1JGJA

Crystal structure of sensory rhodopsin ii at 2.4 angstroms: insights into color tuning and transducer interaction
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
217
structure length
217
Chain Sequence
MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYAVMALGVGWVPVAERTVFVPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFIGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVVLWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of sensory rhodopsin II at 2.4 angstroms: insights into color tuning and transducer interaction.
pubmed doi rcsb
molecule keywords SENSORY RHODOPSIN II
molecule tags Signaling protein
source organism Natronomonas pharaonis
total genus 91
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 1jgjA00
3CAPA 1H2SA 1VGOA 4FA7B 4GBRA 2KSAA 1E0PA 4NC3A 2I21A 1Q5IA 3OE9A 2JAFA 1TN5A 2HPYA 1M0KA 4A4MA 2YCWA 5JJNA 3C9MA 3AYNA 1M0LA 4BVNA 1S53A 3UZCA 4UHRA 3DQBA 5AX1A 5B6VA 4BEZA 4DKLA 1KMEA 4G71B 4JQ6A 5H2MA 3S8GB 1R2NA 1E12A 4MD1A 3NS0A 4XTOA 5AHZA 1QKOA 4J4QA 3T45A 1QM8A 3UG9A 4GP5B 2Y01A 3UTXA 3PWHA 2Y03A 2Y02A 1S54A 3ZPRA 1XJIA 4JR8A 5BR2A 2R4SA 3OE6A 2F95A 1P8IA 3QBIA 2X72A 3S3BB 3COCA 4G70B 4BV0A 3QJRB 2BRDA 5J7AA 1F4ZA 4X32A 1UCQA 1BRRA 5AX0A 1FBKA 1BRXA 5G2CA 1Q5JA 1AP9A 4XTLA 4UG2A 1O0AA 3ZEVA 5ITEA 3WQJA 5B6WA 3P0GA 3AYMA 3QBGA 1BRDA 2LNLA 4OV0A 5DHHA 4LDLA 2I20A 3VW7A 3QBKA 4IB4A 5B6ZA 3UONA 3D4SA 4GP8B 3PXOA 5DYSA 3QBLA 5ETZA 1XMEB 1X0K1 3HANA 4N4WA 1X0I1 1H68A 3HAPA 1C8SA 2YDOA 4FPDA 1QHJA 3OE0A 2NTWA 4PXKA 1JV6A 4KLYA 1KG9A 4TL3A 1DZEA 4MD2A 2Z55A 1S52A 4FBZA 3PQRA 2YCXA 4GYCA 4JKVA 4IAQA 2YCZA 1HZXA 1CWQA 5G53A 3REYA 3ODUA 1PXSA 5H2NA 5B6YA 5FJGA 5C1MA 1MGYA 1KG8A 3OAXA 1L0MA 1L9HA 3PBLA 3ABWA 4G7SB 5KKHA 4DJHA 2RH1A 3QJQB 4HYXA 3HASA 2WJKA 4DAJA 5G28A 1PXRA 3MBVA 5EN0A 3X3BA 