1JG4A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosylmethionine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein-L-isoaspartate O-methyltransferase
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg4A00
4LWPA 3GXOA 1D2CA 1G8SA 3KR1A 2BM8A 5EKUA 5GWXA 4H0NA 2ZW9A 2AVNA 2LD4A 4OQEA 4BP3A 3FTFA 2ZVJA 3EVCA 2QRVA 3TRKA 5LQNA 3B3FA 3RW9A 3SMQA 3GJYA 1SVUA 1XDUA 1YF3A 3FTCA 5LQAA 4RVGA 2QM3A 4QQNA 2ORED 3R9XB 5GIOE 3T7TA 4M36A 2FRXA 2HWKA 1RI4A 3EVAA 3MTEA 3X0DA 1F3LA 5G02A 2GAFA 3UJ9A 4PWYA 1L3IA 3NVKI 2PJDA 3BKWA 3FUWA 3R0QA 4FSXA 4RVHA 4KIFA 2PX5A 5FUBA 1O54A 1G60A 5IKMA 3LDFA 3R24A 3HM2A 4X1OA 5C9ZA 1RI1A 2QYOA 3NWEA 4MQ4A 4PYLA 1DL5A 3FUUA 3HA5A 3Q7EA 3UJDA 3ER9A 1NE2A 2QY6A 3EEYA 3HEMA 3HVJA 1ZQ9A 2FPOA 4E2YA 2I9KA 2YVLA 5K0NA 3B3GA 4KWCA 3DOUA 4BLWA 4FP9A 3L8DA 4OA5A 3NWBA 5EZQA 2Y1WA 3A7EA 1X1AA 2AOTB 2P8JA 5DTMA 2AN3A 3GGDA 4GUAA 1G38A 5EVJA 1XVAA 2HTEA 3G2OA 4ISCA 4XUDA 3PT9A 4A6EA 2NXEA 4X63A 2VS1A 5FA8A 1JQDA 4R8SA 1M6EX 2XVMA 3T0IA 4HGZA 1NW7A 4PYKA 1UFKA 1RI5A 4DA4A 3LDUA 2GPYA 3FUTA 3H2BA 3ERCA 2PX8A 3PVCA 2FK7A 1QZZA 2ZLBA 4PYNA 2K4MA 2NXNA 3G8AA 2ONZA 3MCZA 4FR0A 5F2OA 2ERCA 5FQNA 3REOA 4CKBA 3LKDA 3OZRA 4IV0A 4PNEA 1EAMA 3DH0A 2EJUA 2C7PA 4BLUA 3B5IA 3C3PA 3A4TA 1KP9A 3FRIA 2PBFA 3THRA 5EMJA 4E2XA 4YUVA 3QV2A 4FT4A 1AQJA 5K0LA 2CKDA 2OB2A 2CMGA 4EKGA 2PWPA 3ANXA 1SUSA 2ZTHA 3KPWA 2Z6QA 1BKYA 2P7IA 4MHTA 2XBMA 3BKXA 5CCXA 2P7HA 5DRYA 2UYOA 3TKAA 5EMMA 2GB4A 2B9EA 3EVDA 3GRUA 3M6UA 5LQRA 3KR2A 3LECA 3G5TA 1ZHFA 4RTRA 5DT2A 5K05A 1RJEA 4X61A 2ZWAA 3M33A 5KQSA 4YMGA 1L9KA 4YMHA 5P8WA 1RI2A 5CUQA 3HCDA 4WVLA 2B78A 2CMHA 5FULA 5EZSA 5JR3A 2BZGA 4OBXA 4GOND 2FHPA 3G8BA 4CKCA 1X1CA 2AN5A 1EJ6A 3F4KA 3OFKA 3FTDA 3JWGA 4ER5A 1Z3CA 4OA8A 2NP6A 5F2KA 2ZIEA 3B7PA 4LWOA 1FP1D 1VQ1A 4E30A 2BM9A 3KQSA 3GRVA 2ONYA 5EKXA 4DQ0A 2H00A 4ER0A 2AOVA 3UJ7A 1R6AA 3KQWA 4X60A 2YQZA 5LSAA 4RTSA 1N7JA 5E2BA 4EVIA 3OU2A 4MIKA 5BW5A 2GH1A 3MB5A 2JH8A 2UZ4A 3FPHA 1IY9A 1R74A 2PY6A 4MTLA 1BC5A 3KQQA 5DX0A 3PB3A 1AQIA 3KQOA 5GOZA 5HFJA 3UA3A 5JUWA 1M0EA 2AS0A 1NKVA 3M6VA 1JSZA 4GOMD 3UFBA 4AZTA 5MHTA 1MJFA 5DM1A 5BW4A 1R18A 3M6WA 3SX0A 3TLJA 5K0CA 5E1OA 3A27A 5CVEA 1NW5A 4E32A 3CVOA 3TKYA 3DR5A 3ELWA 4M7RA 4PYOA 4E2ZA 2IDKA 3DXXA 3G88A 2UYCA 2YX1A 4GOLD 1WY7A 5CVDA 5BP7A 5HIKA 5KVAA 5LQKA 4KRGA 2WK1A 3I58A 5E8RA 5LQCA 1D2HA 2HV9A 2PLWA 1KIAA 3TQSA 4M37A 3UZUA 4YV1A 5BXYA 4LG1A 1QAQA 3S68A 1HNNA 4C05A 3I9FA 3K6RA 5K09A 5KQRA 4DZRA 1YFLA 4BY9E 1ZKDA 1O9GA 1I9GA 1WG8A 2PV0A 3HA3A 3LCUA 1YZHA 3NVMB 4R8RA 5M5BA 2ZULA 3EVZA 3JWIA 1YZ3A 4L7VA 3OE5A 3MQ2A 1NT2A 1Q0TA 2JHPA 2AOUA 3NMUF 5FCDA 5DTRA 3CBGA 3DP7A 3EVFA 5T6BA 4F85A 3FUVA 2IH4A 2G8NA 5DXAA 4E2WA 3DMFA 2O07A 2ZFUA 5EHIA 5FHQA 5FWAA 4R05A 5HIJA 4AZVA 5KYGA 3FYCA 3G2MA 5CIYA 3SXJA 4WXHA 2QE6A 5CD1A 3LHDA 3EGVA 2KW5A 4XUCA 3VC2A 5DX8A 4OBWA 4DF3A 2B3TA 2IPXA 2WA1A 1WXWA 1FPQA 3CC8A 3GO4A 2PX4A 5HIIA 1P91A 4KDRA 4P7FA 5EOVA 3UWPA 3C0KA 2AOXA 3DLCA 2P41A 3CKKA 4P7KA 4QTUB 4XUEA 4Y2HA 5GINE 3UBTA 1EJ0A 1VP3A 3O4FA 4RTLA 1XCLA 2N47A 4AZSA 2AVDA 4X41A 4QDKA 3MTIA 5T67A 1H1DA 1XCJA 1FJXA 2IBSA 3IEIA 2E5WA 2GA9A 2I6GA 4ER3A 1O9HA 4QDJA 3LKZA 3AWIA 4EKIA 4GBED 1DUSA 2OB1A 1KR5A 3EVGA 1UWVA 3T7SA 1EIZA 4DCGA 1INLA 2B25A 3UJCA 5EPEA 2CL5A 4QVGA 3LL7A 3GNLA 4R6XA 5F2NA 3K0BA 4RTQA 2HNKA 4DCMA 4P58A 1YFJA 2BH2A 2Z6AA 4YUZA 4HSGA 1YB2A 2FYTA 3A7DA 3HCCA 1G8AA 3BUSA 3ELYA 5H02A 4BP1A 3LBFA 4C07A 5FHRA 4EMSA 5K01A 5LQUA 3FPEA 4K6MA 3GDHA 1JTEA 3HA7A 4RSRA 1KYWA 4YV2A 5C1IA 5EQJB 2YXLA 1JG3A 4BLVA 1SKMA 1B42A 2AOUB 2V74B 1SG9A 1TPYA 4OX9Y 2PT6A 4FSDA 3EMBA 3RODA 2P35A 5E1MA 2CWWA 1JSXA 1SQGA 2XYVA 1BOOA 1G6Q1 2JH9A 3DULA 3NDIA 3P97A 4RTJA 3KU1A 5DTQA 1EG2A 5CVVA 2OPBA 3BWYA 3THSA 3P71T 3ELUA 3CGGA 4GEKA 2I62A 4PGHA 3GU3A 4KVZA 3BGDA 2WA2A 3G2QA 3KR0A 1N2XA 4HTFA 3GRYA 4QTTB 1NW6A 1XDZA 4Y30A 2BR5A 5EIFA 4F84A 1JG2A 3G2PA 4YV0A 2OYRA 2EFJA 1VIDA 2PGXA 2F8LA 2PKWA 3LCCA 4GQBA 1NV8A 1JG1A 3PX3A 4RVDA 1L3CA 3KKZA 2PSSA 3ME5A 2PXXA 1JTFA 3C6MA 1PJZA 1M6YA 3TR6A 3EEOA 5DM0A 4G56A 1L1EA 3KPVA 3M4XA 1JQEA 4AX8A 4IV8A 4E33A 3SSOA 2YR0A 1YUBA 4P7GA 2NNWB 4GC5A 4YUYA 3DMGA 3KQVA 3P2EA 3I64A 1KPHA 4UOEA 3TM5A 1IXKA 4CXMA 3KHKA 3G89A 3PLAE 2P3QA 3P9CA 2Z6UA 1I1NA 5CVJA 5GIPE 1VBFA 2R3SA 4FS8A 3TMAA 1XXLA 1FBNA 3I5UA 4IKPA 3FPJA 1TW3A 3CJQA 3OZTA 5C0OE 4HC4A 1RJDA 3HP7A 3HTXA 5DM4A 4DM3A 3NJRA 1P1CA 4GC9A 1X1DA 5FA5A 1L3BA 5E2AA 1AF7A 2HMYB 2NXCA 2PVCA 3E05A 3ER8A 3KQTA 4HH4A 8MHTA 1UIRA 3SR4A 2IGTA 3AXTA 5GM2A 5ICEA 3LDGA 3P9IA 1XJ5A 2AZTA 5K8VA 3JWHA 3I53A 3B3JA 3MAGA 1IM8A 2ZBQA 3LSTA 1Q0SA 1JG4A 4HTFB 4POOA 2R6ZA 3V97A 2IP2A 1EQAA 3KR9A 3DXZA 4M38A 4V0QA 4IWNA 2IDJA 2NYUA 2P3LA 3ORHA 4FZVA 4PGGA 3DUWA 3R3HA 3FPFA 2AOWA 1BHJA 3MERA 2DPMA 3P9KA 1QAMA 4U7PB 1P1BA 3EGEA 3A26A 3LX6A 1FP2A 3BXOA 4JXJA 1U2ZA 4FGZA 3RIEA 3BWMA 2OO3A 1N7IA 2AR0A 3AJDA 2YXEA 3IV6A 3EPPA 5E9JA 3WSTA 5K0BA 2ZZNA 3BT7A 2V7EA 3VC1A 3GIWA 3KQMA 3PS9A 1MHTA 1KPGA 4RX1A 3HVHA 1RJFA 3UJ6A 5ERGB 3KQPA 