1JG8A

Crystal structure of threonine aldolase (low-specificity)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
343
structure length
342
Chain Sequence
b'MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-allo-threonine aldolase
publication title Crystal Structure of Low-specificity Threonine Aldolase, a Key Enzyme in Glycine Biosynthesis
rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 120
structure length 342
sequence length 343
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.5: L-threonine aldolase.
pdb deposition date 2001-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01212 Beta_elim_lyase Beta-eliminating lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1jg8A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1jg8A02
1SFFA 1J04A 3GSBA 3VK3A 2Q7WA 2R5CA 2W8UA 5EAVA 4EMYA 1TOJA 1XEYA 2VLFA 3I4JA 2EZ1A 2AY5A 1ZOBA 2VMSA 2CJDA 2FNUA 1YAAA 1O4SA 3MADA 3HVYA 1MDXA 3ELEA 3NNKA 1WYVB 4W1WA 4WXFA 3AENB 2YKYA 3HQTA 3EI7A 1AIBA 4ADEA 3JW9A 4BA4A 2W7FA 3WGCA 2AEVA 1D7VA 1ASCA 1GDEA 1H1CA 4XEWA 2R0TA 5EIGB 5G09A 3CAIA 4AZJA 1O62A 5J8QA 2VGUA 1TOGA 4ZSYA 4F5GA 2VGZA 1BQAA 4WB0A 5EUEA 3A9YA 1W7LA 1G4XA 1YJZA 3BCXA 2OGEA 2D61A 3MC6C 2WK9A 3PD6B 2G6WA 3QHXA 2OGAA 3FVUA 3FZ6A 5DB5A 2Z1ZA 1MDZA 5EFSA 4CBSA 4ISYA 1CQ8A 1C7GA 4F5FA 1Y4IA 1DJ9A 1LKCA 1YJYA 2E7UA 3DR7A 2BWPA 2R5CB 4JEWA 3KGWA 2OKJA 3AELA 1CQ7A 2X5DA 3RBFA 1CJ0A 2E7JA 3A9ZA 4GE9A 4Y0IA 3DYDA 1S06A 1IVRA 1DGEA 1ARHA 4WYEA 2CB1A 3NUIA 3FSLA 2FN6A 3NDNA 1J32A 4MSOA 4E1OA 4ZAHA 1X28A 2AY4A 3BB8A 4MGRA 2CH1A 3B1CA 4EFFA 4XJMA 2W8VA 1UU1A 3GWPA 3R9AA 4AOAA 2BWOA 3EIBA 4LNJA 1ASBA 1BJOA 3R4TA 1X0MA 1EQBA 1LW4A 2ZYJA 4B98A 1I48A 1AJSA 4OTLA 3BS8A 3USFA 3ZRQA 2BI1A 4BHDA 4E3QA 1H0CA 4A6TA 4RM1A 2W7GA 4K2IA 2ZUKA 3KKIA 5IWQA 3B46A 3II0A 3QM2A 3JTXA 4HF8A 4ZSWA 2YKXA 4Y0DA 3NTJA 3AOWA 1WYTB 1WKGA 4IXOA 5BJ3A 1PMMA 3DRDA 1KKJA 2W7DA 4ZWMA 2W8WA 2W7LA 2BIEA 3PGYA 4P7YA 1I41A 2DOUA 2CJGA 2FQ6A 4WYDA 2VMRA 2DGLA 4WP0A 3UWCA 1E5FA 2HOXA 2AY7A 2D7YA 1ELQA 1ASNA 4DGTA 5DJ1A 3W1HA 1GC3A 1IJIA 3QBOA 3NYTA 4TN4A 1PG8A 2CY8A 2W7JA 1V2EA 1ARIA 3EZSA 1BW0A 2EGYA 1W7MA 3N5MA 3CQ4A 3COGA 1M32A 3AEOA 1M7YA 3LY1A 3OP7A 2CTZA 1X2AA 1AMAA 4K2BA 4PIWA 5EUNA 3OKSA 4LW4A 4A0GA 1IAXA 3BCAA 1OXPA 2BYJA 2FYFA 1QZ9A 4GEBA 5D5SA 5EQCA 4UHNA 1TASA 1YIZA 2BWNA 4ZASA 5G4JA 5EUDA 1KKPA 4ZM3A 2VMYA 3P6KA 4IYOA 5FT4A 4AZKA 2FM1A 1M6SA 2VI8A 1AJSB 2D63A 4JEYA 4A6RA 5HXXA 4U1TA 4XK1A 4L0OA 4MQPA 2AY1A 3PAAA 2AEUA 2Z9WA 3E2ZB 2ZY5A 4MQQA 4M2JA 4WLHA 1ECXA 1QIRA 2EH6A 3EI6A 4Q31A 2X3LA 1MLZA 1IX6A 1LS3A 1FG7A 2GMSA 3T32A 4LW2A 1WKHA 4Q76A 1GC0A 3FTBA 2VMTA 1KMJA 1YIYA 1WYUA 2R5EA 1Z3ZA 1GCKA 1ASMA 2TPLA 1V2FA 3FQ7A 4OT8A 4RKDA 2QB3A 1S0AA 2OKKA 3M5UA 1AHGA 2AY8A 4CBRA 4UOYA 2ZY2A 2YHKA 2W8TA 1TPLA 3EI9A 1JS6A 1W7NA 3A2BA 9AATA 3W1IA 4ITGA 1SZSA 2O7CA 3TCMA 1GEXA 3VOMA 3GZDC 2PO3A 4JF0A 2ZY4A 1OHVA 1OHYA 1GBNA 3E2YA 3WKSA 1M0QA 3FQAA 4ZWVA 1EJIA 1SZKA 4IYOB 4BMKA 2W8JA 4CXRA 1AY5A 4WYCA 4R2NA 1ASAA 2O0RA 2VMVA 1GEYA 1G7WA 3PIUA 4A0FA 2Z20A 3K40A 2BHXA 3TATA 1ZC9A 4IXSA 3AEJA 2VGWA 2W7KA 2VGTA 1QJ5A 1IBJA 3H7FA 2DGKA 2F8JA 3JU7A 2VI9A 4WD2A 1BKGA 1TOIA 2Z9VA 3K7YA 4J5UA 5G2QA 3NYUA 3PDXA 2VMQA 4XJPA 2CH2A 4JEXA 4WXGA 3BN1A 1C7OA 2JJGA 2VMPA 4WXBA 3RBLA 4CVQA 4R5ZA 1V72A 2VIBA 2CFBA 5F8VA 3JZLA 3MKJA 4IW7A 4RIZA 3UAKA 3N75A 1XI9A 1AKBA 4BQ0A 1W23A 1BT4A 3HMUA 3MBBA 3PJ0A 1IX7A 4ZM4A 3G0TA 3IF2A 2AY6A 3F6TA 4RLGA 1AKAA 4OBUA 3KGXA 1O61A 2JJEA 8AATA 5DJ9A 1AMRA 5HDMA 4F5KA 2GMUA 2AATA 1X29A 3AEJC 3BWNA 3ZRPA 3E6GA 4N0BA 3DXWA 4KXKA 3WCOA 1LC5A 4A0RA 3AOVA 2JGTA 5LH9A 1VP4A 3ELPA 1ASEA 3PDBA 4R8DA 2VGVA 4WLJA 5I92A 5AX8A 3CBFA 4KAMA 4MKKA 4DBCA 4WB0B 1AKCA 1IX8A 4ZDLA 4LNLA 4WYFA 1SVVA 1M0NA 3KE3A 3FD0A 1TOEA 4K2MA 3RCHA 4HVKA 4F5IA 4TMRA 1OHWA 2D65A 3E77A 3PPLA 1AAWA 1YOOA 3EIAA 1B5PA 1OATA 3L44A 3Q8NA 1ASGA 4JEZA 1AAMA 2BIAA 1PMOA 2EPJA 4EB7A 1JS3A 1I43A 1B9HA 1YJSA 1BJ4A 2BI2A 2BIGA 2WKAA 3GJUA 1TARA 2ZJGA 1GEWA 4IY7A 4TV7A 2JJFA 3TFTA 2C44A 3HT4A 3FFRA 4MY5A 1AJRA 1M4NA 4H51A 5F9SA 3BWNC 3CQ6A 5JAYA 4ITXA 4OC9A 4OMAA 1MAQA 1AHXA 3AATA 2OQXA 2DKBA 3I5TA 4LNMA 2W7MA 1UKJA 3FZ7A 4DQ6A 1D7UA 2EO5A 2HUUA 2VMXA 5FT6A 2BYLA 4Q6RA 3FDDA 2O1BA 1KL1A 2HZPA 3BWOA 1GC4A 3LVJA 4Q75A 5M4BA 3HDOA 3EZ1A 2DGMA 3WGBA 7AATA 1LC8A 3MAFA 4W91A 3TQXA 3ATHA 2VMNA 3IHJA 3FFHA 1BJOB 2BKWA 2CJHA 1QJ3A 3NRAA 3DXVA 1Z7DA 2YRRA 2D7ZA 2CINA 2GQNA 4WYGA 4M2KA 2VLHA 3TFUA 2ZP7A 4OCAA 4AO9A 3JWAA 4Y0HA 1B5OA 2AY3A 4MKJA 1ASFA 2CSTA 1LK9A 1G4VA 3AEPA 1DGDA 3E2FA 1ZODA 3QGUA 1BJNA 3AV7A 2GSAA 1FG3A 1WYVA 4ADCA 3AENA 2ZC0A 3DR4A 2ZY3A 1SPAA 5D95A 2Z9UA 3WY7A 3WKRA 1ARTA 5BJ4A 2FNIA 2VMUA 2Z61A 4NOGA 4PVFA 4RAEA 4W1VA 3ZZJA 1D7RA 1M0PA 1S09A 3UE8A 2C81A 2X5FA 3DC1A 2QMAA 3GETA 3H14A 1VEFA 4RKCA 4U2HA 4EB5A 2VGSA 4O6ZA 1U08A 4E77A 1AHFA 1MAPA 2DR1A 1CQ6A 1B8GA 2ORDA 2PB0A 3PD6A 4FL0A 4E3RA 3EUCA 1UU0A 1DJEA 2EZ2A 5G2PA 5M49A 4ADBA 3F0HA 2YRIA 2CANA 1B9IA 5E3KA 4XJOA 3MAUA 1C7NA 3NUBA 2QLRA 2Z9XA 3MC6A 4GDYA 4N0WA 1DFOA 1KL2A 2YCNA 3MEBA 4W1XA 5DX5A 3VP6A 2HP2A 4ATPA 3VK2A 2AY2A 3FQ8A 4QGRA 4RJ0A 2C7TA 1AHYA 1OXOA 1RV3A 2C0RA 2E7IA 2D5YA 3ISLA 4I8AA 1WYUB 1ASDA 3GBXA 4UQVA 2JJHA 4F5HA 2W7EA 4XQ2A 1N2TA 2AY9A 4W5KA 3VK4A 3B8XA 5TF5A 2JISA 3RUYA 1S08A 1EG5A 1MLYA 2OATA 4GRXA 1ARGA 1GC2A 1CL2A 3ECDA 4LC3A 1ASLA 3LG0A 3QN6A 1C4KA 4OBVA 1CZEA 2ZSLA 1CZCA 3FVXA 4R5FA 3HL2A 3BC8A 4AO4A 2W7IA 4WBTA 5LHAA 2NMPA 3RQ1A 1P3WA 2W7HA 5EAAA 4AH3A 3CQ5A 4IXZA 4RJYA 3WZFA 4W8IA 1WYTA 1LW5A 1WSTA 4PFFA 1C0NA 2ZSMA 2D64A 4A0HA 3WX9A 1ELUA 1DKAA 1JF9A 1MDOA 1TATA 3FVSA 3G8MA 4A72A 1VJOA 3QI6A 2PB2A 2VIAA 2Z67A 5FT8A 4A00A 1AY8A 1AMQA 3FCRA 1N8PA 5K8BA 1QITA 1AHEA 3FZ8A 1RVYA 3QPGA 4A6UA 2JG2A 2HORA 3HLMA 3DZZA 2XBNA 3DODA 3B1EA 1AIAA 4ZDPA 1UU2A 2RFVA 3EI8A 3GR9A 4F5MA 4J8LA 3G7QA 1AMSA 2QB2A 2V1PA 2XH1A 1BQDA 1AICA 3WLXA 2BI3A 5E5IA 5HHYA 