1JFXA

Crystal structure of the bacterial lysozyme from streptomyces coelicolor at 1.65 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
b'DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-beta-N-Acetylmuramidase M1
molecule tags Hydrolase
source organism Streptomyces coelicolor
publication title A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution.
pubmed doi rcsb
total genus 80
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfxA00
2WZEA 2X8RA 2YOCA 2VZUA 3K4AA 3AXXA 3EDDA 1ZBKA 3TTQA 1PX3A 2WMIA 1EOKA 3ALFA 1MQRA 3W26A 1EOMA 4PMUA 1W3JA 1HJUA 4HOXA 2XPKA 1CXEA 2D2OA 3BC9A 1ECEA 1AQ0A 1UH4A 3PZVA 5TD4A 4EANA 1JNEA 2ZOXA 1HNYA 3WQ6A 2A3EA 2V5CA 3T08A 1KGUA 2J62A 4JHZA 4KWUA 1W9PA 1NP0A 2CESA 3HJEA 4J3SA 3LPGA 2GJXA 2IXVA 4NRSA 2BNJA 3ARWA 3TTOA 2VQUA 1ZU8A 3VNZA 1JAKA 2VCAA 5FKYA 1VFFA 2O9PA 4UQ9A 2WHLA 3VGDA 1ISWA 1JDAA 1HVQA 1W1PA 1CTNA 4MDPA 2F61A 4BZYA 3J7HA 4MDOA 3ZR6A 2XM2A 2WVVA 3WEZA 5ABFA 1TVNA 5A6SA 2BY2A 2WCSA 3K1DA 2DT0A 1C90A 3M46A 2W62A 1OT2A 1KGXA 4XB3A 3VIPA 3UERA 4CU6A 1B3VA 1BYCA 2JFEX 4HOZA 4PMOA 4WJXA 2OLHA 4AD5A 2ZX7A 4PMYA 1NWRA 3NSNA 4QLLA 2OYKA 5I23A 3GDBA 3N13A 3ZT7A 1JZ6A 1E6PA 3G6LA 1MWOA 3AZSA 2J7GA 5LYRA 3SCUA 3HN3A 4PUDA 1W9BM 4AZGA 4NZCA 1H0IA 3WUEA 3VM7A 2WSPA 1EO7A 2EEXA 4ACZB 1HJQA 1TA3B 2EO7A 1E1FA 1OSEA 1V3MA 3MKKA 2YIHA 2G4FA 2TAAA 2VQTA 1AMYA 2PWGA 2ZX8A 5CSYA 3AISA 3ECQA 3QGVA 1QNQA 4BQ3A 4MAZA 3ARTA 1M01A 3K8MA 4BCEA 3A47A 1FH8A 3L2LA 2G3JA 1UZ4A 1C8XA 1QBBA 5E09A 2D22A 4H8VA 1E56A 2G41A 2WCAA 4UFMA 1QNSA 5A6BD 1G9HA 2ZUWA 1EHAA 3O9NA 1KXHA 2X2YA 1C3FA 4V27A 3WDJA 4A4AA 1E0VA 4JZ5A 1BVZA 1GW1A 4CUCA 4AEEA 3CBWA 1CXIA 1UR2A 1H5VA 2UY5A 2EPNA 3POCA 1E4LA 2WVSA 1TCMA 2OSYA 3WD3A 2PBOA 4GO8A 2VT0A 5LA1A 4M56A 3ARYA 4P7OA 1H1NA 1EHNA 1H41A 4HZ6A 3GBEA 4E8DA 5CLWA 4AMCA 3AMGA 3EYPA 2CEQA 1HP5A 4GQRA 1OBAA 4M80A 5CGMA 1FH9A 1VFUA 3QOMA 2OSXA 2V38A 2BVYA 3PZ9A 4MB4A 3MU7A 2J7CA 2VZVA 3ZR5A 3GXMA 5GNZA 4KH2A 3OIHA 1DWJM 3LPOA 3OLGA 4P8XA 4LYQA 4JKLA 3MMUA 4GZEA 1K9TA 3FN9A 5AC5A 1UWRA 2DSVA 3IJ7A 5A2CA 4LYRA 3AICA 3KEHA 1GORA 3VX1A 3FAXA 3OGSA 3PZUA 3VTRA 1H49A 3ZMRA 2YBUA 4OZOA 3W6LA 1QHZA 4OOUA 1IZJA 2XHYA 3DYMA 2A3HA 4YHGA 3TP4A 3W25A 4M29A 3MUZ1 3WNKA 4GIAA 2ZXQA 1UKOA 3LPPA 3CHDA 1JGIA 2WVTA 4D6JA 1B3WA 1UKTA 1TVPA 1W3LA 2XFFA 1E73M 4MB3A 4CU8A 2J7DA 3QHMA 4ZENA 4QAWA 1W9UA 1W9XA 3PZQA 2VRJA 1MW2A 2OWWA 2NT0A 5D9MA 1UR0A 2J8GA 4MADA 4W7UA 3VD9A 5DF0A 3WL0A 3WNMA 4W86A 4RL3A 3WN6A 2XVGA 2GK1A 3WH5A 2ZXBA 5A6KA 2X0HA 1CPUA 4UZSA 1CYGA 2CERA 3AIVA 4H8UA 5FL0A 2WSKA 2CYGA 2OWXA 2VR4A 5EB8A 2UY2A 1V02A 4UQBA 1D3CA 1E6ZA 1QNPA 5A2BA 4JIEA 1V0NA 2DDXA 1FFRA 3SCWA 4WK9A 4JKMA 1DWGM 5JUVA 1B90A 2QMJA 3AIWA 1J9YA 2XM1A 1HL9A 5FOOA 4FLQA 2J4GA 2WKGA 3WF2A 2XWDA 5HDRA 3POHA 4N42A 4HOWA 2W5FA 3GXFA 2V3GA 2ZUUA 1BAGA 1OGSA 4PSPA 3HU7A 4OOZA 2CETA 4AD1A 2BHZA 5I77A 3GXDA 4MJ2A 1DP0A 4B15A 4M24A 1H09A 1E4NA 4Q22A 1CWYA 1X6LA 4AC1X 1WDRA 1V6UA 2DH3A 4OIFA 3U5UA 5M03A 2WNWA 4PMZA 4GI8A 1UD2A 2ZXAA 1HJSA 3EDFA 1B9ZA 1E6XM 1R87A 3UG5A 3K4DA 2ZIDA 1WO2A 3VMPA 3W29A 1GUVA 2D23A 2BHUA 5CSUA 4P7QA 4URIA 1HN1A 3TONA 3W27A 3L4ZA 4U31A 3ARQA 5ABHA 4IPLA 2Y4SA 1LWJA 1O6IA 2VL4A 5JBFA 5HPCA 4CVWA 4XZBA 5A1AA 4H2CA 4PTXA 3N9KA 2ZUSA 2D1ZA 4WKHA 1J0KA 1OIMA 4J7RA 4DUWA 2VVNA 4DWSC 3MO4A 4MNLA 4A3YA 1RP8A 4CCCA 3MUY1 2BHYA 2GJXB 2QF8A 2J74A 3DYPA 3VUPA 4M82A 3RPMA 2ZE0A 3ARSA 1M53A 4DWSA 1LWHA 5E0CA 1JI1A 3M07A 2JIEA 4WLCA 1GVIA 5BCAA 1JL8A 2GK1B 1QNRA 4BQ2A 1V08A 1EDGA 3AXIA 4E2OA 3BLPX 1ODZA 4ZE5A 2J7FA 1XHGA 4CD6A 3VOCA 1XC6A 2Y5EA 5E9AA 2WM0A 4HMEA 2WCGA 3NDZA 1MW3A 4UFJA 3SCTA 3WEMA 1BSIA 2WVUA 4A3HA 3SCVA 4AW7A 1GQLA 2YDRA 3N11A 2VZSA 3GBDA 4S3JA 4AZIA 4AZ7A 3CIVA 1TFVA 1V3JA 2W66A 4L4OA 1I75A 1JYWA 3CUHA 1UG6A 5F7UA 5M17A 2WLYA 3FXYA 4BF7A 3F4VA 5D9OA 5LA2A 1CGWA 3SEPA 1JYVA 1JZ8A 4W93A 4H04A 3AXHA 4TVDA 6TAAA 4QFUA 4F79A 2WVVB 4WIWA 1B3ZA 2XSAA 3VD5A 4EKJA 5HBFA 1MW0A 3MS8A 5FCZA 4AZCA 4OBRA 1UWTA 5AYIA 1X1NA 1XH1A 2O9TA 2IUZA 4JL2A 2BV9A 4P8UA 3W38A 1JNDA 1Q6EA 1MXDA 2JALA 1V6YA 3AIRA 2BY0A 1NQ6A 3CZKA 4D1IA 2WANA 1CXFA 3VGBA 3AMDA 1LL6A 2CNCA 3VU2A 3RMEA 3OZPA 4H7VA 2JEPA 5GNXA 1HX0A 2VMFA 4MJ4A 3T2QA 2JIWA 1BYDA 3MUIA 1EO5A 4LXFA 2WHJA 3FHQA 1UQZA 1B3YA 2WXDM 1RP9A 1LF1A 3WQ5A 1EDQA 5CPSA 3AS3A 1ZL1A 3NJ3A 4U3CA 3LPFA 5IFTA 2J47A 4ZE4A 1E0XA 3ZJKA 2XVKA 2RGMA 4B16A 2BXYA 5IFPA 1J0IA 4D6FA 4DUXA 1KGWA 4PCSA 3EMQA 4LQ1A 5E70A 2C0HA 4PYSA 4XX6A 2ZUNA 2QV4A 4K68A 3ZJ6A 3MMDA 4MTVA 3WD2A 1EQPA 3O2LA 3WDQA 3A4XA 4PMDA 1WNOA 1Z32X 2D3LA 3GTNA 5A8NA 4P7NA 3ZM8A 3AHTA 4TX8A 5I2UA 1HVXA 1GQJA 2GVYA 3PZGA 4HZ8A 2J77A 3D3AA 4W87A 1E1EA 5BWFA 1J0YA 4UCFA 2O92A 4Y7EA 1H4PA 4JL1A 3WL1A 3WQ8A 1AQMA 3L4YA 1HKMA 3TTSA 3PTMA 1C92A 1E3ZA 1UR8A 3K8KA 1HJVA 2CKSA 3D5HA 1VEPA 5HNNA 3IANA 2F8QA 5ECUA 1PX8A 2E9MA 4CN6A 3BXWA 4DWSD 2WC3A 2XSBA 3L4WA 3B9DA 4XZWA 1FHDA 1JXJA 4TXEA 4HPGA 3SUVA 1W2PA 4W7WA 3WQ4A 1VF8A 1JDDA 4P7RA 1W3HA 3AIQA 4HU8A 4WSKA 2Y24A 2Z1KA 3BGAA 1IT0A 2WC7A 1V03A 1WP6A 3WMCA 1QNOA 3WH8A 