1JG4A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosylmethionine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords protein-L-isoaspartate O-methyltransferase
total genus 71
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg4A00
3HCEA 1SQGA 1NW7A 2EJTA 2ZTHA 3F4KA 4PGGA 3EMDA 2H11A 3OU6A 2QY6A 2PXCA 4PGHA 3H2BA 3NTVA 5E1MA 5GM1A 4CKEA 1BOOA 5CVEA 5EHIA 2YX1A 4C03A 2ZWAA 2FCAA 4GOOD 4M7RA 4AZWA 2ZIGA 1R8YA 4PINA 5GOZA 1YB2A 2PX4A 5HIIA 2BM9A 5DTQA 2AOTA 3GU3A 3FUVA 4EVIA 2OY0A 4OA5A 3DXYA 2AOVA 4CTJA 1SKMA 2NP7A 5DM0A 3GJYA 5EGSA 4X41A 1BC5A 3FUWA 5CIYA 1Q0TA 3REOA 2IFTA 3MTEA 1G8SA 2G71A 1VE3A 4QPPA 4U7PB 1KHHA 3SX0A 4E32A 3C6MA 5DX1A 2YXDA 2K4MA 2GAFA 4DCMA 2DPMA 3IHTA 4GC9A 3T7TA 3FPFA 3P97A 1KP9A 3GRZA 1EQAA 3KQQA 3R0QA 2IPXA 1P1BA 1KR5A 5KS2A 3UBTA 3BWBA 2OPBA 1KPGA 3KPWA 3HCAA 3ID6C 3LHDA 3LSTA 4RVDA 5E9WA 1WXWA 2ZSUA 4F86A 1L1EA 1JG1A 2FRXA 4X60A 2CWWA 3GNLA 2IH2A 5EPEA 4PNEA 2IH5A 3SSNA 3TKAA 3ER8A 5FQNA 3EVAA 1DUSA 4A6DA 3M6XA 3MB5A 1B42A 3AJDA 4AZTA 3M6UA 3TRKA 1RI5A 5E8RA 2IDKA 1QANA 2YTZA 2ZBRA 1VPTA 5EMJA 3BXOA 3KPJA 3A7DA 3RW9A 3UJ8A 5DX8A 4EQZA 3EVDA 1FJXA 1WS6A 2JHPA 5K0BA 2PBFA 4YUZA 3FPHA 3LCUA 3MAGA 2C7QA 4BLUA 2UYOA 1UFKA 3A7EA 2ORED 1WZNA 3G5TA 1NW5A 3SM3A 3SSOA 2YXEA 3HTXA 3KQSA 4RX1A 5CUQA 5E1DA 4BP3A 1AQIA 1NW6A 2BM8A 5T67A 3O7WA 5BW4A 4WXHA 3BWMA 4QPNA 3WSTA 4DCGA 2XVMA 5K0FA 2NP6A 5MHTA 3P9KA 1NBHA 3DR5A 3BT7A 1L3CA 3HNRA 1NKVA 1YF3A 3MCZA 5BP7A 1JSXA 2NNWB 3TLJA 3KHKA 3FTEA 4ATNA 2E5WA 1MJFA 4OBXA 3TKYA 5F2NA 2EG5A 2GPYA 1HMYA 1XDZA 3M4XA 4ISCA 4LECA 3IYLW 3FPGA 3THSA 4C05A 3GRYA 1H1DA 1WY7A 2P7IA 3EPPA 3G2PA 5LR6A 4QQNA 5GIPE 2IBSA 3PFGA 3ANXA 5HFJA 3B3GA 3KR0A 1JG2A 4WVLA 5HIKA 3PS9A 2WK1A 3BGIA 4HGYA 5E9JA 3UZUA 5LQJA 3NJRA 2B3TA 3RIEA 3UJAA 3FTDA 3ORHA 5LQRA 2PV0A 3TPZA 2P1DA 1M6EX 3CKKA 4FSDA 3GIWA 3DUWA 5CVDA 4E31A 5CCXA 4DF3A 3KKZA 2QRVA 3ELWA 3S68A 3JWJA 1BKYA 3ME5A 3THRA 5GINE 5DWQA 5DXJA 1T43A 1JG4A 4KRGA 5CVUA 3EEOA 1KPHA 3HCFA 1N7JA 4MHTA 3A27A 2P7HA 3G8AA 2WA1A 3DH0A 3TMAA 5FUBA 3G5LA 2C7PA 3G88A 1O54A 1RJGA 2ZW9A 4Y30A 3PT9A 2ZZNA 4C4AA 5D1HA 2AOWA 1F3LA 2B2CA 1U2ZA 2DULA 3AXTA 3KPYA 4PYOA 4AZSA 3HA3A 5BXYA 2BR3A 2ZWVA 3KR1A 2P3OA 4JXJA 3OFJA 4PIPA 1KPIA 3FTFA 4PWYA 1L9KA 5GM2A 5EKXA 2KW5A 2CMHA 3SSMA 3IEIA 4RTQA 1DL5A 2AN3A 3TR6A 5HOQA 4XCXA 5DRYA 4IV0A 1RI3A 1RJDA 3M6VA 4ER7A 3PX2A 4HRAA 4YUWA 1D2GA 1L3IA 1TPYA 1NBIA 3B5IA 3EVCA 5E8JA 4ZTBA 5EKUA 3TOSA 5K0EA 2FK7A 3EMBA 3EVGA 4OA8A 2UYHA 1XDSA 3P9IA 2JHAA 4MIKA 4PYLA 3GWZA 2VDUE 3OFKA 3T7SA 3AXSA 2OO3A 3CJRA 3P9NA 3UJ7A 3FRHA 5LQUA 4YUVA 1X1CA 3JWHA 4PYJA 3KQYA 3KQVA 2QE6A 4YV1A 5T6BA 1ORIA 4RTMA 1EAMA 1ZKDA 4B17A 2G70A 1PRYA 3A4TA 1YUBA 5E2BA 4RTKA 2ZIFA 5EMLA 3CC8A 2GH1A 4FGZA 2N47A 3K0BA 5F2KA 2OZVA 1P39A 4DMGA 4E2WA 4HSGA 5DPMA 5HILA 2CL5A 2R6ZA 5GWXA 3NMUF 4R8RA 4E2XA 2PJDA 1ZG3A 3KPUA 3HA7A 3HVJA 4PYKA 4C08A 2A14A 3EGVA 3DLCA 1NW8A 3EVZA 4KVZA 4LG1A 2PVCA 5HEKA 5ICEA 5DM4A 3DP7A 4CXMA 5P8WA 10MHA 1XVAA 4CWAA 1I4WA 3SGLA 2GLUA 1AV6A 1XXLA 2VP3A 3LBFA 2PX8A 1R00A 4EKGA 3O4FA 2I62A 3OE5A 3VYWA 4RTLA 4P58A 1O9GA 4KIGA 2PXAA 4E70A 3ER9A 1PJZA 3R24A 1SQFA 2JHCA 3KPVA 1Z3CA 5EZQA 3CJQA 3PFHA 5EMKA 1KYWA 4ER0A 3R3HA 3PTAA 1XCLA 3OZTA 5FADA 4RTRA 3L8DA 4OQEA 5G02A 3EVBA 5DSTA 2C7OA 3P2EA 2H00A 1EIZA 3LPMA 5JR3A 4M37A 3OU2A 1JQDA 3HVKA 4C06A 2NXEA 3E23A 4PYMA 5EIWA 3PLAE 2ZZKA 4PCAA 2EX4A 3EEYA 3PB3A 3I58A 3GGDA 3G8BA 5EC8A 5IKMA 4AX8A 1SUSA 4FZVA 3OZSA 1G38A 1KYZA 4BLVA 1YZ3A 4GUAA 1P91A 4Z2YA 4XUCA 1ZGAA 3G2MA 3SR4A 4CTKA 1VL5A 1SUIA 5EEGA 4QVGA 3M70A 2OB2A 4O29A 3EGEA 5EIFA 4K6MA 5LQAA 2AOUA 1VBFA 4GEKA 3P9CA 4DA4A 1G60A 2ZCJA 3DLIA 3UA4A 2HTEA 3DOUA 3EVFA 3GXOA 3LL7A 4UOEA 4DM3A 5EOVA 1JSZA 3CVOA 3CBGA 5FA8A 3ELDA 3U81A 3X0DA 3LX6A 1YZHA 2PKWA 5BW5A 1NV8A 5EHGA 3LECA 5FWDA 4ER3A 2ZLBA 3FYDA 4PCLA 4QDKA 3UJBA 4E30A 4FR0A 3HP7A 2AVDA 3IV6A 4KW7A 3CCFA 3NW9A 2GA9A 1X19A 3GRVA 2I6GA 7MHTA 1KIAA 2PSSA 4R6XA 1BHJA 3UA3A 4DQ0A 4MWZA 8MHTA 4GOND 3MERA 5DXAA 4V0QA 2IP2A 5IH3A 5CCBA 4IKPA 5LQKA 2AN4A 1M6YA 1TW2A 1VP3A 2AR0A 1QZZA 1X1DA 2YVLA 3G89A 4M36A 2PY6A 5KYGA 5LSAA 2BZGA 3MHTA 2LD4A 3FRIA 2ZULA 5EQJB 4OX9Y 3OZRA 2GB4A 3A25A 3DXXA 3HCBA 4YUXA 4KDCA 1MHTA 3KR9A 2GS9A 4X1OA 4A6EA 2OB1A 1YFLA 4RTJA 4BY9E 4X63A 1XTPA 4QTUB 5K0LA 2B25A 4RTOA 3ELUA 3JWIA 3OU7A 3GCZA 2IGTA 3C3PA 1Y8CA 2QYOA 3HEMA 3KQTA 5C0OE 5K05A 2HR1A 3TM5A 3BWCA 5T64A 3QOXA 3TQSA 2ERCA 1X1BA 2PGXA 4PYQA 5KQRA 2XBMA 2V74B 3MQ2A 3OPNA 3R6TA 4M38A 5DSXA 5EZSA 3V97A 1AF7A 2AVNA 3KQMA 4ER6A 1JG3A 2R3SA 1XDUA 2VDWA 3B7PA 3CGGA 3HA5A 2ESRA 2XYRA 3M33A 3NDJA 4PYIA 5B1SA 1D2CA 3R9XB 2P3QA 4GC5A 1RJEA 5DTRA 3HM2A 1JTFA 4QDJA 5ICCA 4C07A 2O0LA 2PWYA 2BR4A 2QRVB 3BKWA 2ZBPA 3OCJA 4GQBA 4AUKA 4E2YA 2EFJA 3E8SA 1FBNA 5DM2A 5U4XA 1R74A 2YR0A 1QAOA 2NXNA 2PT6A 4MTLA 2XVAA 2PXXA 2QM3A 3I53A 1FPQA 2AN5A 2NXCA 3G7UA 4FT2A 4V0RA 5FULA 1FP2A 5E1BA 2ZVJA 3UJ9A 2IDJA 3V8VA 2P3LA 2H1RA 5DX0A 2EJUA 2ONYA 1G6Q1 3MTIA 4GF5A 2OXTA 3GRUA 1EJ0A 5CVVA 4HC4A 