1JG4A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosylmethionine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords protein-L-isoaspartate O-methyltransferase
total genus 71
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg4A00
5K0JA 1FJXA 3M33A 5E1OA 3TFWA 4ER3A 4P7KA 5H02A 2EJUA 4OA8A 5EQJB 4GC5A 5EGSA 1P91A 5DWQA 3JWIA 3MAGA 4Z2YA 4EQZA 5LQUA 2ERCA 4HC4A 2P8JA 3OU2A 4Y30A 4PCAA 2ORED 5DLYA 5DSXA 1P1CA 2JHCA 3EVBA 3HCCA 3ERCA 2JHPA 3PB3A 1L9KA 3TKAA 4PYMA 2ESRA 1FBNA 4FT4A 3KQSA 4OBWA 2OB2A 5DTRA 3EVAA 3VSEA 3DMFA 1QYRA 3FPGA 2ADMA 3I53A 5E8JA 3SR4A 3HVKA 3CJQA 4AX8A 2WA1A 3KR1A 4RTMA 1IXKA 1SUSA 5HIJA 2P40A 3ANXA 1AF7A 2I6GA 1KP9A 5FCDA 2QY6A 3FRIA 3GRZA 3VC1A 2ZTHA 3UJ6A 5K09A 5EKUA 3A26A 3PT9A 1RI5A 2QRVB 3B89A 1JTFA 4YMHA 4EK9A 3M6XA 4RVFA 3PTAA 4YV2A 2H11A 3E7PA 4AZSA 1BC5A 2OB1A 3O4FA 2JHAA 3DTNA 2PSSA 5HILA 2P41A 1T43A 3LCUA 2C7PA 3IV6A 3GO4A 1R8YA 4OBXA 1ORIA 3SVZA 3PX3A 4BLWA 2Z6QA 5EIWA 1BKYA 3C3PA 5CM2Z 4PYNA 3CVOA 2BR3A 4PNEA 5FA8A 5FWDA 3UWPA 3NMUF 1D2CA 4NECA 5FUBA 2ZULA 3HCDA 3V8VA 5BW4A 1RJEA 3HTXA 3LDFA 4BP3A 5K01A 4HG2A 5K0LA 4FSXA 2UZ4A 4G56A 3KQYA 3QOXA 3B3GA 1NBHA 4PYJA 2AVNA 5EC8A 3R9XB 4GF5A 4M37A 2OYRA 5KYGA 3TPZA 2ZW9A 4X60A 4M36A 4PYLA 3MB5A 2YXDA 4QTUB 1G60A 4DZRA 4CKEA 1N7IA 1G8AA 5E8RA 4C03A 2PV0A 4CTKA 5EMLA 2I9KA 8MHTA 4MQ4A 3OFKA 4R6WA 4U7PB 3P2EA 3UJ7A 1JQEA 5DSTA 3P8ZA 5CVUA 5C1IA 3C3YA 4C04A 3I9FA 4PONA 3RIEA 3HA5A 3F4KA 3HVIA 4KW7A 2PXXA 1QAOA 3HCEA 1JG3A 4FR0A 3UJDA 3P9NA 5EIFA 4R8RA 1RI2A 3LBYA 3A7DA 2A14A 3UA4A 2N47A 5C9ZA 3JWGA 3MGGA 4ER5A 2DPMA 2CWWA 4C06A 4KDCA 4M38A 1NBIA 2FK8A 2PWYA 3EVGA 2QRVA 4RV9A 1NW5A 1VPTA 5FTWA 5HFJA 4CWAA 4F84A 2PWPA 1G38A 1R18A 2PT6A 1Y8CA 1XVAA 2PVCA 3BGDA 1VIDA 3OE4A 5EVJA 5BW5A 1L3BA 1O9GA 3M4XA 3E05A 3EEYA 2AOTA 3A25A 2PBFA 4RTKA 2GA9A 3LCCA 4R6XA 4XUCA 3GRRA 2OY0A 2O57A 2ZBRA 1ORHA 2FRXA 3R3HA 1BHJA 5BXYA 3IHTA 5F2NA 2B3TA 5FHQA 1YFJA 2PX5A 2IBTA 3R0QA 3I58A 5DM2A 1IM8A 4EKGA 3GGDA 5E2BA 4CXMA 5DTQA 4IKPA 1JTEA 1TW3A 3B7PA 4KWCA 2Q41A 5DXAA 4C4AA 3DR5A 1NW8A 3DMHA 4GOND 1EQAA 2UYQA 4RVHA 3KQPA 1P39A 3LKZA 2ZBQA 4CKBA 2ZFUA 4HRAA 3EVCA 4DM3A 2G8NA 4RVGA 2IH5A 4P7JA 3FUUA 5LQKA 3T7SA 4YUWA 1EJ6A 2ONZA 2HNKA 5F2OA 4E31A 1KYWA 2C7RA 3G8AA 2AOVA 1MHTA 5HIMA 3CC8A 4RTPA 1KR5A 3TM5A 2BR4A 3KPJA 3M70A 3P2KA 4HH4A 4Y2HA 1JSXA 3SGLA 2PX4A 3FTCA 3R24A 4AUKA 3JWJA 2KW5A 3BT7A 2YUIA 4QQKA 5K0NA 1SQGA 3LECA 4HGYA 1SVUA 3G8BA 4K6MA 1SG9A 1X1CA 2FK7A 4IV0A 5DM0A 5GOZA 3TR6A 4POOA 4OQDA 5E9QA 5LQAA 3SSNA 4EVIA 3GXOA 3FUXA 3G2MA 4E2YA 1XCLA 3KQTA 5K0BA 5ERGB 2IDKA 5GM2A 2PGXA 3PFGA 1WXWA 5LR6A 4E2ZA 1VE3A 1NKVA 3U81A 3P9KA 4C05A 4YV0A 4PIMA 2VDWA 4C07A 5DXJA 2YTZA 5IKMA 4RTSA 3KKZA 4DF3A 10MHA 1WS6A 1UIRA 4O29A 3SSOA 4XUEA 4JXJA 5GP1A 3HVHA 2V7EA 1VL5A 3GJYA 2IGTA 3P9CA 3T0IA 1KPGA 4X1OA 1N7JA 3HCAA 3ER8A 1R74A 4DMGA 2IBSA 2FHPA 3D2LA 2AS0A 1M6EX 2H1RA 1EJ0A 4DA4A 4OA5A 4A6EA 1NV9A 2PX8A 3ER9A 1JG1A 2IIPA 2GPYA 3G88A 3GRVA 2ZZNA 1F38A 2PJDA 3FUWA 2HR1A 2NP6A 1L3IA 3R6TA 2NNWB 4BLUA 1QAMA 4CKCA 2ZVJA 1AQJA 4QQNA 1R8XA 1R00A 4GOMD 3REOA 2HV9A 3FRHA 2OBFA 4QTTB 3DLIA 3NWEA 2VP3A 2EFJA 3T7TA 1Q0TA 4E2WA 3OZRA 2NXCA 2ZSUA 3LKDA 2ONYA 3EGIA 3IYLW 5FULA 4ER6A 1JR4A 5K0GA 2O06A 5CD1A 4BY9E 4M7RA 2YR0A 5EMMA 3DH0A 2UYOA 3HA3A 5G02A 2XVMA 4PIPA 3RW9A 4OX9Y 5HZMA 1O54A 3HNRA 1KYZA 2EG5A 2OZVA 3FYDA 1HNNA 2GB4A 1YUBA 3EVEA 2VZ9A 4RVDA 2AOUA 3UJAA 2IDJA 4P7FA 1ZGJA 2DULA 3LHDA 4FSDA 1RI4A 3L8DA 3AY0A 3TOSA 2ZWAA 3A7EA 1YFLA 1WXXA 5HOQA 3AXSA 2XYQA 2AZTA 5CUQA 5CVJA 1DUSA 3PVCA 4BLVA 4XCXA 2P3OA 1X1BA 3UJ9A 3FTDA 5FQNA 4ER7A 2NYUA 4PYKA 4KIFA 1YZHA 1EG2A 4F85A 2G1PA 2ZCJA 4MWZA 2BZGA 3KQOA 3BWYA 3HEMA 1JSZA 5EHIA 2QE6A 1NW6A 3KPUA 3I5UA 3NTVA 3BXOA 3UBTA 1NW3A 5DTMA 1RI1A 1D2HA 3QOWA 4GOLD 3GRYA 4PINA 3T7RA 4MHTA 1QANA 3LPMA 2PY6A 3Q87B 4PYOA 4RSRA 3THRA 3Q7EA 3X0DA 1DCTA 4R8SA 5DPMA 3RODA 1XCJA 3FTEA 3LGAA 4P58A 5EMJA 5KVAA 1ZQ9A 5DM4A 4AZWA 2P3QA 3EGVA 4ISCA 1VP3A 4R05A 3BGIA 1INLA 3TKYA 4MIKA 1JG2A 2AR0A 2CKDA 2PX2A 3NWBA 3IEIA 2JH8A 3NDIA 4ZTBA 5C0OE 3G2QA 3LX6A 4E30A 4RTRA 4PGHA 4WVLA 2P7HA 2C7OA 3BKWA 4P7GA 4EMSA 3M6WA 3KR9A 2BH2A 1XXLA 2GS9A 1I4WA 2FPOA 3BZBA 3ID6C 4HTFB 1PJZA 4MTLA 4U7TB 4F86A 1JG4A 2IFTA 1P1BA 3H2BA 2G72A 1B42A 4DCGA 1WG8A 3K6RA 4E2XA 2VS1A 4GQBA 3EMDA 4RTLA 1RJGA 4BP1A 3AXTA 2JG3A 2I7CA 2QM3A 3SXJA 3ELWA 2AOTB 2WK1A 2HWKA 5LQNA 5EPEA 2NXJA 5DRTA 4EKIA 1O9HA 2HMYB 3BWBA 3PS9A 3UZUA 2FCAA 1FP1D 2O05A 3C6MA 4HGZA 5FA5A 2GLUA 3VC2A 1WY7A 3E23A 4X63A 2AOUB 2G70A 2IH2A 2ZZKA 5ICFA 2B2CA 1G8SA 2AN5A 3G5TA 5JUWA 4IWNA 3MERA 2EJTA 5E1BA 5E1DA 5E9WA 1IY9A 1RI3A 2BM8A 4LG1A 1L3CA 2GAFA 3KR0A 3ME5A 4YV1A 2HTEA 2IPXA 4PCLA 3B3JA 2ZIEA 1F3LA 2PKWA 1KIAA 3TMAA 2YQZA 3EGEA 5CVDA 3DXZA 3DP7A 3OU7A 4HTFA 3A27A 3OZSA 1U2ZA 4H0NA 4QPNA 3OFJA 5D1HA 3FPJA 1I1NA 3SMQA 4QDJA 4E33A 5GIPE 2XYRA 2R3SA 2Y1WA 3E8SA 4X61A 3ELDA 5DT2A 3KQQA 2IP2A 1JQDA 5P8WA 1VQ1A 5EKXA 4GUAA 3KR2A 3FPHA 2LD4A 1G6Q1 3DXXA 5EZSA 3S68A 1BOOA 3FPEA 3ELYA 