3CO4A 2EPMX 4J3XA 2E3ZA 3WNLA 3CLWA 3ZSSA 1CDGA 4D72A 1ITCA 4KMQA 1DWFM 4U33A 5D8WA 4C7FA 3ZT6A 1ODUA 3TTYA 2XFYA 1HT6A 4JAWA 1KQZA 2DGAA 4GQQA 3NDYA 2B31A 4UQCA 4U5KA 1LLOA 1U2YA 2YBTA 5A6LA 5CJ5A 4X9YA 4Z2LA 1UA3A 3VMOA 1W1YA 4KRUA 1D7FA 1LL7A 4CKQA 2FHCA 1PAMA 5GPRA 1MXGA 1UQYA 2YDQA 4HP5A 1J11A 5I78A 3N15A 3AMLA 4B9YA 2CKRA 1J12A 2XTKA 1K9DA 4Z2IA 1H3GA 1SMAA 8A3HA 1R7AA 3ZIZA 5I3DA 3WENA 4CGTA 1FOBA 1DHKA 5GQBA 3BAWA 4D6HA 2BVDA 2ZICA 5CGTA 4HA1A 7TAAA 3CMGA 2ZUMA 3WUGA 2XVNA 3ZJ8A 2VTFA 1C7TA 1DEDA 2WMKA 3EDKA 2FHFA 2C8NA 1ISZA 1Q6CA 2A3CA 2CITA 4TVCA 1BYAA 3VKKA 1QVBA 4NF7A 3PBGA 1UKPA 5AYBA 3MSDA 3VO0A 3WKZA 2EBNA 3AROA 1CNVA 3HMCA 2VX4A 3SUUA 2YL6A 4RE2A 6CGTA 1BLIA 1OD8A 2WBGA 3GNPA 2WAGA 2UY4A 1G1YA 3I3DA 2WC4A 1UD5A 2DIJA 1SR0A 2J7EA 2WWCA 5EBAA 1W91A 2ZX6A 4PMRA 4D6CA 3N18A 2WZIA 1ISXA 1HXJA 1PJ9A 2VO5A 3WEOA 1UOKA 4GXPA 3VIGA 4PUEA 3UESA 1WPCA 1VAHA 1OINA 4LX4A 3K8LA 2ZUVA 4QP0A 3SCQA 2WMGA 1US3A 3AIBA 4AZ6A 1M04A 2VJXA 4HMCA 1PEZA 3DYOA 1A3HA 3IK2A 4AZ5A 4MNJA 1UR4A 3AYRA 1AVAA 3BAKA 5GNYA 5CPQA 3DC0A 4UTFA 3U5YA 4NSBA 3W82A 1CGYA 5C70A 3GXIA 4PMXA 3VPLA 3PHAA 4UFHA 1UZ1A 3WFZA 3UR7A 5IXEA 2FH8A 4N0RA 5A6BA 3T0BA 3AS1A 4Z2JA 1H0GA 1CXLA 4UQEA 1HF6A 3B9EA 3WBAA 4W8LA 3F5JA 1QW9A 2PB1A 4CN4A 1V6WA 1Q6GA 1TA3A 1HIZA 4Z2GA 2D3NA 5M5DA 4JFSA 5E0FA 3S2CA 1UA7A 4PTWA 3SIMA 1QI0A 1CENA 3VIIA 2JE8A 5JIPA 4AZHA 1CXHA 1NWSA 2X09A 2E8ZA 3WY1A 5FIPA 3CZJA 5IDIA 1E4MM 3PTKA 3T2PA 4D6EA 4ATLA 2OYMA 4FLSA 1J0HA 3RIKA 2WHKA 3ZO9A 3CTTA 3OG2A 4JKKA 4PN2A 5FL1A 3OZOA 4LPCA 4FLRA 1M7XA 2BY3A 3N12A 5EFFA 4PRWA 2CBJA 2WWDA 1CLXA 1F4AA 1XH2A 2UWFA 5BXSA 2WB5A 4BA0A 3APGA 1XH0A 4L4PA 2VOTA 3AS2A 1FH7A 3L4TA 2XIBA 2VI0A 2D0FA 1LG1A 2VX5A 1HKIA 4KGJA 4AXNA 3AFBA 1NH6A 1H11A 4D6GA 1E9LA 1KXTA 5A8OA 2W67A 3VINA 4ATWA 3PZIA 4MB5A 1UKQA 3AZTA 3WNPA 1CBGA 2V5DA 3OB8A 2A3BA 3TOPA 3ZQ9A 4B9ZA 3WF3A 3DHUA 2PWEA 3PTQA 3MV01 1OD0A 1J01A 1GJWA 2FH6A 6A3HA 5D9PA 1U33A 3G6MA 3T0AA 1GQIA 1GHSA 3CMJA 1IZKA 1UH3A 4NRRA 1XD0A 2PF0A 1BGAA 4ACYA 4F9JA 3PZMA 3VD3A 1V0LA 1OGBA 2UY3A 3ARUA 1ZJBA 4CU7A 5BYWA 1K9FA 2ZUTA 3UEQA 1OM0A 5M3WA 1Q4NX 2OYLA 1VFOA 3ARZA 2QLYA 3W53A 1JAEA 2VZTA 4UOZA 3EMZA 1J18A 4B3KA 3WMBA 1PBGA 1TE1A 2PC8A 2XGBA 4AIOA 1E6QM 1GPFA 4EK7A 1XSKA 3BAIA 2NT1A 3O6AA 4J3UA 4AY1A 3EDJA 1NOWA 3PZOA 3L4VA 1SMDA 1NWUA 4UR9A 1K9EA 4HA4A 4W5ZA 4M1RA 3VIKA 4AD0A 4PCTA 4UOJA 3BMWA 1XYFA 2Y2WA 3U7VA 2E8YA 3OBAA 1W9DM 4KGLA 4PMQA 2EPOA 1G94A 3CPUA 1EIBA 1VEMA 4UQDA 4S3KA 4Q7NA 1W9VA 3B9AA 1MFUA 1R86A 1QI4A 4ZEPA 2PBGA 2J7HA 2Z1SA 3BMVA 3RCNA 1LJYA 1Q6FA 2NSXA 3M6DA 1CXKA 1QHOA 3OA5A 5CPTA 4W7VA 1W2VA 2DIEA 2VVSA 4MPKA 5A8PA 4HTYA 9CGTA 2VCBA 5CXPA 2WK2A 2ZX9A 4U2ZA 1QHPA 2XG9A 1BG9A 2DEPA 5A6JA 3GH4A 1P6WA 1KFWA 2DSZA 4MNKA 4V2XA 1ZBWA 3WELA 1DWHM 1KBKA 4E4PA 2MANA 3SUSA 3AIUA 3EDEA 1PZ3A 5CQ1A 1KQYA 1JZ5A 4TX6A 3I3EA 4GI9A 3MUAA 2XVPA 4GKLA 1E43A 2WBKA 1UD4A 1VBUA 3WD4A 4AZBA 4F8XA 2NW0A 4C7GA 5A8QA 5AC4A 1GZJA 1C93A 3EBVA 2DT3A 3CZEA 3II1A 3NIYA 1JIBA 1HKJA 1KWKA 3WNOA 4TOQA 1JF5A 2Q8XA 2VCCA 2V3EA 1V6VA 1V3HA 1E5NA 2X1IA 3WF0A 4CCDA 2GDVA 4LGXA 1KB3A 2YA0A 5D9NA 4LYPA 4IUGA 3CZGA 3UG4A 1GOMA 2D0HA 3WD1A 1CECA 3A3HA 3A4AA 3IAQA 2EPLX 3GH5A 2O9OA 1GNXA 3VGGA 2WW5A 2F2HA 3VDHA 1BG4A 1HL8A 1VENA 2OSWA 3SUWA 4CD4A 1WZMA 1OIFA 3W28A 3RJYA 2EPKX 2YLAA 4U5IA 2WMJA 1MVYA 3GZAA 4GINA 2CXGA 2FGZA 1KR0A 2E9BA 3ZJ7A 3CGTA 3ARPA 3OGRA 4F9DA 3WQVA 3K46A 1US2A 3DECA 1PX4A 3VMNA 2D24A 4JFUA 4J27A 1XCXA 2YL9A 2W4XA 2VC9A 5AY7A 4JFWA 3T0DA 2GJPA 4AIEA 1H2JA 1UR9A 4ACZA 2VZOA 3VDAA 5I5RA 4M81A 2ZWZA 4ZFMA 1GHRA 1SFSA 3W4RA 2O9RA 3SCRA 7A3HA 3WSUA 1VB9A 1QI2A 3ALGA 4BQ5A 1J10A 1M03A 2EJ1A 2XYLA 1UUQA 3NYDA 1KR1A 4AZCB 3VILA 5A69A 3BH4A 1V6XA 3N1AA 1VJSA 1ZBVA 2G3IA 2DQXA 1C7SA 1ZBCA 3CZLA 3SCOA 3AOFA 1HJWA 2DSKA 2WMIB 3ZT5A 4PTMA 2E4TA 3RJXA 1E4IA 1QI5A 3CUGA 4EAMA 3FNDA 1NP2A 1VBRA 2VX6A 1W1VA 4PSRA 1Q6DA 3PN8A 1WCGA 1FP8A 1NOUA 1KCLA 4OKDA 2DT1A 4BS0A 1WE5A 1R85A 3VDBA 3BSHA 1L8NA 1ZJAA 1EQCA 4XV0A 1I1WA 1TMQA 2XWEA 2JEQA 4AD2A 3U57A 1V0MA 4U3AA 1U30A 1XRVA 2V3FA 1JFXA 3A6OA 4ATDA 5I6SA 1GONA 4R5EA 5HPOA 2AOSA 4P8WA 3THDA 3GH7A 4J3VA 5LA0A 4AD4A 1JG9A 4AWEA 1ISYA 3BSGA 5ABFB 4F66A 4FLOA 3SCNA 4JHOA 3AHZA 1BVNP 2PI6A 3ZOAA 4HMDA 4WKFA 7CGTA 4AIUA 3KL3A 3L4UA 3VD7A 3MV11 1GOIA 2W61A 3F5KA 2E9LA 4GO9A 5HOSA 2PWFA 1J0JA 2XIIA 4OJYA 3WNNA 1EXPA 1LL4A 2YLLA 1JD7A 3VIOA 1E6SM 5A3HA 1KXVA 4DM1A 1GOQA 3CZ8A 3T09A 4GI6A 1E55A 2DPEA 4J3WA 1EA9C 1BQCA 4QDMA 1OWQA 5I79A 2V3DA 3RDKA 4IM4A 1JYXA 1XSJA 4JFVA 4HZ7A 5EMYA 2QPSA 1R8LA 2DSWA 3VDCA 1CGTA 3WQWA 1E72M 4CN1A 3WUBA 1CZ1A 2E0PA 5D8ZA 1HJXA 2YA1A 2ESCA 1XV8A 2QMKA 3CUJA 1XYZA 1BHGA 4QCFA 1W1TA 5KZ6A 4D1JA 1I1XA 1XGZA 3T2OA 5E6ZA 3BAYA 4D6DA 4W88A 1OCQA 1YQ2A 1TR1A 4M8UA 5BRQA 2XFRA 3AJ7A 4X0VA 3IJ8A 4GZIA 5C71A 3S6TA 1MFVA 3VIFA 3I3BA 5A95A 4PEEA 1EGZA 5E6YA 1UYQA 2J7BA 4HPHA 3DHPA 1PIGA 4QLJA 5BXPA 2G8ZA 2J8FA 5KEZA 2CCRA 4P7LA 2GUYA 1BFNA 1WDSA 1CEOA 1L0PA 1LQ0A 1VEOA 3FW6A 3SUTA 3KWXA 1J0ZA 2YJQA 2G3NA 4ZXOA 1JZ2A 