1JFXA

Crystal structure of the bacterial lysozyme from streptomyces coelicolor at 1.65 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords 1,4-beta-N-Acetylmuramidase M1
total genus 80
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jfxA00
1OWQA 4HMCA 4IISA 2G3JA 1FHLA 2JIWA 1GW1A 3NCOA 2BVTA 3AS0A 3BGAA 1NOUA 3WF1A 2E0PA 1ESWA 1GQKA 4E8CA 1E71M 2W67A 1OINA 4Z2HA 4YPJA 1SR0A 1HJSA 1MVYA 1UWRA 1ITXA 2UY5A 2CYGA 4B9YA 2EPOA 3VD4A 2YKKA 4K68A 3EDFA 3VGBA 2YDQA 2WVTA 2OSXA 5GNXA 1RP8A 2WXDM 4HZ7A 2CXGA 2EO7A 4QLLA 4HA4A 3OA5A 3PZ9A 4H8UA 5HBFA 1CGVA 2VCBA 1PX3A 4MPKA 1JDCA 1V3HA 1VFOA 4DWSD 8CGTA 2GUYA 3WBAA 1QNPA 1I1WA 2XVNA 1GOQA 1QNOA 4PMXA 1XYFA 1X1NA 2VOTA 2D23A 3AIRA 2Y4SA 8A3HA 4UQCA 2GJXA 3GXDA 2VL4A 4OUEA 3SEPA 2V38A 2VQUA 2XM1A 3SCSA 3D5HA 1M53A 2O92A 2DT2A 2W91A 3T0DA 3RM8A 5A6AA 1EOKA 4OKDA 4D1IA 3MUAA 4BQ2A 2YDRA 2VQTA 2VVSA 1KGUA 2Q8XA 5I2UA 1D2KA 1BHGA 3O6AA 1K9EA 4HP5A 1E73M 4M81A 4GKLA 4A3HA 4W7UA 1JL8A 2WNWA 2AMGA 4EKJA 1W9BM 1DWAM 3N04A 5HOSA 4BQ3A 1LG2A 4DWSB 1OIMA 4H41A 2QPUA 1BGGA 3MSDA 4BS0A 3M7SA 4XV0A 6A3HA 1OGBA 1XH2A 1VFFA 4CVUA 1ZBVA 1GVIA 1VF8A 2YBUA 1XGZA 4AZBA 1Q6DA 2DSVA 3GH5A 5A8NA 1RD6A 4AXNA 3BAKA 2OWXA 3CHCA 4PUDA 3VNYA 5IHRA 5I77A 2VX5A 2DT0A 1JGIA 5CXPA 5HXMA 1GONA 1UKQA 4N42A 2CBVA 4XZWA 1CENA 4HU8A 4HOWA 2WMJA 1TE1A 4DWSC 5BCAA 1G0CA 2Z1SA 3VIFA 2WAGA 3ZSTA 2BV9A 3PZGA 4S3KA 3S6TA 1CGTA 1C92A 1QNSA 1J11A 1MW3A 2WHLA 2J7GA 4TVDA 3AISA 5BXTA 1EDTA 2D0HA 2WVUA 4W5UA 1HJQA 2ESCA 1H49A 2ZUWA 1KXTA 3BAIA 3WH7A 2G3MA 2CERA 3PZIA 4W84A 4AEFA 3PZTA 4ATDA 5D8ZA 4CD6A 5D4YA 4YHGA 2XFYA 3WD3A 4CU6A 2J75A 2WVVA 2VTFA 4HTYA 3DHUA 3N1AA 2VZOA 3THCA 2VR4A 4J3WA 3RJYA 3CZ8A 4IPLA 5ABFB 4QAWA 2RGLA 4PMZA 4KRUA 4EAMA 5CJ5A 1GQIA 1MYRA 3VD9A 1UA7A 4JFSA 4XX6A 3PBGA 3AMCA 3BLPX 3UERA 4E4PA 1ISWA 3AZRA 3QHMA 3AYRA 3TTYA 3WH9A 1JFHA 1MWOA 3SCQA 4AEEA 1W3LA 4DM1A 3I3BA 3UG5A 3POHA 1ZBCA 4UQDA 1KWKA 4JCMA 3ZO9A 3AIWA 2QLYA 5ECUA 3II1A 3AMKA 6CGTA 4UFLA 3K8LA 1JI2A 1LL4A 4WK9A 2ZICA 3NSXA 1KCKA 3ALGA 4UQBA 1ZS2A 2DH2A 3SURA 2J7EA 3G6MA 3WDJA 2ZWYA 1EQPA 4CU7A 3MO4A 3B8SA 4PN2A 2X05A 1MQRA 4JHZA 4P7QA 1ISXA 2WC7A 3AHVA 2BHUA 3CMGA 1MQPA 4XZBA 1JI1A 3ZOAA 3PZOA 3ZSSA 2VUYA 5JBEA 1BF2A 3F4VA 2YL8A 5M5DA 1S46A 2JEPA 3DYMA 1AQHA 1L0PA 1W9UA 2GK1B 1ZU8A 2JE8A 2OWWA 1UKPA 1TFVA 4PMRA 5ABGA 2ZIDA 1J0HA 1GZJA 4MAZA 2NSXA 1OM0A 5KEZA 4QCEA 1QPKA 1WPCA 1B3XA 4NZCA 3CZEA 1HIZA 1Q4NX 5EMYA 5JUVA 4ATWA 3VU2A 4FMVA 3WH5A 2WK2A 2XFRA 1C3FA 4OJYA 4ZE4A 4OZOA 2VMFA 3W0KA 4UFJA 4AZGA 3WUGA 4F9DA 2G4FA 4JCLA 2WCSA 4OIFA 1Y7VA 1UH3A 4GO9A 4B9ZA 1VFUA 1A47A 1VRXA 2VJXA 2Y8KA 3WEZA 4TVCA 2WKLA 4MB1A 5GQBA 1WAWA 1NP0A 1KB3A 2VRKA 1O7AA 3EMCA 3AS1A 5GNZA 2OYMA 4OBRA 4WJXA 1EHAA 2EJ1A 1B30A 3TTQA 2V3FA 1V3MA 2Z1KA 4DWSA 1FP9A 1UR1A 3CLWA 1UR2A 3OIHA 1TA3A 1R8LA 4P7NA 1X6LA 4H2CA 5HPCA 3WQ5A 1BAGA 1YQ2A 1SMDA 1VB9A 3SCUA 1QW8A 3U7BA 5A2BA 4UOJA 4CN4A 1BYCA 1LLOA 3JUGA 4D71A 7CGTA 3ZR6A 4AISA 1JNDA 1E4MM 4JZ5A 3F5LA 4MB3A 1FH8A 3FNDA 1PX4A 2D1ZA 1LJYA 3K8MA 2PWEA 1WB0A 1UKOA 4KGJA 1TVNA 2FHBA 4H8HA 3K1DA 1WDQA 7A3HA 2BVDA 2W62A 2W5FA 4D6JA 1KCLA 2PC8A 1B3ZA 3D3AA 2WPGA 2WSPA 1OT2A 2G41A 3QGVA 3PTMA 4ZFMA 3AHYA 3MMWA 2ZE0A 1LG1A 1XD0A 2WC3A 4E2OA 5HDRA 1Q6GA 1UD5A 1V6XA 2DSZA 1JZ6A 1HT6A 1DEDA 1J01A 5TD4A 1Q6CA 4CCEA 4UNIA 7TAAA 4AMCA 1W3KA 2E3ZA 4W89A 1C93A 1EO5A 3GH7A 5DT7A 1WZMA 4UQEA 2WMFA 2VI0A 1WP6A 3GZAA 2F2HA 4PMDA 1J0JA 1QI4A 4U2YA 3EDKA 1UQYA 1VJZA 2CBUA 1DHKA 3AIBA 4AZHA 3PZVA 4UOZA 3ARVA 1GVYA 2ZXQA 4FLRA 3OGRA 3AIVA 2CHNA 5CGMA 1JZ3A 4HZ6A 2WWDA 4L4PA 3EMQA 1FOBA 4H04A 1CGYA 3O9NA 3W82A 1GHRA 3FAWA 3CPUA 2EPMX 1OGGA 4W93A 1CLXA 2VZTA 1QI5A 3VNZA 2EBNA 3N18A 2J78A 3WQ8A 5CQ1A 3VKKA 1NP2A 1H1NA 4Z2IA 3VO0A 2MANA 4AD0A 2OYLA 1H3GA 2X8RA 4CGTA 1JDDA 1CDGA 3M07A 2ZX8A 4PRWA 4M1RA 3WEOA 2DPEA 1OCQA 1EQCA 2JALA 3VMPA 1R7OA 1W9XA 1TCMA 5E09A 1YHTA 3CUGA 3VILA 1E40A 4N0RA 3NYDA 3ARYA 4W87A 3SCNA 3CGTA 4JKLA 1CLVA 1J12A 3HU7A 3O2LA 5EFFA 3PTKA 1CXHA 1UD2A 2BNJA 3CUJA 1L8NA 2J25A 3AICA 3CZKA 5DMYA 2YDSA 3AI0A 3RO8A 4F79A 1JZ2A 1VEMA 4LXFA 5F7UA 4UFHA 4AC1X 2VZSA 2FHFA 4NF7A 3W28A 4AZIA 4TUFA 3CMJA 4URIA 2XGIA 3OB8A 2J77A 1H5VA 1NOFA 1VFMA 4AIEA 5DEZA 1BG9A 3L4TA 2WMIA 1E56A 1G1YA 3J7HA 4ML4A 2XYLA 4U2ZA 1V0NA 3IK2A 2C0HA 3VX1A 3OLEA 5A1AA 1OGSA 1R86A 2DSKA 3KE0A 2C7FA 1OBAA 3HJEA 4XB3A 1TVPA 1UKTA 5FKYA 3MUY1 2A3HA 1HN1A 1E72M 1JF5A 4AD4A 4JFVA 3VIGA 1UZ1A 4WKFA 2WSKA 4MB5A 5A8PA 1CWYA 4F66A 1RH9A 4MTVA 2FH8A 3IJ9A 3SCOA 2ZXBA 2ZX9A 4J3UA 1IT0A 2WHJA 1ZJBA 1TMQA 2PWDA 1MW0A 2DEPA 2DQXA 1GOWA 5FIPA 2QF8A 1XCWA 3TA9A 3EMZA 1HP4A 2QPSA 1PX8A 2WHKA 3QR3A 1NH6A 4AIOA 1XC6A 3WF2A 4QDMA 1F4AA 3TTOA 1ITCA 2G8ZA 3ZQ9A 2WMIB 3QOKA 3PTQA 3U7VA 1GOOA 5D9MA 5ABEA 3TONA 1UWTA 2C8NA 5CLWA 3AXIA 1FH9A 3L2MA 1ISVA 4CD5A 4P7RA 1XSIA 5A8OA 1QI2A 4JKMA 4ACYA 2BFGA 3VIHA 3DYOA 4CN1A 4A4AA 1CZ1A 3L4WA 2VZVA 4R5EA 2J7FA 2XM2A 1E5NA 4UQAA 3FHAA 3AHZA 1W2PA 3EDJA 5I6SA 4L4OA 3SCTA 3RIKA 1DWGM 2XPKA 1W2VA 2VC9A 4UCFA 5C8BB 