5C6UA 1IUGA 3P1TA 1CS1A 1FC4A 2YCPA 3BV0A 3ASAA 4FFCA 1I29A 1YNUA 1TOKA 2HUFA 3BCBA 1IAYA 3NU7A 1AY4A 5E4ZA 3E2ZA 3D6KA 4KYOA 2YOBA 3N0LA 1QISA 1E5EA 4ZLVA 2DKJA 4RITA 4XAUA 1SZUA 2D66A 3AEMA 2GB3A 1AX4A 1C9CA 3JWBA 3GZCA 3ACZA 3PDBB 4JE5D 4OYTA 3ZZKA 1SF2A 1JG8A 3L8AA 1G7XA 5G0AA 3F9TA 3LVLB 4IX8A 3W1JA 1W3UA 3LWSA 4ZDOA 4GSAA 2BI9A 2VMZA 5G4IA 1RV4A 3A9XA 3RCHB 4JEVA 3A8UX 2HOYA 1BS0A 4XJLA 2VYCA 2HUIA 3ASBA 4UHMA 1D7SA 4GE7A 3FKDA 1QGNA 1O69A 3K28A 1MGVA 4F4EA 2VMWA 2VMOA 5M46A 1M0OA 3NX3A 1D2FA 4CXQA 2YCTA 4P3MA 4MQRA 3E9KA 3ZRRA 2HOZA 4ATQA 3I16A 5EIGA 3AEMC 4PFNA 3VAXA 1DJUA 3FRKA 3LVKA 5FT5A 3GZDA 3NYSA 4BA5A 1KMKA 3FDBA 4M2MA 4F5LA 1PFFA 1ORDA 2YKVA 3LV2A 2Z1YA 1V2DA 4JF1A 1DTYA 4EU1A 3LVMA 2R2NA 2V0YA 2YKUA 1LC7A 1ARSA 2HP1A 5M4DA 3PA9A 2E54A 3HBXA 4GE4A 1N31A 1B4XA 2BI5A 2QA3A 4WYAA 3RI6A 2X8UA 3WCNA 3DU4A 3MAFB 3NU8A 4ADDA 3EI5A 1BJWA 4B9BA 2WK8A 1RVUA 3B1DA 1GD9A 1S07A 1T3IA 2WK7A 1CL1A 4JE5A 2QBTA 4F5JA 4UHOA
chains in the Genus database with same CATH superfamily
1SFFA 1J04A 3GSBA 3VK3A 2Q7WA 2R5CA 2W8UA 5EAVA 4EMYA 1TOJA 1XEYA 2VLFA 3I4JA 2EZ1A 2AY5A 1ZOBA 2VMSA 2CJDA 2FNUA 1YAAA 1O4SA 3MADA 3HVYA 1MDXA 3ELEA 3NNKA 1WYVB 4W1WA 4WXFA 3AENB 2YKYA 2KFPA 3HQTA 3EI7A 1AIBA 4ADEA 3JW9A 4BA4A 2W7FA 3WGCA 2AEVA 1D7VA 1ASCA 1GDEA 1H1CA 4XEWA 2R0TA 5EIGB 5G09A 3CAIA 4AZJA 1O62A 5J8QA 2VGUA 1TOGA 4ZSYA 4F5GA 2VGZA 1BQAA 4WB0A 5EUEA 3A9YA 1W7LA 1G4XA 1YJZA 3BCXA 2OGEA 2D61A 3MC6C 2WK9A 3PD6B 2G6WA 3QHXA 2OGAA 3FVUA 3FZ6A 5DB5A 2Z1ZA 1MDZA 5EFSA 4CBSA 4ISYA 1CQ8A 1C7GA 4F5FA 1Y4IA 1DJ9A 1LKCA 1YJYA 2E7UA 3DR7A 2BWPA 2R5CB 4JEWA 3KGWA 2OKJA 3AELA 1CQ7A 2X5DA 3RBFA 1CJ0A 2E7JA 3A9ZA 4GE9A 4Y0IA 3DYDA 2A1VA 1S06A 1IVRA 1DGEA 1ARHA 4WYEA 2CB1A 3NUIA 3FSLA 2FN6A 3NDNA 1J32A 4MSOA 4E1OA 4ZAHA 1X28A 2AY4A 3BB8A 4MGRA 2CH1A 3B1CA 4EFFA 4XJMA 2W8VA 1UU1A 3GWPA 3R9AA 4AOAA 2BWOA 3EIBA 4LNJA 1ASBA 1BJOA 3R4TA 1X0MA 1EQBA 1LW4A 2ZYJA 4B98A 1I48A 1AJSA 4OTLA 3BS8A 3USFA 3ZRQA 2BI1A 4BHDA 4E3QA 1H0CA 4A6TA 4RM1A 2W7GA 4K2IA 2ZUKA 3KKIA 5IWQA 3B46A 3II0A 3QM2A 3JTXA 4HF8A 4ZSWA 2YKXA 4Y0DA 3NTJA 3AOWA 1WYTB 3H9XA 1WKGA 4IXOA 5BJ3A 1PMMA 3DRDA 1KKJA 2W7DA 4ZWMA 2W8WA 2W7LA 2BIEA 3PGYA 4P7YA 1I41A 2DOUA 2CJGA 2FQ6A 4WYDA 2VMRA 2DGLA 4WP0A 3UWCA 1E5FA 2HOXA 2AY7A 2D7YA 1ELQA 1ASNA 4DGTA 5DJ1A 3W1HA 1GC3A 1IJIA 3QBOA 3NYTA 4TN4A 1PG8A 2CY8A 2W7JA 1V2EA 1ARIA 3EZSA 1BW0A 2EGYA 1W7MA 3N5MA 3CQ4A 3COGA 1M32A 3AEOA 1M7YA 3LY1A 3OP7A 2CTZA 1X2AA 1AMAA 4K2BA 4PIWA 5EUNA 3OKSA 4LW4A 4A0GA 1IAXA 3BCAA 3N4RA 1OXPA 2BYJA 2FYFA 1QZ9A 4GEBA 5D5SA 5EQCA 4UHNA 1TASA 1YIZA 2BWNA 4ZASA 5G4JA 5EUDA 1KKPA 4ZM3A 2VMYA 3P6KA 4IYOA 5FT4A 4AZKA 2FM1A 1M6SA 2VI8A 1AJSB 2D63A 4JEYA 4A6RA 5HXXA 4U1TA 4XK1A 4L0OA 4MQPA 2AY1A 3PAAA 2AEUA 2Z9WA 3E2ZB 2ZY5A 4MQQA 4M2JA 4WLHA 1ECXA 1QIRA 2EH6A 3EI6A 4Q31A 2X3LA 1MLZA 1IX6A 1LS3A 1FG7A 2GMSA 3T32A 4LW2A 1WKHA 4Q76A 1GC0A 3FTBA 2VMTA 1KMJA 1YIYA 1WYUA 2R5EA 1Z3ZA 1GCKA 1ASMA 2TPLA 1V2FA 3FQ7A 4OT8A 4RKDA 2QB3A 1S0AA 2OKKA 3M5UA 1AHGA 2AY8A 4CBRA 4UOYA 2ZY2A 2YHKA 2W8TA 1TPLA 3EI9A 1JS6A 1W7NA 3A2BA 9AATA 3W1IA 4ITGA 1SZSA 2O7CA 3TCMA 1GEXA 3VOMA 3GZDC 2PO3A 4JF0A 2ZY4A 1OHVA 1OHYA 1GBNA 3E2YA 3WKSA 1M0QA 3FQAA 4ZWVA 5KTBA 1EJIA 1SZKA 4IYOB 4BMKA 2W8JA 4CXRA 1AY5A 4WYCA 4R2NA 1ASAA 2O0RA 2VMVA 1GEYA 1G7WA 3PIUA 4A0FA 2Z20A 3K40A 2BHXA 3TATA 1ZC9A 4IXSA 3AEJA 2VGWA 2W7KA 2VGTA 1QJ5A 1IBJA 3H7FA 2DGKA 2F8JA 3JU7A 2VI9A 4WD2A 1BKGA 1TOIA 2Z9VA 3K7YA 4J5UA 5G2QA 3NYUA 3PDXA 2VMQA 4XJPA 2CH2A 4JEXA 4WXGA 3BN1A 1C7OA 2JJGA 2VMPA 4WXBA 3RBLA 4CVQA 4R5ZA 1V72A 2VIBA 2CFBA 5F8VA 3JZLA 3MKJA 4IW7A 4RIZA 3UAKA 3N75A 1XI9A 1AKBA 4BQ0A 1W23A 1BT4A 3HMUA 3MBBA 3PJ0A 1IX7A 4ZM4A 3G0TA 3IF2A 2AY6A 3F6TA 4RLGA 1AKAA 4OBUA 3KGXA 1O61A 2JJEA 8AATA 5DJ9A 1AMRA 5HDMA 4F5KA 2GMUA 2AATA 1X29A 3AEJC 3BWNA 3ZRPA 3E6GA 4N0BA 3DXWA 4KXKA 3WCOA 1LC5A 4A0RA 3AOVA 2JGTA 5LH9A 1VP4A 3ELPA 1ASEA 3PDBA 4R8DA 2VGVA 4WLJA 5I92A 5AX8A 3CBFA 4KAMA 4MKKA 4DBCA 4WB0B 1AKCA 1IX8A 4ZDLA 4LNLA 4WYFA 1SVVA 1M0NA 3KE3A 3FD0A 1TOEA 4K2MA 3RCHA 4HVKA 4F5IA 4TMRA 1OHWA 2D65A 3E77A 3PPLA 1AAWA 1YOOA 3EIAA 1B5PA 1OATA 3L44A 3Q8NA 1ASGA 4JEZA 1AAMA 2BIAA 1PMOA 2EPJA 4EB7A 1JS3A 1I43A 1B9HA 1YJSA 1BJ4A 2BI2A 2BIGA 2WKAA 3GJUA 1TARA 2ZJGA 1GEWA 4IY7A 4TV7A 2JJFA 3TFTA 2C44A 3HT4A 3FFRA 4MY5A 1AJRA 1M4NA 4H51A 5F9SA 3BWNC 3CQ6A 5JAYA 4ITXA 4OC9A 4OMAA 1MAQA 1AHXA 3AATA 2OQXA 2DKBA 3I5TA 4LNMA 2W7MA 1UKJA 3FZ7A 4DQ6A 1D7UA 2EO5A 2HUUA 2VMXA 5FT6A 2BYLA 4Q6RA 3FDDA 2O1BA 3N7NA 1KL1A 2HZPA 3BWOA 1GC4A 3LVJA 4Q75A 5M4BA 3HDOA 3EZ1A 2DGMA 3WGBA 7AATA 1LC8A 3MAFA 4W91A 3TQXA 3ATHA 2VMNA 3IHJA 3FFHA 1BJOB 2BKWA 2CJHA 1QJ3A 3NRAA 3DXVA 1Z7DA 2YRRA 2D7ZA 2CINA 2GQNA 4WYGA 4M2KA 2VLHA 3TFUA 2ZP7A 4OCAA 4AO9A 3JWAA 4Y0HA 1B5OA 2AY3A 4MKJA 1ASFA 2CSTA 1LK9A 1G4VA 3AEPA 1DGDA 3E2FA 1ZODA 3QGUA 1BJNA 3AV7A 2GSAA 1FG3A 1WYVA 4ADCA 3AENA 2ZC0A 3DR4A 2ZY3A 1SPAA 5D95A 2Z9UA 3WY7A 3WKRA 1ARTA 5BJ4A 2FNIA 2VMUA 2Z61A 4NOGA 4PVFA 4RAEA 4W1VA 3ZZJA 1D7RA 1M0PA 1S09A 3UE8A 2C81A 2X5FA 3DC1A 2QMAA 3GETA 3H14A 1VEFA 4RKCA 4U2HA 4H63Q 4EB5A 2VGSA 4O6ZA 1U08A 4E77A 1AHFA 1MAPA 2DR1A 1CQ6A 1B8GA 2ORDA 2PB0A 3PD6A 4FL0A 4E3RA 3EUCA 1UU0A 1DJEA 2EZ2A 5G2PA 5M49A 4ADBA 3F0HA 2YRIA 3N4SA 2CANA 1B9IA 5E3KA 4XJOA 3MAUA 1C7NA 3NUBA 2QLRA 2Z9XA 3MC6A 4GDYA 4N0WA 1DFOA 1KL2A 2YCNA 3MEBA 4W1XA 5DX5A 3VP6A 2HP2A 4ATPA 3VK2A 2AY2A 3FQ8A 4QGRA 4RJ0A 2C7TA 1AHYA 1OXOA 1RV3A 2C0RA 2E7IA 2D5YA 3ISLA 4I8AA 4K05A 1WYUB 1ASDA 3GBXA 4UQVA 2JJHA 4F5HA 2W7EA 4XQ2A 1N2TA 2AY9A 4W5KA 3VK4A 2EYQA 3B8XA 5TF5A 2JISA 3RUYA 1S08A 1EG5A 1MLYA 2OATA 4GRXA 1ARGA 1GC2A 1CL2A 3ECDA 4LC3A 1ASLA 3LG0A 3QN6A 1C4KA 4OBVA 1CZEA 2ZSLA 1CZCA 3FVXA 4R5FA 3HL2A 3BC8A 4AO4A 2W7IA 4WBTA 5LHAA 3N4XA 2NMPA 3RQ1A 1P3WA 2W7HA 5EAAA 4AH3A 3CQ5A 4IXZA 4RJYA 3WZFA 4W8IA 1WYTA 1LW5A 2WB6A 1WSTA 4PFFA 1C0NA 2ZSMA 2D64A 2QSRA 4A0HA 3WX9A 1ELUA 1DKAA 