1JG8A

Crystal structure of threonine aldolase (low-specificity)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
343
structure length
342
Chain Sequence
MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-allo-threonine aldolase
publication title Crystal Structure of Low-specificity Threonine Aldolase, a Key Enzyme in Glycine Biosynthesis
rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 120
structure length 342
sequence length 343
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.5: L-threonine aldolase.
pdb deposition date 2001-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01212 Beta_elim_lyase Beta-eliminating lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1jg8A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1jg8A02
3WGCA 1CZEA 1DGEA 1RV3A 3NUBA 3DYDA 4R5FA 3FKDA 3HDOA 2YRRA 4AO9A 2AY6A 2YKXA 2VGWA 2G6WA 2QB3A 4CVQA 3EUCA 3GZCA 3ZRPA 3UE8A 1TOKA 3EIBA 3FTBA 4BQ0A 3CQ5A 1B9IA 3ASAA 1TATA 3B46A 4F5KA 1AY5A 2D7YA 4R5ZA 1KL2A 3PDBB 1C7OA 1IAXA 1GBNA 3AEJA 4P3MA 4TMRA 1ARSA 4AH3A 4NOGA 1ZODA 1PMOA 2Z20A 2C0RA 1O69A 1TOEA 3PA9A 2BIGA 2WK9A 2Z9XA 4ZLVA 2X8UA 3AV7A 4A72A 2E7UA 1CL2A 3DR7A 3RCHA 4RJ0A 3QN6A 4XJMA 3LV2A 4CBRA 3BWNC 4ZWVA 2NMPA 1BS0A 2FYFA 3P1TA 4MSOA 4F4EA 3W1JA 4H51A 2CH2A 3AENA 2JISA 1P3WA 1IX8A 1AAMA 2DOUA 3FQ8A 3PDXA 4WB0A 1YOOA 2OATA 1D7VA 1CS1A 2HUIA 3JTXA 2VI8A 1EJIA 2QBTA 4XJLA 1B5PA 1ASCA 2FNUA 4WYFA 4A6RA 3PJ0A 1S06A 2CANA 4W1WA 1E5EA 2W7EA 5FT5A 1C0NA 2C81A 1V2EA 2C7TA 1WYUA 3VK3A 4CXQA 1DJEA 2R5CB 5HDMA 4R2NA 3W1IA 4DQ6A 1C7NA 1D7UA 2OGAA 4J5UA 3TCMA 2E7IA 3TFTA 1BQAA 4W91A 1V2DA 4WYEA 3MAFB 3NNKA 3LVJA 1IX7A 1FG7A 3VK2A 3QHXA 2TPLA 2D5YA 2D63A 2VMXA 3FDDA 4M2KA 4GEBA 3PD6A 4R8DA 4WXFA 1UU0A 3DODA 1H1CA 4JEYA 4WXGA 2FM1A 4ZDLA 4ADDA 4ADCA 2X5DA 4F5JA 3QPGA 1ARTA 1AHYA 1S08A 2JJGA 2VGSA 4DBCA 2EZ2A 2QLRA 4Q6RA 1BJ4A 2CY8A 3DU4A 2EZ1A 2EPJA 3E2FA 1DKAA 3L8AA 4UHOA 2R2NA 2GMSA 3E2YA 1PG8A 1JS3A 2YCNA 1W23A 1AAWA 1DGDA 2EH6A 2AY1A 4JEWA 2RFVA 2W7IA 2AY2A 4E3RA 1G7WA 1SFFA 1VJOA 1N2TA 2FQ6A 4IXOA 4ZDPA 1G4XA 2D7ZA 2X3LA 3N0LA 1PFFA 4JF1A 3W1HA 1ARIA 2EO5A 3ELEA 1I48A 2YOBA 3A2BA 4IYOA 1WYVB 2HOZA 1MAPA 5EIGB 4MY5A 2W8WA 2W8JA 1CJ0A 1O4SA 4M2MA 4WYGA 1YJSA 4XQ2A 5EUEA 3MAUA 5FT8A 1JF9A 2BI1A 1MGVA 1O62A 1YIZA 4QGRA 1WKGA 4WLJA 1LC8A 1AY4A 2FN6A 3EI5A 4XAUA 3AELA 5F8VA 1MAQA 3BWOA 5E3KA 5LHAA 3PAAA 4EMYA 4F5LA 4N0BA 4HF8A 5BJ3A 2AEVA 1S0AA 1IJIA 2HP2A 1LW5A 5EUDA 1QISA 2JJFA 3FFRA 1AMAA 3NYTA 4Q75A 4Y0IA 3B8XA 4K2IA 3AEMA 4RKDA 4ATQA 2O1BA 1X2AA 1YIYA 1H0CA 2CH1A 3PIUA 1M7YA 1QZ9A 2W7LA 3COGA 2VIBA 4CBSA 4E77A 2YKVA 1BKGA 1V2FA 3A9XA 4EB5A 1RVYA 4RM1A 1GC4A 2ZUKA 4EU1A 3ATHA 3TQXA 1O61A 2ZY5A 1N31A 4JF0A 4W8IA 2VIAA 2E54A 3TFUA 5BJ4A 1YNUA 3G7QA 5FT6A 3WKSA 1GCKA 4J8LA 2OQXA 1XI9A 4ITGA 2JGTA 4UOYA 2C44A 3CAIA 1WYTA 1CZCA 1AMSA 2VGVA 2VMQA 3K7YA 3WZFA 4A00A 5M49A 2BKWA 4KXKA 3QGUA 3EI6A 2ORDA 5EAAA 3L44A 3VK4A 3DZZA 4ZWMA 3G0TA 1BT4A 4CXRA 4LW2A 1EQBA 2WKAA 3HLMA 3ZZJA 4RKCA 2AY9A 4MQQA 2VMZA 4OTLA 3NRAA 1QJ5A 4U1TA 1ASGA 1ASLA 4MKJA 4A6UA 2DR1A 1KMKA 2ZJGA 1CL1A 1AKCA 2Z9UA 3BWNA 5DB5A 3WX9A 1B4XA 1UU2A 2CSTA 3AEOA 1AY8A 4ZSWA 3RBLA 3MEBA 3AOWA 1BW0A 1CQ8A 3E2ZA 5LH9A 3BS8A 2CJDA 4JEVA 2VYCA 3WCOA 5HXXA 3RCHB 1Z3ZA 4A0RA 2O7CA 5D95A 3JZLA 4E1OA 7AATA 3BB8A 3RI6A 2W8VA 4LNMA 2ZYJA 3AENB 1I29A 3IF2A 2HZPA 3KGXA 3GWPA 3N75A 3PGYA 4LC3A 2VGZA 1PMMA 2X5FA 1ARHA 2VMOA 4WB0B 1SVVA 3LVKA 1M0NA 2AY4A 3GZDC 1M0OA 1I43A 3FQAA 3RQ1A 1VEFA 1T3IA 2HUFA 4XK1A 5M46A 2CJGA 2BWPA 4A0GA 2V1PA 3AEJC 3EI7A 5G2QA 2XBNA 3G8MA 1ASBA 4F5IA 4W1XA 3JWAA 4OMAA 3FDBA 4OC9A 4U2HA 1WYUB 5F9SA 1D7RA 1AHGA 1KMJA 3EIAA 2BIAA 2XH1A 4XJOA 3NUIA 4B9BA 5C6UA 3M5UA 3R9AA 4ADEA 1D2FA 3MBBA 3BV0A 3I4JA 4UQVA 4JEZA 2YKYA 1ASMA 3NU7A 4GE7A 5G09A 3PD6B 3EZ1A 2VMWA 3ECDA 2VGUA 1GEYA 3BCAA 4F5MA 1BJOA 4ZAHA 1ASFA 3NX3A 3USFA 2D66A 2W7HA 1ZOBA 1U08A 1C4KA 1AKBA 4EFFA 2VMVA 3NYUA 2YKUA 3AEPA 1TARA 1OHVA 2BWNA 3N5MA 4IW7A 5G4JA 1G4VA 2AY8A 1WKHA 4M2JA 5DJ1A 2E7JA 4PIWA 4BA5A 1GEXA 2CFBA 1UKJA 5FT4A 2EGYA 2QMAA 2YCPA 1JS6A 2VMYA 3ACZA 1X0MA 3ZRRA 4BMKA 4IXZA 3EI9A 2OGEA 4A6TA 4IYOB 1FG3A 2O0RA 3FD0A 3R4TA 3NTJA 4WYCA 4WD2A 4MQRA 1AMRA 4GE4A 3FVUA 1N8PA 2BIEA 1D7SA 1IAYA 1AHXA 4Q76A 2R0TA 3HQTA 1J32A 2ZY2A 2Z9WA 1W7LA 1KKJA 3HMUA 3A9YA 1AJRA 1GC0A 2W7GA 2QB2A 2PB0A 1DJ9A 1GEWA 3JW9A 1ELQA 1W3UA 1E5FA 3FCRA 5DX5A 1GD9A 5EUNA 5D5SA 3VP6A 3BCXA 2CJHA 3UWCA 2AY3A 4XJPA 3FFHA 3BCBA 1AHFA 2VMRA 3ELPA 3HT4A 4JE5A 4GDYA 3HVYA 1UU1A 1M0QA 1B5OA 3Q8NA 3RUYA 1AIBA 4ATPA 4B98A 4WP0A 1IBJA 2HOXA 3KE3A 3LWSA 4I8AA 3A8UX 1QITA 4OBVA 3NDNA 3OKSA 3VOMA 1LC5A 2WK7A 5EFSA 8AATA 1YJZA 3FQ7A 1RV4A 3E6GA 2CTZA 5EAVA 3CQ4A 1MLYA 5E4ZA 4ITXA 2VMPA 1C7GA 4AZJA 3CBFA 3DXWA 3LG0A 4OYTA 1EG5A 4Y0HA 1WYTB 4Q31A 3BC8A 4WYAA 2PB2A 3KKIA 2W7DA 3D6KA 3QI6A 2GB3A 3K40A 4BHDA 2JJHA 1WSTA 9AATA 3HL2A 4IX8A 2WK8A 2BI9A 2VLFA 3E77A 3FVXA 4KAMA 3GJUA 5E5IA 1ELUA 3ZRQA 1JG8A 1M32A 2AEUA 1J04A 3OP7A 4DGTA 3WKRA 3MC6C 1RVUA 3ISLA 3WGBA 1AX4A 4W1VA 2W7MA 2D64A 2GMUA 1OATA 1TOJA 2BI3A 2R5EA 2CINA 4FL0A 2DKJA 4AOAA 3LVMA 3E2ZB 3F0HA 2BI2A 4AO4A 4EB7A 3GSBA 4MQPA 1CQ7A 4LW4A 3GZDA 1ECXA 3PDBA 1ASAA 1MDXA 3DR4A 4RJYA 3WCNA 2D61A 2Q7WA 2QA3A 2JJEA 5IWQA 1KL1A 4O6ZA 4F5GA 1I41A 5K8BA 1QIRA 3FZ8A 1YAAA 4OBUA 1M0PA 3FZ6A 4AZKA 3I5TA 1BJWA 1VP4A 3FZ7A 4LNLA 2VMUA 4L0OA 4K2MA 4GE9A 1LKCA 1LS3A 4ZDOA 4LNJA 4TN4A 5G2PA 3JWBA 2Z67A 2VMTA 3FVSA 3GR9A 2HUUA 3DRDA 3AOVA 1IX6A 3E9KA 4ZM4A 3A9ZA 3AATA 3F9TA 2JG2A 2HORA 2BHXA 1C9CA 5I92A 2VGTA 1AKAA 1W7MA 1QJ3A 2BI5A 3IHJA 4P7YA 3I16A 3F6TA 3WY7A 4JE5D 1DJUA 3II0A 5TF5A 3PPLA 3P6KA 2AY7A 3JU7A 4FFCA 4GSAA 1B8GA 4W5KA 5G4IA 4PVFA 5M4BA 2VMSA 1S09A 2R5CA 2W7KA 4RIZA 1DTYA 2AY5A 2DGLA 1DFOA 2W8UA 1LK9A 1TOIA 3EI8A 4GRXA 4RAEA 1BJOB 2PO3A 4E3QA 1SZUA 1Z7DA 2ZP7A 3ASBA 3MAFA 4F5HA 3NYSA 2W7FA 1OHYA 3MKJA 3NU8A 1X28A 4IY7A 2GSAA 