4WKHA 2X0HA 4MDOA 3CHDA 4B16A 4W88A 1HL9A 1ZL1A 2WVVB 1XV8A 3OLDA 3WUFA 5C70A 3N15A 2VX7A 1QHOA 3CIVA 4IPNB 1Z32X 4M82A 3WIJA 1E3ZA 1U30A 2ZWZA 3SUUA 3VM7A 3LMYA 2DIJA 4FF5A 4AZCB 1E70M 4AW7A 3W81A 4GINA 1KBBA 4ZEPA 3ARTA 3N17A 4PTWA 1TZ7A 2CBIA 5AYBA 2YL5A 3W38A 2WKGA 4YHEA 3K4AA 1W9PA 2BHYA 2BVYA 4V2XA 4U5KA 3GBEA 3A3HA 1JYWA 3WQVA 1C90A 2WYSA 4Q7NA 4PMVA 1E1FA 3CO4A 3WH8A 2CNCA 2X0YA 3SCRA 1LL7A 1GHSA 1E6NA 5IHSA 1LQ0A 1BYAA 3ZMRA 4Y7EA 3WF0A 2ZUUA 3QHOA 1US3A 2IXUA 1G01A 2YLLA 1V02E 4AD3A 3NIYA 2YOCA 2CKSA 4LYRA 5E9AA 3VM5A 1XH0A 1IZJA 2XJ7A 4B3LA 3WNLA 2GJPA 3G6LA 3SCWA 3B9AA 3WL1A 1QBBA 1DWHM 1SMAA 3GM8A 4JKKA 4P8VA 1E43A 2JFEX 1FH7A 3CH9A 3KWXA 4MNMA 3RPMA 2XGBA 3L4UA 5I23A 4FLQA 3BAJA 2QHAA 1CBGA 4P8WA 1HL8A 4D6IA 1EXPA 3K8KA 5BXRA 5D9PA 1PJ9A 1JAEA 3N11A 4IUGA 3TP4A 3WKZA 2WC4A 1Q6FA 3U57A 3AS2A 1B3YA 4J28A 4CKQA 4A3YA 3PZMA 4WF7A 3W24A 3BMVA 5DFAA 3WY1A 5JBFA 1J0ZA 3U5YA 1UD3A 1PIFA 2ZUMA 1E6ZA 5CGTA 1BQCA 1PZ2A 2DSWA 3UR8A 4D6DA 1UWUA 1W9DM 2E8YA 4UFKA 1G9HA 2GVYA 5I79A 1GUVA 2WWCA 1E55A 3CHEA 1NM9A 1U2YA 4UZSA 4DUXA 2YA1A 3VDAA 2XIIA 3ARXA 5HNNA 3WDPP 1V6VA 1US2A 4GZIA 1E6RA 1E3XA 4X0NA 5LA2A 1V6YA 4QP0A 2ZUVA 5E6YA 4EANA 2GJXB 2EPKX 1OIFA 4JHOA 3ZJKA 4V28A 4HOZA 1KXQA 3CBWA 1UD8A 1VAHA 1W1PA 4CCDA 3OBAA 5BXSA 1GCYA 2GFTA 2A3BA 2WZHA 4UOQA 2RGMA 4WLCA 3W25A 4RL3A 2J8GA 4QFUA 3CHFA 3WMSA 1XRVA 2G3NA 2BY1A 1GOIA 4S3JA 1UR8A 3WUEA 1CGWA 2E9LA 3VIMA 4UFMA 1UUQA 1J0YA 1UYQA 4MADA 1K6AA 1B3VA 3BC9A 5CPQA 3WNMA 2CESA 1W3JA 4GQRA 1JZ4A 4LGXA 2EXOA 2D20A 4PMUA 1V0MA 4OOUA 1V3LA 2E4TA 1XSKA 2OWCA 4QLJA 3W6MA 4D72A 5FCZA 1VIWA 3VIPA 4U3AA 3QOMA 1ODUA 3ARUA 5DO8A 2WLZA 3AOFA 2JIEA 3ALFA 2A3AA 4AZ7A 4R27A 2VCCA 1R7AA 2YL6A 4CD8A 2AAAA 3EDDA 3OG2A 1R87A 4KRTA 3E1F1 4D6HA 1JG9A 4W8LA 4D6CA 2YA0A 3SUSA 1V6UA 5CLTA 1H09A 4E8DA 1UG6A 2IUZA 1CXKA 2QMJA 1HKIA 5CPSA 3WQ4A 1JXKA 5D9OA 2HVMA 3CUFA 1E15A 1JD7A 1KQZA 4NRRA 1MXGA 1KGXA 2FHCA 3GXMA 4TX6A 4NSBA 3KL3A 1BVZA 3A4AA 3A4WA 3AQUA 3WNKA 3IJ7A 3WQ6A 4GXPA 5AC5A 3WD4A 4BCEA 1ZBKA 4P7LA 5D8WA 2UY4A 1VEPA 1BG4A 5FOOA 1RPKA 2F8QA 2OSWA 2Y5EA 3GNPA 3MUIA 4PMNA 3KL5A 1DWFM 1JYXA 2ZX7A 4AZ5A 2D0GA 1CGUA 4ACZB 1EHNA 2UWFA 4F8XA 4AY1A 2BHZA 3PHAA 4GO8A 4CD7A 3IANA 2VURA 3S2CA 3VMNA 3RJXA 3VTRA 1MFVA 1V02A 1GQLA 1KGWA 3NSMA 6TAAA 3POCA 2GDUA 3OLIA 3L2LA 3THDA 2NT0A 2W61A 3CTTA 5IDIA 4ZENA 3MU7A 4UZUA 3SUVA 3MKKA 1JF6A 2WB5A 3VIOA 1J0IA 2WHMA 1K9DA 1RP9A 3WNPA 5D9NA 2EPNA 4PTXA 1M03A 4V27A 1E0XA 3WELA 1D7FA 3K46A 3CZJA 2J74A 1V0KA 3AS3A 1TUXA 1UWIA 1JZ8A 1LL6A 4C7DA 4CD4A 2XG9A 1MFUA 1XYZA 3ZJ8A 1HNYA 1B9ZA 4D6EA 2DGAA 3KZSA 4HA1A 2BY3A 3L4VA 4UFIA 4GI9A 1AMYA 2GSJA 5BRPA 3T2PA 2VVNA 1G94A 3MSGA 1TG7A 4WSJA 4J3VA 4AD2A 4TX8A 1XSJA 1WZAA 3RMEA 2YA2A 5ABHA 4WSKA 3ZT6A 5A6BD 5BWFA 4WIWA 1CNVA 4UR9A 3VVGA 1EOMA 1B1YA 2J79A 3GBDA 4XUYA 2Y8VA 1BPLB 4PEEA 1UKSA 2ZOXA 3AIEA 2V5DA 3HMCA 2GJRA 1BTCA 3VDHA 3BAWA 3WD0A 1GORA 4DUVA 1FFRA 1B0IA 1UZ4A 3BLKA 3NSNA 2Y24A 2JEQA 1B31A 2JF7A 4MNKA 1V03A 4GZJA 4PYSA 3AMDA 3F5JA 2F61A 4FLSA 3APGA 1E4IA 5I0DA 1BVNP 1XD1A 5CPTA 4JFWA 5JIPA 4HMEA 1WDRA 3VGFA 1M01A 4HPHA 1UA3A 1CXLA 3WL0A 1TA3B 1ZBWA 3ARSA 2WCAA 3AYSA 2FGLA 3U5UA 4EE9A 4AWEA 2V3GA 4OBSA 5IFPA 2VX6A 4JAWA 5EB8A 3KEHA 1WNOA 3AIQA 1H4PA 5E6ZA 3VIIA 3WEMA 3LPOA 4LYQA 2BS9A 2J7CA 4U3CA 5HPOA 3L4YA 3EDEA 5A6MA 4H7VA 2CHOA 1IV8A 4HPGA 1JXJA 2PB1A 2WZIA 2OYKA 4PCSA 3RCNA 3ZT5A 3VD5A 2DIEA 2CIPA 9CGTA 5FL0A 1NOWA 4CN6A 5A69A 1WCGA 1QVBA 3N13A 2PWGA 2W4XA 5LA1A 5LYRA 3VOCA 1MW1A 1WZLA 2WMGA 3UESA 2PF0A 1WO2A 2TAAA 2D24A 2J62A 1UD6A 3WN6A 3QHNA 3ARPA 2A3CA 2XWEA 4D6FA 4GIAA 1SFSA 2NW0A 2E9MA 4KMQA 3EYPA 1EIBA 1NWRA 1LF1A 4CCCA 4PMOA 1XHGA 1HVXA 4D6GA 2WBGA 3I3EA 1UH4A 1N82A 4W86A 1TR1A 1UWQA 2DT3A 4HA3A 2V5CA 1UQZA 5KZ6A 3AXXA 1CPUA 2CBJA 3VIKA 4MJ2A 3VINA 1C8QA 1UWSA 3MANA 3GXFA 4JIEA 5BRQA 3BXWA 3VGDA 1AVAA 2VRQA 2VX4A 1W32A 1QBAA 3OLGA 1W1TA 4W8AA 1HJWA 1BFNA 1WZKA 2PBOA 3NJ3A 3N9KA 1BYDA 5I24A 1ODZA 1PIGA 3WMCA 1KXVA 3A6OA 1JYNA 3ZIZA 4PUEA 1UR9A 5ABFA 4MJ4A 5AYIA 5CSUA 2V3DA 3DECA 2PBGA 3TOPA 3SUTA 2J7DA 1MQQA 3T08A 4GPNA 4W85A 3WENA 3W27A 5A2CA 2Y2WA 4LX4A 1UH2A 4D1JA 3NDZA 1HF6A 1X6NA 5FD0A 1CXIA 1QI0A 3FN9A 3UEQA 3BAYA 1QW9A 3WF4A 3GH4A 5C71A 2AOSA 4HZ8A 3FAXA 2D3NA 1CIUA 3SCPA 4CU8A 1PPIA 4PCTA 1KBKA 1H0GA 3RDKA 4WKAA 5GPRA 2CPUA 2O9RA 3GDBA 1HKKA 4Z2KA 4Q22A 3WF3A 5A6LA 2ZUSA 5A8QA 1JAKA 5A94A 2HISA 3N12A 1E1EA 1GPFA 2ZUTA 1P6WA 3ARWA 4Z2LA 2WANA 3VD7A 5LA0A 1I75A 2CEQA 3A47A 1CYGA 4U31A 1OB0A 3T0AA 4AD1A 3WDHA 4F9JA 4MNJA 1W1YA 2D0FA 1QHPA 1NWUA 3MMUA 2DSUA 4M29A 1JIBA 1GNXA 3ARQA 3WNNA 3I3DA 3AIUA 1E9LA 2PI6A 3FXYA 4KWUA 3CZLA 1WKYA 4RE4A 4Z2GA 3CUIA 3OZOA 1K9FA 1BGAA 5JBDA 1UR0A 4B15A 1GOMA 4ZXLA 1VEOA 4P7OA 5I78A 2WW5A 3VUPA 3VD3A 3ZJ6A 1V0LA 1GJUA 3B9EA 3WDQA 4MAVA 4LPCA 2YL9A 1BSIA 1PEZA 4UTFA 2W92A 5E0CA 2BXYA 3EBVA 5A6SA 1VBRA 2WVSA 4TTGA 1PAMA 2ZX6A 1EH9A 2E40A 2O9TA 1JZ5A 1JZ7A 3NUKA 2B31A 2XSBA 2FDMA 2JF6A 1DWJM 2G3IA 1UD4A 1M04A 3AHTA 4KH2A 4J3XA 3LPFA 3W53A 