4TUFA 1UWSA 3AYSA 2FHBA 1UH2A 3KE0A 3LMYA 2CBUA 1E3XA 3GNOA 3VGFA 3A4WA 3UCQA 5FD0A 2BFGA 2X05A 1RD6A 1JDCA 2D20A 3CHEA 1JFHA 4DWSB 2XGIA 3VGEA 3GNRA 3BCDA 3UR8A 2FDMA 2RGLA 4AEFA 1EDTA 5A94A 3N17A 1B0IA 4FF5A 1UWQA 4D71A 4Z2HA 2W63A 2YDSA 4HA3A 1QW8A 2EQDA 1WB0A 2WYSA 4W8AA 2WPGA 1WKYA 1XD1A 1JZ3A 3QHOA 2A3AA 1JXKA 4CD7A 1CGVA 1UD8A 1WDQA 2ZWYA 3BCFA 3RILA 3RM8A 5A6MA 4JCLA 4UZUA 3W24A 4TVUA 1KCKA 4CD5A 2Y8VA 3VNYA 4AYSA 1ISVA 2VNCA 3F5LA 1NARA 4B3LA 3KL5A 5DT5A 4PBGA 1DWIM 1UHVA 3IAPA 1B31A 3JUGA 3AI0A 2ZXDA 2BVTA 1G01A 2PWDA 4TTGA 2XUCA 1GOKA 3FHAA 3SCPA 4ML4A 4UQAA 1JF6A 3VIMA 5CG0A 1UWIA 4IPNB 1C91A 4GZJA 1B1YA 1A47A 2CPUA 2VUYA 1EH9A 4W84A 2BXZA 5BRPA 1KXQA 3BAJA 4ZXLA 1MQPA 2VR5A 1XSIA 4WSJA 1C8QA 2C7FA 3IJ9A 1WDPA 5DO8A 1OB0A 1V3LA 3VVGA 1W3KA 1HKKA 5IHSA 4YPJA 2WHMA 1RH9A 3RM9A 2CIPA 5IHRA 4WF7A 5DMYA 2VX7A 1WAWA 4C7DA 1KBBA 1OGGA 1D2KA 3CH9A 3VIJA 1VJZA 2J78A 1GOWA 4PMVA 2VURA 5DFAA 1VIWA 3AHXA 1V02E 1BGGA 1JZ4A 3UETA 1BYBA 5JBEA 3GM8A 2IXUA 1E5JA 1HP4A 4QLKA 1S46A 4W5UA 1MW1A 2VRQA 3FY1A 1YHTA 1JYNA 1ITXA 3WMSA 1ZS2A 2WKLA 4UFKA 1UD3A 4TTUA 1GJUA 3AHYA 3L2MA 4CCEA 4JFTA 1TG7A 1TZ7A 3WDPP 2CBIA 2GJRA 1W32A 1LG2A 1V0KA 2PWHA 3AZRA 3RM4A 2XJ7A 4RE4A 1GCYA 3OLIA 4R27A 5A6AA 3CUIA 3NCOA 1NM9A 2WMFA 3FAWA 3THCA 1VFMA 4NI3A 3QOKA 1XCWA 4OUEA 3N04A 1PZ2A 2DH2A 5A8MA 5HXMA 4XUYA 3PZNA 4FMVA 3VGHA 3QR3A 3WDRA 3B8SA 4MB1A 3CHFA 3E1F1 3AHVA 1WZKA 2QPUA 4W8BA 3MMWA 2QHAA 3WUFA 5EFDA 3WF1A 4AISA 1CGUA 3WDIA 3WH9A 1FFQA 1E0WA 3WBEA 4IISA 1UD6A 1GVYA 3L4XA 4QCEA 4KRTA 2DT2A 3NUKA 4CVUA 4OBSA 2WZHA 1GQKA 2D0GA 1CLVA 3AMKA 4HU0A 5BROA 1FP9A 3NSXA 4AD3A 4GPNA 4DM2A 5ABEA 3AIEA 3CHCA 3AS0A 3MSGA 5CZKA 1C8YA 1K6AA 5DT7A 4H41A 3W81A 3QHNA 4YHEA 1UR1A 1CGXA 1PPIA 1FA2A 1NOFA 1DWAM 3AMCA 2AAAA 3ARXA 4CD8A 1B3XA 4RE3A 3VIHA 5I0DA 4BQ4A 1WZAA 2VRKA 4WKAA 3BAXA 2EXOA 2BS9A 3MANA 3WF4A 2OWCA 3ARVA 2ZX5A 3W0KA 3OLEA 1F4HA 3WDHA 4FK9A 1JD9A 1O7AA 1OT1A 1X6NA 1VRXA 1JI2A 2W92A 1IV8A 3CUFA 1Y7VA 1E71M 2GDUA 4W89A 2XVLA 1JZ7A 1QI3A 1TUXA 2W91A 2JF6A 4J28A 1R7OA 2Y8KA 1MQQA 1G5AA 2CHNA 2J25A 1PIFA 3ARRA 2YL8A 3VD4A 4Z2KA 3TA9A 1B30A 2DSUA 2CHOA 2HVMA 3OLDA 4D6IA 1WZLA 2GFTA 4H8HA 5JIWA 5JBDA 1V3IA 3VM5A 4U2YA 1KWGA 3GYCA 3M7SA 1MYRA 4DUVA 1UKSA 5C8BB 1CIUA 1RPKA 3ZSTA 1ESWA 1E15A 5CLTA 3BLKA 3VX0A 1QBAA 3NSMA 2JF7A 3SURA 3WH7A 2E40A 1QPKA 5BXRA 1BF2A 4W85A 2YA2A 1BPLB 2BY1A 3U7BA 3W6MA 1UWUA 4E8CA 1FHLA 3UG3A 2WLZA 1QOXA 3RO8A 2G3MA 3KL0A 3AQUA 4UFLA 1BTCA 1V3KA 3PZTA 1G0CA 5ABGA 2FGLA 5DEZA 1E6RA 3SCSA 3OGVA 4UFIA 5A2AA 1E40A 3KZSA 1B2YA 3WFLA 2X0YA 5I24A 4V28A 1E6NA 2J75A 4JCMA 1DTUA 1SYTA 1N82A 4YN5A 1ZB5A 4UNIA 1E70M 2GSJA 4P8VA 2J79A 3EMCA 3WIJA 2HISA 4PTVA 2WMHA 2YL5A 3WD0A 4UOQA 4PMNA 8CGTA 4J3TA 4X0NA 1AQHA 5D4YA 1GOOA 2YKKA 3W37A 4MNMA 2AMGA 2CBVA 3WH6A 4EE9A 1NWTA 5BXTA 4MAVA
chains in the Genus database with same CATH superfamily
2WZEA 2X8RA 3NQ7A 3K4AA 3AXXA 1ELSA 4B5WA 2Y7EA 1ZBKA 1ICSA 3HM7A 1T8XA 1HO1A 1MQRA 3W26A 4CQDA 1EOMA 2YR1A 3OYZA 1W3JA 4QE4A 1CXEA 4XKYA 1I2PA 1YMYA 1PHWA 3PZVA 5TD4A 2ZOXA 7REQA 1YTDA 3P3BA 3G18A 4GXWA 1OVDA 3G3MA 2J62A 3AXKA 1AZ2A 3HJEA 3GW3A 4Y96A 3TTOA 3LEPA 5HATA 3QQ0A 1XI3A 2HPIA 1VFFA 4GYFA 2WHLA 2O0TA 3VGDA 3S2MA 2E1DA 1W1PA 4MDPA 4AWTA 1PIIA 4F4RA 1P0EA 4WY0B 1EX5A 2WVVA 5FEPA 4GH1A 3TZNA 5HQMA 2Z1VA 1XG3A 3GK0A 2BY2A 3ONCA 4B5TA 2WCSA 3K1DA 1C90A 3M46A 3VK5A 2VD8A 4JYEA 8TIMA 3R0UA 4HOZA 4WJXA 3IJLA 5MKGB 2OLHA 4DO4A 2ZX7A 3RX4A 4PMYA 1RK5A 1NWRA 3TNBA 1RD5A 2OTDA 4QIUA 1SFJA 4A22A 3G6LA 3AZSA 3OHIA 4KRZA 1EPXA 2PDFA 1RY0A 2J7GA 3SCUA 3LU2A 1X97A 2QKFA 5CZSA 4PUDA 1W9BM 3VM7A 5LGXA 3AWOA 2WSPA 4I7VA 1P0NA 4FA3A 1XJBA 3MJYA 2QJNA 1IF2A 2YIHA 4CQ8A 1HKWA 4Z0SA 1AMYA 2PWGA 4FAMA 4CQ9A 1UZHA 2WSRA 4Z42C 3K8MA 3WX7A 4LY8A 1UZ4A 1XIDA 1QBBA 4H83A 3KVMA 2WCAA 1XRFA 2ZUWA 1KXHA 4K7VA 4UXDA 4V27A 1VPYA 3LZ5A 4H4IA 4PRRA 2Y5SA 1YXYA 1XYMA 3TXVA 2UY5A 4OWGA 1KFBA 4ZO7A 2OEKA 1XP3A 4PFHA 2VT0A 5LA1A 5HA7A 4P7OA 4RDVA 4O0ZA 1EHNA 1UPPA 3GBEA 3OVGA 3KVJA 3THUA 3BV7A 1P6CA 4JTQA 1EC7A 1OCBA 1R3QA 4M80A 3RLGA 2G97A 4DJFD 3GXMA 2AMXA 2O7QA 2E5CA 3E6EA 4KH2A 1EWEA 3OLGA 1GJPA 4JKLA 3FN9A 4NILA 1RVGA 2DU2A 3W70A 4L61A 2XDFA 3UZWA 1UBPC 2PDMA 1GORA 3VX1A 4DNHA 3TWAA 1R9XA 2PCQA 2W6RA 3OGSA 3VTRA 1H49A 3ZMRA 4OZOA 3Q58A 2QXWA 3LV5A 1IZJA 4YHGA 2DP3A 3H2EA 1G7VA 3TP4A 3W25A 4M29A 3WNKA 2NXGA 3LPPA 4Q8PA 2WVTA 3GU1A 2KX9A 4JQ1A 1W3LA 3SFKA 4LOCA 3DKJA 3TYEA 4Q8QA 3QR0A 4ZENA 3M64A 1UJPA 3ITTA 3TV8A 1MUWA 2P10A 4OV4A 3KZPA 1W9UA 4PUKA 3WBWA 5BMXA 2EG6A 4JTTA 4DBSA 1MW2A 2OWWA 4IIHA 5DQPA 3M7WA 3HMJG 1U5JA 1X96A 3LM3A 1XKYA 4JS3A 1A53A 3WN6A 4Y9OA 5HWMA 3EWBX 4O0QA 2ZXBA 5A6KA 4UZSA 2DZBA 2CERA 4TMBA 2WSKA 2VR4A 4MWAA 1KTCA 5C2XA 3VKCA 2XGZA 4UQBA 1D3CA 1QNPA 4JIEA 1TIWA 3W1LA 1EJVC 1V0NA 3SCWA 1PDYA 3AIWA 3IIOA 5DCDA 1YLVA 4NZ1A 5I07A 1LRTA 4O28A 3R79A 9XIMA 3AU2A 3POHA 2W5FA 4CQBA 2ZUUA 1OGSA 3GR8A 4OOZA 3T44A 2GVGA 1DQWA 4K7YA 2PRLA 2BHZA 5JXQA 4H6RA 1E4NA 2OKOA 4Q22A 4C60A 1CWYA 3NPWA 4XZMX 1OFBA 3U0HA 3LXCA 1V6UA 