1JG4A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosylmethionine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords protein-L-isoaspartate O-methyltransferase
total genus 71
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg4A00
2ZZMA 2WA2A 3HA5A 2PGXA 2EJUA 3I5UA 3A7DA 3UA4A 1I1NA 1KHHA 3DMFA 4CWAA 3AY0A 3NVKI 3DXXA 1AQIA 2AOTA 5DWQA 3SR4A 2G1PA 1G8SA 2ZULA 4NECA 3P2IA 2ZSUA 5E8JA 2UYHA 1JQEA 3B5IA 1NW3A 4LECA 3LDUA 4EQZA 3ER8A 4KDCA 4RTLA 4BP3A 5DRYA 4DA4A 5FULA 5GOZA 3TMAA 1MHTA 3FUVA 5DRTA 2OB1A 5GM1A 4C07A 2ESRA 1RJDA 2IDJA 3T7RA 2OKCA 3HVIA 3O4FA 1SKMA 5C9ZA 5P8WA 3V97A 1HNNA 2PSSA 3KKZA 3LCUA 4RVGA 3BT7A 2CKDA 2IIPA 3FTCA 5FWDA 1EJ0A 1RI2A 1NKVA 3FUTA 1VP9A 4GEKA 2YVLA 4RTRA 3IHTA 1XDZA 5HIKA 4FSDA 1QAMA 4GQBA 2AOVA 5EEHA 5DTRA 4FGZA 2FRXA 3FYCA 1QAOA 2AN3A 3KHKA 4RVDA 4EK9A 2GLUA 4CKEA 5KVAA 1X1CA 2YXDA 1JR4A 1KPIA 2JJQA 3BGIA 3P2EA 3MTIA 2IBTA 4RSRA 4GF5A 2AS0A 1UFKA 2OB2A 3EEYA 3DXYA 3GRVA 4K6MA 4OBXA 5CIYA 1X1AA 3E05A 5BP7A 4PYIA 2Z6UA 4KW7A 4M7RA 3ER9A 3NDIA 3PX3A 3P71T 5D1HA 1ORIA 1SUIA 4XUDA 3UJ9A 5K01A 1VIDA 3G8BA 1SG9A 3O31A 1JG4A 1WY7A 3OU2A 2PLWA 4PIMA 4X1OA 5HIJA 5LSAA 3PTAA 3FTEA 1FP2A 5DM1A 3C0KA 1G55A 2R6ZA 2OY0A 5K0CA 2YTZA 3R9XB 4OQEA 3TM5A 3X0DA 1N2XA 3E23A 2IH4A 2Z6AA 2VS1A 3DXZA 2P35A 1FBNA 1L3IA 2PT9A 4EVIA 2NP7A 1YFLA 4HGYA 4X61A 2G8NA 3EVEA 5FWAA 4AZTA 1NV8A 3DP7A 4U7PB 5ICEA 4H0NA 4BLVA 3KR2A 4MWZA 4PGHA 3RODA 2PXXA 1KP9A 3G2QA 3L8DA 2WK1A 4YUXA 3MGGA 2IH5A 1Y8CA 2GPYA 3B3GA 3Q7EA 3JWJA 4OA8A 4HG2A 5CUQA 2P7HA 2UZ4A 1BC5A 2XBMA 4RVHA 5E1BA 1JG2A 3KQMA 4YUVA 2PX2A 2C7QA 1EAMA 1WXWA 4LG1A 1UIRA 5HFJA 5DSTA 4A6EA 4C05A 1JSZA 2ZIFA 1NT2A 3GXOA 3OE4A 1NW5A 3KU1A 4MQ4A 1JTFA 4PYJA 2ZZNA 1XCJA 2VDUE 2XYRA 3FYDA 4IWNA 1FJXA 3G7UA 2YXLA 3AXTA 3LKDA 5FA5A 5KQRA 2R3SA 1UWVA 3TR6A 1ZGJA 5K0GA 3C3YA 4PYLA 2G71A 1RI3A 2NXNA 2ZBRA 3EVGA 1SQFA 2AOWA 4E2YA 3MTEA 2PKWA 2PX5A 3KPUA 1EJ6A 2YR0A 1L9KA 4PGGA 1VP3A 3OZSA 5D1NA 4P7JA 5DX0A 1NE2A 5K0FA 4R8RA 4RTQA 2ZBQA 3BGVA 1KXZA 2DPMA 2P7IA 4DQ0A 1YFJA 1R8YA 2O0LA 3NWBA 1NW6A 5EC8A 3VYWA 4CTJA 1XDUA 2GS9A 4JXJA 4WXHA 5EGSA 5EQJB 2F8LA 3TKAA 4E2WA 4BP1A 5K0JA 5GINE 2AOUB 2OBFA 4GUAA 3TKYA 1QAQA 2NXEA 5HZMA 4HGZA 5EZSA 5EPEA 4X63A 3P8ZA 5T67A 1AQJA 3P9CA 3DULA 2YXEA 10MHA 2E5WA 2P8JA 2Y1XA 2XVMA 3HCEA 1I4WA 4RTNA 4HC4A 2ZVJA 5K0BA 3C6KA 4M36A 5HIIA 2PT6A 4MTLA 1YF3A 5LR6A 5K0NA 2VDWA 1RI4A 2HMYB 4GC9A 3TQSA 1KPHA 3EGVA 5FHQA 3S68A 2BH2A 1EQAA 1HMYA 2ZWVA 5E1MA 2FCAA 1EIZA 3H2BA 5CM2Z 1IXKA 3DLIA 5EMJA 3EPPA 3G5TA 3G88A 2BR3A 3UJBA 4ISCA 5DPMA 3LDFA 5H02A 2YX1A 4FS8A 2PX8A 4C03A 3A26A 4DCGA 1WXXA 5FHRA 2BR5A 5LQCA 1QANA 1RJGA 3BUSA 4M37A 1XXLA 4AX8A 5FADA 3KQSA 5FQOA 5CCBA 4PYKA 2IBSA 3I53A 2BM8A 3KQOA 2OO3A 3P9KA 2VP3A 3TPZA 4IV0A 2IFTA 3K6RA 3K0BA 3UA3A 2FPOA 3R24A 2ERCA 1Q0TA 1WG8A 3AJDA 3OFKA 3LKZA 4FT4A 3QV2A 2ZBPA 3GCZA 1P91A 3FPGA 4PIPA 1ZHFA 3G2MA 3R3HA 2IGTA 4PCLA 5HIMA 4PNEA 5CCXA 1M0EA 4MHTA 3SXJA 5LQRA 3ME5A 1XJ5A 1ZG3A 3FPJA 3LHDA 3NTVA 4KRGA 8MHTA 1KR5A 3ELUA 5FUBA 4C08A 2NYUA 3P2KA 1T43A 1X19A 5DTQA 4B17A 5ICCA 3HCAA 4BY9E 3ELDA 4OBWA 2CMHA 3LCCA 3VC1A 2PWPA 3PFGA 5EHIA 3D2LA 4C04A 5CVVA 1B42A 4QQKA 3REOA 4YV1A 2XYQA 4E2ZA 4CXMA 3JWHA 2G70A 3BKWA 4GOMD 1RI5A 5DXAA 1JQDA 3DLCA 2HNKA 2UYQA 4AUKA 4DF3A 3HCFA 1RI1A 2C7RA 5G02A 4POOA 4G56A 3EEOA 5HILA 4YV2A 3EMDA 5FQNA 2JHCA 3M6VA 3BWCA 3T7SA 2I6GA 5LQKA 2PVCA 1L1EA 3EGEA 3LPMA 2PX4A 1JSXA 2CWWA 3UJ6A 5K05A 5JUWA 3LL7A 2ZIGA 4ER3A 4IV8A 5EEGA 4RWZA 1EG2A 5F2KA 3OU7A 2AOXA 4E70A 3GDHA 1X1BA 5ICFA 5GIPE 4DMGA 2I9KA 3E8SA 4FT2A 4Y2HA 2JHAA 1MJFA 2OZVA 3B7PA 3G8AA 3HVJA 3GIWA 3OPNA 5DT2A 5EZQA 4Z2YA 2NP6A 1ZQ9A 4HSGA 4RTJA 9MHTA 1R8XA 3DTNA 4Y30A 5K8VA 3RIEA 2KW5A 1XVAA 2AVNA 2FHPA 2FK7A 2GB4A 1VE3A 1F3LA 3B3FA 3FRIA 3LBFA 1YB2A 5F2OA 3KPWA 3UJDA 5GIOE 4P7GA 2C7PA 3PLAE 1N7IA 3C3PA 3I58A 1BOOA 3LCVB 1FP1D 3EVAA 4KWCA 1VLMA 3BZBA 3EVBA 1KPGA 5DSXA 3TOSA 1P39A 5EOVA 5ERGB 1X1DA 3OE5A 3P97A 1NW7A 2AOTB 2OPBA 3AWIA 1D2HA 2ONYA 3MB5A 1BHJA 2UYCA 1XDSA 1NW8A 1DL5A 2ZFUA 3BXOA 4HTFB 1KIAA 1XCLA 1DUSA 5FTWA 1VL5A 4DM3A 4GOLD 4AZVA 4AZWA 3EVZA 3KQPA 3NW9A 3DMHA 3HCCA 3FTDA 3I9FA 2CMGA 2P1DA 1FPQA 2AVDA 2EX4A 1I9GA 5DXJA 4ER7A 2GA9A 5C0OE 2HR1A 4X41A 1TW2A 3MERA 3F4KA 3IV6A 4LWPA 2ZTHA 4P7KA 4QVGA 5CVJA 5DTMA 4HRAA 5GWXA 2AR0A 3LGAA 4ER5A 3UJ8A 4E30A 3ANXA 3UJAA 3HA3A 3THRA 3EVFA 1R74A 1U2ZA 2PY6A 5DX8A 1D2GA 1AF7A 3OFJA 4YMHA 4DZRA 5IKMA 1VBFA 4KIGA 4GOND 1V39A 3OCJA 3BWMA 1G6Q1 5IH3A 3GNLA 3R0QA 2H11A 3ELYA 5JR3A 2QM3A 3M6UA 2UYOA 3BGDA 3NDJA 1WS6A 1Z3CA 3LX6A 1G60A 4GOOD 3JWGA 4PYNA 4YV0A 2DULA 3GRUA 1N7JA 3QOWA 5DX1A 1O54A 5E2AA 2B78A 2JG3A 3MCZA 2NXCA 5M5BA 5CVDA 3NWEA 3OZRA 4FR0A 4GC5A 5GP1A 4RTKA 3PX2A 2Q41A 3Q87B 4AZSA 2QRVB 3M6XA 3JWIA 5EMLA 2O05A 4LWOA 3G2OA 3UWPA 4EKIA 4ZTBA 1ZKDA 4R05A 5EKUA 5HEKA 4RTOA 3HVKA 4OQDA 2G72A 4O29A 3SGLA 3EVDA 4C4AA 4EKGA 5K09A 3MHTA 3PB3A 5KS2A 1KYWA 3HA7A 3FZGA 2VDVE 4DCMA 1NBHA 3HNRA 5K0EA 5EVJA 2WA1A 3G5LA 4MIKA 2GH1A 4QTUB 3G89A 