4P8UA 2E8ZA 3IAQA 1ECEA 2XFFA 3AMGA 2VO5A 4KGLA 5A6KA 3GYCA 3BCFA 5IFTA 4AZ6A 1HJUA 1W1VA 4GQQA 2WZEA 1W91A 3UCQA 2WMKA 3UG3A 2EPLX 4J3TA 2VZUA 1UOKA 4X9YA 4C7FA 3TTSA 3L4XA 2UY3A 3VX0A 1FP8A 2VR5A 1HKMA 1R85A 4X0VA 3WD1A 1UR4A 2W63A 3RM4A 1U33A 5EFDA 4Z2JA 4PTVA 2J47A 1E6QM 5BXPA 3AROA 1FHDA 1WDPA 2FGZA 1CXEA 1NARA 3WDIA 4W7WA 4PSPA 2A3EA 2J7BA 1HKJA 4U5IA 1EGZA 3AJ7A 2WM0A 4QLKA 4W7VA 2DDXA 1V08A 1E6PA 1VJSA 1HXJA 2BY0A 4ZE5A 4BQ4A 5A95A 4AZCA 2XSAA 1V3JA 3ZR5A 1NQ6A 1EO7A 2D22A 1PBGA 1BYBA 4EK7A 5IXEA 3WBEA 3SIMA 1UHVA 1H0IA 5AC4A 1F4HA 4BQ5A 4RE2A 1QNQA 5A6JA 5I3DA 1V3KA 3CUHA 1DP0A 1H2JA 4J7RA 1W3HA 4HU0A 2V3EA 1V3IA 4MB4A 3GNRA 4PMYA 4U33A 1JYVA 3BCDA 1KXHA 3VIJA 3HN3A 1ISYA 3PN8A 4CVWA 3ZJ7A 1J0KA 2EEXA 3BMWA 2GDVA 3OZPA 4JL2A 3AFBA 1HJXA 2J8FA 4M80A 4MDPA 1DTUA 2XTKA 5E0FA 1ISZA 1EDQA 2PWFA 1FA2A 1H41A 4PMQA 1GJWA 4GI8A 2XWDA 2J7HA 5DF0A 2YIHA 1KWGA 3W26A 1C8XA 2X09A 1G5AA 1WE5A 2ZXDA 2DT1A 1SYTA 4BA0A 3WUBA 3VGGA 4JL1A 1CXFA 2UY2A 1E0WA 2D2OA 3WSUA 3KL0A 3VGEA 2XVLA 1CTNA 3A4XA 3W29A 4RE3A 3NDYA 1C7SA 1J18A 3VMOA 3WQWA 4HOXA 1FFQA 1D3CA 1KFWA 1MXDA 1E6XM 3MS8A 1I1XA 1MW2A 1CECA 3ARZA 4MNLA 1OD8A 1IZKA 3M46A 4TTUA 5GNYA 3GNOA 4ACZA 4PTMA 3MMDA 3ECQA 3ARRA 4AYSA 4P8XA 2XHYA 3AZTA 4H8VA 3T09A 1O6IA 3VPLA 2IXVA 2O9OA 3T2OA 3DYPA 1JD9A 2ZXAA 3WMBA 3VDCA 2E9BA 2GK1A 1B90A 3AMLA 4HMDA 3CZGA 3OGVA 1HVQA 1EDGA 4BF7A 1K9TA 4ATLA 3RM9A 4UQ9A 1H11A 1J9YA 2ZX5A 4M56A 1QI3A 3K4DA 2X1IA 4B3KA 3FW6A 1CGXA 3FHQA 5JIWA 3GXIA 1EA9C 5M17A 1C7TA 2OLHA 4CUCA 3L4ZA 3OGSA 1AQMA 5CZKA 3UETA 5A2AA 3WFLA 1KQYA 1DWIM 5A6BA 5EBAA 4PSRA 4QCFA 4TXEA 1C91A 5BROA 1C8YA 4C7GA 1JDAA 4PBGA 2CITA 2EQDA 3UR7A 4DM2A 1QNRA 1VENA 1HX0A 3VDBA 2CKRA 4JFTA 3AHXA 1VBUA 4ZXOA 1Q6EA 2OSYA 3M6DA 1NWSA 1HJVA 3SUWA 5CG0A 1B3WA 3W6LA 1QHZA 3AZSA 2D3LA 2X2YA 3PZQA 3IJ8A 3WFZA 1WDSA 5CSYA 1W9VA 4IM4A 4M8UA 3SCVA 5M03A 3DHPA 3F5KA 2VNCA 4NI3A 2YBTA 4YN5A 5I5RA 1BLIA 2PWHA 1KR0A 3PZNA 4LQ1A 2VCAA 3T0BA 1J10A 3MV11 1GOKA 3T2QA 2CCRA 1M7XA 2XVGA 3AXHA 3LPPA 1CEOA 2WCGA 2BY2A 3WNOA 2VT0A 1OT1A 2NT1A 4FLOA 1JNEA 4JFUA 1QOXA 4OOZA 4GZEA 2WLYA 5M3WA 4FK9A 1B2YA 3GTNA 3ZM8A 1LWHA 1HP5A 3ZT7A 2DH3A 3RILA 1A3HA 2XVPA 4W5ZA 2CETA 3LPGA 5DT5A 2XVKA 4DUWA 2YJQA 3MV01 5FL1A 2J4GA 2XUCA 3PZUA 3DC0A 1E4LA 4BZYA 5A3HA 4M24A 2WMHA 3WD2A 1E5JA 5A8MA 4NRSA 1ZB5A 5AY7A 3BSHA 2XIBA 1E6SM 2ZUNA 4AIUA 1E0VA 2WBKA 2QMKA 2O9PA 3W4RA 1ZJAA 1V6WA 1PZ3A 2BXZA 4J27A 3BH4A 1E4NA 4LYPA 4TVUA 5BYWA 1OD0A 4GI6A 1XCXA 3MUZ1 3UG4A 3W37A 4W8BA 3IAPA 2QV4A 3BAXA 1XH1A 1AQ0A 5E70A 1LWJA 3WH6A 3WDRA 4J3SA 1NWTA 3VGHA 3FY1A 3B9DA 2YLAA 2VRJA 2FH6A 2W66A 1OSEA 1KR1A 4TOQA 1JFXA 3BSGA 4AD5A 1GQJA
chains in the Genus database with same CATH superfamily
1RQHA 4HMCA 4K1WA 3R13A 2BXVA 4PL1A 1Q2RA 3LHWA 2JIWA 2BVTA 4NASA 3V0UA 1W1ZA 4XTDA 3W1MA 5B7ZA 2QIIA 2QUVA 1Z7AA 4E8CA 2W67A 3VE9A 2I7GA 3N4EA 4IIDA 4Z2HA 4YPJA 1HJSA 1MVYA 1UWRA 1KTBA 1Y5WA 1Q8JA 4B9YA 3RLGA 4BI7A 4DO7A 4XISA 3VGBA 4AF0B 5GNXA 4HZ7A 4PUJA 3R1ZA 4HA4A 5HQEA 4ZTXA 4FAMA 3KP0A 4PCFA 1X8FA 3IJLA 5G1TA 2GUYA 1NAL1 1QNOA 4PMXA 1LWIA 1XYFA 3RU8X 5KTLA 3TSDA 2IKHA 2FFIA 4NZJA 4O50A 3N9RA 3N4AA 3GXDA 3HG4A 2V38A 2VQUA 4K8GA 4LWWA 4XSLA 4JTSA 4GKTA 3H7VA 3W2UA 3R6IA 4JXCA 1KM5A 5K9CA 4Q7IA 1TV8A 1D2KA 1FDYA 1RAKA 2QJNA 4PB4A 3AWNA 1E73M 3PAOA 4M81A 4GKLA 1XBZA 4MVAA 1JL8A 1W9BM 1DWAM 1G4TA 1FWNA 5D38A 1W6TA 4BS0A 6A3HA 1GVIA 5LZLA 3TN4A 2HK1A 1YXDA 3W1LA 3GH5A 1BXBA 3GD6A 2OWXA 4HGXA 4A3RA 3L12A 4ECLA 5A5WA 2ISFA 3VK5A 3CH0A 4HOWA 2C71A 1EXBA 4JS3A 3FCPA 3Q65A 1FWIC 2BMBA 9XIMA 3FXGA 3ZS4A 1EYWA 3VIFA 1H51A 3THUA 2BV9A 4MM1A 4NY2A 4CQ9A 1GVFA 1C92A 1ICPA 1MW3A 4L5ZA 3W1TA 2HE8A 4TVDA 3JZEA 1EDTA 2D0HA 3DHDA 1S39A 3E6EA 2INFA 2F38A 3BAIA 1SSGA 4I5UA 3WH7A 4LAKA 2ACUA 3PZTA 2NUWA 2QAPA 3WD3A 4CU6A 3OHMB 4GCAA 3OQ8A 2VTFA 1Q6RA 3DDMA 5DX7A 1IWBA 3RLUA 4JBRA 2WNQA 4IJRA 3MJYA 4J3WA 4FXJA 1B4KA 3GG0A 3GR7A 4IPLA 4Q32A 4EAMA 1UA7A 4JFSA 3BLPX 4YVVA 4K3ZA 4E4PA 3AZRA 4EX4A 3QHMA 3TTYA 3MZ2A 3LK6A 1XRTA 3QF0A 2VWTA 2GPTA 1FKWA 1MWOA 3FLUA 4AEEA 4IHCA 1PL9A 1K77A 4UQDA 1ADSA 1HO1A 1JI2A 3W7OA 3DH7A 4WK9A 3NSXA 4Q8MA 5T26A 1W3NA 3VKCA 2J7EA 3ONCA 3G6MA 4QXIA 2ZWYA 4O16A 1EQPA 4CU7A 3R94A 2BHUA 1JI1A 3ZOAA 3ZSSA 1R47A 5CZTA 4LBUA 5JBEA 1BF2A 2BGSA 1MUMA 4HIBA 5A8GA 1L0PA 1ZU8A 5BRBA 1XRSA 4PMRA 1WKEA 4RZBA 3CZEA 1Q4NX 5EMYA 4ATWA 4FR1A 2HK0A 1TO3A 3WH5A 4GIYA 2F2KA 2XFRA 2DJXA 4OJYA 2QXWA 2ACQA 2BTMA 4N6EA 1FXQA 3C2FA 3IIVA 1R9YA 4H1ZA 4F9DA 1TIWA 4LC6A 2V67A 2VFFA 4YTTA 4NNCA 3QBUA 4O1DA 1W5PA 1HTIA 2VJXA 3SJ3A 2Y8KA 4BWLA 3GR8A 1XBYA 5GQBA 1WAWA 1NP0A 4JYDA 1KB3A 2PGRA 2A7RA 3GNXA 2DORA 1UR1A 3QQ1A 1UR2A 1UPPA 3OIHA 1TA3A 2WJZA 1XDMA 1BAGA 1RJPA 4GABA 3OJGA 1RBAA 1YQ2A 4MZ8A 1QW8A 2A6LA 3UWUA 3OA3A 4UOJA 4RV8A 1LLOA 3L65A 3ZR6A 2PCEA 4NU7A 1B5TA 1XCFA 4FO4A 1JNDA 4JZ5A 3F5LA 4MB3A 2ZZ4A 1LJYA 3K8MA 3T8LA 1UKOA 2OXNA 4ONVA 1XUUA 4FOKA 1TVNA 3K1DA 1JRCA 1PO9A 3KS6A 3QZAA 1MXSA 4D6JA 1KCLA 4HSHA 3D3AA 3NQAA 2WSPA 5D2TA 3UY8A 1JEZA 5HJLA 