3M6VA 2ZIFA 3CGGA 5LSAA 4FS8A 3LDUA 3FZGA 1UFKA 4UOEA 1KPIA 4PYQA 1FPQA 3WSTA 3OCJA 5KQRA 2UYCA 3KPVA 1R6AA 3MCZA 1V39A 2BR5A 3LCVB 2CL5A 1ZGAA 5FHRA 1YB2A 5E1MA 2GH1A 1PRYA 3GDHA 3LBFA 5HIKA 4DKJA 5T64A 1G55A 2YXLA 1HMYA 2B25A 1KHHA 3CJRA 3AWIA 3M6UA 4FP9A 4FZVA 5GIOE 1JQ3A 2JJQA 3TM4A 5GINE 4L7VA 5F2KA 4CTJA 4YMGA 3LL7A 2JH9A 2P35A 2PT9A 3B3FA 1VBFA 1N2XA 4RWZA 4LECA 1YF3A 5E2AA 3OU6A 4E70A 4RTNA 3KPWA 2FYTA 2ZBPA 3G89A 3MTIA 3G2PA 2VDUE 5FADA 4KDRA 5M5BA 1SKMA 3PX2A 2AOXA 2PXCA 3LDGA 1ZKDA 2XBMA 3P9IA 1XJ5A 1YZ3A 5GWXA 5DRYA 1X19A 3UA3A 2OO3A 2B9EA 2YXEA 1Z3CA 3G5LA 3GU3A 1RJFA 1X1DA 2O07A 4FT2A 4GC9A 3GRUA 2P3LA 5ICCA 3NVKI 2XVAA 3BGVA 3CBGA 3KU1A 3BKXA 2K4MA 3C0KA 4FGZA 1XDUA 4KIGA 1M0EA 1X1AA 2AOWA 1M6YA 5BP7A 2OPBA 3DOUA 3KQMA 4QDKA 5EZQA 2QYOA 5K8VA 3C6KA 1QAQA 5ICGA 3OE5A 2ZZMA 4X41A 3DXYA 3AJDA 3KQWA 3CCFA 5EG5A 3V97A 3DUWA 3ORHA 3FYCA 3VYWA 9MHTA 3A4TA 4QVGA 4LWOA 3QV2A 5T67A 3EEOA 3P97A 3G7UA 1SUIA 2PXAA 3PFHA 2B78A 5GM1A 3SSMA 2Z6AA 5EEHA 5DM1A 2VDVE 3O31A 2OXTA 4C08A 2NXNA 3FUVA 4RTJA 2H00A 1EAMA 3GWZA 3HCBA 1NE2A 1TW2A 3CJTA 2CMHA 4KRGA 4A6DA 2R6ZA 2PLWA 1XTPA 1NV8A 5DX8A 4XUDA 5FWAA 1WZNA 5LQCA 1KXZA 4PYIA 1EIZA 4YUXA 4QPPA 5JR3A 3FPFA 3P71T 3UJBA 4RTOA 4GOOD 5T6BA 2Z6UA 5K05A 4E32A 4YUVA 2ZLBA 2AVDA 2NP7A 1DL5A 4LWPA 3OZTA 2Y1XA 4B17A 2OKCA 2UYHA 3I64A 3FTFA 3TRKA 3NDJA 5EHGA 3GNLA 5IH3A 5LQRA 2V74B 2XYVA 3HCFA 2P1DA 1MJFA 3EPPA 4KVZA 1ZHFA 2CMGA 5LQJA 1AV6A 1UWVA 5K03A 4AZTA 3GIWA 4PWYA 4ATNA 5KS2A 3P2IA 1TPYA 3BWMA 3DLCA 3EVDA 5CVEA 3LSTA 1KPHA 3KHKA 5CCXA 1Q0SA 4V0RA 2C7QA 1NW7A 1VLMA 4DCMA 3JWHA 5K0CA 3PLAE 1H1DA 3HA7A 3G2OA 5CIYA 3OPNA 5CVVA 4GEKA 2P7IA 4HSGA 2YX1A 5HIIA 1I9GA 4ER0A 2F8LA 5FQOA 4PGGA 3THSA 4YUYA 1ZG3A 3MHTA 3DULA 5EOVA 3SM3A 1AQIA 5D1NA 3HM2A 3UFBA 5EMKA 5E9JA 5MHTA 3UJCA 1RJDA 3BUSA 2YVLA 2ZIGA 3KPYA 3O7WA 3TQSA 4YUZA 5CCBA 1XDSA 3B5IA 3HVJA 5U4XA 5EEGA 2AN3A 1NT2A 3EVZA 1L1EA 3ELUA 5K0FA 2G71A 3EVFA 3NJRA 2AN4A 4RYLA 2IH4A 3SX0A 4IV8A 2I62A 3TLJA 2ZWVA 2BM9A 3KQVA 3NW9A 1XDZA 4AZVA 2WA2A 3MCTA 5DX1A 5KQSA 2EX4A 1OR8A 1FP2A 1VP9A 3EMBA 3K0BA 3MQ2A 4DQ0A 4RTQA 5DX0A 4V0QA 3DMGA 2E5WA 3MTEA 4OQEA 4WXHA 5HEKA 5ICEA 3GCZA 1QZZA 2NXEA 3BWCA 3NVMB 3HP7A 3FUTA 1D2GA 5B1SA 3UJ8A 3CKKA 2O0LA 4GBED 7MHTA 1SQFA 5K0EA 4QVKA 4RX1A
chains in the Genus database with same CATH superfamily
2HXYA 5KWVA 4JT4A 2FFBA 1YULA 2XTNA 4MMYB 4ZT3A 1KQFA 2ZTVA 2FSVC 1XELA 4KV7A 2X0NA 3OF2A 4LQCA 1SPXA 3TZQA 3D8TA 2MSLA 1YKFA 2CJPA 2QLTA 3GMSA 2XE7A 5CMLA 5F76A 2W6ZA 4BNTA 1JMKC 4Z5XA 5BV2P 3I09A 1Z74A 2XUIA 2RHDA 3F6PA 5KVQA 2VT2A 2YJ4A 4JQZA 4MI1A 1I7DA 4MGEA 2PU7A 1SB8A 3QU4A 5F5NA 2VSXA 3ANXA 3N8KA 4BBPA 1AXGA 4UUNA 3BN3A 4RU1A 3U7JA 4P81A 4WD3A 2GZ1A 3UJ6A 1GSHA 4A03A 5T57A 2YXPX 2X41A 2HC9A 2NPIA 4IJKA 1IC6A 4Q1EA 1MVNA 5EQFA 4WXYB 3IP9A 4K9PA 4JLOA 2C96A 3GGGA 4BTLA 1KEUA 3ADOA 4U7HA 5J1TB 3ESAA 3OC0A 5LIRA 1W0CA 4OK3A 3GDFA 1GEEA 1V6CA 3BIWA 3IR6A 2ARKA 2AA3A 1TKRA 5IJXA 5EJ8A 1Z8DA 5JCPA 5BNIA 2WIBA 4N03A 2REBA 3GO4A 1IWBB 1CERA 1ORIA 4BLWA 2FLWA 3DTVB 1HDZA 3DDUA 2RARA 5AHXA 3KFXA 5EJAA 4X92A 3RU9A 3VO9A 2FZLA 1MX1A 4DPMA 2BR3A 5FEUA 2XNJA 4B9EA 2O4UX 3AI2A 4CEHB 3U16A 1FS4A 1U2RA 2A0FA 4NECA 4AVYA 4CIDA 2F1KA 3NH6A 2VYND 5K01A 4IDFA 1V5WA 5TF0A 2FFAA 1XAGA 5I9TA 3I4FA 2PRYA 3KQYA 4MDYA 5BW6B 2JAUA 2P9YA 3OKAA 3UB2A 1SURA 1XNRB 2F67A 1NU6A 2OYRA 5KYGA 4FONA 4R5HA 3ZTYA 1H9AA 4M36A 2WDPA 5F1OA 1UDBA 3RE1A 2I1QA 2OCGA 4PS1A 1XRPA 4JR1A 1FUUA 4LRSB 1HFWA 2YCBA 5H3LA 3TBFA 3WLAA 5HRUA 3TNJA 3DXFA 1C30A 3A1DA 3IUNA 4JROA 2FR0A 4YFYA 3CF6R 4G67A 3HABA 4DY4A 5LMCA 1J2UA 4BCBA 4BLOA 1E9CA 2VCHA 3I9KA 2FR1A 1NXWA 3LOQA 4FDAA 4NPAA 1QAOA 4UVHA 5B37A 3W5IA 2AZMA 3RANA 3QF7A 1U0RA 3TIVA 4A36A 5EIFA 5A9SA 3PYLA 2G7MC 1C8BA 1O0SA 3QW2A 2YHIB 5ALOA 4EJ6A 1WV0A 4UUMA 1T5IA 5JNTA 3EG9B 3KKLA 5ALMA 2JLSA 1OGIA 3KCNA 4CU5A 3G8CA 3LPCA 4WRRA 2QTLA 4HMPA 3A32A 1ZA2A 1G4AE 3U09A 4DR6B 4V39A 1JBKA 1H4SA 5JAZA 5EVJA 1SBCA 5IT0A 2QBYA 4Q0MA 5CNJA 3ZI4A 3DL2A 4IFBA 5ADVA 1A76A 1DQPA 2FWJA 3V8PA 3QU7A 4INJA 2ZUVA 1Y7PA 2DFDA 2QTMA 1B8PA 2VHVA 2ZAGA 4M87A 1GA1A 4E03A 1W19A 1RBMA 2O1EA 2R1TB 4XPIB 4C0WA 3HDYA 4WIAA 1XTIA 3HXLA 2CCJA 1S2IA 1MH1A 3KTDA 1IG0A 3WNCA 3QOFA 4WN9A 3R1IA 7YASA 4IOMA 1X6VA 3V00A 2HHLA 4A23A 3EXG1 3I2IA 4BNHA 4LCBA 4KWCA 1HT1E 4C4AA 1WEKA 3JS5A 4GOND 4EEZA 1BH6A 2O6HA 4KH1A 3FMGA 5EYPB 2P30A 4EKYA 1MQ8B 4BQFA 5TGDA 1A04A 5IUJC 3P32A 3FUUA 3V4PB 3MVEA 2ONZA 4AJPA 4NAHA 4BN5A 1KYWA 2KLBA 4MWCA 1GKUB 2JIOA 3THYA 2PNJA 3WO1A 3F3SA 3CXUA 2Q0QA 4EPTA 1KJWA 2BR4A 1Z12A 5K8JB 1IEXA 1DIOB 2QX8A 4GD3Q 2NT4A 2PX4A 4ZPXA 3P2MA 3RSHA 3WOVA 3LIIA 1LBQA 2ZTUA 4JL5A 4ASUA 1RHJA 2PL3A 3GLGB 4G25A 2B1RA 1J9ZA 1E58A 3GJRA 2YV3A 4PZDA 5DM0A 3W3AH 3LUDA 1NFFA 3HPQA 1Z6QA 1IZZA 1WKBA 3RS8A 4YYZA 1G9TA 2WUEA 2GNPA 4B32A 4M0CA 1N8NA 4FX2A 4LDZA 4ABTA 1PJRA 1QMPA 3NIGB 2RDMA 2ZJOA 2QJRA 4B2IA 2H1FA 2CVZA 2R6AA 3RVBA 3LD9A 2J32A 4MI9A 1F8YA 1JL3A 2H7CA 4YV7A 2WTXA 4PIMA 5DXJA 1DCKA 1PU2A 3I83A 4AULA 