1JG4A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosylmethionine
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
b'EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein-L-isoaspartate O-methyltransferase
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg4A00
2NXEA 2P3QA 4HTFA 3DXYA 3SMQA 4E2WA 4BLUA 2ZBQA 5JUWA 2G70A 1Z3CA 4V0QA 3VC2A 4OA5A 3UJAA 3G88A 2ZWAA 2YVLA 3LKDA 1TPYA 4RTOA 1NKVA 2EJTA 3G2PA 1EAMA 1Q0SA 2JJQA 2XYQA 1XTPA 4HG2A 5LQJA 5GIOE 3BGIA 3IV6A 5MHTA 3KQYA 1O9HA 1R6AA 1XDUA 1EJ0A 2I9KA 3BGDA 3C6MA 1T43A 3MQ2A 5K0EA 1QAQA 1JTEA 2B9EA 4DMGA 5K0JA 3ELYA 1TW3A 3JWHA 3DUWA 4CXMA 3FPFA 4CTKA 2DPMA 1NW3A 2YR0A 4PIPA 2GPYA 2Q41A 4QVKA 2YUIA 2QRVA 3EVFA 3UJ6A 5EMJA 4KIFA 4BY9E 5EIFA 2PGXA 4MIKA 3DXXA 4L7VA 5CVVA 1NBIA 4AZSA 1DL5A 3DTNA 2Y1XA 5BXYA 3SXJA 4P58A 4GOMD 3VYWA 5FQNA 3FPGA 3OPNA 4DCGA 3HM2A 3UBTA 2NNWB 3NVKI 3E05A 3ME5A 4MQ4A 2AVNA 2PVCA 2P40A 5CVUA 5E9QA 4RX1A 5HIIA 5HZMA 3DMHA 3HCEA 2G1PA 2ZTHA 3U81A 3PFGA 1XJ5A 4QVGA 5E2BA 1L3CA 1NV8A 3EVGA 1I9GA 3IYLW 4PYQA 5DXAA 5ICEA 5CD1A 2BM8A 1MJFA 1ZGJA 4DQ0A 3B3JA 2FRXA 3M6WA 2LD4A 3TMAA 4PONA 1RI2A 3EVAA 1JSZA 2R3SA 3BT7A 1N7IA 5D1NA 1HMYA 3CC8A 3NWBA 3GU3A 5CM2Z 5BP7A 3DULA 2E5WA 3EGIA 3KR1A 3MCZA 2PWYA 2PJDA 3GGDA 4E32A 2DULA 2BR4A 9MHTA 2IIPA 3HVHA 8MHTA 3EVBA 1YB2A 3JWGA 5CCXA 3QOXA 2GAFA 1JG4A 1X1AA 3ELUA 2AOTB 2IDKA 3R3HA 1O9GA 3HVIA 5GOZA 5T67A 3RW9A 1NV9A 1RJGA 3DR5A 4FT2A 2EJUA 5LQCA 4ATNA 1VIDA 4HC4A 3KQSA 2ZW9A 5CIYA 1QANA 4IWNA 4C06A 4BLVA 5EVJA 1TW2A 3HA5A 1INLA 3PT9A 2PX5A 3NWEA 1KP9A 3AY0A 3I9FA 3CJTA 2GH1A 2IP2A 1RJDA 2XYRA 3JWJA 5E8RA 1AQJA 1G6Q1 10MHA 1VLMA 2JHPA 2KW5A 3HEMA 1Q0TA 3P9CA 4PYKA 1F3LA 2CMGA 3P2IA 4XUDA 5ERGB 5C0OE 1KXZA 1R8YA 3M33A 2YQZA 3MTEA 5HEKA 3TM5A 1VPTA 3TR6A 1OR8A 5EQJB 3G2OA 3I58A 4QPPA 1BOOA 2VDUE 3PX2A 4EKGA 4UOEA 4KW7A 3SSNA 5F2NA 5KQRA 1WS6A 1YFLA 5HILA 4A6EA 1NT2A 2JG3A 3UFBA 3E7PA 1L1EA 4R8SA 2VDVE 3LBFA 4GC9A 1DUSA 3EVDA 3MTIA 3G8BA 3KQWA 2GLUA 3HCCA 5F2OA 4JXJA 2G71A 2HNKA 2IGTA 3KR9A 4PYNA 1WY7A 3OE5A 4PYLA 1X1BA 2C7QA 1NBHA 5EG5A 2JH9A 2WK1A 3Q87B 3R6TA 3FUWA 1JTFA 3L8DA 2FHPA 5DXJA 4C05A 3OFJA 5BW5A 2PSSA 5DTMA 2P7IA 2XYVA 3OE4A 2CWWA 2WA2A 5DRYA 2Z6AA 2P3LA 4OQEA 2I7CA 4F86A 1QYRA 2VP3A 1ZG3A 1NE2A 5DSTA 4OBWA 3UJBA 2OZVA 1WZNA 3EGEA 4C04A 3P9NA 3HNRA 2H00A 5E9JA 3OFKA 5DX1A 4M36A 4QQKA 5EOVA 2HV9A 3HTXA 3HCAA 2B3TA 1I4WA 2OO3A 2OB2A 2QY6A 3EGVA 3IEIA 1YZ3A 2AR0A 2EX4A 3DLCA 1EG2A 2UYOA 1NW8A 3B3GA 4GBED 3UJDA 2PKWA 3KPWA 4FT4A 4PGHA 5EPEA 3UJ9A 3ELWA 5ICGA 3QV2A 4U7TB 5K8VA 1RI5A 5K0BA 1L3IA 3FUXA 3H2BA 4LWPA 5HIJA 3T0IA 3KPUA 4FZVA 3M6XA 3KQVA 2FK7A 2I6GA 3B3FA 3C3YA 3LDUA 4MTLA 1YUBA 1UWVA 3R0QA 4Y30A 5CVEA 1JSXA 3PX3A 3UA3A 4GOOD 5FQOA 4FGZA 4A6DA 4F85A 2OKCA 3EVEA 4M7RA 3ER9A 2H1RA 4QDJA 2NXNA 3C6KA 3LDGA 3G2QA 3THRA 1M0EA 4YUWA 2BM9A 3GCZA 2OXTA 3R9XB 4RTKA 2IDJA 1G55A 2PX4A 4PCLA 3FYDA 5GP1A 4LECA 3KU1A 1EQAA 1FPQA 3LDFA 1IM8A 3LX6A 5CUQA 3SVZA 2QRVB 1JR4A 2AVDA 2B2CA 3FPJA 3KQTA 4PYMA 1ZHFA 5CVDA 5FCDA 5FHQA 3UWPA 2C7RA 5EZSA 3T7SA 4GOLD 2B25A 3P9KA 4RTMA 1KIAA 3B7PA 2CMHA 3DMFA 2BH2A 4EVIA 2GS9A 3M6UA 4R05A 2CL5A 1JQEA 4QTUB 2C7OA 2AZTA 2AN3A 4OBXA 5LQKA 3DMGA 5LQNA 5EEHA 5FADA 2O06A 5T64A 2AOUA 4WVLA 3ID6C 3FRHA 3K6RA 5DLYA 2IFTA 3UA4A 1G8AA 1RI3A 3G5TA 2IH4A 1KPGA 2IBTA 3AXSA 4PYOA 3PTAA 3NVMB 1R74A 4E70A 2PLWA 5K0LA 4O29A 1P1BA 1WXXA 3OZSA 3OCJA 3TPZA 4YUVA 2PT6A 3FTCA 4YMHA 3O7WA 3LCVB 2PXXA 5KVAA 2AN4A 5K03A 3K0BA 2PY6A 3IHTA 3HA3A 4DF3A 2GB4A 3HP7A 5H02A 4M38A 1MHTA 2JHCA 2HMYB 2ZIGA 3G7UA 2YX1A 4RTRA 1G60A 3SSMA 3T7TA 1QAMA 4AZTA 1FBNA 3M6VA 5F2KA 2N47A 1P39A 3GO4A 3CCFA 2AOXA 2G8NA 4IV8A 2BR3A 4P7FA 5EMMA 2ZZNA 1NW5A 4XCXA 1VQ1A 3C3PA 3MERA 4RVGA 3A7EA 4GEKA 4WXHA 3BKXA 4KIGA 4XUEA 4E2ZA 3FTEA 4LG1A 5GIPE 3LPMA 4X63A 4DKJA 4RWZA 4QDKA 2O57A 1VE3A 2OB1A 4BLWA 3R24A 4NECA 1RI1A 3LSTA 3E8SA 4CKCA 3DLIA 1PRYA 5FA5A 2ZCJA 2YXEA 4E30A 4GOND 1D2GA 4YV1A 3HA7A 3LCCA 3CGGA 5U4XA 3G89A 2B78A 1YZHA 4GC5A 4PIMA 3GXOA 2ONYA 4OQDA 5EHIA 5BW4A 1L3BA 2BZGA 5IH3A 3EMDA 1VP9A 4CWAA 3EEYA 4RTSA 4KDCA 3X0DA 3TKAA 1L9KA 3OU6A 5DM4A 4AUKA 3VC1A 5HIKA 4YV0A 2ZIFA 3GRVA 4FSXA 5EKUA 3ORHA 2ZIEA 5DTRA 4OX9Y 4HGYA 5EEGA 2AOTA 3G2MA 5G02A 2P1DA 5EHGA 5DPMA 2IH5A 3JWIA 4PGGA 5FUBA 5LQAA 3ANXA 3P8ZA 5EC8A 3EEOA 5LSAA 1U2ZA 2PT9A 1SUIA 3SM3A 5JR3A 3PFHA 1WXWA 3KPYA 5E1MA 1BC5A 1X1CA 3GNLA 3NJRA 4AX8A 4BP3A 5KYGA 5C9ZA 2AS0A 3NMUF 3REOA 4FR0A 3THSA 5ICCA 2UYCA 3PLAE 1SG9A 4OA8A 1G8SA 1FP2A 3LBYA 1JG3A 3HCBA 4ZTBA 4QTTB 3GJYA 3D2LA 2O0LA 3DP7A 2PX2A 3B89A 5EZQA 4K6MA 3PS9A 3FTDA 2YXDA 5K0GA 3HCDA 1KPHA 5EKXA 2V7EA 1SQFA 1ORHA 3C0KA 3LCUA 5LQUA 3SX0A 1KPIA 3GRRA 4PINA 1XCLA 3P2KA 4HTFB 2PXCA 4YV2A 3EVZA 4MHTA 4U7PB 2UYHA 2XBMA 2XVMA 4RVFA 2P35A 3KQMA 5LR6A 5CCBA 1NW6A 4HRAA 2ZVJA 2ZFUA 4PWYA 1KYZA 5E8JA 2ZLBA 3G5LA 3GDHA 3TLJA 3SR4A 4E31A 4EQZA 5K0FA 2QE6A 2VZ9A 4P7GA 1Y8CA 4V0RA 1KHHA 4B17A 5E9WA 3BUSA 2VS1A 3GRUA 2PBFA 3GRZA 4C07A 4PNEA 3LGAA 3BWMA 3MAGA 1YF3A 2ZZMA 2BR5A 3HCFA 