1JF9A 1MDOA 1TATA 3FVSA 3G8MA 4A72A 1VJOA 3QI6A 2PB2A 2VIAA 1KAFA 2Z67A 5FT8A 4A00A 2G7JA 1AY8A 1AMQA 3FCRA 1N8PA 5K8BA 1QITA 1AHEA 3FZ8A 1RVYA 3QPGA 4A6UA 2JG2A 2HORA 3HLMA 3DZZA 2XBNA 3DODA 3B1EA 1AIAA 4ZDPA 1UU2A 2RFVA 3EI8A 3GR9A 4F5MA 4J8LA 3G7QA 1AMSA 2QB2A 2V1PA 2XH1A 1BQDA 1AICA 3WLXA 2BI3A 5E5IA 5HHYA 5C6UA 1IUGA 3P1TA 1CS1A 1FC4A 2YCPA 3BV0A 3ASAA 4FFCA 1I29A 1YNUA 1TOKA 2HUFA 3BCBA 1IAYA 3NU7A 1AY4A 5E4ZA 3E2ZA 3D6KA 4KYOA 2YOBA 3N0LA 1QISA 1E5EA 4ZLVA 2DKJA 4RITA 4XAUA 1SZUA 2D66A 3AEMA 2GB3A 1AX4A 1C9CA 3JWBA 3GZCA 3ACZA 3PDBB 4JE5D 4OYTA 3ZZKA 1SF2A 1JG8A 3L8AA 1G7XA 5G0AA 3F9TA 3LVLB 4IX8A 3W1JA 1W3UA 3LWSA 4ZDOA 4GSAA 2BI9A 2VMZA 5G4IA 1RV4A 3A9XA 3RCHB 4JEVA 3A8UX 2HOYA 1BS0A 4XJLA 2VYCA 2HUIA 3ASBA 4UHMA 1D7SA 4GE7A 3FKDA 1QGNA 1O69A 3K28A 1MGVA 4F4EA 2VMWA 2VMOA 5M46A 1M0OA 3NX3A 2FKIA 1D2FA 4CXQA 2YCTA 4P3MA 4MQRA 3E9KA 3ZRRA 2HOZA 4ATQA 3I16A 5EIGA 3AEMC 4PFNA 3VAXA 1DJUA 3FRKA 3LVKA 5FT5A 3GZDA 3NYSA 4BA5A 1KMKA 3FDBA 4M2MA 4F5LA 1PFFA 1ORDA 2YKVA 3LV2A 2Z1YA 1V2DA 4JF1A 1DTYA 4EU1A 3LVMA 2R2NA 2V0YA 2YKUA 1LC7A 1ARSA 2HP1A 5M4DA 3PA9A 2E54A 3HBXA 4GE4A 1N31A 1B4XA 2BI5A 2QA3A 4WYAA 3RI6A 2X8UA 3WCNA 3DU4A 3MAFB 3NU8A 4ADDA 3EI5A 1BJWA 4B9BA 2WK8A 1RVUA 3B1DA 1GD9A 1S07A 1T3IA 2WK7A 1CL1A 4JE5A 2QBTA 4F5JA 4UHOA
chains in the Genus database with same CATH topology
1SFFA 1J04A 3GSBA 3VK3A 2Q7WA 2R5CA 2W8UA 5EAVA 4EMYA 1TOJA 1XEYA 2VLFA 3I4JA 2EZ1A 2AY5A 1ZOBA 2VMSA 2CJDA 2FNUA 1YAAA 1O4SA 3MADA 3HVYA 1MDXA 3ELEA 3NNKA 1WYVB 4W1WA 4WXFA 3AENB 2YKYA 2KFPA 3HQTA 3EI7A 1AIBA 4ADEA 3JW9A 4BA4A 2W7FA 3WGCA 2AEVA 1D7VA 1ASCA 1GDEA 1H1CA 4XEWA 2R0TA 5EIGB 5G09A 3CAIA 4AZJA 1O62A 5J8QA 2VGUA 1TOGA 4ZSYA 4F5GA 2VGZA 1BQAA 4WB0A 5EUEA 3A9YA 1W7LA 1G4XA 1YJZA 3BCXA 2OGEA 2D61A 3MC6C 2WK9A 3PD6B 2G6WA 3QHXA 2OGAA 3FVUA 3FZ6A 5DB5A 2Z1ZA 1MDZA 5EFSA 4CBSA 4ISYA 1CQ8A 1C7GA 4F5FA 1Y4IA 1DJ9A 1LKCA 1YJYA 2E7UA 3DR7A 2BWPA 2R5CB 4JEWA 3KGWA 2OKJA 3AELA 1CQ7A 2X5DA 3RBFA 1CJ0A 2E7JA 3A9ZA 4GE9A 4Y0IA 3DYDA 2A1VA 1S06A 1IVRA 1DGEA 1ARHA 4WYEA 2CB1A 3NUIA 3FSLA 2FN6A 3NDNA 1J32A 4MSOA 4E1OA 4ZAHA 1X28A 2AY4A 3BB8A 4MGRA 2CH1A 3B1CA 4EFFA 4XJMA 2W8VA 1UU1A 3GWPA 3R9AA 4AOAA 2BWOA 3EIBA 4LNJA 1ASBA 1BJOA 3R4TA 1X0MA 1EQBA 1LW4A 2ZYJA 4B98A 1I48A 1AJSA 4OTLA 3BS8A 3USFA 3ZRQA 2BI1A 4BHDA 4E3QA 1H0CA 4A6TA 4RM1A 2W7GA 4K2IA 2ZUKA 3KKIA 5IWQA 3B46A 3II0A 3QM2A 3JTXA 4HF8A 4ZSWA 2YKXA 4Y0DA 3NTJA 3AOWA 1WYTB 3H9XA 1WKGA 4IXOA 5BJ3A 1PMMA 3DRDA 1KKJA 2W7DA 4ZWMA 2W8WA 2W7LA 2BIEA 3PGYA 4P7YA 1I41A 2DOUA 2CJGA 2FQ6A 4WYDA 2VMRA 2DGLA 4WP0A 3UWCA 1E5FA 2HOXA 2AY7A 2D7YA 1ELQA 1ASNA 4DGTA 5DJ1A 3W1HA 1GC3A 1IJIA 3QBOA 3NYTA 4TN4A 1PG8A 2CY8A 2W7JA 1V2EA 1ARIA 3EZSA 1BW0A 2EGYA 1W7MA 3N5MA 3CQ4A 3COGA 1M32A 3AEOA 1M7YA 3LY1A 3OP7A 2CTZA 1X2AA 1AMAA 4K2BA 4PIWA 5EUNA 3OKSA 4LW4A 4A0GA 1IAXA 3BCAA 3N4RA 1OXPA 2BYJA 2FYFA 1QZ9A 4GEBA 5D5SA 5EQCA 4UHNA 1TASA 1YIZA 2BWNA 4ZASA 5G4JA 5EUDA 1KKPA 4ZM3A 2VMYA 3P6KA 4IYOA 5FT4A 4AZKA 2FM1A 1M6SA 2VI8A 1AJSB 2D63A 4JEYA 4A6RA 5HXXA 4U1TA 4XK1A 4L0OA 4MQPA 2AY1A 3PAAA 2AEUA 2Z9WA 3E2ZB 2ZY5A 4MQQA 4M2JA 4WLHA 1ECXA 1QIRA 2EH6A 3EI6A 4Q31A 2X3LA 1MLZA 1IX6A 1LS3A 1FG7A 2GMSA 3T32A 4LW2A 1WKHA 4Q76A 1GC0A 3FTBA 2VMTA 1KMJA 1YIYA 1WYUA 2R5EA 1Z3ZA 1GCKA 1ASMA 2TPLA 1V2FA 3FQ7A 4OT8A 4RKDA 2QB3A 1S0AA 2OKKA 3M5UA 1AHGA 2AY8A 4CBRA 4UOYA 2ZY2A 2YHKA 2W8TA 1TPLA 3EI9A 1JS6A 1W7NA 3A2BA 9AATA 3W1IA 4ITGA 1SZSA 2O7CA 3TCMA 1GEXA 3VOMA 3GZDC 2PO3A 4JF0A 2ZY4A 1OHVA 1OHYA 1GBNA 3E2YA 3WKSA 1M0QA 3FQAA 4ZWVA 5KTBA 1EJIA 1SZKA 4IYOB 4BMKA 2W8JA 4CXRA 1AY5A 4WYCA 4R2NA 1ASAA 2O0RA 2VMVA 1GEYA 1G7WA 3PIUA 4A0FA 2Z20A 3K40A 2BHXA 3TATA 1ZC9A 4IXSA 3AEJA 2VGWA 2W7KA 2VGTA 1QJ5A 1IBJA 3H7FA 2DGKA 2F8JA 3JU7A 2VI9A 4WD2A 1BKGA 1TOIA 2Z9VA 3K7YA 4J5UA 5G2QA 3NYUA 3PDXA 2VMQA 4XJPA 2CH2A 4JEXA 4WXGA 3BN1A 1C7OA 2JJGA 2VMPA 4WXBA 3RBLA 4CVQA 4R5ZA 1V72A 2VIBA 2CFBA 5F8VA 3JZLA 3MKJA 4IW7A 4RIZA 3UAKA 3N75A 1XI9A 1AKBA 4BQ0A 1W23A 1BT4A 3HMUA 3MBBA 3PJ0A 1IX7A 4ZM4A 3G0TA 3IF2A 2AY6A 3F6TA 4RLGA 1AKAA 4OBUA 3KGXA 1O61A 2JJEA 8AATA 5DJ9A 1AMRA 5HDMA 4F5KA 2GMUA 2AATA 1X29A 3AEJC 3BWNA 3ZRPA 3E6GA 4N0BA 3DXWA 4KXKA 3WCOA 1LC5A 4A0RA 3AOVA 2JGTA 5LH9A 1VP4A 3ELPA 1ASEA 3PDBA 4R8DA 2VGVA 4WLJA 5I92A 5AX8A 3CBFA 4KAMA 4MKKA 4DBCA 4WB0B 1AKCA 1IX8A 4ZDLA 4LNLA 4WYFA 1SVVA 1M0NA 3KE3A 3FD0A 1TOEA 4K2MA 3RCHA 4HVKA 4F5IA 4TMRA 1OHWA 2D65A 3E77A 3PPLA 1AAWA 1YOOA 3EIAA 1B5PA 1OATA 3L44A 3Q8NA 1ASGA 4JEZA 1AAMA 2BIAA 1PMOA 2EPJA 4EB7A 1JS3A 1I43A 1B9HA 1YJSA 1BJ4A 2BI2A 2BIGA 2WKAA 3GJUA 1TARA 2ZJGA 1GEWA 4IY7A 4TV7A 2JJFA 3TFTA 2C44A 3HT4A 3FFRA 4MY5A 1AJRA 1M4NA 4H51A 5F9SA 3BWNC 3CQ6A 5JAYA 4ITXA 4OC9A 4OMAA 1MAQA 1AHXA 3AATA 2OQXA 2DKBA 3I5TA 4LNMA 2W7MA 1UKJA 3FZ7A 4DQ6A 1D7UA 2EO5A 2HUUA 2VMXA 5FT6A 2BYLA 4Q6RA 3FDDA 2O1BA 3N7NA 1KL1A 2HZPA 3BWOA 1GC4A 3LVJA 4Q75A 5M4BA 3HDOA 3EZ1A 2DGMA 3WGBA 7AATA 1LC8A 3MAFA 4W91A 3TQXA 3ATHA 2VMNA 3IHJA 3FFHA 1BJOB 2BKWA 2CJHA 1QJ3A 3NRAA 3DXVA 1Z7DA 2YRRA 2D7ZA 2CINA 2GQNA 4WYGA 4M2KA 2VLHA 3TFUA 2ZP7A 4OCAA 4AO9A 3JWAA 4Y0HA 1B5OA 2AY3A 4MKJA 1ASFA 2CSTA 1LK9A 1G4VA 3AEPA 1DGDA 3E2FA 1ZODA 3QGUA 1BJNA 3AV7A 2GSAA 1FG3A 1WYVA 4ADCA 3AENA 2ZC0A 3DR4A 2ZY3A 1SPAA 5D95A 2Z9UA 3WY7A 3WKRA 1ARTA 5BJ4A 2FNIA 2VMUA 2Z61A 4NOGA 4PVFA 4RAEA 4W1VA 3ZZJA 1D7RA 1M0PA 1S09A 3UE8A 2C81A 2X5FA 3DC1A 2QMAA 3GETA 3H14A 1VEFA 4RKCA 4U2HA 4H63Q 4EB5A 2VGSA 4O6ZA 1U08A 4E77A 1AHFA 1MAPA 2DR1A 1CQ6A 1B8GA 2ORDA 2PB0A 3PD6A 4FL0A 4E3RA 3EUCA 1UU0A 1DJEA 2EZ2A 5G2PA 5M49A 4ADBA 3F0HA 2YRIA 3N4SA 2CANA 1B9IA 5E3KA 4XJOA 3MAUA 1C7NA 3NUBA 2QLRA 2Z9XA 3MC6A 4GDYA 4N0WA 1DFOA 1KL2A 2YCNA 3MEBA 4W1XA 5DX5A 3VP6A 2HP2A 4ATPA 3VK2A 2AY2A 3FQ8A 4QGRA 4RJ0A 2C7TA 1AHYA 1OXOA 1RV3A 2C0RA 2E7IA 2D5YA 3ISLA 4I8AA 4K05A 1WYUB 1ASDA 3GBXA 4UQVA 2JJHA 4F5HA 2W7EA 4XQ2A 1N2TA 2AY9A 4W5KA 3VK4A 2EYQA 3B8XA 5TF5A 