1TEXA 2JGMA 4QJ5A 2QN7A 1PJQA 2PMCA 3PPXA 2CBGA 1KZ4A 2FX5A 2QT9A 5ALLA 2REOA 4DA7A 5GP1A 4CQLB 2V7EA 3GJYA 3UXYA 3IBFA 4Q01A 3IPAA 2NU9A 5I7EA 3LZCA 3UGJA 3O4HA 4BJ1A 3AVYA 4X6XA 3WLTA 4LOAA 1ABEA 1W4CA 2D5CA 2JFPA 3CW9A 4FFPA 3RSCA 2KLHA 2LVBA 3JRWA 1UM9A 1CW2B 1RW4A 3HE3A 3MJEA 5FXMA 2IWHA 5DIFA 1ESNA 4C7VA 4JLBA 1K88A 4DLPA 2X0JA 1E9FA 2I2FA 2ZSBA 4GP9A 3T5BA 4ZGGA 2O8VA 1G8HA 4O08A 5EKDA 4CM9D 6PFKA 3FRHA 3K71B 1A9TA 1YT5A 2NTYC 2ZQZA 4KH0A 2VT7A 4ARZA 5C32A 2X86A 3Q8WA 1LJUA 3FR7A 1LGYA 3PE4A 1P0QA 2L19A 1YQEA 2DHEA 4LVOA 3C7KA 1QPGA 1R5BA 1Z34A 2RCYA 2ZSUA 4BFTA 4I4IA 2O54A 4O4HA 3QOYA 5LLSA 1PJBA 1TJNA 1J97A 4A0QA 4BWFB 2VP9A 3HM9A 2LWIA 2XVMA 2N46A 2RGWA 2QRLA 4YMIA 5I8ZA 1XUOA 4UUBA 3RW9A 3TG2A 3CX3A 4U3JA 1T9CA 4D0RA 4LY0A 4KR3A 2AOUA 3UV3A 4XIYA 1NC1A 2RKOA 4FHCA 1PF7E 1EWRA 2GUGA 1CJKC 2WJAA 1DBIA 3QKRB 4YP5A 4H59A 4F6LA 2UXDB 2FOXA 5IULC 1Y3BE 2C94A 1PJ4A 4MVWA 1B6GA 1MABB 4K6FA 5JLAA 2QQFA 4B44A 1NBWB 1GAQA 2R9VA 3FTDA 4IUYA 1Y34E 3RRZA 4Q7EA 4DLLA 5KOHA 2NYUA 4PYKA 3ZDCA 3TGWA 4ZQEA 4MWZA 3SZRA 3C1AA 5AUNB 2B5WA 1YS7A 3ILVA 2FV8A 4X3CA 4GWLA 1NW6A 4EHBA 4Q39A 1U31A 5JROA 3LPLA 4GZLA 2J3MA 3K5HA 2D06A 1ODKA 1D2HA 1HQKA 1PEAA 1UK7A 2BZ1A 2VQ3A 3F5SA 3T9BA 2QU7A 4DG9A 3ESZA 4BKMA 4B46A 4XWOA 2XWQA 1X94A 4INPA 3JD4A 5DPMA 1UXJA 4ETWA 1GRQA 5AUPB 5TQ0A 2R85A 3ICQB 4CCAA 3NT5A 1CUWA 1I80A 4IIJF 4WT7A 3WLSA 1USGA 4NJEB 3T3EA 4YX9A 3F7MA 1O95C 1IK6A 2XKJE 3WAKA 1PFYA 1EGMB 4NBWA 4EYQA 1SWWA 1QONA 2YHIA 5GZ1A 4PGHA 1KMIY 4MVJI 2BOVA 3C8UA 5EUCA 2XADA 5C8DA 5K3FB 3GHYA 4KE6A 1NX9A 1SK9A 1E3QA 1YVEI 4LDRA 3I01M 4YJHA 3SR3A 1KF0A 4F2PA 2UXCB 4D8WA 4E2XA 2IHKA 3N6XA 1PUIA 4KOAA 3SE0A 4QVIA 4OKIA 3UXHA 4RKQA 2J30A 2I7CA 4HAIA 4IO0A 3D7SA 4M53A 5ALWA 3LKVA 3OF5A 1H4VB 5DBFA 3DKRA 4DLYA 2D1RA 3K9QO 3D64A 2Q8PA 5AOVA 3F1KA 4HGZA 2OVBA 3H83A 3H9GA 2XVYA 4LEIA 3OWOA 1ZVVA 2B2CA 1ZH6A 4OLBA 3V48A 3ZWAA 5JUWA 2YZ2A 3ZWOA 1V1MA 1WDMA 4HEJA 5MF6A 1C3OA 2VHZA 4INOA 5BRAA 4HN4B 1PUJA 1W2WB 2O19A 2I7VA 1DGQA 2ZBEA 4CTNA 2X7JA 3U7RA 3VZSA 1Q1AA 1LH0A 2QDKA 2PKWA 2ZATA 1L4EA 4GW3A 2SNIE 3RYFB 3KXLA 3KZ1E 4HVAA 4TWAA 5JC8A 3DP7A 4GO1A 2A9VA 5FBHA 3WHKA 4TWIA 5HPYB 3PDJA 5GIPE 1KORA 3WGNA 3JPWA 3Q15C 4CMHA 3FSEA 3V8EA 3MEQA 4I50F 2WTMA 1JQAA 3ELDA 5A5EA 4GLOA 5BR7A 1DOZA 2IP2A 4AP6A 5P8WA 1FRNA 4KR9A 3D3EA 4Z3KA 5KNDD 2G0NA 3RT9A 4PVCA 3FOBA 1C3VA 3JR3A 2V6MA 3EBLA 4IIDA 2XZLA 4WEQA 3FPEA 4TXLA 3AP3A 2WPNA 3EQZA 3KP1A 1Y9DA 3NEAA 4TTJA 1L8QA 1VM6A 1QVWA 5HBRA 4EB6B 3ML1A 3RD5A 3VVBA 2J87A 4YGYA 3PWZA 1VSUA 5DMXA 3FNGA 3ZWKA 1THMA 2WJWA 2QAIA 2GHIA 4W7HA 4ZQGA 2ECQA 3U7IA 1PT6A 1XL0A 1CZLA 1U0EA 4OQMA 4NXMB 1DI0A 1V1JA 2FR8C 5BQOA 1W5FA 4FC7A 4G5YA 2CVHA 1A5AB 2YXLA 1UC9A 1F0NA 4FP9A 1A88A 3FD8A 3QWFA 5DNAA 4AY4A 3SDBA 1JQ3A 3WLJA 3UATA 4YRSA 3QKSA 3A05A 2IZOA 2Y9PB 4N6NA 5A62A 1OI4A 3B3FA 3LUHA 4EZBA 1GQQA 2EJVA 5TNXA 1H69A 2ZJZA 3L6EA 3IOCA 2VUSA 3P45A 4FLMA 3V4LA 2Q49A 3ZY5A 4L5IA 2PTGA 2WVHA 3F78A 4Y3UA 5HOEA 4OBBA 3BAFA 2DBVO 3IKMB 2HXGA 4FZJA 2QUKA 3LYHA 4R9UC 1IQUA 1UF9A 4D3FA 3MRVA 4Z9FA 4F92B 1DXOA 1XN4A 4WJKB 5L51A 2QRHA 4MVJG 4EG3A 3DAFA 1L7BA 4RQUA 2B8NA 3OTIA 2DT5A 1T9ZA 2OD9A 3Q7IA 3RVJA 1T2DA 2IELA 1F9EA 3DO6A 5I7SA 4V0SA 5B5SA 2OVFA 4HFNA 1M0EA 4G0WA 5KB3A 2J48A 4MR9A 3OCWA 3Q3EA 1QAQA 4LSWA 1XRSB 2PRSA 4Q9HA 3VNQA 4BUCA 1Q3TA 1YS6A 3DXYA 3KQWA 4EUNA 1JWBB 1BXGA 1SG6A 3E0XA 1KFKB 1VA5A 2HJ9A 4GBJA 4FVTA 1M0SA 2DY1A 4OJNA 4F8YA 5I45A 2FETA 4U8GA 1TD1A 2F4NA 3EEOA 3DT6A 5KYYB 4B4UA 1ZHHA 1EWTA 1ZXBA 3PFHA 4XVQA 3CN7A 4PC7A 3SEZA 3X1WA 2C9ZA 3DDHA 5CW1A 4EPVA 5FYQA 1V8ZA 4C4TA 1T1IA 1W85B 4PYRA 5KSYA 1XEFA 1AMNA 4ZJYA 4UNPA 1TGVA 3GWZA 3AW8A 1CUIA 4NI5A 3HCBA 3OPQA 1NGSA 1DQZA 1L5YA 1X7YA 4MGYR 4W9MC 2FPGA 1U8YA 2Q4TA 2I1VB 3H8JA 4QL3A 1NNI1 2PVPA 4LYJA 2POQX 2RFLA 1Z08A 5KTMA 5JJLA 1OTHA 5CDGA 3KDPA 1DC6A 5CB8A 1D2MA 1PFQA 4EHDA 4G1VA 3T1NA 4LBWA 1TADA 2D7JA 3FI0A 2OBLA 4UM5A 4LRTB 5LZ9A 3D5QA 3HBAA 1QSGA 3MUNA 4AC9A 4EKEA 2BHNA 3AUYA 1Y7IA 2C7BA 3D0OA 4ARCA 3U5TA 2QW0X 3R5XA 4OI0A 1UBTS 3AEKA 2IL1A 5JCJA 5C53B 3EPPA 5LQJA 1JLMA 1U1DA 1RMQA 2VATA 2WLSA 5FOVA 3NP7A 2GX6A 1ABFA 1SVMA 1ND6A 2HMUA 3TE7A 4BKUA 4C3UA 2CY0A 3LDHA 3PFKA 1OFUA 2YN0A 4R1UA 2FEKA 4GMKA 1VLMA 4QICA 3JWHA 3AGQA 3NZEA 3ODPA 5JWRA 4Y2VA 3BWEA 2R97A 4YCJA 3T34A 3AL3A 1V3VA 2YX1A 3I76A 4OH7A 1TNDA 1TO6A 2G5CA 2PFGA 2ZB2A 3GAZA 4PRZA 4RY2A 5GZ6A 3EX7C 4OHXA 1EDDA 1W44A 4EY6A 1AY0A 4IWXA 3OCZA 3KDSE 4IGFA 1JDZA 1RJDA 3DBHB 1S8FA 3KOOA 4F5YA 3FWZA 1XDSA 2H2GA 2G1JA 3B5IA 3CINA 2DHRA 3NT4A 4IYRA 4LSZA 4ND5A 2FCRA 5U4XA 2NYRA 5BQ3A 2DEUA 5DZSA 1MGOA 5TB5A 1JDVA 1N4DA 4NK5A 1RYFA 3OAAA 4DBLC 4QG3A 4JEUA 1U11A 4WY8A 1PLJA 4KXFB 5HRCA 2XF2A 3TAUA 1E2JA 3K6KA 1VHWA 1XDZA 4B4WA 4FCCA 1QVZA 4G36A 4EGFA 2X3UA 3FWYA 4S0XA 1EUQA 2GEJA 3Q6IA 4JBXA 2A94A 4YEDA 3THXA 2ZIXB 3DFMA 1SC3A 4DLUA 4J1TC 4IDAA 1GEGA 4OQEA 4RUKA 3LUKA 1M34B 4EF6A 1OHHA 1WUHS 2DTDA 3BWCA 5BN3A 2W48A 3OI7A 2Y77A 1K5DA 4L27A 3OM1A 4OG2A 4AROA 4CUKA 4EJSA 5BWBA 3NCTA 1CEYA 