4FP9A 1N7JA 1RJFA 4RTQA 3A4TA 3ERCA 2NP7A 3HVKA 5IKMA 3MCTA 5E1DA 1M6YA 1I1NA 2ZWVA 1RI4A 2QYOA 4G56A 2AOUB 5K01A 5CVJA 3P9IA 2R6ZA 5DRTA 5C1IA 4ER0A 1SVUA 5ICFA 1XCJA 4EKIA 2I62A 1XVAA 3NDJA 5K05A 2ERCA 3TQSA 3FTFA 3WSTA 3AXTA 1VP3A 3PB3A 1YFJA 2FYTA 4X61A 3UJ8A 1XDSA 1ZGAA 3KQQA 3DOUA 4HSGA 4RTLA 4IV0A 4RVDA 5FTWA 4XUCA 1SUSA 1V39A 3HVJA 2K4MA 3P71T 5DM2A 4CTJA 3BXOA 3F4KA 1FJXA 4MWZA 1N2XA 2JH8A 3GWZA 2Z6UA 2P8JA 3CJRA 3UJ7A 3A27A 3KQOA 4E2XA 4GUAA 4HGZA 3FUTA 3KKZA 3AWIA 2P3OA 4M37A 2ONZA 2IH2A 2IPXA 4X60A 4DM3A 1P91A 2YTZA 3OU2A 4YUXA 2EFJA 1JQ3A 4FSDA 3KR0A 2F8LA 3NTVA 3TKYA 5EGSA 5HOQA 1SKMA 1NW7A 5DX8A 3T7RA 3FPHA 5DM1A 4C4AA 1QAOA 2Y1WA 4RYLA 4RTNA 1H1DA 5P8WA 3B5IA 3OZTA 4Z2YA 1FP1D 2PXAA 4Y2HA 4EK9A 5K09A 3S68A 5EMLA 3BKWA 4RTPA 1F38A 4E33A 4ISCA 5FWDA 4RVHA 3BZBA 1BKYA 3SGLA 2AOVA 4P7KA 4IKPA 1JG1A 4KVZA 5GM2A 3NW9A 4ER7A 1ZKDA 5LQRA 2CKDA 5M5BA 3NDIA 4C03A 3GIWA 1KYWA 3BWYA 3FRIA 1O54A 4FS8A 4HH4A 2O07A 4X1OA 3G8AA 5HIMA 3V97A 1UIRA 4BP1A 2A14A 1EJ6A 2G72A 3O31A 3MHTA 2NYUA 3KPJA 1SQGA 1WG8A 5FWAA 5GWXA 1DCTA 2XVAA 5DT2A 3KR2A 2PWPA 4LWOA 2ZZKA 1QZZA 3A26A 3TM4A 1KR5A 2EG5A 4KRGA 3M4XA 5DM0A 3CKKA 5DX0A 3OZRA 3OU7A 1ZQ9A 2ZBPA 3PVCA 1JG2A 3FPEA 2ORED 2HTEA 4KDRA 3TOSA 2FPOA 1JQDA 4PCAA 5KQSA 4F84A 5DSXA 2GA9A 3LHDA 5EIWA 4PYJA 2ZULA 5GINE 3V8VA 2FCAA 5E2AA 1PJZA 3DH0A 1R00A 2P7HA 3CVOA 2O05A 3UJCA 4H0NA 2WA1A 2HR1A 4C08A 2IBSA 3TFWA 1D2CA 5B1SA 5EMKA 7MHTA 3UZUA 1IY9A 3M70A 5DWQA 2ZSUA 4YUZA 1UFKA 1VBFA 3RIEA 5K0CA 3RODA 1VL5A 5FA8A 3SSOA 3FUUA 3GRYA 5T6BA 3VSEA 1X1DA 5E1OA 2HWKA 4EMSA 1AV6A 1EIZA 4CKBA 2NXJA 2P41A 3BWCA 2NP6A 4CKEA 3DXZA 4R6XA 4RSRA 1B42A 2V74B 4ER5A 3A7DA 3FUVA 3MB5A 2YXLA 2AOWA 2PX8A 1R18A 2JHAA 3A25A 3EPPA 5E1BA 3LECA 4PYIA 4ER6A 1XDZA 4DCMA 4QQNA 2NXCA 2AN5A 1P1CA 4E2YA 4DZRA 4RTJA 3AJDA 1AF7A 4P7JA 3I5UA 4X41A 2UYQA 3Q7EA 2C7PA 2Z6QA 4AZVA 3ER8A 2QM3A 3EMBA 2OBFA 1AQIA 5FULA 2VDWA 3KPVA 4R8RA 3FYCA 3P97A 5GM1A 2UZ4A 2OYRA 3LKZA 2OY0A 3CBGA 5K0NA 3MGGA 4R6WA 2OPBA 3I53A 1X19A 5FHRA 1R8XA 3LL7A 3TRKA 2H11A 3I64A 2PV0A 2ZBRA 3E23A 1D2HA 5HFJA 3QOWA 1ORIA 1XXLA 3BWBA 1IXKA 4YUYA 4GF5A 1HNNA 1RJEA 3P2EA 4GQBA 1BHJA 3ELDA 5DTQA 4AZWA 2ESRA 3FZGA 3KHKA 4RV9A 1M6EX 4ER3A 3O4FA 2FK8A 3BGVA 3KQPA 4KWCA 4POOA 1G38A 3CJQA 2ADMA 3EVCA 4QPNA 5D1HA 4YMGA 4DA4A 5KS2A
chains in the Genus database with same CATH superfamily
2WIKA 5D87A 3DXYA 2GN0A 3VOSA 4E2WA 3TB6A 3OWHA 1JHOA 1OILA 4V0QA 5DEOA 4CBVA 2CVPA 4BXOA 3BGOS 4IIBA 3H3FA 4N3BA 3T3OA 2YVLA 2NZUG 3D8UA 3DTTA 3EZ9A 5KAMA 5K1ZA 2RGDA 3OE1A 1YU6A 3CUUA 4DTCA 5MHTA 1FE8A 1KO8A 2HJGA 3KKPA 4Q21A 5TVGA 3S2UA 2YOGA 4ZVPA 3ZW9A 3AUTA 1CUAA 2WWWA 3NOOA 2QM0A 5PGMA 4LFCB 3EDQA 1BEUB 1U0TA 1U81A 4ENUA 2ZJ7A 4PPQA 3BJIC 5E6RB 3JWHA 3WZ2A 5T4HA 1L5YA 3OTIA 1U1EA 1TQDA 4RA6A 3GP3A 1JS1X 4PC6A 3M7IA 5CXUA 2ZTUA 4UBOA 3WS7A 4GL2A 4NWIA 2ENUA 2QUHA 2B4AA 3FZYA 3OX1A 2QV7A 3PSAA 3AX6A 4WZZA 5L95A 1NBIA 4UBNA 3Q6NA 1PL8A 3DMDA 3RG8A 3TUZC 3B2QA 5EJMA 1P0PA 4ZVTA 3DBRB 3WGVA 3JZIA 1VLQA 4LVCA 2RGRA 2GERA 2CE7A 4Q03A 4FBMA 4JA2A 1R0RE 5GONF 2GJ4A 4EA7A 1OBOA 4Z1OA 1L3CA 4JBNA 2RHHA 3H9BA 4WOJA 3RGGA 2A88A 4QBGB 3FLBA 3H13A 2OG1A 2WYIA 4V0MA 4UTRA 4HDQB 2B1IA 3JQAD 5IZCA 5AO9A 1JKJA 1HUQA 4QPCA 2JJMA 2W2KB 2VPPA 4Q24A 3TSYA 4FK8A 3HUEA 1WW3A 5JBIA 5LYYA 2RJNA 1JSLA 3H17A 2B5VA 2PJDA 4Q39A 3AVXA 2E7ZA 2R5FA 2XNKA 3IVRA 3W6OA 2W0SA 2IIPA 2HXSA 3H8WA 5DNCA 1FFXB 2MYPA 3LQ1A 6AT1A 2QD5A 3GL9A 1QQ5A 1E2PA 1JG4A 1V3TA 4JJFA 3ON5A 1O97C 1T4CA 3GLIE 4ED9A 1RJGA 3AUKA 2WILA 3DR5A 4C01A 5CDSA 1QONA 2QR3A 5ALIA 1EGAA 3QWBA 2KLBA 5HKKD 2QUAA 3ASYA 3GVIA 4MRMA 4NESA 4P0TA 3LLVA 4KC0A 1U80A 5CIYA 4GR5A 3ZN2A 1W49A 5F7OA 4FKBA 4C4SA 5D01A 3TW8A 1QRDA 4LMAA 3DNMA 1TVEA 4MVJI 4FYMA 3GFVA 5TQ2A 3S28A 4NXMB 1L7BA 3A3PA 3CJTA 5EIBC 2H2GA 3CW2A 3ZQJA 5E8RA 5HKOA 3OG9A 3RBZA 3D8NA 2PZKA 3BRCA 3TRDA 3UAYA 1CKEA 3A8TA 2LW7A 4R01A 1BMDA 4QO7A 2AHRA 1VFPA 4LHZA 3SFTA 3IL2A 4JP8A 4BVHA 1JHRA 3K9BA 2GETA 4RDIA 3UKDA 4KW7A 5J40A 2PTGA 2EC5A 4NL4H 1FLAA 4BQFA 4A6EA 1VMAA 4XRRA 4JNKA 3HXMA 4MGZR 5HQJA 4X8OA 3FH0A 3FVRA 2VDVE 4PM4A 2XZLA 4I3GA 4U6QA 5EPOA 5AJTA 3WLKX 4ZDJA 5FOQA 4JXJA 5G0VA 4XWAA 1PNRA 4NYIR 1VI5A 3GJRA 3QVGA 4D3FA 1X1BA 1AMOA 3DSRA 1FVHA 2GGSA 3E9YA 1N6RA 4N6OA 3TZBA 3WXBA 1UDWA 2YQ5A 4MZDA 3TK1A 3KEOA 1KO1A 3UT6A 2WA2A 2VJLA 2V6BA 2VPZA 3TL6A 2PU7A 4PSAA 3U80A 3ZE9A 1NP7A 2QSJA 3I0ZA 4EELA 4ZJUA 3DT9A 4TXMA 2G9RA 2C98A 3ONNA 4PGMA 3ZZ1A 2Q0QA 4QLOA 4C4TA 2VKQA 3KKNA 2SHKA 4QQKA 1W4CA 5EOVA 1ZUD1 3FSGD 4MKHA 5EIHA 1PEAA 5TARA 4CKXA 2XODA 1T36B 4Q7QA 1ZR4A 2QY6A 4PPGA 1CYEA 1PCXA 2HKIA 2RH8A 4H1HA 2R6FA 4ROTA 1Y8ZA 1VE5A 1WETA 3KPWA 1Y1PA 2YWRA 1KDOA 3WHIA 4RMGA 4ZVNA 2Q2OA 2R1VA 5A04A 1J07A 1QV6A 4R2LA 5K8VA 4G9GA 1ESZA 5HIJA 2QPOA 3ISVA 4MR7B 1P4SA 4P5PA 5JAIA 2AW5A 3RKRA 5AVYA 3WDKA 2YMLA 4BGDA 3SS7X 3LC2O 4HPXB 1P0FA 4KHZA 5I3CA 4Q1FA 3T7IA 2X6RA 3EVEA 3IOCA 5GMOA 1XJWA 2QVCA 3Q2OA 4NU0A 3G2JA 3LQYA 2QAJA 3PD7A 3U4GA 1YB4A 3CLUD 1Z16A 3GZJA 3UUWA 4EUHA 