3QOXA 4EK9A 2H11A 4NECA 2VZ9A 3HCAA 3LPMA 5K0FA 4C08A 5K03A 4PCAA 3VSEA 1AV6A 5EEGA 2C7RA 3BGVA 1SUIA 4PIMA 1X1BA 3FYDA 3GRRA 3EVEA 3SM3A 4CKEA 3KPJA 3GRZA 1QYRA 1R8XA 4AZWA 1ORIA 2PX2A 2NP7A 3DLIA 3LCVB 2ZWVA 2ESRA 3E8SA 4CWAA 2UYHA 1NW8A 2IH2A 2NXJA 4HGYA 2ZBPA 5GM1A 3BZBA 3OFJA 2JHAA 4P7JA 1I4WA 5KS2A 4GOOD 3JWJA 5E9QA 2BR4A 5K0GA 2VDUE 4ER6A 4C4AA 1Y8CA 3TPZA 3DXYA 2UYQA 4PCLA 4PYQA 5CVUA 2H1RA 4QPNA 3UJBA 2IFTA 2ZBRA 2ZZKA 3M70A 4RVFA 4F86A 2HR1A 2EJTA 5DSXA 4GF5A 2IBTA 2ZCJA 5HILA 1X19A 1VP9A 1G55A 3E7PA 5DRTA 2A14A 5EHGA 5EGSA 3UA4A 3LGAA 3AXSA 2G70A 2DULA 2OY0A 3UJ8A 4CTKA 4DKJA 1P39A 1XDSA 2EX4A 3D2LA 5LR6A 2YUIA 4B17A 3OU6A 2YXDA 3FPGA 3CJTA 5DLYA 4YUXA 3AY0A 4PONA 3ID6C 5EMKA 3HVIA 5DXJA 3P2IA 3P8ZA 4LECA 4KDCA 2G72A 4V0RA 4O29A 2C7OA 3NDJA 1KYZA 2P40A 5HIMA 3C3YA 3CJRA 2ZSUA 2B2CA 1QAOA 2JHCA 3OU7A 2FCAA 4PYJA 5HOQA 2O06A 4QVKA 2AN4A 3BWCA 5HZMA 4OQDA 2O0LA 2OBFA 5FADA 5HEKA 1KHHA 3FRHA 5E9WA 5DX1A 4KIGA 2O05A 2O57A 5E8JA 2OKCA 4HG2A 4U7TB 3OCJA 3PFHA 3QOWA 3KQYA 3ELDA 1T43A 3DMHA 2IH5A 3DTNA 5FQOA 4A6DA 2C7QA 3VYWA 2QRVB 5EMLA 2GS9A 4XCXA 3SGLA 3PTAA 1ORHA 5D1HA 1ZGJA 2XYRA 3U81A 4E31A 4YUWA 3HCFA 1VPTA 3IHTA 4DMGA 1NBIA 1WS6A 1XTPA 4FT2A 2XVAA 4HRAA 3O7WA 5D1NA 3EMDA 5E1DA 2Y1XA 1R00A 4PINA 5U4XA 4MWZA 3BGIA 2ZZMA 2Q41A 2VDVE 5EG5A 4RTNA 5DPMA 3FUXA 3Q87B 1RJGA 3FZGA 5ICCA 2BR3A 3EGIA 5T64A 4ATNA 3EVBA 3TM4A 3UJAA 4PIPA 1NV9A 3R6TA 2JJQA 2ZIFA 3HCBA 1WZNA 3V8VA 1F38A 1VE3A 4RV9A 1JQ3A 3CCFA 5FTWA 4ER7A 3SSMA 1R8YA 2ZIGA 3GCZA 1V39A 4QQKA 1WXXA 4C04A 5LQJA 1NBHA 4RTKA 2PT9A 2P1DA 3HNRA 1VLMA 2P3OA 3PX2A 3MCTA 5K0EA 3M6XA 2OXTA 2EG5A 3C6KA 1NW3A 4RYLA 5B1SA 7MHTA 3PFGA 1KPIA 1PRYA 1TW2A 1KXZA 2OZVA 4C03A 3G7UA 5EC8A 2G71A 3T7RA 3SSNA 2IIPA 4KW7A 4Z2YA 10MHA 4R6WA 4ZTBA 3G5LA 3NW9A 5DM2A 3TOSA 1DCTA 2XYQA 3IYLW 2PWYA 3FTEA 9MHTA 1JR4A 3BWBA 4RTPA 3P2KA 2PXAA 2G1PA 3NTVA 4RTMA 1ZGAA 3A25A 3B89A 4EQZA 5K0JA 2JG3A 4RTOA 5ICGA 4C06A 3SVZA 2VDWA 2YTZA 3HVKA 5EIWA 3KPYA 2ADMA 4PYIA 3OE4A 5CM2Z 4E70A 1QANA 2FK8A 3GWZA 5E1BA 2VP3A 5GP1A 4CTJA 2AOTA 3P9NA 3HCEA 5CCBA 1HMYA 5EEHA 3KPUA 5DWQA 2PXCA 3E23A 3LBYA 3O31A 4QPPA 1ZG3A 4RWZA 5FWDA 1RI3A 5IH3A 2I7CA 5DSTA 5ICFA 3OZSA 3MHTA 1D2GA 3TFWA 1SQFA 3OPNA 4PYMA 2GLUA 1VL5A 3MGGA 1OR8A 4AUKA
chains in the Genus database with same CATH superfamily
4HXYA 4W9RA 4MW4A 5DLPA 2BGUA 2E4ZA 3D43A 3WMGA 4EGSA 4ZHQF 3O83A 4INJA 3NUGA 1YR2A 2XGSA 2WU8A 2ZVJA 3MJFA 3OIGA 4I5GA 4MUKA 5DISB 3TRKA 2QN3A 1FVXA 1GAJA 3L77A 4MDFA 4OQPA 2RGEA 3JYQA 4BC0A 4I9UA 5EJGA 3SU8A 4YPOA 3AUFA 2C4MA 3A1VA 3HEAA 2PZ8A 3T7JA 2IT1A 4JLWA 2OUKA 2YVQA 3INTA 5JAMA 2DT8A 4YAWA 1GY8A 4D92A 1VE6A 4PWYA 5A7GA 4OSPA 4URFA 3BKWA 2O2YA 1GYQA 2FSVC 2AXNA 2WRZA 3K0CA 4KIFA 4GKJB 1OI4A 2QX9A 1U9YA 4QC2A 3DHEA 4RJTA 3T8YA 2OWDA 1I8TA 4LDPA 1DL5A 1R4AA 4BB5A 1N6NA 3L7MA 4O4HB 2YVLA 4AECA 3DOUA 1R3UA 3JXEA 2O3RA 3NC1C 4YRGA 4RY8A 1WQ1R 3UFXB 3EGWA 4D0SA 1VCNA 2EFCB 4FDTA 1N6RA 2EAUA 3UWOA 4MS1A 4E6PA 3BE4A 1FLNA 3BRSA 4WN3A 4A6EA 4DY6A 5JNWA 1ESMA 2ZI5A 4N3CA 1SCUB 3Q3IA 2JCBA 5KX5F 4B3TB 5A5FA 3UATA 4KXNA 1YFZA 4IIDA 2ZCVA 3D2AA 3FBTA 3W2IA 1EK0A 2P4QA 1KARA 3H9GA 5IUJC 3I6IA 3KB6A 4TS9A 3SBOA 2E7ZA 4DA8A 3FH0A 1RI5A 3SC2B 1PR3A 2HT1A 1JFLA 3MJHA 1XZEA 1BU5A 5L95A 4MWCA 3SAJA 2IXAA 4AJ2A 2ZIZA 3SBEA 2RH5A 4RA6A 1H6DA 3LDHA 4ASUA 2IS4A 5DMHA 4Z4GA 2Q1WA 2Z2JA 4BX2A 3O93A 3SZOA 2QRNA 3UXMA 3TINA 4L75A 2X0FA 1CUSA 1KP9A 2QMZA 2PBFA 4MI9A 2XKBA 2QTVB 2ZBUA 4FT4A 1EE2A 1CF2O 1YE3A 3B8EA 4J1QA 4S05A 3BA1A 4FM9A 3NHAA 1T8WA 4NTZA 4WGGA 5DGIA 3V8NA 1XO1A 1RHKA 2N46A 3ZHVA 1S02A 2G9UA 9ABPA 3NHYA 2X0IA 5C1PA 2J7KA 4C7OB 2H0AA 1VKRA 4G65A 5AT1A 4BUCA 5JPDA 3JQGB 2B99A 2GVDC 2H29A 2WYWA 3IAEA 3M33A 2IOQA 3N2ZB 4KWTA 1ZUD1 3CNLA 2VIIA 3HO6A 4M86A 3WV5A 3RVBA 1S2MA 3IRVA 4KR2A 2JD2A 3H8WA 5CYGA 1ZK1A 4NS1A 2J4CA 3D8HA 2GOYA 4GUDA 5CVCA 1T1RA 5B7PA 1AT1A 1BGXT 4BLPA 4DABA 3LWNA 2YS6A 4ND1A 4H0CA 1P0PA 1G7SA 1N2EA 3P2OA 1O08A 4Q1EA 4XE5A 1NXTA 1VBKA 1T2EA 3KQWA 3L7KA 3LUAA 3LX5A 3OMWA 4MS1B 4RL6A 4X60A 4AY4A 1E8DA 1NI4A 2MSWA 2PM8A 3AB8A 3F6RA 4LRYA 1NURA 3I32A 2MCFA 4B8YA 4B6FA 3OI7A 4AUEA 5JALA 2ACVA 3L49A 3V7NA 2WU0A 2G5GX 3BIFA 3FYTA 2ZIVB 3I4LA 5GOZA 2D2IA 2RH8A 3KQOA 4HUJA 3BN3A 4WX2B 5BRAA 1HWYA 2AS0A 3H3FA 3VKGA 1CZKA 3OJ0A 2O20A 1H8HA 2BZSA 3EF3A 5TGDA 1BEEA 2FOLA 3QOYA 4PE5B 3KVYA 4RA6B 3WGYA 4WJZA 1VDZA 1KWGA 1H2XA 1ZYUA 3LIPA 4MUJA 4E32A 4IJMA 1DJOA 4W1RA 3G6WA 3JTMA 3WL5A 2DUMA 2AIRA 2I4LA 1J5XA 3WMFA 1YJ8A 3U7HB 3OBIA 2XB8A 4FCTA 3BCUA 2OBLA 4BKRA 3C1AA 5AKZA 5LQKA 2OGSA 1GTZA 5H59A 3VHRA 4H3HB 4FJ2A 3AEXA 4EJSC 1A9PA 3ZVKA 4TWAA 4MPPA 2DPLA 2HV9A 2IEGA 2HCJB 3VO8A 3TQSA 4DZTA 5IF9A 4GX1A 5M04A 1NVVR 4ND6A 3WL3A 1FDRA 4ZJYA 5B3JA 1HQYE 4GT1A 4DZRA 3PEFA 3W5BA 1YRQA 1FSZA 1I9GA 3K73O 4BGUA 2I55A 2F3QA 4MVJF 13PKA 4CV1A 1TQ8A 4KAXA 4CIDA 4K40A 2GAOA 4OJYA 4RMIA 4UW9A 2HGSA 5KOHB 4NZNA 1JHVA 3LA8A 3V4VB 4A0RA 4NU6A 2ZIXB 3QFFA 1NYLA 3PRYA 1GA1A 3MZ0A 1TEHA 2CFCA 2F1KA 1JQBA 1GL7A 3TSOA 4AJEA 