2DFAA 4ZFMA 3GC2A 3P67A 4ZFCA 4OWGA 5FESA 2E1DA 1Q6GA 4HHHA 1UD5A 2VEPA 2X1TA 4QJ5B 2C18A 1OG6A 1JZ6A 1J01A 3IUHA 4LB3A 4LUTB 1W3KA 1JQXA 1GKRA 1C93A 5DT7A 4F0RA 1WP6A 4AWTA 3GZAA 2CLFA 1QI4A 3EDKA 4PTDA 1DHKA 3LM3A 3M6YA 1Y5XA 5IDZA 1OFEA 1YEYA 3EA1A 1JZ3A 4WRHA 2F84A 4JIQA 2WWDA 1ITQA 3NL5A 1YPXA 1ECQA 3W7EA 1CGYA 1GHRA 1WBJA 3QJAA 5HJYA 3G1AA 4FR6A 1GKQA 3VNZA 2R1NA 5AKQA 1G6CA 3M9YA 3VKKA 2C1IA 3QR1A 2ACSA 2YCIX 3VO0A 3N73A 4A35A 2OYLA 1NSJA 1H3GA 4RDZA 4CQAA 2X8RA 3TSMA 3LBOA 5JMUA 3WEOA 3W2MA 2JALA 3B8UA 2BVWA 1ML1A 1HZYA 3P80A 3NQ2A 1H7WA 2I9UA 3DESA 2QCLA 3MP5A 4EPBC 1W5OA 3SCNA 4JKLA 1J12A 1SGJA 3HU7A 5HNRA 3C86A 1VYPX 2ISSA 3PTKA 4ZOAA 3CUJA 4JTFA 4GMEA 3UBPC 3AICA 2YDSA 4F79A 1YIXA 4LXFA 4AC1X 2VZSA 5EGRA 5FF3A 2FZDA 3OB8A 4JTCA 3F4CA 1NOFA 1VFMA 1W37A 5AOUA 2WMIA 4I9MA 4QTGA 1EF2A 3J7HA 1F5ZA 1TPB1 3T4CA 3S2NA 4U2ZA 5A1AA 3HQNA 3B06A 3CUXA 2GWGA 3QEZA 1OBAA 3T05A 4NKCA 4MSSA 1EZ2A 1RY8A 4ZO6A 1HN1A 3VIGA 4WKFA 1E1CA 3HPFA 2WSKA 4F66A 1RH9A 2FH8A 4REQA 3SCOA 3IV8A 1FTXA 2ZXBA 4WD0A 4J3UA 3LCWA 4H9YA 1QWKA 1GOXA 2X16A 4GC3A 4O28A 3EWYA 1ZJBA 5CZSA 1TMQA 4DNMA 2DEPA 2DQXA 2E5CA 1I45A 3SGUA 1OX6A 2P0IA 4AIOA 3WF2A 4QDMA 1F4AA 3LV6A 1GOOA 1XYLA 5D9MA 2OFJA 1UWTA 4XVDA 3UCDA 3L2MA 1ISVA 2GQ9A 2PODA 4F0MA 1Q4WA 3LNMA 2QVHA 4JKMA 4ACYA 1KRBC 3VIHA 2AL2A 1VFTA 4A4AA 2J7FA 2L5HA 5H8PA 3AAMA 3EDJA 1Q13A 2ZTKA 3L23A 1ADOA 2PDIA 3PUEA 1K4HA 1NFPA 3RIKA 1O68A 1UZHA 2VC9A 4UCFA 1TJ1A 1XI3A 4B16A 4W88A 1N8WA 2WVVB 1XV8A 4FIRA 2QDGA 3NZQA 4MG4A 4JQ3A 3CIVA 2YXGA 4AXKA 2NX1A 3TN5A 2ZWZA 2XH2A 3VOIA 4KQNA 3EX3A 2DIJA 4AZCB 1E70M 4QM1A 1SJBA 4IQJA 1NELA 1KBBA 3OVQA 5D2VA 1PHQA 3LLDA 4LH8A 2YL5A 1AL8A 4TIMA 3K4AA 1W9PA 1ADDA 2VFEA 4PTNA 3GBEA 2AMXA 2PSNA 4IJCA 1W1B1 1D3HA 1E1FA 2X0YA 1GHSA 5IHSA 1PIIA 1KCZA 2E6AA 2HXUA 1HL2A 3QHOA 4YWSA 3KVMA 3SY8A 2WZMA 2PDHA 4XBSA 2HDJA 2YLLA 1L6WA 5G2IA 2CKSA 2BP1A 3VM5A 3HFYA 1IZJA 4UXDA 3WNLA 2GJPA 3SCWA 4J5NA 5LXEA 3WL1A 2F6XA 2FPYA 1DJXA 4S3EA 3NL3A 4XD6A 3IGXA 2C19A 4N02A 4P8VA 2I9EA 4O0ZA 4L4LA 1FH7A 6XIMA 4QQUA 5HATA 2GVLA 1BKSA 4DUOA 3KWXA 3M0LA 3RPMA 3TMQA 1UIPA 2XGBA 3V16A 3L4UA 4G7FA 4B5XA 4RW3A 1TRIA 2QHAA 1IT8A 1YDNA 3XISA 5GVJA 3H2CA 1EXPA 5I3HA 3K8KA 5BXRA 2HSAA 2R94A 2H9AA 3BW3A 3WKZA 2PLCA 2WC4A 3U57A 5I09A 3AWOA 3MHFA 1R3SA 5JH1A 1UD3A 4ZQMA 1R6WA 4BR1A 4HN8A 5CGTA 5ECVA 1ZCOA 1DXFA 2DSWA 2NVCA 3UR8A 4C6BA 4D6DA 4NI8A 3FJ4A 3LHYA 3EEGA 4C6QA 1O5XA 3LI0A 2PD9A 3CHEA 3BLDA 1NM9A 1U2YA 1SZEA 2TRSA 3CL7A 3IVTA 2YA1A 3DC8A 3G1YA 2XIIA 1XIIA 2QV5A 5FAJA 5HNNA 1V6VA 1US2A 4JTUA 4OBTA 4QP0A 2ZUVA 5E6YA 2E5DA 4ZQRA 2GJXB 1ZTVA 1SO3A 4JHOA 2Y88A 3OYZA 1F7BA 3CQKA 5I3KA 3CBWA 1UD8A 3EXTA 2GFTA 4NX5A 1LQAA 4DI8A 8XIMA 1AQFA 1YBQB 4AAJA 4LRTA 4QFUA 1TWIA 4N9DA 2XH7A 3WMSA 1DIDA 3FSTA 3UWEA 3IUIA 1X38A 4S3JA 3W2LA 1UR8A 3WUEA 3S6OA 4UFMA 1VQTA 1EYEA 2ZQ0A 1IR2A 1B3VA 4HNUA 3WNMA 4GFIA 1W3JA 2PTDA 5HJXA 1JVNA 4LGXA 4DX3A 3CAVA 1V0MA 2ALDA 1DIOA 2C3ZA 3W6MA 3VIPA 1OFBA 3QOMA 4BKNA 3N2TA 7REQB 2FZ8A 2P8BA 4WEVX 1FQ0A 3Q37A 1T5AA 2A3AA 3BUVA 4AZ7A 1R7AA 2J27A 3EDDA 3T44A 4XO7A 1R87A 3H55A 3L2IA 5CLTA 3CYVA 2DVTA 4E8DA 3REQA 3V75A 1EEXA 3VOHA 2QMJA 5D2WA 2NQJA 1G4SA 1I2PA 3UGVA 1KQZA 2V30A 2OQYA 3PY2A 5FF4A 1OFRA 5DY3A 3AQUA 4QR6A 3IJ7A 3LQLA 1FWHC 4PH6A 4P7LA 5D8WA 2VKZG 5FF7A 2F8QA 4NJIA 3GNPA 2XIMA 1TE6A 2YDAA 1DWFM 1CGUA 3G8EA 2GUUA 1EHNA 4XO6A 4G56A 4XBJA 4Z08A 2OT0A 4GO8A 4ES4A 3VMNA 3M0VA 1MFVA 1V02A 1D7KA 4UBPC 2VEFA 2NV9A 3ZFHA 3NSMA 3VCNA 3W2NA 3G0SA 3OLIA 3L2LA 2PLMA 4JTJA 2DVXA 1YTEA 4OV4A 1LBLA 2UZ9A 3NR0A 3WNPA 1SFTA 1LT7A 1UR3M 3ORWA 3GVGA 3U8GA 1E0XA 3P81A 3K46A 3TQKA 3FYPA 3UCCA 3AS3A 4WJEA 1LL6A 3E49A 1GVSA 1ZAHA 4HTBA 4C7DA 3KRSA 2FMOA 4X22A 2FPTA 1XYZA 1HNYA 3LTSA 4D6EA 5AHFA 4UTWA 2IKGA 4GXMA 2X7VA 1ZQ5A 3I6RA 5DCEA 1MMFA 1J4EA 4UB9A 1F3EA 1MUWA 1AMYA 2XIJA 5DCBA 4Z1BA 2O55A 3NYZA 3M5VA 1TG7A 1XLLA 2OGYA 2H3BA 4Y9MA 4AD2A 5MHBA 3IJDA 1J6OA 3WLRA 2NUXA 1WZAA 2WJEA 3RMEA 3RGTA 3GHRA 3I7QA 3LLFA 4GYPC 1FVPA 4GH1A 3GC4A 4YWIA 3WJWA 1CNVA 1YNQA 5BWFA 1EOMA 1B1YA 3GBDA 4PMJA 1BPLB 1UKSA 3AIEA 2PZ0A 3W2JA 2V5DA 4O1BA 2GJRA 1MZRA 1XP3A 1UZ4A 3BLKA 3NSNA 4MKSA 3NPXA 4XAFA 3S1XA 4PYSA 2JGYA 1OY0A 2B81A 2F61A 4EXAA 3KDNA 3C56A 1XLCA 1JDEA 4KRZA 3T81A 1BEUA 1S3HA 5JIPA 1TTQA 1AUSL 1WDRA 1KM4A 3VGFA 2EG8A 3W73A 3MSRA 4O53A 3WL0A 4ML9A 1L6YA 2PU0A 5F2LA 4H8NA 2Z1VA 1POJA 3MDWA 3ARSA 2WCAA 3H21A 4NAEB 4EE9A 2O4MA 3CU2A 4H9VA 2I1OA 3PB0A 2ZRVA 3ABSA 5IFPA 1NIUA 3IPWA 4JAWA 3C2RA 3AIQA 3OW1A 3VIIA 3WEMA 4AUBA 4AHPA 2VHLA 3R12A 4HNTA 1XINA 4KCWA 4FNPA 3H70A 1IGSA 3Q2DA 4H7VA 3O07A 4S2BA 4Z0SA 1IV8A 2OR2A 4O8AA 4H9MA 3M47A 3UPWA 4PCSA 3O7UA 1K3UA 3QC3A 5LNSA 3GNDA 9CGTA 1NOWA 1WCGA 3N13A 4JNMA 2WOQA 3VOCA 2WMGA 3N2MA 1KV5A 2D24A 2J62A 4UTKA 3NDOA 3WZ0E 1KM6A 5C5YA 3GS6A 1F73A 1EIBA 1TWDA 4E4UA 1LF1A 4IQDA 2QPXA 1U5HA 1XHGA 3I3EA 4IFKB 2ZTJA 3M44A 1A5UA 1RA5A 4HA3A 5CJMA 2VOMA 2EPHA 4HCDA 3EKGA 2EG6A 3WCZA 3U2CA 3VINA 1C8QA 3BQ6A 3PAJA 2NXGA 5IM51 3TJXA 3CHVA 2P3EA 