5IVIA 1YRBA 5D6NA 1RHJA 2PBLA 3B7WA 3LWZA 1LXCA 1R0KA 1EHYA 3FPJA 4N82A 3DS8A 5KTNA 3H1EA 3EXIB 3GLHE 3IAM6 3VBCA 3ORRA 3T7SA 4X65B 1KJWA 3D7NA 4IOKA 4RY0A 2XUIA 4MS3B 3B7PA 4KIWA 4YT5A 4H77A 3DMFA 3NUZA 5JTUA 2GS9A 2V54A 4N3NA 1ZVJA 3PRJA 4G25A 3RJ9A 1A4IA 1GEEA 4TV8F 4QECA 5LQKA 3IEVA 2GZHA 3DMGA 3DFUA 1RYBA 5LUBA 1WQ1R 1WB4A 5BPFA 4A0SA 2PD6A 3FRHA 4UTVA 1UOPA 5HUQA 3HE3A 3FNRA 1HI9A 3D3NA 4L76A 4IO1A 3T3DA 2BPOA 3EH1A 4CG2A 2I03A 3C70A 3SS8A 2VHJA 1TKBA 1PLLA 4O29A 2F1IA 1BYIA 2HXGA 2WTUA 3KSUA 4IDFA 1ONNA 1VZ3A 2BGTA 3Q3HA 4M9UA 4MJXA 4UHCA 4F4FA 5C1BA 1QHGA 3N74A 5BOSB 4G1FA 5F76A 5DNWA 2IV2X 3SDZA 2IXFA 4EWLA 5HK8A 1N2BA 3ZTYA 3Q41A 1O0BA 3PZRA 3NOQA 4L0CA 1F2TB 4CMJA 4EA9A 3DE6X 1GU0A 1NQXA 2HCBA 3IMKA 2Z8YA 3PUIA 3JQ9C 3B1KA 1QGOA 2FGJA 2ZUEA 5JZBA 4G86A 3UXMA 4AZTA 5C5IA 4LTDA 2GM3A 3GGOA 3UWMA 4DDMA 4LYJA 1B3BA 3KTDA 3QEKA 3ZVRA 1SXHA 1H2HA 1FFSA 2QDKA 1QIFA 4FEEA 3TX6A 3QHAA 5L8VA 3CT4A 4NBWA 2VH5R 3NHAA 3ZHYA 1H5NA 1OYWA 2PL9A 2OVFA 2RC6A 4ASUD 1UJ6A 1X8LA 5J5AA 4HVLA 2CV0A 4DPLA 1RM5A 2CLDX 4PN7A 4TXNA 4YHBA 4JC8A 3FJ1A 4L8VA 3RSOA 3VDMA 5IULC 4D79A 2Z5FA 2O8VA 1C30B 1JDBC 4GRIA 4JB2A 1EZZA 4GOND 4D5GA 1GZ3A 5FPSA 1OLXA 4PPFA 4ES6A 2B94A 5IT4A 3HBNA 2VUTA 1CQJB 3STHA 4B4DA 4PIMA 4DA6A 4DUYB 3RWBA 3A4VA 2WJ6A 521PA 1TEVA 4NCBA 1ZSNA 1L3BA 3DLHA 2VNIA 1DAIA 4ITUA 4MULA 1ZU4A 1RRFA 3PGVA 4JJGA 4Q37A 1Z12A 5FOTA 3WLLA 3C8MA 1L4FA 2DOKA 2FOLA 2N9UA 1W5EA 3Q2IA 3SHTA 5HIKA 1KYXA 1UOEA 4ZYZA 3KE9A 1KKUA 2AMVA 4R1LA 1ONPA 4C2BA 3WLEA 1AB6A 1SURA 1KORA 3FTEA 3C41J 3O2QB 4WFJA 3K9FC 1THMA 3KDSE 1AH2A 1T0BA 4BCBA 2AKEA 3ZHRA 4PZDA 3N05A 2J07A 4LF5B 2C0CA 1UBRS 4ITVA 1FZQA 2JD0A 4OUKX 3KD3A 5F1PA 5JJKA 2BM1A 4TKMA 3ONWA 3T4UA 4ZTZB 1QR2A 1XCGB 4WKOA 4EW3A 4AKEA 1M7BA 4O4LA 1P6XA 4OJTA 1LLDA 4QJ3A 3SR3A 1NMQA 2FA9A 3BFXA 2ZE8A 1M54A 1PKEA 5LNK6 4WN9A 5F5XA 1ADFA 4DCVA 5I9TA 5L3SA 2SNIE 5A4FS 1E7RA 1T6BY 4P86A 4WA8A 1CZNA 1E18A 1Q7CA 4KVGA 2SBTA 1QH1A 5EWMA 5FI5A 4YI5A 1VE9A 1QCYA 4OQ4A 2C7GA 2ZS8A 3ZJ4A 4F9GA 1HBJA 4H7IA 4I50A 1XAHA 3CX6A 3W5UA 3M8KA 3WYDA 4YRDA 3U48A 3V00A 2P35A 2QD4A 3DW1X 2GCOA 4TV9B 2WSBA 4Y2VA 3OQMA 3RBVA 2VF2A 4WRRA 4E88A 5A4AA 1IAVA 3QEMB 3T9CA 3BD9A 1U9JA 5CLGA 1BQ4A 4YCLA 4EY3A 3PPYA 4E31A 2C96A 5L4LA 5K0FA 2ATIA 1HT1E 3WP0A 4NX2A 2JKYA 3R44A 3AK4A 3FX2A 4KWHA 4HEQA 5HM6A 2WUFA 2JLSA 2ZSFA 1UK7A 4PANA 1CRZA 1F0YA 5CT8A 5DSZA 5CFPA 2PRZA 2EBFX 3IC5A 2ZYAA 3CLHA 2ZJOA 2PJZA 2PD3A 4XIIA 2E21A 1OJLA 2BJWA 1XI2A 1TA0A 2QRGA 1E3LA 4AL4A 4HS9A 4HGNA 4TS1A 5DZSA 1PP4A 3LY9A 2DWPA 4HD8A 1O6GA 1M5UA 4A4DA 1PR2A 4R1SA 1O94A 4DXHA 3CUVA 2AUNA 4RDCA 1FSSA 2AQ8A 1FUEA 3FR8A 1SUSA 2F4NA 2CUTA 3HVJA 3OZEA 3OZAA 1S3GA 2IHVA 5BSRA 2VTKA 3BBPA 3JALB 4X6UA 4MOWA 1K7EB 4HGZA 2CZGA 2FXIA 1PFVA 5THKA 3TDNA 4TZKA 1KI7A 5K3BA 3C16C 3W7BA 2OCDA 1E9CA 4XOUA 4TQAA 2YTZA 3EX7C 1NQTA 1E0AA 2MT9A 2Q3BA 2BEVB 3Q9NA 3HO1A 3AP1A 3QVWA 4TM7A 3FOFC 3T4PA 2NTJA 4RYLA 4BV2A 1SUDA 4DLYA 2BTEA 2VPWA 3B5IA 3OZTA 3WV4A 2O7VA 4LF8B 3OQ1A 3GP5A 4IKEA 5EMLA 2B0CA 3OWOA 3ZXIA 2VPQA 1KH2A 3LP5A 5FNVA 1NOJA 3HB9A 4NU8X 3QIVA 3PQ4A 4O2LA 5HKLA 2JJ1D 3ZW8A 1UXIA 3MF4A 2AOVA 2ZREA 3D8RA 3E9RA 4ZO9A 1RRGA 3V2IA 1VA4A 3OCXA 3PUXA 1SVIA 4P4TA 2P4EA 3CNOA 4IJMA 1DBSA 4TTTS 4PLGA 4JYCA 3C7DB 1H69A 3CF6R 5BR4A 1WU7A 3JASB 4GI5A 4ZCLA 1EK5A 3RSLA 2O07A 4X1OA 2X8JB 1DARA 1ZVQA 1ZI6A 1Y4UA 3AIOA 5FIUA 2C61A 1UIRA 2OGTA 2ZRAA 4KQ1A 4TUYF 2A58A 5EE5B 3IVCA 4P36A 4LX0A 4I6EA 1T25A 3MHTA 3T0FA 3SYTA 2O23A 1Y8RA 5FYDA 2AYXA 1XQXA 4WOBA 1ZFNA 4Q01A 2QN7A 2JGJA 1VJ5A 2J33A 2QROA 2UAGA 1PHPA 3CUWA 3PEFA 2I80A 2WQ7A 5CH5A 1WUKS 4WOCA 1UT8A 3L7NA 3TVDA 4BB0A 1CJTC 1ZQ9A 3AVVA 2XVZA 1B73A 1K5GA 3KJZA 4MAMA 4W63A 5BSEA 1I7SB 3PC6A 3TOSA 3EZGA 3EUAA 4YDHB 2Q99A 1VB5A 4PQYA 2BRUA 5IVPA 1QQAA 1R5OA 1NP6A 1OROA 1X77A 2P79A 4HUTA 3QXSA 4EJ0A 2CXTA 4F84A 2A94A 1CVRA 2H31A 5FAXA 2RC5A 4MRNA 3V4VB 1WMAA 1Z28A 2ORYA 3RSSA 2JJ2A 5BN5B 3ZJTA 3UTDA 1D2AA 4JBLA 1MHPA 3T1HB 3IA7A 1COWD 1QQTA 3F2IA 3TFWA 3I73A 5J3JA 1WHTB 1UDAA 4X20A 1EWVA 1F5NA 2ZSUA 4DLRA 1KAOA 1TA9A 1TM7E 3PIIA 1PUXA 2YJNA 1CNEA 4FTWA 3SSOA 5JC1A 3FNHA 3ZC3A 1DTSA 5JFTA 2ZVQX 4B73A 4YMWA 1Q17A 2IA5A 2P9TA 3I62A 3NVDA 2XTJA 3E9ZA 3OZXA 5D6OA 3W90A 4F6RB 2BW0A 3CQ9A 1CUUA 3CKMA 3KB1A 3QU2A 4EJMA 1Z6QA 2YXLA 5JS1A 1XHLA 3MUOA 4GSLA 3K5HA 4Y2PA 4LF6B 2PA3A 4N39A 4INAA 3IE1A 4UAVA 1BDHA 4QQNA 1YL7A 1E2NA 3Q3GE 4JQZA 4JUBA 2GFHA 1RE1A 1AUVA 1GCAA 1RLJA 1U8FO 4HQFA 3GLFE 3F9IA 4R7ZA 3RWMB 5TGDA 1AQIA 3K71B 1F6BA 1NYRA 2FPXA 3FGPA 1DQSA 3EW7A 3K94A 3OOYA 4J3JA 1EBUA 2JBAB 5C8YA 2E0IA 1ZIXA 2XBUA 2O2YA 2WM3A 2FE4A 1DXYA 1K7XB 4M99A 1ZM4A 4EHDA 4AYWA 1TCBA 2BAGA 4YT2A 2UZAA 4KMOA 3TPCA 4K0KB 2BGGA 1ORIA 2R4QA 1NXPA 1OWOA 2V3WA 3JZAA 2J0EA 1T2VA 4ZOAA 4YUYA 4M6WB 1HNNA 3B2EA 4MITA 5ELLA 1SIOA 1DBRA 4BLRA 4NATA 2W98A 1YR6A 2C9BA 1E96A 1NI4B 4RPGA 5REQA 3BGVA 4LY9A 4ZV7A 5LFAA 1VIVA 2H85A 4UQOA 1PR6A 4XFDA 3I2IA 5AKYA 3ICCA 4JUIA 4BQQA 3NHSA 2P3QA 1C0KA 4HYTA 4TPKA 3QWIA 4PXAA 4TVKA 4E2FA 3PQ8A 