3K28A 1Y4IA 3ZZKA 5JAYA 1YJYA 3GBXA 1S07A 4MGRA 3B1EA 2V0YA 3RBFA 2FNIA 2D65A 1BJNA 1AJSA 1SZSA 1LW4A 2VLHA 2YCTA 2BYJA 4K2BA 4ZASA 2ZY3A 3LVLB 5HHYA 1AJSB 2W8TA 1AICA 1TOGA 3QBOA 4OT8A 5DJ9A 4PFFA 3CQ6A 1KKPA 3QM2A 4IXSA 5M4DA 3EZSA 4HVKA 5J8QA 1M6SA 1AIAA 2ZSLA 3B1CA 1AMQA 2W7JA 1G7XA 1WYVA 4ISYA 1QGNA 3LY1A 5EIGA 1ORDA 1X29A 4UHMA 4WBTA 4TV7A 2DGKA 1M4NA 5G0AA 3DC1A 4OCAA 1SF2A 3T32A 4JEXA 3VAXA 1V72A 1W7NA 4KYOA 4ZM3A 1LC7A 5AX8A 3UAKA 3GETA 4RLGA 2CB1A 3TATA 1GC2A 4XEWA 2OKKA 1TPLA 4F5FA 2DGMA 1TASA 1XEYA 1OXPA 1ZC9A 4PFNA 4ADBA 3B1DA 1ASDA 1IVRA 1OHWA 1SZKA 2ZY4A 2HOYA 2VMNA 1MDZA 4WYDA 1CQ6A 2HP1A 3FSLA 2F8JA 2VI9A 3MADA 4WLHA 2ZSMA 4ZSYA 1B9HA 1BQDA 1OXOA 1GDEA 2GQNA 4WXBA 2ZC0A 4Y0DA 4RITA 5EQCA 1MDOA 4A0FA 4A0HA 2Z1YA 3KGWA 1IUGA 2OKJA 3H7FA 4N0WA 1ASNA 1GC3A 3BN1A 3H14A 3HBXA 4MKKA 2AATA 3AEMC 3MC6A 3DXVA 2Z1ZA 1AHEA 4UHNA 2YRIA 3WLXA 2Z61A 1ARGA 1FC4A 2BYLA 2BWOA 2Z9VA 1ASEA 1SPAA 1MLZA 3FRKA 4BA4A 2DKBA 2YHKA
chains in the Genus database with same CATH superfamily
3WGCA 1CZEA 1DGEA 1RV3A 3NUBA 3DYDA 4R5FA 3FKDA 3HDOA 2YRRA 4AO9A 2AY6A 2YKXA 2VGWA 2G6WA 2QB3A 4CVQA 3EUCA 3GZCA 3ZRPA 3UE8A 1TOKA 3EIBA 3FTBA 4BQ0A 3CQ5A 1B9IA 3ASAA 1TATA 3B46A 4F5KA 1AY5A 2D7YA 4R5ZA 1KL2A 3PDBB 1C7OA 1IAXA 1GBNA 3AEJA 4P3MA 4TMRA 1ARSA 4AH3A 4NOGA 1ZODA 1PMOA 2Z20A 2C0RA 1O69A 1TOEA 3PA9A 2BIGA 2WK9A 2Z9XA 4ZLVA 2X8UA 3AV7A 4A72A 2E7UA 1CL2A 3DR7A 3RCHA 4RJ0A 3QN6A 4XJMA 3LV2A 4CBRA 3BWNC 4ZWVA 2NMPA 1BS0A 2FYFA 3P1TA 4MSOA 4F4EA 3W1JA 4H51A 2CH2A 3AENA 2JISA 1P3WA 1IX8A 1AAMA 2DOUA 3FQ8A 3PDXA 4WB0A 1YOOA 2OATA 1D7VA 1CS1A 2HUIA 3JTXA 2VI8A 1EJIA 2QBTA 4XJLA 1B5PA 1ASCA 2FNUA 4WYFA 4A6RA 3PJ0A 1S06A 2CANA 4W1WA 1E5EA 2W7EA 5FT5A 1C0NA 2C81A 1V2EA 2QSRA 2C7TA 1WYUA 3VK3A 4CXQA 1DJEA 2R5CB 5HDMA 4R2NA 3W1IA 4DQ6A 1C7NA 1D7UA 2OGAA 4J5UA 5KTBA 3TCMA 2E7IA 3TFTA 1BQAA 4W91A 1V2DA 4WYEA 3MAFB 3NNKA 3LVJA 1IX7A 1FG7A 3VK2A 3QHXA 2TPLA 2D5YA 2D63A 2VMXA 3FDDA 4M2KA 4GEBA 3PD6A 4R8DA 4WXFA 1UU0A 3DODA 1H1CA 4JEYA 4WXGA 2FM1A 4ZDLA 4ADDA 4ADCA 2X5DA 4F5JA 2WB6A 3QPGA 1ARTA 1AHYA 1S08A 2JJGA 2VGSA 4DBCA 2EZ2A 2QLRA 4Q6RA 1BJ4A 2CY8A 3DU4A 2EZ1A 2EPJA 3E2FA 1DKAA 3L8AA 4UHOA 2R2NA 2GMSA 3E2YA 1PG8A 1JS3A 2YCNA 1W23A 1AAWA 1DGDA 2EH6A 2AY1A 4JEWA 2RFVA 3N7NA 2W7IA 2AY2A 4E3RA 1KAFA 1G7WA 1SFFA 1VJOA 1N2TA 2FQ6A 4IXOA 4ZDPA 1G4XA 2D7ZA 2X3LA 3N0LA 1PFFA 4JF1A 3W1HA 1ARIA 2EO5A 3ELEA 1I48A 2YOBA 3A2BA 4IYOA 1WYVB 2HOZA 1MAPA 5EIGB 4MY5A 2W8WA 2W8JA 1CJ0A 1O4SA 4M2MA 4WYGA 1YJSA 4XQ2A 5EUEA 3MAUA 5FT8A 1JF9A 2BI1A 1MGVA 1O62A 1YIZA 4QGRA 1WKGA 4WLJA 2EYQA 1LC8A 1AY4A 2FN6A 3EI5A 4XAUA 3AELA 5F8VA 1MAQA 3BWOA 5E3KA 5LHAA 3PAAA 4EMYA 4F5LA 4N0BA 4HF8A 5BJ3A 2AEVA 1S0AA 1IJIA 2HP2A 1LW5A 5EUDA 1QISA 2JJFA 3FFRA 1AMAA 3NYTA 4Q75A 4Y0IA 3B8XA 4K2IA 3AEMA 4RKDA 4ATQA 2O1BA 1X2AA 1YIYA 1H0CA 2CH1A 3PIUA 1M7YA 1QZ9A 2W7LA 3COGA 2VIBA 4CBSA 4E77A 2YKVA 1BKGA 1V2FA 3A9XA 4EB5A 1RVYA 4RM1A 1GC4A 2ZUKA 4EU1A 3ATHA 3TQXA 1O61A 2ZY5A 1N31A 4JF0A 4W8IA 2VIAA 2E54A 3TFUA 5BJ4A 1YNUA 3G7QA 5FT6A 3WKSA 1GCKA 4J8LA 2OQXA 1XI9A 4ITGA 2JGTA 4UOYA 2C44A 3CAIA 1WYTA 1CZCA 1AMSA 2VGVA 2VMQA 3K7YA 3WZFA 4A00A 5M49A 2BKWA 4KXKA 3QGUA 3EI6A 2ORDA 5EAAA 3L44A 3VK4A 3DZZA 4ZWMA 3G0TA 1BT4A 4CXRA 4LW2A 1EQBA 2WKAA 3HLMA 3ZZJA 4RKCA 2AY9A 4MQQA 2VMZA 4OTLA 3NRAA 1QJ5A 4U1TA 1ASGA 1ASLA 4MKJA 4A6UA 2DR1A 1KMKA 2ZJGA 1CL1A 1AKCA 2Z9UA 3BWNA 5DB5A 3WX9A 1B4XA 1UU2A 2CSTA 3AEOA 1AY8A 4ZSWA 3RBLA 3MEBA 3AOWA 1BW0A 1CQ8A 3E2ZA 5LH9A 3BS8A 2CJDA 4JEVA 2VYCA 3WCOA 5HXXA 3RCHB 1Z3ZA 4A0RA 2O7CA 5D95A 3JZLA 4E1OA 7AATA 3BB8A 3RI6A 2W8VA 4LNMA 2ZYJA 3AENB 1I29A 3IF2A 2HZPA 3KGXA 3GWPA 3N75A 3PGYA 4LC3A 2VGZA 1PMMA 2X5FA 1ARHA 2VMOA 4WB0B 1SVVA 3LVKA 1M0NA 2AY4A 3GZDC 1M0OA 1I43A 2A1VA 3FQAA 3RQ1A 1VEFA 1T3IA 2HUFA 4XK1A 5M46A 2CJGA 2BWPA 4A0GA 2V1PA 3AEJC 3EI7A 5G2QA 2XBNA 3G8MA 1ASBA 4F5IA 4W1XA 3JWAA 4OMAA 3FDBA 4OC9A 4U2HA 1WYUB 5F9SA 1D7RA 1AHGA 1KMJA 3EIAA 2BIAA 2XH1A 4XJOA 3NUIA 4B9BA 5C6UA 3M5UA 3R9AA 4ADEA 1D2FA 3MBBA 3BV0A 3I4JA 4UQVA 4JEZA 2YKYA 1ASMA 3NU7A 3N4RA 4GE7A 5G09A 3PD6B 3EZ1A 2VMWA 3ECDA 2VGUA 1GEYA 3BCAA 4F5MA 1BJOA 4ZAHA 1ASFA 3NX3A 3USFA 2D66A 2W7HA 1ZOBA 1U08A 1C4KA 1AKBA 4EFFA 2VMVA 3NYUA 2YKUA 3AEPA 1TARA 1OHVA 2BWNA 3N5MA 4IW7A 5G4JA 1G4VA 2AY8A 1WKHA 4M2JA 5DJ1A 2E7JA 4PIWA 4BA5A 1GEXA 2CFBA 1UKJA 5FT4A 2EGYA 2QMAA 2YCPA 1JS6A 2VMYA 3ACZA 1X0MA 3ZRRA 4BMKA 4IXZA 3EI9A 2OGEA 4A6TA 4IYOB 2FKIA 1FG3A 2O0RA 3FD0A 3R4TA 3NTJA 4WYCA 4K05A 4WD2A 4MQRA 1AMRA 4GE4A 3FVUA 1N8PA 2BIEA 1D7SA 1IAYA 1AHXA 4Q76A 2R0TA 3HQTA 2KFPA 1J32A 2ZY2A 2Z9WA 1W7LA 1KKJA 3HMUA 3A9YA 3N4SA 1AJRA 1GC0A 2W7GA 2QB2A 2PB0A 1DJ9A 1GEWA 3JW9A 1ELQA 1W3UA 1E5FA 3FCRA 5DX5A 1GD9A 5EUNA 5D5SA 3VP6A 3BCXA 2CJHA 3UWCA 2AY3A 4XJPA 3FFHA 3BCBA 1AHFA 2VMRA 3ELPA 3HT4A 4JE5A 4GDYA 3HVYA 1UU1A 1M0QA 1B5OA 3Q8NA 3RUYA 1AIBA 4ATPA 4B98A 4WP0A 1IBJA 2HOXA 3KE3A 3LWSA 4I8AA 3A8UX 1QITA 4OBVA 3NDNA 3OKSA 3VOMA 1LC5A 2WK7A 5EFSA 8AATA 1YJZA 3FQ7A 1RV4A 3E6GA 2CTZA 5EAVA 3CQ4A 1MLYA 5E4ZA 4ITXA 2VMPA 1C7GA 4AZJA 3CBFA 3DXWA 3LG0A 4OYTA 1EG5A 4Y0HA 1WYTB 4Q31A 3BC8A 4WYAA 2PB2A 3KKIA 2W7DA 3D6KA 3QI6A 2GB3A 3K40A 4BHDA 2JJHA 1WSTA 9AATA 3HL2A 4IX8A 2WK8A 2BI9A 2VLFA 3E77A 3FVXA 4KAMA 3GJUA 5E5IA 1ELUA 3ZRQA 1JG8A 1M32A 2AEUA 1J04A 3OP7A 4DGTA 3WKRA 3MC6C 1RVUA 3ISLA 3WGBA 1AX4A 4W1VA 2W7MA 2D64A 2GMUA 1OATA 1TOJA 2BI3A 2R5EA 2CINA 4FL0A 2DKJA 4AOAA 3LVMA 3E2ZB 3F0HA 2BI2A 4AO4A 4EB7A 3GSBA 4MQPA 1CQ7A 4LW4A 3GZDA 1ECXA 3PDBA 1ASAA 1MDXA 3DR4A 4RJYA 2G7JA 3WCNA 2D61A 2Q7WA 2QA3A 2JJEA 5IWQA 1KL1A 4O6ZA 4F5GA 1I41A 5K8BA 1QIRA 3FZ8A 1YAAA 4OBUA 1M0PA 3FZ6A 4AZKA 3I5TA 1BJWA 1VP4A 3FZ7A 4LNLA 2VMUA 4L0OA 4K2MA 4GE9A 1LKCA 1LS3A 4ZDOA 4LNJA 4TN4A 5G2PA 3JWBA 2Z67A 2VMTA 3FVSA 3GR9A 2HUUA 3DRDA 3AOVA 1IX6A 3E9KA 4ZM4A 3A9ZA 3AATA 3F9TA 2JG2A 2HORA 2BHXA 1C9CA 5I92A 2VGTA 1AKAA 1W7MA 1QJ3A 2BI5A 3IHJA 4P7YA 