3HJBA 3K1ZA 3RAGA 4R8MA 4GSYA 3F8SA 1FJXA 5BN4B 5E4FA 3ICVA 1XWWA 4ND8B 4JOSA 3P2JA 3SSAA 1G5RA 1PJ3A 1UFRA 3WKEA 5THXA 2XITA 3QTBA 4HKTA 2JI4A 2ZSKA 2DWCA 4WV3A 4XM0A 1ZZGA 4Z2YA 3CB4A 2Z56A 2TMKA 2Y6VA 2UVDA 1J1IA 1DEOA 1HM5A 4EW3A 1QIJA 3EVBA 1XZJA 4JLVA 1JA1A 1PGPA 2FQ1A 2GAOA 2Z83A 1QQTA 4I4TB 2VBGA 4NK4A 4Z9YA 4F84A 4HXEB 3VX4A 2FP4A 4HS4A 1LBHA 1RPJA 2YIDA 3GG9A 3U56A 2Z1NA 1I5EA 2D5IA 5TMBA 4FI3C 1FDWA 3LUBA 5J5AA 2V4MA 5I7FA 1RKVA 3E9NA 2OXIA 3RJMA 3TRJA 4ZZIA 3PT9A 4GYJA 3F74A 3PXBA 3QFTA 4WFJA 3A70A 1U2DA 3V7UA 1MXHA 1H1LA 2BFPA 3E7PA 1QC5A 5G0VA 5TARA 1DIHA 2I4TA 5K99A 4DT1A 3BOSA 4Q9DA 3UT0A 4LDJA 4KE9A 4MINA 2P41A 2WNHA 4YAGA 1X1EA 1IUNA 1QH9A 2P91A 3LQ4A 3QKWA 4Z3OA 4HLDA 5JSQA 1GAEO 2O2HA 3OO1A 4DR3B 3H5LA 3R5JA 1D9ZA 3GFGA 4LYEA 2KJQA 4QODA 3SVZA 5JYEA 5JAUA 3U4MA 3T1TA 1JHAA 3DO5A 3O8QA 1EUCB 2X1MA 3YASA 5AW4A 2F4VB 3V6MA 2BCJQ 4UU0A 1D2CA 1K8RA 4DRYA 3CS3A 1KYIA 2HDWA 2C4HA 3N0VA 5CVCA 3HYSA 4LXUA 1ARZA 3LDFA 3WSVA 5BW4A 3QA3E 1X74A 2ZDHA 1Y8AA 4RK0A 1XTKA 3QTTA 4HJRA 4M1WA 4D0LB 3ZWQA 3B3GA 4CLEA 2B1QA 1J49A 5IC6A 4GG1A 5BWLA 4B82A 3DKPA 1T3LA 1YWGO 4Z4FA 1J0XO 4QM7A 1JZQA 1XMJA 5GJVC 3R8FA 3C7TA 3QXXA 4I5GA 2FW9A 1X77A 3BBPA 3MB5A 4TQ9A 2JGNA 4B73A 3ZEIA 1C3JA 3JQBA 5C5DA 3GRFA 4LTDA 4WX2B 3MELA 2I9KA 1TF7A 3CH7A 1Q0UA 1MZVA 1K8QA 4R6WA 1USVA 4QBIA 4ND4A 2MINA 1NJFA 4IDQA 3R5HA 1UFQA 4MYSA 5I9NA 4LF7B 3EF3A 4IHJB 4E1BA 3TLKA 2PXXA 1K06A 4MJXA 4EAQA 4IG4A 3WK4A 1RKBA 3AOEC 3EGCA 3QEOA 2BDEA 3W9YA 2BHTA 3M1LA 4BNIA 1V9CA 1BYIA 2C2ZA 4HNSA 1X80B 5G0UA 4M86A 3GFTA 2J0VA 3U62A 2V96A 1QLHA 3BK7A 4CL2A 1EYZA 1FMCA 1RYMA 3UK1A 1R18A 4JJAA 4LQLA 4UM9B 1Y4DE 2JLXA 3CZMA 4WZAE 5HCIA 5EL0A 3TFQA 3B70A 4DAEA 4ZVPA 2P9QA 3A6HA 4X3PA 3E9DA 3F3YA 5U1PA 3IAHA 1VJ0A 4JYAB 5EIAA 1SWVA 3U7QA 3FCOA 4XH9B 1K89A 3IDZA 5G4KB 2VPIA 5FKJA 3U4QA 2IA5A 2PBRA 4QBKA 1WF6A 4JUCA 2HA3A 2RKWA 2ZE6A 4A5SA 4TWBA 3I72A 3EGXB 4BV8A 3UJNA 2OORA 3UT5A 3FCCA 1Z33A 3O8QB 4HH0A 1LWOA 4HPXB 1X8XA 4LV8B 4IVPA 5CA0B 1HDOA 5FTMA 1TQ2A 1I2CA 1SBYA 1KAOA 2WU8A 3GGDA 3IJRA 4FR5A 3EFBA 3PUHA 3FGOA 1A5ZA 2Q41A 2IY8A 1SCIA 3BSSA 1EM6A 4M7OA 1VLVA 4CF7A 1EQAA 1F0YA 3T5AA 4YDSA 2F2TA 2IPNA 5LOVF 1FYWA 3GARA 2P2NA 1KNQA 2YWJA 2ZBQA 3H16A 4CKBA 4JP2A 3ZQ6A 5AVUA 5H59A 4KX5A 3Q9SA 2QGNA 5SV2A 2PKCA 4CDMA 1D1TA 1FU7A 4PE5B 4F97A 3EQ8A 2B4KA 4F11A 3IX7A 4KWTA 2AOVA 3ZDDA 3CZ5A 3CC8A 2O0JA 3BSYA 4UD6A 5G4LA 3WFIA 3ZE0B 1XNJA 3EQ6A 3HI6A 4HH4A 3GLQA 3JQ9A 4TKLA 3RS7A 4N49A 2EDCA 1W2GA 3JWJA 1O6CA 4A0GA 1YIAA 4HNVA 4BXOA 1SVUA 2H1LA 2QL7A 3OHMA 2GYYA 3LX8A 1N6NA 1OCEA 4HGPA 3R8XA 3O8NA 3I5MA 4IV0A 4WECA 4D3XA 2FDCA 4A8JC 4ZJUA 1HQCA 2WD7A 2OQIA 3RS3A 1II8B 5EE1A 1BEUB 3AY6A 2IXFA 4IGEA 3LRXA 3BMOB 3X1JA 1U7XA 1Q16A 2LUOA 4BIMA 1JILA 1Z2NX 4BS9A 3BD9A 4D74A 1I2BA 4M54A 4GGMX 3SF8B 3HJFA 1RWMA 2O8BA 2X5KO 3FE2A 3WWEA 4E2ZA 1SQ6A 4V3BA 3E7FA 2GLXA 4LYAA 1RZ3A 2XKAA 3PQ2A 1GFZA 2ZRLA 2PS9A 3B1FA 2UYYA 3H86A 3K8ZA 3I0ZA 2UAGA 5FI0B 5BN4A 4L3WA 1YBFA 4XE5A 2PMWB 5D5PA 3FFXA 1XK7A 3RS2A 5FOXA 1A7KA 1RS0A 4IYJA 3T0IA 1T9AA 1ZD1A 2IW1A 2X9GA 3HCAA 2WM9B 2V98A 3A6JA 4RMHA 2UUCB 4MDHA 2FB9A 4A16A 3WLOA 2QRMA 4QOGA 1SCKA 1Z6PA 4IF4A 3C6QA 1KEEB 1E63A 5E9AA 2R8EA 2A1TS 3D4BA 3E9RA 1JG1A 2IIPA 4DADA 2J9RA 1GR1A 4L5AA 2ZIUB 3KETA 2JLCA 1LK7A 4MGKR 2HO4A 2W4MA 2Q7OE 3AERB 2C0PA 4IFIA 4XTCS 4TWZA 3CX6A 2G9UA 2PZKA 5JARA 2AWNA 3UMYA 1UKYA 3AETA 2HXSA 4FGJA 1FX0B 1IULA 1YFKA 4M0EA 5REQB 3RHZA 5C8XA 5F1YA 4LYGA 5KCZA 4IH4A 3O26A 1X86B 1BWQA 2G63A 3V4ZA 1BEEA 1X2BA 3ND7A 4HT3B 5K0SA 1WNFA 2PIDA 2X5OA 3Q41A 4J9VA 5AW9A 4OB6A 3BHNA 2BISA 1CUXA 4KQMA 5EMMA 2IX3A 5JAPA 1ZR4A 3I4CA 3JQCA 2BGIA 3MUEA 1XN1A 5KJ1A 2GXUA 4AMZA 5G3ZA 3HNRA 1KYZA 2ZE5A 4ID9A 4RFSA 2QGZA 3UJAA 3H4IA 2A86A 2RHJA 4RPIA 5EXXA 4B8ZA 1ZGJA 3O92A 4IX1A 2GYUA 4OGWA 5KMGB 3VI3B 1LB1B 2DPGA 3M5WA 4G07A 1IY8A 2QVXX 4OLJA 2DH6A 1RLIA 1VLHA 3NKVA 5KX5B 3F2VA 3UAXA 4XCXA 2P3OA 4QSMA 1X1BA 4GMXA 3VPBA 1CUJA 2QI9F 1JHYA 3M0EA 4F1KA 4K46A 5BT8A 2FPLA 3OX1A 1EG2A 1W7AA 3NATA 1X9IA 5F1PA 4PFJA 2ZUCA 3UTDA 1G4UR 1XQ6A 4N0PA 5TS2A 4PW0A 4KREA 2VJKA 1TYCA 4YI5A 3CVWA 2A4KA 2HJHA 1ZJ5A 3T6KA 3U37A 3MJFA 1NXPA 4R1PA 3BH7A 5PGMA 3T7RA 3U9TA 1OJLA 1TQ4A 3I73A 3Q87B 2PBZA 4I1RA 4AP5A 2OHGA 3JZFA 4U02A 4YH1A 3GLRA 3MILA 4FYIA 5FAXA 3THRA 1U3TA 1FFDA 5AFSA 3O2JA 2CVQA 2R7NA 3NBXX 4QA9A 4JQYA 2NO0A 2FSPA 4JSTA 2Y3IA 1C7ZA 4NMHA 1K6JA 1AHIA 4ISCA 4DREA 5A2QA 3CHYA 5LA6B 1WZUA 2BJVA 4KPGA 3B6JA 1KI1A 3DBIA 1U8FO 1XZNA 4Y6OA 3IP8A 4RVCA 1KJZA 5K3DA 5KTRA 2OEPA 1DOHA 1VPEA 1XTQA 1Y6JA 3HSYA 1QDUA 4GRIA 5JWOA 1LX6A 2GM5A 1UMKA 1N3LA 3IXLA 4FNGA 3T4PA 3AV0B 1UMCB 2ZAOA 3VR4D 2A5JA 2N1BA 3RHTA 1LKZA 4UQLA 4MIOA 3U3ZA 1FX1A 5LD2B 1KY5A 1V3TA 4J1QA 2ZVQX 8ABPA 4IFTA 4C7OB 4CMCA 4PSAA 1TZCA 4XWAA 1E59A 3IUEA 3RIHA 1PTJC 3U4HA 3HLYA 4Z9BA 3L8HA 4Y6RA 2H2IA 4N5DA 3COWA 1HURA 1QFSA 2NVUB 5DI3B 4YRJA 3OLYA 3BE6A 2DFKB 1V7ZA 2Q3BA 4BKRA 2JEZA 1C50A 1M66A 1ZNWA 1R8QA 1E1MA 2R5FA 3AOEA 4QGAA 5I4CA 2YN2A 3U3RA 1YZYA 5KVSA 1CFZA 