2RB5A 1N2OA 4JUCA 1M0TA 4BYGA 4UC0A 2AA3A 5KTOA 4J94A 1ZMRA 2INGX 4KGVA 4H18A 1VJ0A 3IA2A 3SEQA 3CR7A 3RNOA 3ZWCA 5L3VA 1XOIA 1TFRA 1KXJA 4BZWA 4DBLE 2NU6A 2GZRA 2Z1MA 3I05A 2HADA 3GNQA 3ANTA 3C5HA 3KVOA 2GSWA 4BFTA 2CVOA 2J9ZB 1IHUA 2P62A 2W48A 4OJYA 3BGDA 3MQ2A 4TL6A 4E12A 5FWXB 2P67A 2VQ6A 3AM1A 1Y1LA 1X13A 2HO4A 3FPFA 2Z3ZA 4GUDA 4ND2A 4OHMA 3RVKA 4BNYA 3ZJUA 3L6RA 1E64A 5H81A 2YFYA 3RYIB 1AT1A 1FMLA 1T6NA 1UPBA 1E7SA 1WB6A 1Y34E 4JIGA 1DEOA 2B83A 1MB0A 4HVTA 3QELA 4NE9A 4B9EA 4HEHA 3VYWA 4WY8A 3LZDA 1RR6A 2YZNA 4V0ME 2ECFA 5NULA 1DCMA 2W7TA 3DMHA 4QVIA 2XGJA 2O52A 1NV8A 4PYQA 4RF2A 1USGA 3OHSX 1JDBB 1QIJA 3UJNA 5B57C 4B3TB 1R6UA 2BFMA 3PNPA 4F96A 1E2LA 3DR3A 5IJ0B 2QTVB 2QN6A 1HMYA 2RJ3A 3G6KA 4ZEWA 2QJWA 1Z06A 2Q29A 4J0HA 1A9PA 4LRQA 3VR1A 4ZCQA 3LDAA 1AHPA 9MHTA 2HZBA 1WUTA 2XB9A 2ZYDA 4EY8A 4HDCA 4ZDIA 4RFLA 2CKMA 1TM5E 1VLLA 1MX9A 1UKAA 1V45E 1O94D 1QVWA 4S04A 3FCAA 5T4BA 5J58A 2EF1A 4PR0A 5A2QA 1BCSA 2EJUA 4DEXA 1H1LB 2AXPA 3QXJA 4PLFA 1MTOA 2B9VA 3I6ZA 1G1MA 3PQEA 1QANA 1C7FA 2C1EA 3BE5A 4UJ5A 1TJYA 3NWEA 4BB5A 1NW9B 1PW5A 1K8QA 3IP1A 2VH1A 4ITRC 3X1ZA 4Z0TA 3BZUA 1DJPA 4U0KA 4YMUA 3Q8MA 1DE0A 4IHJB 3UMMA 3ODGA 3S27A 2WFMA 1RXSA 2JCGA 3MZ0A 2E6UX 3HEMA 2YMMA 3O8OB 4JBWA 3DOJA 4IXWA 4ZT4A 4J3NA 1AZSC 3E22B 3P2IA 4ZI7B 1O0CA 2LVBA 5C0OE 4Z7JA 1HTTA 5LBUA 4Y7CA 1QFSA 3ZBPA 4K9MA 2WZQA 2RD2A 1JDSA 3IQFA 3Q0EA 1AKNA 5I9MA 4E09A 1G3QA 2FP4A 4FBGA 3TYXA 5KNDD 3I61A 4F06A 1XMJA 3KS9A 1PDWA 5B1IA 2H2AA 2X77A 2IF2A 4R2WA 2ZDGA 3CEJA 4KE9A 2CSXA 2GRJA 1EEXB 5I6DA 5AM0A 3M1IA 5ES4B 4K05A 4QU8A 3TIVA 2BMFA 1ODJA 1OY1A 2DECA 3PXUA 2FFJA 4NMXB 1ZHOA 1SVWA 1V5WA 2X13A 4XQEA 3ZGVA 1YRYE 1JWAB 2H1FA 3A1TA 3EPJA 4N1AA 1YI1A 1J99A 2O2XA 3KYDA 4Q9NA 5IAJA 4ARZB 3G8CA 5A6VA 3EXEA 4MK4A 1A7UA 4WI1A 4LXXA 3HC7A 1HEIA 3UGQA 4IX1A 4IS3A 3ZWMA 5L7WA 2OMEA 1SXJA 2H17A 5IG2A 2Q5OA 1EH5A 1HTWA 4BRSA 4DWVA 2GN2A 1NWHA 3EDRA 3ROKA 3ZHTA 4EOGA 4CGZA 2XUQA 3TLXA 2PGLA 1ZN2A 5FPKA 2OORC 1EUCB 5HS6A 1DV2A 1F2UB 1I4WA 1ZS9A 2WG0A 3UF0A 4DNPA 7AT1A 4DR5B 5B37A 3HJHA 4KLAA 1Y3CE 4AS3A 3CH6A 2ZCJA 2PKWA 2A7XA 1Z7WA 3GQBA 4IF4A 4DM7A 2YWXA 1N1EA 4CG3A 1P6QA 1HF3A 4J2TA 1KBOA 4D0NA 1J70A 4H3SA 1SAYA 1TAUA 4WA7A 1GQ2A 1V11B 1YACA 3DE7X 5F3DA 3HUFA 5BWOA 2J7PA 5LMNB 2OHJA 2OUKA 4GOOD 4F85A 4D9GA 3C6ZA 3H2ZA 3HXPA 2NXNA 1TIPA 3THRA 1O3YA 1X9HA 4QLAA 1E5QA 1PZMA 2Z5GA 5CT9A 5DXFA 3OJXA 4JI1B 4AF7A 4DUPA 3EC7A 1IK6A 1XUOA 1H9BA 1FDSA 3KU1A 5KHLB 1NYLA 2BDUA 1TKRA 4PSUA 3KQTA 3FN4A 1QGAA 2JIZD 1Y42X 4M0PA 2QSUA 4E51A 1PHRA 1UBFA 3P9KA 3BXFA 5CH3A 3R9IA 1E92A 1EFRD 5IMSA 2QXUA 1C9JA 2A0WA 1IN5A 3NHFA 3DPIA 3PXAA 3D3QA 1CEQA 1HRKA 1WTAA 3E82A 3GYBA 1UEXC 3NYIA 4X6LA 3VGJA 1ZC4A 3FMFA 4OBXA 4RD2A 1PGPA 2Z2IA 1CZUA 4ND8A 4OMFG 3UXEA 1AUOA 1K88A 1U5CA 4WVLA 3EBLA 5P21A 3K6RA 3WNCA 3LPLA 1JALA 1YE5A 4FGUA 1VRWA 5J59A 1AO0A 2DFKB 4OHZA 2PFGA 1H2BA 1H05A 1X7XA 2YKGA 1DKOA 3ZV6A 2K6GA 4CUJA 1MH9A 1MEEA 4NICA 5JU6A 2ZSKA 3IDAA 4L28A 3I8OA 5JDIA 4W1QA 1MKYA 1WE2A 4XXHA 4TTPA 5ALEA 1E1RA 4C9BA 2PXXA 4I55F 1OHHD 2C9YA 2EKDA 3RC1A 3HU3A 5BN1A 4WVFA 5J2TA 4UD2A 1WCIA 4D74A 4EM6A 3ZWXA 1RXCA 2RG1A 1GPAA 2DKNA 4DPKA 2GN9A 1U28A 2BMJA 2Q8QA 1M1XB 3NWPA 5IJZA 5KNDH 1XPRA 3H9UA 3RRZA 1C4KA 3K2BA 2GI4A 4ZP1A 3OHPA 5AM1A 3K9HA 4CMGA 4RQBA 3ACDA 4XCXA 1VQ1A 1LPOA 5HE8A 4WLEA 3SFVA 2VYND 4FCVA 1XA0A 4QXAA 3KOXA 1TO1E 3IMCA 2XUPA 1MMFB 2WWTA 4LHEA 4MQFA 2I91A 4GMFA 2Q1WA 3B60A 1I4TD 3ZZUA 4CKCA 4HAUA 4UXHA 5JCOC 2J3QA 1CJKC 3BIWA 2A78A 2XEDA 3AESA 3WK8A 2FI1A 3KBOA 4PLZA 4ML3A 1P62B 4ZVMA 3R8XA 3T94A 4IWXA 4U1RA 4PZLA 4BVAA 4JV5B 4GICA 4W9NA 3HABA 4KDCA 3WNQA 3O8RA 4M9XA 2H4ZA 2FMTA 2O8EB 1I8TA 2ZJBA 3V80A 1YGPA 2FEPA 2VJBA 2Y9MB 1SK9A 1Z2CA 1Y7IA 1GV0A 1M2OA 4Q47A 1Q1GA 5I7RA 4AN1A 1V1JA 1N6NA 2ERYA 3BFVA 5CAEA 1C3OA 1U2PA 1ZAYA 3QFTA 1WZUA 3ADKA 1HPLA 3I2YX 2AJBA 4RK1A 5JLAA 5DTEA 5FBQB 4EP1A 2O8FB 4OQYA 4FGJA 1KZ6A 5IVDA 4IJ6A 3WIBA 4D9BA 2R1TB 2PZBA 4LF9B 2KX7A 1SCNE 2FFQA 3MMNA 2XECA 4KXQA 1RYFA 4QOEA 3GEHA 3UKJA 4D9CA 3PLAE 3WGQA 4G63A 2CSUA 1OAOC 2JLQA 1B1AA 2IVFA 2LKCA 2GCNA 1LPBB 4RQAA 1DELA 1MEOA 3MXOA 1FFAA 3AEKA 4OP2A 1X9IA 5IN5A 2PQ0A 1KC3A 4R84A 1RXIA 3U26A 3W8DA 2VJMB 4AIRA 5BV8A 5EFOA 3DZJA 1DUVG 3JQPA 4KIUA 5FPPA 5DYWA 4EZBA 2HJSA 5LQUA 4AY2A 3ZDBA 5ECDA 4HTFB 1P33A 1YGYA 2PXCA 3NDRA 4PBSA 2J67A 4TVSA 4UUQA 2UXCB 4F6LA 2V4MA 2VDNB 2ABWA 1HC7A 2DSTA 3D7KA 4IDQA 2EFGA 4Q4JB 3VVLA 3L8FA 3AL3A 1N6PA 2V96A 4U00A 2GYWA 4C88A 4GNRA 3IERA 4G5YA 4P5EA 1KU6A 4LC0A 1BMFA 1OAAA 1BXGA 3BUSA 2VS1A 2Y1GA 2QP9X 4RWEA 3I12A 2PIAA 3BORA 3H5WA 4RFVA 4MUJA 1CDOA 3SN6A 1VYVA 3V1MA 4YJDA 5I9NA 3TTSA 2H1WA 3NTUA 2YIJA 3T5TA 4GR4A 3L0DA 1RYNA 1CUVA 1QLJA 2GWHA 2J0UB 1O03A 3UATA 5H9VA 2R6ZA 5FBRB 3ZLTA 1K4KA 4CT4B 2DXIA 5TC4A 1KJZA 3R20A 1E6LA 4U6SA 3JQBC 4B3RB 2R7AA 2FR1A 1ZGAA 3KQQA 2P65A 1Z3IX 1PVVA 4FFRA 3OCZA 1AQUA 3AJAA 3TRJA 3IR7A 4DADA 5SY6A 3RUHA 1H22A 2QBYB 1TJ4A 3GWZA 3L84A 5KYGA 5IT0A 1UUFA 1D09A 4QUJA 1KO4A 1W6UA 2VLBA 4LOLA 3CRQA 1TJNA 3NBYC 1N0WA 3O8QB 