3GRZA 4ATNA 2ZIEA 1SUSA 3FUWA 2B2CA 4FP9A 2PBFA 3KPJA 5T64A 1QZZA 4RTPA 5HOQA 4PWYA 2NXJA 1H1DA 3KR0A 5LQJA 1PRYA 3OU6A 4FZVA 5MHTA 2HTEA 1IM8A 3HEMA 3SX0A 4HTFA 4BLUA 2ONZA 3SM3A 3CKKA 4E31A 4DKJA 3FTFA 3CVOA 4P7FA 3O7WA 1QYRA 4QVKA 4RV9A 4OX9Y 4C06A 2AN4A 2QY6A 3B3JA 3MCTA 3MQ2A 4CKCA 2C7OA 3CCFA 5DM0A 5EHGA 1M6YA 4QTTB 3A25A 3CGGA 3KR1A 3NVMB 4RVFA 3A7EA 2LD4A 2P3LA 4R8SA 4F84A 2VZ9A 3TFWA 2V7EA 1R6AA 3KQYA 4XUEA 3EMBA 3HP7A 3VSEA 4PINA 1JG1A 2H00A 4QDKA 5DM2A 5K03A 1INLA 3C6MA 4KIFA 4YUYA 1TPYA 5F2NA 4E2XA 3ID6C 3GRYA 3E7PA 2QE6A 3NJRA 5EIWA 3TM4A 3UZUA 5FA8A 2XYVA 3FPEA 3CJTA 4YUZA 5CVUA 4RTMA 3GWZA 3HM2A 4XCXA 2HWKA 2IDKA 3LBYA 3FUXA 5E2BA 5LQAA 2AN5A 3BKXA 4QPPA 3T0IA 5LQUA 4CKBA 3DR5A 3IEIA 5KQSA 1ZGAA 2NNWB 2JHPA 2P3QA 3SVZA 1G8AA 1PJZA 4PYMA 5E9JA 5EMMA 5BW5A 3M6WA 4PYQA 4WVLA 2ZW9A 3GGDA 2EG5A 2EJTA 2FYTA 3B89A 3CJQA 4KDRA 2ORED 4RX1A 1KYZA 2FK8A 3PFHA 2Y1WA 3SMQA 1RJFA 2BZGA 4IKPA 4GBED 2O06A 5EKXA 3DOUA 4R6WA 3PT9A 3IYLW 3OZTA 1P1BA 1M6EX 3KQQA 3CC8A 2HV9A 4U7TB 3FRHA 4V0RA 1RJEA 1O9HA 4F86A 2JH8A 1G38A 3BWYA 4HH4A 2PV0A 3FPFA 1SVUA 1L3CA 4BLWA 3UJ7A 3UBTA 2YUIA 2PWYA 2BM9A 4QDJA 3KR9A 3LECA 3SSNA 2QYOA 3TLJA 3PVCA 1SQGA 4KVZA 5GM2A 3M33A 3WSTA 5BW4A 2IPXA 2O57A 3KQVA 1ORHA 1WZNA 3M4XA 5DLYA 1OR8A 4PONA 2OXTA 1BKYA 3UJCA 3VC2A 3CBGA 3SSOA 5ICGA 4E33A 3AXSA 4PYOA 1D2CA 1YZHA 2BR4A 3P9IA 2ZWAA 5T6BA 3P9NA 2YQZA 2GAFA 3MAGA 5LQNA 1R00A 2IP2A 5EMKA 4V0QA 5CVEA 5DM4A 3ERCA 1JTEA 2EFJA 1TW3A 3CJRA 4R6XA 5E9QA 3U81A 4F85A 7MHTA 3V8VA 3FPHA 1NV9A 2CL5A 2K4MA 1JQ3A 3BWBA 5C1IA 4RTSA 2P40A 4M38A 3NMUF 3A27A 4RYLA 2N47A 3KPYA 3GRRA 2PJDA 4FSXA 3T7TA 5KYGA 1NBIA 3KQTA 2B9EA 2B25A 2IH2A 2PXCA 4A6DA 1L3BA 3HCBA 2XVAA 3HVHA 3THSA 3DMGA 1VQ1A 4QPNA 3KPVA 3UFBA 4YUWA 5BXYA 4ER0A 2ZLBA 2AZTA 3A4TA 3GO4A 3HTXA 4ER6A 2P41A 3HCDA 1F38A 3GJYA 3EGIA 1IY9A 4OA5A 5EG5A 2PXAA 5K0LA 3TRKA 3LSTA 1O9GA 2O07A 4PCAA 2QRVA 4EMSA 2ZCJA 3RW9A 3FUUA 3KQWA 5FCDA 2JH9A 5E9WA 1YUBA 2B3TA 2AOUA 2I62A 5U4XA 2Z6QA 4E32A 1YZ3A 3QOXA 5E1OA 3ORHA 1JG3A 1R18A 2V74B 5E1DA 2I7CA 3DUWA 4CTKA 1VPTA 2OYRA 3ELWA 1XTPA 2ADMA 1Q0SA 2H1RA 3EVCA 3R6TA 4L7VA 3GU3A 4X60A 1P1CA 3I64A 5B1SA 2ZZKA 2A14A 3G2PA 5CD1A 4QQNA 5E8RA 3PS9A 5EIFA 4UOEA 3DH0A 3SSMA 4XUCA 1DCTA 3LDGA 1AV6A 2P3OA 3M70A 4YMGA 4P58A
chains in the Genus database with same CATH superfamily
3LD9A 1T1GA 2VNKA 4FNGA 1Y1QA 5FI1B 1KHHA 3QIAA 1OWMA 1I7SB 5DWQA 2GF0A 2QR5A 1IXRC 1VKHA 3KLNA 3P2IA 2IU4A 3BCHA 3PNBA 1B15A 3TCXB 3SJ7A 4JZYA 5A4DA 5BV7A 1JI0A 4DIOA 4ZGGA 1EX9A 5GOZA 4AROA 3N8NA 1FXUA 3EMVA 4I6JA 4DCUA 3W9UA 1GYPA 3T7RA 2FPPA 1K9SA 4EMBA 3QBDA 3ROEA 2A35A 1DJPA 2CMKA 3A1SA 3KVYA 3AHIA 1JW9B 2H4WA 4IGKA 2OPHA 3TEJA 2QT1A 1HDCA 4UXJA 5HFAA 1RD4A 3TQTA 4RDCA 5BN4A 1PJLA 4DV2B 2GEJA 4PAOA 4PIVA 4IHKA 4DYDA 5IZ4A 3CW9A 1A50B 3E3AA 3VTKA 3CLKA 2OQ2A 3REFA 4PRKA 3F3KA 4FM9A 5EJIA 1RZRA 4QUJA 3V1TC 3ANSA 2HSGA 3AMVA 4DJFC 4BFTA 2W37A 4DKXA 4IV5A 1EE1A 2Y0PA 3FOBA 3KOMA 4QAQA 5HFNA 3HJHA 1ODTC 3QFSA 3EK2A 2BKAA 4KNVA 3X1ZA 3I62A 2D00A 2Q4OA 1NFFA 1OZFA 1J97A 3EAGA 2OENG 3EW9A 3K73O 5IBPA 4J94A 1YV9A 1GNSA 3ZBUA 3PNOA 3KXLA 4HP8A 2KE5A 3E70C 4M7RA 4PLZA 5AHXA 3ZJYA 2GZDA 4H0FA 3LPNA 1GHTA 1WUHS 1J2JA 2DH6A 2G63A 2Q2WA 3L02A 2BP7B 1DRUA 3Q2KA 1W85A 4I8DA 1C9YA 1SG9A 1H8EA 3OJ0A 2QRMA 1EUYA 4N0EA 2NO4A 1AK2A 1NMSA 4QE3A 3JYLA 1A9SA 3QKSB 3S2GA 3MYRA 1NFQA 2JFNA 5ITZA 4XD2A 1FEZA 1N3LA 2V6MA 1HDXA 4LIPD 1EXVA 1KJZA 3GD5A 2MSEB 3RC8A 2J7PD 2JEYA 4E0BA 1VJGA 1GZHB 4UNSA 2FPSA 4L51A 3P4XA 1WMAA 1SIBE 2D3WA 4R9NA 1WVMA 1BWQA 1ZR2A 2AMFA 5CYPA 3ZS9A 3FJYA 3USCS 1RAFA 3QVGB 1Z2DA 1LWNA 2ZM6B 1L7MA 3T3DA 5J3JA 1UPXA 4CM4A 1D6JA 2JKVA 4X94A 5FPTA 3U44B 1WDLA 2A1IA 1XAGA 4HDKB 2DPHA 1QGAA 4MYRA 4HX5A 1QYVA 1H0KA 1JMVA 1RTTA 3VDMA 5JQGB 4H4DA 5FORA 1JNYA 1RWQA 3EYWA 4EECA 4QIHA 3JV7A 5DSTA 1ISGA 2OSBA 2O1EA 4CN9A 2QZ4A 4F2PA 3NRCA 3PYXA 1KDPA 1XQ9A 2ODAA 5FFFA 5AUNB 3LFHA 1GG8A 2WTEA 3T5CA 3OIWA 4E5DA 1F7VA 3CMMA 4TWBA 3W9SA 5DMHA 5E38A 1GXSB 3CLRC 4CV2A 4H15A 1V7CA 4GX5A 3STYA 2WSSA 1Z8FA 3BVPA 2PE5A 4HXEB 4UHCA 3BIXA 1GTJ1 4PGGA 2HHJA 4U39A 4K3UA 4PN7A 3ZDAA 4UAVA 1SXHA 1W2GA 5DHTA 1S3IA 2GFHA 1XMOB 1W75A 3LOQA 4I2NA 4WXEA 1GZ4A 1SOMA 2VQFB 2FWNA 2NO6A 3NGLA 521PA 2AZ4A 1R8YA 3AI2A 4LXIA 1BWPA 5TPZD 4KYTA 3N76A 5LMUB 2EX0A 3DT9A 1Z15A 1G1MA 1GGEA 1GL9B 2P1RA 3HR8A 4ZQGA 1NVVR 4NPHA 3O1JC 1MOPA 4ZRDA 4ZEWA 3DTVD 4P53A 3RR2A 4GE0A 10MHA 2H9IA 3RT1A 2XVMA 4IHJF 4LQLA 3A04A 1NXQA 3ZI4A 1E8DA 1O0SA 4NCXA 2QAGC 4TRNA 4MTLA 4ZVRA 3C3DA 4RL4A 3NJ4A 1YO6A 2HMSA 2VZEA 3DL7A 4GC9A 3PUWA 3TQSA 4CE6A 5JNWA 2F9MA 2ZWPA 1SJ9A 3NTUA 3WB1A 1DELA 1PG5A 4Q34A 1ZH8A 2PQ0A 3EPPA 4AMYA 3G88A 1TAHA 4JI3B 4JC0A 1OB2A 4GYWA 3OG9A 1W4ZA 2FZVA 1G5IA 2ZSAA 3T5GA 4CMBA 1L7OA 1X80A 2UUOA 5H02A 3UAVA 4CDRA 1I13A 3QE9Y 2QTHA 4DUYB 3LHFA 1A4XA 3ILHA 4FUQA 3BUSA 1Y4UA 1BO6A 2A5YB 4MQLA 3Q15C 4Q02A 5CK5A 4R4JA 3KKNA 1CF2O 3DUFA 2D13A 5D3ZA 4DXDA 3C1OA 4K6CA 4B7AA 3MWKA 1R8SA 1JJFA 5JS7A 2OCGA 1GTMA 4FZJA 1UUFA 1O8BA 