9A 5M17A 4RNJA 2GJXB 4UIOA 4J3WA 4B3KA 3ZOAA 4OVXA 4GXPA 1PZ3A 4CQ9A 1SJBA 3W3OA 5T26A 2GQ9A 3RFAA 2PDLA 1CB2A 3AYVA 1HX0A 1JYNA 2HNHA 5AC8A 4N9BA 4FNSA 2Z28A 1OFRA 3W00A 4ZQPA 3B8TA 4GVHA 3W2UA 1GOIA 4PMQA 3O15A 2FQIA 4UMBA 7A3HA 3W24A 4AC7C 4J4KA 2GUUA 5DEZA 1TMQA 1W2VA 4EXQA 2PODA 1DIDA 4P7LA 1NARA 3FJ4A 1TJRA 1DWFM 3H7UA 3W7LA 1OZMA 1BVWA 4LVGA 4V1YA 4JL2A 4DZ5A 1X6NA 5JBEA 4RXGA 5E09A 1K9FA 3U3HA 1VYRA 1LOLA 1HT6A 2BMBA 3T0TA 4H3DA 2WSYA 1GNXA 2ZE3A 4Q8MA 4PRTA 4E2BA 3HFYA 2PGEA 2VWTA 3U7BA 4BEQA 1N7KA 4AZIA 4JXCA 3G1VA 1VFOA 4UOQA 1FWSA 1GEQA 3A9IA 4O8AA 4L6HA 2B81A 4ZO8A 1GORA 2D0HA 2CBJA 4W8BA 3WDQA 1QNPA 4YVPA 4M3PA 3O9NA 3OOQA 1FRBA 4E4FA 1JPMA 4ORMA 5A6TC 1J2WA 1S46A 5AN7A 3LGDA 1XYLA 2NQLA 6CGTA 4H8VA 1M9HA 5CPSA 6PTDA 2BVDA 4G1KA 4DJFA 2I57A 4C90A 2ATMA 1H1ZA 1AH3A 4H7CA 3QHMA 3VE7A 1GJWA 2QCCA 3L0KA 1KWKA 4DYJA 4Y8FA 2ZWZA 2EHHA 4DF0A 3PPCA 3CYJA 1CB7B 4QAIA 3A12A 3JVAA 4LV4A 3QW4B 1UA7A 2G3NA 1OC7A 4IWWA 1DTUA 4Q8NA 3MKKA 1IQ8A 3VZYA 3N15A 3GH7A 1GUVA 2XDFA 4W4QA 4NHVA 4JKKA 1UMYA 1GG0A 3QY8A 1UKSA 1C8VA 2PF0A 2VGBA 3WLNA 4WXYA 2XSXA 3A4AA 4M24A 3NUKA 4B9YA 4NNAA 3BMXA 1RCXB 1F61A 3T2PA 3WD4A 7REQA 1KCZA 3W37A 4AISA 2V5JA 2PDJA 5A94A 1IXPA 4XBKA 5TAOA 4DB7A 5DMMA 2CWXA 5DY3A 1BQCA 3KCOA 1RP9A 2R1MA 3JU2A 5CPTA 4ZENA 5TQLA 1TE6A 3GG0A 3QHNA 3KL0A 3CZEA 1AH0A 1NDZA 3QV9A 4QE4A 3KDNA 3QQWA 1TV2A 1MQQA 1FH9A 5DCEA 2GJLA 2ZZ3A 2IKJA 3QFEA 2PD5A 2OSWA 1EKOA 2QNEA 3L4TA 4LRTA 1J0KA 2H9AB 3CIWA 4R5EA 4GBUA 4IH3A 3IJ9A 3VABA 4LUSB 4PMJA 1UR3M 1QPRA 1AL7A 3VMOA 3RJXA 1XUUA 3QSRA 2JIWA 1C8XA 2VOTA 2CNCA 4IMAA 1BWKA 1B3OA 2I5IA 4QS6A 3OLEA 3VNYA 4XIMA 3W01A 