3IUSA 3O93A 1UC4B 5EESA 4FOSA 3OU7A 2D59A 4HTFA 2JFVA 4J3JA 2QENA 4XJVA 5ECYA 4Z4CA 4E33A 2DGDA 1ZSVA 4H0CA 5B3JC 2C0QA 3L7DA 5HXAA 1BHO1 1X1QA 3K6SB 5J2UA 1PEKE 2PVSA 2PH7A 4M55A 4CL0A 1JQDA 2G06A 4K2AA 4Y8VA 3VH3A 4CMJA 1MN6A 4EFKA 2GRJA 3AU8A 3FWKA 3AYXB 4C6SA 4CDGA 2R62A 3EXIA 2RGBA 1Q14A 4LDNA 5CEJA 3D02A 2J5BA 2JDID 4EOGA 2O1WA 1JI0A 2J9YB 2FF5A 2QBYB 5HMLA 3DV9A 3LC1O 3B2QA 4JLNA 5AKXA 1M0WA 2I7DA 4L7QA 2AJBA 3TDKA 4D8UA 4TV8A 3OCJA 3KVVA 4UMEA 1B00A 2J4FA 4URFA 1BX3A 5DGDA 2GO7A 4ZYVA 5KQRA 1MX9A 1Y1LA 4MPTA 4M88A 2WY2D 2VHWA 4QBFA 1PI3A 2WD8A 3BMXA 4FFLA 5F7XA 5D3MB 4KWIA 1O96A 1NUSA 3HYRA 5JYCA 4U00A 1WSDA 2H1WA 2EGHA 3WK9A 1ADYA 3KT3A 4P33A 1TB4A 1PG2A 4HI0E 4B6SA 1W36C 2Y1KA 4TMWA 4CR6A 4H7EA 4I8IA 5BSMA 2XIQA 4RWZA 4BN4A 4OGLA 2B8TA 3UH1A 4DLBA 2DQZA 4MVCA 4E70A 2PKXA 3WIVA 1IB0A 2E18A 2FYTA 5IXYA 1E9DA 1I0LA 2CXQA 3MT0A 4FEEA 1JB1A 1EFCA 3A4VA 3IALA 1C4OA 4ALLA 3UC5A 4EL5A 3DDSA 4LNUB 2ZR0A 3DPSA 4D57A 3L7NA 1I8TA 1H8ED 2CNNA 3FX2A 3ZH9B 1XPUA 2DJ5A 3LH5A 2WZCA 4LCJA 2AGVA 4LYDA 4OO3A 3UMVA 1NUPA 4H3SA 4JELA 3RS0A 3BGVA 1M34E 4G4GA 3H1PA 1ZM3A 3I1JA 3BKXA 1P18A 4JXKA 5IKEA 3M6FA 4UBKA 2Z2JA 1GG2A 5IH7A 4ROTA 5AKIA 5LYJF 1DRKA 1CQJB 1L8AA 2X8JA 3KT8A 4KIUA 2HV8A 1DAOA 3VR5H 2OM6A 5IU6A 1VRWA 2FR8A 3ANMA 5J23A 3R76A 4HQRA 2LCQA 2RHLA 3K0FA 3SSMA 4Y18A 2H3HA 1AGXA 1N6PA 1FVOA 5KNBD 3HCOA 3IE1A 1AUVA 3EIFA 5E3IA 5J63A 3E4DA 5EI5A 3ROMA 4BJHB 3GNTA 1HRDA 2O3SA 4JB2A 3KJXA 4PZAA 2E0IA 3EIXA 5CNKA 5JS7A 1P4RA 3RADC 3GV0A 4Z6KA 3EG9A 3PF8A 1SG0A 1LPSA 1G7SA 3AR5A 5KKAA 5K4HA 3D4OA 1I7NA 4UTPA 1CIPA 1XFAA 4NBTA 1I7SB 1UM8A 1O6FA 2R44A 1M76A 4XA8A 2W8BB 2H08A 3AI1A 4JC8A 3PV0A 3PEYA 1RPAA 1DXQA 2OBNA 3QKSB 3TRFA 3DZJA 3OIDA 4JLKA 1SC6A 4HMQA 5AM2A 4M83A 3AM4A 4B17A 1VSTA 3COJA 4B1FA 2AC7A 1E2IA 1E5LA 2I4NA 5F98A 2V74B 1UJMA 2X4IA 3L9XA 1SOAA 2X19A 1HI9A 2XE6A 3EA5A 1ZHFA 4Q1AA 2QI9C 3OE7A 4R3NA 5A3JA 5AICA 1X2EA 2ZRDA 3OBBA 3TW8B 3D7KA 3K9FC 4PZYA 2IY7A 3EMVA 1QXSA 3SD7A 1CS0A 4P83A 4CL3A 4FOLA 3HBMA 4GRDA 4EFDA 2JAQA 3ZG6A 3KVYA 1F1JA 1LZKA 1KEVA 4S2EA 3ZS9A 2B2XA 4JJ7A 4R7GA 1AKUA 2XE8A 3C97A 5FQOA 5LBUA 2HF7A 3L04A 4B35A 4EHIA 4NU6A 4ZMBA 4QYMA 3S1AB 1XMVA 3DULA 3H04A 4C2UA 1P45A 2E49A 2WABA 3BX1A 2G0AA 2ZJ0A 1DU4A 1T4CA 4NZMA 4UPVA 5E6RA 2E55A 521PA 4BVFA 3KWFA 4B7AA 1T0HB 2VP2A 4O4LA 1XRNA 3HI4A 2YV2A 3CLHA 4X8LA 1H2AS 2K6GA 3SHOA 1OXUA 4M1TA 5JRJA 3VDNB 3EUAA 3FCXA 4ZAGA 4RJKA 4PLCA 5I51A 3N74A 3ZDEA 2ZS7A 4EHNA 1NYTA 2BM9A 3VR2A 4DJJA 3AUTA 2WA2A 1Q92A 1IEQA 5CDHA 1OR8A 1WAMA 3V8QA 4DQ0A 2FH5B 1CE8A 1GNRA 2Q62A 5H9VA 5KTNA 5KX5F 4ICIA 2FPKA 3TLYA 5BOVA 3O82A 1NYRA 3OZDA 1MX3A 3GCZA 4NZ9A 3GC6A 2I8CA 4K9LA 1XD9A 2C42A 4NAVA 3UJ8A 2Y1GA 3GUHA 3BRWA 3NBKA 3SP1A 4BPRA 4FJ0A 3OM9A 1R64A 5AUQA 1JV2B 1GCGA 2PZGA 2V7VA 4YT2A 1CB0A 2ODTX 3N2NA 4ALMA 3T5DA 5IXJA 1Z0AA 2WWRA 1ZK4A 3O1IC 1EEXB 3VRHA 4E22A 3ZDYB 3WOHA 5GJCA 1NKTA 5EZ6B 2ZRNA 4PQEA 5K3FA 1Q84A 2OQRA 4E4TA 4UNNA 4KXUA 3AEKB 1BA3A 1LNQA 4E88A 3PB3A 3TKAA 1L5NA 2BFAA 3R44A 4FT4A 4PYMA 3G0BA 5C8YA 2OB2A 4NXNB 1GFSA 3WWPA 2ADMA 1ZINA 3BFKA 3NGLA 3C14C 4B7CA 5T7BA 4BVJA 3CISA 1GV1A 2Y1FA 1PV4A 1N2BA 1N6LA 2PWBA 3TEFA 3WIEA 3L8EA 5IJAA 3UB3A 1IN4A 1KP9A 1VFNA 4GE3A 4PLWA 2WIFA 2X15A 5K20A 1MC4A 1QYXA 3EWNA 1TCAA 2WG0A 3VDMA 4EHAA 1UBUS 2JI8A 3CW8X 4MRRA 4FHDA 1U04A 1ADFA 3RC8A 4O4HB 4KYTA 1JNYA 5LBIA 1RTTA 3OQIA 1SUEA 2BP7A 3GVIA 3D8BA 1P60A 3PQ8A 3ZHSA 3PC2A 4B6GA 4FX5A 5HCNA 3KSRA 4R3WA 1KI4A 1XXHA 5JEDA 2QZ4A 4G26A 5I7WA 3D4NA 3LY7A 3LFHA 3N8HA 1BE1A 3C3PA 3LPNA 2BGTA 2ZRBA 3E27A 5TXGA 1SVNA 1RXUA 4X1IB 5FWDA 4DV4B 1GPJA 5H83A 5F73A 3HCDA 2XYPA 4EPRA 4BVAA 1YO6A 4FGKA 1JR6A 3Q10A 4PSVA 3NHKA 3BREA 2WWGA 3ZNNA 1SXJA 1XEXB 2PGNA 4WASA 2V6IA 3KU4A 1Q20A 1C29B 2QT1A 3I45A 3MWLA 4FBGA 2ZXEA 4IIFA 1QIEA 3FLBA 3J81k 3RS9A 1YQGA 3AGPA 3D9QX 4MYRA 4UXJA 1OLSA 3TWOA 1F8XA 1WTAA 2XMGA 4C03A 4US0R 1W48A 4DXDA 4OFBA 5EMLA 2NZ2A 3OY2A 3IVGA 3F5DA 4HATA 3KZVA 2CFSA 4I5DA 1N2ZA 3KE8A 2A1UB 5CYOA 2DG2A 2OESA 3C3YA 2J6BA 2XGOA 1PYOA 4IKOA 5DH9A 3WLEA 3Q3JB 3IAS6 1UJBA 2IE0A 4J43A 3RS5A 3RO7A 3VO1A 2GSDA 4EAAA 3GVPA 2JZNA 5JZSA 1O08A 3EZ6A 1QFYA 2ANBA 3C4JA 1OWOA 2Z5FA 3Q5DA 1DADA 1I4OA 2AD5A 4M38A 4FE4A 1H6BA 3PP8A 4PC1A 4CWAA 2X3FA 1QIKA 1F9AA 3EIHA 4C1BA 2W8BA 3O3MB 3STTA 2PT6A 2JIRA 2AFVA 3B1YA 5GPBA 4YDQA 4IJQA 1L3BA 5LYYA 5T8KA 1YZNA 2RK6A 3HADA 5HF6A 1YDWA 5BV1A 1MJGM 1EVEA 3QHAA 4RS4A 4UDNA 4C76A 1L8XA 2V4UA 2BV3A 1TZJA 3HDJA 4GR4A 2QSZA 4BFSA 2ZBRA 1YQQA 2NAPA 1OA1A 4BB6A 1XCBA 2C3UA 2REXB 1DRWA 3HXKA 3WDLA 2Q2NA 4B3SB 1L5LA 5DM2A 3BJEA 1GPUA 1QHNA 1YBMA 4TSRA 4Q9IA 1W75A 3TQFA 4YQFA 2GYWA 1EB9A 2O3JA 3EBPA 2OCIA 3M5PA 4XPZA 3E58A 1JFSA 2Q5OA 4MV1A 3NGXA 3A37A 5DI3A 4N1AA 5LJIA 1ZC4A 2GWHA 2O2IA 4PM4A 4ACBA 4MZDA 4AXBA 2GZHA 2RH9B 1W1WA 4P7JA 2HQBA 4K2HA 5E7IA 5IASA 1TFRA 5AM4A 1KC1A 2ADOA 1HTWA 4CKEB 1DJLA 3SLKA 1Q7RA 2WWVD 3F97A 5HIMA 1KU6A 1SZPA 3BIXA 2ZUWA 1ST2A 3OQHA 3L4EA 1CKEA 5FTKA 3UXEA 4CMKA 4CLRA 3PNKA 2B7LA 5L9AA 1OH6A 3C1OA 