3I16A 3F6TA 3WY7A 4JE5D 1DJUA 3II0A 5TF5A 3PPLA 3P6KA 2AY7A 3JU7A 4FFCA 4GSAA 1B8GA 4W5KA 5G4IA 4PVFA 5M4BA 2VMSA 1S09A 2R5CA 2W7KA 4RIZA 1DTYA 2AY5A 2DGLA 1DFOA 2W8UA 1LK9A 1TOIA 3EI8A 4GRXA 4RAEA 1BJOB 2PO3A 4E3QA 1SZUA 1Z7DA 2ZP7A 3ASBA 3MAFA 4F5HA 3NYSA 2W7FA 1OHYA 3MKJA 3NU8A 1X28A 4H63Q 4IY7A 2GSAA 3K28A 1Y4IA 3ZZKA 5JAYA 1YJYA 3GBXA 1S07A 4MGRA 3B1EA 2V0YA 3RBFA 2FNIA 2D65A 1BJNA 1AJSA 1SZSA 1LW4A 2VLHA 2YCTA 2BYJA 4K2BA 4ZASA 2ZY3A 3LVLB 5HHYA 1AJSB 2W8TA 1AICA 1TOGA 3QBOA 4OT8A 5DJ9A 4PFFA 3CQ6A 1KKPA 3QM2A 4IXSA 5M4DA 3EZSA 4HVKA 5J8QA 1M6SA 1AIAA 2ZSLA 3B1CA 1AMQA 2W7JA 1G7XA 1WYVA 4ISYA 3H9XA 1QGNA 3LY1A 5EIGA 1ORDA 1X29A 4UHMA 4WBTA 4TV7A 2DGKA 1M4NA 5G0AA 3DC1A 4OCAA 1SF2A 3T32A 4JEXA 3VAXA 1V72A 1W7NA 4KYOA 4ZM3A 1LC7A 5AX8A 3UAKA 3GETA 4RLGA 2CB1A 3TATA 1GC2A 4XEWA 2OKKA 1TPLA 4F5FA 2DGMA 1TASA 1XEYA 1OXPA 1ZC9A 4PFNA 4ADBA 3B1DA 1ASDA 1IVRA 1OHWA 1SZKA 2ZY4A 2HOYA 2VMNA 1MDZA 4WYDA 1CQ6A 2HP1A 3FSLA 2F8JA 2VI9A 3MADA 4WLHA 2ZSMA 4ZSYA 1B9HA 1BQDA 1OXOA 1GDEA 2GQNA 4WXBA 2ZC0A 4Y0DA 4RITA 5EQCA 1MDOA 4A0FA 4A0HA 2Z1YA 3KGWA 1IUGA 2OKJA 3H7FA 3N4XA 4N0WA 1ASNA 1GC3A 3BN1A 3H14A 3HBXA 4MKKA 2AATA 3AEMC 3MC6A 3DXVA 2Z1ZA 1AHEA 4UHNA 2YRIA 3WLXA 2Z61A 1ARGA 1FC4A 2BYLA 2BWOA 2Z9VA 1ASEA 1SPAA 1MLZA 3FRKA 4BA4A 2DKBA 2YHKA
chains in the Genus database with same CATH topology
3WGCA 1CZEA 1DGEA 1RV3A 3NUBA 3DYDA 4R5FA 3FKDA 3HDOA 2YRRA 4AO9A 2AY6A 2YKXA 2VGWA 2G6WA 2QB3A 4CVQA 3EUCA 3GZCA 3ZRPA 3UE8A 1TOKA 3EIBA 3FTBA 4BQ0A 3CQ5A 1B9IA 3ASAA 1TATA 3B46A 4F5KA 1AY5A 2D7YA 4R5ZA 1KL2A 3PDBB 1C7OA 1IAXA 1GBNA 3AEJA 4P3MA 4TMRA 1ARSA 4AH3A 4NOGA 1ZODA 1PMOA 2Z20A 2C0RA 1O69A 1TOEA 3PA9A 2BIGA 2WK9A 2Z9XA 4ZLVA 2X8UA 3AV7A 4A72A 2E7UA 1CL2A 3DR7A 3RCHA 4RJ0A 3QN6A 4XJMA 3LV2A 4CBRA 3BWNC 4ZWVA 2NMPA 1BS0A 2FYFA 3P1TA 4MSOA 4F4EA 3W1JA 4H51A 2CH2A 3AENA 2JISA 1P3WA 1IX8A 1AAMA 2DOUA 3FQ8A 3PDXA 4WB0A 1YOOA 2OATA 1D7VA 1CS1A 2HUIA 3JTXA 2VI8A 1EJIA 2QBTA 4XJLA 1B5PA 1ASCA 2FNUA 4WYFA 4A6RA 3PJ0A 1S06A 2CANA 4W1WA 1E5EA 2W7EA 5FT5A 1C0NA 2C81A 1V2EA 2QSRA 2C7TA 1WYUA 3VK3A 4CXQA 1DJEA 2R5CB 5HDMA 4R2NA 3W1IA 4DQ6A 1C7NA 1D7UA 2OGAA 4J5UA 5KTBA 3TCMA 2E7IA 3TFTA 1BQAA 4W91A 1V2DA 4WYEA 3MAFB 3NNKA 3LVJA 1IX7A 1FG7A 3VK2A 3QHXA 2TPLA 2D5YA 2D63A 2VMXA 3FDDA 4M2KA 4GEBA 3PD6A 4R8DA 4WXFA 1UU0A 3DODA 1H1CA 4JEYA 4WXGA 2FM1A 4ZDLA 4ADDA 4ADCA 2X5DA 4F5JA 2WB6A 3QPGA 1ARTA 1AHYA 1S08A 2JJGA 2VGSA 4DBCA 2EZ2A 2QLRA 4Q6RA 1BJ4A 2CY8A 3DU4A 2EZ1A 2EPJA 3E2FA 1DKAA 3L8AA 4UHOA 2R2NA 2GMSA 3E2YA 1PG8A 1JS3A 2YCNA 1W23A 1AAWA 1DGDA 2EH6A 2AY1A 4JEWA 2RFVA 3N7NA 2W7IA 2AY2A 4E3RA 1G7WA 1SFFA 1VJOA 1N2TA 2FQ6A 4IXOA 4ZDPA 1G4XA 2D7ZA 2X3LA 3N0LA 1PFFA 4JF1A 3W1HA 1ARIA 2EO5A 3ELEA 1I48A 2YOBA 3A2BA 4IYOA 1WYVB 2HOZA 1MAPA 5EIGB 4MY5A 2W8WA 2W8JA 1CJ0A 1O4SA 4M2MA 4WYGA 1YJSA 4XQ2A 5EUEA 3MAUA 5FT8A 1JF9A 2BI1A 1MGVA 1O62A 1YIZA 4QGRA 1WKGA 4WLJA 2EYQA 1LC8A 1AY4A 2FN6A 3EI5A 4XAUA 3AELA 5F8VA 1MAQA 3BWOA 5E3KA 5LHAA 3PAAA 4EMYA 4F5LA 4N0BA 4HF8A 5BJ3A 2AEVA 1S0AA 1IJIA 2HP2A 1LW5A 5EUDA 1QISA 2JJFA 3FFRA 1AMAA 3NYTA 4Q75A 4Y0IA 3B8XA 4K2IA 3AEMA 4RKDA 4ATQA 2O1BA 1X2AA 1YIYA 1H0CA 2CH1A 3PIUA 1M7YA 1QZ9A 2W7LA 3COGA 2VIBA 4CBSA 4E77A 2YKVA 1BKGA 1V2FA 3A9XA 4EB5A 1RVYA 4RM1A 1GC4A 2ZUKA 4EU1A 3ATHA 3TQXA 1O61A 2ZY5A 1N31A 4JF0A 4W8IA 2VIAA 2E54A 3TFUA 5BJ4A 1YNUA 3G7QA 5FT6A 3WKSA 1GCKA 4J8LA 2OQXA 1XI9A 4ITGA 2JGTA 4UOYA 2C44A 3CAIA 1WYTA 1CZCA 1AMSA 2VGVA 2VMQA 3K7YA 3WZFA 4A00A 5M49A 2BKWA 4KXKA 3QGUA 3EI6A 2ORDA 5EAAA 3L44A 3VK4A 3DZZA 4ZWMA 3G0TA 1BT4A 4CXRA 4LW2A 1EQBA 2WKAA 3HLMA 3ZZJA 4RKCA 2AY9A 4MQQA 2VMZA 4OTLA 3NRAA 1QJ5A 4U1TA 1ASGA 1ASLA 4MKJA 4A6UA 2DR1A 1KMKA 2ZJGA 1CL1A 1AKCA 2Z9UA 3BWNA 5DB5A 3WX9A 1B4XA 1UU2A 2CSTA 3AEOA 1AY8A 4ZSWA 3RBLA 3MEBA 3AOWA 1BW0A 1CQ8A 3E2ZA 5LH9A 3BS8A 2CJDA 4JEVA 2VYCA 3WCOA 5HXXA 3RCHB 1Z3ZA 4A0RA 2O7CA 5D95A 3JZLA 4E1OA 7AATA 3BB8A 3RI6A 2W8VA 4LNMA 2ZYJA 3AENB 1I29A 3IF2A 2HZPA 3KGXA 3GWPA 3N75A 3PGYA 4LC3A 2VGZA 1PMMA 2X5FA 1ARHA 2VMOA 4WB0B 1SVVA 3LVKA 1M0NA 2AY4A 3GZDC 1M0OA 1I43A 2A1VA 3FQAA 3RQ1A 1VEFA 1T3IA 2HUFA 4XK1A 5M46A 2CJGA 2BWPA 4A0GA 2V1PA 3AEJC 3EI7A 5G2QA 2XBNA 3G8MA 1ASBA 4F5IA 4W1XA 3JWAA 4OMAA 3FDBA 4OC9A 4U2HA 1WYUB 5F9SA 1D7RA 1AHGA 1KMJA 3EIAA 2BIAA 2XH1A 4XJOA 3NUIA 4B9BA 5C6UA 3M5UA 3R9AA 4ADEA 1D2FA 3MBBA 3BV0A 3I4JA 4UQVA 4JEZA 2YKYA 1ASMA 3NU7A 3N4RA 4GE7A 5G09A 3PD6B 3EZ1A 2VMWA 3ECDA 2VGUA 1GEYA 3BCAA 4F5MA 1BJOA 4ZAHA 1ASFA 3NX3A 3USFA 2D66A 2W7HA 1ZOBA 1U08A 1C4KA 1AKBA 4EFFA 2VMVA 3NYUA 2YKUA 3AEPA 1TARA 1OHVA 2BWNA 3N5MA 4IW7A 5G4JA 1G4VA 2AY8A 1WKHA 4M2JA 5DJ1A 2E7JA 4PIWA 4BA5A 1GEXA 2CFBA 1UKJA 5FT4A 2EGYA 2QMAA 2YCPA 1JS6A 2VMYA 3ACZA 1X0MA 3ZRRA 4BMKA 4IXZA 3EI9A 2OGEA 4A6TA 4IYOB 2FKIA 1FG3A 2O0RA 3FD0A 3R4TA 3NTJA 4WYCA 4K05A 4WD2A 4MQRA 1AMRA 4GE4A 3FVUA 1N8PA 2BIEA 1D7SA 1IAYA 1AHXA 4Q76A 2R0TA 3HQTA 2KFPA 1J32A 2ZY2A 2Z9WA 1W7LA 1KKJA 3HMUA 3A9YA 3N4SA 1AJRA 1GC0A 2W7GA 2QB2A 2PB0A 1DJ9A 1GEWA 3JW9A 1ELQA 1W3UA 1E5FA 3FCRA 5DX5A 1GD9A 5EUNA 5D5SA 3VP6A 3BCXA 2CJHA 3UWCA 2AY3A 4XJPA 3FFHA 3BCBA 1AHFA 2VMRA 3ELPA 3HT4A 4JE5A 4GDYA 3HVYA 1UU1A 1M0QA 1B5OA 3Q8NA 3RUYA 1AIBA 4ATPA 4B98A 4WP0A 1IBJA 2HOXA 3KE3A 3LWSA 4I8AA 3A8UX 1QITA 4OBVA 3NDNA 3OKSA 3VOMA 1LC5A 2WK7A 5EFSA 8AATA 1YJZA 3FQ7A 1RV4A 3E6GA 2CTZA 5EAVA 3CQ4A 1MLYA 5E4ZA 4ITXA 2VMPA 1C7GA 4AZJA 3CBFA 3DXWA 3LG0A 4OYTA 1EG5A 4Y0HA 1WYTB 4Q31A 3BC8A 4WYAA 2PB2A 3KKIA 2W7DA 3D6KA 3QI6A 2GB3A 3K40A 4BHDA 2JJHA 1WSTA 9AATA 3HL2A 4IX8A 2WK8A 2BI9A 2VLFA 3E77A 3FVXA 4KAMA 3GJUA 5E5IA 1ELUA 3ZRQA 1JG8A 1M32A 2AEUA 1J04A 3OP7A 4DGTA 3WKRA 3MC6C 1RVUA 3ISLA 3WGBA 1AX4A 4W1VA 2W7MA 2D64A 2GMUA 1OATA 1TOJA 2BI3A 2R5EA 2CINA 4FL0A 2DKJA 4AOAA 3LVMA 3E2ZB 3F0HA 2BI2A 4AO4A 4EB7A 3GSBA 4MQPA 1CQ7A 4LW4A 3GZDA 1ECXA 3PDBA 1ASAA 1MDXA 3DR4A 4RJYA 2G7JA 3WCNA 2D61A 2Q7WA 2QA3A 2JJEA 5IWQA 1KL1A 