3QTBA 1BGVA 1WG8A 2Z98A 3NKFA 3QOYA 5FO0A 1JQLB 3CB2A 3D6VA 5K8JB 4PIPA 1G98A 4WBNF 5BMOA 3X2SA 2H08A 1PEKE 9GPBA 1E9CA 3S8EA 4AJJA 1I5OA 4DIDA 3T5MA 2AYYA 2GN1A 1EYZA 1LLQA 3RGWS 4JI8B 2RJ3A 4MVJP 5F33A 3LX4A 1J9GA 1HL7A 1VOTA 1NVXQ 4OBWA 1QMPA 2CBGA 2ZRCA 3VXKA 4V0MA 4D97A 1P2BA 1QE3A 4L8VA 1NRXA 1CJVC 5CA1A 2QS9A 1ZWLA 1KDOA 3QPWA 1SGWA 4D8VA 1Y3CE 4GOMD 3BJEA 5C3UA 4DF3A 4QM7A 1HSOA 3VNQA 1WRBA 2EJBA 3GZNB 3L7NA 1QQ6A 3W8RA 4IIXA 4Z99A 2BFFB 1R4NA 2HFKA 2UZ1B 221PA 4BNYA 2HRCA 2EZUA 4PG7A 4DQVA 3W4KA 4WSOA 3KXIA 4MCHA 3AF5A 3JALB 1CR1A 4MCAA 3EGEA 5B57C 2FJUA 3BDVA 3LPMA 1AUQA 1RXCA 2CNWD 4MWGA 1PVOA 5KWVA 3DLTA 3KZNA 4FIDA 1CZOA 2I9KA 3T12A 4NS1A 1CDZA 2NV0A 4MINA 1JXOA 3EWAA 3LM8A 4PFSA 2RHGB 4Q3DA 4Z0HO 2YYZA 1NOKA 3VZDA 4I4IA 1ZRSA 2HDHA 2GN9A 1EX1A 1WCIA 4AMGA 4IQ8A 3CO0S 3VGPA 1XVAA 2FHPA 1OXXK 3HDVA 4L4YA 1DCTA 4D5EA 2YJ6A 4DSTA 1XNGA 1ZC3A 2J3EA 2Z9CA 2FR8A 2ZTSA 4G1VA 4MAFA 1I5RA 2IYQA 3CUWA 1JEYB 1TVEA 4JN6B 5SZIA 3CCBA 4DLSA 3ZJUA 1M7GA 2ZYAA 4KBFA 4ZAVA 1KQFA 3VYTB 5ERGB 1UXJA 1MZPA 2BFBB 3II6X 1G8PA 3PXEA 4C20A 1DV2A 2X15A 1D2HA 3GCWA 2J31A 3AF3A 3G17A 3QMVA 4EDFA 3ITKA 5ECWA 3DVAA 5JSQA 5ALXA 3W6OA 4BXOA 5CVCA 1D2EA 3A1DA 2GXQA 1M2VA 3L6EA 5DF1A 4XDYA 1IQUA 1NOIA 2BMDA 1B6GA 3CH5A 1JVNA 1UBEA 2EZ9A 3Q0EA 4UHJA 5LU9A 4OSEA 1UBUS 2HGSA 2O9JA 3AJ9A 2VATA 4YRKA 1HT1E 1RR6A 3BD7A 3O8OA 4RD0A 1JZTA 2C96A 2Y71A 3TNDA 3KAJA 3L8ZA 4RPJA 1VLHA 5JAMA 5KMGB 2GTHA 4PNZA 3MTJA 5KSPA 5KYTA 4N12A 1H2ZA 1VHDA 2OHVA 5KVSA 2WLSA 2PY6A 2CSUA 1T5TA 3E9CA 2H3EA 4W8HA 1V39A 2FGJA 4O33A 4UXIA 4F1WA 5B3LA 1VPVA 1J0CA 1E79D 1I3MA 3JX9A 3HYSA 2D1RA 1I3CA 2V8BA 4KIWA 2VA8A 2DYKA 3ISTA 3LVBA 3H2HA 3MGBA 1JEAA 3ZCTA 1DGQA 1NL3A 1P9WA 4XW2A 4JKYA 4UKDA 2GEDA 3DLAA 2ZQYA 1XHLA 1MVLA 4I55B 2JLYA 3LQ1A 5AXDA 1GGJA 3M6XA 4M9UA 1UDXA 3KKEA 2ODPA 2FFHA 1DAFA 1ZKDA 4KXXA 4PZPA 5EAIA 5CNIA 4OHPA 3TKLA 3DVRX 3LG2A 4OQDA 3N8DA 4AJ4A 1FXWF 2HA3A 2QJTA 3GLRA 4QRHA 1ZM3A 1C3OB 3DQPA 2ZRKA 2IUFA 3MCWA 4HLUA 2WT8A 4G9BA 2AHRA 3B52X 4W5WA 4YJFA 2FWRA 2FSFA 3UW1A 5HNKA 1AKQA 1F9EA 4PO3X 4I5DA 4IHAA 5FOTA 2WP8J 1TUGA 2JI8A 3NHLA 3O8OB 4Z0NA 5BR1A 5IJ9A 1P0PA 4TWJA 3DMNA 4ZOLF 3MWEB 1UCFA 4WGGA 4M6WB 3MJEA 3OF2A 5MHTA 4KITB 5KVCA 1IM8A 1DUIA 4OHZA 3RUCA 1TYDE 1W8DA 5EYPA 4HFJA 1U63A 4QVKA 2XODA 2ZIZA 3MOSA 4LXXA 2V0NA 1NQWA 4ROTA 1UFRA 1AZSC 2CLEB 1E2HA 3KAKA 3K1AA 3D8SA 4BWYA 1M2EA 4B9AA 4UQPA 2PZKA 2RDMA 5JYCA 2ZI5A 2Z08A 4R81A 1PJBA 2IP4A 3CWQA 4DJDC 1R37A 2B37A 1Y80A 3H2JA 4URWR 2XLBA 8OHMA 2B4RO 1I3NA 1G5QA 1R9MA 5TVGA 1LVHA 2OCXA 2Q2VA 4GYKA 2DQ4A 2TSYB 4DJ5X 3FHJA 1SUDA 2XITA 1PQUA 3E7PA 5BQ5A 4MI9A 1JQ5A 3W2FA 3MZ0A 4J16A 2TYSB 3BRWD 4NR0A 1SG6A 2GNOA 4KUEA 4RDIA 4ZT5A 2D8AA 5EJ8A 4XXHA 3M3DA 2WSMA 4G0QA 1GUYA 2Q1SA 4ZHQB 2CVQA 4HB3A 4A0SA 4II2A 4BLOA 1HNWB 1X15A 5A3RA 4GOKA 2I7TA 3LBAA 5E4FA 1PSWA 3U3JA 2C7BA 3L8FA 3DV2A 3FZNA 1SZJG 1K8YB 2V4MA 1PJZA 5EMMA 5I8PA 2GJ9A 4M0PA 5CXSA 4MROA 4CUKA 5JATA 2JAOA 1KFCB 4B83A 4AX4A 3V00A 3FMVA 5I5GA 3EISA 3TAUA 2XCUA 4PXAA 3NYQA 3U7RA 2MR5A 3DOUA 3OY7A 3SDSA 1QOZA 3CURA 1ZCFA 5SY4A 4AVYA 4DMLA 4EJFA 4RANA 1JBEA 1GFIA 1P1BA 1ZMRA 2Z0MA 2G7MC 3KEOA 4MA0A 2I55A 5IAJA 2JGRA 2WRZA 1PYGA 2NO7A 3CNHA 5FEMA 1QFSA 2XUFA 2YDXA 1KQNA 4D82A 5EP4A 1FMJA 2R1ZA 4YECA 4DMRA 1T3SA 1C8VB 4BJ3A 1YOBA 1B6SA 3K5IA 5B12A 5CFLA 4RLQA 4CJXA 1QZXA 4F56A 2HT1A 1SVWA 3ADOA 3BXFA 1GLGA 2QDXA 4CM8A 3J81A 1FIUA 3KJGA 4F4DA 2QL7A 3QWFA 3KZMA 4Q4LA 4LK2A 4XB1A 1HYQA 3BCUA 1E5DA 3T52A 4BX0A 3U16A 1H8HA 3W3ZB 2BFMA 3WV5A 1X0VA 3MB8A 3S2FA 2JZCA 1FRFS 1JTEA 2NX2A 1FNNA 4GKBA 4XTCS 2HLDA 2DRIA 1BMQA 4Y9RA 2NPFA 2O2YA 1V37A 1NVWQ 1XYVA 4D8UA 1X14A 2ZBEA 3CGWA 3GP8A 1DMRA 2RHLA 3JD0A 5SY9A 4FSXA 5M7EA 4HUJA 1CUSA 1TU3A 2RMKA 3M1AA 4Z1MD 3MOIA 2J0QA 3VJMA 4JCOA 5KOYA 2I66A 3FETA 2Y99A 1ODSA 3L1KA 3TBHA 4IWYA 3TK1A 4G0OA 3QZUA 2HXGA 1PI3A 2RH8A 4KWIA 3M82A 4N3NA 4Q05A 3RU9A 4PS0A 3PUIA 2B35A 2EERA 4OFZA 3JS5A 3T7IA 1BFDA 4RULA 1GUAA 4HN2A 2VLBA 2Q0XA 2W2VA 3Q7QA 4OB8A 2XUIA 2W2NA 5ANRB 1WO8A 3ZLVA 4YDQA 1YK0A 4JI5B 4J0IA 5JCJA 5K0LA 3LF2A 3PF8A 4HDNB 2HO5A 1DQYA 3CEAA 4MQFB 4RVNA 1B1CA 5ULLA 1S0UA 3M4NA 4BRZA 2VQ3A 2FW8A 2JFBA 5T57A 3QXGA 2O0MA 2PU5A 3IP8A 2QAGB 3B9BA 5AHWA 2I7CA 2VUIB 4HDCA 3DEFA 2WIKA 1Q0SA 1P1CA 4MVCA 1WHTA 4XRRA 1KC3A 4EHIA 1CZLA 1SA0A 2VXBA 3UYKA 1J39A 1V8PA 5E8RA 2MYNA 3ILYA 1I80A 1TYAE 2Q3DA 2I7VA 2QG4A 3OFVA 3LDGA 3PBKA 4GH5A 4LSWA 1B0ZA 2YMPA 4QQRA 3TG2A 3FPSA 1EJBA 4HQKA 3A7DA 3UA4A 4HDQB 5L51A 1RHKA 1KL7A 3ICWA 1UKYA 4LCEA 4MXDA 3ZXIA 4EFMA 3BFKA 1W581 3CN9A 2DEUA 1RPZA 4MDEA 1P8JA 1M0TA 4L9WA 4NECA 4XCQA 5KPJA 1T9DA 2ZSFA 1DT5A 1IN6A 3QBVA 4ZO4A 4JBWA 1PG0A 3ROPA 4E6EA 1ONBA 4COOA 3LT1A 5EHZA 1HE2A 1UT6A 3I9KA 4JP3A 5DP2A 4HFNA 3MW8A 1YR9A 2VJBA 1KJ8A 4TL7A 4ML3A 4JH0A 3KAPA 2I7XA 3E84A 2NZYA 3AYXB 1K2WA 1WULS 4TTRA 4YALA 1SVOA 2R4TA 4IFIA 1MDBA 3SQWA 4M83A 1KKLA 1WDTA 4A1OA 5CHYA 2IHNA 1ZJ5A 2NO9A 3EIEA 3PGJA 4G97A 1E2DA 3MA0A 3MJHA 2QZSA 3S5JA 4XH9B 1WQ4A 3ILSA 2OCYC 4U02A 5FL7A 4RELA 