4XSLA 2DH3A 5M03A 3I65A 1HJSA 3QEZA 3B4UA 3O16A 2ANUA 5HJXA 1E6XM 2H8ZA 3QH2A 4HCLA 3K4DA 2HXUA 2ZIDA 3I7QA 1WOAA 2VEPA 4YWSA 5CSUA 4P7QA 1HN1A 3TAOA 3W27A 4U31A 1ADSA 1A5BA 4WY0F 3NEHA 1HG3A 3BQ6A 4H2CA 4LNYA 1P4CA 3TXZA 3SY1A 4AFYA 4LCQA 1YNPA 3P7YA 4GUHA 1OIMA 4J7RA 4DUWA 4DWSC 1EC8A 2QCFA 1O5RA 1RP8A 3MUY1 1KC7A 5GJPA 1WDDA 1Y65A 3DYPA 3MKCA 4NZ3A 3OVRA 3VUPA 3MHGA 3RPMA 2ZE0A 3P5ZA 4N6EA 1I4NA 3ZXWA 4QGCA 3WJWA 2YCJA 3M07A 3MC5A 3QXBA 4KERA 3VDGA 1JL8A 3UG8A 4BQ2A 1V08A 4IGNA 3NZQA 2CLKA 1WA3A 1ODZA 4CD6A 2B0MA 1XC6A 2Y5EA 1V7AA 3LBCA 5LNWA 2WVUA 4AW7A 5D37A 4GYKA 3GBDA 4G8TA 4A3UA 1TFVA 1T0OA 1X1OA 3ATZA 3AU6A 4NZJA 4MHBA 4QJ1A 3FXYA 4BF7A 3F4VA 1FX6A 2JKAA 1F05A 5I3KA 4ZR8A 1JZ8A 5HMDA 2RHGA 3JZUA 4H04A 3RF9A 1VQTA 3EKZA 1B3ZA 3VD5A 5CKSA 5D2VA 2VM8A 3WMLA 3S1XA 2IUZA 1A5MC 2YW4A 4KEZA 1EB3A 3KLKA 2Z2UA 3VE9A 2VC5A 4LJ3A 1N8WA 3S6OA 2KZHA 2V9DA 3THQA 4C6FA 4M6UA 3AIRA 1A5NC 4J1OA 2V67A 4NJGA 3VGBA 4AVOA 3QW3A 2CNCA 2I9UA 1AJZA 3VU2A 5LXEA 2OX4A 3LLFA 2JIWA 1EO5A 4OBTA 1UQZA 1LF1A 4GVHA 2QGYA 3MP5A 1H61A 5CPSA 5C2CA 4LCRA 3LTPA 4Y90A 1CCWB 1EZ2A 2J47A 1ENUA 2C1HA 2DUXA 4Q8WA 2RGMA 1DE5A 2PDXA 4D6FA 3PM6A 1PV8A 1E9YB 2C0HA 4PYSA 5AC7A 4K68A 4DJED 3WD2A 1EQPA 1TWIA 4NJJA 1ZHAA 2X0SA 3RMJA 4CNPA 4P7NA 3DFSA 3ZM8A 3KM8A 1FCVA 3AHTA 4DJFC 1QR7A 5DCEA 3PZGA 4W87A 4J40A 2V69A 1RQEA 1W8SA 4NU7A 4BR1A 5L9FA 3TTSA 3NM1A 1E3ZA 2ZRXA 3K8KA 4JTGA 5H8PA 1ZY9A 1VEPA 5D38A 2CLOA 2V2HA 2F8QA 1GVOA 1F3EA 3LXBA 1S5NA 2E9MA 1EFZA 3L4WA 3B9DA 4JR5A 3ANYA 3H7RA 1DE6A 4HPGA 3LLXA 2ACQA 5I3FA 1W2PA 3O07A 3KBMA 5E5CA 2OEJA 3A9BA 2E5DA 1W3HA 3AIQA 4WSKA 4XBSA 3BGAA 1IT0A 1V03A 3WMCA 5D04C 3CLWA 3TSDA 1ZJIA 4DJEC 3HQNA 4D72A 2VEMA 4O18A 5D8WA 1D8WA 3IUHA 1ODUA 4ZOAA 5DBUA 3ZT6A 3N34A 1HT6A 3PPFA 2DGAA 3LI1A 3UWWA 3TYDA 5I3JA 3ITXA 4RZ4A 5A8GA 4ORMA 1DJWA 3EX1A 3VMOA 2PZNA 1RSCA 3PF3A 2B7PA 4FXRA 1D3HA 3SR7A 4V1XA 4JTHA 4MM1A 1H7OA 3AMLA 1Q45A 3WBYA 2CKRA 3CV1A 5CAKA 2FPTA 3L21A 3G1HA 1FOBA 1DJYA 5JH1A 4GA8A 5GQBA 3ONBA 4JICA 4HN4A 1SW0A 4DI9A 1XW8A 4QG9A 1Q6QA 3K1GA 3WUGA 3M43A 2QUVA 3G8EA 2VTFA 1K7FA 4FF7A 5C55A 2WMKA 2FHFA 2C8NA 1DKWA 2QDEA 4TVCA 3OZMA 3VKKA 5ECVA 1GKPA 3PBGA 5AYBA 3MSDA 2EBNA 4QX4A 4ILSA 4KCUA 4A35A 1P1MA 3SUUA 2YL6A 6CGTA 3HF3A 3KTXA 2WBGA 3P8JA 4QTGA 4Y9MA 5AHFA 1UD5A 1SR0A 1LM1A 1X8CA 5EBAA 1EYEA 2DVTA 1HXJA 4DQWA 3MSYA 2FKPA 2VO5A 4LB3A 3WEOA 3R43A 2X7WA 4KEVA 1UOKA 4KWWA 4UC5A 3LGGA 2Q01A 4DEFA 1R30A 3H2MA 1JDEA 1OINA 3W7CA 3GNXA 2PE4A 1SJDA 2WMGA 1US3A 3AIBA 1XYBA 3ZLHA 4HMCA 4UTHA 3MP3A 2A6NA 2X2GA 2CZEA 1DXFA 4QISA 3MSRA 2FZ8A 4LY4A 1NFGA 3U5YA 5KZDA 2GPTA 3XISA 4F0SA 2YFOA 2WQPA 5C70A 3GXIA 3GB6A 3WLJA 5IM51 3WFZA 5D33A 1YTKA 2CFFA 4MYAA 4U4MA 4KCVA 4LF2A 5HUOA 5TNVA 1YPXA 4W8LA 2OZTA 2PB1A 2QVNA 5I3IA 1V6WA 1Q6GA 2I5IA 3GS6A 5D2YA 4JFSA 3S2CA 5AHIA 1UA7A 4F40A 4PTWA 1X7FA 3MUXA 1CENA 4HPNA 2JE8A 4R7OA 2DVUA 1CXHA 2X09A 1A5UA 2E8ZA 5LNSA 4GVFA 4EF8A 3ORWA 3V5CA 5FIPA 3EOOA 4PB3A 4FLSA 3RIKA 4A8RA 3OG2A 3TW9A 5AOUA 2OXNA 4BHYA 3VNDA 4I5XA 4IIFA 1MRQA 4BF5A 4AY7A 2BY3A 3CUXA 1B4KA 5EFFA 2FQIA 1P1XA 1WXJA 1ICQA 4Q8NA 5BXSA 1E51A 4BA0A 3APGA 4L4PA 3ZWSA 5G5IA 2PDWA 2XIBA 3HG3A 2D0FA 1U83A 5DANA 3NURA 2D2GA 4G6CA 3LM7A 2BGQA 3FYOA 4AH7A 1WKFA 3E74A 5KTLA 4F48A 3KOYA 4G7EB 4YJ5A 3VINA 1PYMA 5CSSA 3E96A 2PDIA 2OR2A 2A3BA 2OU4A 1LRNA 4B9ZA 3ZQ9A 2ZCGA 3WF3A 3DHUA 3PTQA 4N6FA 3G3DA 1FKXA 1OD0A 4LSBA 4LAZA 4JNZA 3N3TA 1GJWA 2FH6A 3NM3A 1IGSA 2QPXA 3T0AA 3APTA 3B8WA 5CSRA 1XLBA 1GHSA 3LG3A 3CMJA 1UH3A 5LIWX 1FCQA 2UY3A 2DUZA 3OG3A 4CU7A 1K9FA 2X1RA 2ZUTA 3UEQA 5M3WA 1Q4NX 1TO3A 4GZ7A 4R88A 3UXAA 1VCVA 1VFOA 3ARZA 3Q2DA 3C2EA 1JAEA 2VZTA 1J18A 1Q65A 4B3KA 3GUGA 2ZZ5A 3TQ0A 4BEQA 3SN1A 3LHTA 1PBGA 1TE1A 1XBZA 4KEUA 1GPFA 3LY0A 4EK7A 3PUEA 3G0SA 1RZMA 4X9SA 5F1UA 1Q7ZA 1JEZA 3FK4A 1SMDA 4UR9A 3QV6A 4INFA 4AD0A 4ZGYA 3DFNA 1X7IA 2XZ7A 4PMQA 2OT1A 1G94A 3UWYA 2WJFA 3CPUA 1VEMA 1KCZA 3LXAA 4S3KA 3WLKX 1I60A 3SJ3A 3UWUA 3PBVA 1MEHA 3TN4A 3UQNA 2Z1SA 3WQCA 4IPPA 3C8FA 2NSXA 2NQLA 1O60A 1CXKA 3QKEA 3BLLA 4DIAA 1W2VA 2PEVA 3GNDA 3S5YA 1JULA 4C5ZA 9CGTA 5G2IA 5J8LA 1EA0A 4FNRA 4D8ZA 4GMEA 2WK2A 1QHPA 2XG9A 1BG9A 4EPBC 3GH4A 2PZ0A 2DSZA 2PDGA 2VP8A 4Y8EA 4C6LA 1P7TB 1ZBWA 1DHPA 3WELA 1KBKA 1Q4WA 1IR1A 2Q09A 2MANA 3SUSA 4IUOA 4HU4A 3SW6A 1KO0A 3EWUA 1UZDA 2WZMA 1PWMA 4IMFA 4TX6A 3GVQA 1MDLA 3I3EA 2AL1A 1W3IA 2RAGA 3QC0A 4OVXA 1UD4A 3VZZA 5CC7A 3WK0A 3MT1A 2E25A 3V3WA 4N02A 4KKXA 3MY9A 3IRSA 2E28A 4AZBA 3MA8A 5AB3A 1BQGA 5AC4A 4I9JA 4LCSA 3H24A 3EBVA 4LV4A 3TW6A 3II1A 3NIYA 3LENA 3NNTA 1W5QA 4RXFA 2NWSA 2QF7A 2V3EA 2YB4A 1VPQA 3KXQA 4CCDA 1TPFA 4EWND 4ES4A 1AJ0A 4GFSA 3WD1A 3HPZA 4ZQOA 1TKKA 3BE7A 4UTJA 7ODCA 2HZGA 4DBEA 1AK5A 3NO1A 3N2MA 1GNXA 4M3PA 5EMLA 2WW5A 2F2HA 3VDHA 2Z1WA 1VENA 3DAQA 1KKOA 4CD4A 1Q66A 1WZMA 1IWBA 3W28A 3RJYA 2YLAA 4U5IA 3GC2A 3GQYA 1MVYA 3RGTA 3GZAA 4GINA 4RZ6A 2CXGA 2FGZA 1KR0A 3ARPA 3OGRA 2EGZA 4JIPA 1LT8A 1WOBA 1UUOA 3V1HA 2VWTA 3WQVA 1REQB 3K46A 5AFDA 3P84A 1PX4A 3TQPA 1V7YA 3BW4A 1J2BA 1XCXA 1U1HA 1DJXA 