2JISA 3RUYA 1S08A 1EG5A 1MLYA 2OATA 4GRXA 1ARGA 1GC2A 1CL2A 3ECDA 4LC3A 1ASLA 3LG0A 3QN6A 1C4KA 4OBVA 1CZEA 2ZSLA 1CZCA 3FVXA 4R5FA 3HL2A 3BC8A 4AO4A 2W7IA 4WBTA 5LHAA 3N4XA 2NMPA 3RQ1A 1P3WA 2W7HA 5EAAA 4AH3A 3CQ5A 4IXZA 4RJYA 3WZFA 4W8IA 1WYTA 1LW5A 2WB6A 1WSTA 4PFFA 1C0NA 2ZSMA 2D64A 2QSRA 4A0HA 3WX9A 1ELUA 1DKAA 1JF9A 1MDOA 1TATA 3FVSA 3G8MA 4A72A 1VJOA 3QI6A 2PB2A 2VIAA 2Z67A 5FT8A 4A00A 2G7JA 1AY8A 1AMQA 3FCRA 1N8PA 5K8BA 1QITA 1AHEA 3FZ8A 1RVYA 3QPGA 4A6UA 2JG2A 2HORA 3HLMA 3DZZA 2XBNA 3DODA 3B1EA 1AIAA 4ZDPA 1UU2A 2RFVA 3EI8A 3GR9A 4F5MA 4J8LA 3G7QA 1AMSA 2QB2A 2V1PA 2XH1A 1BQDA 1AICA 3WLXA 2BI3A 5E5IA 5HHYA 5C6UA 1IUGA 3P1TA 1CS1A 1FC4A 2YCPA 3BV0A 3ASAA 4FFCA 1I29A 1YNUA 1TOKA 2HUFA 3BCBA 1IAYA 3NU7A 1AY4A 5E4ZA 3E2ZA 3D6KA 4KYOA 2YOBA 3N0LA 1QISA 1E5EA 4ZLVA 2DKJA 4RITA 4XAUA 1SZUA 2D66A 3AEMA 2GB3A 1AX4A 1C9CA 3JWBA 3GZCA 3ACZA 3PDBB 4JE5D 4OYTA 3ZZKA 1SF2A 1JG8A 3L8AA 1G7XA 5G0AA 3F9TA 3LVLB 4IX8A 3W1JA 1W3UA 3LWSA 4ZDOA 4GSAA 2BI9A 2VMZA 5G4IA 1RV4A 3A9XA 3RCHB 4JEVA 3A8UX 2HOYA 1BS0A 4XJLA 2VYCA 2HUIA 3ASBA 4UHMA 1D7SA 4GE7A 3FKDA 1QGNA 1O69A 3K28A 1MGVA 4F4EA 2VMWA 2VMOA 5M46A 1M0OA 3NX3A 2FKIA 1D2FA 4CXQA 2YCTA 4P3MA 4MQRA 3E9KA 3ZRRA 2HOZA 4ATQA 3I16A 5EIGA 3AEMC 4PFNA 3VAXA 1DJUA 3FRKA 3LVKA 5FT5A 3GZDA 3NYSA 4BA5A 1KMKA 3FDBA 4M2MA 4F5LA 1PFFA 1ORDA 2YKVA 3LV2A 2Z1YA 1V2DA 4JF1A 1DTYA 4EU1A 3LVMA 2R2NA 2V0YA 2YKUA 1LC7A 1ARSA 2HP1A 5M4DA 3PA9A 2E54A 3HBXA 4GE4A 1N31A 1B4XA 2BI5A 2QA3A 4WYAA 3RI6A 2X8UA 3WCNA 3DU4A 3MAFB 3NU8A 4ADDA 3EI5A 1BJWA 4B9BA 2WK8A 1RVUA 3B1DA 1GD9A 1S07A 1T3IA 2WK7A 1CL1A 4JE5A 2QBTA 4F5JA 4UHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFF A;  1J04 A;  3GSB A;  3VK3 A;  2Q7W A;  2R5C A;  2W8U A;  5EAV A;  4EMY A;  1TOJ A;  1XEY A;  2VLF A;  3I4J A;  2EZ1 A;  2AY5 A;  1ZOB A;  2VMS A;  2CJD A;  2FNU A;  1YAA A;  1O4S A;  3MAD A;  3HVY A;  1MDX A;  3ELE A;  3NNK A;  1WYV B;  4W1W A;  4WXF A;  3AEN B;  2YKY A;  3HQT A;  3EI7 A;  1AIB A;  4ADE A;  3JW9 A;  4BA4 A;  2W7F A;  3WGC A;  2AEV A;  1D7V A;  1ASC A;  1GDE A;  1H1C A;  4XEW A;  2R0T A;  5EIG B;  5G09 A;  3CAI A;  4AZJ A;  1O62 A;  5J8Q A;  2VGU A;  1TOG A;  4ZSY A;  4F5G A;  2VGZ A;  1BQA A;  4WB0 A;  5EUE A;  3A9Y A;  1W7L A;  1G4X A;  1YJZ A;  3BCX A;  2OGE A;  2D61 A;  3MC6 C;  2WK9 A;  3PD6 B;  2G6W A;  3QHX A;  2OGA A;  3FVU A;  3FZ6 A;  5DB5 A;  2Z1Z A;  1MDZ A;  5EFS A;  4CBS A;  4ISY A;  1CQ8 A;  1C7G A;  4F5F A;  1Y4I A;  1DJ9 A;  1LKC A;  1YJY A;  2E7U A;  3DR7 A;  2BWP A;  2R5C B;  4JEW A;  3KGW A;  2OKJ A;  3AEL A;  1CQ7 A;  2X5D A;  3RBF A;  1CJ0 A;  2E7J A;  3A9Z A;  4GE9 A;  4Y0I A;  3DYD A;  1S06 A;  1IVR A;  1DGE A;  1ARH A;  4WYE A;  2CB1 A;  3NUI A;  3FSL A;  2FN6 A;  3NDN A;  1J32 A;  4MSO A;  4E1O A;  4ZAH A;  1X28 A;  2AY4 A;  3BB8 A;  4MGR A;  2CH1 A;  3B1C A;  4EFF A;  4XJM A;  2W8V A;  1UU1 A;  3GWP A;  3R9A A;  4AOA A;  2BWO A;  3EIB A;  4LNJ A;  1ASB A;  1BJO A;  3R4T A;  1X0M A;  1EQB A;  1LW4 A;  2ZYJ A;  4B98 A;  1I48 A;  1AJS A;  4OTL A;  3BS8 A;  3USF A;  3ZRQ A;  2BI1 A;  4BHD A;  4E3Q A;  1H0C A;  4A6T A;  4RM1 A;  2W7G A;  4K2I A;  2ZUK A;  3KKI A;  5IWQ A;  3B46 A;  3II0 A;  3QM2 A;  3JTX A;  4HF8 A;  4ZSW A;  2YKX A;  4Y0D A;  3NTJ A;  3AOW A;  1WYT B;  1WKG A;  4IXO A;  5BJ3 A;  1PMM A;  3DRD A;  1KKJ A;  2W7D A;  4ZWM A;  2W8W A;  2W7L A;  2BIE A;  3PGY A;  4P7Y A;  1I41 A;  2DOU A;  2CJG A;  2FQ6 A;  4WYD A;  2VMR A;  2DGL A;  4WP0 A;  3UWC A;  1E5F A;  2HOX A;  2AY7 A;  2D7Y A;  1ELQ A;  1ASN A;  4DGT A;  5DJ1 A;  3W1H A;  1GC3 A;  1IJI A;  3QBO A;  3NYT A;  4TN4 A;  1PG8 A;  2CY8 A;  2W7J A;  1V2E A;  1ARI A;  3EZS A;  1BW0 A;  2EGY A;  1W7M A;  3N5M A;  3CQ4 A;  3COG A;  1M32 A;  3AEO A;  1M7Y A;  3LY1 A;  3OP7 A;  2CTZ A;  1X2A A;  1AMA A;  4K2B A;  4PIW A;  5EUN A;  3OKS A;  4LW4 A;  4A0G A;  1IAX A;  3BCA A;  1OXP A;  2BYJ A;  2FYF A;  1QZ9 A;  4GEB A;  5D5S A;  5EQC A;  4UHN A;  1TAS A;  1YIZ A;  2BWN A;  4ZAS A;  5G4J A;  5EUD A;  1KKP A;  4ZM3 A;  2VMY A;  3P6K A;  4IYO A;  5FT4 A;  4AZK A;  2FM1 A;  1M6S A;  2VI8 A;  1AJS B;  2D63 A;  4JEY A;  4A6R A;  5HXX A;  4U1T A;  4XK1 A;  4L0O A;  4MQP A;  2AY1 A;  3PAA A;  2AEU A;  2Z9W A;  3E2Z B;  2ZY5 A;  4MQQ A;  4M2J A;  4WLH A;  1ECX A;  1QIR A;  2EH6 A;  3EI6 A;  4Q31 A;  2X3L A;  1MLZ A;  1IX6 A;  1LS3 A;  1FG7 A;  2GMS A;  3T32 A;  4LW2 A;  1WKH A;  4Q76 A;  1GC0 A;  3FTB A;  2VMT A;  1KMJ A;  1YIY A;  1WYU A;  2R5E A;  1Z3Z A;  1GCK A;  1ASM A;  2TPL A;  1V2F A;  3FQ7 A;  4OT8 A;  4RKD A;  2QB3 A;  1S0A A;  2OKK A;  3M5U A;  1AHG A;  2AY8 A;  4CBR A;  4UOY A;  2ZY2 A;  2YHK A;  2W8T A;  1TPL A;  3EI9 A;  1JS6 A;  1W7N A;  3A2B A;  9AAT A;  3W1I A;  4ITG A;  1SZS A;  2O7C A;  3TCM A;  1GEX A;  3VOM A;  3GZD C;  2PO3 A;  4JF0 A;  2ZY4 A;  1OHV A;  1OHY A;  1GBN A;  3E2Y A;  3WKS A;  1M0Q A;  3FQA A;  4ZWV A;  1EJI A;  1SZK A;  4IYO B;  4BMK A;  2W8J A;  4CXR A;  1AY5 A;  4WYC A;  4R2N A;  1ASA A;  2O0R A;  2VMV A;  1GEY A;  1G7W A;  3PIU A;  4A0F A;  2Z20 A;  3K40 A;  2BHX A;  3TAT A;  1ZC9 A;  4IXS A;  3AEJ A;  2VGW A;  2W7K A;  2VGT A;  1QJ5 A;  1IBJ A;  3H7F A;  2DGK A;  2F8J A;  3JU7 A;  2VI9 A;  4WD2 A;  1BKG A;  1TOI A;  2Z9V A;  3K7Y A;  4J5U A;  5G2Q A;  3NYU A;  3PDX A;  2VMQ A;  4XJP A;  2CH2 A;  4JEX A;  4WXG A;  3BN1 A;  1C7O A;  2JJG A;  2VMP A;  4WXB A;  3RBL A;  4CVQ A;  4R5Z A;  1V72 A;  2VIB A;  2CFB A;  5F8V A;  3JZL A;  3MKJ A;  4IW7 A;  4RIZ A;  3UAK A;  3N75 A;  1XI9 A;  1AKB A;  4BQ0 A;  1W23 A;  1BT4 A;  3HMU A;  3MBB A;  3PJ0 A;  1IX7 A;  4ZM4 A;  3G0T A;  3IF2 A;  2AY6 A;  3F6T A;  4RLG A;  1AKA A;  4OBU A;  3KGX A;  1O61 A;  2JJE A;  8AAT A;  5DJ9 A;  1AMR A;  5HDM A;  4F5K A;  2GMU A;  2AAT A;  1X29 A;  3AEJ C;  3BWN A;  3ZRP A;  3E6G A;  4N0B A;  3DXW A;  4KXK A;  3WCO A;  1LC5 A;  