4PYNA 5E1OA 2AZTA 5FHQA 5C1IA 3UJ6A 3VSEA 4HH4A 5C9ZA 1UIRA 2HNKA 1VP9A 4RV9A 5K0CA 3NVMB 4P7FA 2Y1XA 2FPOA 4XUDA 4EMSA 3DXZA 4QVKA 1I1NA 1NE2A 2OKCA 5CM2Z 1VLMA 4RTSA 3QOWA 3NVKI 2HV9A 2O07A 1F38A 4L7VA 1IY9A 1ZQ9A 4EKIA 4RTNA 3BGDA 5FCDA 1VIDA 2OYRA 3UJDA 2P35A 1N2XA 3TFWA 2FYTA 3LGAA 4OQDA 3BGVA 4FP9A 4CKCA 3EVEA 5FWAA 2UZ4A 2Z6UA 1R8XA 4CKBA 4BLWA 4IWNA 3KQWA 3VC1A 1JR4A 3BUSA 5EEHA 2JH9A 3C0KA 1UWVA 5K09A 3T0IA 1X1AA 4FT4A 3P8ZA 4AZVA 3LDGA 5LQCA 3ERCA 3MGGA 1L3BA 2B78A 2YUIA 1R18A 2JG3A 1XJ5A 2FK8A 1RI4A 1SVUA 2V7EA 4RYLA 4Y2HA 5F2OA 3UFBA 4YV0A 5ICGA 2XYQA 4R05A 3DMHA 2ONZA 5FHRA 1WG8A 4H0NA 1FP1D 5E2AA 1EJ6A 5LQNA 1G8AA 2UYCA 5DM1A 5FA5A 3FUXA 3E05A 5ICFA 2FHPA 4HG2A 4C04A 3Q87B 3E7PA 3KQOA 3PX3A 4E33A 2JH8A 3GRRA 1IM8A 4FS8A 4MQ4A 2PX5A 5ERGB 4P7KA 1G55A 3KR2A 2ZIEA 3NWEA 2ADMA 4HGZA 1HNNA 5HIJA 3DMFA 3LKZA 1OR8A 3P2KA 4GOMD 4KIFA 2IH4A 1NV9A 3AWIA 3HVIA 2O57A 2ZFUA 2P8JA 2VS1A 2AOTB 4PIMA 5FQOA 2I7CA 4YMHA 5H02A 2ZZMA 3QV2A 3SXJA 1V39A 3BKXA 3A26A 2Y1WA 5K0GA 3PVCA 3I9FA 4X61A 1D2HA 3MCTA 1WXXA 3SVZA 2O06A 2OBFA 3M6WA 2PLWA 4LWOA 3BWYA 4HTFA 5K8VA 4RVGA 2CMGA 3FPEA 3HCCA 3HVHA 2XYVA 3FZGA 4R6WA 4ER5A 3DMGA 1QAMA 3LBYA 5DT2A 3P71T 2AOUB 4QTTB 4YV2A 5K0JA 3D2LA 4RSRA 3LDFA 1ZGJA 5CD1A 9MHTA 3GO4A 5KQSA 3B3FA 1I9GA 2G1PA 3BZBA 2VZ9A 1TW3A 3NDIA 1M0EA 2AS0A 3T7RA 3GDHA 2ZBQA 3FUTA 5GP1A 2PT9A 1NT2A 2IIPA 2P41A 4GBED 4DKJA 4F84A 5M5BA 3FTCA 1QAQA 3LKDA 5DTMA 4YMGA 2HMYB 1DCTA 1KXZA 3G2QA 1NW3A 2G72A 2C7RA 5HZMA 4OBWA 4RWZA 5E9QA 5JUWA 3CJTA 1N7IA 1INLA 2HWKA 1SG9A 2Q41A 3C6KA 3DULA 5DRTA 3SMQA 4RVHA 1O9HA 3LCVB 3ELYA 3B3JA 4R8SA 2I9KA 3G2OA 4QQKA 4HTFB 2BH2A 2F8LA 3FYCA 2PWPA 3UWPA 3Q7EA 3C3YA 1ORHA 4XUEA 5EG5A 4F85A 1JQEA 4IV8A 4YUYA 4P7GA 4KDRA 2PX2A 1VQ1A 3B89A 4U7TB 5CVJA 3AY0A 4RTPA 3FPJA 3VC2A 2CKDA 2YXLA 2Z6AA 3DTNA 5EMMA 4KWCA 3LCCA 3EGIA 5D1NA 2JJQA 3FUUA 1AQJA 3TM4A 5EVJA 4POOA 1QYRA 5K03A 1YFJA 2IBTA 4G56A 2O05A 1JQ3A 3O31A 4EK9A 2NYUA 5FTWA 3K6RA 1Q0SA 3HCDA 2WA2A 1ZHFA 2NXJA 3I5UA 3KU1A 1XCJA 3LDUA 4DZRA 3NWBA 1RI2A 1RJFA 4BP1A 1RI1A 1P1CA 1IXKA 3RODA 2B9EA 5K0NA 4PONA 5HIMA 5DLYA 2Z6QA 4P7JA 4LWPA 1EG2A 4GOLD 4E2ZA 1JTEA 2AOXA 3JWGA 2P40A 3P2IA 1R6AA 3I64A 5K01A 3UJCA 4FSXA 2YQZA 4RVFA 5GIOE 2G8NA 2UYQA 2VDVE 3KQPA 3OE4A 5KVAA 4NECA 2BR5A
chains in the Genus database with same CATH superfamily
1MIOA 1E64A 1QG6A 1XJQA 4FCWA 4OM8A 1IZ8A 4MVJM 121PA 1I14A 1T6NA 5MFPA 4BIMA 3K35A 3N8IA 4Q1AA 3O2JA 3U4IA 3HRHA 3HWSA 2W2TA 2OV2A 3BH6A 5B5SA 2PSJA 2Z9DA 2QXYA 3JQRA 5EHIA 2CF5A 1RRKA 2XIQA 3P4YA 2E4VA 1IVSA 3KL4A 3EMKA 1ZJJA 3OIFA 2VFAA 2UZ1B 4AUEA 4DBLC 4EUFA 3CUYA 3MJCA 2YIDA 4J0JA 4JLBA 1MG5A 3M6MD 3PL5A 3V1TC 2Z58A 3IP6A 4JQYA 5IMSA 5EGSA 2P11A 1B41A 2V9CA 4I50A 2X6TA 5TLSA 4UBIA 1X7DA 4WERA 2V45A 4OMCA 1GUDA 1VE3A 1XVIA 4MRVA 5HE9A 3TIGA 1ELOA 2C5GA 1OGYA 1YDMA 1Z4OA 2FZCA 1JYFA 3C6MA 3NJ8A 1J2JA 3GI1A 3HDQA 3QXCA 2VP6A 3K2BA 2GAFA 5LPNA 1PL8A 1FBTA 2PDAA 3INTA 2BFDA 1YOVB 4PBTA 3DZHA 4HWSA 5GY7A 4EFNA 1AJEA 2WKPA 1OBHA 2A0WA 1QF7A 2JIPA 4YB8A 5JXGA 3RUIA 1G59A 1BEUB 1HG1A 2E9SA 1XPRA 3FAKA 3MD9A 3NX4A 3LSTA 2II6A 3E3NA 1ODSA 3FNGA 2XJ9A 3NZEA 4JVMA 1R6VA 2HFJA 2QW1A 5EE9A 3WL7A 1H5UA 1TGYA 1HDGO 1U4NA 2OCDA 4B4DA 1PSDA 4F86A 3GEGA 3PQEA 2C78A 1GGVA 2VSNA 5EPEA 5LP6C 5TVGA 2OQVA 5B64A 4PHTA 1JU9A 3LOUA 3DV9A 5EXXA 4CG1A 5BT9A 3PICA 1KK2A 3AJDA 3DBVO 3QLUC 2O7NA 1QK4A 1T2UA 3QEAZ 4C9BA 4LDNA 5KOJB 4EB6B 2XTJA 5KX5A 2NSYA 3W5AA 4BO7A 3WO1A 3PFKA 3UHPA 3ZDBA 1OE0A 1XROA 4C1NA 4ZEMA 4R4JA 5EGNA 3ZBPA 1T3SA 3PUVA 2NYRA 3WMFA 5CLGA 1LB1B 3IE2A 5JJKA 2BEKA 3IE1A 1PJCA 4C3ZA 5AVUA 4C89A 1GGEA 4BBZA 3H2GA 3RJTA 3VHQA 4X1IB 4IIVA 1KR2A 1VIMA 4WLNA 3M6FA 4HXYA 3LP5A 4D3ZA 3AHGA 2V03A 3GLKA 3ZTTA 2FEXA 3IKJA 2PL1A 2ISSD 3ZKWB 4DFDA 1IBMB 4DCGA 4RCZA 3D1VA 4JT8A 4M6WB 4BU0A 5HSGA 2P68A 4CGZA 1CJTC 2RBGA 1YQQA 5AOAA 4C20A 2CLHB 5CP8A 2FWBA 3UUWA 4DEYA 3PNBA 4QQFA 1VBKA 3TPFA 4GWLA 3BBLA 3TLGB 1IHPA 4Q4DA 3NV7A 1SUWA 4WXYB 3NJ4A 1H8HA 3SPXA 2FW8A 1DRVA 5C1OA 2HSGA 1FUUA 4RHFA 1R12A 1T2AA 3THSA 4L5IA 2PZGA 3G5AA 3H75A 1RJ9A 4FLFA 4ARZB 2IYQA 4RULA 2M2IA 3PQFA 1J0EA 4OJKA 4O4IB 2PBZA 1HO3A 3DAGA 2Y1KA 4BNUA 1YI8A 1G17A 1JLLA 1A5ZA 2X58A 3KUXA 4R54A 3WISA 1OBVA 1H0RA 2AMLA 1DKOA 2Q4OA 2FPSA 3QIAA 5G4KA 2D00A 1IQPA 3P4XA 3D59A 2DSNA 2HLHA 3EYAA 4DHWA 1GRCA 2C3OA 2ZI3A 1KPHA 3MWDB 4JIMA 1NJFA 3B12A 3RSGA 3QPAA 4RPKA 2QRQA 2WMNB 5AVXA 5H9WA 3QITA 4PX5A 4EPXA 2ALJA 3V7NA 1UEIA 1RJGA 4KGXA 3PU6A 4X00A 2YZKA 5H5JA 1FIUA 3TTVA 4YAEA 3PD0A 5T3YA 2PZKA 2GSWA 2K2WA 1TFUA 3DXFA 1TKBA 3AIOA 1J5PA 2NZXA 3HUFA 2H9AA 2RGUA 4I14A 2J6HA 3AETB 4L4ZA 1QGOA 4HX5A 2FUG6 1QV7A 4KP7A 5AHWA 3O8CA 3DFUA 3LT0A 1L9KA 1O4WA 4HADA 4RF3A 3TDMA 4U2EA 2IX3A 4ZVVA 3DEJA 1G18A 2CXOA 3P9XA 1C3JA 2WIFA 1LDEA 3B6IA 1LDMA 1CUAA 1RCUA 2D7CA 2X3YA 3VYTB 1DLIA 3HRKA 2NXWA 4KL8S 3QU9A 3KYDA 1SD1A 5GGYA 4OXRA 2NU6B 3GUZA 4D3SA 2Y4OA 4ZVSA 4RTNA 1OXMA 4F11A 2D0IA 3MQ4A 3UOWA 5DVZA 1YZVA 4PSUA 5CA1B 1PZHA 1A98A 4XEUA 3WGVA 2FW7A 3R8FA 