2QQ0A 4OHXA 5FL3A 3T7RA 5BVGB 4W8HA 1QSGA 3GUZA 3WIEA 2CF5A 2ZPUA 2OZPA 3A6DA 4DQLA 1YBFA 3TNJA 3IVAA 5J63A 1KDYA 1FP1D 4GYKA 4RE6A 5C5CA 1JQAA 1ICIA 1NR1A 2HUPA 1J24A 1E1MA 4A23A 3L7MA 4R83A 3H1TA 3QLEA 2BHRA 4DILA 3DO6A 1N6KA 4BJ3A 3DT6A 2FG7C 1Y1SA 3QMWA 1YVPA 4KOEC 3L4BA 2JAQA 2ZTSA 3CR3C 1Y81A 5LMCA 1W75A 1Z18A 2CLCX 2PZAA 2ZRQA 4M76B 4TROA 3FKQA 2HB6A 2IYWA 2JIBA 3MB8A 3BWXA 5A9SA 1G66A 1E3WA 3VI3B 1EFPA 3VPDA 2Y8EA 1KSFX 2HK8A 2JIDA 3OEYA 4J0EA 4RF3A 4BO6A 1T5OA 4CT5A 1A72A 3FWNA 3T5AA 4ESEA 1WMEA 3HM9A 1EMDA 4DIKA 5B5SA 3QVJA 3TRIA 1NPYA 4PWZA 2PUHA 4RYDA 2VTBB 1ZJ4A 1RLIA 1U2GA 4DS3A 1JPNA 4Q3LA 4KQ9A 1GQYA 4TM8A 2EKPA 3WWYA 2PX0A 3HCPA 3I6YA 3EBOA 1IXSB 2FWMX 2JAUA 2UZIR 2W2XA 4G4SO 4KGZA 5BSTA 1H4SA 1JHVA 4MW4A 1CLEA 4FR2A 1QV9A 3HADA 1NG1A 4TXJA 1P8AA 1R7RA 1EVEA 3IIEA 1IOWA 3PRKE 1P18A 3ANNA 2LDXA 1CUJA 4TOIA 4EB6B 2ODQA 1CDEA 1OYOA 2WNSA 3HRKA 3FHJA 4CKWA 1JJAA 2DCUA 2VQFB 2ZULA 4MHOA 4P08A 1U8AA 2BGNA 1ACJA 3RAEC 4DLPA 2BUCA 3CVWA 3LXRA 5COBA 5EIOA 3OMXA 1HKUA 1R6DA 1RU3A 5AW7A 3NIFB 5KNCH 2C20A 1PFUA 2NZVG 1QO0D 4O5AA 4O8ZA 1UKYA 1WHSB 3KKOA 4HN4B 5AK4A 3IO5A 3N2GB 1FVFA 3L9WA 2O3QA 3G49A 4BCCA 3WB9A 2OLEA 2GPTA 5HBGA 5DN9A 5KYWA 3L6OO 4EHNA 1XTJA 4DJEC 2WJPA 3EZLA 1DTWB 4XGQA 5IRCD 3L0IB 1Z5UA 2A9FA 2A0FA 2QSZA 1W4AA 3IAXA 3JXEA 5AW2A 3HYSA 2R00C 4KO2S 4CHGA 1QTIA 3VFDA 4DZRA 4IH9A 2HU5A 1G7TA 2FEKA 3LC1O 1IN8A 4HX5A 2V3VA 3F78A 4H0CA 1WDLA 1L4GA 2W5UA 2FZGA 4JX9A 5DYIA 2I7XA 5LIPA 5GZ6A 1Z5VA 5E95A 3JATA 3K2EA 1SCQA 4IYJA 1AG9A 4K3VA 3BHJA 5AM3A 4WFQA 4UE6A 3EDCA 1QE0A 1R4AA 2Q8PA 4M88A 5AIAA 1JVSA 1AJEA 3LL7A 4YQEA 4CIXA 2HF2A 5TX7A 4D96A 1UWKA 4Q0MA 1OYVA 1GNPA 2J5XA 3E9MA 1RFGE 1ZD1A 1CUWA 1JVNA 1HNWB 4KJXA 3CH7A 3ZHQA 3KHKA 4W5RA 1SXIA 1A9TA 4K8RB 1Z34A 3TCNA 1D9ZA 3H2HA 4J7AA 3BTVA 1ZMXA 1C4OA 3T5BA 2AJTA 1QH9A 2EGGA 4J0IA 2GO1A 5AW8A 5FV4A 4N8SA 1VJTA 2OO7A 2ODNA 1E79D 2VYCA 3B1VA 3K53A 1RS0A 4HX2A 5LP6C 2QMQA 4G8BA 4YRMA 1KEUA 1TD1A 2CXQA 2Q07A 2O2CA 3FVTA 3RJTA 1QFYA 3AB8A 1EX6A 1P5HA 3TW6A 4U7FA 2I1QA 3HVUA 4BEVA 1H85A 5DNUA 1KRXA 1CUXA 1P9LA 1USWA 1A0OA 1YXMA 4LC1A 1ZC3A 1G64A 4QNRA 5DP1A 1QAQA 2LCIA 2AR9A 1GAQA 4QYIA 1UJ2A 5HX7A 3OQOA 2R751 3VPSA 3HWSA 2IWRA 5A6SB 2NG1A 1Z83A 1AMNA 1Z4LA 1VKZA 2Z2KA 1KOGA 4HSEA 3OTGA 4EITA 5J4KA 1OB5A 1I4EB 4C2UA 4F5ZA 2EATA 1YR9A 1ZDMA 3DEJA 3NIDB 3KQUA 2WHXA 3KYCB 4G2TA 2GOYA 1Q1NA 3Q10A 1P1KA 2BTOA 4H17A 4TV8A 2QGZA 4Y2TA 1DEAA 1HE8B 3EFOB 3UBTA 4X45A 2PVCA 2ONKA 4KL8S 1ODKA 1BRTA 1R1DA 3HCEA 3AOEC 3CNQS 1GNVA 2FPGB 3EVGA 4BNDB 5L51A 3MWLA 5AM2A 3NGMA 2BM8A 1PS0A 2Z08A 4QXRA 1E9VA 4PGFA 4JQYA 1BN7A 2FRXA 1XMOB 1CX9B 4WPGA 1HK7A 3NGXA 1KEPA 4YCCA 5K6AA 1JSZA 1JBEA 1MO3A 4MJ7A 3BT7A 1LLUA 2G83A 2WJ4A 4D8TA 3GU3A 4BGUA 3EGIA 4TYWA 1AXEA 2P0EA 2OC9A 1Z4MA 2G7ZA 2ICAA 4L27A 4F2WA 4B2YA 3HL0A 2NSLA 5DCLA 1K2WA 1A4XA 1XTKA 4CR6A 3QOXA 1NNUA 3M5PA 4JSTA 3BIOA 1O9GA 1RE0A 3OEEA 3ZDCA 1O87A 2YBDA 4HDSA 3ILHA 5KYUA 1I4OA 2YY7A 3BYZA 5FR1A 4CEJB 1EFTA 1AGPA 1DC6A 1VI2A 1YO6A 4L95C 4DIMA 1CK4A 1MOPA 4IH1A 4JQCA 5HZGA 4XR9A 2VF8A 2BMEA 1T0IA 4R3WA 2LPMA 3P4UA 2BBSA 5JAPA 1W85B 3L7CA 1DIBA 4RMHA 121PA 1IQRA 1FYVA 5F78A 2XDWA 3FOEC 2AB0A 3WTBA 5I8ZA 2HSGA 1BHQ1 4DCTA 4LJ9A 2WF9A 3OX4A 3O74A 4JT2A 4BX8A 1N7GA 3M6MD 4Q48A 5LJLA 5EY5B 2V1UA 3G9UA 5EQJB 2E5LB 4DXAA 3RFTA 4D4KA 1R8JA 2J31A 4MEAA 3HSKA 2VSOA 1A50B 3HKCB 4BMZA 1CDDA 5HILA 2C2GA 3BVPA 5FI1B 1L1EA 3L02A 4MQEB 4FFSA 5AVQA 3TMYA 1SWWA 3VR3A 5JECA 1VHLA 2Z58A 1VG0B 3OHMA 1JI3A 4DY6A 2JJYA 4Y2UA 1NUSA 4M8SA 3PSHA 1YQEA 2D1QA 2X2EA 1Q7EA 4ZMRA 5DN6D 3LYAA 3HJGA 1SXJE 3L8DA 4NS1A 1U7DA 3OFJA 3H83A 3B1XA 1U6KA 2ZR7A 4GFDA 4A27A 3TLGB 2JFGA 2B6HA 3WIDA 3AI1A 3IAFA 3I6BA 3ABIA 2OZLB 1PZFA 1YZKA 2QJRA 2ZETA 3M0EA 3VTZA 2Q6TA 2V7TA 2J6CA 2DY0A 1JR3D 4NVRA 1WZNA 4CFYA 4BB9A 4DWJA 2HHHB 1NQVA 3PEEA 3H18A 3CSDA 3P2JA 2WLTA 4JFRA 5E2IA 1YRQA 3RAPR 4ZYYA 5KYTA 3DEAA 3I52A 1J6UA 2OO3A 4L16A 4ND6A 4OU4A 4F92B 4JVSB 5K6RA 5BSKA 1LWOA 2AR0A 2UYOA 3TSAA 2N3ZA 1LX7A 1WL8A 2BONA 4XGIA 5AR1A 3WMRA 4ENPA 3P0EA 8ATCA 1FS6A 4GAEA 4ARSA 3NETA 3FUXA 4JEMA 2PYIA 2XTAA 3U3KA 5BUQA 2XWSA 3EW9A 3WAJA 4OREX 2Q9CA 1SOAA 3M6XA 3K1AB 1AA6A 1ZH2A 4Q9AA 4CIDA 3JWPA 1BGWA 1K9SA 1PGJA 3DPSA 4MI6A 4BAGA 1OC2A 4RSMA 3C8UA 2BSQA 3IAM1 4R0NA 5AI9A 2VP0A 4RL6A 2A0YA 3EA0A 2BC9A 4OFXA 4EG4A 1SO8A 1GTZA 3PA8A 3PDCA 5BSUA 5JZSA 4BAUA 2O5CA 3R9XB 3PHIA 1H2YA 3CX4A 1N5MA 2Y0DA 3EQ8A 3HP4A 1EK6A 4EB0A 2B2CA 1VPVA 2F3PA 4JLKA 1WEHA 4RS3A 2CK3A 5EZSA 2XUFA 2F3QA 1SUFA 2I4MA 3HKDB 4IY1A 4PZYA 1OT3A 1OLUB 3Q72A 1YTUA 4RFSB 3Q7PA 4G0WA 3VR4D 3J81A 5AVKA 2DHQA 4IMJB 1T4MA 4OSEA 3W6ZA 2RGYA 3LG2A 4LK3A 2OXCA 3ZHCA 4AO8A 4B2IA 5K6TA 2PV7A 1IDOA 2ATEA 2EWWA 4NZMA 4X1KB 4R5MA 5LPNA 5BVHB 2QTZA 3S70A 3HZHA 2FTKE 4OATA 3CCBA 2XOKD 1VYHA 1G8AA 3FVQA 2ACVA 1NBEA 3K5WA 1M34B 4LRUA 2BEWB 3ZX5A 1C0LA 1LCIA 4PYOA 3RT7A 3V8QA 3H87A 2FZLA 5DASA 4RMJA 2OCYC 1G8GA 4HV4A 3SLRA 3FCUB 3MQFA 4XE5A 1PL0A 5EP2A 3VSCA 5JEEA 1LLCA 3FBGA 1IUKA 1KZ1A 4MXDA 2J3EA 1UKEA 3QA9A 