1YE6A 3VGDA 3C0JA 4I7VA 4LVGA 4O1AA 4ZZ9A 1QBAA 3RYSA 4E2VA 4IMGA 4QSFA 1EL3A 4YNGA 1IXOA 2XGZA 4WCJA 3N9SA 5I24A 1ODZA 4LTSA 3LU2A 1PIGA 3WMCA 4DZHA 3A6OA 5F2GA 4JGDA 1JYNA 1SU5A 1UR9A 3KVJA 1NF7A 5CSUA 4Z1YA 3DECA 5LKYA 1FCVA 3B8WA 5BU6A 2PMQA 4BF9A 3CWNA 4JEJA 4W85A 1RJQA 1IGWA 3VDGA 1VS1A 1SZRA 1PDZA 1K7XA 3NDZA 1XICA 1X6NA 2YPIA 5FD0A 3KOWA 1XM3A 3DGRA 3FN9A 6ALDA 1WDWA 2WQDA 3GH4A 4C6KA 4IX0A 3FAXA 1CIUA 1XQKA 3GSMA 3ME3A 1NDVA 2CPUA 3GDBA 1HKKA 5FSEC 1O4UA 4UTIA 3G1DA 4XIMA 2X42A 5A8QA 1JAKA 1E1EA 4GY1A 1WKDA 1P6WA 3C61A 1XPYA 4JNYA 4IL2A 4JEQA 3WLNA 3B4YA 5C9ZA 4XD4A 3MPGA 1CYGA 3NNTA 4AD1A 3HQ1A 1W1YA 4Q4SA 1NWUA 3MMUA 3QPYA 3S83A 3ARQA 3TW9A 2ISDA 1E9LA 1WV2A 4KWUA 3NQ7A 3B04A 4NZFA 1WKYA 1KM0A 3CUIA 1TJRA 1K9FA 3VI2A 2Q71A 4UMCA 4WUIA 2GSEA 3VD3A 2C16A 3ZJ6A 3DHFA 4FSAA 5RUBA 3B9EA 4MAVA 4RZ6A 4I8YA 3M43A 4UTLA 1GT8A 2ZRYA 1XIDA 3DBNA 5KINA 2C14A 2JF6A 1DWJM 4J35A 3HIJA 3DFYA 2TYSA 5J5RA 5JH2A 2E8ZA 2Q8LA 3NO1A 1A49A 3V35A 2VO5A 2E68A 2YB1A 3GYCA 3DUGA 5IFTA 2FJKA 4ZGYA 1HJUA 3S8HA 2WZEA 5DBTA 3IV3A 4D8ZA 4C7FA 4DJEC 3LEPA 4R88A 4F2BA 4GX8A 4LANA 1R85A 1AH0A 2CLLA 1UR4A 2R9RA 1KBJA 3LHTA 4H2HA 4KFNA 8RUCA 2YYUA 1WDPA 3VABA 3NVTA 3URAA 4GACA 4W7WA 2AQWA 2J7BA 1HKJA 3A9BA 2O0TA 4I7UA 4XQ6A 3EPMA 1YX1A 2DDXA 2FTWA 3TC7A 2E25A 1V3JA 2F9RA 3ANUA 5EA9A 1RY0A 4ZA0A 1EO7A 1K8ZA 1KTCA 3M4HA 3N2BA 4EK7A 3GNNA 3WLLA 4F48A 3SIMA 1UHVA 2QGYA 4H7ZA 4LV4A 4RE2A 4GI4A 5A6JA 5CAHA 3YPIA 2XISA 4XVEA 5MKGA 1H2JA 1W3HA 1M5WA 2H3DA 3I65A 2DW6A 3GNRA 3MI2A 1UJQA 2FZNA 3PULA 1OF6A 3PBWA 3ZJ7A 2EEXA 2NQZA 2PURA 3KAOA 3AFBA 1JRBA 4FP1A 1AJ2A 3QTPA 4M80A 2V68A 1W8SA 3ES8A 3SQMA 5HAOA 3CLMA 2XTKA 2PWFA 3NQEA 1H41A 4PMQA 1GJWA 4Q8NA 3TJIA 5CC7A 1VLIA 4WVXA 1E9IA 4D8LA 1KFBA 2DZSA 2YIHA 1KWGA 3LI1A 3S3GA 1DJGA 2DT1A 1GVOA 4NQ1A 1QUMA 4GY0A 4JIRA 1NY1A 1KRAC 1E0WA 2D2OA 3WSUA 4FXRA 1JUEA 3PBYA 3W29A 1UWAA 2XN1A 1KLYA 2EJAA 4C1LA 1RBOB 1D3CA 4KBXA 3ZLHA 5BZAA 2VFDA 1KFWA 1E6XM 1MW2A 4RXGA 2Z2BA 1ZFJA 3BSMA 4ACZA 3MMDA 3EOOA 3M0ZA 1J79A 3E74A 4K2SA 3ARRA 5F4XA 4P8XA 5IRPA 4TMCA 1O6IA 4RDWA 2IXVA 2NQHA 4LV9A 4OU1A 3DYPA 3DFPA 4I3GA 3S2JA 4AC7C 3VDCA 1KD0A 4DB7A 2GK1A 3AMLA 4KEZA 1QT1A 2Z25A 1P48A 1HVQA 2Y7DA 4BF7A 4M7TA 3RM9A 3LV5A 1J9YA 2ZX5A 4NAEA 3STPA 4JR5A 3AC0A 2X1IA 3BICA 4OHQA 4B3KA 1A50A 1B54A 3HPXA 2YSWA 1CGXA 2Z28A 1KA9F 2XN2A 4NIRA 1F07A 4CUCA 3TXZA 4B91A 1S5NA 4RPPA 3UETA 1WXZA 1DWIM 4PSRA 4QCFA 4FX7A 1T6MA 1C91A 1J96A 3L9CA 4C7GA 3UR7A 2CITA 1FUYA 2EQDA 2ZRWA 5E1QA 3CM4A 4G1KA 1DJYA 1W8GA 4WOZA 1GK8A 3AHXA 5HWMA 1G67A 1RV8A 4O17A 4KWVA 3UU0A 4ZL1A 1TMHA 1B3WA 1QHZA 1DHPA 1QAPA 3H26A 2B4GA 2TSYA 3W9ZA 2DZUA 1HO4A 1AW5A 5D30A 3PC0A 1ONEA 4PC8A 3D3FA 4M8UA 1UMYA 3F5KA 2Q09A 4NI3A 3ID7A 1BLIA 3PZNA 4KESA 1J10A 1LCOA 2BDQA 3M41A 3S1GA 1M7XA 2XVGA 3AXHA 4G6CA 2BY2A 4I90A 1OT1A 2NT1A 2VEIA 4PODA 4GZEA 5M3WA 3T9PA 4GXWA 2R24A 2GL5A 2DH3A 3I4EA 4UTUA 1OABA 4JDBA 2ZFAA 3LTYA 2CETA 1XFBA 3W2KA 1XLEA 5DT5A 3SO7A 5FL1A 3SY5A 4U10A 1E4LA 2PP0A 5K2ZA 4M24A 1E5JA 1V6TA 2XIBA 3EWUA 2NWSA 2QYGA 4N7QA 3KTSA 4LEQA 1ZJAA 1ZHAA 4EWND 4W4QA 2BXZA 3RHGA 3BH4A 5FI8A 1XKJA 1F2JA 1XCXA 3C0LA 3MUZ1 5HMSA 2VGBA 3W37A 1TX2A 3P74A 1ONRA 2QV4A 4GG9A 3BAXA 3UY7A 5C9UA 4JN8A 5D03A 1DJIA 1LWJA 4UTJA 1Q63A 2B0MA 2Y61A 4Q8TA 1AD1A 3VGHA 2D73A 3CMFA 2ODOA 4EP8C 3ZVHA 1KR1A 3MW7A 4GJ1A 3TWAA 1GQJA 1OWQA 2HJPA 4IISA 2G3JA 3E5PA 2R6OA 1GYNA 1GW1A 4HT3A 2QW5A 3WF1A 1QK0A 4D2JA 4G7EA 2DQWA 2E0PA 3CIWA 4V1XA 1DJHA 3SN1A 1GQKA 4BI5A 3IGSA 4GVIA 1SR0A 4XKYB 4IIBA 4US6A 4A8IA 3VCCA 2CYGA 2YKKA 4C5YA 2Y8UA 4K68A 2YDQA 2WVTA 2OSXA 2VYOA 4LAOA 3BMXA 4QLLA 1A5OC 1CGVA 1TPFA 1PX3A 4BI6A 2PRHA 3ATYA 2W0UA 4OECA 3F2CA 4DWSD 3WBAA 6XIAA 1Q6QA 1I1WA 1GOQA 4F2UA 1A53A 3O06A 1Y65A 1XIEA 3AIRA 2KAUC 1MO0A 3URBA 5AHNA 2GJXA 3LHVA 5K4ZA 2VL4A 2QJGA 4YCPA 3SCSA 4AH7A 4LCRA 4XAYA 1H60A 1YNYA 3D5HA 2JKPA 3UXIA 2DT2A 2W91A 3UXAA 4M6UA 4O1CA 2ZA3A 2VQTA 1G7VA 1IEVA 3V5FA 4E38A 1VPXA 1GW9A 3NXFA 3S1UA 2Q8XA 3MYOA 2P1FA 1BHGA 1QO5A 4IXHA 5ENLA 4A3HA 4W7UA 2WNWA 1XLGA 4YLWA 4EKJA 5HOSA 4H41A 3M7SA 4XV0A 3BLFA 1XH2A 4CVUA 1ZBVA 4E2BA 3RU6A 3LZ3A 2FVMA 1XGZA 3H7RA 3HM7A 1Q6DA 2DSVA 3W7MA 3ABQA 3QYQA 3EX2A 4GNVA 5I77A 3U3HA 2DT0A 1AFSA 1GONA 1OEPA 1UKQA 1G7UA 4N42A 2CBVA 4L6OA 4XZWA 4E6MA 4H00A 3KTXA 5BCAA 4WHBA 4LOCA 3MA8A 2NZLA 2WKJA 2CZVA 2Z2AA 1X1ZA 3KCLA 1S5TA 3PZGA 2A0NA 3S6TA 1QNSA 3G2GA 4D8AA 4QE5A 4O54A 2ESCA 1S2WA 4HU4A 3BW2A 1KXTA 4LRSA 2CERA 2J75A 2WVVA 3W02A 2Z7KA 3W1AA 2INZA 4QEHA 1K8CA 3W1PA 2VZOA 3THCA 2FPVA 2I57A 1P0BA 2CLMA 5FEZA 4A2SA 5ABFB 1X7FA 3HPZA 4PMZA 1OZQA 4KRUA 1OCJA 1KM2A 3EX1A 3R4IA 2WNZA 5HR6A 1QASA 1DIKA 3AYRA 3WH9A 1JFHA 3C8FA 5D33A 3VOGA 1U1UA 3GIPA 4PFHA 1W3LA 3I3BA 3BO9A 1B3OA 4O4WA 1ZBCA 3AIWA 2QKFA 4CQDA 1DBTA 3LXAA 3K8LA 3PB2A 1LL4A 4R33A 2V82A 2YR1A 5FAGA 4UQBA 2DH2A 1QMLA 2BB0A 4Y90A 5LXXA 1F6PA 2CU0A 2PDXA 3IGHX 2Q8ZA 4V1YA 2X05A 1MQRA 4JHZA 4P7QA 5H6HA 1MQPA 4XZBA 1QU4A 4DLMA 1I2RA 1DJWA 4AF0A 3PZOA 1WXJA 1XYAA 2G95A 3SJNA 2QCEA 