4K0KB 3X43A 3DMFA 4DDKA 1RP1A 4MUMA 3UJ3X 1H94A 2Q4EA 3FYCA 4CMGA 4BFYA 1CR6A 3E2MA 3SXJA 3EPJA 2QZ4A 1ZD5A 3GY0A 3MMSA 3AERA 1SC9A 4DIBA 4W8OA 1ZVQA 1GG5A 2PQ2A 5JRJA 1NXWA 4OF4A 1NI4B 1SIOA 3BB3A 3NO4A 2X2OA 4JLAA 4M1MA 1R3DA 2B30A 4DYHA 2XRMA 2Y1DA 5KVQA 3H1GA 3IVXA 1ZI6A 3SYLA 3G17A 4FWTA 3PDIB 3REGA 4C6RA 5LB2A 3VSCA 4HFRA 1K2VN 2PUDA 1ZXBA 2IHKA 4JKYA 5KNDD 4DSOA 1FW6A 1RRVA 4K1XA 5F7ZA 2FHSA 3M1YA 5FJIA 2I6GA 4YPFA 5I3ZA 1UPUA 4ZD6A 4ZKDA 1XZQA 4G0PA 3WYGA 3WHLA 4N76A 2NVBA 5C7IO 1G5RA 5A62A 5L4SA 1YR9A 3GZNB 1J49A 3ADCA 3EXG1 3L9WA 4M1EA 2ZK7A 4AMZA 3VNVA 3GFVA 1TD9A 2ZBFA 5YASA 3DDUA 5KJEA 3QPAA 4Q9IA 4YUZA 2RHOA 3ANYB 1VTKA 3EGOA 1C4OA 1TU4A 2RHJA 2P9QA 1I3NA 4NYMR 4JNCA 1Z88A 1FOEB 3THXA 3RF7A 5DHAA 5SYAA 1RD4A 3DFMA 4EKDA 1DBQA 4IXNA 3PPXA 1SKMA 2XE4A 1B42A 2W4QA 2IITA 1SG9A 4M0DA 2X5JO 4OX9Y 1VHLA 5JJKA 1K8RA 1XQYA 2WIBA 3DP9A 5FBKA 2CXNA 1B93A 3QHPA 3FSRA 3NDIA 3W2EA 1A76A 2CBZA 2QTGA 1GSAA 4PSCA 1CJSA 1JLLA 3AERB 2X2EA 3F96A 3NEJA 3MTDA 1OGIA 1RFLA 2SNIE 5CW1A 1J06A 3TSAA 2XOKD 2Q21A 2G1KA 3NHMA 5L51A 4KVZA 1IH8A 1LVUA 2AMYA 3OA0A 3E3AA 1RLJA 4O1HA 4UCQA 3NONA 2EXXA 1EGAA 3CRQA 2IZ5A 2CL6X 1I6LA 4Q05A 3Q2OA 4WXRA 4EHLA 4QFMA 2F8TA 3JSXA 4GMKA 3V7FA 3M1LA 4N5LA 2FR1A 1OFGA 4WESA 2OO5A 4KTVE 1MIHA 1UBTS 3EQ9A 3HU2A 4YFYA 3BTUA 3AF0A 5KTOA 2V7GA 4LHVA 4B3XA 4JOSA 4A0FA 2NZJA 4ROTA 3BF7A 3OE7A 4B3CA 3KZOA 3KPVA 4NE7A 4CM7A 5C5DA 3D5TA 4GWLA 5C5EA 5TF4A 1Z0ZA 4D79A 4KR3A 4KH1A 1BX1A 3E3NA 2I87A 3VU1A 3NH6A 3WIUA 5CM8B 3X1ZA 5HRAA 1X94A 2NNWB 5T6MA 2YQ4A 3ECCA 2VXYA 4FONA 4Z6KA 3TW8A 4P4SA 1COZA 1I1NA 4D4HA 4D9EA 3THXB 1NXXA 3U5TA 4R1QA 4JWTA 1WUHS 2ZBDA 3O2QB 1TT5B 2D0PB 1W1UA 3OSZA 5C34B 3H1PA 2BUAA 3AOEC 4HYTA 5JNSA 3CJQA 1EE1A 4HC4A 1XMSA 4KLAA 3TTYA 1E9AA 1KEZA 4KPEC 1NUPA 3W1VA 3D8UA 5K8TA 5FA5A 1TLFA 1J99A 1IXZA 3I9LA 2JASA 5AKGA 1U0NA 4LZOA 4UE3S 3G0DA 4IM7A 1X0XA 2IWRA 1I0ZA 1Z8NA 2H07A 1ECFA 3SR4A 3VPAA 5TMBA 2HPVA 4DDWA 1YZTA 3H5OA 3KLNA 1QH1A 3B6ZA 3I2GA 1WKBA 1KAHA 1V6SA 1Q0SA 5F1OA 5HQTA 1DVRA 3T3GA 1R2QA 5HSGA 3RAJA 2A3RA 1B1AA 4I1RA 2X0KA 1MDBA 2JEZA 3DVLA 2W6ID 4JJEA 5HCUA 2P6RA 3VNBA 3DUWA 1Z34A 4E46A 2FY8A 2FETA 2IYWA 1DEKA 2ONJA 3OM0A 4CIYA 1M2NA 3LX6A 1TTPB 1KDRA 2C61A 4H7KA 4V2IA 4II3A 2HL6A 4GOXA 4IV5A 4ITRC 5AVZA 2Y2UA 1UXHA 2IZ6A 1BE8A 3TK1A 1XP8A 4DR5B 3QX7A 1RLMA 3UUEA 3QNMA 5DW0A 1NA5A 2IE8A 1JDVA 1V2GA 2H2IA 4QGFA 4RUKA 3AVVA 1MH1A 1PZNA 2PSJA 2X5XA 4HAIA 4JC5A 3SDBA 2ZSAA 4KHZA 4ZT6A 3KDSE 4P4SB 3FCEA 1ADJA 3LM8A 4BPBA 2EF0A 3HDGA 3Q0EA 5J4YA 3KPJA 2ECPA 4CL0A 1QYRA 1JMYA 2IKSA 1VC2A 1BDJA 5G4LA 4AJ1A 3B52X 1TTTA 1L6RA 4ESEA 1F51E 2QMOA 1NW8A 3EWIA 4QRIA 4D2IA 1RRCA 1X7ZA 4A8HA 4YCDA 2BSQA 1N0HA 1RBMA 5BPFA 4GP6A 2IHJA 4MK4A 3INYA 4LYYA 5F3DA 2QQ0A 2F3UA 3KEOA 3FDZA 4JIGA 3PFCA 2OMKA 3FTQA 3WWYA 3TPZA 3KTAB 4ZQEA 1CRPA 4QDTA 2R1UA 3TZQA 1B4DA 1VECA 2ZZKA 1FUIA 3AR6A 5TQVA 3TLBA 3IIMA 2BMDA 1A4XA 2D1RA 2C3OA 3MMXA 2OGWA 2J5QA 3Q6IA 4H7FA 3ZW8A 1SBNE 4RLSA 1OTXA 1U02A 2B82A 3PF8A 2B8NA 2OCYC 3QTTA 1AGPA 2G70A 4PNPA 4URXR 1PR2A 3GLVA 4DKJA 4I1OA 1C1DA 1M7BA 3I6QA 2X4GA 1FSSA 3F71A 3HLKA 1L4YA 2QD1A 3FPGA 3OU6A 4HNTA 4PX9A 2RHHA 3UYLA 2JAXA 5KVVA 2XOEA 3NHPA 4C7VA 3P8ZA 1JLSA 3OTHA 3HCPA 5HDQA 1OFUX 4L72A 5K3OA 1AKVA 3R7SA 2OYSA 3V1NA 1QAOA 3CH4B 3EIOA 3NPAA 1ND5A 3DYIA 5FL7D 1J2YA 4ZRMA 2WG0A 5JHGB 4CG2A 3TD9A 4ENTA 2IUFA 2O0LA 2GYYA 4BV3A 3E3LA 1YR6A 1QU2A 5AJYA 3LC0A 1Y5MA 3CE9A 5DTJA 3TQIA 3OPXA 3V3KA 4E03A 1T8YA 2VUSA 4G4SP 2GCGA 2QG4A 3H99A 2FW6A 2HZBA 3G85A 3FWHA 1YQGA 1C9YA 1Z0FA 3E8MA 5DV9A 3ZOKA 1A7AA 3DE7X 3JCZA 1T5LA 4RK4A 3T3EA 3OZGA 1Z4KA 4WACA 4A27A 1B2RA 2D4AA 1X7ZB 4KLNA 2OAP1 2VUIB 1KDOA 4QQ8A 1SRQA 5DI9A 5AKHA 4K9DA 3ZCSA 3CF6R 1C3VA 1P75A 1Q50A 1KK0A 4AVYA 5E7MA 1FS6A 3A6DA 1UZMA 3OLQA 3TUIC 3WLFA 3AY7A 5KNCA 2CWDA 2PKYX 2OXEA 2GHRA 2IU6A 1HOXA 4J16C 3DFFA 1F6WA 3H9JA 1AE1A 3GGGA 1D4ZA 2GPWA 1D6MA 1CR0A 3L06A 3SIXA 4OFXA 4U2EA 4J4TA 2PJUA 5K8LA 1NU8A 1IXYA 4HVCA 4IXTA 1WTAA 1O4VA 3W3ZB 4BQRA 4CHGA 4BU0A 4FR5A 2WM2A 1UZUA 2GSWA 2LIVA 3BK1A 1NAHA 1M6WA 2H6EA 2ZIGA 3GCZA 2R6JA 1N57A 2IXFA 4Y3UA 4I9NA 2XCRB 3SY8A 1ORVA 2JGJA 5IULC 1UBKS 5ES4B 2OHJA 2GD1O 1YAHA 4TZTA 4QJIA 1W5EA 4L51A 4RMHA 3MUFA 2EATA 3DW1X 1SZCA 3M6XA 4L4UA 2EG5A 3IEXA 4I46A 5TGTA 4GKAA 1JIVA 5DTEA 1JA9A 4NC9A 5BQXA 4G5HA 5CFRA 2ID8A 3T1YB 2JW5A 5EC8A 4EW2A 4FYWA 1THZA 3KV1A 3PEEA 1E7WA 1USIA 3EGCA 3LBHA 3TIXB 1OJLA 1RXEA 3K1AB 1THMA 1JR4A 1O89A 2XX3A 2ZOSA 4WAUA 3QY0A 3J81A 1A9OA 3NHRA 4ES6A 3KVVA 1GDHA 5IC6A 5KO2A 4FD3A 4GZLA 1T9ZA 5IVHA 1P5FA 2V7TA 3C8UA 5BWNA 1K5PA 2F90A 2Q2WA 3F7OA 3PPIA 4IFEA 3JQFC 2WD7A 4D6XA 2VHWA 3OETA 3GWZA 1E2PA 3DGFC 1F14A 3DE2X 5G0UA 3P9NA 2HIGA 3R7NA 1KZYC 3HP4A 4YDHB 2CYAA 3BFPA 2ZBVA 3QEMA 4YO8A 3S7ZA 5HXAA 3R1IA 4G8CA 5JS1A 2V03A 1MHPA 2JC3A 4R9VA 3MHTA 2DHEA 3WE7A 1XZHA 4PYMA 2F55A 1CZUA 1KH2A 2HT6A 3H5AA 4GQBA 1ZONA 2C3YA 1IRIA 1EB8A 4ENRA 4FKZA 3GLQA 4DLBA 2HDWA 2XPCA 2WU3A 4NE2A 1EWQA 3O9VA 3D3EA 4EF4A 2WHEA 3EVCA 3G5AA 4OKIA 4MNTA 