4DF3A 3DHYA 2D4AA 5A5FA 2PWAA 1L5OA 3ZE2B 4RF5A 2DETA 1E7YA 4GPTA 2DKFA 3OP1A 1E1CA 1XD2A 2HMYB 1DBVO 4D98A 1RLUA 4E5MA 5B4UA 1I2AA 4P54A 3BXZA 4JEUA 3EIFA 1ZCFA 3R0XA 4MA0A 2X42A 4EO9A 4H2DA 3TJRA 3D81A 4EI7A 3R41A 3JZMA 1WD7A 5ICMA 3T3EA 3N8IA 3IAS6 4IILA 5K0TA 1Y5RA 4XPIB 3JQGA 2OCIA 1NU6A 2PYZA 3OVMA 5JI2E 1G3IA 2PFSA 3FJOA 3ONVA 2P90A 3ZQKA 2EV9A 1O95C 2PPVA 1FU4A 2RK6A 3FM9A 3OUTA 2HBZA 4MVJG 2O57A 1M8GA 4YH1A 5D7NA 4DHEA 4JLVA 3KFLA 4K46A 2GF2A 3G2IA 1XZ8A 3R3WA 3UAVA 1ZIYA 4AKTA 2CDBA 2QY9A 2HW8A 3NATA 1M2HA 2I6SA 1CR2A 1ZJZA 3B8EA 4MZXA 4RESA 4XWTA 1LDNA 3RFUA 2I1WA 4YXFA 4JASB 1W59A 5CPBA 4AJ4A 4MO9A 5B1EA 1YQQA 2PKXA 2F17A 2VZ0A 3R8CA 5MF6A 5DM4A 4M87A 3SBEA 1AKYA 2X7JA 2GJSA 3OM1A 4BVGA 4YV0A 1ZONA 2P0AA 1E5DA 2E85A 2WYUA 4WERA 3JQFC 3OZCA 5CNMA 1YE8A 2F7SA 3D3WA 2AOTA 2QVGA 2YFQA 6REQA 4CLXA 1H65A 3H1PA 2RB4A 4MROA 1K86A 2B35A 2FWJA 1RZUA 1UFVA 5FUMA 1FVOA 1PX0A 1QHFA 3OD5A 1E2FA 3PDIA 4IXDA 4Q00A 4UHHA 5AKXA 5LNK1 4CM4A 2W22A 1I6KA 1L5HA 3UW1A 3U4HA 2JLCA 2Z1DA 3K0CA 3EMKA 2O3TA 2VUIB 2XI4A 2OFFA 3NMUF 2RONA 2Z8YM 3EDMA 4QNNA 2CNWA 4UEJA 1L8AA 4W1SA 3EAQA 4WESB 4YROA 4AMYA 2CDNA 3FFBA 2VZ8A 3QJGA 4N6NA 3QSYA 4Z4IA 4WJLA 3O6VA 1Z0SA 4BQNA 4GP6A 4E7OA 3C24A 2LV8A 4NCAA 1JG7A 4FOOA 2Z3WA 4I9UA 3H11B 5FOUA 2DBZA 1P7PA 2XZTA 1E6WA 1FFBA 2JAXA 3RVBA 3KVYA 3OJCA 3PIRA 4NG4A 4AX4A 2PGJA 1U5BA 1BS9A 4Q7MB 3TKLA 4CM1A 5BYKA 4AYXA 4HS4A 1F0NA 1JU3A 3DP9A 4MS1A 1HFWA 3U7JA 2XB8A 3D7SA 4CN9A 5LP6B 1CIVA 3AEQB 2QG4A 3H1BA 3ZY4A 4F4UA 1P29A 1U3GA 5JH7F 1JHAA 3KOOA 1XKLA 2FW0A 4KKXB 3P9QA 1D4AA 4NBNA 3KD2A 1O0SA 1U7ZA 3GPCA 1WU8A 2OWEA 1NIPA 1OGIA 2J9FB 4RD6A 4FOLA 1FDTA 5CJPA 5CEJA 4PNEA 4JEIA 4UE3S 1OD6A 4YQZA 1HYBA 1P19A 2IZZA 3O75A 3V7YA 4A91A 4X3OA 4FP9A 1N7JA 4DC1A 4NR0A 3AL2A 1KVSA 5ALDA 1M6YA 3W06A 1KMHA 2PLAA 3TNYA 1L7OA 1RI4A 2ZWVA 3IELA 3JR7A 4X00A 2C4NA 3CINA 4LE1A 4V1CA 1UPFA 3D4BA 3BE6A 1ST3A 4IMPA 5LMZA 3AGPA 4FGWA 4Y9TA 4ZVKA 4DV4B 3T54A 3D2CA 4BUZA 2X14A 3HKBB 1VC2A 5CDYA 2CLSA 1IMOA 2B4RO 2W2VA 3NYWA 1XRSB 2ZWOA 5LQMA 4RD1A 1OXUA 4HSGA 2GMWA 2WZDA 3WLMA 4BMXA 4BQRA 5ER9A 4DCNA 4O4JF 1UOOA 4GVXA 2O14A 2R68A 3Q9UA 4JODA 4NONA 1JU4A 1NE7A 1U1IA 2FEXA 3KUUA 3MJCA 4DMUB 4ZYWA 3EG9A 4Q4CA 5B7GA 4Q1CA 2CYBA 2HSZA 4J0DA 3E4DA 2XMRA 5DDIP 3RSZA 4NNJA 4U7GA 3W6PA 5ARCA 4LHWA 1QPGA 2QQ5A 1NLMA 4FVTA 4WQMA 5HGJA 5CVTA 4TYYA 1RPAA 1H9AA 3GFTA 1ND5A 3D02A 4OJKA 1UH5A 3NAGA 3C14C 2F8LA 1FX0B 1TKAA 5HOQA 1GL6A 3OQNA 1H3FA 4HLUA 4PQGA 2DB3A 3W8FA 4M9SA 2BTQA 3D6MA 3JYOA 4I08A 1XNGA 4G4JA 3VKVA 1L4MA 5SZIA 4HNAA 3L07A 2BFEA 4INOA 4QD3A 5B4VA 5K3CA 5K09A 1BEEA 1IVYA 3ANMA 1YFKA 4C2AA 2PGDA 3A0UA 1F38A 2QXTA 3PDUA 3FMPB 4KK4A 4RVHA 2CF6A 4QZVA 5IFKA 4U7WA 1GDTA 2XMDA 3NHPA 1JLMA 1IE3A 1LQ2A 2QT9A 3F7NA 5CURA 4DLVA 3H5RA 4PF1A 3S55A 3L1JA 4V0KA 3WHKA 3H5NA 4AG5A 3C87A 1NIJA 5K2MA 4B5KA 1S2MA 1GR0A 1CFZA 4UM8B 4C03A 1I4LD 2X6TA 1ZW1A 3DLPX 2AV6A 5C8ZA 5B4TA 3T5PA 2WHPA 3VPCA 2XA9A 1BFUA 4MS4B 3R5KA 4UTZA 2WG2A 3LT2A 4CZ2A 4MI3A 4BP1A 4PY2A 5FPHA 1JQBA 4FOPA 1WB5A 1GUDA 3LOUA 4M3NA 3WKBA 2DR3A 3ND7A 4BO0A 3QF7A 1SQGA 3M9XA 2Z2ZA 4PBTA 5GWXA 3FOBA 2CLKB 3KNZA 4FD2A 3THXA 2GBLA 3X1YA 4BDTA 5JATA 5KNBA 1CULC 4EPWA 3IE0A 2N42A 2XCRB 4P83A 2G9VA 3P52A 4KRGA 4KXFB 2Q3LA 4Y6RA 1TM2A 3UT5B 5A7HA 2GPSA 5ESWA 5L7YA 1N33B 2YWHA 1I6MA 2ANBA 5EJGA 2EVWX 5E9AA 1VMDA 1T9KA 1YRAA 2DC1A 4BNLA 1DKPA 5A3VA 4C20A 4PCAA 1H23A 1LF0A 1G20A 4BJ6A 3I4CA 2IU3A 4TYQA 2ZJ6A 4J91A 4Q4AA 4A7PA 4V0NA 4MO2A 5H4HA 3C3JA 1S8AA 4PC1A 1BDIA 1W4BA 2C4MA 3RC2A 5IK2D 1SCIA 4H0NA 3COSA 1PF7E 3K0AA 4JOBA 3EXG2 5FTLA 3SVTA 4CEIB 1HV8A 2ZSAA 3BK1A 3CLUC 4KFTA 4UHEA 3RODA 2WOJA 4M1QA 1ADYA 4B34A 3OQBA 4GH5A 3B6IA 3U1TA 3NCTA 3BB1A 3AHJA 2B5OA 1QHNA 2WUWE 4MI1A 3ZKWA 3ZDXB 3GVXA 4EPRA 5EJ4A 1VGVA 2DU8A 3OURA 1GGEA 5CH8A 2O7QA 4B3IA 2VSQA 2ZSDA 1OFHA 1CTQA 4GR9A 5JNVA 4LJYA 1JHZA 5TQ0B 4D43A 4MKFA 1P1CA 2NU8A 4C22A 4D4MA 1BD3A 1L7XA 4ZO8A 3HU5A 1I9CA 3ILVA 3PJGA 4KLZA 4PEVA 5DK6A 2NSYA 4M0MA 2HYIC 2SECE 1J7KA 1RTKA 1U0EA 1BE6A 2MSDB 4GKAA 4M53A 4OB8A 4MWSA 4BIMA 4JYBA 3PC7A 2LIPA 4GMGA 3CONA 4NJOA 4Q3CA 2FLVA 4L72A 3I53A 2FMHA 3PFBA 2VDPB 3VNRA 1TYDE 3WI7A 2WU8A 3I01A 3I1IA 2O0MA 1CB7A 1QO9A 5DYNA 4WIAA 1IYZA 3I4LA 3PRHA 4KX5A 1D6MA 4LNUA 5HFJA 3RIYA 4YMVA 3A2KA 1SD1A 2I2FA 2JCBA 2C5EA 2Q6IA 2QN3A 4KHPB 3FPCA 4L7QA 5DTQA 4AZWA 4D02A 4NBSA 1ABBA 4LKOA 8AT1A 2I6FA 5KOJB 5JAQA 1D8AA 3PFIA 2FK8A 4KWCA 3JQ8A 3IMEA 3M4YA 1FUYB 1HT3A 4A8HA 4BGVA 1NJSA 4ZT2A 1G38A 1K8RA 4YPFA 2JD2A 4U4AA 1KYIA 3MPOA 3IQIX 3M4JA 5T3UA 5KS2A 1E58A 3IR5A 2MSNA 5FEUA 1EM8A 3VC2A 5C52B 3GJ4A 2ZE5A 3CEAA 1X0VA 3IUSA 3LO5A 4JDPA 4O1HA 3RHTA 2I71A 1IUOA 4JI6B 1YDEA 2CHQA 4EFMA 5FX2A 2PE5A 1ABFA 1GAWA 3DZCA 2IY9A 3OX3A 4MVJP 1Q7BA 3SXPA 4BATA 3E3OA 4C7VA 3RIXA 4DCCA 2ZYGA 2O2GA 1KEKA 1G6KA 2A0KA 1FU7A 2OEPA 2ZSJA 3KOYA 3KQYA 3NIWA 4P33A 1CWUA 1R27A 1WSAA 1ACMA 3QX3A 5JROA 3K31A 1JTEA 2RGXA 4ICIA 4X3CA 5CTAA 5EHNA 5C7IO 1GZDA 1YSCA 4QFDA 2IPMA 3CIFA 4KZPA 3DV2A 3W2TA 2JGFA 1YB7A 