5LIYX 4AWSA 4WQ6A 4O4VA 4K6AA 2E09A 5AY7A 4JFWA 1SW7A 1M6JA 3A64A 3G24A 2GJPA 4DPPA 3DENA 1UR9A 3VDAA 2ISDA 1O1ZA 3BG3A 4ZFMA 3TYUA 5HUPA 3AUJA 1AH0A 4A2SA 2WJDA 7A3HA 3WSUA 1OX6A 1QI2A 2L5HA 4BQ5A 4H9MA 4B4HA 2AL2A 4AZCB 5A69A 4XWUA 3O0KA 3OO2A 2PURA 3N1AA 1I2QA 4CNSA 1VJSA 2G3IA 2VYOA 4L4LA 1ZBCA 4Q4QA 3MBDA 3O6DA 1R3VA 1HJWA 3CB8A 2E4TA 2ISWA 4NL1A 3RJXA 2BZNA 3CS2A 1E4IA 3CUGA 3N25A 4NX5A 1J79A 2BX7A 2QCCA 3V36A 3W01A 3VYLA 2TRSA 4G1NA 4PSRA 3PN8A 2OX1A 2A21A 2PU1A 3TEVA 1WCGA 3F03K 1A0DA 3GR7A 1R85A 4S3GA 2OG9A 3BOFA 2V63A 3CLMA 1TMQA 2JEQA 1P0DA 3TMQA 1P48A 3CXOA 1JFXA 5I6SA 4PE8A 1MI3A 2DUAA 4YVPA 3V5FA 1TIMA 3T55A 4Q8VA 4V33A 3THDA 4E0CA 2VXNA 3LN3A 4J3VA 1TX0A 2EKCA 5KETA 4FLOA 1PZ1A 3P67A 4JHOA 3AHZA 4EAYA 3CWOX 2PI6A 3ZOAA 4HMDA 4XKYB 4AIUA 3TVAA 3KL3A 3LCWA 3CAWA 5I06A 4WRHA 2QCDA 2YW3A 3F5KA 1J0JA 3ZFHA 1IYXA 3WLRA 3VIOA 3SGUA 1E6SM 2OJPA 3QVQA 5A3HA 1TZ9A 4Q8UA 4GI6A 1I45A 1NU5A 4J3WA 3V5OA 1OWQA 1UOZA 5AHLA 1JYXA 3QPZA 3RDKA 3S42A 5XINA 1XSJA 5EMMA 3BOXA 5D32A 1ZGDA 1QMLA 1PB0A 4IHCA 4NXSA 2E6FA 3WK1A 1H7XA 2ESCA 2G50A 3VOGA 1XV8A 2ATMA 3LBMA 2IKHA 4O14A 1W1TA 2TSYA 5IRPA 5HR6A 1I1XA 3FGCA 3R5EA 3BAYA 1YDVA 4W88A 4ROQA 1YQ2A 2PGWA 1TR1A 3H4GA 4PTDA 4X0VA 3HPXA 4HZMA 5IOBA 3LRLA 4GZIA 1Z3NA 1MFVA 2WZTA 4GC4A 4YYFA 4WJEA 3KRBA 1EGZA 3SQSA 3I10A 5BXPA 4PFMA 1EJWC 1QT1A 4AXKA 1H7NA 1BFNA 1WDSA 2DJLA 1L0PA 1KTBA 7REQB 3WLTA 4NAEB 1P5BA 5G1MA 4IX0A 2NLIA 2YCIX 3L12A 1TJPA 3AYSA 2FHBA 1UH2A 4PTNA 2PDHA 3KE0A 1W3TA 2CBUA 1E3XA 2FYMA 1A0CA 4I3GA 3UCQA 3V7PA 2BFGA 2X05A 1JDCA 3S9IA 4DWSB 5BW6A 2OCZA 3IK4A 3EPOA 4IXXA 3GAKA 3AUOA 3UR8A 3HO8A 3CV6A 4MWAC 3N17A 3UR5A 1XISA 3E9AA 4MG4A 2O7SA 3AYVA 2C1GA 1QW8A 1WB0A 1MSSA 1RA0A 1YIXA 3SM0A 4W8AA 3B4YA 1R9ZA 5F4WA 1PL9A 1WKYA 3QHOA 2NQJA 4WXZA 1WDQA 1VFLA 2C6QA 1KCKA 4U28A 2POTA 3VNYA 4AYSA 1KM4A 4KW2A 4KQNA 3W02A 3DGBA 3GHUA 1EYWA 1B31A 3NOYA 2PCEA 3WCZA 3UD6A 2PDKA 3NGJA 1FWHC 1DPMA 3VIMA 4F3HA 5AVHA 4FOJA 5HMEA 1A47A 1SM9A 2Z7GA 3T7VA 2BXZA 4QAIA 3G1RA 1KXQA 1XPYA 3RLHA 3W74A 3PBUA 1XSIA 4JX5A 2V0TA 1TV3A 2C7FA 3W7OA 1WDPA 2RDUA 3FYPA 5DO8A 1V3LA 4ZCWA 4WUIA 1H60A 2IQTA 2WHMA 2O56A 3FS2A 5IHRA 4WF7A 7ENLA 3H12A 1TRDA 1GOWA 3CYVA 5DFAA 2C19A 4ZO9A 3P14A 1XIFA 4IWWA 1JZ4A 1EP2A 3UETA 3NZPA 2IXUA 1EUAA 1E5JA 1PE1A 4QLKA 3LGEA 3MWCA 4W5UA 3ABOA 3IWPA 1BWKA 3CNYA 1ZS2A 1JPDX 1GQNA 2HXTA 2WKLA 1Z89A 1GVSA 4XO7A 2H8XA 3UFYA 1UD3A 2A4AA 4TTUA 5U7SA 2OQHA 1TZ7A 3WDPP 1OFRA 2CBIA 4IP4A 2Q02A 4CQCA 4LAMA 2XJ7A 4ICCX 3SY5A 1GCYA 3LLDA 2WMFA 1IXNA 4REQB 3L0KA 3CC1A 4OUEA 3T0TA 1P43A 1PZ2A 5A8MA 4XUYA 3PZNA 3VGHA 3K2GA 3QR3A 4JNYA 1HFBA 3B8SA 3R89A 4HA0A 5HAOA 5IBXC 1HGYA 4ZOEA 4TQTA 5CPMA 4W8BA 1KKRA 4L64A 2QHAA 3WUFA 5EFDA 5J5RA 4AISA 3WDIA 3WBEA 4IISA 1UD6A 4FHAA 3W2MA 3W00A 5EL1A 1GVYA 3B04A 4KRTA 5LZLA 2WZHA 4XTDA 2PRMA 3W1XA 2ZA2A 4AD3A 3QSRA 3IIVA 5ABEA 3HQ1A 2PDCA 1JUKA 5CZKA 3VC6A 1C8YA 4H41A 1NQKA 3W81A 4YHEA 3C2VA 1CGXA 2BLEA 2GVLA 1NOFA 2OKTA 5JU6A 3AMCA 1WXYA 5FSDC 1FRBA 3BWWA 4O50A 4RE3A 4BQ4A 2DZAA 1R47A 3KBWA 3LHWA 2VRKA 3EOLA 4H6QA 4M5PA 3TAKA 4AC7C 3N6JA 4DJDD 4YTRA 1D8CA 2A79A 3OLEA 2PGFA 1F4HA 2HVOA 3WDHA 4C5YA 1YTEA 1O7AA 1T40A 1OT1A 1X6NA 5IDZA 4M7TA 4XBKA 1IV8A 3CUFA 4KCWA 4X61A 3ICJA 1JZ7A 4TU1A 3DFYA 1QI3A 4N2YA 1R7OA 4LUTB 4XIAA 4FR1A 3ARRA 4ZB5A 4Z2KA 2DSUA 3UWQA 2HVMA 5H8MA 2YB1A 5DN1A 5DMNA 3E2SA 5FJRA 4FNPA 2TMDA 5JBDA 3VM5A 1UKSA 1CIUA 1ESWA 1E15A 1XIBA 4BEUA 5XIMA 4AIBA 3IUDA 3C0LA 3SURA 2JF7A 1D3GA 2FMOA 4IX2A 1BPLB 1L6GA 3U7BA 4UTLA 3T1GA 1FHLA 2WLZA 3KP0A 2EKGA 1Z41A 3UZ5A 2JK2A 2X1TA 1QOXA 3NGFA 3K30A 1K02A 2G3MA 3AQUA 1BTCA 4OT7A 3PZTA 1G0CA 4B4FA 3PUDA 2FGLA 1JUBA 5MKGA 1XIGA 1E6RA 4YYCA 4LT9A 5K3VA 2FDSA 4X60A 5A2AA 4UTUA 3KZSA 4PCFA 3N9RA 3KOWA 4PMJA 5CZJA 2BOEX 2H3BA 5I7GA 3EMCA 1A5LC 4PTVA 2OZ8A 2WMHA 3WD0A 4UOQA 1AH4A 4J3TA 3UW6A 3W2NA 1GOOA 1AQHA 2NX3A 3WH6A 4EE9A 1NELA 3UY8A 4GVIA 5SWUA 4H9XA 2VZUA 1UASA 3EDDA 3JZEA 4NZ5A 3TTQA 4D8LA 1PX3A 2WMIA 1J96A 3ALFA 4I9TA 4PMUA 4MZYA 1V77A 1LT7A 4ZO8A 3G0XA 4QJ3B 4DXVA 2J6VA 1ECEA 1JNEA 1HNYA 3LZ3A 3IEBA 4J4KA 4LAOA 3LOTA 3N2CA 1LQ2A 1NP0A 4ZODA 3GXPA 1TREA 4J3SA 4XQ6A 3LQLA 4CEUC 2GJXA 4UIOA 3BURA 5TBOA 3T6CA 4B92A 2VENA 5FKYA 1RQBA 2O9PA 4LTSA 5U4NA 4BZYA 3RPDA 3PWAA 3RX3A 1Z9AA 3WEZA 4MWAE 1I6NA 2DT0A 3CL8A 3VAVA 1R2TA 5CBBA 3NO5A 5BRBA 1AD4A 2WQDA 4XB3A 3UERA 4CU6A 1BYCA 5H91A 1M41A 4PMOA 2GQ3A 3K13A 4ZQPA 2ZRUA 4AD5A 3CIXA 4FNQA 1P7TA 1Q2RA 1A5OC 2NZLA 3NYZA 2Z27A 5I23A 3TC7A 3N13A 2E67A 3H2FA 4HHPA 4GY0A 1JZ6A 1NDVA 1AW5A 5LYRA 5C9XA 4UMAA 2HBVA 1V79A 3MYOA 4AZGA 3WUEA 4GIYA 2EEXA 4DO5A 2R91A 1TPUA 1TA3B 1AL7A 3QN3A 4TV6A 3TJIA 1EJ7L 1K7EA 3AISA 2XIOA 4F2BA 4A29A 1QNQA 2XU2A 3KHDA 4JGDA 1AUSL 4ALDA 4LUTA 3UA3A 3W85A 2BGSA 3T8LA 3PC0A 1EJSC 2WJEA 5E09A 4GD0A 2D22A 4H8VA 1E56A 1X8FA 4UFMA 5A6BD 4WY0A 3M0ZA 2OEMA 1HQTA 3WDJA 4DXXA 4A4AA 3MP4A 1E0VA 2V5JA 4JZ5A 1Q7MA 1TX2A 2J88A 4ZOCA 5G1YA 4CUCA 1IEXA 3CBWA 1QK0A 2WVSA 1TCMA 4UTTC 2EJAA 2HJPA 3WD3A 2PBOA 4HK5A 4GO8A 2LLEA 4G7FA 1OFOA 2OOFA 5AC8A 