4O6ZA 4F5GA 1I41A 5K8BA 1QIRA 3FZ8A 1YAAA 4OBUA 1M0PA 3FZ6A 4AZKA 3I5TA 1BJWA 1VP4A 3FZ7A 4LNLA 2VMUA 4L0OA 4K2MA 4GE9A 1LKCA 1LS3A 4ZDOA 4LNJA 4TN4A 5G2PA 3JWBA 2Z67A 2VMTA 3FVSA 3GR9A 2HUUA 3DRDA 3AOVA 1IX6A 3E9KA 4ZM4A 3A9ZA 3AATA 3F9TA 2JG2A 2HORA 2BHXA 1C9CA 5I92A 2VGTA 1AKAA 1W7MA 1QJ3A 2BI5A 3IHJA 4P7YA 3I16A 3F6TA 3WY7A 4JE5D 1DJUA 3II0A 5TF5A 3PPLA 3P6KA 2AY7A 3JU7A 4FFCA 4GSAA 1B8GA 4W5KA 5G4IA 4PVFA 5M4BA 2VMSA 1S09A 2R5CA 2W7KA 4RIZA 1DTYA 2AY5A 2DGLA 1DFOA 2W8UA 1LK9A 1TOIA 3EI8A 4GRXA 4RAEA 1BJOB 2PO3A 4E3QA 1SZUA 1Z7DA 2ZP7A 3ASBA 3MAFA 4F5HA 3NYSA 2W7FA 1OHYA 3MKJA 3NU8A 1X28A 4H63Q 4IY7A 2GSAA 3K28A 1Y4IA 3ZZKA 5JAYA 1YJYA 3GBXA 1S07A 4MGRA 3B1EA 2V0YA 3RBFA 2FNIA 2D65A 1BJNA 1AJSA 1SZSA 1LW4A 2VLHA 2YCTA 2BYJA 4K2BA 4ZASA 2ZY3A 3LVLB 5HHYA 1AJSB 2W8TA 1AICA 1TOGA 3QBOA 4OT8A 5DJ9A 4PFFA 3CQ6A 1KKPA 3QM2A 4IXSA 5M4DA 3EZSA 4HVKA 5J8QA 1M6SA 1AIAA 2ZSLA 3B1CA 1AMQA 2W7JA 1G7XA 1WYVA 4ISYA 3H9XA 1QGNA 3LY1A 5EIGA 1ORDA 1X29A 4UHMA 4WBTA 4TV7A 2DGKA 1M4NA 5G0AA 3DC1A 4OCAA 1SF2A 3T32A 4JEXA 3VAXA 1V72A 1W7NA 4KYOA 4ZM3A 1LC7A 5AX8A 3UAKA 3GETA 4RLGA 2CB1A 3TATA 1GC2A 4XEWA 2OKKA 1TPLA 4F5FA 2DGMA 1TASA 1XEYA 1OXPA 1ZC9A 4PFNA 4ADBA 3B1DA 1ASDA 1IVRA 1OHWA 1SZKA 2ZY4A 2HOYA 2VMNA 1MDZA 4WYDA 1CQ6A 2HP1A 3FSLA 2F8JA 2VI9A 3MADA 4WLHA 2ZSMA 4ZSYA 1B9HA 1BQDA 1OXOA 1GDEA 2GQNA 4WXBA 2ZC0A 4Y0DA 4RITA 5EQCA 1MDOA 4A0FA 4A0HA 2Z1YA 3KGWA 1IUGA 2OKJA 3H7FA 3N4XA 4N0WA 1ASNA 1GC3A 3BN1A 3H14A 3HBXA 4MKKA 2AATA 3AEMC 3MC6A 3DXVA 2Z1ZA 1AHEA 4UHNA 2YRIA 3WLXA 2Z61A 1ARGA 1FC4A 2BYLA 2BWOA 2Z9VA 1ASEA 1SPAA 1MLZA 3FRKA 4BA4A 2DKBA 2YHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGC A;  1CZE A;  1DGE A;  1RV3 A;  3NUB A;  3DYD A;  4R5F A;  3FKD A;  3HDO A;  2YRR A;  4AO9 A;  2AY6 A;  2YKX A;  2VGW A;  2G6W A;  2QB3 A;  4CVQ A;  3EUC A;  3GZC A;  3ZRP A;  3UE8 A;  1TOK A;  3EIB A;  3FTB A;  4BQ0 A;  3CQ5 A;  1B9I A;  3ASA A;  1TAT A;  3B46 A;  4F5K A;  1AY5 A;  2D7Y A;  4R5Z A;  1KL2 A;  3PDB B;  1C7O A;  1IAX A;  1GBN A;  3AEJ A;  4P3M A;  4TMR A;  1ARS A;  4AH3 A;  4NOG A;  1ZOD A;  1PMO A;  2Z20 A;  2C0R A;  1O69 A;  1TOE A;  3PA9 A;  2BIG A;  2WK9 A;  2Z9X A;  4ZLV A;  2X8U A;  3AV7 A;  4A72 A;  2E7U A;  1CL2 A;  3DR7 A;  3RCH A;  4RJ0 A;  3QN6 A;  4XJM A;  3LV2 A;  4CBR A;  3BWN C;  4ZWV A;  2NMP A;  1BS0 A;  2FYF A;  3P1T A;  4MSO A;  4F4E A;  3W1J A;  4H51 A;  2CH2 A;  3AEN A;  2JIS A;  1P3W A;  1IX8 A;  1AAM A;  2DOU A;  3FQ8 A;  3PDX A;  4WB0 A;  1YOO A;  2OAT A;  1D7V A;  1CS1 A;  2HUI A;  3JTX A;  2VI8 A;  1EJI A;  2QBT A;  4XJL A;  1B5P A;  1ASC A;  2FNU A;  4WYF A;  4A6R A;  3PJ0 A;  1S06 A;  2CAN A;  4W1W A;  1E5E A;  2W7E A;  5FT5 A;  1C0N A;  2C81 A;  1V2E A;  2C7T A;  1WYU A;  3VK3 A;  4CXQ A;  1DJE A;  2R5C B;  5HDM A;  4R2N A;  3W1I A;  4DQ6 A;  1C7N A;  1D7U A;  2OGA A;  4J5U A;  3TCM A;  2E7I A;  3TFT A;  1BQA A;  4W91 A;  1V2D A;  4WYE A;  3MAF B;  3NNK A;  3LVJ A;  1IX7 A;  1FG7 A;  3VK2 A;  3QHX A;  2TPL A;  2D5Y A;  2D63 A;  2VMX A;  3FDD A;  4M2K A;  4GEB A;  3PD6 A;  4R8D A;  4WXF A;  1UU0 A;  3DOD A;  1H1C A;  4JEY A;  4WXG A;  2FM1 A;  4ZDL A;  4ADD A;  4ADC A;  2X5D A;  4F5J A;  3QPG A;  1ART A;  1AHY A;  1S08 A;  2JJG A;  2VGS A;  4DBC A;  2EZ2 A;  2QLR A;  4Q6R A;  1BJ4 A;  2CY8 A;  3DU4 A;  2EZ1 A;  2EPJ A;  3E2F A;  1DKA A;  3L8A A;  4UHO A;  2R2N A;  2GMS A;  3E2Y A;  1PG8 A;  1JS3 A;  2YCN A;  1W23 A;  1AAW A;  1DGD A;  2EH6 A;  2AY1 A;  4JEW A;  2RFV A;  2W7I A;  2AY2 A;  4E3R A;  1G7W A;  1SFF A;  1VJO A;  1N2T A;  2FQ6 A;  4IXO A;  4ZDP A;  1G4X A;  2D7Z A;  2X3L A;  3N0L A;  1PFF A;  4JF1 A;  3W1H A;  1ARI A;  2EO5 A;  3ELE A;  1I48 A;  2YOB A;  3A2B A;  4IYO A;  1WYV B;  2HOZ A;  1MAP A;  5EIG B;  4MY5 A;  2W8W A;  2W8J A;  1CJ0 A;  1O4S A;  4M2M A;  4WYG A;  1YJS A;  4XQ2 A;  5EUE A;  3MAU A;  5FT8 A;  1JF9 A;  2BI1 A;  1MGV A;  1O62 A;  1YIZ A;  4QGR A;  1WKG A;  4WLJ A;  1LC8 A;  1AY4 A;  2FN6 A;  3EI5 A;  4XAU A;  3AEL A;  5F8V A;  1MAQ A;  3BWO A;  5E3K A;  5LHA A;  3PAA A;  4EMY A;  4F5L A;  4N0B A;  4HF8 A;  5BJ3 A;  2AEV A;  1S0A A;  1IJI A;  2HP2 A;  1LW5 A;  5EUD A;  1QIS A;  2JJF A;  3FFR A;  1AMA A;  3NYT A;  4Q75 A;  4Y0I A;  3B8X A;  4K2I A;  3AEM A;  4RKD A;  4ATQ A;  2O1B A;  1X2A A;  1YIY A;  1H0C A;  2CH1 A;  3PIU A;  1M7Y A;  1QZ9 A;  2W7L A;  3COG A;  2VIB A;  4CBS A;  4E77 A;  2YKV A;  1BKG A;  1V2F A;  3A9X A;  4EB5 A;  1RVY A;  4RM1 A;  1GC4 A;  2ZUK A;  4EU1 A;  3ATH A;  3TQX A;  1O61 A;  2ZY5 A;  1N31 A;  4JF0 A;  4W8I A;  2VIA A;  2E54 A;  3TFU A;  5BJ4 A;  1YNU A;  3G7Q A;  5FT6 A;  3WKS A;  1GCK A;  4J8L A;  2OQX A;  1XI9 A;  4ITG A;  2JGT A;  4UOY A;  2C44 A;  3CAI A;  1WYT A;  1CZC A;  1AMS A;  2VGV A;  2VMQ A;  3K7Y A;  3WZF A;  4A00 A;  5M49 A;  2BKW A;  4KXK A;  3QGU A;  3EI6 A;  2ORD A;  5EAA A;  3L44 A;  3VK4 A;  3DZZ A;  4ZWM A;  3G0T A;  1BT4 A;  4CXR A;  4LW2 A;  1EQB A;  2WKA A;  3HLM A;  3ZZJ A;  4RKC A;  2AY9 A;  4MQQ A;  2VMZ A;  4OTL A;  3NRA A;  1QJ5 A;  4U1T A;  1ASG A;  1ASL A;  4MKJ A;  4A6U A;  2DR1 A;  1KMK A;  2ZJG A;  1CL1 A;  1AKC A;  2Z9U A;  3BWN A;  5DB5 A;  3WX9 A;  1B4X A;  1UU2 A;  2CST A;  3AEO A;  1AY8 A;  4ZSW A;  3RBL A;  3MEB A;  3AOW A;  1BW0 A;  1CQ8 A;  3E2Z A;  5LH9 A;  3BS8 A;  2CJD A;  4JEV A;  2VYC A;  3WCO A;  5HXX A;  3RCH B;  1Z3Z A;  4A0R A;  2O7C A;  5D95 A;  3JZL A;  4E1O A;  7AAT A;  3BB8 A;  3RI6 A;  2W8V A;  4LNM A;  2ZYJ A;  3AEN B;  1I29 A;  3IF2 A;  2HZP A;  3KGX A;  3GWP A;  3N75 A;  3PGY A;  4LC3 A;  2VGZ A;  1PMM A;  2X5F A;  1ARH A;  2VMO A;  4WB0 B;  1SVV A;  3LVK A;  1M0N A;  2AY4 A;  3GZD C;  1M0O A;  1I43 A;  3FQA A;  3RQ1 A;  1VEF A;  1T3I A;  2HUF A;  4XK1 A;  5M46 A;  2CJG A;  2BWP A;  4A0G A;  2V1P A;  3AEJ C;  3EI7 A;  5G2Q A;  2XBN A;  3G8M A;  1ASB A;  4F5I A;  4W1X A;  3JWA