4A0R A;  3AOV A;  2JGT A;  5LH9 A;  1VP4 A;  3ELP A;  1ASE A;  3PDB A;  4R8D A;  2VGV A;  4WLJ A;  5I92 A;  5AX8 A;  3CBF A;  4KAM A;  4MKK A;  4DBC A;  4WB0 B;  1AKC A;  1IX8 A;  4ZDL A;  4LNL A;  4WYF A;  1SVV A;  1M0N A;  3KE3 A;  3FD0 A;  1TOE A;  4K2M A;  3RCH A;  4HVK A;  4F5I A;  4TMR A;  1OHW A;  2D65 A;  3E77 A;  3PPL A;  1AAW A;  1YOO A;  3EIA A;  1B5P A;  1OAT A;  3L44 A;  3Q8N A;  1ASG A;  4JEZ A;  1AAM A;  2BIA A;  1PMO A;  2EPJ A;  4EB7 A;  1JS3 A;  1I43 A;  1B9H A;  1YJS A;  1BJ4 A;  2BI2 A;  2BIG A;  2WKA A;  3GJU A;  1TAR A;  2ZJG A;  1GEW A;  4IY7 A;  4TV7 A;  2JJF A;  3TFT A;  2C44 A;  3HT4 A;  3FFR A;  4MY5 A;  1AJR A;  1M4N A;  4H51 A;  5F9S A;  3BWN C;  3CQ6 A;  5JAY A;  4ITX A;  4OC9 A;  4OMA A;  1MAQ A;  1AHX A;  3AAT A;  2OQX A;  2DKB A;  3I5T A;  4LNM A;  2W7M A;  1UKJ A;  3FZ7 A;  4DQ6 A;  1D7U A;  2EO5 A;  2HUU A;  2VMX A;  5FT6 A;  2BYL A;  4Q6R A;  3FDD A;  2O1B A;  1KL1 A;  2HZP A;  3BWO A;  1GC4 A;  3LVJ A;  4Q75 A;  5M4B A;  3HDO A;  3EZ1 A;  2DGM A;  3WGB A;  7AAT A;  1LC8 A;  3MAF A;  4W91 A;  3TQX A;  3ATH A;  2VMN A;  3IHJ A;  3FFH A;  1BJO B;  2BKW A;  2CJH A;  1QJ3 A;  3NRA A;  3DXV A;  1Z7D A;  2YRR A;  2D7Z A;  2CIN A;  2GQN A;  4WYG A;  4M2K A;  2VLH A;  3TFU A;  2ZP7 A;  4OCA A;  4AO9 A;  3JWA A;  4Y0H A;  1B5O A;  2AY3 A;  4MKJ A;  1ASF A;  2CST A;  1LK9 A;  1G4V A;  3AEP A;  1DGD A;  3E2F A;  1ZOD A;  3QGU A;  1BJN A;  3AV7 A;  2GSA A;  1FG3 A;  1WYV A;  4ADC A;  3AEN A;  2ZC0 A;  3DR4 A;  2ZY3 A;  1SPA A;  5D95 A;  2Z9U A;  3WY7 A;  3WKR A;  1ART A;  5BJ4 A;  2FNI A;  2VMU A;  2Z61 A;  4NOG A;  4PVF A;  4RAE A;  4W1V A;  3ZZJ A;  1D7R A;  1M0P A;  1S09 A;  3UE8 A;  2C81 A;  2X5F A;  3DC1 A;  2QMA A;  3GET A;  3H14 A;  1VEF A;  4RKC A;  4U2H A;  4EB5 A;  2VGS A;  4O6Z A;  1U08 A;  4E77 A;  1AHF A;  1MAP A;  2DR1 A;  1CQ6 A;  1B8G A;  2ORD A;  2PB0 A;  3PD6 A;  4FL0 A;  4E3R A;  3EUC A;  1UU0 A;  1DJE A;  2EZ2 A;  5G2P A;  5M49 A;  4ADB A;  3F0H A;  2YRI A;  2CAN A;  1B9I A;  5E3K A;  4XJO A;  3MAU A;  1C7N A;  3NUB A;  2QLR A;  2Z9X A;  3MC6 A;  4GDY A;  4N0W A;  1DFO A;  1KL2 A;  2YCN A;  3MEB A;  4W1X A;  5DX5 A;  3VP6 A;  2HP2 A;  4ATP A;  3VK2 A;  2AY2 A;  3FQ8 A;  4QGR A;  4RJ0 A;  2C7T A;  1AHY A;  1OXO A;  1RV3 A;  2C0R A;  2E7I A;  2D5Y A;  3ISL A;  4I8A A;  1WYU B;  1ASD A;  3GBX A;  4UQV A;  2JJH A;  4F5H A;  2W7E A;  4XQ2 A;  1N2T A;  2AY9 A;  4W5K A;  3VK4 A;  3B8X A;  5TF5 A;  2JIS A;  3RUY A;  1S08 A;  1EG5 A;  1MLY A;  2OAT A;  4GRX A;  1ARG A;  1GC2 A;  1CL2 A;  3ECD A;  4LC3 A;  1ASL A;  3LG0 A;  3QN6 A;  1C4K A;  4OBV A;  1CZE A;  2ZSL A;  1CZC A;  3FVX A;  4R5F A;  3HL2 A;  3BC8 A;  4AO4 A;  2W7I A;  4WBT A;  5LHA A;  2NMP A;  3RQ1 A;  1P3W A;  2W7H A;  5EAA A;  4AH3 A;  3CQ5 A;  4IXZ A;  4RJY A;  3WZF A;  4W8I A;  1WYT A;  1LW5 A;  1WST A;  4PFF A;  1C0N A;  2ZSM A;  2D64 A;  4A0H A;  3WX9 A;  1ELU A;  1DKA A;  1JF9 A;  1MDO A;  1TAT A;  3FVS A;  3G8M A;  4A72 A;  1VJO A;  3QI6 A;  2PB2 A;  2VIA A;  2Z67 A;  5FT8 A;  4A00 A;  1AY8 A;  1AMQ A;  3FCR A;  1N8P A;  5K8B A;  1QIT A;  1AHE A;  3FZ8 A;  1RVY A;  3QPG A;  4A6U A;  2JG2 A;  2HOR A;  3HLM A;  3DZZ A;  2XBN A;  3DOD A;  3B1E A;  1AIA A;  4ZDP A;  1UU2 A;  2RFV A;  3EI8 A;  3GR9 A;  4F5M A;  4J8L A;  3G7Q A;  1AMS A;  2QB2 A;  2V1P A;  2XH1 A;  1BQD A;  1AIC A;  3WLX A;  2BI3 A;  5E5I A;  5HHY A;  5C6U A;  1IUG A;  3P1T A;  1CS1 A;  1FC4 A;  2YCP A;  3BV0 A;  3ASA A;  4FFC A;  1I29 A;  1YNU A;  1TOK A;  2HUF A;  3BCB A;  1IAY A;  3NU7 A;  1AY4 A;  5E4Z A;  3E2Z A;  3D6K A;  4KYO A;  2YOB A;  3N0L A;  1QIS A;  1E5E A;  4ZLV A;  2DKJ A;  4RIT A;  4XAU A;  1SZU A;  2D66 A;  3AEM A;  2GB3 A;  1AX4 A;  1C9C A;  3JWB A;  3GZC A;  3ACZ A;  3PDB B;  4JE5 D;  4OYT A;  3ZZK A;  1SF2 A;  1JG8 A;  3L8A A;  1G7X A;  5G0A A;  3F9T A;  3LVL B;  4IX8 A;  3W1J A;  1W3U A;  3LWS A;  4ZDO A;  4GSA A;  2BI9 A;  2VMZ A;  5G4I A;  1RV4 A;  3A9X A;  3RCH B;  4JEV A;  3A8U X;  2HOY A;  1BS0 A;  4XJL A;  2VYC A;  2HUI A;  3ASB A;  4UHM A;  1D7S A;  4GE7 A;  3FKD A;  1QGN A;  1O69 A;  3K28 A;  1MGV A;  4F4E A;  2VMW A;  2VMO A;  5M46 A;  1M0O A;  3NX3 A;  1D2F A;  4CXQ A;  2YCT A;  4P3M A;  4MQR A;  3E9K A;  3ZRR A;  2HOZ A;  4ATQ A;  3I16 A;  5EIG A;  3AEM C;  4PFN A;  3VAX A;  1DJU A;  3FRK A;  3LVK A;  5FT5 A;  3GZD A;  3NYS A;  4BA5 A;  1KMK A;  3FDB A;  4M2M A;  4F5L A;  1PFF A;  1ORD A;  2YKV A;  3LV2 A;  2Z1Y A;  1V2D A;  4JF1 A;  1DTY A;  4EU1 A;  3LVM A;  2R2N A;  2V0Y A;  2YKU A;  1LC7 A;  1ARS A;  2HP1 A;  5M4D A;  3PA9 A;  2E54 A;  3HBX A;  4GE4 A;  1N31 A;  1B4X A;  2BI5 A;  2QA3 A;  4WYA A;  3RI6 A;  2X8U A;  3WCN A;  3DU4 A;  3MAF B;  3NU8 A;  4ADD A;  3EI5 A;  1BJW A;  4B9B A;  2WK8 A;  1RVU A;  3B1D A;  1GD9 A;  1S07 A;  1T3I A;  2WK7 A;  1CL1 A;  4JE5 A;  2QBT A;  4F5J A;  4UHO A; 
#chains in the Genus database with same CATH topology
 1SFF A;  1J04 A;  3GSB A;  3VK3 A;  2Q7W A;  2R5C A;  2W8U A;  5EAV A;  4EMY A;  1TOJ A;  1XEY A;  2VLF A;  3I4J A;  2EZ1 A;  2AY5 A;  1ZOB A;  2VMS A;  2CJD A;  2FNU A;  1YAA A;  1O4S A;  3MAD A;  3HVY A;  1MDX A;  3ELE A;  3NNK A;  1WYV B;  4W1W A;  4WXF A;  3AEN B;  2YKY A;  2KFP A;  3HQT A;  3EI7 A;  1AIB A;  4ADE A;  3JW9 A;  4BA4 A;  2W7F A;  3WGC A;  2AEV A;  1D7V A;  1ASC A;  1GDE A;  1H1C A;  4XEW A;  2R0T A;  5EIG B;  5G09 A;  3CAI A;  4AZJ A;  1O62 A;  5J8Q A;  2VGU A;  1TOG A;  4ZSY A;  4F5G A;  2VGZ A;  1BQA A;  4WB0 A;  5EUE A;  3A9Y A;  1W7L A;  1G4X A;  1YJZ A;  3BCX A;  2OGE A;  2D61 A;  3MC6 C;  2WK9 A;  3PD6 B;  2G6W A;  3QHX A;  2OGA A;  3FVU A;  3FZ6 A;  5DB5 A;  2Z1Z A;  1MDZ A;  5EFS A;  4CBS A;  4ISY A;  1CQ8 A;  1C7G A;  4F5F A;  1Y4I A;  1DJ9 A;  1LKC A;  1YJY A;  2E7U A;  3DR7 A;  2BWP A;  2R5C B;  4JEW A;  3KGW A;  2OKJ A;  3AEL A;  1CQ7 A;  2X5D