2VWGA 5EEHA 3UENA 5FTJA 3ISJA 5ERYA 4C0KA 4DM4A 3WGIA 4KI0A 2JFPA 1HMPA 2ZI7A 1NI3A 4LX8A 1WOYA 2FEKA 4MYHA 1QVWA 5HMMA 4BZWA 1ATIA 1C81A 2R84A 2XRMA 4GF5A 3D4IA 3EODA 4R0VA 3RIMA 4KXNA 1EFVB 3GH1A 3N6RA 2ZYHA 1VBMA 3GRVA 3SJZA 4QO8A 2VYCA 1KORA 3RSZA 3MILA 4BRSA 5PGMA 3R9XA 3CF2A 4OBBA 2M1XA 1H0SA 1VPEA 2G1AA 3PKZA 1SUCA 1MQSA 5IM4F 4LF8B 4YACA 1CW2B 3S28A 4F4CA 2AR7A 3I04M 4HQLA 4PQYA 2QWXA 3HKBB 2QM0A 3LRTA 4K9OA 4NMMA 3EZLA 3OU2A 3UAGA 3KUCA 4OQMA 5FWNA 1LDMA 5HR5A 5EKSA 3D6FA 3JPYA 1DDOA 4QTXA 3I52A 1ZVVA 4J3JA 1DG1G 4DLNA 3U7JA 2QLJA 4MR8A 2YWGA 3O8RA 3K92A 3VHRA 1IUPA 1BEZA 1JAZA 1W93A 2IVFA 2E85A 1DTSA 3H5IA 1FQJA 4X54A 1DPGA 1P5JA 4YGYA 4PGAA 2VKTA 5IJ0B 1EFAA 1ZGHA 4Z9FA 4DDWA 4HPXB 4EX7A 5HQ3B 1EGAA 2BFPA 1MENA 3PFNA 4J2HA 3OOWA 2WM8A 2DF8A 2HIMA 4UQLA 4XGIA 3TGLA 2LE0A 3KKMA 4WCDA 3BBPA 3IT1A 5JISA 2H1HA 2ZB2A 3FCAA 4H35A 4HH3C 5FPSA 3BGOS 4UHEA 1XRSB 2H5IA 3WOVA 1SWVA 1G41A 1P9OA 3RVRA 2KHZA 4FE7A 2C7QA 2V1UA 2K2WA 2OILA 2WYHA 2EKZA 3CLSC 1RXUA 3W8FA 4AU1A 2CNDA 4A6EA 1A76A 1JTFA 4RY2A 3ZDFA 1YJBA 2ZRPA 2C57A 3F5SA 3ACBA 3L1VA 4HB2A 3RSHA 4CYMA 1P19A 3E81A 5AW1A 1T1EA 1H94A 5F5NA 4URUR 2R3SA 4ZVNA 5TE9A 2BZ0A 2ATXA 1QHSA 4EI8A 4OJMX 1X13A 1OE0A 1DAMA 5L53A 4PVCA 4WCFB 1SBYA 4BGIA 1R3DA 1Q7CA 2XCRB 3LF1A 3LQFA 2QD3A 2YZMA 1NUTA 2MMGA 3GLIA 3ODPA 3S1AA 1S7GA 2B8EA 4NTZA 4YLEA 4A2WA 4CDNA 2C7VA 1GITA 3U3OA 1KXZA 5M04A 2Q5LA 3SF0A 1LJLA 3LP8A 4JXJA 3NM6B 1YT5A 5EPOA 4HPWA 3MJSA 3FOEC 5DHUA 2AE2A 3Q3JB 1GU0A 4ZKDA 2H2GA 1MG0A 3NNNA 3R3XA 4RGQA 4O4LF 2AOUB 4GUAA 2IS6A 2NXEA 5HZMA 2BELA 4MV0A 1WXIA 3MBOA 1GYQA 1T35A 3B1JA 5HQ3A 2VPIA 2RGEA 1SHTX 1M3SA 1GPUA 3F1LA 4ZCQA 1AIPA 1QHFA 4EMUA 5CGZA 5HIIA 1OGYA 5ED0A 1RWNA 2B6HA 3FFTA 3HWWA 3V5NA 1GGHA 2XQJA 2CLSA 4JLJA 2WJPA 1QR6A 5LP6A 1IIBA 3CEPB 1VGRA 2WWRA 3HXKA 4H7IA 5AI6A 1IXKA 4B3BA 3DLPX 1JXQA 3PRKE 2X7XA 2PYDA 2Z3ZA 3IURA 3PC8C 4B80A 2WJ6A 5LQCA 4LTDA 3PQ5A 4C87A 1G3MA 3GBPA 1U0NA 2FXVA 1FFBA 3VAYA 1ZY2A 3GH3A 4JQCA 5THQA 4IUBS 2V9ZA 3QKRB 4IO1A 4O2AA 4BECA 5CB0A 2ZI6A 3AR5A 5K3AA 4QOGA 1J42A 3M5WA 2VHYA 4RZIA 1PGQA 2ODQA 3UANA 2W6QA 5H7XA 4JENA 3AOEC 5FTMA 3U1BA 3U60B 1KETA 3KJFA 4FT4A 3HO6A 2WF9A 4E03A 1ITZA 3F5DA 3FNFA 4OHKA 4PCLA 3PTLA 2B61A 3BDAA 3V4PB 1FMTA 2VTBA 1MPXA 2WM2A 1W85B 3ELUA 5JCPA 1TK2A 3OZUA 5CYOA 1OH5A 2GUGA 1JHRA 3OD1A 4FI3C 4PTZA 3I2KA 3VC1A 4CMEC 3HJFA 4BLPA 1KARA 2NTJA 2C4UA 2ZSDA 4DNFA 3FDZB 5LB2A 4NU6A 4N01A 2CE7A 4UAGA 4ZT4A 4REOA 2YVUA 2O8FA 1QH1B 4W1SA 3BTUA 4WCVA 5L7TA 3IESA 1L4NA 3NJ8A 4M49A 2ZATA 4F21A 3U56A 1MFZA 3ZR4B 3NANA 2R9VA 3UQYS 1SBNE 5IANA 3ZYCA 3KS9A 5JJ5A 1SEPA 4JLUA 1JVBA 5ALZA 5IUNC 4AO7A 1HI9A 2PVCA 4CTOA 2PX4A 3I1IA 2Z5FA 1J49A 2VK1A 4RWZA 3O95A 3REQA 4CKBB 3KKLA 5F2KA 2PUCA 5AKIA 3HXOA 1YQWA 4LOJA 4CLRA 3WGOA 3OIDA 3OX1A 4IYJA 4ZAYA 4D0SA 4QUHA 3HSKA 2NP6A 3ZXXA 1ZQ9A 4RAQA 1DAOA 2UVPB 3OIFA 4XVQA 1P4RA 5TMBA 4OSOA 1AKNA 2KW5A 3JYOA 2YYAA 3SI7A 1QHNA 3S1SA 2HIGA 2QI9F 2JAWA 1EGMB 3NKVA 3PLAE 1C1DA 5C2JB 2C7PA 5AJHA 2F43B 1NNEA 3LCVB 3MS2A 3OZGA 1YHNA 5EN4A 1KPGA 1WNTA 1VHLA 1T6BY 3H8SA 3DZJA 4KYVA 3OE5A 3PI6A 4D8WA 1QPZA 1NW7A 1XRQA 3AWIA 1U5BB 3B38A 4N6NA 5KYUB 1NONA 1S4QA 2XX3A 3VOSA 4TUYA 3GUHA 4HRYA 4JVMA 3TZKA 1FU4A 3VOAA 2MHCA 3ZW7A 4ALJA 1RC8A 1WBDA 4F7DA 3L92A 2OMKA 4POAA 4CCYB 3OT1A 3PFFA 3W5VA 3ZY5A 3WYGA 3GMTA 1ADBA 1Y33E 5FWXA 3THYB 3VZQA 5DXJA 5ALEA 5FBWB 1AB6A 1JDNA 2ZBGA 2R86A 2VJLA 3EA0A 4ESVA 4I1RA 4EGAA 4Q1DA 4LWPA 3QVOA 2NQ8A 4J7XA 4P7KA 1R9NA 1E2PA 3SHOA 1CUEA 2HRBA 4V0ME 4D9EA 1OD6A 5JVDF 4Z4CA 1VPWA 4UU0A 1O57A 2B5VA 3RS7A 4H1VA 3GQVA 1RYNA 1UZAA 4D3ZA 2LIPA 1ZA2A 2IYFA 2RHMA 2H11A 3AKCA 3P9PA 2QAIA 4KLAA 5G0VA 2IHBA 2UYOA 5KTOA 1SR8A 2J9XB 4JVOA 4XD7A 1WS6A 4LOHA 1NVDA 1JIVA 2IXBA 3I8XA 4C4PA 1WB5A 5ETJA 2KWIA 4CMIB 1PQPA 4YV0A 4ZHQF 3VKHA 1G20E 4KTTE 1N6IA 2HADA 5BT8A 3K09C 2E87A 2W7TA 2QMQA 3NWEA 2HPHA 4KN9S 4ILEA 4EB6A 1U7WA 2ZU6A 5AP9A 1TF7A 2HJ9A 2C4NA 2Q6TA 4GZLA 5AESA 4QUBA 2A5LA 3W06A 4CQMB 1F0NA 4ZTBA 3C6BA 4GI1A 3WJ2A 1NSFA 2ODBA 1GL3A 3N6XA 2PL9A 3W1WA 4J29A 2FDXA 4BC0A 4EKDA 1JT2A 1SKQA 2ZRDA 1K8QA 3C2QA 4F0JA 1OBOA 3ILXA 1QPBA 4KFUA 3P1JA 4RCZA 1I2DA 2QVGA 6LDHA 3NFRA 1XI2A 3EDMA 4ZQFA 2BGRA 5EVJA 4YCMA 4CM9A 1RRGA 1ZL2A 4E88A 5EJ9A 6ADHA 3I6BA 1KRXA 1WAMA 3SXUB 1P0MA 1DC6A 3A8TA 4EY7A 3N2YA 1XZEA 1G5RA 2AF4C 3E9DA 3KPJA 4W8GA 2ANBA 1T34A 2VRBA 4A8JB 4BN5A 4JB3A 1NLYA 2NZVG 3FNIA 3GEMA 1BE6A 5LBTA 4WVFA 3PC6A 4ZXPA 4LMAA 3IQDB 4O6VA 4WOJA 1NU6A 3RJ9A 1SHLA 1MABA 3EFOB 1GPNA 4ESEA 1NP7A 5L4LA 2V7BA 1E3MA 3K30A 4RV5A 2FW7A 1GGFA 2OC4A 4KIJA 5E9AA 4P7FA 2XA9A 3A2KA 4C2BA 1GFWA 1Y9EA 1TTPB 5JEEA 4TMVA 3S2IA 3E61A 5EHGA 5LLDA 3IDAA 2MCFA 3NVMB 4R9VA 1XALA 1PW5A 1X80B 4JVSB 5DLDA 5LFAA 2F43A 1YWGO 3JD4A 3CMCO 4WERA 2QD4A 3TW6A 2W2QA 3X44A 4UNRA 4O2BF 2R62A 5JD5A 3HYCA 4AN4A 3UZUA 1NTRA 4ZMRA 3JATB 1R88A 4QXAA 1SCKA 3AL3A 3FPEA 4FMPA 3WLSA 2H92A 3ZQKA 1GSOA 1Z63A 1DKNA 2X2OA 4DUZB 2G1UA 1XZGA 3HJUA 1WMSA 3UMVA 2VYQA 1EEXB 1ORRA 2D5AA 2ORIA 3CFYA 3JZAA 3HKEB 