3D4BA 2YKGA 3B3FA 1IB6A 1YRBA 2Z6VA 3CTPA 3RSFA 1N33B 2X8WA 3VZCA 4U4AA 2ZANA 2E82A 3ETGA 3OCXA 3OCCA 4OATA 4LBYA 1K8ZB 1X15A 3C98A 1Y7PA 4DCVA 5JARA 3NOVA 1YO6A 1RI4A 4US1R 2GAAA 5C31A 4DQDA 3F5QA 3ZBTA 3Q8LA 4F3TA 4Z9AA 5ALWA 1LPPA 3ZU6A 4FSXA 4KE6A 1Z25A 1TAHA 3JVEA 4BPRA 1P44A 1YZGA 1W36C 3F6CA 4H1VA 2HK7A 3IIIA 2AYYA 1JYSA 4G5OA 1DO2A 5JYCA 3E7DA 2XNDA 3FUUA 3D1LA 4QBTA 5A9RA 2C0PA 5GGXA 2B2XA 3D02A 1P7YA 1QGUA 4KNVA 4RGBA 5HCNA 4DNXA 3AR8A 5ECWA 4TL7A 3A9TA 3SYKA 5JTTA 5J2UA 2J30A 1W46A 2MSLA 1ZC3A 2Y1WA 2GCNA 3EWAA 5EP1A 4EFMA 1M6NA 5DYTA 3SFZA 1E3IA 1MXFA 3GN2A 4CQJA 1SKQA 4ZC1A 4E07A 4OQQA 4W8GA 1VM6A 2ACKA 2XGGA 3U3OA 1M6EX 2O23A 2XUKA 1U1CA 3H2HA 1E1CA 1LPMA 3UAZA 3R4VA 3NBYC 1B76A 1PSDA 2BHTA 4MQ6A 3KB2A 5BNTA 4UU8A 1RBYA 4FHGA 4L9AA 3USZA 3ZVLA 5FDFA 1WMEA 4QSMA 4O3FA 4EUFA 1DQRA 3CU5A 3CLVA 1U5BA 2NXNA 3DVRX 4H7PA 1JI0A 4KUEA 1OYYA 2JLUA 5B1YA 2TRSB 4IMRA 2XLBA 1WB5A 4Z4HA 2LCQA 2AW5A 3RSSA 3LUJA 2VJDA 4IZ6A 4NMMA 1JEDA 3ASUA 1GZSA 4QECA 1GNTA 1XRRA 3I45A 2CSXA 1G17A 1T4CA 1V9CA 2PMBA 1RAHA 4YJ2F 4C0SA 3U7FB 5KSYA 1UBNA 3GJ7A 4TV8A 4JB3A 4MAAA 1U7PA 4ILKA 2Q8QA 3CRVA 1SK9A 3KRTA 3KZCA 3EVNA 3O4VA 3ZI0A 2ACEA 3RRYA 1YOVA 4R8MA 3TBHA 3VX4A 5BV7A 4NBUA 1ORDA 3WYBA 1NJ5A 3FOZA 4YMHA 1UDCA 4LY9A 4W1PA 4QPZA 4LJRA 1U8AA 5CHEA 3A31A 1NRXA 1MC1A 2BZGA 2OT3B 1AD2A 1VPVA 1S3FA 3QVMA 4FHCA 3EF0A 1XPRA 3WRXC 2IIQA 1JEAA 3S5JA 4NV0A 3TOVA 1DC3A 1KJYA 4HYYA 3QELA 1WL8A 4QYMA 1T26A 1KAGA 2ZUWA 5ECGC 3CNEA 3U44B 2FEMA 3OIUA 3O8NA 4JVNA 2NZVG 5BVHB 4DJ5X 1BXGB 4OM8A 4KMRA 4MDEA 3IQXA 5JQWA 2KBEA 1SU7A 4PQEA 1N5JA 1U2DA 1XVLA 3TRIA 4MW7A 1W5FA 5CDGA 3VR2A 1MRSA 3L8CA 3T35A 3JD4A 5H8WA 3KQNA 5A4KA 2OP1A 5BRNA 5HMMA 5CDSA 3DF7A 2W5UA 3OH8A 2AG5A 2H59A 4W9NC 2QLLA 1WMBA 3ER6A 2IUYA 4M7RA 2P2CA 3L93A 4NEHB 1P1IA 1DIOB 4ZYYA 3DXXA 3L40A 2IEAA 4BWFB 5BP7A 2Y67A 2ILVA 2DE0X 4L0CA 1SHJA 3G9TA 4HMOA 3EPKA 1DAIA 1YZLA 1T4CB 1YI1A 2IY8A 4MXDA 1MB2A 4GS5A 2JCXA 2JARA 4RK7A 3RU7A 1OH6A 2W0MA 3B1YA 3U49A 5JEDA 3H1AA 4OHZA 3OZFA 3P2MA 3FDFA 3K0HA 3SBDA 4B82A 1Z2EA 5JLAA 1YOVB 2WB4A 1LX6A 4BB0A 3IIJA 1FLDA 3RM3A 4MLPA 1DT3A 3U0BA 5KOIA 3GAAA 1Q0TA 3NMUF 4WXPA 4O5AA 4X8LA 1JE0A 5AVWA 3DZIA 1P8JA 5KHAA 3QG5A 4WPGA 4DBLC 1T0UA 2QX7A 3SEAA 4YMTA 2G5CA 4JJZA 1K06A 3OFVA 3D8TA 3ONWA 4JZYA 4RSMA 4DV6B 3WGUA 4YRNA 3LH5A 2VHCA 2Y05A 4GWKA 4LK3A 2PGAA 5JE8A 2KW5A 4XUCA 1PWHA 1NN1A 2GN6A 4KQKA 4MLZA 4B3BA 4DY4A 1Q0QA 3AR3A 4J03A 4C89A 1JGTA 3CC8A 4KE7A 3H0KA 2MSNA 3L0ZA 4FX5A 4TN5A 4F21A 5EJ8A 1I13A 1KDVA 4Y2HA 3HNOA 1KGSA 3RC8A 4Q9AA 4OGLA 2R84A 4AKGA 4MYCA 1PKEA 4FDMA 2B36A 1EKXA 2C29D 3A05A 3ZS9A 4CW7A 4ND2A 1HY3A 4FVTA 4KE8A 1B14A 1E0AA 2H4YA 1OY1A 4PGMA 1HURA 3QUCA 2CW5A 4KI0A 4K87A 4LVOA 4OK5A 2CKMA 2BFDB 2E85A 2I03A 4RE5A 2XNKA 4AMYA 2JIBA 4BU1A 3LT2A 3QEKA 4ZOBA 3EXHC 1DX9A 3TDKA 2ZJ2A 1PQPA 2A8YA 2D1TA 2D3TA 2Z6AA 1RAEA 4HSGA 1HDOA 2DECA 3A7DA 5JC1A 3IJEB 4UUQA 5I9LA 4LRUA 4DMUB 4A1FA 1I4TD 4H31A 3RQIA 5B4VA 1DWQA 3EHDA 4K6MA 4RJJA 5CEJA 2QT1A 3OC0A 1ELOA 2JFFA 4BX9A 1GADO 4QOFA 2D0OB 1DIHA 2FFQA 1HOTA 2OCIA 1GSOA 2J3HA 3Q7PA 2YXLA 4MA4A 1PEAA 3D7KA 4KPFC 3WTCA 1ZNXA 2UXBB 4DGQA 3AUTA 3ZTYA 5ANRB 3ODGA 2HMAA 1LB1B 3D6HA 4XARA 1MB3A 5E1MA 4MMZB 5F64A 5JROA 1SQGA 1W2GA 4HB3A 4TKUA 3ZX5A 1RYFA 1UP6A 5FFMA 3KZ1E 4A8JA 4D4JA 1NBAA 2H9AA 4DREA 1EG2A 1H42A 1VGQA 4O2BF 3AUKA 3FSJX 1EDBA 3FFTA 4NOLA 2A1TS 2Y0PA 1TDJA 3DHYA 4I4TB 3RE1A 1OT3A 1HT2E 6ADHA 2QRPA 2YZNA 3A1FA 4QOHA 4RDCA 3BQ9A 3OP4A 2A59A 3G2QA 2CXSA 2VF5X 4LAFA 5JISA 2X2FA 1XDZA 2C9OA 2YHUA 1ILWA 1B8PA 1HQDA 3IRUA 2IHBA 4EG4A 1E2FA 2Z4RA 3X2SA 3I5MA 1RTTA 1RS0A 2B35A 3MBOA 4UHJA 4XIFA 3EDOA 4GGOA 1A9RA 4HEA1 3EPLA 1XTSA 2VJPA 3ZGXA 2GZ1A 2R96A 1T0HB 5JI3E 1DEHA 3EEOA 3HY4A 4HJXA 3TJZA 4CLRB 2PUGA 1SXJC 3KJXA 4JEHA 4MZXA 4O4LA 4YQEA 3GOHA 3GGCA 3DTTA 3EMVA 3H2GA 3U4IA 1FL9A 3KCNA 2YR0A 2C2YA 3EB9A 2BV3A 3SFTA 4JL5A 3AKDA 3DMGA 1DMSA 1M2EA 2PTGA 5KIAA 1X14A 2O2SA 1VLLA 3UQYS 3JQRA 1IZ8A 3W8RA 3ESAA 1JFTA 4MYDA 2DWQA 4HDAA 1BVRA 5CCDA 4ALNA 1Z83A 4EG7A 1UJ5A 3CH6A 4X3CA 1JEOA 3GRAA 1D3AA 3FTPA 3LT5A 3C97A 1BE6A 1DC6A 4WW0A 1SQ5A 2CYCA 1SVWA 1ATIA 1IQPA 1SCKA 3GFPA 4QYXA 3RUFA 3FAKA 5E2AA 5LB4A 5LXTB 1GTJ1 3NFYA 1G9SA 4HH4A 3O4HA 1UQRA 1GZ6A 1SPBS 2AMLA 4RKFA 4W99A 4CLEA 1Z29A 4ZDKA 3NKVA 2HO5A 2QTHA 1NZDA 3IEKA 4TMTA 3MAGA 2INGX 4IWYA 3AYZB 3GT7A 3EYAA 1PSZA 3ZGOA 1TJYA 2I3BA 3PP8A 1QHXA 5DBOA 3RU2A 2HA6A 1EQAA 2IYZA 2IUEA 2QAGC 5FNVF 4HZIA 1SKYE 1BHQ1 2CLDX 2RMKA 3MMZA 4O0MA 4Q01A 4TYYA 2O3TA 3PSAA 4JXJA 1II0A 1T5TA 1VE5A 3E7WA 1XF1A 4LUCA 3AJDA 4TS3A 2ZZNA 1IN4A 2EF1A 3WSTA 2HRZA 4F4JA 4YAGA 5LXTA 4UM9D 3IP3A 1PUJA 4I4NA 4G3XA 2JANA 4GVXA 3AKZA 4FZ5A 4UEKA 4QX6A 1EM8A 2XZTA 1XRSB 2VZ9A 1KE2A 1K6XA 1K86A 2YMMA 4TKMA 4JASB 3WXBA 2ZSKA 4J8PA 4UQLA 3G9QA 2PBLA 5I8WA 4WQMA 4C87A 3WAGA 2H16A 3RTAA 1WPQA 3IUMA 1ZD8A 1AV6A 3BAZA 1VE7A 5CA1A 4PIMA 1ZVMA 3BWEA 2Q3HA 4W6QA 2XUZA 2HJRA 1V26A 3PXAA 1EBBA 1X80A 3HXMA 2OCBA 1ONNA 1E1YA 3NCHA 4DQUA 4ML3A 2HSEA 1S8NA 4LBWA 4MAMA 