A;  4OMA A;  3FDB A;  4OC9 A;  4U2H A;  1WYU B;  5F9S A;  1D7R A;  1AHG A;  1KMJ A;  3EIA A;  2BIA A;  2XH1 A;  4XJO A;  3NUI A;  4B9B A;  5C6U A;  3M5U A;  3R9A A;  4ADE A;  1D2F A;  3MBB A;  3BV0 A;  3I4J A;  4UQV A;  4JEZ A;  2YKY A;  1ASM A;  3NU7 A;  4GE7 A;  5G09 A;  3PD6 B;  3EZ1 A;  2VMW A;  3ECD A;  2VGU A;  1GEY A;  3BCA A;  4F5M A;  1BJO A;  4ZAH A;  1ASF A;  3NX3 A;  3USF A;  2D66 A;  2W7H A;  1ZOB A;  1U08 A;  1C4K A;  1AKB A;  4EFF A;  2VMV A;  3NYU A;  2YKU A;  3AEP A;  1TAR A;  1OHV A;  2BWN A;  3N5M A;  4IW7 A;  5G4J A;  1G4V A;  2AY8 A;  1WKH A;  4M2J A;  5DJ1 A;  2E7J A;  4PIW A;  4BA5 A;  1GEX A;  2CFB A;  1UKJ A;  5FT4 A;  2EGY A;  2QMA A;  2YCP A;  1JS6 A;  2VMY A;  3ACZ A;  1X0M A;  3ZRR A;  4BMK A;  4IXZ A;  3EI9 A;  2OGE A;  4A6T A;  4IYO B;  1FG3 A;  2O0R A;  3FD0 A;  3R4T A;  3NTJ A;  4WYC A;  4WD2 A;  4MQR A;  1AMR A;  4GE4 A;  3FVU A;  1N8P A;  2BIE A;  1D7S A;  1IAY A;  1AHX A;  4Q76 A;  2R0T A;  3HQT A;  1J32 A;  2ZY2 A;  2Z9W A;  1W7L A;  1KKJ A;  3HMU A;  3A9Y A;  1AJR A;  1GC0 A;  2W7G A;  2QB2 A;  2PB0 A;  1DJ9 A;  1GEW A;  3JW9 A;  1ELQ A;  1W3U A;  1E5F A;  3FCR A;  5DX5 A;  1GD9 A;  5EUN A;  5D5S A;  3VP6 A;  3BCX A;  2CJH A;  3UWC A;  2AY3 A;  4XJP A;  3FFH A;  3BCB A;  1AHF A;  2VMR A;  3ELP A;  3HT4 A;  4JE5 A;  4GDY A;  3HVY A;  1UU1 A;  1M0Q A;  1B5O A;  3Q8N A;  3RUY A;  1AIB A;  4ATP A;  4B98 A;  4WP0 A;  1IBJ A;  2HOX A;  3KE3 A;  3LWS A;  4I8A A;  3A8U X;  1QIT A;  4OBV A;  3NDN A;  3OKS A;  3VOM A;  1LC5 A;  2WK7 A;  5EFS A;  8AAT A;  1YJZ A;  3FQ7 A;  1RV4 A;  3E6G A;  2CTZ A;  5EAV A;  3CQ4 A;  1MLY A;  5E4Z A;  4ITX A;  2VMP A;  1C7G A;  4AZJ A;  3CBF A;  3DXW A;  3LG0 A;  4OYT A;  1EG5 A;  4Y0H A;  1WYT B;  4Q31 A;  3BC8 A;  4WYA A;  2PB2 A;  3KKI A;  2W7D A;  3D6K A;  3QI6 A;  2GB3 A;  3K40 A;  4BHD A;  2JJH A;  1WST A;  9AAT A;  3HL2 A;  4IX8 A;  2WK8 A;  2BI9 A;  2VLF A;  3E77 A;  3FVX A;  4KAM A;  3GJU A;  5E5I A;  1ELU A;  3ZRQ A;  1JG8 A;  1M32 A;  2AEU A;  1J04 A;  3OP7 A;  4DGT A;  3WKR A;  3MC6 C;  1RVU A;  3ISL A;  3WGB A;  1AX4 A;  4W1V A;  2W7M A;  2D64 A;  2GMU A;  1OAT A;  1TOJ A;  2BI3 A;  2R5E A;  2CIN A;  4FL0 A;  2DKJ A;  4AOA A;  3LVM A;  3E2Z B;  3F0H A;  2BI2 A;  4AO4 A;  4EB7 A;  3GSB A;  4MQP A;  1CQ7 A;  4LW4 A;  3GZD A;  1ECX A;  3PDB A;  1ASA A;  1MDX A;  3DR4 A;  4RJY A;  3WCN A;  2D61 A;  2Q7W A;  2QA3 A;  2JJE A;  5IWQ A;  1KL1 A;  4O6Z A;  4F5G A;  1I41 A;  5K8B A;  1QIR A;  3FZ8 A;  1YAA A;  4OBU A;  1M0P A;  3FZ6 A;  4AZK A;  3I5T A;  1BJW A;  1VP4 A;  3FZ7 A;  4LNL A;  2VMU A;  4L0O A;  4K2M A;  4GE9 A;  1LKC A;  1LS3 A;  4ZDO A;  4LNJ A;  4TN4 A;  5G2P A;  3JWB A;  2Z67 A;  2VMT A;  3FVS A;  3GR9 A;  2HUU A;  3DRD A;  3AOV A;  1IX6 A;  3E9K A;  4ZM4 A;  3A9Z A;  3AAT A;  3F9T A;  2JG2 A;  2HOR A;  2BHX A;  1C9C A;  5I92 A;  2VGT A;  1AKA A;  1W7M A;  1QJ3 A;  2BI5 A;  3IHJ A;  4P7Y A;  3I16 A;  3F6T A;  3WY7 A;  4JE5 D;  1DJU A;  3II0 A;  5TF5 A;  3PPL A;  3P6K A;  2AY7 A;  3JU7 A;  4FFC A;  4GSA A;  1B8G A;  4W5K A;  5G4I A;  4PVF A;  5M4B A;  2VMS A;  1S09 A;  2R5C A;  2W7K A;  4RIZ A;  1DTY A;  2AY5 A;  2DGL A;  1DFO A;  2W8U A;  1LK9 A;  1TOI A;  3EI8 A;  4GRX A;  4RAE A;  1BJO B;  2PO3 A;  4E3Q A;  1SZU A;  1Z7D A;  2ZP7 A;  3ASB A;  3MAF A;  4F5H A;  3NYS A;  2W7F A;  1OHY A;  3MKJ A;  3NU8 A;  1X28 A;  4IY7 A;  2GSA A;  3K28 A;  1Y4I A;  3ZZK A;  5JAY A;  1YJY A;  3GBX A;  1S07 A;  4MGR A;  3B1E A;  2V0Y A;  3RBF A;  2FNI A;  2D65 A;  1BJN A;  1AJS A;  1SZS A;  1LW4 A;  2VLH A;  2YCT A;  2BYJ A;  4K2B A;  4ZAS A;  2ZY3 A;  3LVL B;  5HHY A;  1AJS B;  2W8T A;  1AIC A;  1TOG A;  3QBO A;  4OT8 A;  5DJ9 A;  4PFF A;  3CQ6 A;  1KKP A;  3QM2 A;  4IXS A;  5M4D A;  3EZS A;  4HVK A;  5J8Q A;  1M6S A;  1AIA A;  2ZSL A;  3B1C A;  1AMQ A;  2W7J A;  1G7X A;  1WYV A;  4ISY A;  1QGN A;  3LY1 A;  5EIG A;  1ORD A;  1X29 A;  4UHM A;  4WBT A;  4TV7 A;  2DGK A;  1M4N A;  5G0A A;  3DC1 A;  4OCA A;  1SF2 A;  3T32 A;  4JEX A;  3VAX A;  1V72 A;  1W7N A;  4KYO A;  4ZM3 A;  1LC7 A;  5AX8 A;  3UAK A;  3GET A;  4RLG A;  2CB1 A;  3TAT A;  1GC2 A;  4XEW A;  2OKK A;  1TPL A;  4F5F A;  2DGM A;  1TAS A;  1XEY A;  1OXP A;  1ZC9 A;  4PFN A;  4ADB A;  3B1D A;  1ASD A;  1IVR A;  1OHW A;  1SZK A;  2ZY4 A;  2HOY A;  2VMN A;  1MDZ A;  4WYD A;  1CQ6 A;  2HP1 A;  3FSL A;  2F8J A;  2VI9 A;  3MAD A;  4WLH A;  2ZSM A;  4ZSY A;  1B9H A;  1BQD A;  1OXO A;  1GDE A;  2GQN A;  4WXB A;  2ZC0 A;  4Y0D A;  4RIT A;  5EQC A;  1MDO A;  4A0F A;  4A0H A;  2Z1Y A;  3KGW A;  1IUG A;  2OKJ A;  3H7F A;  4N0W A;  1ASN A;  1GC3 A;  3BN1 A;  3H14 A;  3HBX A;  4MKK A;  2AAT A;  3AEM C;  3MC6 A;  3DXV A;  2Z1Z A;  1AHE A;  4UHN A;  2YRI A;  3WLX A;  2Z61 A;  1ARG A;  1FC4 A;  2BYL A;  2BWO A;  2Z9V A;  1ASE A;  1SPA A;  1MLZ A;  3FRK A;  4BA4 A;  2DKB A;  2YHK A; 
#chains in the Genus database with same CATH topology
 3WGC A;  1CZE A;  1DGE A;  1RV3 A;  3NUB A;  3DYD A;  4R5F A;  3FKD A;  3HDO A;  2YRR A;  4AO9 A;  2AY6 A;  2YKX A;  2VGW A;  2G6W A;  2QB3 A;  4CVQ A;  3EUC A;  3GZC A;  3ZRP A;  3UE8 A;  1TOK A;  3EIB A;  3FTB A;  4BQ0 A;  3CQ5 A;  1B9I A;  3ASA A;  1TAT A;  3B46 A;  4F5K A;  1AY5 A;  2D7Y A;  4R5Z A;  1KL2 A;  3PDB B;  1C7O A;  1IAX A;  1GBN A;  3AEJ A;  4P3M A;  4TMR A;  1ARS A;  4AH3 A;  4NOG A;  1ZOD A;  1PMO A;  2Z20 A;  2C0R A;  1O69 A;  1TOE A;  3PA9 A;  2BIG A;  2WK9 A;  2Z9X A;  4ZLV A;  2X8U A;  3AV7 A;  4A72 A;  2E7U A;  1CL2 A;  3DR7 A;  3RCH A;  4RJ0 A;  3QN6 A;  4XJM A;  3LV2 A;  4CBR A;  3BWN C;  4ZWV A;  2NMP A;  1BS0 A;  2FYF A;  3P1T A;  4MSO A;  4F4E A;  3W1J A;  4H51 A;  2CH2 A;  3AEN A;  2JIS A;  1P3W A;  1IX8 A;  1AAM A;  2DOU A;  3FQ8 A;  3PDX A;  4WB0 A;  1YOO A;  2OAT A;  1D7V A;  1CS1 A;  2HUI A;  3JTX A;  2VI8 A;  1EJI A;  2QBT A;  4XJL A;  1B5P A;  