1OA1A 1IN7A 4OQ4A 4NENA 1YO6A 1VHTA 3QVJA 3P7MA 4JJ4A 2YOHA 1X7ZA 1MEOA 1EP3B 4RLSA 4FX2A 4X7BA 4ABTA 5MN5A 4ZCTA 1ABFA 1N0WA 1LF5A 2DCMA 1XMJA 1S9HA 3I8SA 3K0BA 3TRHA 1R0CA 3KLPX 3W5SA 3ZTWA 4ZDJA 4HSGA 2ZB8A 3QXXA 1NA5A 4MTCA 3UH1A 3OA0A 4PM4A 1AGRA 5K3OA 4ITUA 4R3UC 4YAWA 3VGPA 1UMDB 4XD2A 3ZY4A 4MZDA 2WHRA 1NKSA 3O2QB 3CY6A 2A14A 1ULAA 2DFKB 5AO9A 2YYZA 1ZUD1 4FXOA 5BQXA 1MXHA 2WILA 3SS8A 3DTTA 2XV1A 3A6ZA 1GRQA 4CM5A 4U2BA 3F3KA 2G6TA 4CV2A 4RD4A 4ZEVA 5JZSA 4CKEB 4E5MA 2D3WA 3H5AA 2I62A 2KS6A 2OGUA 2ZRJA 4EHDA 2ZJBA 1SNYA 2PXAA 4IDGA 5JWHA 1C30B 4AS3A 2JKVA 1KVSA 4BLSA 4HQ6A 4MHSA 1G5QA 4Q4HA 2Q3FA 2ZAIA 5AW3A 4QJBA 3E27A 1C3OB 1VMIA 4X6LA 4O33A 1WPRA 3HYRA 4FI3C 3FYUC 3QLVA 2BGRA 1QFSA 2Q4BA 2HKIA 2HLPA 1JG7A 3MG9A 4GLBA 4TM7A 4ACBA 1U7WA 3SG0A 1AKTA 4PYMA 2DWPA 2RCNA 2YOFA 4HNVA 2ZT5A 3KYCA 5AOBA 1EXNA 1ZBDA 2O2IA 4AKSA 4AQDA 4GH5A 3OBBA 1G38A 1I7PA 1AE1A 1YZ3A 4LXTA 3SNHA 3FM9A 1W73A 4XUCA 3MOSA 3WWPA 1SUIA 1WIWA 3AEYA 4Q24A 5KO2A 1NJ1A 1U31A 1KQOA 1XEXB 3A04A 5FNVB 3TPCA 4CKCB 2I87A 3DV0B 2PKQP 4FZRA 1GNVA 3AI1A 2DCUA 3BRWA 3KDPA 4U7HA 4FB4A 4IFBA 1NMXA 2B20A 5HCIA 1KOLA 5JSZB 3GLGB 4KQJA 3AEKA 3DF9A 4J0DA 1P9RA 4TLBA 2ADOA 2XI4A 4H3KB 1YU6A 3X0DA 4C0BA 4Z1OA 2VJKA 4YJFB 1QIFA 3D3EA 3WX0A 4ZXFA 1UMBB 4KH0A 1ZW1A 4F3RA 5BW5A 1B0AA 4FMDF 1I3CA 4JA2A 2JVJA 2GK6A 2ZREA 1FDOA 4M0PA 4P1ZA 3NBKA 4GE3A 3QYAA 3FYDA 4G36A 5AM4A 1KO7A 1SA0A 4OGKA 1P2SA 4YRBA 1U9ZA 4HQ0A 4YI3A 3V1KA 1JT9A 1QLWA 3QMPA 2JIQA 1L1QA 4XR9A 4AMVA 1YJXA 3BSFA 2FX5A 1KYVA 3QPBA 1Y6QA 1ABEA 4DMKA 4DQVA 4BFZA 4TOIA 3L7OA 4RPJA 1XI2A 2BM1A 5FEUA 3DCNA 2QM0A 2Q0XA 2BBOA 4JK3A 3TKLA 4IRXA 2O2YA 1SIUA 1SU7A 3U7QA 5KYGA 5ALSA 3QEMA 2QNIA 1VSUA 2XT6A 1PSWA 3IAUA 5DI3B 2ZBDA 4NCJA 5BO5A 1EUCA 4EHLA 4M1KA 1GLVA 4OF4A 4X1OA 1X8JA 1JAXA 4FCTA 1DQPA 5JYBA 1ZK2A 2OGTA 4NU0A 3NORA 2M32A 4L9RA 2G40A 3WLPA 4MQFB 5BUQA 3I2HA 2AYZA 3U1BA 5C0OE 5MN6A 3K09A 2DC1A 1HT3A 3HO8A 5ALUA 1VXRA 4UNQA 3L6OO 3ZGNA 3OPNA 2Z56A 1VPVA 1YJQA 1Y7PA 2A9PA 2RONA 1P61B 2VRCA 2WZDA 3G79A 3IV7A 1ZOSA 3NNDA 1KZHA 1H3NA 2XA1A 3VDNB 2UZ1A 4FR5A 4E5SA 5B1SA 6PFKA 2BEUA 2PXHA 1ECJA 4TT3A 5CH3A 1BROA 3AHCA 1U9IA 1GL6A 4GC5A 1NPDA 4MROA 3JQAD 3O03A 4ZU3A 4MEBA 3R74A 5KZMB 4UHHA 2EFJA 1D4AA 5DM2A 4LE1A 1SC9A 2BHNA 1LD3A 2NLOA 2YR0A 1LPNA 4FHGA 4HJRA 2WR8A 4EJSB 2AXEA 2NXCA 5JROA 3EXEA 2O1SA 1FP2A 3EGXB 5E6UA 2C03A 2Y92A 1OFTA 3LOQA 4K7JA 2ONYA 5BWOA 2CFIA 1A8QA 3E9MA 4XQ9A 3GJRA 1UXKA 3HDTA 2HWYA 2NZYA 3R5JA 4CUKA 1E6LA 1VP9A 5IEBA 1ZNZA 1DWOA 4LOAA 2GTIA 4KYVA 1B8VA 4E21A 1WUJS 4JJZA 2PUHA 4MB0A 4DA6A 2EZUA 4JUDX 4BNVA 4EP1A 2EFDB 4UEWA 4XTCS 4B8YA 1GFWA 4N18A 4C7MA 3RU2A 1XPOA 2AJBA 1J5XA 1VIDA 3B3QA 1Z0KA 4MCIA 5DBOA 3ZDDA 4HD8A 1KEZA 1Y1TA 2O1WA 4QRDA 5B1YA 1L5VA 2FYTA 2O5RA 4M88A 1F2TB 4RENA 4WQMA 4WY2A 3I2YX 3H5OA 3HBMA 3AC0A 4UZEA 5C81A 2WSSA 4LDRA 4QFBA 3V1LA 3RVOA 2HO4A 1TA4A 3T99A 1O5OA 2O3SA 5DEIA 3QQ5A 3GVPA 4I5EA 1OTYA 4MB2A 2GWRA 3ZD6A 2O3TA 2A86A 2H92A 1JW9B 2ZOSA 2P79A 4UREA 2XAAA 3NIGB 3T41A 3A32A 5AQEA 3Q7PA 5F2OA 2WPDA 3K9WA 3EARA 2YC2C 2ZB2A 5AJVB 1YZKA 2GQ0A 3O4HA 2B8EA 3G7SA 5TQ2B 5JO0A 1FP1D 1KZ4A 1G8AA 3BAFA 4XE5A 1FFEA 1SU6A 4FMBB 1YR9A 3R7DA 4LVOA 5CNJA 1C50A 1O97D 2VLIA 3KV3O 1JPUA 1P2FA 4P08A 5FF9A 1CY6A 2ZGVA 4YMIA 3K1AB 3AP2A 5IX8A 3KR2A 4LOHA 1WUTA 2W9XA 2AA3A 1Z5WA 4I5DA 4BNIA 1LFDB 2V7QA 4J7UA 3UQZA 2BMFA 4U0JA 5SZKB 1XGKA 5JI2E 2DKOA 5A4MS 1XDDA 1GL3A 4AU1A 2C7VA 1GSAA 4DMCA 2V4ZA 3L8FA 1X3LA 4HDAA 4JGBA 1XRNA 4MV6A 3R7SA 4DN6A 2WM9B 2IEIA 2WVHA 2VP2A 1JEYA 1EFRA 1IY2A 1ANKA 4G5OA 3PK0A 4QYWA 4D3DA 1G0NA 4GSYA 1D2HA 3NV9A 1NN3A 1L7BA 4AXXA 2VTEA 3JQ7B 1DTWA 3GWGA 4DABA 2YNMC 4EUSA 1I1QB 2YWHA 4BFTA 2GCIA 3RK4A 2JJ8A 3M5WA 4FK8A 2EDCA 2J5QA 4FGLA 5EHXA 3ZH2A 1C0EA 3RUDA 3CPJB 1Z6ZA 5A05A 3GR6A 1N0IA 2HCTA 1JJIA 3P0HA 4LJ9A 3TXAA 1UANA 5KX5F 4RGVA 3G1TA 1DADA 1X94A 1MH1A 2EWWA 4F6RB 4KRYA 4GKJB 1NRXA 2K6GA 5IKEA 5JAUA 1XWWA 3FPAA 2VPPA 2PT9A 1X77A 2QZZA 4FYWA 1NT2A 3TE6A 4EGQA 4DKJA 1LRLA 2BGGA 1QAQA 1OBOA 4LZAA 2YXNA 5LP1A 1E99A 1RWXA 2O9JA 2PBLA 4JBGA 2RGBA 3RYCB 3ZWPA 1VSVA 3IC5A 4HLUA 3RC7A 1J8QA 1N7IA 3IMKA 2J33A 1LF0A 1XR3A 4LTDA 2KB0A 4BLTA 3F74A 5A7FA 1NXSA 1NU8A 2IYXA 4MRPA 1AHPA 1Z17A 5IYZB 5D3ZA 3PCTA 2C5BA 4Y18A 1JGTA 5F98A 4TQUS 2WSMA 3AR8A 4IUBS 3CNEA 1MH9A 1WUKS 1F14A 3CLUD 2CD7A 4LPSA 4LYHA 1EM8A 5I3ZA 1XZGA 1CRZA 1ODKA 2OTCA 4EHIA 4OSPA 4TXJA 4BQSA 5CK4A 3KHSA 4YQYA 2ZUCA 4MPPA 1S3GA 1KMMA 4RY0A 3UQYS 1RWVA 3U3KA 1JAHA 4D02A 1KFJB 1M1XB 2JNWA 1JH8A 2CHGA 4G86A 3O47A 2AN9A 1P8JA 3HXKA 4M6WA 2P69A 3X2SA 1I4OA 1R2QA 4DARA 3OZAA 4D9KA 3A0RB 4D57A 1YB4A 4S1WA 1ZHFA 1QE5A 5K20A 3B85A 1W5BA 1NVWQ 1UR5A 4PBRA 3VTKA 4QKQA 3BK7A 3FW1A 1Q2XA 2VSFA 4KSYA 4MVJP 1KNXA 3ZE1B 1G16A 5AI8A 4HEHA 5T8KC 1UKBA 2AOXA 2UKDA 5EXDA 1Y7IA 2ZR0A 5IFLA 1WAMA 1SVKA 1L5RA 4E5UA 2AG0A 3U26A 4B3RB 4XDZA 4RSGA 3TZBA 4PCUA 1DZIA 3IMCA 1LA2A 4MV3A 3RKSA 4B74A 5C3MA 1FSSA 1MPXA 3HCEA 1SQGA 1L7QA 1GFIA 4QIHA 1KWGA 2QGFA 1YKFA 1FC0A 2DQZA 4BRUA 1CB7A 2BJHA 