4UHFA 4V0MA 4EPWA 4MHOA 5KQLA 2B5OA 1CRZA 4N0PA 4W9MC 1P18A 5AVKA 3RIXA 3AV3A 4GSYA 1BMTA 2DH6A 2FA9A 2M2IA 2QV7A 5K0GA 3T5PA 1KOJA 1C7RA 1TCVA 2DZDA 4FSHA 4H17A 3RFVA 2PUFA 4BP9A 3U6BA 4QFBA 2HX1A 4ZVSA 1G8FA 2MMCA 1FNCA 1DDGA 4J7AA 1UOEA 4JC4A 3DMDA 1PT7A 2AUNA 4WUTA 1EB9A 3OMLA 3ROQA 3JASA 4I5DA 5DRTA 5ALPA 3IXLA 4CFZA 2D6FA 3W4IA 1IY2A 3MINA 2WD8A 2YFKA 4IUYA 3BIXA 5DT9A 3L0BA 4NICA 4JUFA 1KSJA 3UJ8A 4BFZA 5CFLA 5LD2B 3WGTA 4X64B 2JCVA 1FMJA 3OJOA 1WMDA 2CNWD 5G1PA 3NI2A 3IAS1 5DLYA 3GWGA 5EMKA 2QS9A 2YYYA 4AQ7A 5KTPA 4KDCA 3JWPA 2HF7A 1UMCA 4KX3A 3GI1A 4MLCA 1JS1X 3T5MA 3CW8X 4ACAA 3I4FA 2Q1YA 3OZ7A 2R6DA 5A7FA 5C80A 1FMFA 3SVTA 4NLLA 2JF0A 1B0PA 3GQBB 5KB3A 2RG1A 1IAQA 2CXQA 3C70A 4NYIR 3R74A 2KHZA 1IULA 5EIBC 4AS1A 1R8SA 4BATA 1L7XA 1EX7A 4I55A 4QVIA 1OBCA 2JFYA 4L5BA 1QTRA 4WKPA 5E8JA 2VYVD 5CA1B 1T2DA 3QUQA 1M8GA 4O2AF 1W5SA 4LY6A 2XCUA 4J0HA 3C8HA 4AYXA 2OA0A 1QCZA 1R1DA 4PLPA 2VO1A 3AEUB 4KBYA 4DNQA 1ZEMA 2XA1A 2IQIA 1E59A 1Q15A 2Z5GA 3Q3GE 2XJ9A 4UPVA 4E2FA 2I6FA 3OJLA 1Q0HA 1WNTA 1D2EA 3G82C 1NYTA 2ZBGA 3MWKA 2QLNA 4IICA 1J09A 5IM4F 2FI1A 4K46A 1QXSA 1NBIA 2BY4A 4HI0E 3UTCA 4B3HA 2VZ0A 2AZMA 2VJBA 1GZDA 1BRMA 3EMDA 3FZEA 4FMBB 1E94E 4JBNA 1IMOA 4NULA 4QJ4A 4AB1A 5M2QA 3HHPA 2X9GA 4UJ5A 4FNGA 1IJKA 3KOZA 3ZYZA 4D43A 3NBQA 3Q87B 4WLEA 3G7NA 2K5UA 4OYHA 3MINB 5AXCA 4DEVA 2P5UA 5T64A 5J9FA 1F7UA 3TM4A 2QVLA 4FC6A 4GSKA 4XWAA 3IGFA 1XZJA 3KT8A 4ZZ0A 5J47A 3PFIA 3UC9A 2VVTA 4DN6A 4DADA 4H6WA 1FLVA 5K99A 5LQJA 3LO5A 2P1DA 1C3EA 3GZJA 3UBMA 3U60B 4CMEC 2OVFA 2QPTA 1H4VB 1OSNA 3LL4A 3MCTA 4ZO9A 1HSOA 1QIFA 2IXBA 4TWRA 3TAUA 1REQA 2NZUG 5EQTA 3ETEA 2E3JA 2GO7A 2W43A 2D2FA 4A03A 4EUKA 4I55B 1EVJA 3VR6D 1XXHA 4JQYA 4OLFA 2PWYA 4KQGA 2WY2D 3SF8A 4EHNA 4MJ3A 2XMBA 4NBRA 5JCJD 3QNUA 3FSGD 1T91A 2O5CA 1JG7A 4X71A 2QMEA 3PQ6A 1OLSA 3SI7A 3ZKWB 4JI5B 5A3RA 3LVFO 1NVXQ 4NYJQ 1FTYA 1RPNA 4MS4A 1HA3A 4BVFA 2A9KA 1RPJA 1Z9BA 1S7GA 2ZAOA 2AKAB 3BC1A 3HMQA 3JWEA 1AKNA 5IH3A 2WFAA 3LU1A 4QPPA 4XX0A 3TCNA 4B73A 1KOFA 1WB9A 3INNA 4G8BA 4V2UA 1DELA 2FAXA 3C4JA 4B43A 3COZA 2RGAA 2CDBA 3EEFA 3PTLA 2NUTA 4GI5A 4L15A 2YZMA 2YBDA 4ECEA 1XJQA 4MB6A 1W73A 4KUHA 3P2JA 3R8CA 5FAXA 4TMZA 1J5EB 1WSBA 5EKUA 3GP5A 9ATCA 4CCYB 3ZD7A 3HFRA 4HJRA 2LD4A 1E5DA 3UJBA 3L8EA 1GT91 3L8HA 1GPUA 3RG8A 3UAWA 3HBFA 3KOYA 1CXZA 2I99A 2RH4A 3FSEA 3L7LA 2X8JA 4WLUA 3R76A 3VV3A 5CEFA 1KEEA 4BKMA 2CB9A 3NHWA 3RFUA 3JARA 3D7LA 1YJCA 4C7MA 4D0RA 1YZYA 2ZCUA 3JQBC 4J94A 2ZDQA 3EVAA 3MTEA 4MKGA 4JX8A 3MJEA 1KZGB 5EJAA 2Y0DA 1F3LA 1REQB 4L8FA 3WKBA 4PVCA 5E95A 5BNZA 1UM9B 4RE6A 4UAVA 1O5OA 1T0PA 1D0VA 2MR6A 3SE0A 1K6JA 1CY6A 1O54A 2HF2A 3C5HA 1QG0A 4GPIB 1XXHB 2PSHA 1N3LA 1K4YA 1NMXA 3E03A 4IIJA 4D0GA 2C3MA 1P4AA 3SF8B 1ISIA 3T5TA 2ZTUA 1BXRB 2P5TB 3A3OA 4XIGS 4IZOA 1N5IA 1WCYA 3PLRA 4AMGA 4BVGA 1H9CA 3VU0A 4GZ3A 2NO1A 4FP9A 3OBBA 1OLSB 1FF9A 4GE0A 4QAQA 4ZAYA 1R5OA 5GPBA 4II7A 3L4SO 2QI9C 3KZNA 4JYMA 4M7PA 1PS9A 1W4AA 1NLZA 4V1CA 1M0WA 3EBOA 1TCCA 4FZRA 1UQUA 1XVAA 4GUAA 1PW5A 5JAPA 2Q4DA 3AR2A 1PJAA 3NDPA 3EDQA 3AKYA 3EC7A 4KEAA 4M9UA 3GJ6A 3IOMA 3RJMA 1VGRA 4QRHA 4QEZA 1RZ3A 2Q1TA 3CWZA 3AP1A 3PVCA 5IJAA 1QZZA 5AW5A 1QRUA 5JNRA 3CLTC 2FG7C 4YJDA 2W8BB 4NZZA 5CXXA 1PGNA 4IHJB 2I8CA 4CG0A 4E09A 4EABA 3ZDDA 2C0CA 2Q3FA 4P54A 4FI3C 1CY8A 1NI5A 1OBFO 2F1HA 2XITA 3B5IA 4JUDX 4QBGB 3Q72A 4P5DA 3QV2A 621PA 4PX2A 3ANXA 3QF4B 3G2KA 2BRUA 3LUKA 1DKUA 1MX5A 4AN4A 3OKFA 3EUEA 4U9HS 2OGTA 4C0LA 3KSZO 4RMNA 3U61B 2X7HA 1UAYA 4U02A 3OX2A 1KFBB 2WP0A 2FMKA 3OM1A 4X61A 5AKIA 5HKLA 3UHAA 4TTAA 4L95C 4B44A 1N1DA 1QG2A 3QJGA 1QJCA 4XR4A 4L3WA 5EZSA 3L9XA 3C3BA 1QZXA 1GRCA 4EA8A 1XNQB 2PH1A 1H5NA 4KGDA 4ILEA 1IWPB 1WF6A 4LISA 3WIOA 4C0XA 2QPLA 5L7YA 4RO0A 4C7KA 3CEMA 1PNQA 1Z3CA 4KXWA 4XOUA 3T1NA 2CZCA 3VTKA 1QKIA 1FP1D 1UKEA 5E3JA 4TSFD 2J5XA 1DXOA 4XQGA 3IP6A 3UJ7A 4KPYA 4PC7A 5JLJA 5GJVC 4DCTA 4V1CB 5JSZB 4U2GA 2HA0A 2PIDA 1C9EA 3I0ZA 5B1IA 4EYGA 2DUNA 2JH8A 4MTLA 2B0CA 1KNQA 3LQ2A 4IVQA 3MG9A 4TOIA 1HM5A 3A4YA 2OXIA 2QTRA 1KYVA 3P26A 4RCZA 1P5RA 4GWGA 2FPWA 4E14A 3ZWOA 5I7OA 3Q9NA 2P3SA 2E4UA 2OPHA 3SQMA 4DMLA 1DKOA 1E2EA 1JKJA 1TEVA 1H2EA 2JZOA 2QTTA 4LMRA 5BSTA 4US2R 3C3JA 5GADl 2JAQA 1U1DA 2FMHA 1HXHA 4LS3A 3WWDA 3R3ZA 1LI5A 3DBHA 3U1VA 5JS8A 3N87A 2Q4OA 1WDKA 3P19A 4J49A 3EZYA 3VYSB 4XGRA 2Z3WA 2YJ4A 4OJQA 3K9LA 2BFBA 5KVAA 2BWJA 4IBOA 1V5WA 4KXMA 2EW1A 3I58A 5CM9C 3TLAA 3VHXB 3A3YA 1KIAA 2Y76A 3LP5A 3WBJA 4C4OA 4BQEA 3NIBA 2JLWA 4ZO7A 3IIEA 5CURA 3JSAA 4EITA 5HE8A 5KQRA 1AF4A 3W7VA 4XWWA 1SVNA 5EQDA 3V4SA 1G5HA 4U0JA 2PSFA 4UM8B 2H85A 5ITVA 4O3MA 2G6BA 1C7ZA 4X90A 2YNMA 3O1LA 2XYHA 3JWIA 2KBFA 4BNKA 4P81A 1A9QA 3PPWA 4IUDS 3HO1A 3ZNQA 1KJNA 1DDOA 2DVMA 3AVYA 5BMVA 4M98A 3EFBA 4PPNA 4F0JA 3OWOA 1R8QA 4X1YA 2VTDA 5CDFE 4KPUB 5BNFA 3CMMA 3BB1A 3PQ8A 2OORA 3SBXA 1IBSA 1W36D 4Q66C 3QY9A 2BE9A 4TVOA 1IBCA 1ST3A 2R47A 4W5QA 5B4UA 2VNKA 1E9CA 1XYVA 2W2KA 4G67A 2ETXA 4ZVLA 3VBCA 4DNOA 1SC1A 4FS3A 4MRSA 3L7OA 4DF3A 3GO4A 5AM4A 4E4YA 1B1CA 5I01A 1LDBA 3MT9A 