4AVOA 4CEUC 4H7CA 3KBMA 3M5ZA 4WZHA 1N8FA 2GK1B 2HS8A 2ZADA 3CQJA 2JE8A 1TFVA 2VFGA 5HMEA 5ABGA 1RR2A 4IGHA 3TEVA 4K7VA 5KEZA 4DBSA 9XIAA 2AAMA 2P50A 3CO8A 1HQTA 4C6OA 1QPRA 2X7WA 1ZCCA 4I9TA 1TVLA 1GQNA 2C6QA 1U83A 4OZOA 4I7WA 1QOPA 2VMFA 3M0JA 4DZAA 1A3XA 3FEMA 4AZGA 3QN3A 3W7IA 7REQA 3FA4A 1XWYA 3GXTA 4GLEA 3C2OA 2WCSA 1Y7VA 3RCYA 3HBLA 4GO9A 3TXVA 1GVEA 5DRIA 4B9ZA 1VFUA 4F2TA 1VRXA 3HGOA 3F7JA 1OK4A 1XF0A 6PTDA 1ZUAX 2VRKA 1O7AA 5JU6A 3B03A 3AS1A 2HEJA 4XD5A 4QRNA 1AJZA 4WJXA 2V3FA 1V3MA 3CLWA 3LRMA 5HPCA 1X6LA 4K37A 4ERIA 3UF9A 1SMDA 4KEUA 3SCUA 3V7PA 5A2BA 4CEXC 2E7FA 3W7QA 1IZCA 4D71A 1RSCA 3DBPA 4O57A 5B7YA 1E4MM 2E28A 1HKVA 1MDRA 1TR9A 4G8TA 4IX2A 3N2CA 3V1HA 1WB0A 1XBXA 2FHBA 4MY1A 1P7TA 4LT9A 2Y5SA 1AK5A 3UGRA 1WDQA 1VFHA 4YYCA 2W5FA 2ZZ1A 1LLWA 3NXLA 2RAGA 2WPGA 3INPA 1OT2A 1XDLA 3PTMA 1TCDA 3MMWA 1A0EA 2ZE0A 2HE5A 1LG1A 5HDRA 1REQA 4V33A 1V6XA 2DSZA 1HT6A 3I6EA 3TU9A 4CCEA 1GTEA 4UNIA 4XZIA 4AMCA 5EMUA 2OQLA 1QJWA 4GIRA 3UZWA 3BJSA 1L2QA 2WMFA 2VI0A 3FKRA 2F2HA 3CYJA 1S1RA 3SN0A 1UQYA 1EC8A 3EXSA 4B5SA 3PZVA 3VNDA 2WQPA 3LOTA 2ZXQA 4E3TA 4FLRA 2IPFA 2HBVA 3E2VA 5CGMA 4L4PA 5HNTA 1J5TA 3M0IA 4H04A 4WY0F 1QW7A 2EPMX 1OGGA 2POTA 3SQSA 1CLXA 3CNYA 2J9XA 2BGQA 4RNHA 2F6KA 1H1NA 4Z2IA 4AD0A 3E96A 1BKHA 2MUCA 1IHIA 2A1YA 2QVNA 3E0VA 3MSYA 2ZX8A 4PRWA 1LUCA 3N19B 1S2UA 2PPGA 1R2SA 4RKAA 4MLRA 2VDIA 4LBSA 4L80A 4UTHA 4GUJA 1M7PA 4L4MA 4C6JA 1S1PA 3I4KA 3VZXA 1TCMA 1SZFA 3CUGA 3IUDA 2PDBA 3WG6A 3EWDA 3ARYA 1E1CB 2QCDB 1H5YA 2ONEA 4TO8A 3KTCA 3RMJA 4MGGA 4KETA 2J25A 4C5ZA 2GQ3A 3CZKA 5DMMA 1EWDA 1YXYA 3SRFA 3F4WA 1JZ2A 5F7UA 2FHFA 4NF7A 5HULA 5EY5A 1Z48A 5LIKX 2J77A 3N34A 4AIEA 5DEZA 3L4TA 4M51A 1J8VA 3D47A 2XYLA 5LHFA 3LCIA 2Y63A 3F4DA 3MUXA 2IQDA 3OLEA 2Z6IA 5LNRA 2PU1A 3BLIA 1O60A 3P61A 3QPZA 4LVDA 4QS6A 1TPDA 3HJEA 4AX7A 1TWSA 3EXRA 3RX2A 3GU1A 2A3HA 1E72M 3GTIA 4I6VA 2FKPA 1SW7A 5HWJA 1WA3A 4S3CA 4MB5A 4ZOBA 1ZALA 1B57A 3IJ9A 3SQLA 3VYLA 4IPJA 4IP4A 3LYEA 4WGXA 1XCWA 3JR2A 2OU4A 2QPSA 1PX8A 4R7OA 1UP2A 2WHKA 8XIAA 5BMWA 1ITCA 3TVAA 3H6OA 1QCWA 4RE0A 1AZ1A 4M0XA 2NVAA 2C8NA 3AXIA 1FH9A 2NXHA 4CD5A 4DJDD 2BFGA 1SR9A 5TAOA 2BLEA 4NZ3A 1I4NA 4R5EA 6ENLA 1MI3A 3FHAA 3WBXA 4FALA 3NAVA 2RFGA 4HQVA 1XGDA 1G69A 2NUYA 2XPKA 4B4HA 3DZ1A 5C8BB 1F05A 2BG5A 1EC7A 1HL9A 1BWLA 4F0LA 2XZ9A 4MKNA 4A8RA 3LUTA 3GB6A 3VKBA 4RPQA 5AFDA 4O0KA 4M82A 2P0OA 4FF5A 3W81A 5AC7A 3EOUA 2ZZ6A 4JOMA 3EOLA 2FTPA 1GZGA 1NDWA 1LORA 2IPJA 3IVUA 3N17A 3LXCA 1XLHA 1TZ7A 4GBUA 2R91A 2P76A 4OVXA 4OUIA 3WK0A 4B3ZA 2BHYA 2BVYA 3GY1A 4U5KA 5BOEA 5JQ9A 4ICMA 3EGJA 4IPPA 4Q7NA 3CO4A 3WH8A 1GWJA 2CNCA 4BHYA 4C1NB 2X30A 4NYYA 3WF0A 2ZUUA 4S3FA 1VFSA 4PUMA 4WDXA 3KX6A 1V02E 3UXLA 4AD3A 4GVHA 2CWNA 3NIYA 1DKWA 1DJQA 1LDCA 2YOCA 3HB9A 5I02A 5E9AA 4B3LA 2XJ7A 1OFPA 4PUUA 3MC5A 2E6YA 4FX6M 5D09A 2JFEX 4MNMA 3L66A 3DXIA 1V77A 5I23A 4FB7A 4KWSA 1CBGA 4D6IA 4J9JA 2FGBA 4NILA 4UC5A 5D9PA 2OG9A 4IUGA 1FWJC 1XXXA 4DJEA 3TP4A 4LFYA 3HG2A 1ZGDA 4LY4A 2VEMA 1I0BA 1PIFA 3W71A 1E6ZA 4M7SA 4NZ1A 3PWAA 4UMBA 3HO8A 2IPWA 2G0WA 4RW5A 2E8YA 2DZVA 5L6UA 1G9HA 4K7YA 4JN6A 2A5HA 1EJTC 3IS4A 4Q4PA 3VDAA 3ARXA 3WLKX 4Y8FA 5C0QA 1E3XA 1IEQA 3P60A 1Q8AA 1U22A 3ZJKA 4CCDA 1W1PA 3DG3A 4R7WA 1GCYA 2WZHA 2RGMA 1XLAA 4RL3A 1IYXA 4HPJA 3CHFA 3PANA 4IT1A 4GA8A 4YYFA 2G3NA 1A5NC 4GUIA 2ZZ2A 3BK0A 1GOIA 1CGWA 1ZJIA 3VIMA 5BOFA 1VYSX 2PDUA 4GQRA 1O1ZA 1VCFA 3O0FA 1F3XA 1V3LA 5AHEA 3V18A 1H7RA 4QLJA 5FCZA 1VIWA 3ARUA 3N6HA 3RPTA 5DO8A 1EZWA 4ZR8A 2W3ZA 3BGGA 3OODA 1T41A 3ALFA 3N2OA 3MYPA 2YL6A 4MY9A 1JULA 2OVLA 1AA1B 4Z42C 2AAAA 1XIMA 3E1F1 4YTSA 4GNKB 4D6CA 3SUSA 1V6UA 4Q4RA 1FWSA 4DF0A 2ZRUA 3TYCA 3H4XA 1CXKA 1HKIA 5CPSA 3ABOA 3O3RA 2V5LA 4B92A 4NSBA 2JKEA 4HPNA 3WQ6A 1VHNA 3GC5A 2ISVA 1ZBKA 4PRRA 2PDCA 1ZP3A 1XG3A 3MUIA 4PMNA 3MBFA 3CWOX 1QFEA 2D0GA 4GGBA 4ACZB 3UT0A 4ADUA 4AY1A 3E0LA 3ICJA 3RITA 3VOJA 4F40A 1W5MA 3JZUA 1GQLA 1KGWA 1Z69A 1OFDA 2PDYA 3BWWA 3EA3A 2GDUA 3OVGA 3THDA 2NT0A 2W61A 2A79A 2FB3A 2OX1A 3LCGA 3UPBA 1GEHA 3MU7A 3MKKA 3VIOA 2FYMA 1UUOA 2WHMA 3GTFA 3TN6A 5LSMA 2EPNA 1R3QA 4XKYA 3CAKA 4I9AA 1M03A 3SIZA 1D8CA 3WELA 2H8XA 4MLJA 5CBIA 1D7FA 3CZJA 2J74A 1RJRA 3P5ZA 3AYTA 3R0UA 2GVEA 1JPMA 3DX5A 3KZSA 2I5GA 4QISA 3BURA 5DMNA 3FK4A 3ZWSA 4AFYA 3H4GA 3L4VA 3GG7A 4GI9A 2OEKA 2ZA2A 1SZGA 3KCJA 2ZYFA 5E93A 3AU2A 3MSGA 3C0SA 1FWEC 4WSJA 1RVGA 2TPSA 3DENA 2Z29A 1MRQA 4TX8A 4MIMA 3IEBA 3BE7A 4DZIA 3ZT6A 4A6GA 1ELSA 1ZJHA 2PUZA 3VVGA 4XUYA 2Y8VA 4PEEA 4JN7A 4NT0A 4FX8A 1OZMA 1TPC1 3QSRA 2RJGA 1BTCA 4L9YA 3TC3A 1ZZMA 3BAWA 2P5NA 3WD0A 1GORA 4DUVA 1B0IA 2Y24A 2JEQA 3UR2A 1MNSA 2PCQA 4QDPA 1MEWA 3HTWA 2AGKA 4L9XA 3WQCA 3ITYA 4I5RA 2Z7GA 3DFSA 4UWMA 3MTWA 1E4IA 5I0DA 5FJIA 1BVNP 1XD1A 2Y7FA 3N14A 3H12A 4JFWA 1SO6A 4HVXA 2FFCA 2QIWA 4HMEA 3ELFA 1M01A 1YPFA 2GQAA 2GJNA 1ZBWA 1LUCB 4NJJA 4NUWA 4NAFA 1H61A 3NOYA 1E51A 2Q3RA 5H91A 1LRNA 3NQCA 4NVTA 3OU8A 4OBSA 2VX6A 3KEHA 5GJMA 2DJLA 1P0NA 2XH0A 3QZEA 3KZPA 3QGKC 4M5PA 3LPOA 3FJ6A 4QX4A 2J7CA 4U3CA 2G96A 3EDEA 3A4JA 3EA2A 