4UMVA 3M9XA 3B2EA 2YN0A 1OTXA 2QWXA 2XEDA 3PITA 2VYVD 1O0CA 2AF4C 3U40A 1JAYA 1Z6XA 1IMOA 2FCAA 3L0YA 2O8DB 4HOYA 2VK2A 1M2EA 5GOZA 3CGWA 3NHZA 1XMIA 2JFHA 2X42A 3O8DA 3GFVA 1K8YB 1T5BA 1E96A 3FUVA 5DTQA 4RMJA 4IXDA 1U7DA 5A0FA 5BN5A 3RVLA 5FTJA 2HPZA 3O1IC 1F2UA 5I4IA 1IEXA 3RYTC 4KQIA 1LZLA 3MTEA 1JT2A 2QI9F 3BA6A 3EQ6A 3HGTA 5ALPA 3ROFA 5A4KA 3I01M 2XB4A 3WSVA 2QTTA 2WNHA 4YCBA 1MW9X 3I8OA 1V8DA 1YRWA 2N9UA 3EW7A 4NH0A 4EJ2A 1X8XA 1Y34E 2HQ1A 3WB1A 4AN4A 1F9AA 2DPMA 3DEIA 1QQ6A 3BB3A 2EBUA 3GRZA 5AM2A 4JVOA 2ZDGA 2XJ4A 3L8EA 1XMVA 1P1BA 4OK3A 5FUMA 2JLRA 3CUKA 3QE0A 3QX3A 2CFOA 3R0JA 4MYRA 4PZEA 1GGFA 3ID6C 4I4CA 4NMMA 1QP7A 4QOGA 3T5CA 4QJ4A 4AKIA 3NI2A 4PZ0A 1GTVA 3PPXA 3W9UA 5FBZA 1V41E 2QX9A 2Y1LA 4UE6A 3PEWA 2WDZA 1Q74A 3SHOA 1KAGA 5C2JB 1ZXBA 3FNQA 4N3GA 1M2VB 2HK8A 4FMPA 4J4TA 4NYMR 5IH7A 5F2NA 3T35A 4Q05A 4LZOA 1XD8A 2PGIA 3NH6A 3TRKA 1IY1A 4AG5A 3GQBB 3OUZA 3TQIA 4AURA 1T9HA 3OZXA 4MPTA 2PO5A 1BZYA 2QYSA 2J3JA 3WRXC 1FJXA 1YD7A 1X39A 2VLBA 1PDOA 1K4MA 2NV6A 2B5OA 4TUYB 1I3NA 1KAQA 3EWSA 4UUBA 1UBSB 3EAQA 1H66A 3BMNB 1V1JA 2BHTA 2RHTA 3DMPA 4P38A 2OXIA 4GR5A 4LQLA 1ZRNA 1EWVA 3CEHA 5CEFA 1BX1A 1C9MA 3OTIA 5TQVA 4CZ2A 4YDQA 3WL4A 1CNMA 3GY0A 2VF8A 1L7OA 4B9AA 4ZZ3A 4ZT7A 3ILXA 1KWKA 3TOVA 3PD7A 2ZDQA 4AJLA 1IFXA 1MO4A 1UDRA 1XVLA 2R48A 3EFEA 1CF4A 1HNZB 3SJBA 2JD0A 3DR5A 3DHNA 3JQ9A 4P5DA 3UEOA 3MCZA 1JSXA 1SK8A 1XFAA 5G1OA 2E4XA 1M34E 4Z51A 4AF8A 5BT8A 4QPZA 1AN9A 1TD1A 2EQAA 4OBXA 3M6AA 4XX0A 5KIAA 2FFJA 2IODA 4ECAA 3LBIA 1GUAA 6Q21A 4GMGA 3TFOA 1HEIA 3TUZC 4PZYA 1Z0IA 1E89A 5HTOA 4TRNA 2A9QA 4EZBA 3PLNA 3KVOA 5DYGA 5IVIA 1CFZA 4Z4GA 1NQUA 2IEZA 4MV5A 3RFUA 3BF8A 4MJLA 4GMXA 2V54A 2IHVA 4QSMA 3NJRA 3KUUA 2GCNA 4WKGA 3HHEA 2WD9A 2UZ3A 1QGAA 3GFFA 2P9CA 4TLAA 3JVUA 4TV8A 5CBPA 4RZUA 5KQGA 2RGRA 1V37A 4Q4JA 1Z5GA 2ZYDA 3QG1A 1OLXB 2PT5A 2XGOA 3O26A 3ZWXA 5KSZA 3TECE 1R0LA 1OPXA 1YRHA 3HMKA 5BPHA 1DGQA 3GAAA 3IRVA 3S68A 3AVTA 1T6XA 1Q1BA 1W1IA 1VE1A 3NP7A 4JOSA 3KQKA 2FZKA 1V43A 2R1UA 2WIJA 2XRMA 4FEAA 4KRGA 1BHQ1 2WSLA 3VV2A 3EEOA 2HLDD 4HZIA 4M0LA 1D6SA 1A88A 5IDXA 3H65A 1JHDA 2WA1A 1JWAB 4JI6B 2VJMB 4E14A 1JNYA 4B76A 3QVMA 3R5XA 4Q7JB 3RT7A 4Y30A 4G3XA 5AICA 3QVUA 1IPHA 4DRZA 1MRZA 3E6AA 1VMEA 4JSRA 4OXYA 1VDZA 4GI1A 3EEBA 3L7IA 4R2LA 4TZKA 1FFYA 3SN6A 4OYRA 3FOEC 4JYAB 1OWNA 3E18A 1Y3HA 4RUKA 1OH8A 1IMJA 1YQXA 1J0DA 4ZVKA 4K81B 3UUGA 1JAZA 1ZW6A 3K0HA 4L08A 4RTQA 5KYUB 4HLCA 2WHPB 3U0BA 3BS4A 3Q41A 5CCDA 4ER7A 5BV8A 2FXIA 4OMDA 2ZQ5A 5IDQA 4Y2QA 3OT4A 4H2DA 1JQKA 2JJ1A 3RUFA 4C0SA 2X0EA 3TAUA 1F0KA 1I7NA 1RWQA 3SFTA 3G2NA 1VA5A 4A92A 1DAFA 1EKXA 3L7CA 4G0UA 1ESMA 1GEGA 3AXSA 3Q8KA 3BWVA 2P9HA 4B3FX 3PX7A 2BLLA 2WU4A 4TYYA 4D3YA 2BRUA 2R4UA 4GVXA 4GKBA 1CK4A 4XIYA 4YFYA 3A4TA 3ZGVA 2QOEA 4U39A 4HWTA 3W5DA 3THXA 3R41A 3LUHA 3MTJA 4DMGA 2J46A 3EZ2A 2HEIA 2HU5A 3GLGE 2OV4A 3EXHA 3FMPB 3CUUA 5GWXA 4HGOA 4C0WA 3I4FA 5K8TA 4R31A 1TL7C 4IQ8A 2RK6A 5D5QA 3QWHA 1KXJA 3H2KA 2V4MA 3EVZA 1KVTA 1X1QA 9LDTA 1PUXA 2X7JA 2FRDC 1J2YA 1Y89A 1S01A 1I4WA 1TU3A 3IO3A 4Q6BA 3E7XA 2VP3A 1N9GB 2PX8A 4H3SA 4MMXB 2XLCA 4YDRA 3RSOA 2KMLA 4QELA 1M76A 1U2DC 1G9SA 4P58A 4KIGA 3V48A 4LEIA 1D7OA 2JK1A 4XDYA 3KPVA 1QQBA 2XQIA 1IG0A 1ZGHA 3NTUA 3CKMA 1GY8A 3PJEA 1MPTA 1ADBA 3BDIA 2C83A 4NCXA 5AJXA 3UPUA 5EUCA 3KALA 3LPMA 4HDKB 4M1SA 4M37A 1LDNA 4KKVA 3OX2A 2I4RA 1WRBA 3NBXX 1R0BA 5IAJA 1AHIA 3V2HA 3D31A 5DN6D 5EIWA 3TBKA 4QBGB 4ZOQI 3ZY5A 1KERA 1N57A 2CUTA 3GLSA 3Q7SA 3FZQA 2KE5A 3AB7A 5DHTA 3WP1B 3ZX4A 1TC1A 2VQ3A 2C9DA 2DFLA 2XUAA 4PAOA 3E4DA 4BKQA 3OESA 3KXPA 3OZBA 2ZRAA 3KLNA 1O2DA 3WLHA 3LPLA 2RIRA 1VG1A 4ZC1A 3VI3B 1G64A 4A2CA 3B1FA 4MV4A 5KNBH 1IULA 2ANBA 2Q9UA 3FCUB 4J43A 4WKNA 1OAOC 2FSSA 3SDSA 1BS1A 1U2TA 2H59A 2IOQA 2VHXA 1E3DA 4ZQCB 1MNQA 4Q48A 4AYWA 1TK3A 5BWLA 5ALEA 1TZCA 1V7PC 4HXFB 3U81A 1Q1EA 4R98A 1KDYA 4B75A 4EHJA 3H5WA 2H31A 4JVNA 4BNJA 1VFPA 1E9BA 4ALNA 3HXTA 3LCJA 3PWSA 2CZGA 3RKRA 3LUDA 4P86A 3RVNA 1JFTA 3ISVA 5EFOA 2PSDA 3UMJA 5HF5A 2X2FA 1GQ2A 4XM1A 2Z5GA 4IXMA 1VGVA 2L17A 1TJNA 3IIKA 3INNA 4OXIA 1MU0A 5D3MB 5KKCA 2GBGA 3E5NA 4Z7NB 3EAGA 4RKFA 4YRKA 4IXNA 4K03A 4CDMA 1JEQB 2PSSA 4HDRB 4HQRA 1EUYA 5AKGA 1GYRA 1YZNA 1H5QA 2ZKIA 1BW9B 5FV4A 4RTMA 2B4RO 1HFEL 4H1UA 4DV1B 3ZX5A 2PRYA 3ILSA 1YZLA 2K7FA 3MHTA 1NQWA 1EFPA 1YAHA 2G4CA 4DIEA 1EVZA 2GB4A 3PLAE 4WBSA 4XD7D 1VZ3A 2N46A 1I94B 1UZMA 4URXR 1PL7A 4B2PA 2B92A 4Z9AA 4Y1FA 1YBFA 3W8FA 1W0JD 2QYOA 2XYHA 4MDEA 1QK5A 4XCVA 1LPSA 5JS8A 5K6RA 4YRSA 1LLUA 1Q50A 3CF0A 4D4MA 1X1BA 4ERXA 2H29A 3RAJA 2V74B 3Q3JB 2ZU6A 5TDHA 5AKJA 3RDPA 2GEKA 3UT0A 4N3CA 2P8SA 1SK9A 4M76B 3UPTA 1GU7A 2XYRA 4B6GA 4ARZA 2P3QA 2YHAA 1CUXA 1EGAA 1WXIA 3AZPA 2JCSA 4OLFA 4P4TA 1IHDA 4N65A 1E7QA 1GKYA 1ZM2A 3OM8A 4O4LA 4ZYTA 3D3WB 3N70A 1QAOA 3H9BA 2PXXA 3TLGA 2GM3A 5BR8B 4KXFB 2AN5A 2O2SA 2XEXA 3AY6A 3O83A 3PIIA 5DCYA 5A4JA 3ENWA 2ZVJA 1ISGA 2WKWA 2A0KA 1XVVA 1YXMA 2WUGA 3H9QA 3PTZA 4G85A 5C7OO 1NFFA 3IP7A 1XTRA 1VHLA 2Y2VA 3H9UA 4AY3A 1P2VA 1HL3A 3O3NB 4FFLA 4NCIA 4P4NA 1VLJA 