1C3LA 1F0KA 3OAAA 3TNDA 4FHFA 1EJ0A 3PCTA 4U6NA 2F2TA 4V03A 5E7JA 4H6PA 4WUVA 3RYTC 5IMSA 2LWIA 1USGA 1U9CA 2DHCA 4K6CA 9LDBA 1O9HA 2AFVA 2X4DA 3N53A 3OP1A 3EARA 1A2OA 1SXJE 3FPKA 3JYOA 4RHEA 4YTEA 3VVCA 2RHTA 1KY3A 2H4HA 2FDXA 1O87A 1QR6A 1CZHA 4UUOA 1SA0A 1B8OA 1A7UA 4HN9A 3C4QA 5EPEA 4P6VF 1N2CE 2BFBB 2QTZA 4R3WA 5HIAA 5IVKA 1SELA 4BQPA 3RSHA 2EL7A 1N34B 1D8TA 1T9CA 4HY3A 1IN5A 1V47A 2OGZA 3F3KA 2I1LA 4B3MB 3M6LA 3GFFA 1H4QA 1PV2A 2LXNA 3X1MA 1NJ6A 4EWLA 1GYPA 1JSLA 1XFAA 5FPHA 4E4RA 2WIFA 2GCPA 3AIMA 2RBEA 3CA8A 1RM4A 5LWQA 1KBZA 1ZUWA 2GZSA 1X7WB 2ZI7A 3AFNA 3UAYA 1Q7GA 4BLVA 1F0YA 3U3ZA 5FWYA 5KKCA 3TXXA 5FTJA 2YWBA 4MPDA 4MV6A 4AJIA 4YCNA 3QE2A 3MAJA 1WZCA 1A5TA 2J31A 4D80A 1KJZA 5IBCA 2OOSA 2QD3A 1J1UA 3LOQA 2FZEA 3K1ZA 4LNUB 3EIFA 3UMVA 4Z0HO 4NSNA 2GXUA 1H65A 4F4UA 3QVXA 2CK3A 4GKKB 2IXGA 5LKRA 4PSDA 5MN5A 3RT1A 1RZVA 1RHUA 1O95A 1GKIA 2B20A 1G9TA 4QTTB 1L4KA 4UXJA 4YN3A 2VHVA 1R0LA 3TLEA 3IAM6 2EJWA 1K27A 2O0MA 1C3JA 3AY3A 4INPA 3HVUA 2P2ZA 3M5CA 3EOZA 2H2WA 4GP7A 4B09A 1J42A 3DZBA 5LZ4A 3LT4A 1KZ4A 4ZI7F 1NNEA 2IOFK 1DRKA 2OBXA 2ODAA 1YNSA 5ALOA 3IDZA 2O0JA 2MYUA 2ZUFA 1MRNA 2I8AA 2RG7A 2W11A 1LPSA 2HYDA 2J5BA 2XAUA 2DR2A 2E48A 1EE9A 2V97A 1D1TA 4IP0A 4JX9A 1R6VA 1WCIB 3DDSA 4K03A 4JU9A 4RDHA 4HUTA 1JVBA 3RC2A 2BDEA 3ESQA 3TZ6A 1KRHA 1N6KA 1GPKA 5E38A 5A06A 2EEPA 2Z6UA 2ODQA 1P5JA 3TTTA 1VXRA 3IC5A 3I01A 2IE0A 3STWA 3CSUA 5JPIA 2BGGA 5DXFA 2X9QA 3X1JA 1EH5A 2OG1A 3CO5A 1HE1C 1FUYB 3QYAA 1AJEA 5DHPA 2LPMA 1Y3BE 5CHYA 1Y4AE 3NJRA 3QKSB 1DX6A 3AGQA 1J22A 3RIHA 4EW1A 1E9DA 1U1IA 4OY3A 3T3OA 2A7QA 3C3MA 4GR4A 4ZWNA 1L8LA 4XCQA 1ONSA 1DZIA 3GJ8A 4G41A 3V2IA 1P9NA 3WWOA 2IVFA 2PL9A 3B2QA 1QM5A 2BFCA 4WNYA 3PQEA 2XE7A 3TEMA 1TMGE 1QUEA 2VQSA 5AXDA 1DKPA 2JFQA 2RHBA 3EUWA 1G4UR 3KT3A 3NATA 2GYVA 1OIVA 1JG4A 2H4WA 2MYPA 4GMXA 4A2WA 1XMVA 2RIRA 5LP6F 4HDRA 4M38A 1UAAA 1FDOA 5JZMA 1AO3A 1DAKA 4DLPA 5CT9A 4FB5A 2BMAA 5HJ5A 1U4OA 4B2YA 3Q0IA 2V6JA 2CL7X 4AKIA 5BUCA 3D59A 1DBVO 1D7AA 1LF5A 3BWMA 3GCDA 3RIEA 2AR0A 3WG9A 2VR1A 2QSZA 1NW4A 1JHOA 3ENWA 3IV6A 2DXIA 2IP4A 3GIWA 2E2WA 4XASA 5EMNA 1MHTA 4KK4A 1PYOA 3JQAB 3A9UA 3HVHA 2FN7A 3PLNA 5HPYB 4QO7A 4EK9A 1AUOA 4BP8A 4O5OA 2XJ4A 4LXQA 4M4SA 4PXAA 4JJ8A 4WOBA 5F98A 1K3FA 1E89A 5K03A 4PCAA 2WFMA 4GQIA 1Y6GA 1HO3A 2Q7DA 2BUBA 3GUUA 4NV3A 4C0WA 1CQIB 4NFHA 1P19A 3PC8A 2J7PD 1E1DA 4CKEA 2PO5A 2XE6A 3GRZA 3RUDA 4AWBA 3SQLA 3DLIA 1FDSA 1QNFA 4JLNA 1MMFB 5HF5A 1RW4A 2WJWA 1W85B 1R0KA 3WGZA 2GD6A 4GM0A 4PO1A 3ZGLA 3RC7A 3F8WA 4DIMA 2JLZA 3N0XA 1I4WA 2HQRA 2G1JA 2X6TA 3AJEA 2SBTA 4HBZA 4LGVA 5KS2A 1WBBA 3QFHA 1HT1E 5HK8A 3C3XA 5BR4A 4YMWA 2BD0A 3WB1A 1J8FA 2OC9A 1K6IA 4OI2A 3RSZA 4C4AA 5I7SA 5IUNC 3RWMB 5JJCA 2BFCB 4XPZA 1JIIA 4URWR 8ABPA 2R79A 4I1YA 4KMSA 4TLAA 1P74A 5DBHX 3ZVRA 1EXMA 3LQRA 2WSSA 3PQ2A 3VZBA 4F46A 3RSQA 3EHEA 5EHGA 1E2DA 4JLKA 1Z2CA 2BM1A 3O38A 5B2ZA 3FOAA 3HDHA 4CTKA 1SHTX 3HZOA 2PL3A 3GVPA 3LJKA 3VPXA 3A6ZA 3HZHA 3FPAA 1PDOA 1W6UA 2GF2A 4B17A 3U4MA 2EJVA 1TC2A 1IQRA 4YI5A 4D4MA 3AY0A 1UUFA 3ID6C 1WOMA 3OIFA 3P2IA 2DC1A 3AVWA 3CRW1 3QVVA 1NMEA 2P9YA 1K75A 3BYZA 4IFIA 1A04A 3BEOA 1KAEA 2GNPA 3B3AA 1C4KA 2VJLA 3B9QA 4F56A 2WLTA 5ITZB 3TRFA 1LCIA 3OU7A 4IVPA 1F2TA 4UTXA 3WHIA 3ESZA 1GKKA 1JRLA 2P77A 1T9GS 4XM1A 4A26A 2JLYA 3N7UA 2PPLA 1B0AA 2N75A 1DXHA 3FRHA 2AYZA 3HFSA 4XJVA 1TM3E 2JK1A 2XIJA 1UK7A 4C3VA 4EI9A 3LP6A 4CKEB 1G5QA 4CIWA 5JOQA 2CHFA 5J3JA 3CVVA 1LTKA 4N41A 1QPZA 2CFTA 1U0OC 5KOJA 2ZU6A 1WQ4A 3AKEA 3L0CA 2F1RA 2EG9A 3UOGA 2C4UA 1KI4A 3PNBA 1SHZA 3GP3A 4B3RB 5AI5A 1RWQA 3M7IA 1SRRA 3DLTA 5J2TA 1ONOA 1S0UA 3Q40A 5ITWA 4LJ4A 3DW3X 2W42A 4JUBA 5G1OA 1ZVVA 4Z49A 1G8PA 3H2ZA 1VPTA 4KQWA 1XMIA 3NQ41 4DMGA 2QPAA 4ALKA 2PPVA 4B48A 4G0OA 4N40A 4MZDA 5FTLA 2CNLA 2Q3MA 3FNHA 5JXGA 1AX9A 4O33A 2A5GA 5JJ5A 3I72A 4UQPA 3AZPA 2JGFA 1RYEA 5B58T 1M7GA 4XD2A 2BR3A 3NU1A 4FOOA 2IEBA 4ZREA 1M34A 4AKSA 3CZRA 2JZNA 5M34A 1U6IA 3T99A 1RQGA 3UJAA 2O4CA 2WB2A 1XOIA 5TVKA 2VDMB 3ZHRA 4E5VA 1A77A 2QT0A 2HYIC 4RV9A 5EPUA 1FXWF 1UMDA 3QFSA 2PBRA 4QT0A 3DBLA 2ZDHA 1Y81A 4UE6A 4DGSA 3DQPA 1J7KA 3OKCA 1XWFA 2Y92A 3BA6A 5BQPA 3QVLA 1L7VC 1NIJA 1WBJB 4QPJC 3E15A 5H3CA 4QYTA 4NKRA 4EKYA 4CI0B 1F2TB 1N6OA 1QOPB 2RK6A 1K08A 4LJ8A 1TW2A 4FOTA 4CT4B 1YB1A 4N82A 4BNVA 2XUIA 4I6JA 2ZE6A 4RW0A 2H4FA 2YN0A 1JNXX 3HZZA 3F8TA 3W5DA 1LJLA 2FW7A 5CK5A 5M7EA 3FTEA 2IDZA 3TCXB 2GPNA 2PXAA 4OUDA 3B78A 1HNXB 4FXPA 4Y7DA 1EFTA 1G0NA 1CWUA 3MTQA 5TS3A 2ECFA 4EUHA 2C82A 2VDWA 3SD7A 4GOJA 4GX5A 4KIWA 3K5WA 1UBLS 4H35A 5CU7A 1KIFA 2PVSA 1BA3A 2QRQA 5J2TB 5BR7A 4Y0NA 1Q22A 3I09A 1CB0A 2V7QD 4JQZA 4MVJP 1NQOA 1Z2PX 4QHSA 4AZ3B 3W3AH 1YZUA 3R8XA 1W0KA 3R5KA 4C4XA 4BQQA 4EG1A 5ICFA 3CO0S 1K66A 2VRNA 2R44A 4MRVA 3CR7A 1F6DA 3LUHA 4S35A 2ZM5A 4YAKA 1W94A 1R27A 2FEWB 3AJ9A 1QCYA 3T9FA 4KN5A 3VSAA 1M34B 2ATIA 5DCYA 1KY4A 4XDGA 4LHZA 2XE8A 4BNMA 3ESCA 1WKVA 3P96A 3A4MA 4RIHA 4YJFA 3P4YA 5KYUA 4MRNA 3COWA 3K9BA 3B13B 1BCSA 3GA7A 2Z98A 1AXEA 1UPBA 1XDUA 3G0GA 3LG2A 3QVOA 4MYSA 3U16A 1GVNB 