2VVNA 2BXVA 3NXLA 3MVIA 4GUFA 1E6NA 4Z1BA 4AC1X 2NWRA 2YZ5A 1GVSA 4U3AA 5LIYX 3ARZA 1KM5A 4JHZA 2JGYA 3VI2A 2V63A 3RR4A 1LQ2A 4NX5A 4UQAA 4GKTA 4BCEA 1MW3A 1XINA 5C71A 2A7PA 1FFQA 2BWGA 3SN4A 3CBWA 1S38A 2DSKA 3C61A 4GO8A 4INFA 2E1WA 1UH3A 3TYCA 1TQJA 1XLGA 2DSVA 5LA0A 3VDCA 4ZTYA 1OFBA 4GVIA 2A3AA 1CWYA 1KKRA 1RP8A 2DIJA 3SM0A 1G4TA 2XIMA 4TX9A 3PG8A 4YTQA 3CZKA 2YXGA 3B0VC 1R0MA 2YCIX 4OOZA 1BVNP 1CPUA 1V7YA 3ELFA 5KZDA 3QRHA 4NT0A 3WQCA 1B57A 2NXGA 3WDRA 5BW6A 3DKJA 2QUTA 4MOZA 3LHWA 3WQ5A 4NL1A 2HXUA 4ML9A 2QDDA 4UXDA 3CTLA 1QRQA 3MA8A 1V03A 3QZAA 4ZB2A 1YBQA 3HFTA 2VYOA 4PCPA 4BQ2A 1VYPX 3KUMA 1F76A 1PJ9A 5HMFA 1E1CA 1Y65A 1QHZA 1OCNA 5FJOA 1XGEA 2A2IA 3TOYA 1L6WA 4PMRA 4R7JA 4WOQA 1KXTA 2YFOA 3HGOA 5HULA 4E38A 1UD2A 1KKOA 2FPVA 4K8HA 1GW9A 4DXXA 1E3XA 3C4UA 1EJVC 1RBOB 4MY8A 3M7WA 3G1YA 3BSHA 4E8CA 1XBYA 4LSBA 1VFTA 1A5KC 1AZ1A 1RJPA 5AB3A 5EMUA 4EF9A 5A6BD 1HTIA 2C16A 4A8RA 4EPDC 3C6CA 3LA4A 3KP1A 2Q01A 4FNPA 3T7VA 3W23A 3BURA 3QMSA 5HWNA 4KEZA 4HOZA 2NUYA 1UCWA 2V5LA 3B9AA 3FOKA 5FEXA 1DQWA 1PXGA 2O7QA 5J8LA 3SCUA 3UU0A 1F5ZA 4X60A 3KBJA 3S5YA 1JZ3A 4NI3A 4N2YA 4PRRA 1R9XA 3TJXA 2OO0A 4OHQA 1ME7A 3WLOA 3R58A 1O4UA 4X2PA 4EX4A 1QR7A 4B3LA 3QV6A 2VX7A 4LY8A 4PTNA 1DTNA 5SWUA 3WLJA 3WUBA 4HHLA 4L1WA 2Z2AA 5DT5A 1FWEC 1TX0A 4FLQA 1QBAA 3QTPA 3M5XA 4TOQA 5CGTA 3WFZA 3BH4A 2DQXA 3GZAA 3N04A 2V82A 1MUWA 3P61A 2QJNA 4I8DA 4I6VA 2CLIA 3WLTA 2OZ0A 2XFFA 1IWPA 1YXDA 2PDQA 2FTYA 4HSNA 3WLPA 1C91A 3CUXA 3TVAA 5IXEA 2W0UA 3W38A 2G50A 1MFUA 4RV3A 1GOXA 1HXJA 3QQ1A 4MTVA 1XSKA 2XVKA 1OD0A 4PUMA 1WXZA 4FAMA 3W2KA 1YPXA 4KCWA 3LTSA 3WUGA 4I9JA 1M41A 3APGA 1WDPA 1THFD 1NQ6A 