1P8UA 3HARA 1XIOA 5AHYA 1VJMA 2R4RA 4G72B 3SN6R 5G36A 4XT1A 2Z73A 1X0SA 4QI1A 2KSBA 1P8HA 2KSYA 3QJUB 5LWEA 3S8FB 1BM1A 5AWZA 1JV7A 4XT3A 4MQTA 3NY8A 1TN0A 4K5YA 3QJVB 3NSBA 3VVKA 1IW6A 4AMIA 3EH3B 5B34A 4GPOA 5G54A 5H2KA 5TGZA 5H2JA 4IARA 3EH4B 1LN6A 4PXFA 4EIYA 3RZEA 3PDSA 3V2YA 1M0MA 2YDVA 2L6XA 2G87A 3QAKA 3S3CB 5H2HA 4QIDA 4MBSA 1S8JA 5A44A 3BVDB 1PY6A 1QKPA 3NYAA 2I35A 2QPEB 3HAOA 4MQSA 2NTUA 3UTWA 4EA3A 4AMJA 4L6RA 4WAVA 2Y04A 5H2OA 3RFMA 1C3WA 5F8UA 5A8EA 4XXJA 4HYJA 3VGAA 4WW3A 1R84A 3A7KA 4FAAB 5A45A 2ZZLA 2Y00A 3QDCA 4XTNA 5B6XA 1GU8A 4HWLA 4LDOA 3QAPA 3X3CA 1S51A 5B35A 3UTYA 3S3DB 3NY9A 4X1HA 5BR5A 5H2IA 1S8LA 1JFPA 3EMLA 5B0WA 2JAGA 1AT9A 5G2DA 1U19A 2WJLA 5ITCA 5AZDA 2VT4A 2AT9A 3VHZA 3OE8A 5G2AA 1IXFA 3V2WA 3CODA 4G7RB 4QRYA 3ZPQA 4X31A 4KNFA 4G7QB 1KGBA 3VG9A 2F93A 3UZAA 1C8RA 4BEYA 5JJJA 5DHGA 4N4YB 2QPDB 3KJ6A 2M3GA 2YCYA 3C9LA 3QJSB 1IW9A 3UTVA 4BUOA 1UAZA 5B2NA 4Y9HA 3VI0A 4BWBA 2PEDA 4N6HA 2I1XA 4L35A 1F88A 5H2PA 2J4YA 2EI4A 2ZFEA 1F50A 1EHKB 3HAQA 5JJEA 1FBBA 1GZMA 4EJ4A 4GP4B 5H2LA 4GRVA 3QJTB 1JGJA 4LDEA 1GUEA 2ZIYA 3EH5B 2KS9A 3AM6A 3DDLA
chains in the Genus database with same CATH superfamily
3CAPA 1H2SA 1VGOA 4FA7B 4GBRA 2KSAA 1E0PA 4NC3A 2I21A 1Q5IA 3OE9A 2JAFA 1TN5A 2HPYA 1M0KA 4A4MA 2YCWA 5JJNA 3C9MA 3AYNA 1M0LA 4BVNA 1S53A 3UZCA 4UHRA 3DQBA 5AX1A 5B6VA 4BEZA 4DKLA 1KMEA 4G71B 4JQ6A 5H2MA 3S8GB 1R2NA 1E12A 4MD1A 3NS0A 4XTOA 5AHZA 1QKOA 4J4QA 3T45A 1QM8A 3UG9A 4GP5B 2Y01A 3UTXA 3PWHA 2Y03A 2Y02A 1S54A 3ZPRA 1XJIA 4JR8A 5BR2A 2R4SA 3OE6A 2F95A 1P8IA 3QBIA 2X72A 3S3BB 3COCA 4G70B 4BV0A 3QJRB 2BRDA 5J7AA 1F4ZA 4X32A 1UCQA 1BRRA 5AX0A 1FBKA 1BRXA 5G2CA 1Q5JA 1AP9A 4XTLA 4UG2A 1O0AA 3ZEVA 5ITEA 3WQJA 5B6WA 3P0GA 3AYMA 3QBGA 1BRDA 2LNLA 4OV0A 5DHHA 4LDLA 2I20A 3VW7A 3QBKA 4IB4A 5B6ZA 3UONA 3D4SA 4GP8B 3PXOA 