4B5VA 1XRSA 1IR2A 3NPVA 4WX2A 2PLCA 4I8YA 5CLWA 4X3ZA 4FNTA 3EYPA 4C6DA 5K4ZA 1BKHA 1HP5A 2ODOA 5EY5A 1VFUA 4RNIA 3QOMA 1Q7QA 3ELFA 3FV9A 3NQGA 2QYGA 3WLQA 2CXEA 2EG7A 1WKDA 3LDVA 1UWRA 2DSVA 2F7FA 3IJ7A 5A2CA 1W17A 2J13A 4LYRA 3GG7A 3FAXA 1TJ0A 4BF9A 4IP7A 1B54A 1QHZA 3AXMA 4O54A 4OOUA 2A3HA 4NX0A 1K7XA 2CZDA 4C1NA 4O13A 4MLRA 3R13A 1TWZA 3GTFA 2RJHA 1JGIA 2R94A 2AAMA 1B3WA 1TWDA 1UKTA 2AGTA 3DFOA 1G4SA 5DX7A 1G6CA 3HURA 1KBLA 4CU8A 3QHMA 4RLIA 1TQXA 4JPGA 4GJJA 1PSCA 1OC6A 3NZGA 3PZQA 3GR4A 3OVQA 3W2JA 5K9DA 3ABRA 2VRJA 5FA5A 1GG0A 2Q8LA 4MADA 5H6HA 4C6CA 4JY8A 2FPVA 3KBJA 2XVGA 2CW6A 3NL3A 1CPUA 4Z17A 3AIVA 5FL0A 2UY2A 4DN1A 1V02A 6ALDA 4DX3A 1K1DA 1UJQA 3R7MA 4C1NB 3LK6A 2Q6ZA 1DWGM 4KFOA 2XM1A 2P3EA 4XBJA 2ZTJA 4WGXA 1HL9A 4N9EA 4MPQA 5K4XA 3QY8A 4GX8A 4FLQA 3SIZA 5HNRA 1F7BA 1IEIA 3QW4B 3LUTA 2O55A 5HDRA 1L8PA 2YCLA 2W3ZA 4HOWA 3GXFA 1BAGA 4PSPA 3HU7A 1Z7AA 2CETA 3C2YA 4GVGA 2CLPA 1DORA 1DP0A 1LWIA 1H7WA 1MRAA 1TPH1 1H09A 4WGHA 5AN7A 2F6XA 2Y7DA 3BVJA 3FJNA 4Z1YA 3EEZA 4N4PA 4AC1X 1UWAA 1WDRA 4ZZ9A 2WNWA 4PMZA 5KZEA 1QPRA 2Y8UA 1WQ5A 4Q4PA 5FAGA 3EDFA 3M16A 4QE1A 4IH3A 4JTLA 3G5EA 1IEQA 5AZ1A 1WO2A 1FHUA 3W29A 2D23A 2BHUA 1SZNA 3TONA 3EWYA 2YX0A 1M7PA 3L4ZA 3A24A 3U48A 1LWJA 3KHJA 1O6IA 3TWBA 2ZZ4A 5HPCA 5T26A 4CVWA 5EPDA 2BVWA 5M1TA 1DJIA 2V8ZA 3N9KA 1IT7A 2ZUSA 2I7GA 1S38A 5F1VA 4H6KA 1J0KA 4GUIA 3SJNA 1BRLB 2BHYA 1H7PA 2QCDB 4M82A 5FF4A 2ZDRA 5C7VA 5E0CA 1JI1A 3PB2A 4WLCA 2ZZ3A 1W31A 3BGJA 4WXYA 5BCAA 3AXIA 4E2OA 3OTRA 2ZKMX 6XIAA 1RBLA 1JCNA 2J7FA 1QU4A 1XHGA 5KITA 3CV2A 5E9AA 2WM0A 5TIMA 2WCGA 1MW3A 3P5YA 2TODA 3UPBA 1JCYA 1X6UA 4LVBA 4ORIA 1QK2A 3N11A 3C52A 3QYSA 4DZIA 4HBKA 3KBNA 8XIMA 5D2XA 3M47A 3BLIA 4GBUA 3CUHA 5DRIA 1UG6A 5M17A 1DJNA 2QUNA 3MJMA 3B0VC 5LA2A 1S2UA 1EBGA 4J35A 5FJTA 4XAZA 4TVDA 4L1XA 4PCNA 3ZVHA 1JCLA 1T6MA 3YPIA 2WVVB 4M6QA 5HBFA 1MW0A 2ATSA 2YCLB 3MS8A 4AZCA 4OBRA 1XH1A 4PCPA 3L67A 3GG1A 3KCJA 1Z69A 2VC6A 4FB7A 3MZ2A 3UA4A 4JL2A 1PCWA 3PP7A 3PK7A 1MXDA 3DH7A 2JALA 3FFSA 2BY0A 2WANA 3ABSA 2J9XA 3GHTA 2QCGA 4C91A 2C71A 3RMEA 3QLDA 1EF3A 1Z6KA 1BYDA 1H5YA 3E0IA 3MUIA 4LXFA 3TN5A 4O12A 3DC8A 4AUBA 2C3ZA 3AS3A 5JMUA 1ZL1A 3NJ3A 1F6PA 1ONXA 1WUFA 1TV7A 3GAYA 1YEYA 3MPGA 1M68A 4UR7A 2DZVA 4CQAA 4B16A 5IFPA 1YNYA 2Y7GA 3NR0A 3KAOA 3Q94A 3BMXA 2H6RA 3EMQA 4XX6A 1A49A 2PTYA 3GHRA 3A4XA 4PMDA 4JTJA 3GE7A 2ICSA 3MHFA 3EXSA 4TX8A 1GQJA 2GVYA 4JTIA 4HZ8A 2ZA1A 1E1EA 4LU0A 1AD1A 3NQ2A 4IQJA 2O92A 4Y7EA 1DBTA 2AL2B 3WL1A 3WQ8A 4J3ZA 3L4YA 2NXHA 1GKQA 3BUVA 3G1SA 4HIBA 2XZ9A 2CKSA 2DQWA 1NVMA 1SO4A 3C6CA 3NXLA 3T4WA 3FEQA 4O4WA 4CN6A 3CASA 3EXRA 5HULA 1TWWA 4DAFA 2XSBA 3P8IA 4GACA 1ZNNA 2MUCA 4TXEA 4W7WA 4IFRA 1NY1A 3EOUA 3ITCA 3WQ4A 4US5A 2PUZA 5IBXA 1JDDA 1SGJA 2X16A 5LHEA 1OYBA 5HJLA 3M4HA 5D2WA 1FWAC 2GGGA 2WC7A 3TU9A 5CZTA 1WP6A 5K2ZA 1QNOA 3UPMA 3C3NA 1S2CA 4LS1A 4J3XA 3WNLA 1A3WA 1FWFC 2C13A 1M7OA 5GVJA 2PU0A 5CC3A 2D69A 3RN6A 1DWFM 2E5BA 3TTYA 3LHZA 2XFYA 4JAWA 4ERIA 4YS1A 3NDYA 1YKWA 4O53A 1EF2A 2YBTA 3QGAC 5CJ5A 2ZA3A 4E4FA 1OADA 4Z2LA 3KVKA 1D7FA 3BW3A 1LL7A 1OZMA 3PSWA 1SR9A 1PAMA 4PUWA 1MXGA 2YDQA 1K8CA 5I78A 1TV8A 1OFDA 1KCXA 1ZZMA 1K9DA 3NQEA 1H3GA 4AHPA 8A3HA 1R7AA 1LTDA 3O6YX 3GDKA 2FVLA 4CGTA 4GY1A 3HGSA 4GG9A 2BVDA 1OFAA 3SADA 3W7RA 3CMGA 2ZUMA 3SRDA 1FHVA 3H7VA 4JN7A 2HS6A 1KFLA 3EA2A 3KRZA 2RH9A 3EDKA 1ZP4A 1VLIA 4I8DA 2F38A 4EOUA 1QVBA 4NF7A 3LTYA 1UKPA 3WKZA 1CNVA 3C0JA 1ZAJA 2VX4A 4NUWA 4RE2A 3DIPA 5CZ0A 1ADDA 2ZRVA 6PTDA 1MNSA 3QZEA 3GRIA 4EPKA 3LQGA 2WAGA 2UY4A 3I68A 2WWCA 3N18A 4XZHA 4NAEA 2WZIA 4JTCA 3B9OA 3U8GA 1PJ9A 3QR1A 1LUCB 4E8GA 4S2BA 5CJNA 4YCOA 4PUEA 3UESA 1WPCA 4L9ZA 3OYXA 2ZUVA 4AZ6A 3CT7A 1PEZA 3IK2A 4HGXA 1KM6A 2PPGA 4DBDA 3V1PA 4DVOA 3SN4A 3W86A 5GNYA 4WD0A 3DC0A 1A5SA 3W82A 3A3XA 2VGFA 2EHHA 5HINA 3W1PA 5CG7A 4AX7A 1ZRQA 2NSOA 3LERA 5LHFA 3GKAA 3PHAA 4Z1DA 3QMTA 3G1DA 5C6MA 4NYYA 5IXEA 3UZXA 1YXDA 3TC6A 5A6BA 4ZB2A 3T0BA 3AS1A 1CXLA 2FIQA 2QW5A 4UQEA 1JRCA 1V51A 3WBAA 1EUNA 1K8ZA 1M65A 1MXSA 5EA9A 3WQFA 2Y89A 5F4SA 2OQLA 1QW9A 1TA3A 1OFPA 4J9JA 5M5DA 1OG6A 1CX9A 2NV1A 4B2DA 2JGQA 3GX9A 1QI0A 3H7UA 4AZHA 3R25A 2A7NA 4W4QA 2PD5A 3IVSA 4HMNA 3N73A 5GJNA 3STPA 5IDIA 4XKMA 1DQUA 4QDWA 4O1DA 3T2PA 3B03A 4CNNA 3F4CA 2Y0FA 4AEOA 7TIMA 3SBFA 2YXOA 3CYJA 4LPCA 4FLRA 2J6XA 4WDWA 4PRWA 3N19B 2WWDA 3STEA 3EZ4A 1XH2A 3QV9A 3HPFA 1XH0A 3AS2A 1P6BA 2VX5A 1HKIA 2HE5A 1A5KC 3E38A 4ZBCA 1NH6A 1OEPA 4C65A 4D6GA 1FWCC 1IXOA 3GFXA 1KXTA 5A8OA 4FX7A 4YTSA 1L6WA 3AZTA 3CQ0A 3WNPA 1CBGA 1FWSA 2V5DA 2FZNA 4UTWC 4DELA 3FVMA 4MUZA 1S2VA 3CTLA 1NDWA 3EX6A 3MV01 3NTYA 1XPGA 2Y85A 4PBEA 4AHOA 1J01A 4UMBA 4PUNA 3ZS4A 6A3HA 3GYEA 4IQEA 1W1B1 3B06A 3SGGA 4CNTA 4D8AA 4Y6GA 3HGJA 2PF0A 1KRCC 2I14A 3PZMA 3VD3A 1KNWA 3UYCA 1V0LA 3XINA 1OGBA 4D9PA 4A3RA 3QTPA 2EG8A 5BOEA 3VI2A 2OYLA 1S2TA 2QIWA 7XIMA 1IGWA 2GOUA 3W53A 4UR8A 1NAL1 4KESA 3HG5A 1ZTVA 3WMBA 3EPNA 1QDSA 3H4XA 5RUBA 4XK2A 1E6QM 4H7ZA 3FGCB 1F8MA 3LD5A 4I9MA 2NQ5A 2NT1A 4AY1A 4J3UA 1YADA 2MNRA 3DI0A 5AHNA 2J9YA 1FVPA 1NWUA 3U2CA 3CK5A 