4RPGA 5NLLA 3SHWA 4U3JA 2DWQA 3R5KA 3U0BA 1TAQA 4GPZA 4F96A 3Q72A 3CRNA 3H04A 4ZGBA 4DR6B 4HWOA 3G0DA 1L0BA 3BXGA 3OTQA 1N6RA 4P54A 1GGVA 2ECQA 1TJ3A 3KB6A 4JIMA 3DF9A 2Y9MB 4TPKA 3W3AD 2ZOSA 1GZUA 2C2HA 1WUKS 1QTQA 3SY8A 4PG6A 4E12A 3R74A 2OTCA 3SMQA 3T9DA 4DIEA 5CFQA 4X7BA 1SCUB 2O06A 5TGZA 4O1MA 1Z37A 1USWA 2PRKA 5DHAA 1NJ5A 5AIBA 2B1JA 5AW3A 1VG1A 1Z0JA 4ZJYA 5CA1B 3MTBA 4PO9A 4D02A 2JPDA 1Q0HA 3EPRA 4XVCA 5AMXA 3PGKA 5DDIP 5BUCA 1RJEA 5GONB 3RK1A 4R1SA 3VTAA 821PA 5JNVA 1FDSA 2PQ6A 4IH1A 4KIUA 1E0KA 1SVUA 2JAQA 3D2BA 5AD1A 1D07A 4IIEA 4TV9A 3TOCA 5A9SA 4P92A 4FEYA 5KMGA 1OB5A 1G5HA 3FTNA 3KVOA 4AZ0B 2G0AA 4F2DA 4MCIA 2AMYA 1U5AA 4MVJG 1GZ5A 4TTSA 1OIXA 2OM6A 3CT6A 4Z9YA 4CTMA 3UOGA 4FDTA 5DNYB 4EUHA 4WK2B 4X1YB 2OECA 4RV4A 4TYYA 2ZDQA 4FGJA 3RVNA 4EYOA 3D0OA 3IQXA 3QNWA 4C4RA 4EHFA 1QKIA 2ZWAA 1SZCA 3EBOA 5LC1A 1E1RA 1P72A 1Y82A 4TYNA 1LQUA 2IF0A 1VIAA 2VNAA 3AY6A 1H9AA 1J8VA 2DFDA 1X8KA 5JG7A 4WZAA 3TQOA 2GR9A 1NV9A 1SU6A 2GSDA 4IQ4A 3DAPA 4FDAA 4NPAA 5C1IA 1YS1X 4QXMA 4BC1A 3RKUA 4F3RA 1PKXA 3KPYA 1RHMA 4O59O 2QMOA 1W46A 3M7IA 5D00A 3UY4A 3GUYA 4PNPA 1PFQA 2CBZA 3IRVA 3FIJA 5CTJA 1PJ3A 1ZN9A 2VDMB 3S2UA 4E09A 2I22A 1W36D 3AL0C 1L3BA 3IAFA 2BGJA 1TK3A 2FMIA 1V5EA 4M60A 1G4HA 4JJ6A 4IDPA 2P9BA 2YHSA 2Z5GA 4M1ZA 2A1TR 3INYA 2R751 3FHCB 5FV4A 4UMVA 4DMCA 5CHEA 4FQ5A 1NYQA 1YU6A 2N0SA 1R0SA 4R0NA 3QSGA 1PJRA 1T8UA 4RSMA 3MT9A 1UBJS 2Q5QA 3HJAA 4ER6A 3RAEC 3KE9A 1IZ7A 1WKVA 3FWYA 3GEHA 4OO3A 1AB5A 1L4KA 1ZA1A 2PXAA 5JAQA 3OPYI 1DKRA 2XW6A 4PCAA 3SDZA 4R1MA 3RW9A 4US2R 4OI0A 2R4UA 3SJAA 4F12A 5E9WA 1Q1ZA 1E7YA 1D4AA 1FSPA 2HJGA 1DX9A 1QHYA 3F6CA 2V74B 5HE9A 4UHKA 1XVTA 1Y1SA 4X8OA 3WLNA 4D9BA 2I03A 5CFPA 1VPTA 2PZEA 1GPAA 3EQ2A 5H3HA 4DWJA 4H7PA 4M1YA 2ZYVX 1PK9A 5BUQA 2GXUA 3RQSA 1JF8A 3NXSA 2M6LA 1ST3A 1AGPA 4IJMA 3TVYA 2YJ3A 1JR3E 1A5SB 3BGWA 3C6QA 1OV4A 3FWKA 3ITNA 3HFJA 1AQLA 1TADA 4BO4A 3N74A 2WHYA 4L3WA 4X0EA 4PHTA 1O97C 3BRQA 2F67A 4ENWA 4P35A 5JBQA 4WFIA 4DE5A 2SECE 3TW8B 2DM6A 4M8NE 2G5PA 2KS6A 5A5FA 4GMXA 3VR5D 4RETA 5ALHA 4MRMA 4GSYA 4C2UA 4EQ6B 1UF9A 2F6RA 2E18A 3FX2A 1VIYA 4IZOA 1H8ED 3NDPA 3UVEA 2B9VA 1AOXA 1P3JA 2QM8A 4LHZA 4EARA 5IEJA 4TLAA 3A6KA 1FDVA 3UMFA 1GRVA 1IG0A 2OBYA 2ZYUX 3HU2A 3PC4A 1T6NA 2NUAB 4MVJH 4E5SA 4O4IA 2CXTA 2C2WA 3FMPB 1H2EA 4U2KA 4WUTA 3TMKA 1DRKA 1E77A 2QRZA 3KFLA 3M4JA 2P9EA 1AQNA 1Z82A 2ZJAA 3MHPA 1JHYA 3ZWDA 2IK8A 4HKTA 3E9ZA 3LLCA 1ORTA 3KT8A 3O8QA 5H3CA 4DJTA 1H1TA 2XJ4A 3AERB 1NKVA 1AZLA 2QE7D 4ROSA 4RS4A 1YS7A 4UUBA 3TECE 5LCXA 3PRJA 1RWKA 3WWEA 4RF3A 2D4HA 4UVIA 3KYDB 3A4VA 3FPBA 2BGUA 2PUGA 3FOWA 2CJPA 2HSZA 4FJ0A 2YRXA 4E46A 1E1QA 4YCSA 1PQYA 3FGOA 3LK6A 2R8OA 3NM4A 5I48A 1GQOA 2G07A 3EUFA 4DTIA 2KB0A 2YN0A 4BQFA 2BTEA 4DR3B 4C4ZA 3PHGA 4DCPA 5K6RA 1DNPA 1F17A 1EVJA 1IG3A 2QVZX 1V1MB 1V11B 2OCLA 3WJ1A 3EG5A 3U4QB 4UNIA 2WF6A 1JWBB 1IPFA 1MIOB 4IX9A 4EJSC 4JOQA 1Z6QA 4GICA 4XGNA 3QH4A 2GHIA 3C7KA 3FYSA 1OI2A 3ASUA 4RBNA 4GHWA 1J6UA 5KYWB 4AY2A 1Q95A 1DP4A 1HE8B 4ZTZB 5K2OA 1NUHA 1ZR4A 1Y5RA 2Q5FA 4P3OA 5DM1A 4L6AA 1QWOA 3ZQUA 3X1MA 4FDUA 2PUJA 4OQEA 4YMWA 2Z2YA 3GFVA 5EJAA 3LT2A 3C3BA 1X1EA 4RZ3A 3WHKA 3QPVA 4JOSA 3SQXA 2QNRA 1DBQA 1YDGA 4X61A 2GI4A 2RHJA 2A8YA 1ZK4A 4EYGA 3AKEA 2A9RA 5KZMB 4UBLA 3X1JA 1KI6A 2BFCA 1O7JA 3C5WP 2L18A 1YIDA 3O8QB 3H19A 4H7HA 5TX7A 1LRJA 1DV1A 2BSQA 4NDZA 3GLIE 3QENA 4YUXA 4K87A 4V1CB 5HGJA 1Y8CA 3BE4A 3UG6A 4OA8A 4IDBA 1VKNA 1J7KA 3OZFA 2GYWA 2XBMA 2HHAA 2AQKA 1A9OA 4DNXA 5D84A 4DA8A 5L3VA 1DG9A 2GMWA 2XE8A 3A6HA 3K9GA 1K1EA 1TZJA 3U37A 1U3UA 1VYHA 3D4LA 3GLTA 1KNXA 1ST2A 1DX4A 1US8A 1YKSA 4L5JA 4CTNA 2P79A 3LC7O 1ZVKA 2DFKB 2VG8A 1NT2A 3GXOA 1OYYA 1GSHA 1ZSNA 2D4AA 4P98A 5ESDA 3BL6A 3U13A 1D6NA 3BJIC 5CCEA 2R65A 1GN9A 3G85A 4QLOA 1UKBA 4Z7NB 4PAGA 5EE5B 4Z4HA 5LZ4A 4JLPA 3FKSA 1YSCA 4RADA 2CT8A 1S8FA 4A36A 4EDHA 4EUKA 2OHIA 4FWIB 5KHLB 1YOVA 1EVQA 1PS0A 1NZFA 1CERA 2PKWA 3PD1A 4L5AA 4IDNA 5LVAA 3KPUA 1KU6A 1QH9A 1RZUA 3IP5A 3OZSA 5DX0A 1UP4A 3RQIA 4DRXA 1W48A 1NE2A 1S1MA 2FA9A 3ZNOA 5K0FA 4RTQA 4JJIA 2ZT8A 3J7AC 1SUWA 4G5GA 4D8YA 4ZMBA 4FKMA 5E7JA 1SHJA 3OQHA 4YCBA 4AZ3B 3P0HA 2NZJA 4MA4A 2A2ZA 4KWHA 3HGQA 4OVKA 5LA6F 4LX0A 4YAEA 5ECDA 5HF8A 3V2GA 1TUEA 3DSRA 1NW4A 2BFCB 3VC3A 1K7YA 1FCJA 4QPZA 2YV3A 3EGCA 4FE3A 2VTEA 1I4WA 2A3RA 4MS1A 4P4TA 5FD8A 4FFBA 3L7CA 3FE2A 4QG3A 5EZ5A 4EY5A 2BFEB 4WXYB 3UMYA 3QQPA 2WP0A 4NE7A 1E2KA 4MUYA 1SD1A 3NLLA 2F8SA 4B7CA 5IAAA 5BN3B 2PUEA 4B3DA 1FYXA 3FCOA 3AVYA 1M7BA 3OZ7A 1NVAA 3DE1X 4LXGA 4N5HX 5IK2D 4ND5A 1TA4A 4CEHA 4HNTA 3DOHA 5DGIA 3EMKA 3LYLA 4G85A 3H9UA 1Q1GA 1VGQA 1VCIA 2Z4RA 4GM0A 4HWSA 4RABA 4I1IA 2YX1A 4QLAA 4X1IA 1NJSA 3H6KA 5K6TA 4YRJA 4WUVA 4BO8A 1KI7A 2R6GA 2VO1A 1AA9A 4AX8A 3EIHA 4PEVA 1CQWA 3A6FA 4A8TA 2PU7A 1CY8A 3GFBA 4UE3S 2Q0QA 2P6RA 5D3MB 5HUHA 1EGVB 3IUJA 1NI4A 1GCAA 1O03A 4HBGA 4L9AA 4IV0A 4Q9JA 5C52B 1EFVA 3B6KA 3UTDA 2CD7A 2D0PB 3WWZA 3ZQ6A 4PHHA 1NPYA 4AJ2A 2Z2ZA 4HB0A 1FDUA 1G18A 2REOA 2FG5A 3GCZA 5F12A 3IBSA 2XH8A 2PH5A 3R0IA 4ITUA 4HYYA 3FBTA 