2FG6C 4AUKA 4CCYA 4TTTS 5K0NA 1CU1A 2BL4A 1U1CA 2HRBA 5BR1A 2O2EA 5LMZA 1HE8B 1XCOA 3R0JA 3WRXC 1A8UA 1L0BA 1SG9A 3O8OB 4DR1B 3JZAA 2DFTA 3NIFB 2E48A 4KXMA 5DSZA 3THWA 1BMQA 4DDTA 5LP6B 4PFQA 4RK1A 4EJSC 4XASA 2X40A 3MUFA 3LBAA 1Q0HA 1XCLA 5KHOC 5K0BA 3KLBA 2BE7A 2Z04A 3NEJA 1ZP6A 2IK8A 3ZEAA 1PV2A 4RF2A 4V0OA 4EB8A 2GAJA 5JY6A 2V6JA 2W42A 1DIAA 1VE3A 2V7UA 1UBSB 1GU7A 4IJ6A 2ZUBA 1KVRA 1GRNA 2B0JA 2PRIA 3VJLA 1WS6A 2HU2A 1XWIA 1N0UA 2ECKA 1PG5A 3L5OA 4M1OA 4Q3AA 2CFTA 3IOYA 4YYEA 1HFEL 4WOJA 4EABA 4DYDA 1SU6A 1T13A 5B53A 3JASA 1Q74A 4J1SA 2M6LA 5AESA 2J07A 4ZVMA 4MUNA 2XGMA 4PSCA 4RVUA 1XLVA 3RFXA 1DB3A 4D5EA 2AEFA 5JNVA 3U61B 1EXDA 4LZAA 2NSJA 2W6MA 2YMPA 3B9PA 3IVMA 5AOCA 1HTTA 3P94A 4N4AA 5IVDA 3WB1A 1F38A 4DPKA 1YQ9A 4ASUD 5CDSA 1AJEA 5LU8A 3MS2A 1XRMA 4JHXA 3VKUA 1DFGA 3A1EA 1ZUNB 4MQBA 3E9CA 1E20A 1L3IA 1GPKA 3PFWO 4XD7D 5J4YA 5TLSA 5TT0A 3R9KA 1M2KA 1WQ4A 1J21A 1E3JA 2B83A 4I1YA 2C20A 3Q6MA 4EJMA 3Q3CA 3DLIA 4LJ4A 3RWMB 1HLGA 1R0YA 4IIEA 4P92A 3F4BA 3PEWA 5EP3A 2JATA 4CNBA 3EGIA 2FRDC 1WUKS 1Y1KE 2JDIA 1CG6A 2FZWA 2KQUA 2O0HA 2IOFK 3IAM6 5E3JA 1X9HA 4IEIA 4M7RA 5HMMA 1HE4A 1FNDA 3HWX1 4GI2A 3BCRA 4O2LA 2BFEA 5C31A 5F5XA 2QE7D 3B60A 4P2GA 3GFFA 3WGTA 1E9BA 2P9CA 4HDRB 1IBRA 1YUBA 4DCVA 3C8ZA 3TVYA 2PUBA 4YO7A 2BEVA 3I12A 1ZK0A 3TOSA 1CHNA 1Q2XA 1WXXA 4TT3A 1SHUX 3L41A 1SU4A 3K2QA 1JMVA 3TNDA 3TQOA 2K5UA 2QRQA 1IN6A 3EWIA 4GZ6A 2VHUA 4XXHA 3TW0A 3ZLBA 5ESRA 3WLQA 4F85A 1TU4A 1LS6A 2AN9A 3GLGA 1BDHA 4B7XA 2Q5QA 1DE0A 4URYR 4AMUA 1JIVA 3NTQA 3RU7A 4I99A 5L6MB 3WV4A 1OLSB 1IFXA 3OMWA 5ITWA 1Z8NA 4HAOA 3KB8A 4ZQHA 4ZO4A 4FPXA 4C6HA 2W90A 3ZK9A 1W34A 2WJ3A 3WYGA 4PQRA 4ND3A 1Z5PA 2WUFA 4HWKA 2OSBA 1V7PC 1FSPA 3WRYC 1MT0A 5LWQA 3KD2A 4NR0A 5IC5A 4ISBA 4CQLA 1KJ8A 1ZRSA 3X1YA 3F71A 4DV5B 3WNQA 1FYDA 1JG2A 1X38A 2AR0A 1K8YB 5KYTA 4RPHA 4P54A 1IM2A 4YFVA 3LX6A 3JYLA 4BB9A 2ODPA 1E1LA 1R5OA 1E94E 3M6WA 2ZG6A 4DCJA 3KWLA 4HTFB 2FPOA 4MTLA 2XT9A 4BTEA 3KOZA 2Z9CA 1RZRD 2CD9A 3DTVD 4I0WB 2ORVA 3ETNA 2GPWA 1E6MA 2I03A 1YB4A 3EMDA 3RYCA 5K8UA 1G19A 2JG3A 4YCSA 1T2NA 5I4BA 4X93A 1UINA 1GZVA 4N18A 1S4QA 4NCKA 3UGTA 4CU2A 1Q19A 3WRYA 4AKEA 2XRFA 2BN4A 2NSLA 1YFZA 2C5SA 1ODJA 5KYXB 1QBKC 4OXKA 1BVHA 5IKXA 4HGNA 5BSVA 4IRXA 1OWNA 4NBKA 4Z86A 2C2MA 5E1DA 4QQRA 1DC7A 1SIOA 4YRKA 2VHEA 3KELA 4QYTA 4ZOBA 3EXG2 4YV1A 4R54A 2X1HA 3KJNA 2G9NA 3ZNPA 5D2CA 2CXNA 2PX6A 3CX4A 1O95D 3B12A 4V0LA 1LPNA 5IMBA 3RREA 4UFNA 3A27A 3K72B 3OZSA 3ZTWA 4G5OA 3NBMA 1AUOA 4G4JA 2KYRA 5HM6A 2A84A 1I1HA 1QIFA 3GHHA 4R8KA 1GL6A 1N4AA 5HGXA 4CTMA 3P4YA 3EFOB 5A05A 5ER6A 5LWHA 4JLMA 4RL6A 5IDXA 1V3QE 3CWCA 5EZSA 3GLFB 1TUEA 2C4NA 5CB4B 2EKPA 3TLGB 3ELYA 3JALB 3PIDA 4MWOA 2GJSA 4XX1A 5FFNA 2BSXA 4XWKA 4GPBA 3ZY3A 4DCNA 3GEGA 3NHFA 4UHDA 1XL1A 4KGVA 3UAWA 4FMCB 4M6WB 5F7OA 2GBIA 1PJTA 2IEZA 1R6AA 3MCZA 2HLHA 1X7XB 3PGMA 5AKLA 3ZHYA 3I61A 3GEDA 1MP0A 4MUXA 3GBSA 5G3YA 4PCUA 1U99A 3NDRA 4JEMA 4BV2A 2M2IA 3T7IA 1U0JA 3AI3A 1E79A 3GDHA 3LKBA 1YZLA 3L40A 2HCTA 2WQZA 1GGJA 1RADA 2RHWA 5C7YA 1ILEA 2JJQA 2WKRA 1GUAA 4BVEA 4JODA 1JQKA 3B38A 1DAMA 1BJRE 3B8HA 5TVKA 4BL5A 4DN6A 1IMJA 1QGZA 2QW8A 2ZJ7A 3ESYA 3NU1A 4RPCA 1F6WA 4EG4A 4FW8A 2ZBDA 5SYAA 1Q2UA 3KPWA 5IZ4A 1MQAA 1VI2A 4Q4JA 1RFGE 4RK7A 2PLAA 4KV9A 4RENA 5KKNB 1JAZA 4QDZA 3K1TA 5D85A 2CN1A 3VC7A 4N7BA 1UMDB 3OQIB 4EHHA 2D1QA 1CRQA 3ZU2A 5TVGA 3EXAA 2B9EA 2FSHA 1VPWA 2PSHA 1ZOOA 1SVOA 2QN3A 4WZBB 1KQPA 2VRCD 3JYQA 3EEFA 3WNBA 4M46A 4M8KA 3KU1A 4L02A 4FGZA 4Q3OA 3PXEA 1JVNA 3QPCA 3GROA 1HLFA 3PXCX 1WKVA 2WHPB 2Y4OA 5T4EA 3V42A 4UXIA 3K9NA 4UD2A 1C80A 4EG7A 2ZUFA 1SC4A 2FFQA 2I55A 4IM7A 4B31A 4DVJA 1H42A 4JC4A 4NL4H 2OCLA 3SKVA 3T12A 1OIXA 4D9KA 5EG5A 3OCCA 4BNUA 3RV3A 2XOKD 3CTPA 3IKJA 1ZO8A 2YMQA 2C3PA 1E4YA 1SUIA 4P4SA 2GN9A 4R16A 1AT1A 3M2PA 3OZIA 1HNWB 4L2IB 2BFCB 4JASB 2RGNC 3TOCA 5GVSA 1REQB 4U2FA 1Y4SA 3DUFB 2HU8A 2IEAA 4TUYA 1I10A 2PQ6A 2EW1A 1GYRA 1PWYE 2JHFA 2YWXA 3A1TA 1V48A 3DLTA 3EEIA 3HMKA 3I3SR 4P1ZA 1UT5A 3JQDA 5E4JA 2Q2VA 1B0UA 2GLTA 1D1SA 3DD5A 3OVMA 2YCLA 1WOMA 1UL1X 2XCOA 1PHRA 2WU4A 1SGWA 4D6PA 3ORRA 1HT2E 1CP2A 5IK2D 1KRWA 4PXYA 1WW2A 5F64A 1WLYA 2CJWB 3QLJA 4JX8A 3ZBPA 3P1JA 1GQ2A 3G0CA 3O83A 3NPAA 3K1AA 4UDYX 4ARUA 1TCVA 4DHEA 4TS9A 3JQBC 2HA4A 4C0HA 2OKCA 4OP1A 3I64A 2UXBB 1FB5A 1FX0A 4BMZA 4MKZA 4HFJA 4RW0A 2QL6A 3R3YA 2OC4A 3H0CA 2XXAB 5CA1B 5AJXA 2IV2X 1DMSA 1CIJA 5TEWA 1DC5A 4YMVA 3AEYA 1ZUIA 2YZNA 1OZ0A 3OUUA 4EI9A 4Q3LA 2Q2OA 2IV3A 3TLBA 2YHAA 3KHKA 4I9HA 5HZMA 1TJPB 4A26A 3TNLA 2H8GA 3QY9A 1PSDA 3RVKA 2P6PA 4DBVO 3RJ5A 3PLAE 1CUSA 1NVDA 3FM9A 3IPXA 1C0EA 1RRFA 2GD2A 2IYOA 2WHXA 4GEKA 2Q50A 4LVCA 5DGIA 5BSRA 4CKBB 4XM2A 3ZK7A 4XGIA 5JDIA 4FGUA 2Z5LA 4WL0A 5JV5A 1BHQ1 2P9HA 3COSA 3EDYA 4LHYA 4Q4CA 2J59A 1GN9A 1AQIA 5D1NA 4HP8A 1X7ZA 1JEJA 4TMXA 3S3TA 4X1KA 1F6BA 1HH4A 3V80A 5CCBA 4PXSA 3HZHA 2C04A 3IQXA 5HM8A 5TS3A 3JQ7B 5MDHA 2O5VA 3A36A 1L1EA 2YXBA 1CJUC 1E2DA 2PAFA 3FKSD 2IVZA 3I32A 4M7WA 5AQEA 2VL7A 3ENKA 3OE1A 1N2CA 4R2KA 4UHFA 3G1WA 5DIZA 4YR9A 5JAOA 2CV0A 