4M1RA 4PCTA 3L7RA 3IRDA 2OPJA 2Y2WA 4C6IA 2W9MA 1ZSXA 2VELA 4JXCA 4DZHA 2WJZA 3H6OA 4RZ5A 4HJFA 4HYRA 4AWUA 4Q7NA 2X40A 3QMRA 4LRTA 1MFUA 2OO6A 2CLIA 3N4AA 2J7HA 1EEXA 3BMVA 4Y9AA 3UNDA 4QSFA 2XH7A 3M6DA 3E2VA 2ISFA 4G2DA 3P62A 3FCPA 2VVSA 3PAJA 4I5UA 3HFYA 3TSBA 1XLHA 5A8PA 2G0WA 4HTYA 2VCBA 1XBVA 2ZX9A 2HVNA 1LOSA 1RJRA 2DEPA 5A6JA 1P6WA 3P82A 4H8NA 1WAUA 3W1AA 4MNKA 3NQCA 2GUUA 3AIUA 5CQ1A 3OQ8A 1KQYA 3F4NA 5CEWA 1JZ5A 3NVDA 3W7HA 1R2RA 1TYGA 3NEVA 2Y1HA 4GI9A 2XVPA 3TYZA 2QCMA 2Z2BA 1E43A 4GKLA 2R6OA 2ZTKA 4JTKA 4RPQA 1BKSA 1VBUA 2A6LA 4LEQA 5EMKA 4YU1A 2PTWA 1UMYA 4Q4SA 4F8XA 2PSNA 5A8QA 1GZJA 1C93A 1EZWA 3GC4A 2R1LA 2HBXA 1KA9F 2DT3A 4S3FA 4UUIA 3B40A 5G4HC 1HKJA 1XBXA 4TOQA 4JTAA 1E5NA 4BY3A 2X1IA 3D46A 2GDVA 1DJGA 4H3DA 1TJ2A 3O1NA 2B7NA 2G3FA 3UG4A 5D9NA 2D0HA 1PYFA 2BTMA 2XIQA 1RBAA 2AKMA 3VNMA 3IAQA 4B3ZA 2O9OA 1R3TA 3IIXA 1RXOB 2OSWA 3SUWA 3QZAA 1G67A 2VEKA 3F2CA 3FEMA 4KFPA 4L1WA 2PLMA 2DY3A 3QFEA 4MZ8A 2YGYA 4XTIA 2XN2A 1OCNA 2WMJA 3T9PA 3TR9A 4GYPC 4MKSA 3GDMA 1FWTA 2E9BA 3ZJ7A 3ZLFA 3MBFA 3CT2A 1MUCA 5AVNA 3M41A 2Y62A 2YL9A 1LDCA 3WLHA 2VKZG 2VC9A 2HNEA 3T0DA 2PAJA 2NV2A 4AIEA 4ACZA 4AU0A 1TQJA 2ZWZA 4NAFA 3R12A 2OGYA 1YPIA 1GHRA 3W4RA 2O9RA 3SCRA 1VB9A 4RUBA 1J10A 1MMFA 1M03A 1ZCCA 1FQ0A 3NL6A 1FXQA 1R3RA 3NYDA 1FWIC 1KR1A 5LNRA 2J24A 3AAMA 1IHIA 1PZ0A 4ADSA 3VILA 3S2LA 4FOUA 4LFYA 3AOFA 5EYWA 2DSKA 1TZZA 1K70A 1N8IA 3CPRA 4PTMA 3B0YA 4DLMA 4C6PA 5BU6A 3P0WA 1QI5A 1FWBC 1S5WA 3E0FA 4EAMA 5H8UA 3C2FA 3ITYA 1VBRA 1W1VA 4GJIA 3FVDA 1KCLA 4ASTA 3KTSA 1QTWA 1EQCA 4XV0A 3I7RA 2CLLA 3BLFA 3KS5A 4DNMA 1U30A 3DFHA 1AMKA 3A6OA 2BG5A 3CQKA 4R5EA 5HPOA 3VKDA 2VFDA 1GT8A 2YSWA 2P88A 1K4HA 3GH7A 4AD4A 5ABFB 1ZP3A 2BOFX 4UB9A 1B3OA 5GJMA 3QY7A 3SCNA 3LB0A 3N2XA 4NJIA 2Q8ZA 5FJUA 3RU8X 1RBOB 3MV11 2W61A 5HOSA 3ABZA 3WNNA 3I4EA 5I03A 2YLLA 3MQTA 2QT3A 1TE6A 1OQFA 4HCDA 3R4IA 5I00A 1E55A 2AQWA 4G1KA 1TV4A 1BQCA 1YDYA 1DJZA 4IM4A 4JFVA 3QGKC 3WQWA 1NJJA 3WUBA 1CZ1A 1OX4A 2E0PA 3WQGA 5F2LA 2DV0A 2YCKX 5XIAA 4JTSA 2NX9A 3R8RA 3R11A 2JBMA 5D2TA 5E6ZA 3KOFA 1PVNA 2P8BA 1BXNA 4M8UA 1EGVA 2GLKA 1SJAA 3S6TA 3VIFA 1UPMB 1UYQA 1XC4A 3WLMA 3U2OA 1XLEA 4LUIA 1CEOA 4RV8A 1ME8A 4JD4A 1XDJA 2YJQA 4OV9A 4Q4RA 1UWSA 2VFIA 2JGYA 4LB4A 5BU9A 1T8QA 3KLLA 1F76A 4JTUA 3EWZA 4FO4A 4LUSA 4B5SA 1XLIA 2E77A 4DYJA 3I6RA 3VGEA 1TPC1 3L66A 4CCZA 1PHQA 3BCDA 3A3WA 5HMFA 4LEFA 4G5DA 4H1ZA 5A94A 3BQ5A 4FF5A 3V18A 1W54A 1O5QA 3S46A 4D71A 3PB0A 2WSYA 4Z2HA 4RKAA 3S83A 3W72A 2W63A 2YDSA 2GSHA 1EXBA 3EX2A 3IPWA 2WYSA 3DX5A 3ES7A 4MYXA 3LCFA 2YBVA 2DFAA 1XD1A 5TAOA 4MKNA 1WUEA 3CEPA 1W5MA 3NWRA 3I7SA 1JJKA 1UD8A 3JW7A 3W6YA 3RM8A 4JCLA 4UZUA 1OHLA 4AY8A 1W1IE 3QMSA 4Q8OA 2I9EA 1NARA 4PUUA 2ZZ6A 3FYYA 1I2RA 4US5D 2REQA 4H7CA 1RCQA 3N29A 1F9CA 3IAPA 3U6WA 5T8GA 1GOKA 3FHAA 4QSHA 4IIBA 3UJ2A 4ML4A 3B8TA 4BWLC 2PLKA 4GZJA 4IJCA 5DBTA 2CPUA 2VUYA 4IGHA 1GG1A 2WOQA 4Y8FA 5BRPA 3NQAA 2VGBA 2VR5A 2ADAA 4AHQA 1UC5A 3MVIA 2DZWA 4G9PA 1N7KA 3L5LA 3VVGA 4I6VA 1HKKA 3SRHA 3RU6A 1XLGA 3F4DA 1VC4A 3EGJA 4MWAB 2YXXA 4PZVA 3TX9A 3G1FA 2IKGA 4GGBA 4X2PA 4LC6A 1D2KA 4R7JA 3CH9A 3OZYA 1IE7C 3NZRA 2FLIA 4PMVA 1VIWA 1BGGA 3FIGA 2QDGA 3CV7A 1BYBA 1KM0A 3GM8A 3SRKA 1GVQA 4KETA 4HVXA 1DXIA 1VCFA 1IZCA 1S46A 1VGAA 3M0YA 1EBHA 3HGOA 1R38A 3L9CA 2VDHA 1HZYA 3DFQA 3UF9A 3SB0A 3L2MA 4CCEA 4JFTA 3U4AA 4YL2A 1EX1A 3HOJA 3R6IA 1LG2A 1V0KA 1W5PA 3AZRA 4RE4A 1PXGA 5A6AA 3THCA 4O1BA 1VHCA 3T40A 3QOKA 3M5XA 1XCWA 3N04A 4JDBA 3GXNA 2DH2A 1OX4B 4FP1A 4FMVA 1QWKA 3ABXA 3ERPA 3WJSA 2UZ9A 3LBOA 3AHVA 1WZKA 5FF2A 2QPUA 1OY0A 4M51A 5DMMA 1L6YA 1LCOA 1CGUA 3OP2A 3WH9A 2R1MA 2Z7KA 1F8IA 3L4XA 1GZ1A 1RK6A 2RJGA 3NUKA 4CVUA 4OBSA 1GQKA 1UP3A 2D0GA 4HJWA 5K7JA 5CBIA 3SQMA 1DV7A 3QV8A 5BROA 3NSXA 1GGOA 5CAHA 3N14A 4GPNA 1RY8A 1SSDA 1CLKA 4IFOA 1U1JA 3AS0A 4KWSA 4P2VA 4QS5A 4JNMA 3B05A 3QHNA 1G4TA 2HE8A 2F6UA 3GIYA 1FA2A 5EMJA 3NG3A 1DWAM 2AAAA 1H51A 1NFBA 3UYIA 2C91A 2VFHA 4Q4MA 3VIHA 3G22A 4DZ5A 4WKAA 3Q37A 2EXOA 2BS9A 2I16A 1UP2A 3G1AA 4N9CA 9XIAA 4H9UA 3HV8A 3MO7A 4ICNA 1MNZA 5FEXA 1QOPA 3AALA 2C15A 4H19A 5T9CE 1VRXA 2ZC1A 1Y7VA 2R1NA 2E1WA 3M0KA 1QNVA 1LRQA 4LVDA 2GDUA 5HANA 3RX2A 3TFXA 5DY3A 1TUXA 2JF6A 4J28A 2Y8KA 1BVWA 1MQQA 1WX0A 1PIFA 1TPB1 2QGHA 2VGGA 3TA9A 2FFCA 2QCEA 2ZVIA 3OLDA 1WZLA 3BCJA 2GFTA 3QRHA 4OQVA 3TE9A 5JIWA 4U2YA 1KWGA 1Z44A 3GYCA 3M7SA 2I5GA 4FSAA 1QBAA 5F2MA 1YBQA 2PDLA 2RDTA 4J2PA 4M1BA 5KMYA 3W6MA 4E8CA 3AC0A 3RPTA 2JKPA 3EWWA 2V5LA 2PP0A 4GY7A 3KL0A 3WJXA 3MI2A 3NFUA 5ABGA 4GCXA 3HZ3A 3UZJA 3TYCA 2O4QA 4C6BA 3W1NA 3ZZ1A 2X0YA 5I24A 4V28A 5H2ZA 1SYTA 4YTQA 1ZB5A 4LANA 4UNIA 2GSJA 2OFJA 5HR7A 4RE0A 3WIJA 1PS9A 4FR6A 4PMNA 3W37A 2AMGA 2CBVA 5BXTA 2G95A 4J5NA 4FNUA 2OVLA 3QTGA 3BSMA 6ENLA 3M44A 5BWAA 3UVIA 2Y5JA 1FXPA 3KDNA 3FA5A 3M0XA 3FLUA 1HJUA 4HOXA 3M0LA 2D2OA 3NAVA 2J9ZA 3BC9A 1AQ0A 2PMQA 1UH4A 3BL3A 4EANA 4IP5A 1CB2A 2V5CA 3T08A 4HU3A 4KWUA 1XXXA 3KCOA 2CESA 4NYUA 3LPGA 2EF9A 4NRSA 2BNJA 3ARWA 2PS2A 1ZU8A 4MMWA 3W88A 2GVJA 2P0IA 1M9HA 3QSTA 3E2QA 4JIIX 4QNEA 1GTHA 1ISWA 