1ASC A;  2FNU A;  4WYF A;  4A6R A;  3PJ0 A;  1S06 A;  2CAN A;  4W1W A;  1E5E A;  2W7E A;  5FT5 A;  1C0N A;  2C81 A;  1V2E A;  2QSR A;  2C7T A;  1WYU A;  3VK3 A;  4CXQ A;  1DJE A;  2R5C B;  5HDM A;  4R2N A;  3W1I A;  4DQ6 A;  1C7N A;  1D7U A;  2OGA A;  4J5U A;  5KTB A;  3TCM A;  2E7I A;  3TFT A;  1BQA A;  4W91 A;  1V2D A;  4WYE A;  3MAF B;  3NNK A;  3LVJ A;  1IX7 A;  1FG7 A;  3VK2 A;  3QHX A;  2TPL A;  2D5Y A;  2D63 A;  2VMX A;  3FDD A;  4M2K A;  4GEB A;  3PD6 A;  4R8D A;  4WXF A;  1UU0 A;  3DOD A;  1H1C A;  4JEY A;  4WXG A;  2FM1 A;  4ZDL A;  4ADD A;  4ADC A;  2X5D A;  4F5J A;  2WB6 A;  3QPG A;  1ART A;  1AHY A;  1S08 A;  2JJG A;  2VGS A;  4DBC A;  2EZ2 A;  2QLR A;  4Q6R A;  1BJ4 A;  2CY8 A;  3DU4 A;  2EZ1 A;  2EPJ A;  3E2F A;  1DKA A;  3L8A A;  4UHO A;  2R2N A;  2GMS A;  3E2Y A;  1PG8 A;  1JS3 A;  2YCN A;  1W23 A;  1AAW A;  1DGD A;  2EH6 A;  2AY1 A;  4JEW A;  2RFV A;  3N7N A;  2W7I A;  2AY2 A;  4E3R A;  1KAF A;  1G7W A;  1SFF A;  1VJO A;  1N2T A;  2FQ6 A;  4IXO A;  4ZDP A;  1G4X A;  2D7Z A;  2X3L A;  3N0L A;  1PFF A;  4JF1 A;  3W1H A;  1ARI A;  2EO5 A;  3ELE A;  1I48 A;  2YOB A;  3A2B A;  4IYO A;  1WYV B;  2HOZ A;  1MAP A;  5EIG B;  4MY5 A;  2W8W A;  2W8J A;  1CJ0 A;  1O4S A;  4M2M A;  4WYG A;  1YJS A;  4XQ2 A;  5EUE A;  3MAU A;  5FT8 A;  1JF9 A;  2BI1 A;  1MGV A;  1O62 A;  1YIZ A;  4QGR A;  1WKG A;  4WLJ A;  2EYQ A;  1LC8 A;  1AY4 A;  2FN6 A;  3EI5 A;  4XAU A;  3AEL A;  5F8V A;  1MAQ A;  3BWO A;  5E3K A;  5LHA A;  3PAA A;  4EMY A;  4F5L A;  4N0B A;  4HF8 A;  5BJ3 A;  2AEV A;  1S0A A;  1IJI A;  2HP2 A;  1LW5 A;  5EUD A;  1QIS A;  2JJF A;  3FFR A;  1AMA A;  3NYT A;  4Q75 A;  4Y0I A;  3B8X A;  4K2I A;  3AEM A;  4RKD A;  4ATQ A;  2O1B A;  1X2A A;  1YIY A;  1H0C A;  2CH1 A;  3PIU A;  1M7Y A;  1QZ9 A;  2W7L A;  3COG A;  2VIB A;  4CBS A;  4E77 A;  2YKV A;  1BKG A;  1V2F A;  3A9X A;  4EB5 A;  1RVY A;  4RM1 A;  1GC4 A;  2ZUK A;  4EU1 A;  3ATH A;  3TQX A;  1O61 A;  2ZY5 A;  1N31 A;  4JF0 A;  4W8I A;  2VIA A;  2E54 A;  3TFU A;  5BJ4 A;  1YNU A;  3G7Q A;  5FT6 A;  3WKS A;  1GCK A;  4J8L A;  2OQX A;  1XI9 A;  4ITG A;  2JGT A;  4UOY A;  2C44 A;  3CAI A;  1WYT A;  1CZC A;  1AMS A;  2VGV A;  2VMQ A;  3K7Y A;  3WZF A;  4A00 A;  5M49 A;  2BKW A;  4KXK A;  3QGU A;  3EI6 A;  2ORD A;  5EAA A;  3L44 A;  3VK4 A;  3DZZ A;  4ZWM A;  3G0T A;  1BT4 A;  4CXR A;  4LW2 A;  1EQB A;  2WKA A;  3HLM A;  3ZZJ A;  4RKC A;  2AY9 A;  4MQQ A;  2VMZ A;  4OTL A;  3NRA A;  1QJ5 A;  4U1T A;  1ASG A;  1ASL A;  4MKJ A;  4A6U A;  2DR1 A;  1KMK A;  2ZJG A;  1CL1 A;  1AKC A;  2Z9U A;  3BWN A;  5DB5 A;  3WX9 A;  1B4X A;  1UU2 A;  2CST A;  3AEO A;  1AY8 A;  4ZSW A;  3RBL A;  3MEB A;  3AOW A;  1BW0 A;  1CQ8 A;  3E2Z A;  5LH9 A;  3BS8 A;  2CJD A;  4JEV A;  2VYC A;  3WCO A;  5HXX A;  3RCH B;  1Z3Z A;  4A0R A;  2O7C A;  5D95 A;  3JZL A;  4E1O A;  7AAT A;  3BB8 A;  3RI6 A;  2W8V A;  4LNM A;  2ZYJ A;  3AEN B;  1I29 A;  3IF2 A;  2HZP A;  3KGX A;  3GWP A;  3N75 A;  3PGY A;  4LC3 A;  2VGZ A;  1PMM A;  2X5F A;  1ARH A;  2VMO A;  4WB0 B;  1SVV A;  3LVK A;  1M0N A;  2AY4 A;  3GZD C;  1M0O A;  1I43 A;  2A1V A;  3FQA A;  3RQ1 A;  1VEF A;  1T3I A;  2HUF A;  4XK1 A;  5M46 A;  2CJG A;  2BWP A;  4A0G A;  2V1P A;  3AEJ C;  3EI7 A;  5G2Q A;  2XBN A;  3G8M A;  1ASB A;  4F5I A;  4W1X A;  3JWA A;  4OMA A;  3FDB A;  4OC9 A;  4U2H A;  1WYU B;  5F9S A;  1D7R A;  1AHG A;  1KMJ A;  3EIA A;  2BIA A;  2XH1 A;  4XJO A;  3NUI A;  4B9B A;  5C6U A;  3M5U A;  3R9A A;  4ADE A;  1D2F A;  3MBB A;  3BV0 A;  3I4J A;  4UQV A;  4JEZ A;  2YKY A;  1ASM A;  3NU7 A;  3N4R A;  4GE7 A;  5G09 A;  3PD6 B;  3EZ1 A;  2VMW A;  3ECD A;  2VGU A;  1GEY A;  3BCA A;  4F5M A;  1BJO A;  4ZAH A;  1ASF A;  3NX3 A;  3USF A;  2D66 A;  2W7H A;  1ZOB A;  1U08 A;  1C4K A;  1AKB A;  4EFF A;  2VMV A;  3NYU A;  2YKU A;  3AEP A;  1TAR A;  1OHV A;  2BWN A;  3N5M A;  4IW7 A;  5G4J A;  1G4V A;  2AY8 A;  1WKH A;  4M2J A;  5DJ1 A;  2E7J A;  4PIW A;  4BA5 A;  1GEX A;  2CFB A;  1UKJ A;  5FT4 A;  2EGY A;  2QMA A;  2YCP A;  1JS6 A;  2VMY A;  3ACZ A;  1X0M A;  3ZRR A;  4BMK A;  4IXZ A;  3EI9 A;  2OGE A;  4A6T A;  4IYO B;  2FKI A;  1FG3 A;  2O0R A;  3FD0 A;  3R4T A;  3NTJ A;  4WYC A;  4K05 A;  4WD2 A;  4MQR A;  1AMR A;  4GE4 A;  3FVU A;  1N8P A;  2BIE A;  1D7S A;  1IAY A;  1AHX A;  4Q76 A;  2R0T A;  3HQT A;  2KFP A;  1J32 A;  2ZY2 A;  2Z9W A;  1W7L A;  1KKJ A;  3HMU A;  3A9Y A;  3N4S A;  1AJR A;  1GC0 A;  2W7G A;  2QB2 A;  2PB0 A;  1DJ9 A;  1GEW A;  3JW9 A;  1ELQ A;  1W3U A;  1E5F A;  3FCR A;  5DX5 A;  1GD9 A;  5EUN A;  5D5S A;  3VP6 A;  3BCX A;  2CJH A;  3UWC A;  2AY3 A;  4XJP A;  3FFH A;  3BCB A;  1AHF A;  2VMR A;  3ELP A;  3HT4 A;  4JE5 A;  4GDY A;  3HVY A;  1UU1 A;  1M0Q A;  1B5O A;  3Q8N A;  3RUY A;  1AIB A;  4ATP A;  4B98 A;  4WP0 A;  1IBJ A;  2HOX A;  3KE3 A;  3LWS A;  4I8A A;  3A8U X;  1QIT A;  4OBV A;  3NDN A;  3OKS A;  3VOM A;  1LC5 A;  2WK7 A;  5EFS A;  8AAT A;  1YJZ A;  3FQ7 A;  1RV4 A;  3E6G A;  2CTZ A;  5EAV A;  3CQ4 A;  1MLY A;  5E4Z A;  4ITX A;  2VMP A;  1C7G A;  4AZJ A;  3CBF A;  3DXW A;  3LG0 A;  4OYT A;  1EG5 A;  4Y0H A;  1WYT B;  4Q31 A;  3BC8 A;  4WYA A;  2PB2 A;  3KKI A;  2W7D A;  3D6K A;  3QI6 A;  2GB3 A;  3K40 A;  4BHD A;  2JJH A;  1WST A;  9AAT A;  3HL2 A;  4IX8 A;  2WK8 A;  2BI9 A;  2VLF A;  3E77 A;  3FVX A;  4KAM A;  3GJU A;  5E5I A;  1ELU A;  3ZRQ A;  1JG8 A;  1M32 A;  2AEU A;  1J04 A;  3OP7 A;  4DGT A;  3WKR A;  3MC6 C;  1RVU A;  3ISL A;  3WGB A;  1AX4 A;  4W1V A;  2W7M A;  2D64 A;  2GMU A;  1OAT A;  1TOJ A;  2BI3 A;  2R5E A;  2CIN A;  4FL0 A;  2DKJ A;  4AOA A;  3LVM A;  3E2Z B;  3F0H A;  2BI2 A;  4AO4 A;  4EB7 A;  3GSB A;  4MQP A;  1CQ7 A;  4LW4 A;  3GZD A;  1ECX A;  3PDB A;  1ASA A;  1MDX A;  3DR4 A;  4RJY A;  2G7J A;  3WCN A;  2D61 A;  2Q7W A;  2QA3 A;  2JJE A;  5IWQ A;  1KL1 A;  4O6Z A;  4F5G A;  1I41 A;  5K8B