4GOXA 4ID3A 4LI3X 1RJ9B 2G1KA 4XQGA 1YRHA 3QUQA 1E4OA 2QTFA 1T5OA 4AJNA 5IC4A 2GBLC 1H5UA 1VI2A 3I32A 1SN7A 4HOYA 2LXNA 1G0NA 5A7FA 2RHDA 2OV3A 3KL2A 1VL6A 3NO4A 3IGFA 3RU2A 3QV1A 3S40A 4CV0A 1QYIA 1GNPA 1PL6A 2BN4A 3DHEA 4KV9A 3FCSB 1DFHA 2PUAA 4JBGA 1HH4A 3BKWA 1RKVA 2C98A 1RI5A 2J5RA 4OP2A 3KV3O 1DDGA 2AQIA 2HNKA 2Y1OA 2GD6A 3IR6A 4LRUA 4B6EA 1OFTA 2AJCA 2QNBA 3NEJA 3HP4A 4DADA 4K8RB 2B8NA 5HILA 9ABPA 1WW3A 1Y3FE 1ZONA 3T95A 2A7XA 1II0A 2JHCA 5TR9A 3BWCA 3ZNQA 4DGSA 2VUHB 1V1JA 1MRNA 3HWSA 1WX1A 1NLZA 1P80A 2O7RA 3LL7A 1KS9A 1BCSA 2YXPX 2AW3A 2FW6A 3CRRA 3R3ZA 4K9PA 1K98A 1ESCA 2FPXA 1B8OA 1D8AA 3DAOA 3VJKA 1V4BA 4K6HA 2GGSA 3Q7RA 4Y2HA 2JHAA 2QXUA 4EGSA 1RWOA 1J23A 3EH1A 2JFWA 3GIWA 4D6YA 4YV7A 1VIMA 3OZCA 4B32A 1MB3A 3NIWA 2M6SA 4MWEA 4CF4A 2ZCUA 3UMGA 1R8XA 2Q50A 2OK7A 1Q7RA 3FCYA 3NBQA 5CYFA 3U4MA 3WLIA 2D06A 3LBFA 1G9TA 1GQFA 1KMHA 3F8SA 3IBGA 1UJ6A 3V8EA 1RZ3A 3PENA 4P7GA 5KDDA 4L3VA 1E9RA 4RM3A 5DKFA 3KSBC 4KWCA 5JY1A 4ND6A 3OBBA 4MX8A 4NYJQ 4JNCA 3OQNA 4FZRA 1G8YA 2ACKA 4BQRA 1E6UA 4JSYA 3QIVA 3F46A 4ZVSA 1JIKA 1KEEA 1TZ2A 2I3BA 4U63A 3AUYA 3L7BA 5G4KA 3DKVA 3T5AA 3V7FA 5DWDA 4KGZA 1KIAA 4A8PA 1WZIA 3FPLA 3LP5A 3E27A 1RXSA 2VPQA 4L8WB 3TBKA 3HCCA 1EDEA 4BCCA 1KAQA 1VXOA 3O73A 3RAFC 1QB7A 2EX4A 2V4UA 1HM5A 3O3NB 4LNAA 2O59A 3OCVA 2XAAA 1NIPA 4EUNA 3BK7A 5CFRA 3RRJA 2HR1A 2RK3A 1ONNA 5I9IA 2DQZA 3IV6A 3GLQA 3GLHA 4UUQA 4WDQA 3LNTA 5LZ9A 2AK3A 3FDFA 2EKPA 3DDZX 4J43A 1T9GR 2X41A 4NH0A 1L4YA 3GJ7A 3I4CA 3EVFA 1R74A 3TAHA 4X93A 1ZUWA 5AKKA 2VA9A 3CT4A 5IKMA 1TD9A 1O5IA 1KOGA 4OEHA 5C4GB 1ZVMA 2PT5A 4BLTA 1E2BA 3HG7A 3RT9A 3R7SA 1SCIA 2BZ1A 1WB4A 4QUDA 4Y9TA 1JAXA 1N3IA 4CIYA 3DLBA 4HYQA 3MLAA 2YASA 3UK6A 3RRFA 2XNCA 2OO7A 3VPGA 2A0FA 1EUQA 5CPFA 1WCWA 1Z7GA 2VK8A 3AVPA 4ITRC 5THXA 4RTKA 4LMRA 2XWSA 3CU5A 4KX5A 1ZIPA 3HADA 4MPPA 1EK1A 2QL9A 2XE6A 1I7LA 2VH2A 4Q21A 3IT2A 4YRRA 4BX9A 1MRSA 1T1JA 1M1YE 1MFPA 3DE4X 3T0GA 2WD7B 4R05A 5IZCC 4K6KA 1QB8A 2HB6A 2WTBA 4ZODA 3OAAD 2G72A 3REQB 1FX1A 4G3XA 4LRYA 1NBMD 1CUBA 1JEJA 1F9AA 4A6PA 1SVLA 4DCMA 1NBHA 1IHOA 4M0KA 3MF4A 5DK6A 5B3JA 1YL6A 4G5SA 4QHYA 2KBEA 4ASUA 2BKXA 2C1ZA 1UZNA 3DE6X 4Q1BA 2RHRA 1B8NA 4Q3CA 1D2NA 4N6OA 2GN0A 3TRDA 3IP3A 3CVWA 3ZWYA 5C1OA 2CGEA 4UPVA 1ZVJA 3GNSA 2GBIA 2FEMA 4JOBA 4GUDA 5THKA 2VWQA 4G1UC 2CB0A 2WJYA 4UHFA 1KXJA 5U4QA 3I5AA 3Q6IA 5IHXA 4DW8A 1CEXA 3CVOA 1RPTA 3L7KA 2CVOA 3O7WA 1BXGA 5KYUA 1M34A 5C7IO 2AN4A 4Q1FA 1CUDA 4R83A 1U6JA 4D9HA 4NFSA 2Q0HA 3GI1A 3BB1A 4RJ2A 3CGGA 4IDCA 4MVJF 1ZXBA 4R8SA 5JBNA 3A3OA 3LLUA 1R6AA 1XHFA 2JJMA 3EXHB 4KFSA 4B6OA 3V8NA 3U09A 5IJWA 1UK8A 2WW8A 4NBKA 4YI3A 5J63A 4F9FA 3IERA 4OATA 2QE6A 2FEOA 1ZN7A 1C1YA 4R8MA 3A1UA 3H2IA 1U81A 3I04A 5FBHA 4MLCA 3K0FA 4RVOA 5D3QA 3TQCA 4ZK6A 9ATCA 3E9EA 2FRDA 3LAWA 5LQAA 3SWWA 2I91A 2AW5A 2VJDA 1COZA 1BRTA 3HH8A 1P2SA 4PZCA 2B8WA 4LSMA 5JSYA 3RSSA 1XKQA 3SEFA 3T54A 2QQ5A 3HNPA 1J8DA 1T15A 1DXQA 2P6OA 3K6JA 2AV6A 4YC7A 2FCRA 4I5IA 5JZ9A 4JLWA 5BW5A 2BFAA 4MIYA 4HGRA 5CTAA 4KC0A 5BWLA 1MAUA 3LY8A 1YVEI 2I6QA 1POWA 2YIDA 4I19A 3PFHA 4BNMA 1NG9A 1FQOA 1GADO 3H4VA 3C16C 3WNVA 1T9CA 1E3WA 3BBLA 1L4GA 3SVLA 4NJOA 1IRIA 2EG9A 1VLLA 3H13A 5CX4A 3DLHA 4HY3A 3TIVA 4ALIA 1JQKA 3MWFA 1L1FA 3RANA 1JDPA 1F7UA 3DDCA 3QUAA 2R6JA 3WWDA 3O4RA 4LPSA 1WZUA 4MS3A 2ZT6A 4B35A 5J47A 1PHPA 5ES3A 1T2NA 1ZBDA 3UJ7A 2JCBA 2PWYA 3HGMA 2OYCA 2CXQA 1KVUA 2H1WA 3DB1A 3FAKA 1ZD3A 1VMKA 3KB8A 2BRUA 4MIOA 3U39A 4EHDA 4LXUA 5KOHA 4LYFA 2RBKA 1G5FA 1FFAA 2WMNB 1Z73A 3L5KA 1PT6A 3UJCA 1A71A 4BN4A 4D3FA 5LDDC 4OX9B 4E33A 2MOKA 4B2IA 2C20A 2P6UA 4Q4HA 5EE3A 3ODGA 4W63A 4FJ2A 1Q17A 3ROMA 2B82A 1E2NA 3U9LA 3WHLA 4BXOB 1JEQA 2F3UA 3O4JA 3Q5GA 5JANA 1TEZA 3SYKA 5EMNA 2GRJA 4BLQA 1OZGA 5BNWA 3CR7A 4H4CA 3V3TA 5E9QA 2A9PA 2EQ5A 3TI9A 1O95C 1Z08A 4L57A 4TN1A 3MQ4A 4NULA 2GK7A 4CLXA 4GO1A 1TQ8A 4UVDA 4Y2XA 2FN8A 3WLMA 1PJQA 3QRWA 5FOVA 1IWBB 2PXCA 2Y1FA 3BE8A 3LYHA 4KPEC 1CJTC 3HVHA 3WP1B 1W30A 1OQAA 3THSA 5JSZA 3PXBA 5FL3A 1WZ2A 1VQ1A 3JPWA 1FVFA 4DJAA 1HLFA 1CX9B 1GL6A 1TM4E 1GXSA 2J0VA 1XTTA 2QJRA 3A36A 3A4TA 3CLVA 4UEOA 5FWXB 4IFBA 2CY0A 5KI6A 2GLTA 5D8DA 2IEIA 4UTZA 2RC5A 3UWSA 5JCOC 3WYNA 1BN7A 3U0VA 3ZTTA 2R97A 3GL9A 1QV7A 2ZU0C 2GD2A 3D7RA 2AHOA 1CUZA 3JZDA 2PLNA 2RGYA 1OT3A 3DNMA 4EO7A 2F1JA 3PJRA 1SBZA 1A1VA 1WPGA 3TTYA 3UUGA 3KCQA 5IT0A 3HVUA 3UB4A 5BVHB 3RS0A 3QELB 1L8OA 5BOVA 4H2DA 2IL1A 4P5DA 3LQRA 4REMA 5TQVA 2LUOA 5CD1A 4QQNA 4X6XA 4BUZA 4FDMA 1AUXA 1JEQB 3PS9A 4XFKA 3WL3A 1B0PA 3DWIA 4WHMA 4DLTA 2BKUA 1UJNA 2V0GA 1BU8A 3LX5A 4W5HA 5E4TA 3L8MA 1KDTA 1GD1O 3HZRA 4IWXA 1M2JA 1ZW1A 4KXVA 4QXQA 3H5WA 1IEXA 5IF3A 3W5AA 3NVKI 3HZHA 1TI7A 1RP1A 3NUZA 1XN1A 1ISSA 2Q6OA 5EIOA 5BYJA 3TRFA 4AZ0A 3ZZUA 4MR9A 4CT4B 1NBEA 1NP6A 1VA5A 5KJ6A 1YASA 2PA0A 1CR4A 1E61A 4PG8A 3B8EA 3FSGA 2H1VA 4AJPA 1ODKA 3N1UA 4R41A 4RIIA 4X1YA 5DRYA 5EE9A 2HTFA 4X91A 5FULA 3PXXA 4EW6A 3QYFA 1P45A 5DO9A 1E9EA 3MAAC 2BONA 3GXBA 1FRQA 2ZS8A 3EXFB 4Q4JA 2YMQA 1GZDA 1S7CA 2WZDA 1KBZA 3MINB 3I05A 4JNKA 1DLJA 1UBFA 2RAUA 