4GNJA 4HPGA 1JXJA 1MSSA 3ZT5A 4LUJA 2DIEA 2CIPA 4CN6A 3S46A 4IIEA 4XKMA 2A85A 2PWGA 3U4AA 2W4XA 5LYRA 3W7JA 1VCVA 3VC6A 4DYEA 3WN6A 1PKLA 3ARPA 2X2GA 4D6FA 4GIAA 3EYPA 1NWRA 1S2CA 4HKPA 1RCXB 2WBGA 1R2RA 1N82A 4W86A 1TR1A 2DT3A 4JD4A 5KZ6A 3AXXA 1CPUA 1UWSA 3NL2A 2PDGA 3MANA 3GXFA 1J6PA 4LEFA 3GZ3A 4J1OA 4JTDA 3QMTA 3BXWA 3LX9A 3HMJG 3THQA 3UP8A 3TAKA 3VNMA 4O19A 4XTIA 3IRSA 4CNOA 1W32A 1UC4A 1W1TA 5E0KA 2PBOA 2ISWA 3N9KA 5FJRA 3U0HA 2IW0A 3S1VA 1KXVA 1T8XA 2OODA 1JCJA 3PPFA 2F6UA 4MJ4A 5AYIA 3TMLA 1WOAA 3G3DA 4QGCA 3ABRA 2R1LA 4L56A 2A7PA 1VZWA 1ZAIA 3T78A 3KBWA 1P5BA 3W27A 1MZHA 4LX4A 3B05A 5G4HC 1HF6A 3PJXA 1DJNA 4NJHA 3L5MA 3DFHA 4KCUA 1M68A 3QV7A 3UEQA 2R14A 3W7HA 3BAYA 2OPJA 1QTWA 1W1IE 2Y7EA 2QGHA 3OVRA 4N9EA 3COTA 1F3WA 1FWFC 4L1XA 1PPIA 4PCTA 1KBKA 3GVRA 4FNTA 1H0GA 4JTHA 3QY6A 4WKAA 3GIQA 3LXBA 3MCMA 3RLHA 3WF3A 5A6LA 2VFHA 2DW7A 4B90A 4DN1A 5A94A 1OC7A 3N12A 1DQXA 1V8EA 3GU2A 2QCFA 3TN3A 1OX5A 4ZO9A 3H2EA 4IH3A 2C15A 1P6BA 5AVHA 7ENLA 1OB0A 3T0AA 4R7JA 2HPIA 5K7JA 1EC9A 5M2FX 2D0FA 2OX4A 1QHPA 1NDYA 3FYOA 2DSUA 1FWGC 1JIBA 1GNXA 3I3DA 3GAKA 2GVGA 2PI6A 1HGWA 5D04C 3UWYA 2OZ8A 3CZLA 4KT2A 3AUJA 3QLDA 5CJNA 4Z2GA 1O95A 2VD8A 3JRKA 3CPGA 1EUAA 1XLMA 2QCHA 3TZFA 1BGAA 2Z4GA 4NZ5A 2XU2A 1MRAA 2PDQA 3WJZA 1HUVA 4H4IA 4LVFA 3A21A 4C1NA 3CAQA 4ORIA 4MJZA 1BSIA 2R8WA 2OQHA 4FHAA 3WX7A 3MWCA 4MMWA 3A13A 2W92A 2BXYA 1VBRA 2WVSA 5KSWA 4TTGA 3CC1A 2ZX6A 1XDJA 3CV1A 2E40A 3VC5A 1LOSA 4MWAC 3NUKA 3WQOA 2FDMA 2G3IA 1UD4A 1EPVA 4J3XA 3W53A 3GW3A 4Q8UA 3IAQA 4HBKA 1Z42A 4XWUA 3E02A 3VKAA 2XINA 1W1VA 3EPOA 3PBMA 4CNUA 2VZUA 3ERPA 5HANA 4MY8A 1UOKA 3SSJA 1T99A 3PPCA 5J04A 1TPEA 2UY3A 3NEHA 3VX0A 2RUSA 1HKMA 4X0VA 1IWAA 2R1MA 4AMAA 1F74A 4XZLX 2DV0A 5EFDA 1UASA 3TQ0A 1K7FA 4RZ4A 1XYCA 2VEGA 2FGZA 4XBKA 1CXEA 4A21A 4PCNA 4CQ8A 3AJ7A 4JNZA 4PULA 1E6PA 3IJIA 5A95A 1TTJA 4MKVA 4PE8A 2BOEX 4IMEA 1QXLA 4AZCA 3ZR5A 4PFMA 1NQ6A 1TZ9A 3BQ5A 1B4EA 5IXEA 2QCNA 4GWEA 1XPGA 4OE7A 3UWZA 5AC4A 3L5AA 4BQ5A 5AZ0A 4Q8OA 3E3HA 3SY1A 5DCDA 3BJFA 4AWUA 2PGEA 4CCZA 2V3EA 1R2TA 4IQLA 3NM3A 4PMYA 1Q7QA 1TRDA 4XIAA 3KVKA 3T07A 4BJHA 3LSBA 2OO6A 4CVWA 1J0KA 5FJUA 2GDVA 3URQA 4C60A 3WLJA 1Z44A 3UNDA 4QROA 5J5DA 3RFAA 4MFDA 3USZA 3K13A 4JL2A 4EACA 1TV7A 1AJ0A 3W01A 2WJDA 3I7RA 1DTUA 1OC6A 5EBUA 1ISZA 4OT7A 5AHIA 1FA2A 5LIXX 3DFQA 1T40A 3B4UA 2ICSA 1ME9A 4TX9A 4BWLC 3W26A 1YW1A 2X09A 1F6KA 3VCRA 1G5AA 1E9YB 3W22A 1SYTA 2QCMA 3UXKA 1LM1A 3KVLA 3BANA 2UY2A 3G0UA 3NQ8A 5CBJA 3KL0A 1I2NA 1OCNA 3VGEA 1A4LA 2IKIA 3LB0A 2XVLA 3W86A 1CTNA 3A4XA 3APTA 1XFCA 2INEA 1PWLA 5AHLA 3VMOA 3KBNA 1KBIA 3B8TA 3E2QA 3MZNA 3ARZA 1OD8A 1IZKA 5GNYA 4DIAA 3PWIA 1TJ2A 1IXNA 1H1YA 4GUGA 4AYSA 3AZTA 3VPLA 3F4NA 3WK1A 1FWDC 1KFEA 5HUOA 1KO0A 4AQLA 3V5OA 3B9OA 3CT7A 2QJMA 1P7TB 1ZP4A 3ZLFA 3CZGA 3ABXA 2HXTA 1BD0A 4O12A 3GTHA 2QJHA 1QI3A 2D2JA 2TMDA 5AYZA 1I8JA 5E5CA 3FW6A 2PDKA 1O12A 1VJIA 3GXIA 3LTPA 1EA9C 4IP7A 4ENLA 1O5RA 4S3AA 1SW3A 1ZAJA 5A6BA 5EBAA 4TXEA 4BF5A 2NV2A 4ZB2A 1JDAA 1FWTA 3TNBA 2QDDA 2ZA1A 1K4GA 4O1EA 3W7GA 1XKYA 4JFTA 4TV5A 1EJSC 3TOYA 1VBUA 4ZXOA 1NWSA 3G77A 3SUWA 5F2MA 3B0XA 4BY3A 2WSYA 5CG0A 3GXNA 2X2YA 2CLPA 3HA1A 2Y89A 4QDWA 1XQLA 3DKJA 3KS5A 3WFZA 4GYPA 1WDSA 5CSYA 2RDXA 1M7OA 1Z9AA 3V0SA 4J2MA 2PWHA 1KR0A 1DXIA 3F2DA 3WQDA 3UVAA 3T2QA 3LPPA 2YXOA 3OQEA 1UBPC 3WNOA 3EOEA 1SFJA 4H3DA 4OOZA 1P4CA 3WLHA 5CC6A 2WLYA 3EOSA 4FK9A 4LS2A 2C0AA 1B2YA 2VC7A 1KNWA 2BBFA 2Z00A 3UVIA 3LG3A 1P1MA 1A3HA 3IIXA 4G7EB 5JVLA 1W5QA 2XVPA 5C55A 1J2WA 2VM8A 3O6CA 2P53A 2OLAA 4L61A 4DUWA 4Z1CA 2C1HA 1XLDA 5LNUA 2XUCA 3PZUA 1FWWA 3OPSA 1EP2A 2WMHA 1FDZA 2HCVA 3WD2A 5A8MA 3CTLA 2PDJA 1E6SM 4QQ3A 2WBKA 2QMKA 1Q66A 4QE1A 3G0XA 2GLKA 3C4UA 4J27A 1E4NA 4LYPA 1CW2A 3O6YX 5KZDA 3VE7A 4HU3A 4WY0B 1EGMA 3GFYA 3WJXA 1XH1A 5E70A 3WH6A 4J3SA 2BSLA 2NLYA 2YLAA 5EYWA 4K8EA 1OSEA 1VKFA 1P0KA 3C2YA 3QH2A 2E77A 1JFXA 4WXYA 2Z26A 4HYWA 3R5EA 1FHLA 4JPGA 3NCOA 3AS0A 3BGAA 4KFPA 3JS3A 3WLIA 1U5JA 5C9RA 1W54A 5I07A 3IIZA 3GTXA 2WNNA 2UY5A 2Z24A 2J66A 3VD4A 2NVDA 3MVIA 4NNAA 1F3TA 1RP8A 2WXDM 2EO7A 3FA3A 3OA5A 1H1ZA 3PR2A 3I6TA 3V1PA 1JDCA 1VFOA 4FNQA 3AXKA 4GFSA 4LS0A 2PAJA 1QNPA 2XVNA 4MWAE 2CLOA 1PB0A 1X1NA 2D23A 4CQBA 2Y4SA 3FVMA 8A3HA 4UQCA 1TIMA 4X2PA 5FJPA 1M53A 2O92A 3T0DA 1R3YA 2I14A 3SR7A 4INFA 4D1IA 5IBXA 4BQ2A 4QS5A 3W7CA 3G3MA 2ASHA 2VVSA 1KGUA 4DO6A 1TZZA 3G5EA 5XIMA 4FOUA 4EWJA 3PG9A 3KM8A 3HURA 1FBAA 2YZ5A 3H7UA 1EA0A 2AMGA 3P93A 4BQ3A 4DWSB 1Z6KA 3UPMA 3W1NA 3MSDA 5U7SA 1OGBA 1VFFA 1O5QA 1CB7B 2YBUA 2FZBA 3GFZA 4KCVA 3GDMA 4K6AA 3CHCA 4GK8A 3VKJA 4WOQA 5TNVA 1F61A 4DZ5A 2QJJA 3DU0A 5DMLA 1OYCA 4LUSB 5CXPA 5C2GA 5HXMA 4DEFA 4HSNA 4K8HA 1CENA 2PP1A 3DKLA 1TE1A 4DWSC 2Z1SA 2WAGA 3ZSTA 4YTQA 1J5SA 4QNWA 4S3KA 1H7OA 1CGTA 1J11A 4R3UA 1K03A 4QSHA 3QV9A 2RDUA 3GVVA 4Q6JA 3AISA 5BXTA 2WVUA 4W5UA 3TYBA 3W1RA 5I06A 5DN1A 3N25A 4RCXA 1Z89A 4W84A 5D4YA 5LIYX 2XFYA 1EJ7L 3N1AA 3TNOA 2D69A 3P8JA 3N2XA 3UG8A 3AUOA 1ME7A 4QAWA 2RGLA 5CJ5A 3VD9A 3TCEA 4XX6A 3PBGA 5CC5A 1XIGA 2VGGA 