2GXQA 1GUBA 4PIPA 3VR5H 4M21A 1HY3A 3V2GA 2QRVA 3UCXA 4A0FA 2LNDA 4NXNB 1VJRA 3T95A 1VCOA 1UQRA 1XC7A 4G07A 1LDEA 5FOWA 1DL5A 1CHNA 2Y1XA 3DDUA 3HDYA 3LY5A 4EG0A 1QRUA 1XMXA 2WZCA 3O84A 2P8SA 4CMBA 2QX8A 1L8LA 2HPVA 2GYVA 1Y6FA 4TLCA 1FLNA 5AM5A 5IAOA 5A4JA 4S35A 2PUEA 3LW8A 4BY9E 2QLMA 3IYLW 4NBTA 4UEOA 5CD1A 2G0TA 3KLPX 4KB5A 3JARB 5IZCC 1QYWA 2AG0A 4W5TA 4RGVA 3HBJA 2FR8C 4MPPA 2KS6A 5H59A 3SBDA 4BOYA 3RKSA 3GG2A 1W0CA 2VAWA 5CFLA 5D1NA 4EG7A 2WF5A 4B3XA 3WY9A 3OO1A 3DULA 1R9JA 3CSSA 3KR1A 1F14A 4I55A 4JU9A 4R98A 2XDYA 3UN1A 2ZRLA 4P4GA 3HDVA 4AJLA 1QG2A 2YJ5A 4LAFA 3AKEA 3VV3A 2JLVA 2B61A 2PZGA 3KJEA 4PAMA 2JVIA 2NNLD 3TVYA 3T34A 2GKOA 1L7VC 3UAXA 4ZHQB 3GPLA 2BSAA 4IBOA 5BYJA 1PYGA 4ZDKA 6NULA 1U2TA 2PUAA 3GFOA 1ZMTA 2B1GA 5BSVA 5BW8A 2XCTB 4F71A 2D4HA 2HDHA 5G1PA 4GHWA 2BOVA 1PEYA 3WKDA 2O19A 2WSMA 1GFIA 3ESCA 4CM8B 3VH1A 3P5SA 1YJBA 4IZ6A 1N75A 4ME6A 4RVCA 4UE2A 4URZR 4Z51A 3DAGA 4ESOA 1BCRB 3A0RB 1D03A 4NOLA 4F46A 2GZAA 3QI2A 1XXHE 2OCKA 4BGIA 4D82A 3E7WA 4YT4A 1BD4A 2WT9A 1GRRA 2FU5C 2GUGA 3L82B 4QO8A 3P9CA 5TV2A 5COQA 4MGKR 2QTTA 4Y0AA 4XUDA 2QLLA 5JQGB 3TM5A 1Z74A 2WB4A 2YDXA 1CB0A 4XW2A 3W9SA 4HYYA 1Y7TA 5HIAA 2GPJA 3HNOA 4Q4LA 2WF7A 4G5OA 3RR2A 4J4BA 1YFLA 1V6SA 3MINA 3UJPA 5BRJA 1MB3A 3ZNNA 2GZDA 3G2KA 3Q3EA 4UEQA 4KQ6A 2C4WA 3HCCA 1FVXA 1UBGA 2DBRA 3BQMB 4I2NA 1ZNYA 2HNKA 4PYNA 1YZGA 4Z3OA 1DAHA 1B16A 1TRKA 2D5LA 3AR8A 1LDBA 3IQXA 4C29A 2DUWA 3G13A 2COUA 4ONEA 5AJHA 4RAQA 5DXJA 2OQVA 4LIPD 4N7MA 2WM9B 4E5SA 1WUJS 2BJHA 2LCQA 1P72A 1WCV1 3FFTA 3NS7A 4OP3A 4TZ6A 1M76A 4YJ2B 2VP6A 4ZQFA 4RK6A 5TMDA 1V48A 3Q8XB 2DQYA 1Z7GA 3RS0A 1DAOA 2JI6A 2RH5A 1Q77A 3K73O 3FAKA 3LJKA 2E1RA 1BX0A 2QRLA 2TMKA 3P9NA 4OXXA 5KNBD 1BG6A 4L22A 4R9UC 4RHTA 3ZWKA 2HFKA 2X41A 2XGOA 1NTRA 2XUOA 3JYQA 4KXUA 2NUPA 1RWNA 5FFFA 3UWKA 3U60B 1IY0A 4DRXA 2X76A 1MDBA 2XNSA 3GFRA 3O8LA 4GPZA 4OJNA 2P0YA 5F33A 3UMBA 3DE0X 3ZYCA 4YAKA 4AMGA 3E9QA 1ZN7A 1X7YB 4CUZA 3UJ9A 2WIBA 2IEDA 2F67A 1ZLYA 5EYPB 1JJ7A 4L5YA 4EHBA 1QNLA 1XF1A 1A27A 1J21A 2QD1A 1VLZA 5JO9A 2OHIA 4C0XA 4EHJA 3WBJA 2DLNA 3EGDB 4FYVA 4L75A 4P3OA 4G4GA 3QLTA 2H29A 1OB2A 4FGZA 5I5EA 3VNQA 2VP4A 2PDAA 3ROEA 1XYYA 2JFZA 3N6VA 3OZUA 1QPZA 2GR9A 1F0KA 5FWYB 2NUTA 3R76A 3TSZA 3WSVA 1G55A 1W1WA 3FYDA 3FZNA 5EP1A 4W7SA 5LDHA 1G4UR 4BO9A 2Q3DA 1XEXA 5D3MA 3VKUA 1DBPA 4LRYA 3WL4A 1XLUA 2A35A 3Q85A 4JZKA 4MUXA 3A36A 4F4DA 3I2HA 3UAWA 3ZIAD 5JI3E 1CP3A 2XV1A 3OE7A 3C74A 1I33A 2PMKA 3AKZA 4OKNA 5AJXA 5AWFC 3SQDA 3DZKA 2QOEA 3FGZA 3QKRB 4OXNA 2YL2A 2HLPA 1Y7HA 4NDNE 4UASA 5FL7D 3HB0A 3U7EB 2UVPB 1T15A 1CCWA 3CA8A 3O82A 4KQCA 5FFNA 2ZXUA 3K70D 4D81A 4CDGA 1RQLA 3K3PA 2QORA 3CXRA 4IRMA 3IJEB 3LT0A 1J06A 5JSQA 1S3IA 1X7GA 2J0SA 2Q4DA 3BH6A 5MN4A 1WXXA 3TLAA 5DI3A 4NF2A 2H9AA 4C87A 4DAEA 1RWQA 1IAQA 2HFJA 4HAIA 5ALOA 3A9TA 4S1TA 4UUBA 3REQA 3VDQA 5EJ6A 1ZNWA 4HUQA 1XQVA 3RS8A 5I4CA 3LP6A 2ORVA 2Q3FA 4U3JB 3GLGA 2PUBA 1U63A 1CVLA 2ZJFA 4QAQA 2JHCA 2B20A 5TS3A 1Z2NX 4A6XA 1EZ1A 1P44A 1VPEA 3VRHA 6YASA 2XQVA 1FTNA 2YJZA 1ZUWA 2YCBA 4LISA 2WSSD 4J7XA 1C1HA 4RZIA 4M89A 1WLSA 2N47A 2YWCA 3ROQA 3EWAA 3GGGA 3USZA 2H8KA 2VG8A 2CB9A 3WIUA 1YJQA 4NBRA 1BH2A 3DO5A 4IV8A 1RBMA 1Z7EA 5EMMA 3R5FA 4AXXA 4G23A 2BBTA 2W2PA 1SHZA 5IX8A 3ZE7A 1Q1BA 4RA9A 4HQ0A 3OFSA 2QX6A 4EUFA 5TPWA 5CFZA 1SU8A 4E2ZA 4WCFC 4CMEA 1XMVA 2GJ8A 3QLVA 2DQSA 3ELBA 2I34A 2YXPX 4OQQA 5AXCA 1O5TA 2FY8A 4KI0A 2WIFA 3R4VA 4L8GA 3WLNA 5IAAA 3C8DA 1FRZA 3MSXA 4RGYA 3SFZA 4EQ6A 2C92A 2FMUA 1OSNA 2QE7A 1XDBA 2GN1A 2YNMA 4IEFB 4COKA 2VIIA 3LCCA 3WGNA 1O1YA 3W34A 4AU1A 3KU4A 4BFZA 2WDZA 1MORA 1H8HA 1YIAA 4GC5A 3DBLB 3H7IA 3JQRA 4CT0A 3VVBA 4OXQA 1BW9A 1TNDA 1UDXA 4F9TA 1XX6A 5FEMA 4MCAA 3QVSA 3CLRD 1DKQA 3QY9A 1SKQA 3VC1A 4H3KB 4FKZA 3K6SA 1QLHA 2IHYA 3IMGA 3GRVA 1GTL1 2XMZA 3W1WA 2PMWB 4L3OA 3QUQA 1UP7A 1DG3A 1VDZA 2O2ZA 3NG1A 3QFRA 4PNHA 3L4SO 2XE4A 5JSKA 5DPMA 1V4VA 4MMZB 3GLFB 1D8TA 2B34A 2VTDA 5LSAA 4MDFA 3DVRX 5CG2A 4H3HB 5KKNB 1FMJA 3G9QA 4AKIA 1M72A 1VMKA 1AUQA 3NC0C 2P6MA 2NVUA 4BNWA 3PJDA 1X1CA 1DO0A 2VJPA 5BQPA 4ND1A 2AS0A 5H9WA 2PUGA 2NO6A 2WJVA 2BFFB 2QAIA 3GHHA 3GHYA 2VBCA 3NTOA 3W3AA 4D3SA 1CF4A 3HLKA 4R1TA 3RGWS 3JQDA 3DP7A 2PX2A 3TD2A 1RDFA 1RIFA 1RXYA 1Z6XA 5CB8A 3A2MA 4XWKA 4B45A 5EKXA 1A95A 1ZI9A 1N9GA 3HP1A 2VRWA 1JDJA 3VM6A 5FBHA 4B6PA 4F56A 4V1CI 1VM6A 1D0VA 5ENVA 4BXOB 2XVMA 3EULA 3GLQA 4P98A 4JJIA 1T9HA 5CGQB 3KQMA 5LR6A 4CLRB 1R6TA 2XCUA 2WJAA 4WK4B 3BRSA 1G9XA 4OX9B 3P9PA 1A5SB 2Y4OA 3O2SB 4BJHB 3GDHA 4L4YA 4LKRA 3GBPA 4XIFA 2C4HA 3A70A 5KTPA 2YV4A 3IEXA 4AICA 3BGWA 1S2LA 1P2TA 2X4DA 1LVUA 3LGAA 3E8XA 2LRHA 2ZZMA 1AOXA 3HCFA 1Q14A 3SM9A 1IVNA 4ZT6A 2A84A 3QEAZ 3Q0IA 5IKMA 1C41A 1M2GA 3Q8KA 2WKSA 4K87A 1H2ZA 3ORQA 5T6MA 4BIIA 1BE8A 4KUEA 2XUJA 4YLYA 1U7XA 2P3SA 5HVNA 1F12A 1M0SA 3O92A 4FS3A 1ZXBA 3KLNA 5SY9A 3VAYA 1ZUHA 2ET6A 5AVWA 1PR0A 1O94C 3SLKA 1QRTA 2FYTA 1Z6TA 3CZCA 1IPEA 2WY2D 1LTKA 5B6IA 2H0AA 5LDDC 3CPHA 2OM6A 3PIDA 2EW8A 4IV0A 4KTVE 1JHPA 2GXSA 2HO5A 3ONEA 4PCVA 5JCPA 3K2IA 5DE3A 1RZRD 3OSUA 