2NOAA 3VQTA 3ZD7A 4HNUA 1ODFA 1YJCA 2Q6LA 3AF1A 3AZQA 4U6NA 4FYYA 1AXRA 3TLEA 3MBOA 3VBCA 2YNMC 3ASYA 3WAJA 4YJGB 4H6VA 1US8B 3C3CA 2GPBA 3ZWMA 3GH3A 2EF1A 1Q0LA 2W6PA 1VXOA 3B2EA 3M81A 4IIXA 4KSBA 4W6ZA 2GJ8A 3DOJA 3JD2A 2GZAA 3JQAB 3FOCA 2XD4A 1O3YA 3CKKA 4X8HA 2IITA 4INAA 2ZB4A 4GBED 3V55A 2GPJA 3WMWA 2DCMA 3GYBA 3R3VA 3RHFA 2AG1A 5DEOA 1Z7BA 3SIPA 3U4GA 1Y63A 1B43A 3H2IA 3WLRA 4AMYA 2ZYUX 3QTLA 4JLDA 3MOIA 2IQIA 2YY6A 3UKJA 3ZBQA 3U60B 3CNLA 5GAJA 1KWKA 3PZBA 3V7NA 3ESQA 2GHRA 4L4YA 4TYPA 4FD3A 2P67A 2BD0A 1ZA1A 2C0CA 3F6CA 3JQ9C 3NORA 3HH8A 5DLYA 1U28A 4CFYA 4D8VA 2NU7A 3K4PA 2I3AA 3R3XA 4LZPA 1JQBA 3IIJA 3JQFA 4OBWA 3H0EA 4D8XA 3EZ7A 1SVLA 1VE9A 1FXSA 1KH2A 3WL5A 2QAGA 3MJTA 2A57A 2XQKA 3PA8A 1JLLA 1JAIA 1FVHA 4WXEA 1DAFA 4BNMA 5FOUA 3ON5A 3BD8A 1U3UA 4WFQA 1P6QA 1FF9A 1XEXA 2OGZA 2V3WA 4DMCA 1GNVA 3PJRA 3F7NA 2XUJA 3NNSA 2JFWA 1CVIA 1FDUA 3OZCA 4E2FA 4EK9A 4P3XA 1WZCA 1UKEA 1UK8A 3UK2A 3N0WA 2Q0XA 3NP9A 1AMOA 4GR9A 4LNAA 4CIVA 1KJQA 4J0IA 4B7ZA 5BV8A 3PL1A 3IEXA 1NFQA 1TT5B 4IVRA 1T43A 3LCUA 2JLBA 1NX6A 3I6ZA 3MLBA 4KO8A 4D2IA 1W5TA 1JZTA 3W2GA 2BIFA 3DBHA 4KXYA 5EIWA 5F9MA 1BKYA 4MWDA 3OZBA 3CVUA 1W47A 2VJMA 3WWCA 1B0AA 4LXTA 4BNYA 2BKLA 4V1CB 3B82A 1NULA 4LJ6A 2B2NA 3BCHA 3JD1A 2WE8A 4REQA 4BFLA 4OMCA 2CXSA 4ZO7A 1XHFA 3I2YX 4HG2A 3R7LA 3TNFA 1KDTA 3V3TA 4LY3A 5BW8A 1Z07A 2C2OA 3EWAA 4U1RA 4G1UC 3EZ9A 2FJ0A 1ACLA 4QWWA 1QVRA 2ZW9A 3U0BA 1HEUA 4QLAA 1GL7A 3FVTA 1N7IA 5E8RA 1Y3CE 3W8FA 4CTKA 4Z49A 8MHTA 4IDGA 5LYJB 4ARAA 3AY3A 4U7PB 1CZOA 1YJ8A 1D7AA 2Y67A 2QVLA 3GLTA 1UOOA 1SEVA 2X3YA 4GLLA 3HY3A 1ZGCA 3DVQX 1QHIA 3K0CC 3HJAA 1Z73A 4DMKA 5TPWB 1BE6A 4QHYA 4TYNA 3OICA 1XK6A 1R88A 2GKSA 2ZTMA 3WGZA 5KNLA 3LBYA 3A7DA 2G88A 1JLKA 4A8TA 1GAWA 1LVGA 5CK5A 4MW0A 1EU1A 1BVYF 4K9OA 2LNDA 3SLGA 4DIDA 4OHMA 3EVGA 5DYTA 3RFCA 2R68A 4GE0A 3LRPA 4KTVE 4DARA 2XLBA 1Z62A 1VPTA 2GVDC 2Q1XA 4URZR 4RETA 2PKYX 2WG2A 5COQA 3U4AA 4KQ6A 3VBEA 3VZCA 4DGQA 5HJ7A 4HN9A 1ZUHA 5C1DA 1EVLA 2OV1A 1Y9AA 2Z8ZA 2K7ZA 5EWLA 1TF2A 3BEDA 4QXOA 4WZAA 4QECA 3FBTA 3TLMA 2GM9A 2RHHA 1E7RA 2Y27A 4NYJR 4PN3A 3G0IA 3L8CA 2DKOA 5DWVA 3BXFA 1YMVA 1Z39A 1H8HA 1T9HA 1BCRA 2GQ0A 4F4FA 1NW9B 2JLVA 4K9SA 4D97A 4GI5A 1PAUA 9GPBA 1CQJA 2B3TA 2NU6B 3PQFA 3ICCA 5FHQA 2HLDA 2GEDA 1SUWA 4PSUA 3I58A 5GONA 1OSNA 3AKCA 1QV7A 4DRXB 3FDJA 3SAJA 5HQ3B 1TU3A 3K0FB 2EJCA 4J1TA 2PKEA 5EJ6A 2AMYA 1F8GA 3I2GA 4LUCA 4NU8X 1NBMA 1XZQA 1M8GA 3DMHA 5FOTA 3DE5X 1WVIA 1DIRA 3RNLA 3MGCA 1NJ6A 4NJEA 4BNJA 3OM8A 1DIBA 2ZFUA 3K9CA 5B55A 2VAXA 1ZL2A 4D6YA 2YRXA 3A3KA 1M6WA 2VNJA 4DQKA 2BONA 3RC3A 2WIGA 1K66A 1EVYA 4I7EA 2B1GA 3DBLA 1U6KA 3LT4A 4MKFA 3MIZA 1ORVA 3DLPX 3UMCA 3ZJ4A 4RTPA 3GAFA 3HZOA 4JT2A 2XDQB 3F47A 3DTYA 3FSGA 3RWBA 1A5BB 1S2GA 3ND6A 4M2LA 3GJ0A 4BO2A 4EQ6A 4HGYA 1Z4KA 2CXTA 2WAXA 1CJSA 4KACA 5IJWA 1JSLA 4ZI7F 1Z2DA 3DLHA 1E3IA 1AKVA 3WNZA 3ETCA 4K6GA 1BW9B 4G01B 2JAXA 4A91A 5LPNA 3PKJA 1ADGA 2WSSD 1K4KA 3OKPA 2RAUA 4UBJA 5CLQA 3K5PA 3PFGA 3LRTA 5LR6A 2ET6A 1Y3HA 4BQQA 1B76A 3GOHA 3TFOA 1KE2A 4XRRA 4KE8A 1N5JA 2GERA 4NRDA 1EFPB 4V2UA 4ZVQA 2RGRA 1DBQA 3BA6A 3I1FA 2A92A 5FR1A 3EXEB 1QORA 3OLQA 3TSOA 2L82A 1Z26A 2R751 3AKDA 3BE5A 2Q1UA 1KPGA 3Q9UA 4RCYA 3GRPA 2VSFA 1GA4A 4PTZA 5DYNA 2IBSA 4OHYA 1UIMA 2JKVA 1KYQA 4AW9A 4H17A 1KDYA 3UAGA 3LTEA 2PX8A 4M76B 4ODIA 4AX4A 1HC7A 2X14A 3C8MA 3G88A 2CNWA 4MKHA 4IUBS 1JJFA 1ZD3A 4YJFB 3QITA 1W0JA 3SBEA 5FUWA 5CFLA 3GFSA 4QTTB 2OBFA 3HU2A 4X6YA 2JZCA 5ALUA 2WOOA 1QK3A 3PEEA 4BO8A 3GG2A 4LXHA 3UUEA 3UQZA 3ZGVA 2X8JB 4BEVA 1RLMA 4L6IA 5FDFA 3M34A 5F9HA 1SRQA 3VO2A 1ZX1A 1YZKA 3QLUC 4LCEA 4TTQA 2VWPA 3CCCA 3NBAA 1SELA 2QLJA 3Q8LA 2FSVA 2G9ZA 1ZISA 4H3HB 4DDHA 3ONFA 2Y1DA 1RWWA 2WC1A 4FYVA 2H65A 4GHWA 4IGAA 2D8AA 1V45E 4Q4HA 3HBNA 4FI3F 2QSJA 2VJMB 5CVJA 5BRJA 1Z0UA 2E1PA 1AKYA 1N2SA 2WPDA 4HX5A 4LXGA 2BPOA 1U9CA 4TZ6A 2GN1A 3TTWA 3HJHA 4OF4A 8LDHA 3KYJB 2G1PA 1Z4OA 3MWJA 3A9UA 2LIPA 3T0FA 3LC7O 2G09A 1LY1A 5IANA 4ROSA 2BBSA 1II8A 1P72A 3OEHA 4BQRA 3KQUA 3HQ4O 3VR5D 2UZ3A 1XE3A 3AV3A 2V7QD 3OKFA 1CF9A 1Q77A 2FDXA 4K9RA 2P11A 4LZLA 4ZOLA 4O4JF 3TBKA 5JVDF 1J1UA 4LHZA 1SXGA 4ZICA 2A9PA 2ZPTX 4D6XA 5ADWA 1N1MA 1P8AA 3DW3X 4TTRA 3ZDRA 4GDFA 1Y8QA 3ZD9A 2EQAA 4JK3A 2AUNA 1AKMA 2VXBA 4MRMB 1IATA 1RQ7A 1YJAA 1T8YA 1QH1B 1M8FA 2DC1A 1EUCA 1M1YA 1YZFA 3C7AA 1NI4B 1U3VA 2X5XA 3DFIA 3K0EA 4K9KA 5H16A 2EBHX 3F9RA 4K9MA 1U7UA 1NUHA 4PZPA 3LSYA 5C0OE 3NDIA 3TTUA 1TMKA 4IIJA 1CNEA 3R09A 2YVKA 4MH0R 4WA7A 5T3UA 2JFZA 4Y9TA 2HPHA 3BBLA 3ZJ5A 1BFDA 5JSFA 3IIEA 2EW2A 1ZGZA 2QD2A 1E7SA 1ECBA 1WV1A 2AE2A 3H2BA 5AVOA 2H8KA 5CEFA 1QRUA 2XEXA 3ZCPA 4PF1A 3K0KA 1HE5A 1JU3A 1PS0A 3IERA 4RHUA 1Z6YA 4LRQA 3VNVA 3FXAA 3PUYA 2I76A 4B9AA 3VR3A 2DYKA 4JITA 1GWNA 4II2A 2RMKA 1AXEA 2J5QA 1P7CA 2C2WA 1BCRB 1ISJA 1FFGA 3AFHA 3EHEA 1V25A 4J7UA 5JZ9A 5CLIA 3WMRA 3ZW7A 3GGJA 2W71A 1FP4B 1CJVC 1EUZA 2CBZA 1WXQA 2QIOA 3HMQA 3LMKA 2X6QA 1FFHA 1Q0ZA 1J9GA 4GYKA 4OHUA 3ROQA 4K03A 2SCUA 4YRMA 2D5LA 3AVTA 4G81A 1V11B 4XIGS 1F4PA 5BYAA 2J85A 3BVPA 4JMLA 4TXMA 