A;  3RBF A;  1CJ0 A;  2E7J A;  3A9Z A;  4GE9 A;  4Y0I A;  3DYD A;  2A1V A;  1S06 A;  1IVR A;  1DGE A;  1ARH A;  4WYE A;  2CB1 A;  3NUI A;  3FSL A;  2FN6 A;  3NDN A;  1J32 A;  4MSO A;  4E1O A;  4ZAH A;  1X28 A;  2AY4 A;  3BB8 A;  4MGR A;  2CH1 A;  3B1C A;  4EFF A;  4XJM A;  2W8V A;  1UU1 A;  3GWP A;  3R9A A;  4AOA A;  2BWO A;  3EIB A;  4LNJ A;  1ASB A;  1BJO A;  3R4T A;  1X0M A;  1EQB A;  1LW4 A;  2ZYJ A;  4B98 A;  1I48 A;  1AJS A;  4OTL A;  3BS8 A;  3USF A;  3ZRQ A;  2BI1 A;  4BHD A;  4E3Q A;  1H0C A;  4A6T A;  4RM1 A;  2W7G A;  4K2I A;  2ZUK A;  3KKI A;  5IWQ A;  3B46 A;  3II0 A;  3QM2 A;  3JTX A;  4HF8 A;  4ZSW A;  2YKX A;  4Y0D A;  3NTJ A;  3AOW A;  1WYT B;  3H9X A;  1WKG A;  4IXO A;  5BJ3 A;  1PMM A;  3DRD A;  1KKJ A;  2W7D A;  4ZWM A;  2W8W A;  2W7L A;  2BIE A;  3PGY A;  4P7Y A;  1I41 A;  2DOU A;  2CJG A;  2FQ6 A;  4WYD A;  2VMR A;  2DGL A;  4WP0 A;  3UWC A;  1E5F A;  2HOX A;  2AY7 A;  2D7Y A;  1ELQ A;  1ASN A;  4DGT A;  5DJ1 A;  3W1H A;  1GC3 A;  1IJI A;  3QBO A;  3NYT A;  4TN4 A;  1PG8 A;  2CY8 A;  2W7J A;  1V2E A;  1ARI A;  3EZS A;  1BW0 A;  2EGY A;  1W7M A;  3N5M A;  3CQ4 A;  3COG A;  1M32 A;  3AEO A;  1M7Y A;  3LY1 A;  3OP7 A;  2CTZ A;  1X2A A;  1AMA A;  4K2B A;  4PIW A;  5EUN A;  3OKS A;  4LW4 A;  4A0G A;  1IAX A;  3BCA A;  3N4R A;  1OXP A;  2BYJ A;  2FYF A;  1QZ9 A;  4GEB A;  5D5S A;  5EQC A;  4UHN A;  1TAS A;  1YIZ A;  2BWN A;  4ZAS A;  5G4J A;  5EUD A;  1KKP A;  4ZM3 A;  2VMY A;  3P6K A;  4IYO A;  5FT4 A;  4AZK A;  2FM1 A;  1M6S A;  2VI8 A;  1AJS B;  2D63 A;  4JEY A;  4A6R A;  5HXX A;  4U1T A;  4XK1 A;  4L0O A;  4MQP A;  2AY1 A;  3PAA A;  2AEU A;  2Z9W A;  3E2Z B;  2ZY5 A;  4MQQ A;  4M2J A;  4WLH A;  1ECX A;  1QIR A;  2EH6 A;  3EI6 A;  4Q31 A;  2X3L A;  1MLZ A;  1IX6 A;  1LS3 A;  1FG7 A;  2GMS A;  3T32 A;  4LW2 A;  1WKH A;  4Q76 A;  1GC0 A;  3FTB A;  2VMT A;  1KMJ A;  1YIY A;  1WYU A;  2R5E A;  1Z3Z A;  1GCK A;  1ASM A;  2TPL A;  1V2F A;  3FQ7 A;  4OT8 A;  4RKD A;  2QB3 A;  1S0A A;  2OKK A;  3M5U A;  1AHG A;  2AY8 A;  4CBR A;  4UOY A;  2ZY2 A;  2YHK A;  2W8T A;  1TPL A;  3EI9 A;  1JS6 A;  1W7N A;  3A2B A;  9AAT A;  3W1I A;  4ITG A;  1SZS A;  2O7C A;  3TCM A;  1GEX A;  3VOM A;  3GZD C;  2PO3 A;  4JF0 A;  2ZY4 A;  1OHV A;  1OHY A;  1GBN A;  3E2Y A;  3WKS A;  1M0Q A;  3FQA A;  4ZWV A;  5KTB A;  1EJI A;  1SZK A;  4IYO B;  4BMK A;  2W8J A;  4CXR A;  1AY5 A;  4WYC A;  4R2N A;  1ASA A;  2O0R A;  2VMV A;  1GEY A;  1G7W A;  3PIU A;  4A0F A;  2Z20 A;  3K40 A;  2BHX A;  3TAT A;  1ZC9 A;  4IXS A;  3AEJ A;  2VGW A;  2W7K A;  2VGT A;  1QJ5 A;  1IBJ A;  3H7F A;  2DGK A;  2F8J A;  3JU7 A;  2VI9 A;  4WD2 A;  1BKG A;  1TOI A;  2Z9V A;  3K7Y A;  4J5U A;  5G2Q A;  3NYU A;  3PDX A;  2VMQ A;  4XJP A;  2CH2 A;  4JEX A;  4WXG A;  3BN1 A;  1C7O A;  2JJG A;  2VMP A;  4WXB A;  3RBL A;  4CVQ A;  4R5Z A;  1V72 A;  2VIB A;  2CFB A;  5F8V A;  3JZL A;  3MKJ A;  4IW7 A;  4RIZ A;  3UAK A;  3N75 A;  1XI9 A;  1AKB A;  4BQ0 A;  1W23 A;  1BT4 A;  3HMU A;  3MBB A;  3PJ0 A;  1IX7 A;  4ZM4 A;  3G0T A;  3IF2 A;  2AY6 A;  3F6T A;  4RLG A;  1AKA A;  4OBU A;  3KGX A;  1O61 A;  2JJE A;  8AAT A;  5DJ9 A;  1AMR A;  5HDM A;  4F5K A;  2GMU A;  2AAT A;  1X29 A;  3AEJ C;  3BWN A;  3ZRP A;  3E6G A;  4N0B A;  3DXW A;  4KXK A;  3WCO A;  1LC5 A;  4A0R A;  3AOV A;  2JGT A;  5LH9 A;  1VP4 A;  3ELP A;  1ASE A;  3PDB A;  4R8D A;  2VGV A;  4WLJ A;  5I92 A;  5AX8 A;  3CBF A;  4KAM A;  4MKK A;  4DBC A;  4WB0 B;  1AKC A;  1IX8 A;  4ZDL A;  4LNL A;  4WYF A;  1SVV A;  1M0N A;  3KE3 A;  3FD0 A;  1TOE A;  4K2M A;  3RCH A;  4HVK A;  4F5I A;  4TMR A;  1OHW A;  2D65 A;  3E77 A;  3PPL A;  1AAW A;  1YOO A;  3EIA A;  1B5P A;  1OAT A;  3L44 A;  3Q8N A;  1ASG A;  4JEZ A;  1AAM A;  2BIA A;  1PMO A;  2EPJ A;  4EB7 A;  1JS3 A;  1I43 A;  1B9H A;  1YJS A;  1BJ4 A;  2BI2 A;  2BIG A;  2WKA A;  3GJU A;  1TAR A;  2ZJG A;  1GEW A;  4IY7 A;  4TV7 A;  2JJF A;  3TFT A;  2C44 A;  3HT4 A;  3FFR A;  4MY5 A;  1AJR A;  1M4N A;  4H51 A;  5F9S A;  3BWN C;  3CQ6 A;  5JAY A;  4ITX A;  4OC9 A;  4OMA A;  1MAQ A;  1AHX A;  3AAT A;  2OQX A;  2DKB A;  3I5T A;  4LNM A;  2W7M A;  1UKJ A;  3FZ7 A;  4DQ6 A;  1D7U A;  2EO5 A;  2HUU A;  2VMX A;  5FT6 A;  2BYL A;  4Q6R A;  3FDD A;  2O1B A;  3N7N A;  1KL1 A;  2HZP A;  3BWO A;  1GC4 A;  3LVJ A;  4Q75 A;  5M4B A;  3HDO A;  3EZ1 A;  2DGM A;  3WGB A;  7AAT A;  1LC8 A;  3MAF A;  4W91 A;  3TQX A;  3ATH A;  2VMN A;  3IHJ A;  3FFH A;  1BJO B;  2BKW A;  2CJH A;  1QJ3 A;  3NRA A;  3DXV A;  1Z7D A;  2YRR A;  2D7Z A;  2CIN A;  2GQN A;  4WYG A;  4M2K A;  2VLH A;  3TFU A;  2ZP7 A;  4OCA A;  4AO9 A;  3JWA A;  4Y0H A;  1B5O A;  2AY3 A;  4MKJ A;  1ASF A;  2CST A;  1LK9 A;  1G4V A;  3AEP A;  1DGD A;  3E2F A;  1ZOD A;  3QGU A;  1BJN A;  3AV7 A;  2GSA A;  1FG3 A;  1WYV A;  4ADC A;  3AEN A;  2ZC0 A;  3DR4 A;  2ZY3 A;  1SPA A;  5D95 A;  2Z9U A;  3WY7 A;  3WKR A;  1ART A;  5BJ4 A;  2FNI A;  2VMU A;  2Z61 A;  4NOG A;  4PVF A;  4RAE A;  4W1V A;  3ZZJ A;  1D7R A;  1M0P A;  1S09 A;  3UE8 A;  2C81 A;  2X5F A;  3DC1 A;  2QMA A;  3GET A;  3H14 A;  1VEF A;  4RKC A;  4U2H A;  4H63 Q;  4EB5 A;  2VGS A;  4O6Z A;  1U08 A;  4E77 A;  1AHF A;  1MAP A;  2DR1 A;  1CQ6 A;  1B8G A;  2ORD A;  2PB0 A;  3PD6 A;  4FL0 A;  4E3R A;  3EUC A;  1UU0 A;  1DJE A;  2EZ2 A;  5G2P A;  5M49 A;  4ADB A;  3F0H A;  2YRI A;  3N4S A;  2CAN A;  1B9I A;  5E3K A;  4XJO A;  3MAU A;  1C7N A;  3NUB A;  2QLR A;  2Z9X A;  3MC6 A;  4GDY A;  4N0W A;  1DFO A;  1KL2 A;  2YCN A;  3MEB A;  4W1X A;  5DX5 A;  3VP6 A;  2HP2 A;  4ATP A;  3VK2 A;  2AY2 A;  3FQ8 A;  4QGR A;  4RJ0 A;  2C7T A;  1AHY A;  1OXO A;  1RV3 A;  2C0R A;  2E7I A;  2D5Y A;  3ISL A;  4I8A A;  4K05 A;  1WYU B;  1ASD A;  3GBX A;  4UQV A;  2JJH A;  4F5H A;  2W7E A;  4XQ2 A;  1N2T A;  2AY9 A;  4W5K A;  3VK4 A;  2EYQ A;  3B8X A;  5TF5 A;  2JIS A;  3RUY A;  1S08 A;  1EG5 A;  1MLY