3C86A 2QZRA 1HVQA 1CTNA 4IIGA 2F61A 3K4WA 3J7HA 3ZR6A 2XM2A 4POCA 3B8VA 3GO2A 1TVNA 5A6SA 1W1ZA 3SGZA 5DXYA 2ZRYA 3LHVA 1OT2A 4HPJA 1KGXA 3VIPA 3GDLA 3MCOA 4DI8A 5B7YA 3AWNA 4KBXA 2OOGA 1KBIA 2YPIA 2R82A 4ZSUA 4XVEA 2OYKA 4M7SA 3N4FA 1EWDA 1XM3A 1MWOA 3VKJA 3VFLA 3HN3A 4M6VA 1A3XA 1XUUA 1EO7A 4ACZB 4KIRA 1HJQA 4BKNA 1E1FA 1V3MA 2J66A 2TAAA 2PTDA 5CSYA 4RZBA 4JN8A 2ACUA 3ECQA 3QGVA 1M3UA 2FTWA 4S1FA 4BQ3A 1KRBC 3V4BA 4L80A 3NO3A 1M01A 3L0GA 2VFFA 5LGZA 3Q67A 4BCEA 1FH8A 1GVEA 3REQB 3UVAA 4H2HA 1Y5VA 1XDLA 3IV3A 1REQA 4E2DA 1LYXA 1QNSA 4L9YA 1G9HA 4AVNA 3B0UX 1P0KA 4PEKA 3CUZA 2X2YA 2QJIA 1C3FA 1PCKA 4XZ9A 2XISA 3TCSA 1W1A1 1T99A 3EX3A 2ZRWA 1BVZA 1GW1A 4AEEA 2BWGA 3UCCA 5FJJA 3VNIA 1H5VA 3WK2A 3ZYZA 1E4LA 2ZRZA 3KCLA 2CHRA 4DO6A 2G4JA 3IUIA 2INFA 3D47A 1MO0A 2YXGA 3NZ1A 3HA1A 1I0BA 1OYAA 3PG8A 2Q71A 4ZQMA 1GWJA 2G37A 4IOTA 2CEQA 3S5SA 1OBAA 3U2EA 1VH7A 1FH9A 3ZWTA 2OSXA 2PDQA 4Z0JA 1JDFA 3MU7A 2J7CA 2HNHA 2VZVA 4HHMA 3LPOA 1R6WA 4LYQA 2PWUA 1NFPA 1K9TA 5AC5A 1O5KA 2YZRA 4JDYA 4E2VA 4UTKA 1R3YA 1EL3A 1FTXA 4A8NA 4TX9A 3CMFA 5EGRA 2YBUA 3SY8A 3W6LA 3DYMA 1RCOB 2FB2A 3S5OA 2ZXQA 3BPWA 1EKOA 4FX8A 2ISSA 2FB3A 1IWPA 2Y63A 2Z1BA 3UR2A 1XUZA 1FY6A 1DVJA 1XGEA 2XFFA 4A21A 4HTBA 4MB3A 1ZPTA 2B7QA 3KOZA 4IICA 2J7DA 3KUMA 2V5BA 2XIJA 3JR2A 3HG2A 3KRSA 1TPVA 4PBFA 3CEUA 4EXQA 1W9XA 3KVLA 3ZVIA 3TLLA 2QULA 2NT0A 4MSSA 5JVLA 1UR0A 2J8GA 3C0SA 3WL0A 3W22A 4QJ5B 1KLZA 4RL3A 3WQPA 3B9NA 3WH5A 3FKKA 1CYGA 4JEQA 2OT0A 2WM1A 1OC7A 3V75A 4GOAA 4WEVX 4PL2A 5HMSA 4LYKA 5A2BA 1CW2A 4Y9PA 2NQZA 1F74A 4BI7A 1MEIA 4WK9A 4JKMA 5JUVA 1B90A 2QMJA 1J9YA 1A4MA 1DOSA 3ID7A 3L2IA 4ERAA 2J4GA 1UC4A 3F2DA 3GFZA 3WF2A 2XWDA 1BEUA 3TKFA 3NDOA 1JPHA 1ZLPA 4QG8A 1RUSA 1YW1A 1MEWA 5REQA 2ZDSA 3U9IA 3TN6A 4I5RA 4PA8A 5E9XA 4AD1A 1VKFA 1ALDA 4C6QA 3GXDA 4MJ2A 4B15A 4M24A 4YLWA 5FACA 1X6LA 5DY2A 2CC0A 3U5UA 1PWLA 4GQBA 1UD2A 4GI8A 4WDXA 3KRUA 2IW0A 2X30A 5LKYA 3A23A 2D2HA 1HTIA 1DJHA 4XAGA 1B9ZA 4RV3A 2TPSA 3USBA 3VMPA 2BODX 3DCPA 5JH2A 4DF1A 2Z6IA 2R1KA 3UJRA 4R34A 5ABHA 3VA8A 3NOEA 1W5NA 3TJXA 4PUMA 4PTXA 3UWEA 1TR9A 3QLLA 3NQMA 2D1ZA 2OB3A 4N9BA 1W0MA 4RJEA 3P2VA 4A3YA 2ONEA 3G1YA 2J74A 4HPXA 3G77A 5DXXA 4I90A 2PGRA 1M53A 4DWSA 1LWHA 1TJ1A 1H50A 1AW1A 1U5VA 1GVIA 2ALDA 1LBLA 2ASHA 2GK1B 2VEGA 3VNLA 3RK8A 1EDGA 4Z1AA 2PGEA 5FEWA 3UXIA 3BLPX 5CC5A 4ZE5A 3VOCA 4EXAA 3LHYA 1TJRA 3NDZA 3RHGA 3WEMA 1BSIA 4JX4A 1ADOA 1PO9A 1GQLA 1J5TA 4YVVA 4AG0A 2VZSA 4AZIA 4FX6M 2XFWA 1V3JA 4IIDA 4QG6A 2DORA 2W66A 4L4OA 1I75A 1JYWA 3S2JA 2WLYA 4L56A 2GZXA 2HPMA 3SEPA 1JYVA 4I7UA 7PTDA 3D6NA 2QIIA 1W6TA 6TAAA 2F6KA 3QPEA 2QAPA 4WIWA 3NA8A 4YTUA 4EKJA 2HRWA 4X2RA 2CLHA 3M5YA 4ZSTA 2O9TA 3WJZA 1FCBA 5BOFA 4P8UA 3KWSA 2QV5A 1Q5MA 1Q6EA 3HGRA 3W71A 1FDJA 1H63A 1NQ6A 4D1IA 1CXFA 4MVAA 1RV8A 3LX9A 4MGGA 1JPIA 4H7VA 2JEPA 5GNXA 3RXZA 2VMFA 4MJ4A 1E9ZB 4DO7A 2QQ6A 2WHJA 3FHQA 3S47A 1H62A 1DIOA 2WXDM 1RP9A 3WQ5A 1EDQA 3WO8A 1J8VA 3LPFA 1YDNA 4WOZA 1J4EA 4TV5A 4DXKA 4E3TA 2FVKA 4H9YA 1E0XA 2J8TA 2XVKA 3BARA 1U1UA 4RNJA 1ML1A 2PTZA 4DUXA 1KGWA 1QRQA 3RCMA 4PCSA 1TTJA 8XIAA 2CLEA 1VD6A 2QV4A 3GIQA 5C9WA 3AYTA 3ANVA 3MMDA 3O2LA 2IPJA 1Z32X 3EX4A 3GTNA 1C29A 1LQAA 4HK7A 4NY2A 2D2JA 1L9WA 3E2RA 2J77A 1VBJA 3D3AA 1J93A 3UXKA 5MF5A 3N9SA 3SI9A 3PTMA 1C92A 1OFEA 2A3LA 1O94A 1UR8A 3D5HA 1HJVA 5F4XA 2VR2A 5HQLA 3A22A 4WSHA 5HNNA 3E5BA 4L6OA 5C54A 2YDAA 1XLKA 2GGIA 4K8GA 4DWSD 4XZWA 2DZPA 1FHDA 1JXJA 2A2IA 3SUVA 3DHFA 2NWRA 1BD0A 1MUMA 4HU8A 1TMLA 4DJEA 1QFEA 3R0DA 2R1PA 1SO3A 5G2WA 3DGRA 3WH8A 3CO4A 3L65A 3N2TA 1G69A 2EPMX 1JCMP 5B80A 2E3ZA 2Z28A 4HNUA 1CDGA 5AKQA 3W84A 4CEXC 1ITCA 4C7FA 4JIHA 3W23A 4M6PA 1AODA 4GQQA 1IEVA 3OHMB 2B31A 3ANUA 4ZQRA 4U5KA 3RUBL 5A6LA 4XZNX 3TCEA 1UA3A 2HK1A 2FHCA 5EU9A 1J11A 3N15A 3O7UA 3RLUA 4O16A 4B9YA 3PUGA 2DVXA 3W87A 2XSXA 2XTKA 1TTPA 1AL8A 1SMAA 3FA4A 5I3DA 3W1MA 2PA6A 3IJDA 4Q3MA 4R7WA 4D6HA 4GXMA 2ZICA 3TW7A 4ZL1A 4GCAA 3MTWA 1XYCA 2XVNA 4GIRA 1C7TA 3F4WA 3R2GA 3A4JA 1D7KA 1ISZA 4XUGA 2A3CA 4IIEA 4IJBA 3DZ1A 4JIRA 1O12A 2QJJA 3NQBA 3VO0A 3NXFA 1VS1A 2FTPA 3HMCA 3REQA 3WQEA 1L6FA 5AZ0A 3TQVA 3OEXA 4Q8MA 3RFAA 3UT0A 1U5HA 1OD8A 2RDWA 3GNPA 2O4MA 3I3DA 1VJIA 3SRFA 4S3AA 4NQ1A 4JYFA 1W91A 4D6CA 3B0PA 1ISXA 3CL7A 4GXPA 4A3QA 3VIGA 1XQLA 1VAHA 2Z26A 3APYA 3K8LA 3SCQA 1R0MA 1IXPA 1M04A 4IFKB 3PJUA 2VJXA 1A3HA 4AZ5A 4MNJA 1UR4A 2P0OA 3AYRA 1R5YA 4NSBA 2QAFA 4DBUA 1BTMA 4BWLA 4DJDA 4PMXA 1LBFA 3VPLA 3S0CA 4UFHA 1UZ1A 1MDRA 4REQA 2FH8A 4Z2JA 4C6OA 3TJ4A 4NNAA 1HF6A 3B9EA 4JQ2A 4EX4A 2FZMA 1O95A 2R8WA 4Z2GA 3W7QA 3RAOA 1PKMA 5E0FA 1XWYA 1I0DA 3SIMA 4KIEA 1ZFJA 3H4WA 5JIPA 3GWQA 1NWSA 3WZ0E 3T4CA 2REQB 1E4MM 5KINA 4D6EA 3PFMA 2AQVA 1J0HA 2WHKA 3CTTA 2RKXA 2PODA 4C6NA 3OZOA 4GNVA 4XO6A 3BJFA 3N12A 4X22A 1T7LA 1CLXA 1LOQA 2PF8A 1OF6A 2WB5A 3GUWA 2ACRA 3TFCA 3FDGA 3L4TA 1LG1A 4O0KA 4RW5A 4DPQA 3ME3A 4AXNA 4HSNA 4GYJA 4IQDA 4HNNA 3KTCA 1DIKA 1H11A 3G0UA 3BLOA 1E9LA 3GC5A 4H6EA 2FZ9A 4FEZA 1LP6A 4ATWA 4MFEA 3IVUA 1RPXA 3PZIA 4MB5A 4HNOA 4PL1A 3OB8A 1QWGA 4DF2A 1VFHA 1OFQA 3CHVA 2P53A