2GN2A 4MV1A 1Z0IA 3DL2A 1DOZA 5IYZF 3DL4A 5LOVF 1O0BA 3H86A 3VHLB 4LOHA 2V3VA 2C59A 5B2FA 1XLVA 4JLSA 4B3FX 1EXDA 2OR3A 3GDFA 4MW5A 1FE8A 3FUWA 5CH8A 2CMDA 4P4GA 5FNZA 2BHSA 2H3HA 4FEAA 3VOTA 1ZWKA 4UU7A 4RD1A 1WLYA 4ZJUA 1U65A 4GPEA 4OUDB 5B6IA 1XDWA 1GL9B 5EIBD 1TCUA 1X74A 3NV9A 1E5LA 2J3IA 2FQ1A 1Z38A 3MN1A 4G97A 4DJDC 4YRKA 2W48A 2B8TA 1FTQA 4KWCA 1TZMA 1JHPA 2TYSB 2XOXA 1G2QA 3FA2A 3R7LA 4CM1A 5ARBA 4OLAA 1QK5A 4BMYA 1C9NA 3BJMA 3NWBA 3LHFA 3LF2A 2SKDA 4H2DA 4OFBA 1UF9A 2BSXA 2HK6A 5EZQA 4AY5A 5KPJA 3U09A 1JBEA 1UJBA 4YRQA 2OMEA 2GERA 3HV2A 4UD2A 2D7JA 2X8LA 1XKTA 2FPKA 4UHDA 5TPWA 1FYVA 1CP3A 2W70A 2ISSD 4HQRA 2DTDA 2Q4TA 1EGQA 4DPMA 3WL6A 4RMGA 3WGHA 2FW1A 1Z7GA 1T2UA 3EZ7A 1HDYA 3WO1A 3UY4A 1T2AA 3LDUA 5IAGA 1GKYA 1KWKA 1TQDA 1JIUA 3PIRA 4U8HA 4Z99A 1G8MA 4F9EA 4N7JA 2AGVA 4W63A 3H9QA 4YJFB 5AXBA 3ZDBA 3ZDYB 4LRQA 5KYUB 3RADC 1NTRA 2YIMA 3GBSA 1C1YA 2WMYA 1JXQA 4HDMB 4I6EA 1QRTA 2GN8A 3IBSA 3PQFA 4Q4JA 4E2XA 3TLGB 4HCJA 1RKQA 2XRFA 5K0LA 4OG2A 1NUUA 2CMGA 2CVPA 3PT5A 1SUSA 2QUAA 2Q9BA 4RVUA 4BJ5A 5EIEA 3VISA 1H0KA 3FM9A 3PKIA 3TKAA 2UYOA 4X95A 1QDUA 4JQOA 4K8OA 5E6SA 2YVAA 4G2NA 2M98A 3AUSA 3M6UA 4E6EA 4CTNA 2UXCB 4FOSA 2Y9PB 3H3JA 3OIDA 2D13A 2VN8A 4XD7A 2BEWA 2YCLA 1BFDA 2ZJ8A 3DZFA 1YC5A 1Z35A 3GT0A 4IG4A 2CLCX 3AUUA 4QAJA 2CGEA 2G06A 3SKXA 4KLRA 4GOND 1MVLA 5JBIA 1KEWA 5J5AA 3TH5A 4NCJA 3OFKA 3QP9A 3THWA 4M0UA 4WBNB 4X20A 2VDJA 5CNMA 4IFBA 3EDRA 3GRVA 3WZ2A 2ZQ5A 4C0BA 2C7VA 5JMPA 2BFFA 4F5YA 3BD6A 7MDHA 1LKZA 3NBMA 3B2NA 5A7HA 2X3FA 5TPWB 3ZGZA 2Z58A 4N49A 5GONA 4EUNA 3O4GA 4YHHB 5AM1A 2GLTA 4PBTA 2R4UA 4P3YA 4QDUA 5BPHA 4XI9A 3S81A 2HI0A 5KCMA 3K70C 4LVUA 3GELA 4ZAWA 5MHTA 3AM4A 2FN9A 5AQ1A 5I9NA 3KAJA 1PX2A 2EYQA 2J6CA 4LXHA 3WLRA 3QEAZ 3S3TA 2RONA 3KCQA 1NW5A 2AI2A 2VPYA 3BK7A 3L7DA 4KBFA 3ABRB 2Q46A 3DR5A 1A82A 3FGZA 3ZJ5A 1B6TA 1PFWA 4Q4JB 5C8YF 3L4BA 4MJXA 4GLBA 1GSHA 3OQIB 2PLWA 3LPLA 5CA0A 4CEIA 1FFCA 3UZUA 1QAQA 5FLXA 3B36A 3K6RA 2JJ1A 3BMCA 2JLVA 4IDDA 3K05A 4FYKA 1PK7A 4JT2A 4WFJA 4R8RA 5M5BA 3CE6A 1M6VB 4MQBA 2M6LA 2Y27A 4RY9A 1CX9B 3MQFA 3W6PA 1YZ3A 3ESRA 3HYRA 2F64A 3VBEA 4OIFA 3R9KA 3HBLA 4IGKA 2HQBA 1TA0A 2QSYA 1U0BB 3IP7A 1KFJB 2DQZA 3O8LA 3UANA 3X1YA 2A6PA 4R8KA 3O2SB 1CUXA 4B3IA 2IXDA 1XCBA 3QXXA 2ZFUA 2NPOA 4MVYA 3A32A 2APJA 4G0ZA 1DQNA 4Q15A 4FFOA 4MQMA 1N2BA 4X20B 4QNRA 1E2HA 4MYRA 2BFFB 5L3SA 3WGIA 3LCMA 1JQ5A 4DRZA 2BKVA 4E5YA 4RU1A 4R8VA 3I83A 3C0KA 2AOXA 2C5GA 2RGDA 1X8KA 4JR2A 5GONB 4JYAB 6NULA 5JRZA 5A5GA 3PNPA 1EUZA 2IOFA 1WIWA 1UPAA 3CYFA 2Q0XA 3JR3A 1GM5A 4ID3A 4MV9A 4QDJA 5IJ9B 4ZGWA 1KR5A 2PH7A 1P2TA 4LKOA 2WQ6A 3L0PA 3OMXA 3ONEA 5AKLA 1INLA 1XSEA 1H2RS 1TYEB 5TQ0A 2I22A 2XB6A 3CUEF 3GNLA 4BX0A 3BMNA 2GO1A 3R5FA 5F2NA 4Y2RA 2BH2A 4D25A 2CFOA 2AFRA 1J4AA 2RK4A 4JEIA 1CP2A 2J8ZA 3RTGA 3A14A 3RF6A 3VX3A 2XVYA 5CA0B 5CH5A 2A5LA 1Z74A 1Y5LA 2G0AA 2WSIA 1BW9A 5B6PA 4IDQA 4YACA 4MV7A 3T52A 2HK9A 2G17A 1ZMOA 5HKOA 1YR8A 3K09A 7REQA 3KUKA 3AY6A 1A7KA 3ROXA 3K0AA 1FJHA 3PFKA 4TYPA 1TFUA 1W4BA 3IESA 4ZVUA 3H04A 1U2TA 1XZNA 1P4SA 4JBLA 4KACA 4U7GA 5CVVA 4CLHA 2DQ4A 1CUAA 5DCWA 1KQ3A 3P71T 1M3SA 2YZKA 3ND8A 5I4IA 5JVDA 5L3SB 5ADHA 4L8LA 4CFSA 2JGMA 4P1ZA 4IXMA 2IZOA 4LZZA 2P2SA 4KQMA 1SAYA 3DKIA 3GRYA 1QF7A 3QNWA 3TDNA 1T5BA 2AG1A 1KOGA 4QOSA 2BR5A 3BGOS 5KTSA 4CEHB 1AKQA 5AVJA 3G2PA 1A9YA 4C6SA 1WTCA 3ONNA 1EDZA 3BVPA 3GJQA 1KU0A 4M1WA 3A06A 1TPZA 1Q17A 3NTUA 4CU2A 2OAEA 5AD1A 1S7CA 5K45A 5TQ0B 1L1EA 3I61A 2EKZA 2AQIA 1NULA 5CX1A 2C95A 3G0CA 2NO5A 3BMNB 3RSLA 3PGMA 5B7NA 3SK0A 4Y9TA 4EECA 4C4YA 2V45A 3F6PA 4YUYA 1W75A 3U4CA 4ZZIA 4RKYA 1SH7A 4LDZA 4RZIA 2CL0X 3CX6A 3N70A 1PTJA 1BW9B 2AW3A 3ESYA 4QQFA 5E7IA 3RIGA 3M49A 3RROA 5JMTA 4RIEA 4QQRA 3B5JA 5DU2A 3WDKA 2P6PA 4RK5A 4NATA 4ENSA 4N0MA 3I5UA 1AMNA 3OZTA 4IXDA 5C0OE 3TQCA 1RXCA 2EJBA 3ETLA 1E69A 3K0AB 2HXYA 1CHNA 3GYBA 3FR8A 2W58A 1XQXA 4K9PA 3OCVA 4C6TB 4D9KA 4CDNA 1V35A 2EWVA 1DI0A 5THQA 4PZZA 3E05A 1TGYA 4GG1A 4E5NA 3QV1A 5J4KA 3TLKA 5ESRA 1OBOA 1J0EA 1VL6A 2C9DA 3JYPA 4WFQA 2YRXA 4G9BA 1H0HA 1QF9A 1QYCA 4IXWA 4RPHA 3V42A 3W0LB 1OA1A 1Q44A 3IUPA 4IH9A 5LMUB 5IH7A 4LZJA 1BCRA 3WIBA 3ZWPA 5BURA 3OLXA 4DJAA 4QBHA 4WLOA 4YIKA 4B33A 3BH6A 4CTMA 4PGGA 1IBKB 2X5NA 1ECPA 3FPFA 1C5KA 3ESBA 3JQPA 5CLIA 3BMOA 3UAVA 2XF8A 2C4WA 1OJ7A 2E0IA 5JDCC 1IVYA 4KWEA 3LT1A 1G3RA 4BEBA 5KU1A 4DLKA 1P0CA 3BMXA 1JHAA 3QSGA 4HDSA 2IXTA 4WZZA 5CX1B 2UZAA 3V4FA 3UOWA 1XR3A 4L02A 4WK2B 1NNI1 1W1WA 4MWOA 2ORVA 4WY2A 4ZYLA 5KQPA 1Z56C 2QM8A 2C7BA 5CRIA 3LPMA 4K9MA 3VZRA 4D5GA 1GQOA 4BRZA 4Z4QA 1YDFA 4KH0A 4EQ6A 4AJHA 4A8PA 1KEPA 1USKA 2ZYRA 3N1UA 4RKRA 4FQ5A 3PNYA 1SIWA 2AV6A 3MEQA 4Z3DA 3SXUB 2NP7A 5FUXA 1VG9B 1QRDA 1C8LA 2K2WA 1A8SA 1YB6A 1DRVA 3AH8A 1EGMB 2BI8A 2CVOA 5FPTA 5B3KA 2JL1A 3DVAB 3MGCA 3U40A 2JHAA 1GTVA 4JSYA 1JB9A 4GOOD 4YB8A 1EESA 4LSMA 3VAAA 3MPUA 3NJ8A 2BKXA 4I9HA 2QROA 3GBPA 3QXJA 4OP3A 1GXSA 4IW3B 2DQKA 2O59A 3UV7A 1CC1S 4FDAA 4MQEA 4OQXA 1CNFA 3VI3B 2PZFA 3VKVA 2D0DA 2ZBRA 3NYWA 5EJMA 5DSXA 1BCRB 3AKCA 2A14A 2WW8A 