A;  2OAT A;  4GRX A;  1ARG A;  1GC2 A;  1CL2 A;  3ECD A;  4LC3 A;  1ASL A;  3LG0 A;  3QN6 A;  1C4K A;  4OBV A;  1CZE A;  2ZSL A;  1CZC A;  3FVX A;  4R5F A;  3HL2 A;  3BC8 A;  4AO4 A;  2W7I A;  4WBT A;  5LHA A;  3N4X A;  2NMP A;  3RQ1 A;  1P3W A;  2W7H A;  5EAA A;  4AH3 A;  3CQ5 A;  4IXZ A;  4RJY A;  3WZF A;  4W8I A;  1WYT A;  1LW5 A;  2WB6 A;  1WST A;  4PFF A;  1C0N A;  2ZSM A;  2D64 A;  2QSR A;  4A0H A;  3WX9 A;  1ELU A;  1DKA A;  1JF9 A;  1MDO A;  1TAT A;  3FVS A;  3G8M A;  4A72 A;  1VJO A;  3QI6 A;  2PB2 A;  2VIA A;  1KAF A;  2Z67 A;  5FT8 A;  4A00 A;  2G7J A;  1AY8 A;  1AMQ A;  3FCR A;  1N8P A;  5K8B A;  1QIT A;  1AHE A;  3FZ8 A;  1RVY A;  3QPG A;  4A6U A;  2JG2 A;  2HOR A;  3HLM A;  3DZZ A;  2XBN A;  3DOD A;  3B1E A;  1AIA A;  4ZDP A;  1UU2 A;  2RFV A;  3EI8 A;  3GR9 A;  4F5M A;  4J8L A;  3G7Q A;  1AMS A;  2QB2 A;  2V1P A;  2XH1 A;  1BQD A;  1AIC A;  3WLX A;  2BI3 A;  5E5I A;  5HHY A;  5C6U A;  1IUG A;  3P1T A;  1CS1 A;  1FC4 A;  2YCP A;  3BV0 A;  3ASA A;  4FFC A;  1I29 A;  1YNU A;  1TOK A;  2HUF A;  3BCB A;  1IAY A;  3NU7 A;  1AY4 A;  5E4Z A;  3E2Z A;  3D6K A;  4KYO A;  2YOB A;  3N0L A;  1QIS A;  1E5E A;  4ZLV A;  2DKJ A;  4RIT A;  4XAU A;  1SZU A;  2D66 A;  3AEM A;  2GB3 A;  1AX4 A;  1C9C A;  3JWB A;  3GZC A;  3ACZ A;  3PDB B;  4JE5 D;  4OYT A;  3ZZK A;  1SF2 A;  1JG8 A;  3L8A A;  1G7X A;  5G0A A;  3F9T A;  3LVL B;  4IX8 A;  3W1J A;  1W3U A;  3LWS A;  4ZDO A;  4GSA A;  2BI9 A;  2VMZ A;  5G4I A;  1RV4 A;  3A9X A;  3RCH B;  4JEV A;  3A8U X;  2HOY A;  1BS0 A;  4XJL A;  2VYC A;  2HUI A;  3ASB A;  4UHM A;  1D7S A;  4GE7 A;  3FKD A;  1QGN A;  1O69 A;  3K28 A;  1MGV A;  4F4E A;  2VMW A;  2VMO A;  5M46 A;  1M0O A;  3NX3 A;  2FKI A;  1D2F A;  4CXQ A;  2YCT A;  4P3M A;  4MQR A;  3E9K A;  3ZRR A;  2HOZ A;  4ATQ A;  3I16 A;  5EIG A;  3AEM C;  4PFN A;  3VAX A;  1DJU A;  3FRK A;  3LVK A;  5FT5 A;  3GZD A;  3NYS A;  4BA5 A;  1KMK A;  3FDB A;  4M2M A;  4F5L A;  1PFF A;  1ORD A;  2YKV A;  3LV2 A;  2Z1Y A;  1V2D A;  4JF1 A;  1DTY A;  4EU1 A;  3LVM A;  2R2N A;  2V0Y A;  2YKU A;  1LC7 A;  1ARS A;  2HP1 A;  5M4D A;  3PA9 A;  2E54 A;  3HBX A;  4GE4 A;  1N31 A;  1B4X A;  2BI5 A;  2QA3 A;  4WYA A;  3RI6 A;  2X8U A;  3WCN A;  3DU4 A;  3MAF B;  3NU8 A;  4ADD A;  3EI5 A;  1BJW A;  4B9B A;  2WK8 A;  1RVU A;  3B1D A;  1GD9 A;  1S07 A;  1T3I A;  2WK7 A;  1CL1 A;  4JE5 A;  2QBT A;  4F5J A;  4UHO A; 
#chains in the Genus database with same CATH homology
 1SFF A;  1J04 A;  3GSB A;  3VK3 A;  2Q7W A;  2R5C A;  2W8U A;  5EAV A;  4EMY A;  1TOJ A;  1XEY A;  2VLF A;  3I4J A;  2EZ1 A;  2AY5 A;  1ZOB A;  2VMS A;  2CJD A;  2FNU A;  1YAA A;  1O4S A;  3MAD A;  3HVY A;  1MDX A;  3ELE A;  3NNK A;  1WYV B;  4W1W A;  4WXF A;  3AEN B;  2YKY A;  2KFP A;  3HQT A;  3EI7 A;  1AIB A;  4ADE A;  3JW9 A;  4BA4 A;  2W7F A;  3WGC A;  2AEV A;  1D7V A;  1ASC A;  1GDE A;  1H1C A;  4XEW A;  2R0T A;  5EIG B;  5G09 A;  3CAI A;  4AZJ A;  1O62 A;  5J8Q A;  2VGU A;  1TOG A;  4ZSY A;  4F5G A;  2VGZ A;  1BQA A;  4WB0 A;  5EUE A;  3A9Y A;  1W7L A;  1G4X A;  1YJZ A;  3BCX A;  2OGE A;  2D61 A;  3MC6 C;  2WK9 A;  3PD6 B;  2G6W A;  3QHX A;  2OGA A;  3FVU A;  3FZ6 A;  5DB5 A;  2Z1Z A;  1MDZ A;  5EFS A;  4CBS A;  4ISY A;  1CQ8 A;  1C7G A;  4F5F A;  1Y4I A;  1DJ9 A;  1LKC A;  1YJY A;  2E7U A;  3DR7 A;  2BWP A;  2R5C B;  4JEW A;  3KGW A;  2OKJ A;  3AEL A;  1CQ7 A;  2X5D A;  3RBF A;  1CJ0 A;  2E7J A;  3A9Z A;  4GE9 A;  4Y0I A;  3DYD A;  2A1V A;  1S06 A;  1IVR A;  1DGE A;  1ARH A;  4WYE A;  2CB1 A;  3NUI A;  3FSL A;  2FN6 A;  3NDN A;  1J32 A;  4MSO A;  4E1O A;  4ZAH A;  1X28 A;  2AY4 A;  3BB8 A;  4MGR A;  2CH1 A;  3B1C A;  4EFF A;  4XJM A;  2W8V A;  1UU1 A;  3GWP A;  3R9A A;  4AOA A;  2BWO A;  3EIB A;  4LNJ A;  1ASB A;  1BJO A;  3R4T A;  1X0M A;  1EQB A;  1LW4 A;  2ZYJ A;  4B98 A;  1I48 A;  1AJS A;  4OTL A;  3BS8 A;  3USF A;  3ZRQ A;  2BI1 A;  4BHD A;  4E3Q A;  1H0C A;  4A6T A;  4RM1 A;  2W7G A;  4K2I A;  2ZUK A;  3KKI A;  5IWQ A;  3B46 A;  3II0 A;  3QM2 A;  3JTX A;  4HF8 A;  4ZSW A;  2YKX A;  4Y0D A;  3NTJ A;  3AOW A;  1WYT B;  3H9X A;  1WKG A;  4IXO A;  5BJ3 A;  1PMM A;  3DRD A;  1KKJ A;  2W7D A;  4ZWM A;  2W8W A;  2W7L A;  2BIE A;  3PGY A;  4P7Y A;  1I41 A;  2DOU A;  2CJG A;  2FQ6 A;  4WYD A;  2VMR A;  2DGL A;  4WP0 A;  3UWC A;  1E5F A;  2HOX A;  2AY7 A;  2D7Y A;  1ELQ A;  1ASN A;  4DGT A;  5DJ1 A;  3W1H A;  1GC3 A;  1IJI A;  3QBO A;  3NYT A;  4TN4 A;  1PG8 A;  2CY8 A;  2W7J A;  1V2E A;  1ARI A;  3EZS A;  1BW0 A;  2EGY A;  1W7M A;  3N5M A;  3CQ4 A;  3COG A;  1M32 A;  3AEO A;  1M7Y A;  3LY1 A;  3OP7 A;  2CTZ A;  1X2A A;  1AMA A;  4K2B A;  4PIW A;  5EUN A;  3OKS A;  4LW4 A;  4A0G A;  1IAX A;  3BCA A;  3N4R A;  1OXP A;  2BYJ A;  2FYF A;  1QZ9 A;  4GEB A;  5D5S A;  5EQC A;  4UHN A;  1TAS A;  1YIZ A;  2BWN A;  4ZAS A;  5G4J A;  5EUD A;  1KKP A;  4ZM3 A;  2VMY A;  3P6K A;  4IYO A;  5FT4 A;  4AZK A;  2FM1 A;  1M6S A;  2VI8 A;  1AJS B;  2D63 A;  4JEY A;  4A6R A;  5HXX A;  4U1T A;  4XK1 A;  4L0O A;  4MQP A;  2AY1 A;  3PAA A;  2AEU A;  2Z9W A;  3E2Z B;  2ZY5 A;  4MQQ A;  4M2J A;  4WLH A;  1ECX A;  1QIR A;  2EH6 A;  3EI6 A;  4Q31 A;  2X3L A;  1MLZ A;  1IX6 A;  1LS3 A;  1FG7 A;  2GMS A;  3T32 A;  4LW2 A;  1WKH A;  4Q76 A;  1GC0 A;  3FTB A;  2VMT A;  1KMJ A;  1YIY A;  1WYU A;  2R5E A;  1Z3Z A;  1GCK A;  1ASM A;  2TPL A;  1V2F A;  3FQ7 A;  4OT8 A;  4RKD A;  2QB3 A;  1S0A A;  2OKK A;  3M5U A;  1AHG A;  2AY8 A;  4CBR A;  4UOY A;  2ZY2 A;  2YHK A;  2W8T A;  1TPL A;  3EI9 A;  1JS6 A;  1W7N A;  3A2B A;  9AAT A;  3W1I A;  4ITG A;  1SZS A;  2O7C A;  3TCM A;  1GEX A;  3VOM A;  3GZD C;  2PO3 A;  4JF0 A;  2ZY4 A;  1OHV A;  1OHY A;  1GBN A;  3E2Y A;  3WKS A;  1M0Q A;  3FQA A;  4ZWV A;  5KTB A;  1EJI A;  1SZK A;  4IYO B;  4BMK A;  2W8J A;  4CXR A;  1AY5 A;  4WYC A;  4R2N A;  1ASA A;  2O0R A;  2VMV A;  1GEY A;  