2YQZA 5PNTA 2O8CA 2YZGA 2Z4SA 1ZHOA 5JDIC 2IU3A 5JNWA 1IEVA 1SCDA 2QXUA 3TJRA 3VR3D 4YLYA 2VCYA 3E61A 2UZ1B 4YP0A 1I1NA 2R6FA 3ZLVA 5IDQA 1PT9A 2Y1WA 1HYQA 4KQ1A 3G68A 4X61A 4Y2SA 5ALHA 2Q4EA 1NOJA 2HDNB 3GUYA 3KQQA 2OCBA 4Q02A 4QLOA 5TSDA 4QOFA 1XJ0A 4P35A 1Q57A 4LZZA 3LUJA 2CMDA 2VAWA 3VNAA 3BHMA 1I2DA 4KVAA 2J3HA 3KHUA 3PHCA 1FFXA 3OIVA 4TV9F 4QJBA 3W90A 1TF5A 2VDNB 5ES4B 4Z4QA 4H7JA 1A9QA 3HDTA 3N86A 2IODA 3PX7A 4FS8A 2JVIA 3LDUA 4NE7A 1QIGA 1XMIA 4UOEA 1DJQA 4TMKA 2EDAA 1T9GS 3KPVA 5CA0F 2FA9A 3UCEA 1U63A 2H5IA 3EZLA 1I51A 2VO1A 4ANFA 1I7LA 3HKDB 3MWGA 2AZXA 2PJZA 5DJ5A 4GEGA 1O6ZA 4S04A 3V7WA 1RWQA 1A4UA 2VTVA 5HG0A 4DUPA 1HETA 1IY2A 1GL9B 3HS3A 1XALA 4YMGA 2CJFA 4EJ0A 1Y6FA 1EM8B 4D02A 4X90A 5JCJD 4WLFA 3WL3A 1YF3A 3RUAA 1W6UA 4C89A 1WZ2A 1PZXA 4ONEA 3H8SA 5A9RA 2HFJA 3PCXA 4LZOA 2EWWA 5ANRB 4CM3A 2QN2A 2WIJA 3LQ2A 3U1VA 2HF8A 2FXIA 3P9IA 1HQDA 4MUYA 5DCWA 3THYB 1NM5A 4RA6B 1YI0A 4BZPA 2ENUA 3DV0B 4NOMA 2V3CC 4MPDA 3RRFA 3VU1A 1KMMA 2ZQ5A 3QLVC 4FT2A 1HL3A 2HQRA 3W5CA 1RNLA 5AW6A 4LBZA 1UKAA 3HNOA 2C61A 3BXGA 4YI3A 2C31A 3G9XA 3U3DA 1BDMA 3DOUA 3ETHA 3KQMA 3MT8A 1QO0A 3NS7A 3PHGA 3ZE9A 1A0OA 1J7JA 4EENA 3S2IA 1RWBA 4YMUA 4JR0A 3W04A 3CCFA 3UICA 3R3ZA 1M2EA 3EG5A 1C1DB 1DEKA 3HDQA 4HADA 3OJCA 3UHOA 1XZMA 1ZCAA 2FKAA 3G7UA 5HZKA 4K88A 5AVKA 4JR2A 2WF8A 1L8LA 1SVWA 4J16C 4BYMA 4I9GA 4UVGA 4L95C 3AZOA 3QRWA 4WHMA 1ODIA 2ZGVA 1PQ4A 2H00A 5B2EA 5K2MA 2MU1A 2R1UA 3CLTC 4K81B 4NJOA 4X62B 4Q7MB 3DEKA 3DOCA 6NULA 4CM8B 2FZCA 1H3FA 2ZYTX 1XTPA 3NUQA 4FEYA 3DZCA 1DC4A 2G5TA 1TTTA 3FOZA 1DLIA 2JFBA 2OV4A 4M0LA 2QK4A 2QX7A 1JRLA 2VZ8A 5REQA 2PANA 4MUAA 4DQLA 3L3BA 1P1KA 1TEVA 1VKJA 4NYIQ 4CLOB 4OQPA 3AL0C 4A73A 4DV2B 4ZKEA 3AUAA 3R6GA 2AFIA 2AVDA 3WXBA 3DS8A 4D25A 4BQSA 1UT6A 4QUEA 1E4OA 1R6UA 1LSSA 4P3PA 3CKMA 3LQRA 1U7DA 4P86A 3SJZA 2PUGA 1JXQA 5FEMA 2P6UA 2B0CA 3TO5A 4MW6A 2P9GA 1MJFA 3T1HB 3HN6A 1VSQA 1QHYA 3UO8B 4XM1A 4HDNB 3IKLA 3IQDB 4PWYA 4UFOA 5DN6D 2NZUG 3BM5A 3NDPA 5F7JA 5CCXA 1DBWA 4UKDA 5IAKA 1XLTC 1Q0SA 1WDKA 4V0RA 1Z4QA 1EHYA 2WJ6A 2JFXA 4RORA 3TL2A 5E3HA 5JPCA 3TDMA 1QHEA 1NQOA 1QHXA 1VL0A 4M9UA 1JDPA 1JG7A 4UATA 1O89A 2OV8A 4KMMA 4RWEA 1YR8A 4WKOA 5CVVA 1VBNA 5HIIA 4AT1A 5JQGA 2XB6A 4JNCA 1ZZEA 2ZREA 2GBCA 3R6WA 1IOLA 1E2UA 2J3EA 2VJLA 1UBCA 3M1YA 3CO5A 5KOJB 1E1QA 3BUSA 2ODWA 1Z7GA 3C98A 3G2IA 3L7YA 1L5QA 1FPMA 3PC3A 4Q16A 5DGCA 3CZ9A 1HFKA 1WHTB 1A2OA 5GOTA 2B34A 2HSJA 3K73O 3TPFA 5EHZA 4JGBA 1XZBA 2UVQA 1MO6A 2VF7A 2ZYDA 1LDMA 2RC5A 4Q7LA 4G65A 1TAGA 3I0NA 3I30X 4QO7A 2QWXA 4L22A 4RPKA 3ZWPA 4AB1A 3C5EA 4AZVA 4UCXA 2CZCA 3NYRA 5DHTA 4AZ3B 3A8TA 3OEEA 5P21A 4PHCA 4V0QA 4H7FA 2QVZX 3EGXA 3L01A 5HEKA 5AKHA 2IYVA 3ZJUA 3QMWA 1WXGA 3AM5A 4UNSA 4W5RA 1QG2A 4FHZA 4EZEA 3SYNA 3LT2A 5EHXA 2O20A 5KJ6A 4BBAA 3IAUA 4FOTA 5AJUA 5K2OA 2C5FA 1ZLXA 2PM8A 2IKQA 1PL6A 2Y0CA 1NVBA 2C57A 4QEZA 2NU8B 2ZANA 5M29A 2I80A 2YWDA 4JWTA 3N3BC 3VSDA 3IV9A 3MGAA 1T35A 1W6RA 2BEWA 3OU2A 3E9YA 3OF3A 4ARSA 3OQPA 1E1CB 1KH1A 3VJMA 1E1NA 2XEDA 1R4MB 1L9KA 1ZEJA 4PN7A 3CRZA 1O97D 3EVAA 3Q2IA 4QREA 3AEQB 4W9NA 4XI9A 5E8JA 4RAQA 3ZGZA 1FBTA 2P79A 3CJQA 4OQNA 3ZPXA 1RZUA 2X9NA 3LL4A 4DNFA 4B40A 2RH4A 1UODA 2ID4A 2QTTA 4W5OA 1OXTA 4MR9B 4DLZA 4UEJA 1P5JA 5BWMA 4TMZA 5L45A 4LVUA 4R9VA 3FRIA 5FFFA 4ILKA 4XTRA 3S5JA 4BGUA 1GCUA 4I5FA 2I66A 4MR7B 4LFBB 4YAEA 3AFIA 4NV1A 3ITNA 3O4FA 4G5XA 3P9YA 3BMQB 1KK2A 1OFIA 1HZZA 1N8KA 3SG0A 4G1FA 4Z7OB 2EAUA 3CUKA 5G2OA 2H1HA 3SEAA 3KZOA 3T1YB 1FLAA 2FEWB 1BQEA 2A4MA 5SY9A 1VJ5A 5COAA 3BDVA 1ETHA 2C29D 3DVRX 5D51S 5JBIA 3PX3A 4HS9A 1T3HA 3FFTA 1OFGA 3RS4A 2D1FA 2JBHA 3CVOA 2JZOA 5FA8A 3OJOA 1E3TA 2PEYA 1U3WA 2A1UA 4BVBA 1MUUA 3WA6A 4HB2A 4F4HA 4OUDB 1TQHA 5L3VA 1I4TD 4G5QA 4AIRA 1KEEA 1XF1A 5CXQA 2AKEA 1SRRA 2ZT5A 4HLNA 1OV6A 3UAOA 3KYBA 3CLKA 4LC1A 1YMQA 2PIAA 1YXMA 4AY3A 2DLDA 3S7ZA 2VRNA 4LFAB 3DDNA 1PBNA 3TECE 4BP8A 2V0CA 1T2UA 4NYJQ 5LLDA 2O5EA 3GXBA 3S2SA 2J4CA 2XHEA 4UZFA 4XGNA 3VR6A 3DYBA 4J8PA 4RGYA 3E53A 4NU0A 3FAKA 3M6LA 3QBJA 5JDCC 3UG6A 2ZDGA 4E3ZA 3E1SA 3FGNA 3JAWA 2PH5A 1JE1A 4IR7A 4XD2A 5AI8A 5AVWA 2QXTA 1Z29A 1KZHA 5FJJA 5LFAA 1PBTA 2XA2A 2ZKLA 1E0KA 3BJMA 1LF0A 1TD9A 3WMGA 4DYVA 3ZVLA 1Z4MA 2DWQA 1JEDA 1ODCA 3JVIA 3LBIA 2BGUA 2OHFA 3P9NA 2D74A 3N8IA 1M1UA 5D86A 3H9BA 3CLTD 2Q8QA 4J9UE 2ES4A 3FH0A 2GPAA 1CLEA 2MTBA 4LJ5A 2AMFA 5IN4A 4IDNA 2F1HA 4C7MA 1XKXA 1V8PA 1MX5A 2F3PA 4R2MA 4X97A 3TOXA 4XEUA 2QRVA 3FR8A 2MOKA 1EZ1A 4DFDA 2WDZA 1XZDA 2A3RA 1KDZA 1MAWA 1L5SA 2QY9A 4PG6A 1OROA 1K3TA 3FYUB 1OIVA 5BOSA 3DBLB 1WR8A 4LS3A 2P3SA 5CNMA 4WXRA 4EMTA 4Z4HA 4RELA 3FFBA 3WRXA 1UOPA 1HY3A 4ZALA 1FUYB 2Z9BA 2H2DA 1OYOA 2LDXA 3KKOA 1PJ2A 4FZ5A 3N2GA 4J0CA 3QX9A 4B0OA 1XTVA 3MB8A 1IJFA 4RGQA 5J2TA 3W5HA 1YFJA 2PX5A 2OZKA 4P4GA 4LJRA 2YINC 1IM8A 2QMOA 3HWSA 4OXRA 3LYAA 2W2KA 1Y3IA 4P36A 5GTDA 1KFJB 4OK6A 5DTQA 2QTZA 1EDOA 1NSTA 3B6KA 5IP5A 3F73A 3NFYA 3KQPA 3DZFA 4TRNA 3D7RA 3JD0A 4NG5A 1NP3A 1U2PA 4P0TA 3V5NA 3PUXA 2W5UA 2GESA 1U8ZA 1W9HA 2Q4DA 3HYCA 1BEZA 4RESA 3REFA 5HHTA 3H5RA