5FHQA 3WLAA 3WXBA 5T6BA 2QYTA 1GUYA 2I33A 3KT0A 4JQCA 5A3SA 1QHSA 1XQ6A 2P77A 3WK6A 3V1MA 2HQRA 3Q7QA 5DH9A 3T3OA 3WSWA 2AFIB 1ESDA 2R66A 2H2AA 3DS8A 2O07A 3DT9A 2V5AA 4F7WA 1SBCA 1LSJA 2VXBA 2H6EA 2V4UA 1OIWA 4MLZA 5CT4A 4OSEA 3WIUA 4IOJA 4KPYA 1EHIA 3MT0A 2Q8QA 4PFJA 2UZ4A 2Q5OA 4EY3A 3HE3A 3TB4A 2A8YA 3NGMA 3B36A 4NC9A 2SICE 3ZK9A 3HL0A 1AGNA 4JXXA 1V1RB 3F78A 1JKXA 3LDGA 1EEXB 1LBEA 1MDBA 4W4TA 4MVJF 4KO8A 1PUJA 1G7CA 5GTDA 2WP0A 3AR5A 4M89A 2AK3A 5ICGA 1NXPA 2ONZA 3D7MA 3HBNA 5FUWA 2J9ZB 5LQNA 2PUJA 3L1HA 4ND1A 2IX9A 3PFCA 1WZIA 3PX3A 1YS4A 2QRZA 3GRRA 4MMYB 1ISHA 1NRIA 4EY7A 1R8SA 2J9RA 4IMIB 3BN3A 4HZGA 3HDHA 4DM4A 4DLBA 3GLTA 5C52B 4GZLA 3MXTA 5E38A 1N2IA 3V46A 3GBVA 3ZXSA 2JGJA 1CEYA 1KZ6A 1ZIYA 2O57A 5DV9A 4RBNA 3T34A 3KVNA 2JCGA 3CLVA 3M3PA 4MWBA 1K63A 2QL9A 5REQA 3ZZ1A 4O5OA 1GDTA 2QP9X 4RORA 5H02A 4ZI2A 2O59A 2XMBA 1R0XA 5FPYA 3SNKA 3RRXA 3UXMA 1YC2A 3H5TA 3H3FA 1E3SA 1P1HA 3G2HA 2OCLA 2BI4A 4HDMA 1N5KA 4JZYA 4XDGA 3GC6A 4GOKA 3X1YA 5K8VA 3PC7A 2HA4A 2CLEB 3KZXA 1F12A 4F92B 1BNCA 2FJPA 4QQRA 3STXA 5DIZA 1JQJC 2ONJA 4AJ4A 1ZD3A 2I1LA 3OX1A 1M2FA 5TPZA 4HBZA 1C0KA 1WMFA 1X38A 1GQSA 2W2KB 3NDIA 3DEKA 3OZCA 2Q5IA 3DL2A 1O4VA 1G5IA 1WD7A 3QYJA 3P0FA 1S2LA 3HJGA 3MAAC 5DHUA 2CLMB 2CLDX 2X9QA 1NTRA 3QYFA 1UEXC 1D6NA 4OGGA 2C8LA 2LIVA 3QG5A 5JXIA 3B1KA 3FYUB 3W4KA 1E4EA 1ZIPA 4JI0B 1N6KA 5ITZA 4EKYA 3DWEX 3FGOA 3IELA 4P33A 4RZQA 3IPYA 1L1FA 1DOZA 1OXTA 2E87A 3VR6A 1BJTA 2HWKA 4OVKA 4Q66C 3ZU3A 5C4IA 2MSLA 1RIIA 3F7TA 1VI6A 3GCGA 3GMDA 5K8IA 3ZNNA 1SQSA 3NASA 1G7SA 4LY9A 1SXJA 2F67A 1DQSA 5CX1A 3RAEC 1RTTA 3IA2A 3PJGA 3VR0A 1L7XA 1JEYB 2PLAA 3CMCO 1QE3A 3VTZA 3L01A 2QUIA 3W7VA 1FU7A 2CBZA 5CHYA 5COBA 2C4NA 2XCQA 4N0QA 3M9LA 3RTAA 4NFLA 5DYWA 1QO0A 1V3QE 2C5EA 3T06B 1BVRA 1M9NA 4IJWA 3LW8A 2QMEA 1P9OA 4KO2S 3LP8A 1RNLA 2AFHB 2J3QA 3LF1A 3OZFA 5AHRA 1DTEA 3RVJA 2PGNA 1QZUA 4GUDA 3FZYA 2YS7A 4HFJA 5FD8A 1E1YA 1ZK0A 3T3HA 1H3EA 4H3HB 2RIPA 3O38A 1RLUA 3OT1B 4K28A 5HS6A 5CXQA 1H93A 4INPA 4OU5A 3NFYA 3OIGA 3UW3A 2HFKA 1XEWX 5F78A 3KELA 3UHOA 3VOTA 2W6QA 2HZ7A 2O2XA 4FNOA 5GIOE 2XECA 5HM8A 5KVAA 3HKDA 4RFSA 4KLCA 1NVGA 1R3DA 4P3PA 5G3ZA 4LHVA 5EJ7A 1UEJA 1D09A 2XCLA 1PTJC 3U4QA 3URKA 1N8NA 1S8OA 2ZTHA 3AF3A 4U6QA 1V8OA 3W5HA 1I7LA 1O9BA 2Y3IA 3NT4A 5JI3E 5I8PA 4K0RA 1GQYA 1GAXA 4M9RA 5E7QA 1KFKB 3EY9A 1NZFA 1PR3A 1R5BA 4LGMA 1BA3A 3TTYA 5BOSB 5F73A 1EA5A 2A2ZA 4CMKA 4LNUA 3HXOA 4R16A 3HYSA 3TD2A 4XB2A 1RQ7A 2VXOA 4BE9A 5LMNB 4OX9B 3N75A 2NP7A 1KH1A 2D5IA 4RIGA 4PPQA 3IQHX 1SCIA 2ZEJA 2FUKA 3HH8A 4KDEA 1FRVA 2Q6IA 3VSBA 4CLRA 4J1NA 1KHHA 3SX0A 3KOOA 3D43A 2ZT7A 2JAUA 3LC2O 4GI5A 3SQNA 4RAQA 1R64A 2GZ1A 2OAEA 4Q4AB 2OO7A 3IHTA 1DC4A 5JDCC 4U7JA 2N75A 3STVA 1BS2A 2R5NA 1TT5A 5KOHB 4TMXA 2XKBA 1RZVA 5JNWA 1QQ7A 1DAMA 1G20B 1IC6A 1T5SA 3ZHSA 3RYFB 1WPXA 4EYSA 3UJNA 3OQ1A 4RHUA 2OPBA 4HX2A 3WHKA 1VI5A 1NVBA 4UU0A 1FYFA 2KWIA 2P9GA 5HJ7A 3FJYA 1WXWA 5FL7D 3SE0A 1OIVA 2EW2A 2YWGA 1L7PA 2VH1A 3EIWA 3PGJA 1XXHA 4DC9A 4CETA 2XTZA 2XB8A 4UD2A 2FCRA 2LCIA 3JALA 4D81A 4WLVA 3SICE 2J09A 2PMBA 4HGNA 2O3QA 4CKXA 3WZ2A 3KG2A 3D6UA 1VRWA 4TTIA 5GZ1A 4PO9A 1C1DB 1JR3E 2ZBRA 3U0VA 3RHZA 3G5UA 2VRNA 4F6RA 3ND5A 3NNSA 1OLSB 2JHPA 1TM4E 1E5XA 1RC8A 3DQZA 3O21A 2A78A 3WGGA 2FDXA 4P92A 1R0YA 3I4LA 1E2FA 3Q7RA 1NVXQ 4UUMA 3SC2B 3VV3A 4YR9A 4X1YB 2IUFA 3R0XA 2IT1A 4D99A 1ZVJA 1GNLA 3AEUA 4MGKR 4UM8B 4L50A 1KORA 3EDOA 4PZUA 1YZUA 1E3EA 1NE7A 2IDZA 3RRFA 1RAFA 4UULA 1M7BA 1YDGA 2UYYA 3BWMA 2X2EA 4HXEB 1BDJA 1W47A 4OMFG 5K0FA 2QS9A 2ZSHA 2A5FA 3WBKA 5TQ0A 3K5HA 3HKBA 4Q4LA 1NKVA 3CR3C 2ZJ3A 1OI3A 4O4HA 2IWRA 5DZSA 3TLJA 1FP4B 3G59A 4AF7A 1KIMA 5EJ6A 4JS0A 3H5VA 3G1WA 2NM0A 4J07A 3W5JA 5CGQB 4ASUD 4EABA 5IF9A 2W6OA 5KYNA 1BWPA 1I10A 1XDZA 4J0HA 2VQFB 3CPSA 4EFMA 1MNAA 2IGBA 1MB2A 3RYHB 3AESB 2A5GA 5E6SB 5BQ5A 4DNOA 4PSAA 4PRYA 2PLRA 2UZAA 4YR7A 5B30A 1JLSA 4WVLA 3PS9A 1VPDA 4NZNA 1NP3A 2D6FA 5EQTA 3UXHA 5M7EA 4RGBA 3E0QA 1QIHA 3GLHB 3N39C 4BJHB 3SR3A 1TTQB 3CKKA 1W0CA 2WWHA 2XOEA 2QYHA 5KMGA 1C7JA 1CUVA 1A9SA 2PH3A 3WLRA 4DSZA 3R76A 4LYAA 3ZDQA 3A6FA 4PSDA 3T7AA 4WNYA 3I1JA 3EX7C 1B6SA 2C4VA 2ZI6A 3AIMA 2NTEA 3Q5EA 4OCZA 1TECE 4FW8A 3WA6A 5G0TA 1UK9A 3WRYA 3NQ41 1LZKA 1VYHA 5KDOA 2FZLA 2FWMX 1O7JA 1DJPA 1AZTA 3TMAA 4A23A 4CR8A 4XVRA 5CNMA 4RF4A 2NQ2C 2NSHA 3T1HB 3HFRA 3RFVA 3HP1A 4CIVA 4Y7CA 2VIIA 1KL7A 1VDMA 4N54A 4W1SA 2FFQA 1ICIA 3OTHA 1U2ZA 3B51X 3NUQA 4HNAA 3GT3A 3JQBC 3HA3A 4Y0VA 4YXWA 4B3TB 1MVNA 2A0XA 2Y71A 1IOVA 4O1IA 4TLEA 5CIWA 4YBZA 4NYJQ 4D92A 2EERA 3TQRA 1FP7A 1EWYA 1JUDA 4IICA 2R6FA 5C8DA 1F4VA 3CEMA 2CC2A 4OB7A 3RWBA 4EUEA 2B4KA 3O3OB 1IN6A 3JR3A 2BI7A 3FDZA 3JASB 4KX3A 2EEPA 4FDTA 2YZ2A 2BKAA 3BMQB 3NBAA 2OA0A 3ZCVA 3DFIA 1TPYA 4BE7B 3BPSA 4M1ZA 3UWMA 5KU7A 2BDEA 2Q99A 1BGXT 3KQNA 3MJ4A 1KBOA 1TUBB 3L8CA 2OVFA 4DCVA 4FFPA 4XOUA 1N0VC 1P1JA 3LX5A 5TQJA 2QE7D 3LWDA 4Q7KA 1L5KA 1TUEA 2BMVA 2HJSA 2PV7A 4L4UA 4KXVA 4P98A 5M3BA 4E6PA 4EATA 1V8BA 2FQWA 3FRHA 3KHUA 3R3YA 3AM4A 5F3WB 4WK2B 3KQVA 5SZHB 3D0RA 1ORIA 