A;  1QIR A;  3FZ8 A;  1YAA A;  4OBU A;  1M0P A;  3FZ6 A;  4AZK A;  3I5T A;  1BJW A;  1VP4 A;  3FZ7 A;  4LNL A;  2VMU A;  4L0O A;  4K2M A;  4GE9 A;  1LKC A;  1LS3 A;  4ZDO A;  4LNJ A;  4TN4 A;  5G2P A;  3JWB A;  2Z67 A;  2VMT A;  3FVS A;  3GR9 A;  2HUU A;  3DRD A;  3AOV A;  1IX6 A;  3E9K A;  4ZM4 A;  3A9Z A;  3AAT A;  3F9T A;  2JG2 A;  2HOR A;  2BHX A;  1C9C A;  5I92 A;  2VGT A;  1AKA A;  1W7M A;  1QJ3 A;  2BI5 A;  3IHJ A;  4P7Y A;  3I16 A;  3F6T A;  3WY7 A;  4JE5 D;  1DJU A;  3II0 A;  5TF5 A;  3PPL A;  3P6K A;  2AY7 A;  3JU7 A;  4FFC A;  4GSA A;  1B8G A;  4W5K A;  5G4I A;  4PVF A;  5M4B A;  2VMS A;  1S09 A;  2R5C A;  2W7K A;  4RIZ A;  1DTY A;  2AY5 A;  2DGL A;  1DFO A;  2W8U A;  1LK9 A;  1TOI A;  3EI8 A;  4GRX A;  4RAE A;  1BJO B;  2PO3 A;  4E3Q A;  1SZU A;  1Z7D A;  2ZP7 A;  3ASB A;  3MAF A;  4F5H A;  3NYS A;  2W7F A;  1OHY A;  3MKJ A;  3NU8 A;  1X28 A;  4H63 Q;  4IY7 A;  2GSA A;  3K28 A;  1Y4I A;  3ZZK A;  5JAY A;  1YJY A;  3GBX A;  1S07 A;  4MGR A;  3B1E A;  2V0Y A;  3RBF A;  2FNI A;  2D65 A;  1BJN A;  1AJS A;  1SZS A;  1LW4 A;  2VLH A;  2YCT A;  2BYJ A;  4K2B A;  4ZAS A;  2ZY3 A;  3LVL B;  5HHY A;  1AJS B;  2W8T A;  1AIC A;  1TOG A;  3QBO A;  4OT8 A;  5DJ9 A;  4PFF A;  3CQ6 A;  1KKP A;  3QM2 A;  4IXS A;  5M4D A;  3EZS A;  4HVK A;  5J8Q A;  1M6S A;  1AIA A;  2ZSL A;  3B1C A;  1AMQ A;  2W7J A;  1G7X A;  1WYV A;  4ISY A;  3H9X A;  1QGN A;  3LY1 A;  5EIG A;  1ORD A;  1X29 A;  4UHM A;  4WBT A;  4TV7 A;  2DGK A;  1M4N A;  5G0A A;  3DC1 A;  4OCA A;  1SF2 A;  3T32 A;  4JEX A;  3VAX A;  1V72 A;  1W7N A;  4KYO A;  4ZM3 A;  1LC7 A;  5AX8 A;  3UAK A;  3GET A;  4RLG A;  2CB1 A;  3TAT A;  1GC2 A;  4XEW A;  2OKK A;  1TPL A;  4F5F A;  2DGM A;  1TAS A;  1XEY A;  1OXP A;  1ZC9 A;  4PFN A;  4ADB A;  3B1D A;  1ASD A;  1IVR A;  1OHW A;  1SZK A;  2ZY4 A;  2HOY A;  2VMN A;  1MDZ A;  4WYD A;  1CQ6 A;  2HP1 A;  3FSL A;  2F8J A;  2VI9 A;  3MAD A;  4WLH A;  2ZSM A;  4ZSY A;  1B9H A;  1BQD A;  1OXO A;  1GDE A;  2GQN A;  4WXB A;  2ZC0 A;  4Y0D A;  4RIT A;  5EQC A;  1MDO A;  4A0F A;  4A0H A;  2Z1Y A;  3KGW A;  1IUG A;  2OKJ A;  3H7F A;  3N4X A;  4N0W A;  1ASN A;  1GC3 A;  3BN1 A;  3H14 A;  3HBX A;  4MKK A;  2AAT A;  3AEM C;  3MC6 A;  3DXV A;  2Z1Z A;  1AHE A;  4UHN A;  2YRI A;  3WLX A;  2Z61 A;  1ARG A;  1FC4 A;  2BYL A;  2BWO A;  2Z9V A;  1ASE A;  1SPA A;  1MLZ A;  3FRK A;  4BA4 A;  2DKB A;  2YHK A; 
#chains in the Genus database with same CATH homology
 3WGC A;  1CZE A;  1DGE A;  1RV3 A;  3NUB A;  3DYD A;  4R5F A;  3FKD A;  3HDO A;  2YRR A;  4AO9 A;  2AY6 A;  2YKX A;  2VGW A;  2G6W A;  2QB3 A;  4CVQ A;  3EUC A;  3GZC A;  3ZRP A;  3UE8 A;  1TOK A;  3EIB A;  3FTB A;  4BQ0 A;  3CQ5 A;  1B9I A;  3ASA A;  1TAT A;  3B46 A;  4F5K A;  1AY5 A;  2D7Y A;  4R5Z A;  1KL2 A;  3PDB B;  1C7O A;  1IAX A;  1GBN A;  3AEJ A;  4P3M A;  4TMR A;  1ARS A;  4AH3 A;  4NOG A;  1ZOD A;  1PMO A;  2Z20 A;  2C0R A;  1O69 A;  1TOE A;  3PA9 A;  2BIG A;  2WK9 A;  2Z9X A;  4ZLV A;  2X8U A;  3AV7 A;  4A72 A;  2E7U A;  1CL2 A;  3DR7 A;  3RCH A;  4RJ0 A;  3QN6 A;  4XJM A;  3LV2 A;  4CBR A;  3BWN C;  4ZWV A;  2NMP A;  1BS0 A;  2FYF A;  3P1T A;  4MSO A;  4F4E A;  3W1J A;  4H51 A;  2CH2 A;  3AEN A;  2JIS A;  1P3W A;  1IX8 A;  1AAM A;  2DOU A;  3FQ8 A;  3PDX A;  4WB0 A;  1YOO A;  2OAT A;  1D7V A;  1CS1 A;  2HUI A;  3JTX A;  2VI8 A;  1EJI A;  2QBT A;  4XJL A;  1B5P A;  1ASC A;  2FNU A;  4WYF A;  4A6R A;  3PJ0 A;  1S06 A;  2CAN A;  4W1W A;  1E5E A;  2W7E A;  5FT5 A;  1C0N A;  2C81 A;  1V2E A;  2QSR A;  2C7T A;  1WYU A;  3VK3 A;  4CXQ A;  1DJE A;  2R5C B;  5HDM A;  4R2N A;  3W1I A;  4DQ6 A;  1C7N A;  1D7U A;  2OGA A;  4J5U A;  5KTB A;  3TCM A;  2E7I A;  3TFT A;  1BQA A;  4W91 A;  1V2D A;  4WYE A;  3MAF B;  3NNK A;  3LVJ A;  1IX7 A;  1FG7 A;  3VK2 A;  3QHX A;  2TPL A;  2D5Y A;  2D63 A;  2VMX A;  3FDD A;  4M2K A;  4GEB A;  3PD6 A;  4R8D A;  4WXF A;  1UU0 A;  3DOD A;  1H1C A;  4JEY A;  4WXG A;  2FM1 A;  4ZDL A;  4ADD A;  4ADC A;  2X5D A;  4F5J A;  2WB6 A;  3QPG A;  1ART A;  1AHY A;  1S08 A;  2JJG A;  2VGS A;  4DBC A;  2EZ2 A;  2QLR A;  4Q6R A;  1BJ4 A;  2CY8 A;  3DU4 A;  2EZ1 A;  2EPJ A;  3E2F A;  1DKA A;  3L8A A;  4UHO A;  2R2N A;  2GMS A;  3E2Y A;  1PG8 A;  1JS3 A;  2YCN A;  1W23 A;  1AAW A;  1DGD A;  2EH6 A;  2AY1 A;  4JEW A;  2RFV A;  3N7N A;  2W7I A;  2AY2 A;  4E3R A;  1G7W A;  1SFF A;  1VJO A;  1N2T A;  2FQ6 A;  4IXO A;  4ZDP A;  1G4X A;  2D7Z A;  2X3L A;  3N0L A;  1PFF A;  4JF1 A;  3W1H A;  1ARI A;  2EO5 A;  3ELE A;  1I48 A;  2YOB A;  3A2B A;  4IYO A;  1WYV B;  2HOZ A;  1MAP A;  5EIG B;  4MY5 A;  2W8W A;  2W8J A;  1CJ0 A;  1O4S A;  4M2M A;  4WYG A;  1YJS A;  4XQ2 A;  5EUE A;  3MAU A;  5FT8 A;  1JF9 A;  2BI1 A;  1MGV A;  1O62 A;  1YIZ A;  4QGR A;  1WKG A;  4WLJ A;  2EYQ A;  1LC8 A;  1AY4 A;  2FN6 A;  3EI5 A;  4XAU A;  3AEL A;  5F8V A;  1MAQ A;  3BWO A;  5E3K A;  5LHA A;  3PAA A;  4EMY A;  4F5L A;  4N0B A;  4HF8 A;  5BJ3 A;  2AEV A;  1S0A A;  1IJI A;  2HP2 A;  1LW5 A;  5EUD A;  1QIS A;  2JJF A;  3FFR A;  1AMA A;  3NYT A;  4Q75 A;  4Y0I A;  3B8X A;  4K2I A;  3AEM A;  4RKD A;  4ATQ A;  2O1B A;  1X2A A;  1YIY A;  1H0C A;  2CH1 A;  3PIU A;  1M7Y A;  1QZ9 A;  2W7L A;  3COG A;  2VIB A;  4CBS A;  4E77 A;  2YKV A;  1BKG A;  1V2F A;  3A9X A;  4EB5 A;  1RVY A;  4RM1 A;  1GC4 A;  2ZUK A;  4EU1 A;  3ATH A;  3TQX A;  1O61 A;  2ZY5 A;  1N31 A;  4JF0 A;  4W8I A;  2VIA A;  2E54 A;  3TFU A;  5BJ4 A;  1YNU A;  3G7Q A;  5FT6 A;  3WKS A;  1GCK A;  4J8L A;  2OQX A;  1XI9 A;  4ITG A;  2JGT A;  4UOY A;  2C44 A;  3CAI A;  1WYT A;  1CZC A;  1AMS A;  2VGV A;  2VMQ A;  3K7Y A;  3WZF A;  4A00 A;  5M49 A;  2BKW A;  4KXK A;  3QGU A;  3EI6 A;  2ORD A;  5EAA A;  3L44 A;  3VK4 A;  3DZZ A;  4ZWM A;  3G0T A;  1BT4 A;  4CXR A;  4LW2 A;  1EQB A;  2WKA A;  3HLM A;  3ZZJ A;  4RKC A;  2AY9 A;  4MQQ A;  2VMZ A;  4OTL A;  