2QLMA 4L5CA 4YDRA 5GJWC 3VMMA 3N7TA 4KHPB 3HDHA 4U6SA 4WZAB 3HS3A 3M5DA 1GV0A 3JASA 4EGCB 4L15A 3HA2A 5JWOA 3R0XA 1XVLA 1QG0A 1TKBA 1UBTS 3TTUA 1KYYA 3RRYA 1UC5B 4PLCA 3HI6A 1Y5LA 1O6GA 2AOVA 1Q91A 2ZK7A 3BSWA 3HN7A 5GOTA 2G6TA 5JI3E 3FSRA 1G4UR 5EE0A 3CX6A 3GJTA 1VXRA 2IZ0A 3OZIA 4RGYA 3GT3A 5KYXA 5CA0A 4NDNE 1IZ9A 3CIOA 3SMVA 4NJEA 3FWZA 3LUDA 4Y1EA 4TKMA 2C3OA 4TV9B 3WNBA 5A9SB 2G36A 1GT6A 1AF4A 4IDAA 4NNJA 1KAGA 5CFOA 3LIPA 2HL6A 1C3JA 1GDTA 3ZDDA 4HO1X 3UGTA 4ES6A 3ER9A 3JVEA 2DVMA 2FW9A 2O3SA 4N0QA 2HPVA 2XB6A 1LBIA 1R6VA 2F2TA 3C24A 2ACEA 3AEQA 5EXEA 1LY1A 1OFUA 2OUIA 4JHLA 4JROA 1SH7A 1PW7A 3GN1A 3DW1X 4LYGA 4AJKA 3UWOA 4KO1S 1J2TA 1MV8A 4PIMA 2VH1A 5T4FA 1JKXA 1Z4KA 3SS7X 3ILVA 3WLPA 1UDRA 2PPVA 5HCUA 3SSAA 3C0KA 1C3VA 3BIFA 3DQZA 4OB7A 4WXRA 2Z6AA 3ND9A 2PUFA 3V4OA 1XXHA 3D3EA 4FBMA 3EZ7A 4H3SA 4MS4A 4ZQCB 4E4RA 5FUXA 1Y4DE 4BBAA 2H7VA 2QG6A 4FMBB 4JP2A 4LY6A 3SX2A 1DO2A 3HN6A 1XL1A 4MQBA 4MWZA 1HLPA 3JASB 4FBLA 5E2IA 1NF2A 3RVDA 5IFLA 3IQGX 4PSCA 4MMYB 5K3EA 5BN5A 1EWKA 2A0XA 2DPLA 3EZFA 3HGTA 3JARA 3MGGA 3P9XA 4RH0A 5BNIA 2HJWA 4FX2A 4A15A 1ZN2A 4C0HA 3ABZA 5BVHA 1VE9A 2C9YA 2EP7A 2GK3A 4NJMA 3VYVA 3S29A 5JNLA 1FK8A 2ZB8A 4FKBA 4YCCA 3CEJA 1WXWA 1ODLA 1I5EA 3K0HA 1UIRA 3LMKA 5DNDA 3UCEA 2W2XA 2EX1A 3F8WA 4I9NA 1CEQA 1UH5A 1HE4A 3FYDA 4ODIA 4A0GA 4A92A 2AYXA 1CNFA 1PR0A 2ODWA 3LKDA 4P08A 3VR4H 2OHFA 4Z3KA 3WGMA 3CZ4A 2F59A 5C1DA 4MGYR 1T5BA 3TR6A 1EK6A 3DPUA 1IQPA 5K0GA 4ZRNA 2HF9A 3H9CA 4PYLA 5AVKA 4YRNA 2ZPTX 2X1HA 1C3EA 2H54A 1CEEA 2W4IA 4BNWA 1YDHA 3ZX5A 2VRWA 2PZLA 4FIZA 3RF7A 1YIAA 3HV0A 3H65A 3LHKA 4OH7A 1D2AA 4JJZA 3VRHA 3G2KA 4RK6A 1GKUB 1TC1A 2XMBA 1ESEA 1LPBB 2CHEA 2GM5A 2JA2A 3CKMA 2DWOA 3HUEA 1QV6A 4LZAA 3RUFA 5DHPA 1U3WA 3ETCA 4RAOA 4MKGA 2XUQA 3QXJA 1AN0A 3FZYA 2ECOA 2PS9A 4UZFA 3KRTA 4HGZA 4QGGA 1JB9A 2XWBF 3ZXSA 3NX4A 4I0WB 3CUTA 1AQJA 4NS4A 1HE1C 2WD9A 2ZUDA 4JEMA 1U0OC 4CEJB 3HCEA 4I5GA 2IZOA 1P5FA 2D62A 1X8JA 5ALKA 5HJEA 2G9VA 2HX1A 2BW0A 5KHOC 4X85A 1T8SA 5KYXB 4WK4B 1F2UB 2E4ZA 1KPHA 2BH2A 2RKWA 4ON9A 2RGDA 3PQEA 5EJFA 3VHLB 1N2CE 2OXIA 2B7CA 3P52A 1QNFA 5CNMA 3UJBA 1VE6A 1MX1A 1T5DX 2R8PA 4JD5A 1UXGA 4HVTA 4JGBA 4DMMA 2G9UA 2ENUA 4XQEA 5FTNA 3KSRA 2JLUA 3MXOA 4BX8A 1TMKA 1HTBA 3ZWMA 2LW7A 4KR9A 2PWAA 3KQSA 3OO0A 3RF6A 1VCOA 2XLCA 3R4VA 1SBTA 1Y6JA 1RPAA 5A4AA 3L6BA 3PL1A 4LJSA 5LDHA 1HE3A 5HRUA 4FFSA 2A6PA 5F7OA 4YFVA 3L0ZA 1DEOA 4EABA 3GUUA 1DCKA 3HLKA 4G0ZA 1J5XA 3VO8A 4NXNB 1XWFA 4L74A 3K0BA 3AJ8A 3IO5A 2AG1A 2G4VA 4K9DA 2W83A 3SBOA 1IN1A 1Q0TA 1EB8A 3OKPA 3AJDA 3P9RA 4BZPA 3QV2A 2HRDA 2I65A 5REQB 1N0IA 2ZE8A 4FZ5A 2XVXA 3IVXA 4TT3D 1K4KA 4U8HA 2QQGA 4MRMB 4QDZA 5IVPA 3NTVA 1ZG3A 1DEKA 1FY2A 1Y5NA 1UAAA 2PS3A 1HGXA 1E1NA 1LQ2A 3B1XA 4E5YA 4M0EA 1VKRA 1L8XA 2GNPA 3PQDA 3ZQ4A 3K3PA 3NTLA 5ICCA 1IOVA 2G09A 2PGJA 1PQWA 2PWPA 4P4UA 1EU1A 5DXFA 2ZB7A 2PWBA 4NEGA 3ULKA 1W0CA 3DLCA 4LSZA 4MKHA 2EC5A 1UP7A 1RI1A 5CNKA 5JVDB 1E98A 2V7VA 2WOOA 4GNKA 1U0HC 1OGJA 1V5GA 3OF3A 5DMXA 4BMDA 4DRXB 3THWB 5BQOA 2J3KA 3OIGA 2PRJA 1RYDA 1I2AA 1L1EA 3MN1A 1IJEA 1IK6A 2VI5A 2CWWA 4QJ5A 3RUPA 1U90A 2MSCB 3KYDA 3O8LA 5G0UA 5JSUA 1F51E 3JAWA 1N2SA 1EG2A 1P4AA 4EG3A 1QH8B 2YN4A 1Q20A 3BMOA 1GZ7A 4IS2A 4LYDA 2N9UA 2NYRA 4BVGA 1JFSA 1YJAA 3E8SA 1P9RA 4EVSA 2OZVA 3F6YA 2NAFA 5EZQA 4FMCF 5EQTA 4BP8A 4RXTA 4JL6A 2ZIUB 1E1LA 2JC3A 1XA3A 3FRIA 1X7WA 3I34X 3AUTA 1L5NA 3CXUA 3X1XA 2QUAA 3ZGVA 4E6PA 3L0YA 1J9ZA 4KSCA 5E4JA 4KE7A 1MIOA 3EVAA 1WXFA 4Y1GA 3NWJA 3ZD7A 1H2WA 2WZQA 3CCCA 3H4MA 1TYZA 4UCFA 4B5LA 4XAQA 4B47A 2DU8A 1QVRA 4ZV9A 4EVQA 2JI7A 3IDZA 1FFEA 1A2QA 1NZDA 1SIWA 3AP3A 4N82A 1J0DA 5CBKA 4HTFB 4B2YA 3C3CA 2FJPA 4ZDIA 1K6JA 5C8YA 3EVZA 1VCHA 3CH7A 1Z6PA 2J8ZA 4CIXA 3ZLTA 2AVDA 5ILGA 3A37A 2K7ZA 3E58A 3GPCA 5LBUA 5K0TA 2GPSA 2OC9A 2XEDA 4LVOA 2XUZA 2HXYA 1DRVA 3F4KA 1R5NA 4LSGA 4JR0A 3WKAA 4X92A 1N2BA 5CEJA 3ZJTA 2PVSA 3BK1A 2JLXA 4NEHB 2W48A 1H4QA 4HTAA 4OGGA 4QBGB 1HC7A 3UJAA 3TLMA 4V1CA 2Y93A 1JEEA 1I2CA 4B4OA 4EG4A 2EFGA 3NAGA 4B75A 2WWYA 5HW0A 1SC3A 2B6NA 4V02A 1YQ9A 4HNAB 4EHHA 5KQGA 1B23P 2XNKA 4HGPA 4KMRA 2CYAA 2FPRA 2PKXA 3GT7A 5GV8A 4DA9A 3QBJA 2I4OA 1T0IA 1W34A 1TMYA 2GQ0A 5LDGA 3K0EA 5B58T 4DABA 3EBLA 3TSAA 4WV3A 3WY9A 5HRAA 1WZEA 3BK2A 4DR2B 4C0BA 3A28A 5I9TA 5KTMA 3S1AB 1QUEA 5F7JA 5A9RA 5FLXA 1L1RA 3MMNA 3TW0A 3DCYA 3FBWA 3W5UA 4XB6B 4BVJA 1DHTA 2GILA 3GA0A 2Z1NA 4W6ZA 1B4DA 3AYZB 1DQNA 5HM6A 2WE7A 3RADC 3AR9A 2EHJA 4TSKA 5EKUA 3F2IA 2Z2JA 3N8GA 1LLCA 5F76A 3PE4A 5L3SB 1RKXA 2FN9A 1JUDA 2M6RA 3S27A 5H0IA 1YVPA 4DC1A 3K32A 1DBWA 2Q27A 3VZSA 3DGEC 1TT5B 3A6JA 4EFKA 2D5LA 4I9GA 4JJEA 4QTUB 5AUOB 1B73A 1T6ZA 1REQA 1ZRHA 1JDZA 2Q3CA 2ZIEA 4DM7A 5BWNA 5A5GA 3T35A 1NJGA 5HOQA 3DFZA 3OA0A 2BCGY 3OSZA 4GQIA 4JI1B 3ZBPA 3IIJA 4GWLA 3M1IA 1OOEA 3KR0A 4CNQA 5JNUA 2O3QA 4YRAA 1QFYA 1FZTA 3A1FA 3LTEA 4LRWA 4H6PA 4JV5B 4HAVA 1JFLA 3WFJA 3CLHA 4O2AB 1I6KA 1S9HA 2QT0A 5G4KB 3GJZA 4IFEA 5ECYA 1GQRA 2A7QA 1ZCJA 3IVRA 4FFMA 2P2DA 5IH7A 1U2GC 4YA6A 4GKVA 1XMSA 1OA1A 5ADHA 5I7SA 3A7EA 1TQ4A 