3DHVA 1E63A 3T5DA 5KYYB 3MMNA 4AYXA 5EA2A 6LDHA 1TF5A 2ZIFA 5K3SA 4LRQA 2GAAA 5CEEA 5A9SA 2V3VA 4Y6QA 4O5AA 1T5OA 4RMIA 1WQ1R 4WIAA 5KDLA 3RARA 4QG3A 4W63A 5HILA 5JCJD 4B73A 2G0AA 4X8MA 4B6JA 1OHHD 3NKVA 5EI5A 4E03A 1SUDA 1QVZA 2VYNA 2YQ5A 3DLTA 4MOWA 2EIXA 3EB9A 4LXIA 2QD5A 1C4KA 2CLSA 1DSSG 5HEKA 5CLFA 1TYEB 1GNSA 2FI1A 1R1DA 4CXMA 4EB8A 3SJZA 5DN9A 3GH1A 1Z4JA 1NBMA 2P9EA 2V97A 1ZSNA 4YVFA 5BYKA 5BUCA 3DSRA 4B32A 4BV3A 3E22A 4WW0A 5M04A 3KAKA 2NPOA 4J29A 1IDOA 1RMYA 4KN8A 4DIMA 2FN8A 2B8NA 5HZHA 3P0IA 4X3PA 3PRJA 4GWGA 2VDMB 4PHGA 3I2FA 5DYTA 1EESA 1DMRA 1XQVA 4NJEB 1KOJA 2R2AA 3T3MB 4W5RA 3OZTA 3HZRA 3R6GA 1RQLA 4GMKA 2C7OA 2VCHA 5IABA 3UGKA 4FSHA 1QE0A 1DPFA 5BN4A 4K2HA 3V33A 1PT6A 3KOWA 1Y3AA 3JW8A 4DMHA 2H4YA 4G8CA 4BKMA 2IPNA 2I03A 3G9ZA 3O74A 4US1R 2FN7A 2F48A 2FUCA 2P78A 2XYGA 3C1TA 3G8BA 3GUYA 3N8GA 2RHCA 3ECCA 4R8VA 2AC4A 1WB4A 4KEAA 3TLCA 1SPBS 2GAJA 1H9AA 3L79A 4FZVA 3KUCA 3HM9A 5CDFA 3DTVA 3E3LA 4K3UA 3IX7A 4Z9YA 1XEFA 4UM9B 5C46F 3Q10A 3W6PA 4B3BA 4DQUA 2O2DA 3GOQA 3TW4A 4BKRA 2WYUA 1OD6A 3FCCA 4BC1A 5LYJF 4MQ6A 1QP4A 1V2HE 3KXIA 4KXLA 2CYBA 1AUXA 2AOUA 1NVTA 4G26A 4BEJA 3EFOA 1LKZA 3I61A 4UTXA 4WI1A 3RSCA 3SC4A 3EVFA 3T5BA 4GICA 4PSCA 2FZGA 2I1WA 3AKDA 4MLDA 1Z2NX 4UJ5A 5FA8A 5KTKA 1S3FA 1YCFA 4FI3F 4Z4FA 2PKWA 4IOKA 1W46A 5T4BA 2ZRFA 4RV5A 3KSAC 2G08A 3VHRA 1S2DA 2H1IA 1C7ZA 5LLTA 1IRIA 1MXFA 3IAXA 4H27A 1O95C 1M5TA 2BZSA 2L19A 1UOQA 3EXIB 2BUCA 3H84A 3PNOA 2E3JA 4PCLA 4C43A 3B8EA 4W7IA 2DR2A 3F2IA 3HP7A 3K0CC 2AVDA 1X7HA 3MFQA 1CRPA 1CV2A 1K68A 1ID8A 4MW4A 4B3SB 4L8VA 1T0JB 2VYVA 4NAHA 4P4LA 2E5FA 3MERA 1E79A 1OB5A 4YRTA 1IJBA 4A91A 4KG7A 2VQSA 1WKCA 3BTSA 3WWEA 5HGXA 3G89A 1KQ3A 1B8PA 2BUBA 4BNKA 4DV4B 4QBIA 1LK7A 1VG9B 1XA4A 2IDMA 1OWLA 1V71A 1OAKA 1S9DA 4N7RA 1LLDA 4NK4A 4URUR 4EY8A 5I8WA 1MHTA 2FDRA 1JLHA 1GCAA 2JLBA 1MAAA 4BFSA 4RH1A 3B53X 4QTUB 4X63A 3Q40A 5ERYA 5HE8A 3P52A 1IOZA 2OORA 3GT0A 1KKUA 1T9KA 2IGTA 3GCZA 2JGFA 3H4VA 3R6LA 4JJGA 1ACMA 1L4GA 1KZ7B 1UKAA 2QRGA 1ZVKA 3GLVA 2OV6A 4QLOA 5FFFA 3TQSA 4MITA 2C00A 4YV7A 4DMLA 5BR7A 5FX2A 5EZSA 3V97A 2G9RA 2XWQA 1IH8A 1W8IA 2OILA 2TSYB 4HQNA 1SH7A 2MSKA 4P36A 1M7GA 4BS9A 1RKXA 4CT5A 4E3ZA 1CRLA 1SOAA 1U2SA 1UFRA 2R3SA 2VK8A 3D5QA 3BERA 3EH1A 5GONF 2Z04A 2QBYA 1ES9A 2ETXA 2QJFA 1R4NA 2QT0A 3HM2A 1SU8A 2C59A 1U0TA 2C2GA 2J31A 4JH0A 5BNTA 4G63A 4G81A 2F2TA 2MYUA 1KEEB 3PIRA 4MI9A 5HBRA 2FKNA 1JHAA 4E2YA 2QTZA 5U4XA 3G3EA 1YR2A 3Q8WA 1J70A 1JJBA 2CXSA 3ST7A 1OH5A 3UJ7A 2P5YA 4M83A 2BFAA 4YJHA 3UJ9A 3MELA 1JMYA 3AOEC 3IEMA 3OHMA 4NIMA 4R1MA 1ZUWA 4MK4A 2R8PA 3DEHA 3GP3A 1JQAA 2OHGA 3KWJA 2EJUA 2F9LA 3BRSA 4HDKA 4O2BA 4UHFA 4XAQA 3VJMA 4ZFNA 5CVVA 4PYNA 4HNSA 1HLDA 1YJAA 5FBHA 2B3DA 3AFNA 1LTQA 4IHJF 3RU9A 3SZLA 3TSOA 1B43A 3JD2A 2WV7A 1L4NA 4JQSA 4KX5A 3OCYA 3T7JA 4BXOA 4B6FA 4DCOA 1G8FA 4CM8B 3SLRA 3GYGA 2QTVB 3AH8A 2ODBA 2OR3A 2R5FA 4NBWA 2GARA 2PPLA 3C39A 3NOXA 3C1AA 4RETA 2RAUA 2UZ0A 1YL7A 3F6SA 5AMXA 4N7JA 3VO2A 3K9FC 2XE6A 3V2IA 4LF8B 1V3TA 1BA2A 3PNPA 1MABA 3T7CA 2ZB7A 1KDOA 2IYFA 3QE4A 4Z9FA 1JR4A 3VVCA 1D9XA 4WFKA 2P9QA 1NBOA 4MI6A 3MRVA 2D7JA 1V9SA 2JH9A 5J5VA 4B4WA 4MAMA 3S40A 4DC1A 4FT4A 1DCFA 1U2EA 5IC4A 1L3BA 4PFQA 1QSGA 4JR2A 2PMWB 4Y2HA 1K4YA 2J9GA 1D2EA 2ZROA 5ALOA 5DP1A 1E20A 4Y2JA 3DV2A 3L0BA 5CAEA 5ARCA 3CNQS 3QFTA 2XQKA 2B35A 2XNJA 4G0NA 2VPXA 4JQOA 2OP1A 1R4MA 4W9MC 2CXRA 3PXEA 3FPLA 3OC6A 4CM4B 4XDHA 5TC4A 1ZR4A 3PXDA 3T9BA 1EQ2A 3CZ5A 1U8CB 4B3HA 4ZO7A 2SKDA 4KK4A 3TW0A 4KXMA 2P90A 5CJJA 4ZCSA 2PKRA 1VG0B 3FIJA 5CGZA 4YMLA 1D1QA 2IH4A 2ID8A 1Z16A 1P1FA 5ICMA 3EMVA 4G5FA 3AY3A 1LEHA 1XAHA 3IVAA 3WLMA 4DA8A 2AMFA 5KJEA 3HUUA 1XJ0A 4QJIA 2ZZMA 4XQCA 2HSEA 1A7KA 3SXJA 3LHKA 4EM6A 5JRDS 1JA1A 4NNJA 1RCFA 2WF8A 4F3TA 1XTUA 4Q3OA 3CISA 1NYRA 2ZT6A 4OHXA 3ADCA 3GW8A 3MLEA 4L27A 2AE1A 2CMDA 2WFMA 5K2MA 1I3MA 1TYAE 4UUAA 5DW0A 5DT2A 1FW6A 3DM9B 4QBTA 3WLEA 1IXYA 4MA4A 9MHTA 3K1YA 1ZGJA 1M34B 2HNBA 1YA6A 1AA9A 2WUVA 3BZBA 2GXUA 1KY2A 2LBPA 1FOEB 3NWOA 4V24A 3MTAA 3T7RA 3GDHA 2WMDA 2ZBQA 2O0KA 2Z2JA 2BFWA 2J6IA 1YDFA 3U31A 3R3WA 3LNCA 2HF2A 5KVCA 1DPGA 1Z25A 4HO1X 3K3PA 4KIUA 2C84A 3MJTA 1VKZA 4LRUA 1S2MA 5J58A 1DCTA 3A4NA 1ZU5A 4D26A 3SHWA 3EG5A 4CT0A 1Z4QA 1YMQA 1JV2B 4EQ6A 2SCUA 1INLA 1Z3IX 3ASZA 3TTXA 5C7LO 1A5SB 2ZUTA 3MGAA 1JBEA 1R5OA 4D45A 3SMQA 3B48A 1O9HA 2RH8A 5KU1A 2WNSA 4H7HA 4BX8A 5JD4A 2A9OA 2FMXA 1MX1A 4P0TA 4L5JA 5HS4A 3ROMA 1KO4A 3U4AA 1FNMA 2WVGA 1W8DA 3AKZA 1GVNB 2I4LA 2F43A 1SA0B 2O2ZA 2DLNA 4J9UE 1I13A 3SQDA 4LXUA 4YUYA 1PQYA 2HPAA 3B89A 3ZD7A 1T0UA 3CRZA 3G82C 4PG7A 4II7A 3A1EA 3KJHA 4OTZA 3VR4D 3TZKA 1AMNA 1N2CE 3OHPA 4ZHQB 3FUUA 3SSAA 1VE6A 4YASA 4YT5A 4KAJA 4ADSG 4A73A 2AW3A 1NUSA 2X14A 3GZNB 5CYFA 1O89A 1HQCA 2C5AA 2BDTA 2CDNA 2RHWA 3TIXB 3VZQA 4D0RA 5HRCA 1WKBA 4Z4EA 2CJWB 2I4TA 3CZRA 3JQ6A 3DDHA 5A1JA 2V6JA 3U4QB 4S24A 3NETA 5JNRA 2I71A 1W6RA 1XRSB 2OGWA 1L7RA 1KKLA 4YLGA 5LWHA 4GL4A 1UBOS 1ZN7A 1Y37A 1X87A 4Z3OA 3LD9A 3FN4A 3MBOA 1ZWLA 1OXVA 1VYVA 1AT1A 4TMYA 3VYRB 1DKNA 3KFLA 4K9RA 