1M41A 3AMCA 1VBHA 3TIMA 1Q7ZA 3UERA 4YU1A 3VNIA 5BNKA 1ISWA 4I8DA 5M1TA 1IXPA 4GD0A 1EF3A 3CAWA 4E8GA 2A21A 4YMZA 4DF1A 3A64A 5K9XA 4JCMA 3ZO9A 4IGMA 4JX6A 3QW4B 1DOSA 2VUNA 1KCKA 3ALGA 1A5CA 4DYJA 1PTAA 3SURA 3A9IA 3E2SA 5FEXA 3V36A 2QCCA 1HGYA 1TJ0A 4Q6XA 3PNUA 2IMRA 1ISXA 3EWWA 4U28A 4O52A 3CMGA 5KMYA 4N2YA 4A8NA 3N3MA 3OHIA 2VUYA 3DFOA 5TF0A 3S9YA 2FLIA 1W9UA 2DUAA 5IBXC 1UKPA 2PRMA 3PK7A 1J0HA 4Q8WA 2AKMA 2NSXA 4RNJA 4LUIA 1QPKA 4E0CA 4LVBA 1HIZA 5JUVA 1VYRA 3WQPA 3HV9A 3VU2A 1DVJA 3BZGA 4UMAA 3SRKA 4HJWA 4FMVA 2WK2A 2VR2A 1C3FA 2E6DA 4ZE4A 4ZTYA 3IIOA 2JKAA 2GJLA 5D32A 3BOFA 3W0KA 2WJFA 4UFJA 1WXYA 3W00A 3WUGA 3GDKA 1AH4A 1PKYA 1XRFA 4DHGA 2G4FA 4JCLA 1SJCA 4ICCX 4OIFA 1XLIA 4R85A 1JCLA 3ITTA 1A47A 1VLWA 1M1BA 2PDNA 4MB1A 2PDPA 4KCTA 3QFWA 1PYFA 3EMCA 5AC6A 5GNZA 2FIQA 4OBRA 1EHAA 3TTQA 2Y85A 3KRUA 3L0NA 1OVDA 3EKZA 2Z1KA 3H24A 1JGMA 1R8LA 4H2CA 1IXQA 3DEQA 3WQ5A 3OIXA 4CNNA 1L6GA 5CPLA 1VB9A 1PHWA 3WLPA 1EX1A 3W1XA 3PJTA 4YJ5A 1BYCA 3JUGA 1E0TA 4RNFA 1PVNA 3MKCA 2FJUB 5T8GA 3MI3A 4IIGA 4RDYA 1PX4A 2D1ZA 3GUGA 3E0WA 4JQ2A 2PWEA 1NJJA 2PDLA 2OLSA 1BQGA 4KGJA 4E4FA 3H23A 1AL7A 1KFJA 4RV3A 1S38A 7A3HA 2BVDA 2W62A 2PC8A 4Q4KA 3QZ6A 2AL2B 1US0A 2GUBA 3QGVA 3F03K 2WSRA 1WDDA 2P88A 4C6EA 1GKPA 1XD0A 2WC3A 1TUFA 2J24A 4LAUA 3PG8A 1TJPA 4ZODA 5TD4A 2OZ3A 4IFKA 2YCKX 2E3ZA 1TX0A 5CCZA 3GH7A 4IF2A 5U4NA 2HMCA 4PMDA 1HFBA 1J0JA 3M5XA 5I3FA 4HHMA 4AZHA 3A22A 1UZDA 5JXQA 3NPVA 2CZFA 1NEYA 3ARVA 1GVYA 2YZRA 3ONBA 2OTDA 3AIVA 3OGRA 3T7VA 4CLMA 2OT1A 3NZGA 4HK6A 2Z1BA 1FOBA 5HMDA 3FAWA 4G5DA 2IQTA 3JW7A 3NQGA 2EBNA 3N18A 3WQ8A 5CQ1A 1NP2A 3KOYA 4DXVA 4KF1A 4GE8A 1DXEA 3CV2A 2BZNA 3UZYA 3PP7A 4IQEA 1PS9A 3E5BA 3M07A 1E9ZB 4L6DA 2DPEA 1OCQA 1EQCA 3NGFA 3NG3A 1EGVA 2HS6A 3GAYA 5FJTA 1W9XA 5DANA 3M5YA 5HQLA 5C9WA 1E40A 1THFD 3UJEA 4NJKA 2KZHA 1O66A 2P10A 3C8NA 4AWSA 4W87A 2PLJA 3CGTA 1YTKA 3L0KA 4MHBA 3O16A 4Y6GA 4UTTA 1N7KA 2J9ZA 1TV4A 2BNJA 1L8NA 4DBWA 1QNVA 3LENA 3LCLA 3AI0A 3QMSA 3RO8A 1M65A 3W28A 3CIXA 4UIOA 4URIA 3BTNA 2QJIA 4XZHA 3FKKA 1EJRC 2C1GA 2O4QA 1PYMA 3GG8A 4PB5A 4ML4A 2C91A 4ROQA 2C0HA 1BRLB 1TV3A 4DJFC 1EJWC 1OGSA 5CZ0A 2QZRA 1R86A 2DSKA 3KE0A 3NL6A 4XB3A 1TVPA 2JGQA 5FKYA 3E12A 4MF4A 1QR7A 4RX0A 1JF5A 5AECA 3QLLA 4JFVA 1UZ1A 1NDZA 1EX5A 1Q85A 3IK4A 3HZ3A 5A8PA 3HPAA 4MTVA 3KCOA 4Y9NA 4Y2WA 3SBFA 5HINA 2ZX9A 1IT0A 2AL1A 1A80A 3S42A 3PBVA 3S4TA 3GVWA 3FV9A 4Z0JA 1MW0A 4LNCA 5IOBA 3TA9A 4IMAA 1HP4A 4LY8A 1NH6A 8TIMA 1XC6A 1JUBA 1QRQA 4UNLA 3KP1A 1KM1A 4O10A 2WMIB 1OQFA 3QOKA 4DXKA 5ABEA 4KIRA 5DXXA 4Y9OA 5CLWA 1VIZA 4P7RA 4MZYA 4JHMA 4XSMA 1RALA 3DYOA 4FXFA 4CN1A 3HGSA 1CZ1A 4OGZA 2XM2A 1E5NA 1DL3A 1LOLA 5G1MA 3RK8A 4L4OA 4AB4A 2QR6A 4L64A 2V5BA 4B5WA 3WK3A 3VKDA 3UJRA 3S2LA 4IMCA 2X0HA 2ZVRA 3PJUA 2V0TA 5C7HA 1ZL1A 3OLDA 1U1JA 3UZJA 4H9UA 4TMBA 3WUFA 5C70A 3GU9A 2ABBA 4IPNB 4QG6A 1BTMA 1Z32X 1E3ZA 1LZOA 4JY9A 2Y62A 3SUUA 3LMYA 3UJFA 3HGRA 1XC4A 1W31A 2PD5A 4QBXA 2OKOA 2ZDRA 3ARTA 3T4WA 4LAMA 2D2GA 1VP5A 4MUPA 4PTWA 2NQ5A 3Q58A 2WKGA 4DO5A 4CQCA 3R43A 1TV5A 3UQNA 4MWAD 3CASA 3A3HA 3WQVA 3U6WA 3MDUA 4IG2B 5T9CE 2X1UA 1XLKA 5G4WA 1N55A 4ZSTA 1QPNA 1I6NA 3SCRA 4UUIA 1LQ0A 1EKOA 2YBVA 3V0TA 1US3A 1QK2A 1A5LC 3RN6A 3TYDA 3W76A 4WDTA 1XH0A 1YNPA 3UJ2A 2V5JA 3G6LA 3HF3A 4P2VA 3B9AA 5LHEA 5BOOA 2ZC8A 1QBBA 1Q65A 1DWHM 4PR4A 1GTHA 1SMAA 4MWAA 1E43A 3BPWA 3UJSA 3W07A 4C6FA 3CH9A 3K4WA 3OOQA 1TQJA 1AG1O 1UMLA 4FLQA 4HK7A 2HQAA 4P8WA 3P2VA 3EB3A 1ENUA 4AX6A 2PEVA 5LGZA 3W7NA 3R25A 1CCWB 5K3VA 4FNSA 4QJ1A 1B3YA 3P62A 2ANUA 3PVFA 4CKQA 4A3YA 3PZMA 1Q3NA 3KFTA 4WF7A 4K36A 3BMVA 3W24A 1Z41A 5DFAA 3WY1A 1LOQA 1P6CA 3U5YA 3KLLA 1YDOA 1FXPA 2ZUMA 5MKGB 4F0SA 4MUZA 1EEPA 1BQCA 2PDMA 1OCBA 1UWUA 4UFKA 5AYXA 4QEEA 5EMLA 1H7NA 1GUVA 1E55A 1OK6A 4IMDA 3MB9A 4QIUA 3TJLA 1AMKA 3NURA 4MPQA 5HQMA 4GZIA 5D2YA 3W3OA 4J40A 5LA2A 4HYRA 3BG9A 3TYZA 3CS2A 4ZQOA 3AYVA 1S5VA 3VNJA 3TA6A 3OBAA 5BXSA 4UOQA 2Y0FA 3MHUA 3W7KA 2J8GA 2HVOA 2NX3A 1XRVA 1RZMA 3P0XA 3AXMA 3SW6A 2BY1A 2OELA 2E9LA 4AU0A 1UUQA 2JBMA 1J0YA 1K6AA 1QOQA 1SO5A 1B9BA 3NO3A 3A5FA 2PWUA 1XR2A 3KRZA 2X40A 2E4TA 1L2UA 1IT7A 2Y5JA 4U3AA 2MNRA 3TQVA 4Q8VA 1L6FA 4PA8A 3L0GA 3VZYA 4B2DA 3AOFA 3HJZA 1X97A 1L8PA 4R27A 2VCCA 1EP3A 5G2WA 4W9TA 3WO8A 4M6VA 3S5ZA 4GOAA 3OG2A 4D6HA 1JG9A 5H8MA 4IUOA 3TYUA 2IUZA 4AG0A 1K70A 3WQ4A 5D9OA 1KRMA 2HVMA 3CUFA 3LGGA 1E15A 1BXNA 3TW7A 4TV6A 5G4EA 3TQPA 4TX6A 3LRKA 3KL3A 1BVZA 3A4AA 1H62A 1BWKA 1P1XA 1UBSA 4HN4A 5AC5A 2GGJA 4BCEA 3BCJA 1VEPA 1BG4A 1I60A 5FOOA 1RPKA 5BMXA 3FYYA 4HNOA 3B0UX 3WLQA 4HPXA 2ZX7A 1JPKA 1T8QA 1H7PA 3QC0A 2BHZA 3VNLA 2O7QA 3GIYA 3PHAA 4HHPA 5D2XA 4CD7A 3IANA 5FJOA 3S2CA 3RJXA 3VTRA 1CB2A 1LQ2A 2BODX 4L65A 3POCA 2OJPA 3QXBA 5IDIA 3MI6A 4ZENA 1FCUA 2H6RA 3NEVA 2VENA 4GYJA 2WB5A 1J0IA 3EEZA 3REQB 1FWAC 4H9XA 3PFMA 4V27A 3P0WA 1A5MC 1ONWA 4EF8A 1V0KA 3FEQA 1UWIA 1ICQA 5FACA 3BW4A 3Q4DA 2XG9A 3UW6A 1O1HA 1DQWA 2DZPA 3T0TA 4X2RA 3W7PA 4HA1A 1OFOA 4NZ4A 2BY3A 3D46A 2CLKA 3WJYA 1PTGA 3ITLA 2GSJA 3KXQA 4HNCA 3T2PA 1G94A