4JELA 4PAMA 1R66A 4DMCA 1RKBA 2WBLC 4NHOA 3GUZA 5H83A 2EX4A 3PXGA 3NASA 1XZKA 2CD7A 3BTSA 1VJDA 1NZJA 4AAYA 4KMOA 3BXEA 3TBFA 1R6UA 4PONA 2HHAA 1XPOA 3NUZA 2OQIA 1GTRA 1RCUA 2HC9A 3IA7A 4CDRA 4OYYA 1FMCA 1PJRA 1T2FA 1V9SA 3C6YA 3TR5A 1RM0A 4DANA 2G83A 3KQLA 4RKEA 3VAYA 2ZXUA 4GZ6A 3LPCA 2ADFA 4HWSA 4J1SA 1AGNA 1KVUA 4MI6A 2Y0BA 3ZZTA 2GYWA 1Z6AA 2JI4A 3MELA 4HLUA 5C5CA 1RHJA 4Y1GA 4M8SA 4EARA 3UMYA 3HYLA 1ISGA 1IZ9A 1A27A 4AN1A 2XYPA 2O57A 4EQ6B 1P1KA 1E2JA 1KJQA 2JFVA 1VL8A 1GUYA 2B1GA 1E2GA 3PFHA 4G25A 3ORFA 4G81A 4OGKA 4P33A 2P6MA 4PLYA 1T5HX 5DSZA 4H3KB 3NAGA 3PUZA 1OE0A 2QRVB 1CYDA 2IH5A 4MKRA 2GRUA 2Z04A 3LPDA 4XRGA 3FY4A 3RIMA 2XEXA 1UZLA 1ZGJA 4INZA 4MIYA 4BEJA 1JB1A 4B8WA 3D5QA 3DEZA 2MINA 5C8YB 4JT4A 2F4NA 3TW6A 1JHUA 1WULS 4IQFA 1H66A 1WE2A 3P4UA 3M9WA 1M33A 4C3OB 3O7WA 4MQEB 3OF2A 4N6NA 4QUDA 4CM4A 5HS4A 4YHBA 4WL0A 4GPD1 4BKPA 4ONEA 4KQCA 1QVAA 1E79D 1PZHA 3QLTA 5IW8A 3UM9A 4B71A 2VDVE 2IYEA 3IPXA 2JKZA 1F12A 4TMFA 1YTUA 5ICCA 4F3RA 4D98A 2VTBA 1LRKA 4DWOA 1PGJA 4E3WA 2V58A 3NETA 1IHPA 3CEPB 4EDHA 4EEXA 3ANNA 1FZQA 4XB6B 1Z12A 4NEQA 1OFTA 3UG7A 1C4XA 3G8DA 4HMQA 3CCFA 3L0OA 1H23A 3NT5A 4R2LA 2WAYA 3GLGE 2WJPA 5GZ3A 3VZQA 4ND4A 4RTKA 3EPRA 2PT9A 4YAUA 4BS9A 1AHNA 1SUCA 2NADA 3OEYA 4Q6WA 5J5CA 5K51A 2PZGA 2A1UA 5AI4A 3TSZA 3KSDO 1X8XA 1OHHA 2E49A 1TYDE 1ABFA 3DLHA 4YCAA 1E7SA 2FVXA 3RLIA 1NF2A 1ZK0A 4PFQA 5B58C 4HMPA 3N9IA 3FI9A 4FNMA 3WLNA 4QUIA 1ULHA 1LEHA 3G7UA 2IIPA 1E2BA 1QFYA 5FBVB 3WVNA 3D4LA 1UH5A 5G40A 2JFWA 3CONA 4ACBA 4IHKA 2QXTA 1NOIA 4RTPA 3B82A 5B3LA 1D0SA 3F1KA 1OX4A 4BFUA 3IE2A 1ZGAA 4DR6B 1M10A 4XJTA 5CLQA 4DNFA 1LNZA 3HXKA 4TZKA 4K9OA 4J9UE 4C06A 1P7ZA 2Z9CA 3VZDA 4ZOEA 4MUIA 3OE4A 5HS6A 4LDNA 3EXIA 1KBQA 3OZBA 4YP9A 2DJ5A 4FMCF 5I8ZA 2X3UA 4INOA 1PJBA 4FHEA 3CT4A 4HFNA 2HSZA 3BJEA 2VQ6A 5B1DA 5DWQA 1ZMRA 3V7WA 1ENYA 1QIIA 4WEOA 1DB3A 1XRQA 1YKSA 4PTYA 1BYUA 1XKXA 3P9RA 3GH3A 3HYSA 3LLVA 1E2NA 1ORTA 5TMDA 5JECA 4J7CA 3MWYW 1A5ZA 3K5HA 1L4BA 1GPH1 1HV8A 3D9QX 1Y8RA 3JZDA 2VTBB 2NYAA 1DTEA 4YDRA 2XSZD 3T3PB 5GWXA 2TSYB 1A9SA 4BP3A 2DPHA 1NLFA 2RHDA 1L5MA 3H8SA 4R9UC 4EHIA 1DEXA 5DZSA 2O8CA 4IIGA 4JBWA 4DV3B 2X22A 4URVR 4FGSA 3WB0A 4AMBA 2AJLI 3WNVA 5HKKD 2HZ7A 2A1UB 1O5TA 1D6NA 2F43B 2ISCA 3S44A 4D1YA 1SUAA 4DLRA 3GFOA 3W2GA 1BHO1 1P4HA 4Y1RB 2I66A 1U7TA 1SK8A 3G0BA 4WKBA 3V6LA 3J7AC 1P9WA 1P7VA 3H9CA 4KMMA 2XXAA 1E3JA 1YMUA 3DV0B 3IT1A 3N74A 4HFMA 4KHPB 4HQLA 3JATA 5DWVA 3P9PA 4CM8A 4J0EA 4X94A 3LDFA 2A9QA 4BMNA 4G5YA 1IWOA 4M9CA 5DGTA 2DLCX 4X1OA 1EFPB 1H9AA 1COWA 1ZCAA 2J5RA 4ESHA 3HMKA 2J4DA 1OX4B 3E6AA 3HA5A 3DG9A 4C5AA 5BSEA 1M8KA 3NHFA 1YVDA 4N0DA 5EINA 3DOJA 3UPTA 4YJ3F 2PUVA 3PDUA 1RP7A 1U2QA 2JI6A 3NHSA 1NOJA 4KQFA 4Q82A 3DE1X 3FD8A 5FBWB 1GCOA 1O6CA 5LYJA 5TB5A 4BGEA 3EAGA 4F8EA 3OKAA 4X91A 5KQGA 1X1AA 3TTVA 3Q3HA 4XUDA 2XQIA 4JJKA 2BLNA 3PEUA 3M8KA 2NTJA 2V4UA 2BVNA 3CLSC 3A1SA 3I04M 4G8JA 4D45A 2XVMA 5BN3A 5IWAB 1KTIA 1DCKA 3LLCA 2P11A 3CNNA 4GGMX 1Q7BA 1DSSG 3NLLA 4DA4A 1SY7A 4EX6A 5JYDA 5DX8A 2HA3A 3O5AA 4GL4A 2DETA 2RKOA 3H5WA 4R31A 2ONZA 1WU8A 3KSBC 3N2KA 5DYIA 4ASUD 5ADUS 2VH2A 3GDOA 3LCRA 3RHZA 1ULUA 1T34A 2O8CB 1NNUA 4N5MA 4V0LA 1K7XB 5JS2A 3A3KA 1ZGBA 4C4SA 4EFDA 5BR1A 2NPIA 1KMQA 5BWBA 5LUAA 4HT3B 2ODWA 1XTRA 2GUGA 2O2CA 1G2OA 1ZIPA 3P5BA 5D6NA 4F11A 2B9EA 4YRDA 3NOOA 2HDOA 1W48A 1IHXA 5EZYA 3FOEC 2XXAB 3R7AA 1ESCA 3A1CA 4PM4A 2O50A 3JATB 3UXEA 1B6SA 4H4DA 3LVQE 3VR3D 4CM8B 5KQSA 1VYVA 1L9KA 1ODTC 2WYOA 4L4YA 4GMHA 4PO9A 2AX3A 1TRHA 3SDZA 3UHOA 1GO2A 1Y5RA 3O91A 1UJMA 4NU0A 2W71A 1LY1A 2IOYA 2OWEA 5HK9A 3GLTA 2BBTA 2FN8A 3G8BA 5F9FA 3PF9A 1X1CA 2EKPA 4HAWA 4YXFA 4MVJG 3KJIA 1FX1A 2HCBA 1NVUQ 1LZKA 3ILVA 2OK8A 1V7QA 4HLCA 1YWGO 3U7QA 5D85A 3HQ4O 3KQSA 4YI3A 2ONYA 1GYRA 4BZPA 5LYJB 4DVJA 1S8OA 1V8ZA 3OPMA 3PUYA 2W2XA 3N8HA 3DCYA 3NBFA 3Q5DA 7YASA 3UMMA 5LSAA 2REOA 4RTSA 4MUXA 4YJ2A 2IYNA 4WMLA 4G85A 5EWLB 1A5BB 3U4HA 5LVAA 3GAZA 1OAKA 5KKAA 2UZ4A 2CV1A 2DHRA 1J9ZA 1MABB 1ND6A 1AQIA 3A2NA 2OCAA 4EAAA 3ZD8A 4F12A 5CFZA 1YD7A 3H18A 2H1OA 1N9ZA 4BNDA 3D1JA 3ZDXB 3PGKA 3ICVA 3VDMA 5I7FA 2D2EA 4GYJA 3S7TA 1H8HD 3N2KB 1JT9A 3DZHA 1U94A 4PSUA 4CQLA 4CR7A 2PZJA 1N5LA 4Z3KA 2BTEA 5LPNA 3HL0A 3EXEB 3CIFA 1TADA 4X92A 1RWNA 4JC0A 5CVDA 3W05A 4KR6A 2FN3A 1MNQA 2ZREA 1MVOA 2VNIA 1O7JA 4PLVA 2PZAA 2XMCA 4WHMA 3RLFA 4ZYZA 5AW0A 1K6EA 2XY4A 4ND5A 4ZDIA 3JQ7A 3IURA 4ZRDA 1LZLA 1OI2A 3N0WA 4KQ9A 3QVKA 4LG1A 2V9CA 3AI1A 4QFDA 3TAXA 5EZYB 4EHFA 5DNAA 2CUNA 3HE3A 1RZUA 2Q5CA 3ZI7A 4IJWA 1ZUNB 3HN2A 2C88A 2ZUTA 2NXWA 1OGJA 5KZMB 3U3JA 4A0QA 2HDNB 4G5GA 1CDDA 2WSMA 4G8DA 5ESXA 5T8KA 4B7XA 2X19A 2HMVA 1ZW1A 3CBGA 1JW9B 1QIEA 1NPTO 5LMNB 2VRWA 1ZIXA 5LQSA 1NNLA 3WLKX 4C2UA 5EHIA 2H2HA 3WYAA 5CIYA 4KJZA 4WZAA 5HM8A 2I4RA 4HZUA 3U7QB 3CRMA 5LA6F 3TUJC 4RY0A 4DA7A 1C29B 4MVJE 4YYEA 5JXWA 5IT9A 2O7NA 1I3CA 5K3DA 1QYVA 3VV2A 4ZIRB 1RIFA 3DDHA 3OT4A 2C54A 1AA9A 2WWFA 3FWKA 4QTUB 3PPVA 1JXAA 2IYRA 3E0QA 5K3FA 4FMDF 1Z3IX 3U4AA 5LD2C 1QQ6A 3R44A 4RKQA 2YVUA 5A4DA 3H65A 2Z83A