4FFMA 2AI3A 5DN6A 2G9NA 2AHOA 4RVFA 1GGMA 1QPGA 2O2EA 2ZBUA 4HN2A 1BE8A 5DW3A 1TCUA 3T1VA 2UYGA 3ESBA 3N76A 2HGZA 1K86A 3I2GA 3IUPA 3QUQA 3M5PA 1F1JA 1QS0A 3D6MA 4KKXB 2BTQA 1Y5NA 3C41J 3F5FA 3Q2KA 2VUSA 3KUKA 5GM1A 4GPAA 4EGSA 4B6QA 1ZK4A 3B6JA 5CVEA 4KQMA 4WRRA 2GGSA 4TMWA 2DEUA 4V0NA 1E9RA 3KK0A 3C3WA 3AKEA 3RTEA 2GSDA 1C1XB 2FX2A 3GJ4A 5JZ9A 4ZVNA 4C29A 3EZNA 4BAZA 1U2RA 4CM9A 1E6WA 3DXYA 3DHEA 3COJA 1XALA 1CUGA 1KS2A 1UAGA 2VBGA 2CNWD 2E6UX 2XE7A 4ED9A 5TS2A 5BSVA 3L41A 4R9RA 3W4JA 3RYHA 4A4DA 1Q91A 1GUZA 4PW0A 3H9EO 1HKHA 2OFXA 1ECLA 2F1KA 4GC9A 3FVQA 1PG0A 3KKLA 4A1FA 2NO1A 3BZWA 1G5TA 1A8IA 2OC9A 3DQPA 3IUSA 3QTLA 2Q2OA 2VZ8A 3NHMA 4H31A 4DW8A 4LC0A 3Q9LA 4BB9A 2POQX 3P26A 4MKXA 3VBCA 2A59A 1R4NB 2WJ4A 1U3WA 2X3FA 4KQHA 2R4QA 2X6RA 4C6TB 4UMFA 5LM3A 1VLQA 1KEEA 3RS2A 3M4YA 4RPLA 1NVVQ 1XZQA 2HH9A 3AO0B 3BJIC 3I37X 3Q5GA 4Q1DA 4R3NA 1KYTA 3GFSA 1A2QA 3AVXA 4TL8A 5CH8A 3DBIA 2EKBA 4QOEA 4JENA 1EFTA 3M6UA 1IBKB 1C9DB 1MO6A 1CQWA 1P0FA 4KPFC 5EMJA 4WBNF 5HUJA 4M7WA 4U7WA 2MCFA 3N2KB 1JQLB 3MOGA 1Z68A 3L6CA 5J3JA 2TS1A 3HFJA 1WPGA 2JGEA 5FOUA 2O5CA 2JLSA 3HPQA 4ZIRB 4M9QA 1UFKA 2AG8A 3GG2A 3G5TA 4F8YA 2ATVA 2JJYA 3JQBA 1NW5A 3MJRA 4H0CA 4WESA 1YV9A 1U99A 2P65A 2PX0A 1BKDR 1C9NA 3GCWA 2JFXA 3KE9A 4MINA 4Q7EA 5CURA 4F3YA 1M1YB 1VIVA 2C31A 4XLZA 3BL5A 2WG1A 4OHVA 5J2TB 1D7AA 3ZHRA 1Z28A 3S2EA 3A6JA 4WXHA 3K1TA 4QPNA 4ZOBA 4EF6A 2WEKA 2ISQA 5LP6A 4YP7A 1TC2A 3FNEA 3WRYC 3DQQA 3HJRA 4EIWA 5L3QA 2XXBA 5KNBD 4DG5A 2C97A 3Q7TA 4Y2PA 5HGJA 1VJTA 3JYLA 5IU6A 4GMDA 1C7FA 5KNDH 5KJCA 4EVQA 2ZR7A 4NOKA 4Y98A 1YR6A 1HMYA 1Y1LA 1N3BA 2QMQA 3M4XA 2A5DA 4UXHA 4LFAB 3IYLW 4PRKA 2GHIA 1H4QA 1ZLYA 1JR3D 3X3HA 1MOZA 1OMOA 1YF3A 2QN8A 3B3GA 4FGUA 5K0SA 3ZW7A 2B83A 3GPIA 1VJRA 3BQMB 3COSA 5HF8A 1LPBB 5HG0A 1T1JA 4ND6A 1OTHA 1XTSA 5DDIP 4GZ3A 2IU6A 4BQFA 4E5YA 7REQA 3JQQA 4KQKA 1ZR2A 5IKOA 3DD5A 4DF3A 4HUQA 2GEFA 2QRVA 3B3AA 1VJDA 2PTHA 1P0MA 4AIRA 1HYHA 1BKYA 1Y5RA 2DTDA 2J6CA 2ZYRA 3F6RA 1NVVR 4JSYA 3ZHQA 4F7DA 4Q16A 2NPIA 3QU4A 2AXPA 2D06A 2I6TA 3DFZA 2EL9A 4DE5A 5TEWA 4Z7QB 2X6QA 4TL9A 4LJ8A 5FUBA 1NDHA 3N2GA 1OJ7A 1YQ9A 3K9QO 3LY5A 1B76A 3EIFA 5J5CA 4D6XA 3TMKA 4DUYB 2ZZNA 4C4AA 3U7GA 2J41A 4WN9A 3IEVA 2R65A 1RU3A 4U9HS 4ZRDA 5K4AA 4EI7A 3VNSA 1HBJA 1O5TA 1SWWA 3DJYA 3OFJA 1T91A 4EA6A 1GTSA 4LV8B 1EE1A 4ZJYA 4QVIA 2B37A 2XBUA 1RQGA 1M73E 4O4JB 1UBNA 3FDFA 5TGZA 2X1LA 3MFYA 3HA2A 1F8UA 1L8LA 3F5DA 5FOXA 3TR6A 4BVLA 2QRUA 3K70C 4E1BA 1MR3F 5A03A 3VKHA 1JN0A 3TCKA 3C5VA 3H1FA 1TO2E 3WAGA 1ID1A 1NBIA 3UOAB 2IZ5A 3ETNA 4WDRA 2WE7A 1GCOA 1OGJA 1CLEA 3E22B 3QE3A 3SBEA 5BMVA 1MORA 3AUJB 1WWKA 3DZIA 3EA0A 4J0IA 5LZ8A 1KU0A 3I9V6 1PLJA 1DRUA 2NSDA 2OO3A 5TX7A 2Q3LA 1WZEA 2YJ5A 3C74A 3ZCTA 3OJCA 1PN3A 1DWQA 4OHKA 4IY1A 5D6NA 1DCKA 1DBIA 2HC9A 4LTMA 5GZ6A 1A9QA 1Y4DE 3ET5A 2A1UB 3A36A 2I6FA 2QENA 2HK7A 4LDAA 3D2AA 3QPDA 3WBFA 4EPWA 3NBZC 3SJCA 4YP1A 2QD1A 1NC3A 3EUEA 5BURA 5I51A 4QU9A 1TJ3A 3CUVA 4HV4A 1NSTA 3SKXA 4MDFA 4JBYA 4RJ2A 3T7EA 3RC9A 2YV1A 1AUPA 3GLHE 1QMGA 4HNQA 4E2XA 3HYNA 1PHPA 3W3AD 4QGHA 4QWWA 4I9UA 4P3OA 3LIPA 3DBOB 4WZBA 4E6EA 5JH7F 4I5IA 2L42A 5B1IA 10MHA 2GILA 3NDRA 3DPSA 1Z4NA 5CLQA 2RC5A 2CLKB 1RWMA 1FMTA 1ZUHA 4RY2A 1SCUB 1MTZA 3D6NB 1RRGA 3FYSA 3GQVA 3ER9A 1COWD 5CH5A 4DXDA 3U60B 2JHCA 4QXRA 2H5IA 2ZJ5A 4LZNA 3NTQA 1KSJA 3ISTA 4I1YA 5JY1A 4YJ3A 3FSGD 3JYHA 4OQEA 1YQGA 2XCTB 1U94A 1N5IA 2X3UA 1GV1A 1VOTA 3D8BA 4JBIA 1KK1A 4OHWA 3I0ZA 3GLIB 1HYEA 3UF0A 1H0SA 1KSFX 2Z8ZA 3VSAA 5HOEA 1MW8X 3IAHA 3U3XA 3IAM1 3GDFA 3PEUA 3UMRA 1QO7A 3KZKA 2VSQA 2REOA 3BRWD 3PQ4A 5LYJA 4B4OA 2KLBA 3F3YA 2GZHA 3TTSA 821PA 3NIFB 1EFRD 5AW5A 3JQAA 3GAZA 3AP1A 3K9NA 4Q9AA 2CWDA 5JZMA 2H4ZA 2PUDA 2QPOA 1FNNA 2FQYA 4YP5A 1G1MA 2HO5A 4EAQA 3AERA 3FXAA 3C7DB 3NHBA 2C61A 2FRDA 2YV3A 4MUIA 2QTBA 5FI1B 2HSWA 1M2KA 1PR6A 1EUZA 4M0DA 1WL8A 2HRCA 2RHHA 2OHVA 2Q5FA 4OGFA 4DLZA 5AVYA 5EOVA 1CY8A 3ELDA 3K0CA 4M9XA 2Q45A 5JNVA 3HJCA 1OXBB 1L8QA 5CXUA 1O0SA 1W6UA 4ZAZA 1I4LD 1B73A 4FD3A 4II3A 1JAIA 1Y9JA 3I9LA 4QDKA 1YVDA 2CYAA 2PL5A 2HIHA 5DI3A 2EL7A 3H42B 1KEKA 4UQOA 3LK7A 1X74A 3TZEA 2XX3A 1UJ5A 3IP5A 3PI7A 1OU0A 4V0QA 4ZPJA 4WH0A 1Y8ZA 1JHOA 2GZ3A 1CZRA 3TLEA 4A0GA 3PI6A 1PL0A 2ZTSA 2CBGA 1X1DA 4M36A 1LXCA 3PC8A 5GGXA 1TRHA 3M8KA 2QUJA 5LP6B 4TWBA 2X0JA 2L18A 4RABA 1SULA 1Z35A 1A96A 1RZUA 2XB6A 3HKEB 1YIOA 4W9RA 4KXUA 3Q9SA 3SZGA 5IZCA 2LCQA 1BQEA 4BYGA 4TL6A 2XDQB 2ZJ0A 3R8CA 2P1ZA 1W59A 2XNKA 3KQTA 2IV7A 1RFLA 3FMVA 4IEIA 4UEQA 1U1EA 1P0QA 5BYBA 4ALJA 5JNLA 1VE7A 3ZCUA 3PPVA 4ML3A 3LGSA 5JLAA 2WABA 2O8FB 4G4GA 1NR7A 2OMKA 2QP3A 3R9XB 2IXFA 4KQ1A 4FJ0A 4TROA 3Q2OA 3WIDA 4BQOA 5K0GA 4ZO6A 1FTQA 2H17A 1SG0A 4NAVA 3V8MA 2O0LA 2ILTA 2V7QD 4I81A 1XMOB 4FPXA 1PJ3A 2BR4A 2QRVB 1K3UB 4FFNA 3D8SA 4XASA 1GAWA 1PWZA 2FUG1 1FFHA 1QTIA 2VRCD 3LRXA 2PS1A 4ZEXA 4ANFA 4BO4A 4DJAA 621PA 2CV1A 4YTEA 4IUCS 4LK2A 4RHEA 3ZDRA 3KTOA 4FTWA 1HSOA 1U6JA 4CG0A 1MB3A 3ZLBA 3UT5A 4NTZA 2FGJA 4MEJA 1DXYA 5TGDA 1GKUB 1K6EA 5HPYB 2WFLB 1H2YA 1T9AA 3F4BA 3RSHA 3U19A 