4DXDA 1BMTA 1JKJB 1YJ8A 4G8DA 4W7IA 1U8EA 3KXIA 1SNYA 4RABA 3AFGA 3KKZA 4HGOA 3RUFA 3OESA 2P3OA 2V9CA 1JDNA 1NI3A 2FWAA 2IPXA 2VPIA 4GLJA 4IGIA 3VO9A 4DL9A 2YHAA 4D0LB 3PEUA 4CTMA 1UM9A 2X5NA 2YHBA 1NW7A 3IPXA 3O4RA 5KB3A 3AF6A 4C4AA 3R7DA 2WUVA 3UHAA 4X8HA 2BD0A 3L1KA 3V1LA 3HYRA 4FMCB 4XX1A 2JZOA 3MLAA 3BKWA 3KOMA 1YR2A 4MRMB 3H2GA 2QTBA 2GPAA 3NBKA 1V26A 4JT9A 4WHMA 2RI1A 2A1IA 4KBGA 3ROZA 3AG5A 4Y6LA 3WLHA 4O3MA 4V02A 4P7KA 1L4UA 4ZJZA 4H1TA 3PXBA 1MBZA 1OUMA 1NMEA 1T8YA 3JQCA 5TQ2B 4JC4A 3SZ3A 2LP4Y 1YVEI 4UVGA 4KXXA 2K87A 5LQRA 3OZWA 2VHUA 3BJEA 4MRPA 3RS3A 3TD9A 1BNCA 1MRSA 1V1RB 1YC2A 4EBBA 2JI9A 1GU1A 5NLLA 4CCSA 1MPXA 1V47A 3IEUA 5HIMA 4NOMA 5AOVA 4YXWA 1KYVA 3V97A 1EX7A 2PT5A 4HY3A 3T1NA 1C14A 4PS1A 5CLIA 1J2TA 2OM2A 1UDBA 3RTBA 2X23A 1CUHA 5CVCA 5B30A 1WG8A 2K2WA 3PRYA 1GDDA 1J9ZA 4KCGA 1Z38A 3NX4A 4NAVA 5KJEA 3EA5A 3HZRA 1U0RA 3Q5EA 4FX2A 4GECA 4XLTA 5GZ3A 5DM0A 4Q9LA 4LXHA 1T9BA 4KSCA 1ZVMA 1G20E 3OU7A 4YRLA 1L4HA 3QVGB 4AULA 1UBKS 3QP9A 3DE1X 3VPAA 3AL0C 1Y9JA 5HBRA 5K3AA 3KZVA 2C3PA 3KEQA 2G1AA 4RJLA 2FF5A 3EY9A 2A2ZA 5KQPA 1Q95A 3JQ6A 3AY7A 3LHDA 4TSKA 4YLEA 3ZXUB 4EVQA 1S2NA 4MW6A 4XGKA 2PVPA 3KLBA 3BB3A 3QKUA 2OKGA 2FPRA 2I8CA 3GZNA 1RKBA 2CLIB 4KXVA 4LVNA 4YALA 5ICSA 1EK1A 3VJMA 5CBPA 1DEXA 1Z0AA 2PANA 3QUBA 4NCXA 2VDKB 1D2CA 2RCYA 3CSUA 3UZUA 2COKA 4A5OA 3CUKA 3N0XA 4AJ2A 2ZSEA 1XZIA 2QM8A 1J1IA 2V65A 5G2OA 3FOWA 4D57A 4C89A 1KWKA 1KF0A 5T6BA 1Q1AA 3KAJA 5JAUA 3HYLA 4IUCS 5HFNA 5K7SA 3CM0A 4CKEA 5CIWA 2G8LA 3DXZA 4Q1BA 1WXGA 1BKDR 1YAJA 3K8ZA 3K0HA 4QXMA 4BMCA 1DC4A 1PQ4A 2H7VA 3PHLA 3FYUC 1R18A 3A25A 4DCSA 2C4VA 2CXPA 3LECA 4RC9A 4CF3A 1Z88A 4RTJA 3LA8A 2MYUA 4G0XA 5BWLA 1KK3A 5BW6B 1GV1A 4Q34A 1DMSA 2ZTVA 4JOQA 1ABEA 1Z68A 4BNTA 5KJ1A 1CUZA 2F43B 1ZESA 2Z8ZA 4IFTA 3JSAA 4FYYA 4GXRA 1ZRHA 4DR4B 4QE3A 2VZLA 4I8IA 4LRXA 3SXUB 5K0NA 1H0RA 3CRNA 3OM9A 3ASUA 4ZYUA 3A6PC 1UOQA 3DCIA 1T5BA 3QUTA 4JWKA 3CW8X 1M8KA 3OZIA 3DTVD 3DOFA 4BLOA 4XB2A 4B47A 4OOFA 1SZJG 3H1GA 3ZIDA 2ZK7A 1WXHA 2DUNA 4CPDA 3FDZA 4LRTB 4P6VF 2F3UA 1Y8QA 1LS6A 2PMDA 2R8EA 4ETNA 1M9NA 1ZWKA 1JDVA 2VP2A 3N7TA 1M6EX 1YJ5A 4JBGA 4B31A 4BL5A 2J5QA 5EUMA 2QK4A 4BO3A 2H1LA 3NUQA 3TPFA 4WGGA 2B1JA 4YIKA 1N2EA 3P9ZA 4FUQA 4ZO7A 1RC0A 3FHLA 5KDDA 3ZK9A 2BV3A 2DT8A 2MJLA 3JQEA 4GWKA 4D4JA 1JPJA 3TZKA 4BBAA 5JUWA 4G3XA 3G88A 2RGNA 2ZUCA 3GJSA 2A9OA 4JMPA 5CYPA 5DV9A 4N49A 2JLYA 3H1FA 4EX7A 2FQ1A 3CLVA 1GG8A 1Q0SA 1IIBA 2YBEA 2HNBA 1TZJA 4KE8A 3BGIA 3ENNA 1MPTA 5HCIA 1R6AA 5BORA 2CYAA 5I45A 2FFBA 3P2MA 3OLXA 5JD6A 1P8JA 1W19A 2B9EA 3TMKA 1QKIA 2H2HA 5I4IA 4FM9A 3H2IA 5B53A 3WQHA 1WBJB 3P32A 3GK3A 2ZIZA 4YMLA 2VAPA 3QY0A 4YNBA 1SBYA 4KI7A 3CWQA 2W6OA 3GJTA 3BREA 1X80A 4JBHA 3H1AA 3A9WA 2RHDA 1F8FA 3K0FA 4I9HA 1L7PA 4I0WB 4L7VA 1T26A 4NG5A 2W90A 5GV8A 4PHCA 5ULLA 3RWOA 3T6KA 3DBOB 4EFDA 5BXYA 2XUZA 5IC6A 4CF5A 3CMMA 4WCFB 3U7IA 4BJ1A 2VNHA 2D74A 2ZRCA 2R4UA 4PLYA 1LDGA 3T41A 2ZUFA 1T13A 2GF9A 4QDOA 1LVGA 3R5XA 2P9CA 1KVRA 4DQUA 3M83A 4CCAA 3ZDAA 1ZJWA 1RIIA 2VLIA 4AW9A 4CGYA 5AVXA 2Q3JA 3MLBA 4D2IA 1U2QA 2RAUA 4N65A 2D2VA 3TMAA 4Y2XA 3AIIA 1I80A 1RI2A 5AJVB 3WKEA 2F8SA 1SMKA 3W2FA 1K1EA 2QMUA 2YY6A 3NEPX 1LNQA 3AUYA 2ZAMA 2YZ2A 2V7UA 2VAVA 4C6RA 3B13B 4MW1A 3QVOA 1IOZA 4M7WA 4QAJA 1QH0A 3R3YA 4ZDWA 1P4GA 2ZBDA 1UFQA 1O57A 3DYBA 3TO5A 1DG9A 2H1VA 1N9ZA 2GAFA 3OO0A 4EGFA 1ENZA 1SC3A 2YJGA 4F1KA 4Q93A 5LQCA 1V5IA 1KAMA 3F97A 5I7EA 3G85A 3H75A 3B6EA 3KQSA 4LX8A 2PSFA 3WGIA 2I2BA 4O4HF 3DV0A 3NNDA 2AJDA 3H19A 4WBNB 2OD2A 3EF1A 2CNLA 1DRUA 1IL0A 3I9FA 3HCWA 1DC8A 2XYRA 4HRYA 4K9LA 3VU9A 1EDZA 2WPDD 1G6Q1 1LPSA 4WN9B 1BDBA 1TTHA 4DR2B 5L3SB 4HXEB 3OIWA 4MJLA 2R6CA 3TOVA 4ZC8A 1QFZA 2HIMA 1S4QA 1ZM9A 2QVLA 5HMLA 3T3HA 1QH1B 5EWMB 2I1VB 3N7AA 3AF4A 3BFPA 2Z9DA 3KAPA 3G2OA 4I4TB 4O1MA 2E82A 1PFKA 1DSSG 3NAMA 1YULA 4HAOA 1ISSA 3X44A 2RH9B 5I4BA 1MX1A 1SHLA 1NT2A 3C3KA 4Q1AA 4MVJF 2GCOB 1YS6A 5FLYA 4JT4A 2VAMA 1TAGA 1Q44A 3UQZA 5JSHA 1E4EB 2G71A 1XZFA 1WY7A 2DWCA 2AKYA 2P2NA 4PGAA 3EGXB 4HDNB 4QREA 5D51S 4EG3A 2HMAA 5T41A 2H07A 3X3HA 3TSCA 2RHLA 3GH1A 1A9OA 3Q2KA 1NHGA 1JTFA 1GGHA 4AJKA 5BW5A 5KNLA 2HT1A 3AHIA 1VGQA 2F1OA 5DBOA 3U7QB 3RFFA 4KWTA 3HJAA 3PGA1 4H7FA 3HHEA 1JFRA 2WAMA 3NGLA 2IRWA 2ZI7A 5F64A 2HU2A 3C1TA 2I2WA 1QMPA 2H5JA 3BDAA 2YJ4A 4OBWA 3AFIA 4OIFA 3BTSA 1N78A 1OXSC 3U0BA 3HNRA 1MOSA 1XDWA 4CM9A 1EFAA 1JIVA 2NWQA 3HMKA 5HRCA 1DO8A 2W8BA 3FE2A 4U2BA 3HTXA 4Q7EA 2R6GA 1PD0A 3NT5A 3PCXA 1OGYA 4CE6A 1LUAA 1O97D 2FP3A 3H5OA 3IEIA 1G3UA 1ULZA 1E3EA 1THGA 1NXTA 3UJDA 2Z4RA 5EPEA 5GQSA 3HH8A 5AW9A 4B85A 2AWOA 2BF4A 3BCSA 3LLCA 3TIFA 2XX3A 5IHPA 1RHRA 3ZW7A 5K0BA 1W5BA 2HBYA 4P82A 5EUQB 5KJFA 4U2GA 1QP0A 1JBKA 2VUHB 1GLVA 1M1UA 1IDN1 4MYTA 4DNXA 1EGMB 1L4EA 3W2EA 1NFRA 4Y30A 5FLEX 4L4RA 2HIGA 3EC2A 1POWA 4HR7A 1SC6A 4MW7A 5JH7A 1I7DA 1M0EA 1DXHA 4FBLA 4YUWA 5MGBA 3ZU2A 2ORWA 1FJGB 4QDTA 4IIVA 3DGFC 1T34A 3IALA 1W0KD 1ZOIA 1NQOA 2NO9A 4R69A 3R5JA 5SV2A 1JR4A 5IPFA 3RTEA 3AERB 3K2QA 5AW5A 2OGUA 4Y2GA 1BS2A 2DRIA 1CEYA 4Q15A 1ZUNB <