1G7W A;  3PIU A;  4A0F A;  2Z20 A;  3K40 A;  2BHX A;  3TAT A;  1ZC9 A;  4IXS A;  3AEJ A;  2VGW A;  2W7K A;  2VGT A;  1QJ5 A;  1IBJ A;  3H7F A;  2DGK A;  2F8J A;  3JU7 A;  2VI9 A;  4WD2 A;  1BKG A;  1TOI A;  2Z9V A;  3K7Y A;  4J5U A;  5G2Q A;  3NYU A;  3PDX A;  2VMQ A;  4XJP A;  2CH2 A;  4JEX A;  4WXG A;  3BN1 A;  1C7O A;  2JJG A;  2VMP A;  4WXB A;  3RBL A;  4CVQ A;  4R5Z A;  1V72 A;  2VIB A;  2CFB A;  5F8V A;  3JZL A;  3MKJ A;  4IW7 A;  4RIZ A;  3UAK A;  3N75 A;  1XI9 A;  1AKB A;  4BQ0 A;  1W23 A;  1BT4 A;  3HMU A;  3MBB A;  3PJ0 A;  1IX7 A;  4ZM4 A;  3G0T A;  3IF2 A;  2AY6 A;  3F6T A;  4RLG A;  1AKA A;  4OBU A;  3KGX A;  1O61 A;  2JJE A;  8AAT A;  5DJ9 A;  1AMR A;  5HDM A;  4F5K A;  2GMU A;  2AAT A;  1X29 A;  3AEJ C;  3BWN A;  3ZRP A;  3E6G A;  4N0B A;  3DXW A;  4KXK A;  3WCO A;  1LC5 A;  4A0R A;  3AOV A;  2JGT A;  5LH9 A;  1VP4 A;  3ELP A;  1ASE A;  3PDB A;  4R8D A;  2VGV A;  4WLJ A;  5I92 A;  5AX8 A;  3CBF A;  4KAM A;  4MKK A;  4DBC A;  4WB0 B;  1AKC A;  1IX8 A;  4ZDL A;  4LNL A;  4WYF A;  1SVV A;  1M0N A;  3KE3 A;  3FD0 A;  1TOE A;  4K2M A;  3RCH A;  4HVK A;  4F5I A;  4TMR A;  1OHW A;  2D65 A;  3E77 A;  3PPL A;  1AAW A;  1YOO A;  3EIA A;  1B5P A;  1OAT A;  3L44 A;  3Q8N A;  1ASG A;  4JEZ A;  1AAM A;  2BIA A;  1PMO A;  2EPJ A;  4EB7 A;  1JS3 A;  1I43 A;  1B9H A;  1YJS A;  1BJ4 A;  2BI2 A;  2BIG A;  2WKA A;  3GJU A;  1TAR A;  2ZJG A;  1GEW A;  4IY7 A;  4TV7 A;  2JJF A;  3TFT A;  2C44 A;  3HT4 A;  3FFR A;  4MY5 A;  1AJR A;  1M4N A;  4H51 A;  5F9S A;  3BWN C;  3CQ6 A;  5JAY A;  4ITX A;  4OC9 A;  4OMA A;  1MAQ A;  1AHX A;  3AAT A;  2OQX A;  2DKB A;  3I5T A;  4LNM A;  2W7M A;  1UKJ A;  3FZ7 A;  4DQ6 A;  1D7U A;  2EO5 A;  2HUU A;  2VMX A;  5FT6 A;  2BYL A;  4Q6R A;  3FDD A;  2O1B A;  3N7N A;  1KL1 A;  2HZP A;  3BWO A;  1GC4 A;  3LVJ A;  4Q75 A;  5M4B A;  3HDO A;  3EZ1 A;  2DGM A;  3WGB A;  7AAT A;  1LC8 A;  3MAF A;  4W91 A;  3TQX A;  3ATH A;  2VMN A;  3IHJ A;  3FFH A;  1BJO B;  2BKW A;  2CJH A;  1QJ3 A;  3NRA A;  3DXV A;  1Z7D A;  2YRR A;  2D7Z A;  2CIN A;  2GQN A;  4WYG A;  4M2K A;  2VLH A;  3TFU A;  2ZP7 A;  4OCA A;  4AO9 A;  3JWA A;  4Y0H A;  1B5O A;  2AY3 A;  4MKJ A;  1ASF A;  2CST A;  1LK9 A;  1G4V A;  3AEP A;  1DGD A;  3E2F A;  1ZOD A;  3QGU A;  1BJN A;  3AV7 A;  2GSA A;  1FG3 A;  1WYV A;  4ADC A;  3AEN A;  2ZC0 A;  3DR4 A;  2ZY3 A;  1SPA A;  5D95 A;  2Z9U A;  3WY7 A;  3WKR A;  1ART A;  5BJ4 A;  2FNI A;  2VMU A;  2Z61 A;  4NOG A;  4PVF A;  4RAE A;  4W1V A;  3ZZJ A;  1D7R A;  1M0P A;  1S09 A;  3UE8 A;  2C81 A;  2X5F A;  3DC1 A;  2QMA A;  3GET A;  3H14 A;  1VEF A;  4RKC A;  4U2H A;  4H63 Q;  4EB5 A;  2VGS A;  4O6Z A;  1U08 A;  4E77 A;  1AHF A;  1MAP A;  2DR1 A;  1CQ6 A;  1B8G A;  2ORD A;  2PB0 A;  3PD6 A;  4FL0 A;  4E3R A;  3EUC A;  1UU0 A;  1DJE A;  2EZ2 A;  5G2P A;  5M49 A;  4ADB A;  3F0H A;  2YRI A;  3N4S A;  2CAN A;  1B9I A;  5E3K A;  4XJO A;  3MAU A;  1C7N A;  3NUB A;  2QLR A;  2Z9X A;  3MC6 A;  4GDY A;  4N0W A;  1DFO A;  1KL2 A;  2YCN A;  3MEB A;  4W1X A;  5DX5 A;  3VP6 A;  2HP2 A;  4ATP A;  3VK2 A;  2AY2 A;  3FQ8 A;  4QGR A;  4RJ0 A;  2C7T A;  1AHY A;  1OXO A;  1RV3 A;  2C0R A;  2E7I A;  2D5Y A;  3ISL A;  4I8A A;  4K05 A;  1WYU B;  1ASD A;  3GBX A;  4UQV A;  2JJH A;  4F5H A;  2W7E A;  4XQ2 A;  1N2T A;  2AY9 A;  4W5K A;  3VK4 A;  2EYQ A;  3B8X A;  5TF5 A;  2JIS A;  3RUY A;  1S08 A;  1EG5 A;  1MLY A;  2OAT A;  4GRX A;  1ARG A;  1GC2 A;  1CL2 A;  3ECD A;  4LC3 A;  1ASL A;  3LG0 A;  3QN6 A;  1C4K A;  4OBV A;  1CZE A;  2ZSL A;  1CZC A;  3FVX A;  4R5F A;  3HL2 A;  3BC8 A;  4AO4 A;  2W7I A;  4WBT A;  5LHA A;  3N4X A;  2NMP A;  3RQ1 A;  1P3W A;  2W7H A;  5EAA A;  4AH3 A;  3CQ5 A;  4IXZ A;  4RJY A;  3WZF A;  4W8I A;  1WYT A;  1LW5 A;  2WB6 A;  1WST A;  4PFF A;  1C0N A;  2ZSM A;  2D64 A;  2QSR A;  4A0H A;  3WX9 A;  1ELU A;  1DKA A;  1JF9 A;  1MDO A;  1TAT A;  3FVS A;  3G8M A;  4A72 A;  1VJO A;  3QI6 A;  2PB2 A;  2VIA A;  2Z67 A;  5FT8 A;  4A00 A;  2G7J A;  1AY8 A;  1AMQ A;  3FCR A;  1N8P A;  5K8B A;  1QIT A;  1AHE A;  3FZ8 A;  1RVY A;  3QPG A;  4A6U A;  2JG2 A;  2HOR A;  3HLM A;  3DZZ A;  2XBN A;  3DOD A;  3B1E A;  1AIA A;  4ZDP A;  1UU2 A;  2RFV A;  3EI8 A;  3GR9 A;  4F5M A;  4J8L A;  3G7Q A;  1AMS A;  2QB2 A;  2V1P A;  2XH1 A;  1BQD A;  1AIC A;  3WLX A;  2BI3 A;  5E5I A;  5HHY A;  5C6U A;  1IUG A;  3P1T A;  1CS1 A;  1FC4 A;  2YCP A;  3BV0 A;  3ASA A;  4FFC A;  1I29 A;  1YNU A;  1TOK A;  2HUF A;  3BCB A;  1IAY A;  3NU7 A;  1AY4 A;  5E4Z A;  3E2Z A;  3D6K A;  4KYO A;  2YOB A;  3N0L A;  1QIS A;  1E5E A;  4ZLV A;  2DKJ A;  4RIT A;  4XAU A;  1SZU A;  2D66 A;  3AEM A;  2GB3 A;  1AX4 A;  1C9C A;  3JWB A;  3GZC A;  3ACZ A;  3PDB B;  4JE5 D;  4OYT A;  3ZZK A;  1SF2 A;  1JG8 A;  3L8A A;  1G7X A;  5G0A A;  3F9T A;  3LVL B;  4IX8 A;  3W1J A;  1W3U A;  3LWS A;  4ZDO A;  4GSA A;  2BI9 A;  2VMZ A;  5G4I A;  1RV4 A;  3A9X A;  3RCH B;  4JEV A;  3A8U X;  2HOY A;  1BS0 A;  4XJL A;  2VYC A;  2HUI A;  3ASB A;  4UHM A;  1D7S A;  4GE7 A;  3FKD A;  1QGN A;  1O69 A;  3K28 A;  1MGV A;  4F4E A;  2VMW A;  2VMO A;  5M46 A;  1M0O A;  3NX3 A;  2FKI A;  1D2F A;  4CXQ A;  2YCT A;  4P3M A;  4MQR A;  3E9K A;  3ZRR A;  2HOZ A;  4ATQ A;  3I16 A;  5EIG A;  3AEM C;  4PFN A;  3VAX A;  1DJU A;  3FRK A;  3LVK A;  5FT5 A;  3GZD A;  3NYS A;  4BA5 A;  1KMK A;  3FDB A;  4M2M A;  4F5L A;  1PFF A;  1ORD A;  2YKV A;  3LV2 A;  2Z1Y A;  1V2D A;  4JF1 A;  1DTY A;  4EU1 A;  3LVM A;  2R2N A;  2V0Y A;  2YKU A;  1LC7 A;  1ARS A;  2HP1 A;  5M4D A;  3PA9 A;  2E54 A;  3HBX A;  4GE4 A;  1N31 A;  1B4X A;  2BI5 A;  2QA3 A;  4WYA A;  3RI6 A;  2X8U A;  3WCN A;  3DU4 A;  3MAF B;  3NU8 A;  4ADD A;  3EI5 A;  1BJW A;  4B9B A;  2WK8 A;  1RVU A;  3B1D A;  1GD9 A;  1S07 A;  1T3I A;  2WK7 A;  1CL1 A;  4JE5 A;  2QBT A;  4F5J A;  4UHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...