4RK4A 2VXCA 1PUIA 4IG9A 2YWEA 1OF1A 1A8PA 3FTQA 2FV8A 3LW7A 1W5SA 4C7KA 2V58A 3ZDAA 2FH5B 4RTSA 1TJYA 1M6VB 2C2ZA 3C4JA 1V5WA 2EG9A 3QOWA 1EP9A 1M67A 4IGKA 5HMMA 5LUBA 3EHDA 1IY9A 1XE3A 1CZKA 1F2DA 2TRSB 4FZ5A 2W8ZA 4CHTA 2ODWA 2L2QA 4QUKA 3AU9A 2VWQA 1DNPA 5HMLA 2HCJB 1OQAA 5JBNA 1B6RA 1PG2A 3KJEA 3OQVA 2F4VB 2YYAA 5I4CA 4DBZA 1JEAA 4BVEA 4J3FA 4XUGB 5CNIA 1TVKB 2P6PA 4BKUA 1QCYA 3QUCA 1F8GA 5FPKA 3OOSA 2QZ9A 1DX6A 1ZH6A 4ZIRA 4R2IA 4Y1EA 3T0IA 5TPWA 1JLKA 4GYKA 1E9EA 4IJ6A 3VYVA 3QKTA 3WNZA 2C5FA 4DR3B 2V0NA 1OPRA 3WE7A 3G9UA 1YZFA 3F1KA 2C8JA 3HLYA 4V0SA 5DGIA 1MD9A 3AR6A 2VYQA 5FDFA 4W1QA 1Z0UA 5AXBA 1EYZA 3I01A 4DL9A 3HJFA 2EZ4A 2XR1A 1SUAA 3R0ZA 2JAPA 2RGAA 5TT1A 2UYCA 2BV3A 1U5AA 3FUXA 5ICFA 2FHPA 5FLXA 3I3OA 2Y68A 3GLUA 4QUIA 4I50B 3W05A 4E2FA 5JTTA 2D3TA 3E35A 3L0OA 1G3UA 4RF2A 4X92A 2PX5A 3NAGA 3WKDA 1G55A 1RADA 2EOAA 2ZIEA 3W3AH 3NWEA 4DZTA 2P4EA 1G5RA 3RGGA 5IF3A 1TZ2A 3GJSA 3DMFA 2Q9BA 3TLYA 3JRXA 1JS1X 2YXPX 3DKIA 3ESQA 2UVPB 3THYB 2WTAA 1SUPA 4W1PA 5ECGC 1V11B 2HMUA 2OD2A 1ILWA 4BNGA 3KYJB 1SXIA 4BZZA 4D9GA 4DV2B 3KUDA 1R4MB 3X1JA 4MMZB 1V39A 2YC4C 3PDWA 1J23A 5DGCA 1X8KA 3A26A 1DBVO 3KCNA 5T57A 1NUTA 2P75A 3QXJA 1PYDA 3MCTA 3CEJA 5L4LA 4EH1A 3QLEA 2OBFA 4D7AA 3NHUA 2VAXA 4TSRA 4K26A 4EFDA 3G1UA 1FMCA 2GJSA 1YJCA 3B13B 2XGJA 3G02A 1LDGA 1HF3A 1C9YA 1DZ3A 4CL8A 1V3UA 1QHHA 2ZPAA 1QTRA 3RLFA 3JARB 1BRTA 1I9GA 2QN1A 1KJWA 2SCUB 3AR7A 2Q9CA 1P3JA 3V1UA 1N8SA 4GG1A 5EP3A 2PGJA 4OP1A 4ENQA 4EI2A 3SZ3A 1XKXA 1RLMA 1E1CA 2X8JB 2PH1A 1W4ZA 2HHCA 5KI6A 5KWEA 3QNUA 2FSGA 4CEJB 1NW3A 2G17A 3K2EA 5FJIA 1PO7A 1DJNA 3A06A 2O8BB 4B7ZA 3C8ZA 3NHPA 3GF4A 5C1DA 2OHOA 4AMYA 2D62A 2IZ7A 1RAAA 2LKCA 1ZNWA 3AGPA 2Q3EA 4F71A 4NARA 1FFSA 1JPVA 2ZVDA 3FI0A 5FKJA 3KE8A 1PZGA 3VO8A 2MSCB 4L5AA 4R8SA 4B7AA 2I9KA 3BYZA 3V2GA 3Q8LA 3PDIA 4HDMB 1QYXA 2VTKA 2F8LA 1II8A 1ZY2A 4N3AA 2ZM5A 3QLTA 2W7TA 5SY9A 4B44A 2JLYA 2C3UA 2YMLA 1X14A 1Y6RA 4KDRA 1Q22A 1KOFA 4WCFC 4U7TB 3TRFA 2DUMA 2IYUA 4R69A 1H3FA 4RTPA 3A1FA 2YXLA 1YRYE 3G85A 3DTNA 3O94A 1KO1A 4P82A 1Z39A 1ZSYA 1EVKA 3TM4A 1DIRA 3NXKA 3TGLA 3QMWA 4RCVA 1NG9A 1BXGA 2ABWA 3MWGA 2BOVA 3C1UA 2JGDA 4FGWA 4HRYA 5FTWA 4AJPA 2G1UA 4XWAA 1EVIA 3QUTA 1PQPA 3LIIA 1T3ZA 2ZPUA 1Q77A 3MTDA 2XHEA 5BNFA 4A1OA 5CDSA 3L1JA 1NW4A 2JEZA 3BJEA 3FCOA 3RPEA 2BWJA 3RABA 1ZGZA 3GRAA 4JOBA 4R2MA 5ES4B 2QRPA 1UAAA 3QKSA 3UJCA 1IK4A 1NJ2A 3RRBA 1G5HA 2J7KA 2KX7A 2OG2A 4HAIA 2FPUA 4NECA 3RJ9A 4GKAA 4BDSA 4NQRA 1GPMA 4M1QA 5DNCA 5HDBB 3T1TA 2A30A 2OBMA 3E7WA 4DA7A 1NXOA 1PW7A 4OQQA 4QU8A 1VTKA 2O8CB 5BVHA 3HI6A 3F67A 1HT0A 1QFMA 3KB8A 5KSYA 5IKXA 1EGMB 1M2WA 3SEFA 3F3MA 5JXHA 3VTFA 2RGWA 4S05A 3HVRA 3RO7A 1UXHA 4CIDA 5KTRA 5TE9A 1X7XA 1VHDA 3JZFA 1SKYB 4URHA 4CTJA 1AMOA 2GVNA 3I6IA 2LDBA 4I4TB 1N77A 1RRFA 1OH7A 1FA9A 1IXSB 2IFTA 3HV2A 3IIEA 5B4TA 1G8SA 3KU4A 4HGQA 3WFJA 1E9FA 2AR9A 2LKDA 1UJBA 3FDJA 5EJFA 4E32A 1PU2A 2GRAA 4R3WA 5HRUA 1V7ZA 3KOUA 3HJNA 4LDZA 4C14A 5JPCA 4BDTA 4PLCA 2HMVA 3WWOA 5TRTA 4JP1A 2NIPA 5ES3A 3RYIB 2G09A 4IL5A 4DKXA 3U7HB 1SAYA 2R97A 4EB3A 2FZWA 4N5DA 4NYMQ 2BRUC 1I24A 4K2AA 4Y1GA 2A92A 1H69A 1M1NB 3FCXA 4HMQA 2IUEA 3VU3A 4LHEA 3J81A 1TIPA 1U80A 4WD3A 5G0WA 3TR5A 1J25A 4K46A 2X8AA 5JVDF 1JMVA 4P4UA 1XF9A 1WA5A 1K5GA 1KMHA 4P34A 1OBCA 3LYHA 3JAWA 5CVCA 3SS9X 4AJHA 4YRQA 1USKA 2VDNB 5F4ZA 1SZJG 4MH0R 2D54A 2SKCA 4RHXA 4ZI5A 1TUGA 3PC4A 4TMKA 3CPEA 2IDKA 3VXKA 3KB1A 3S99A 2C2KA 4DDKA 4PRZA 3CT6A 3LG2A 1NRJB 3BE4A 2MR6A 3UGTA 1QHFA 3UO8B 2XDWA 2VYCA 5I9IA 1FJHA 1DKMA 4BLUA 2EBFX 2QLLA 3BE6A 2Z5FA 2NTVA 3HPRA 3MM4A 1L5GB 1I5RA 2XUGA 4KFRA 3TLZA 2JAHA 4GP6A 3QEJA 3WJ7A 1FFAA 3MJVA 3NYRA 2BCGY 4IEFB 4BGDA 4E3WA 4PTZA 5CDUA 4CLOA 1ISRA 2VJMA 1YL5A 2XOKD 4GKKB 3GA0A 1MO3A 4UASA 3SE7A 5BW4A 1K6MA 4B6PA 1XRPA 1NAIA 1SC3A 2NP6A 3EXFB 1MUUA 4EVSA 3PXXA 2JW5A 4UKDA 2BGKA 4Y2VA 2NQ8A 3LUFA 4LJYA 3VM6A 3T5GA 2I2FA 4LQCA 4OQNA 5D3QA 4ZQBA 5A2GA 3NFRA 1N6IA 2JGAA 2QRHA 2YHUA 3UM9A 4MIYA 4PZDA 3G9XA 3UK2A 2C4HA 2RC6A 2VHJA 3AVPA 1REQB 1QKIA 3IS3A 2ECOA 2C57A 2KJQA 5GIPE 2AFVA 4KH1A 2WF7A 4IWXA 4OQZA 1VKRA 4DV7B 1I9CA 4D0LB 2OCYC 3OZIA 1S1MA 4KSBA 3A3PA 4CQMB 4DVGA 5IVHA 3RIEA 4BO9A 2GLTA 1AKEA 1Z7WA 3JCZA 1QR2A 1Y8RA 4IZOA 2IXAA 4RMNA 4Z0HO 4ENWA 4EG3A 1P4SA 4XX0B 4Z7JA 3IT2A 3T61A 5DYIA 2DFDA 1FXWA 4YDHB 5LZ4A 1X9IA 3L04A 4JU9A 3U5ZB 5A5EA 3L43A 1EWRA 2DQ4A 1A5BB 2I6QA 2IZ0A 3HR4A 1MC4A 3G7NA 4NVRA 4XWTA 1GRRA 3S6JA 1QLJA 3S7TA 4M0EA 4FOSA 3VKVA 3IALA 5IARA 1K4KA 5FOQA 4KZKA 1W5EA 3R3JA 3RREA 4WINA 1O54A 3DZBA 5D84A 4E07A 4OLBA 1P4AA 5LXTA 2CK3A 3IVCA 1EP1B 3L82B 1N0HA 3QVSA 1YS1X 1Z22A 3RR2A 3FETA 4PYOA 4X7RA 4AZSA 4BO5A 1K08A 4EHAA 3G23A 2B1JA 4RELA 3DNMA 4NCKA 1PFKA 1QX3A 3DYBA 2QXUA 2XDYA 1HOTA 3TO5A 4B2YA 3FMOB 2J08A 1OGIA 1UPCA 3G2KA 3Q2IA 4G0QA 4RY8A 3L92A 2X4GA 4Y2RA 3CXRA 2X0FA 3W06A 1FQOA 4XCXA 2O2CA 1OAAA 2CCKA 2FLKA 3EUAA 3DVSX 2PSHA 3N86A 4Q37A 2JFBA 1HEUA 1NGSA 1OWOA 2H7CA 3IXLA 3KJFA 4DLLA 4NG5A 3EQ8A 5K0EA 3LYAA 2QTFA 1NVAA 1TRKA 2C8KA 3FH0A 3MK31 4KZPA 2UYHA 5AJHA