3DL4A 4UNQA 3RYHB 4DSAA 2CCGA 4MV6A 3TDNA 4YMLA 4E11A 4PSVA 4CKZA 2BMJA 2AWOA 1YQEA 3QVMA 3COPA 5I8ZA 3QEKA 1RYZA 4FR2A 2XTNA 4E2XA 1RMTA 2XXBA 4YN3A 1AKYA 2YZ2A 4IIUA 4FK8A 1KFBB 1YR2A 4EG8A 2OL4A 3EQZA 3FGZA 2QRJA 3KD2A 4MKFA 4XCXA 2F64A 1QDUA 4QYTA 3ZD6A 3I1FA 2VAPA 3BB3A 2AN5A 1FUYB 5D7BA 2WY2D 4BP9A 3FOFC 2X0JA 4YJ3F 2NT4A 1N5DA 2QW8A 3PDUA 4QYIB 1XPUA 2RONA 2P3QA 3IUPA 4GAEA 2BDUA 4QGSA 5E9JA 2WEKA 4G65A 4C7XA 2FSHA 4DLYA 4RW0A 1GRRA 3H83A 2WIJA 4XLTA 2DLDA 1VG9B 5EFZA 2M2IA 3EJ6A 5LYJF 3MNFA 3PT9A 1RLMA 3NHSA 3NATA 1W5AA 3FY4A 3CC8A 1HYGA 3HB1A 2MSKA 4BKUA 2GN6A 1O9HA 2J6BA 3GEBA 3GC6A 3OZWA 2B1QA 3C15C 4R3WA 3AVTA 4FB5A 4V0SA 4BLWA 1DARA 1EI9A 1JILA 1U3GA 3IALA 4DV7B 3ML1A 3K9NA 1R16A 2BHNA 3WDMA 2ZWMA 1Q1AA 2X14A 3QVSA 4KVZA 1RM0A 3KJZA 3KQVA 3L82B 2JLRA 1N75A 1OR8A 1TECE 2AUNA 2G80A 1FXWA 3RVOA 1Y7PA 1KMCA 4TSFA 4U7GA 1TMOA 2XDQB 3BRWA 4BV8A 2H4HA 3KU4A 3NOVA 1D5WA 1AX9A 3P9NA 4OD0A 1X7ZB 3MAGA 2HK9A 3PGLA 1CUJA 2EOAA 1ES9A 1BSVA 3NHPA 2OHOA 3OT1B 4I81A 4XA8A 5DM4A 1BE8A 3ESRA 3U81A 4D92A 4AQ7A 4NFHA 5I47A 1D1PA 5CXQA 2DBRA 4NZZA 4TROA 4IW3B 4X97A 2QMHA 5F9MA 3A27A 1OVGA 1VE1A 5AJXA 3E5RA 4ZOEA 3WIUA 3HUUA 4R01A 4BFYA 1YZLA 2C78A 4URXR 2VNJA 4RSGA 3P0FA 3P45A 1J5PA 3ZX4A 2X9QA 2GZ2A 2B9EA 4L9SA 1RACA 2QRNA 4MVJD 5ICSA 4YJ2F 5JZSA 5TMDA 2R2GA 1BRMA 1W5EA 4GGMX 1BH2A 3LBNA 2GO7A 4X6UA 4ETMA 1ECGA 2NV2B 3CWCA 3RAJA 5LZ2A 5J2UF 4LGVA 3HWRA 1JYFA 1LS1A 4QDXA 2Y66A 4Z8YA 4EEZA 3ZWCA 2RHOA 4ER0A 4F3KA 1EA7A 4HX9A 1BVHA 3CSDA 5JYEA 1JSRA 4G0XA 5AM2A 3O38A 1NY5A 2Y76A 4P4SA 4NC9A 4H18A 1K7EB 1XFDA 1VZ3A 3I37X 4CMIA 3D9QX 4F45A 2FSUA 3ZPXA 5B64A 4WLNA 1ZMXA 3KOUA 1AHNA 1N5RA 4KHZA 4JX9A 3B1VA 4URZR 4YJKA 4ZIRB 2G67A 2KMLA 3QKWA 5JJLA 4X6YA 3OQ1A 4XYBA 3ORHA 4LOIA 3MLBA 1U2DA 3MRXA 2XQFA 2X0RA 4LRQA 3H87A 3LWZA 3I4FA 1QHHA 5FI3A 1FVXA 3EVCA 5DLQC 2DR2A 4S1OA 4NOLA 5IYZF 1AGRA 3PTZA 2EXXA 1U8YA 1ZJ6A 3ZIAA 1Y6GA 1Z38A 4MQ5A 4U0KA 4Y6SA 4BZQA 4RKYA 1TTTA 4DBLE 3V2UA 1X7ZA 3Q0TA 2HLDD 4CM6A 2JVJA 1AV6A 1PBTA 1X38A 1TEXA 3E4CA 4K9LA 1E0AA 1Q92A 4HXGA 4P22A 1T4CA 3EXIB 4OJYA 1OXVA 1U0RA 2Y3IA 4LC1A 1ZJYA 4JCCA 3RIXA 3PEFA 4C89A 1A88A 1G8FA 1JA9A 1GLVA 5FPPA 2GAAA 4A2QA 5EGNA 2X9GA 1WD7A 2AJTA 1VSQA 1NULA 1G4AE 1WHSA 1UBOS 4YYEA 3WLEA 4KGDA 4M7PA 1NW3A 5ALRA 1GR0A 1SC9A 4L4XA 1KS2A 5L6LB 1KZ6A 1U8CB 2EP8A 2VUSA 3LYUA 2HYDA 3VO9A 3VU9B 3FYTA 4I1PA 3DHWC 1L5QA 3IQHX 1O0BA 2ESRA 3ST7A 3EGXA 4XR4A 1MU0A 5H81A 3B51X 1HDZA 1IQ0A 2OKCA 4IXTA 2BTQB 2H31A 5UKDA 5DYNA 1MMFB 2PSSA 3FCUB 3PXDA 2CWDA 3L6OO 3LT4A 5FWDA 3BORA 2QMUA 3V32A 1DC8A 1X86B 3SIWA 3VZCA 1SPBS 1CE8B 3HR7A 2FNAA 4IAOA 3GMIA 5AVWA 1DFGA 1U3DA 5FUWA 2GO1A 2P30A 4FVTA 3TXYA 4CMAA 1WP9A 2BFWA 4DREA 3GRCA 2YHUA 1Q16A 4NCIA 2JAHA 3HQ4O 3PNLA 5ELXA 1AXGA 4WEQA 4RK4A 3OTOB 1IZ0A 1A1SA 1JR4A 4ZV4A 2RGUA 1UMCB 2ENWA 2GA8A 2PH1A 1U11A 1AQYA 1UAYA 1YTLA 2P9HA 3DXYA 3G9XA 1ODCA 1NBME 3VH3A 2IHZA 3N0XA 3LRPA 3VU1A 1H0HA 3ZDEA 1QH1A 5J4LA 5J4YA 5L45A 1C5KA 3MSCA 4PC7A 1A8SA 2OMEA 1XZKA 3GGGA 4ESOA 1QO7A 2GZSA 3SZUA 5D1HA 13PKA 1OFUX 1P1IA 3OIUA 2O5VA 5CIWA 1VIDA 4NG5A 4JDUA 3QKUA 4OQNA 4RKFA 2PGIA 2WE8A 3ECSA 3GUCA 2VF4X 1YBVA 3BSYA 2QY9A 3PVZA 3VDNB 1BJKA 1Z2AA 5D6NA 5FYQA 4CFZA 2J41A 1X8XA 1X94A 3WRWA 3WTCA 4MUEA 1L7PA 4AKIA 1P7VA 2AUMA 2IXFA 4R98A 5B3AA 3VBEA 1ETHA 1YUNA 2A1TS 1BDMA 1LTKA 5CT4A 5I7VA 2GVZC 3HB4X 1Z8HA 4JJFA 4JVNA 1F2TB 4E4TA 2X58A 4Z7QB 5MGBA 2X13A 5DBFA 3QA3E 4DY6A 5T5QA 3FVWA 3IUYA 5E4YA 1B6TA 2B83A 1YCFA 3HDQA 1GCIA 3L8DA 3NEAA 3NV9A 3O0DA 1TUBA 3L1IA 4CN8A 1ZKMA 2VLIA 3B3GA 2FHSA 3OQOA 1G7TA 5MF6A 3QI7A 1MD9A 4ZVUA 4RVHA 5E1BA 4BNZA 5HQJA 1JG2A 2H8KA 5HF9A 4MQ6A 2BGIA 4YUVA 4B7XA 1NDHA 4NBLA 3ZLUA 3LW8A 4MDYA 5HFJA 1YQDA 5JMTA 5ALWA 4IRUB 5EXDA 3UW3A 3WLRA 5CA1F 5A0TA 3EXFA 5HYVA 1S2DA 3IT0A 4Z7JA 1EFCA 4NAVA 2BMFA 1HXHA 1T4CB 2J3HA 4QU5A 2O2IA 1TJ5A 3VBCA 1XROA 2AT1A 4P38A 4BVBA 3PWSA 4CLEA 2ZBRA 3EVGA 4G5OA 2AOWA 6AT1A 2E5LB 3QW2A 5DBGA 3E5NA 4D6XA 3MJVA 1KI3A 3HDJA 4TSRA 3Q3VA 1L9KA 1YU9A 1GVNB 5SYAA 1JDUA 1FUKA 1FDRA 1YKFA 5F7XA 5KVVA 5A06A 2PGOA 4FPXA 3SK0A 5EZYA 3PNMA 1PWEA 1V3TA 2BBSA 3L7LA 4JP1A 4IIFA 3V1NA 4XWTA 1UPCA 3CUYA 3KNZA 2J5QA 2H2FA 4DRZA 4I46A 3CZCA 2X5KO 1EG7A 2WFLA 4Z49A 3JQAA 2OBFA 2YNMD 3FCCA 3PJFA 1KDYA 3U1TA 4JUDX 1MUUA 3D3KA 2VTVA 4WESB 4ZP1A 3P8ZA 3B2QA 1RBQA 2YXEA 3P9CA 1M2WA 2J6HA 2D0IA 1E18A 2P8JA 2Y92A 4UEKA 3CEHA 2GCNA 3ELBA 4BAGA 4KPFC 5CVTA 2HCJB 3AZPA 3PPWA 2XCQA 2C3UA 5B1YA 4BKQA 4JYPA 1NMYA 3S55A 2H1CA 5CXXA 4BTEA 3EGVA 4FN4A 2R85A 1Z2NX 4NZOA 4QYWA 2XOEA 1HMYA 2P2CA 1JHPA 5CM2Z 2ONJA 1R0LA 1HNZB 1O89A 3C5CA 2BR3A 4IMPA 1FA9A 2ZRAA 4MV5A 2W2KB 3LUFA 4M88A 2REBA 4F72A 1U02A 3OCWA 1Z34A 3K2EA 2V55B 3JXEA 3NG1A 4FS8A 4Y6OA 3A26A 2Z56A 2BR5A 1COWD 1OBHA 1QC5B 2BHTA 2GCIA 2VBIA 5TQ2A 3W78A 1L7RA 4AY5A 3OQBA 2EW8A 4DG8A 4CKCB 3SG0A 2H1OA 3RBVA 4ZREA 1X1TA 1BOFA 4HDAA 3EZXA 1FFHA 1NX6A 5C1PA 4DR1B 3TQFA 3WL8A 1MABB 1BN6A 4KPYA 2FAXA 4J90A 1VI5A 3T4UA 1NVVQ 3QTTA 3S1LA 3UA3A 1ODJA 1Q6ZA 3GP5A 1SAYA 2NSYA