5DYSA 3QBLA 5ETZA 1XMEB 1X0K1 3HANA 4N4WA 1X0I1 1H68A 3HAPA 1C8SA 2YDOA 4FPDA 1QHJA 3OE0A 2NTWA 4PXKA 1JV6A 4KLYA 1KG9A 4TL3A 1DZEA 4MD2A 2Z55A 1S52A 4FBZA 3PQRA 2YCXA 4GYCA 4JKVA 4IAQA 2YCZA 1HZXA 1CWQA 5G53A 3REYA 3ODUA 1PXSA 5H2NA 5B6YA 5FJGA 5C1MA 1MGYA 1KG8A 3OAXA 1L0MA 1L9HA 3PBLA 3ABWA 4G7SB 5KKHA 4DJHA 2RH1A 3QJQB 4HYXA 3HASA 2WJKA 4DAJA 5G28A 1PXRA 3MBVA 5EN0A 4DS7E 3X3BA 1P8UA 3HARA 1XIOA 5AHYA 1VJMA 2R4RA 4G72B 3SN6R 5G36A 4XT1A 2Z73A 1X0SA 4QI1A 2KSBA 1P8HA 2KSYA 3QJUB 5LWEA 3S8FB 1BM1A 5AWZA 1JV7A 4XT3A 4MQTA 3NY8A 1TN0A 4K5YA 3QJVB 3NSBA 3VVKA 1IW6A 4AMIA 3EH3B 5B34A 4GPOA 5G54A 5H2KA 5TGZA 5H2JA 4IARA 3EH4B 1LN6A 4PXFA 4EIYA 3RZEA 3PDSA 3V2YA 1M0MA 2YDVA 2L6XA 2G87A 3QAKA 3S3CB 5H2HA 4QIDA 4MBSA 1S8JA 5A44A 3BVDB 1PY6A 1QKPA 3NYAA 2I35A 2QPEB 3HAOA 4MQSA 2NTUA 3UTWA 4EA3A 4AMJA 4L6RA 4WAVA 2Y04A 5H2OA 3RFMA 1C3WA 5F8UA 5A8EA 4XXJA 4HYJA 3VGAA 4WW3A 1R84A 3A7KA 4FAAB 5A45A 2ZZLA 2Y00A 3QDCA 4XTNA 5B6XA 1GU8A 4HWLA 4LDOA 3QAPA 3X3CA 1S51A 5B35A 3UTYA 3S3DB 3NY9A 4X1HA 5BR5A 5H2IA 1S8LA 1JFPA 3EMLA 5B0WA 2JAGA 1AT9A 5G2DA 1U19A 2WJLA 5ITCA 5AZDA 2VT4A 2AT9A 3VHZA 3OE8A 5G2AA 1IXFA 3V2WA 3CODA 4G7RB 4QRYA 3ZPQA 4X31A 4KNFA 4G7QB 1KGBA 3VG9A 2F93A 3UZAA 1C8RA 4BEYA 5JJJA 5DHGA 4N4YB 2QPDB 3KJ6A 2M3GA 2YCYA 3C9LA 3QJSB 1IW9A 3UTVA 4BUOA 1UAZA 5B2NA 4Y9HA 3VI0A 4BWBA 2PEDA 4N6HA 2I1XA 4L35A 1F88A 5H2PA 2J4YA 2EI4A 2ZFEA 1F50A 1EHKB 3HAQA 5JJEA 1FBBA 1GZMA 4EJ4A 4GP4B 5H2LA 4GRVA 3QJTB 1JGJA 4LDEA 1GUEA 2ZIYA 3EH5B 2KS9A 3AM6A 3DDLA
chains in the Genus database with same CATH topology