4O17A 4IFRA 4DO7A 4YYFA 2D2GA 5HBFA 4A4AA 1AG1O 1EHNA 3VIJA 2VOMA 3MMTA 4DY1A 2OX4A 1J6PA 1VCFA 4PMVA 1ZQ5A 2PCEA 1M7XA 3DI0A 3GG8A 3WCZA 1PPIA 3FEMA 1BWLA 1O1ZA 1LJYA 7TIMA 3U5UA 2VEPA 4PMNA 3D5HA 3MSYA 3QMTA 1WZLA 3WYZA 5A2AA 1E9LA 3LXAA 4ZQMA 5K4XA 3G1RA 5FSDC 1WO2A 2V5BA 1PTAA 4GYJA 5HJXA 2VMFA 4QISA 1QDSA 1DQXA 2XISA 1SZFA 4UOJA 4UTUA 4QE1A 1FTXA 4XBSA 3HPSA 1IIHA 2GJRA 5G1TA 4UQEA 3S1UA 3QM3A 2YPIA 4ORIA 1VHCA 1V02E 4Y2WA 3MI3A 3WQ6A 3VKBA 5FESA 3NPVA 3MSGA 1NEYA 1VQTA 5CJMA 1LQ0A 2Y5SA 3VIOA 2FFIA 2UY4A 4WGHA 2QEZA 4R27A 4FALA 1ZSXA 4JTQA 2C3ZA 2Z6JA 2WKJA 4HZ8A 2J6XA 3KLLA 5HNRA 2Z1VA 3C8FA 1FWDC 5A8QA 1UYQA 1FWHC 2CBUA 3WBXA 3WLMA 2NLYA 3TC6A 3CZ8A 1QOPA 2GK1A 3W4RA 1HJSA 2F38A 1J96A 1YEYA 1E6ZA 4PL2A 3N3TA 2WWDA 4NF7A 2DH3A 4C5YA 2WXDM 4AZ7A 3DFPA 2FYMA 4ZB0A 3MI6A 4IG2A 1AMKA 1OD8A 3ITVA 1TPB1 1H7WA 4DLMA 3RYSA 4FXRA 4PSPA 4QLJA 4DWSB 5I3HA 3MS8A 2POZA 3GTFA 3AXMA 4DWDA 4N4QA 1EX5A 4GINA 1J93A 3SW6A 3H23A 7XIMA 5KMYA 2PLKA 1L9WA 3E0FA 3GUWA 1X39A 3GDLA 3NL6A 1D3GA 2J24A 4O52A 1LDCA 4YU1A 5FF3A 3MKCA 5LIUX 4QX4A 4PBEA 4IF2A 3VXGA 4FLSA 3CASA 3FGCA 1WDWA 2JF6A 3R94A 1DJZA 2VFHA 4XG1A 2HS8A 1OK4A 3AMKA 4WSJA 2PDPA 5LIWX 4RDVA 3CZGA 2DH2A 4Z2KA 4F8XA 2ZX9A 4DBDA 3U7VA 4MIMA 1YTDA 3TNOA 1WP6A 3H24A 3N2TA 3F4NA 1JAEA 5TIMA 1LP6A 3SUVA 2VXNA 5IBXC 3GC5A 3QF0A 3DBPA 1PEZA 3AIQA 2EJAA 1PHWA 4ACZB 2BS9A 2YOCA 4Z1YA 5JIWA 3G22A 2NV1A 1TB3A 1XLIA 4B2DD 3ARUA 1WV2A 5F4SA 4JIPA 2X09A 4PFHA 4HMNA 4AU0A 3THDA 5D9NA 4QJ1A 3LPFA 4JTHA 1DE5A 1DYSA 4LYRA 5LYRA 3SY5A 3W88A 3QEZA 1W3LA 3HU7A 4U5KA 2G4JA 2W91A 4HNTA 1LF1A 4YLWA 3HGRA 3Q58A 1AQMA 1HW6A 2OU4A 1A5BA 1U83A 1UP0A