3NRA A;  1QJ5 A;  4U1T A;  1ASG A;  1ASL A;  4MKJ A;  4A6U A;  2DR1 A;  1KMK A;  2ZJG A;  1CL1 A;  1AKC A;  2Z9U A;  3BWN A;  5DB5 A;  3WX9 A;  1B4X A;  1UU2 A;  2CST A;  3AEO A;  1AY8 A;  4ZSW A;  3RBL A;  3MEB A;  3AOW A;  1BW0 A;  1CQ8 A;  3E2Z A;  5LH9 A;  3BS8 A;  2CJD A;  4JEV A;  2VYC A;  3WCO A;  5HXX A;  3RCH B;  1Z3Z A;  4A0R A;  2O7C A;  5D95 A;  3JZL A;  4E1O A;  7AAT A;  3BB8 A;  3RI6 A;  2W8V A;  4LNM A;  2ZYJ A;  3AEN B;  1I29 A;  3IF2 A;  2HZP A;  3KGX A;  3GWP A;  3N75 A;  3PGY A;  4LC3 A;  2VGZ A;  1PMM A;  2X5F A;  1ARH A;  2VMO A;  4WB0 B;  1SVV A;  3LVK A;  1M0N A;  2AY4 A;  3GZD C;  1M0O A;  1I43 A;  2A1V A;  3FQA A;  3RQ1 A;  1VEF A;  1T3I A;  2HUF A;  4XK1 A;  5M46 A;  2CJG A;  2BWP A;  4A0G A;  2V1P A;  3AEJ C;  3EI7 A;  5G2Q A;  2XBN A;  3G8M A;  1ASB A;  4F5I A;  4W1X A;  3JWA A;  4OMA A;  3FDB A;  4OC9 A;  4U2H A;  1WYU B;  5F9S A;  1D7R A;  1AHG A;  1KMJ A;  3EIA A;  2BIA A;  2XH1 A;  4XJO A;  3NUI A;  4B9B A;  5C6U A;  3M5U A;  3R9A A;  4ADE A;  1D2F A;  3MBB A;  3BV0 A;  3I4J A;  4UQV A;  4JEZ A;  2YKY A;  1ASM A;  3NU7 A;  3N4R A;  4GE7 A;  5G09 A;  3PD6 B;  3EZ1 A;  2VMW A;  3ECD A;  2VGU A;  1GEY A;  3BCA A;  4F5M A;  1BJO A;  4ZAH A;  1ASF A;  3NX3 A;  3USF A;  2D66 A;  2W7H A;  1ZOB A;  1U08 A;  1C4K A;  1AKB A;  4EFF A;  2VMV A;  3NYU A;  2YKU A;  3AEP A;  1TAR A;  1OHV A;  2BWN A;  3N5M A;  4IW7 A;  5G4J A;  1G4V A;  2AY8 A;  1WKH A;  4M2J A;  5DJ1 A;  2E7J A;  4PIW A;  4BA5 A;  1GEX A;  2CFB A;  1UKJ A;  5FT4 A;  2EGY A;  2QMA A;  2YCP A;  1JS6 A;  2VMY A;  3ACZ A;  1X0M A;  3ZRR A;  4BMK A;  4IXZ A;  3EI9 A;  2OGE A;  4A6T A;  4IYO B;  2FKI A;  1FG3 A;  2O0R A;  3FD0 A;  3R4T A;  3NTJ A;  4WYC A;  4K05 A;  4WD2 A;  4MQR A;  1AMR A;  4GE4 A;  3FVU A;  1N8P A;  2BIE A;  1D7S A;  1IAY A;  1AHX A;  4Q76 A;  2R0T A;  3HQT A;  2KFP A;  1J32 A;  2ZY2 A;  2Z9W A;  1W7L A;  1KKJ A;  3HMU A;  3A9Y A;  3N4S A;  1AJR A;  1GC0 A;  2W7G A;  2QB2 A;  2PB0 A;  1DJ9 A;  1GEW A;  3JW9 A;  1ELQ A;  1W3U A;  1E5F A;  3FCR A;  5DX5 A;  1GD9 A;  5EUN A;  5D5S A;  3VP6 A;  3BCX A;  2CJH A;  3UWC A;  2AY3 A;  4XJP A;  3FFH A;  3BCB A;  1AHF A;  2VMR A;  3ELP A;  3HT4 A;  4JE5 A;  4GDY A;  3HVY A;  1UU1 A;  1M0Q A;  1B5O A;  3Q8N A;  3RUY A;  1AIB A;  4ATP A;  4B98 A;  4WP0 A;  1IBJ A;  2HOX A;  3KE3 A;  3LWS A;  4I8A A;  3A8U X;  1QIT A;  4OBV A;  3NDN A;  3OKS A;  3VOM A;  1LC5 A;  2WK7 A;  5EFS A;  8AAT A;  1YJZ A;  3FQ7 A;  1RV4 A;  3E6G A;  2CTZ A;  5EAV A;  3CQ4 A;  1MLY A;  5E4Z A;  4ITX A;  2VMP A;  1C7G A;  4AZJ A;  3CBF A;  3DXW A;  3LG0 A;  4OYT A;  1EG5 A;  4Y0H A;  1WYT B;  4Q31 A;  3BC8 A;  4WYA A;  2PB2 A;  3KKI A;  2W7D A;  3D6K A;  3QI6 A;  2GB3 A;  3K40 A;  4BHD A;  2JJH A;  1WST A;  9AAT A;  3HL2 A;  4IX8 A;  2WK8 A;  2BI9 A;  2VLF A;  3E77 A;  3FVX A;  4KAM A;  3GJU A;  5E5I A;  1ELU A;  3ZRQ A;  1JG8 A;  1M32 A;  2AEU A;  1J04 A;  3OP7 A;  4DGT A;  3WKR A;  3MC6 C;  1RVU A;  3ISL A;  3WGB A;  1AX4 A;  4W1V A;  2W7M A;  2D64 A;  2GMU A;  1OAT A;  1TOJ A;  2BI3 A;  2R5E A;  2CIN A;  4FL0 A;  2DKJ A;  4AOA A;  3LVM A;  3E2Z B;  3F0H A;  2BI2 A;  4AO4 A;  4EB7 A;  3GSB A;  4MQP A;  1CQ7 A;  4LW4 A;  3GZD A;  1ECX A;  3PDB A;  1ASA A;  1MDX A;  3DR4 A;  4RJY A;  2G7J A;  3WCN A;  2D61 A;  2Q7W A;  2QA3 A;  2JJE A;  5IWQ A;  1KL1 A;  4O6Z A;  4F5G A;  1I41 A;  5K8B A;  1QIR A;  3FZ8 A;  1YAA A;  4OBU A;  1M0P A;  3FZ6 A;  4AZK A;  3I5T A;  1BJW A;  1VP4 A;  3FZ7 A;  4LNL A;  2VMU A;  4L0O A;  4K2M A;  4GE9 A;  1LKC A;  1LS3 A;  4ZDO A;  4LNJ A;  4TN4 A;  5G2P A;  3JWB A;  2Z67 A;  2VMT A;  3FVS A;  3GR9 A;  2HUU A;  3DRD A;  3AOV A;  1IX6 A;  3E9K A;  4ZM4 A;  3A9Z A;  3AAT A;  3F9T A;  2JG2 A;  2HOR A;  2BHX A;  1C9C A;  5I92 A;  2VGT A;  1AKA A;  1W7M A;  1QJ3 A;  2BI5 A;  3IHJ A;  4P7Y A;  3I16 A;  3F6T A;  3WY7 A;  4JE5 D;  1DJU A;  3II0 A;  5TF5 A;  3PPL A;  3P6K A;  2AY7 A;  3JU7 A;  4FFC A;  4GSA A;  1B8G A;  4W5K A;  5G4I A;  4PVF A;  5M4B A;  2VMS A;  1S09 A;  2R5C A;  2W7K A;  4RIZ A;  1DTY A;  2AY5 A;  2DGL A;  1DFO A;  2W8U A;  1LK9 A;  1TOI A;  3EI8 A;  4GRX A;  4RAE A;  1BJO B;  2PO3 A;  4E3Q A;  1SZU A;  1Z7D A;  2ZP7 A;  3ASB A;  3MAF A;  4F5H A;  3NYS A;  2W7F A;  1OHY A;  3MKJ A;  3NU8 A;  1X28 A;  4H63 Q;  4IY7 A;  2GSA A;  3K28 A;  1Y4I A;  3ZZK A;  5JAY A;  1YJY A;  3GBX A;  1S07 A;  4MGR A;  3B1E A;  2V0Y A;  3RBF A;  2FNI A;  2D65 A;  1BJN A;  1AJS A;  1SZS A;  1LW4 A;  2VLH A;  2YCT A;  2BYJ A;  4K2B A;  4ZAS A;  2ZY3 A;  3LVL B;  5HHY A;  1AJS B;  2W8T A;  1AIC A;  1TOG A;  3QBO A;  4OT8 A;  5DJ9 A;  4PFF A;  3CQ6 A;  1KKP A;  3QM2 A;  4IXS A;  5M4D A;  3EZS A;  4HVK A;  5J8Q A;  1M6S A;  1AIA A;  2ZSL A;  3B1C A;  1AMQ A;  2W7J A;  1G7X A;  1WYV A;  4ISY A;  3H9X A;  1QGN A;  3LY1 A;  5EIG A;  1ORD A;  1X29 A;  4UHM A;  4WBT A;  4TV7 A;  2DGK A;  1M4N A;  5G0A A;  3DC1 A;  4OCA A;  1SF2 A;  3T32 A;  4JEX A;  3VAX A;  1V72 A;  1W7N A;  4KYO A;  4ZM3 A;  1LC7 A;  5AX8 A;  3UAK A;  3GET A;  4RLG A;  2CB1 A;  3TAT A;  1GC2 A;  4XEW A;  2OKK A;  1TPL A;  4F5F A;  2DGM A;  1TAS A;  1XEY A;  1OXP A;  1ZC9 A;  4PFN A;  4ADB A;  3B1D A;  1ASD A;  1IVR A;  1OHW A;  1SZK A;  2ZY4 A;  2HOY A;  2VMN A;  1MDZ A;  4WYD A;  1CQ6 A;  2HP1 A;  3FSL A;  2F8J A;  2VI9 A;  3MAD A;  4WLH A;  2ZSM A;  4ZSY A;  1B9H A;  1BQD A;  1OXO A;  1GDE A;  2GQN A;  4WXB A;  2ZC0 A;  4Y0D A;  4RIT A;  5EQC A;  1MDO A;  4A0F A;  4A0H A;  2Z1Y A;  3KGW A;  1IUG A;  2OKJ A;  3H7F A;  3N4X A;  4N0W A;  1ASN A;  1GC3 A;  3BN1 A;  3H14 A;  3HBX A;  4MKK A;  2AAT A;  3AEM C;  3MC6 A;  3DXV A;  2Z1Z A;  1AHE A;  4UHN A;  2YRI A;  3WLX A;  2Z61 A;  1ARG A;  1FC4 A;  2BYL A;  2BWO A;  2Z9V A;  1ASE A;  1SPA A;  1MLZ A;  3FRK A;  4BA4 A;  2DKB A;  2YHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...