3CAPA 1H2SA 1VGOA 4FA7B 4GBRA 2KSAA 1E0PA 4NC3A 2I21A 1Q5IA 3OE9A 2JAFA 1TN5A 2HPYA 1M0KA 4A4MA 2YCWA 5JJNA 3C9MA 3AYNA 1M0LA 4BVNA 1S53A 3UZCA 4UHRA 3DQBA 5AX1A 5B6VA 4BEZA 4DKLA 1KMEA 4G71B 4JQ6A 5H2MA 3S8GB 1R2NA 1E12A 4MD1A 3NS0A 4XTOA 5AHZA 1QKOA 4J4QA 3T45A 1QM8A 3UG9A 4GP5B 2Y01A 3UTXA 3PWHA 2Y03A 2Y02A 1S54A 3ZPRA 1XJIA 4JR8A 5BR2A 2R4SA 3OE6A 2F95A 1P8IA 3QBIA 2X72A 3S3BB 3COCA 4G70B 4BV0A 3QJRB 2BRDA 5J7AA 1F4ZA 4X32A 1UCQA 1BRRA 5AX0A 1FBKA 1BRXA 5G2CA 1Q5JA 1AP9A 4XTLA 4UG2A 1O0AA 3ZEVA 5ITEA 3WQJA 5B6WA 3P0GA 3AYMA 3QBGA 1BRDA 2LNLA 4OV0A 5DHHA 4LDLA 2I20A 3VW7A 3QBKA 4IB4A 5B6ZA 3UONA 3D4SA 4GP8B 3PXOA 5DYSA 3QBLA 5ETZA 1XMEB 1X0K1 3HANA 4N4WA 1X0I1 1H68A 3HAPA 1C8SA 2YDOA 4FPDA 1QHJA 3OE0A 2NTWA 4PXKA 1JV6A 4KLYA 1KG9A 4TL3A 1DZEA 4MD2A 2Z55A 1S52A 4FBZA 3PQRA 2YCXA 4GYCA 4JKVA 4IAQA 2YCZA 1HZXA 1CWQA 5G53A 3REYA 3ODUA 1PXSA 5H2NA 5B6YA 5FJGA 5C1MA 1MGYA 1KG8A 3OAXA 1L0MA 1L9HA 3PBLA 3ABWA 4G7SB 5KKHA 4DJHA 2RH1A 3QJQB 4HYXA 3HASA 2WJKA 4DAJA 5G28A 1PXRA 3MBVA 5EN0A 4DS7E 3X3BA 1P8UA 3HARA 1XIOA 5AHYA 1VJMA 2R4RA 4G72B 3SN6R 5G36A 4XT1A 2Z73A 1X0SA 4QI1A 2KSBA 1P8HA 2KSYA 3QJUB 5LWEA 3S8FB 1BM1A 5AWZA 1JV7A 4XT3A 4MQTA 3NY8A 1TN0A 4K5YA 3QJVB 3NSBA 3VVKA 1IW6A 4AMIA 3EH3B 5B34A 4GPOA 5G54A 5H2KA 5TGZA 5H2JA 4IARA 3EH4B 1LN6A 4PXFA 4EIYA 3RZEA 3PDSA 3V2YA 1M0MA 2YDVA 2L6XA 2G87A 3QAKA 3S3CB 5H2HA 4QIDA 4MBSA 1S8JA 5A44A 3BVDB 1PY6A 1QKPA 3NYAA 2I35A 2QPEB 3HAOA 4MQSA 2NTUA 3UTWA 4EA3A 4AMJA 4L6RA 4WAVA 2Y04A 5H2OA 3RFMA 1C3WA 5F8UA 5A8EA 4XXJA 4HYJA 3VGAA 4WW3A 1R84A 3A7KA 4FAAB 5A45A 2ZZLA 2Y00A 3QDCA 4XTNA 5B6XA 1GU8A 4HWLA 4LDOA 3QAPA 3X3CA 1S51A 5B35A 3UTYA 3S3DB 3NY9A 4X1HA 5BR5A 5H2IA 1S8LA 1JFPA 3EMLA 5B0WA 2JAGA 1AT9A 5G2DA 1U19A 2WJLA 5ITCA 5AZDA 2VT4A 2AT9A 3VHZA 3OE8A 5G2AA 1IXFA 3V2WA 3CODA 4G7RB 4QRYA 3ZPQA 4X31A 4KNFA 4G7QB 1KGBA 3VG9A 2F93A 3UZAA 1C8RA 4BEYA 5JJJA 5DHGA 4N4YB 2QPDB 3KJ6A 2M3GA 2YCYA 3C9LA 3QJSB 1IW9A 3UTVA 4BUOA 1UAZA 5B2NA 4Y9HA 3VI0A 4BWBA 2PEDA 4N6HA 2I1XA 4L35A 1F88A 5H2PA 2J4YA 2EI4A 2ZFEA 1F50A 1EHKB 3HAQA 5JJEA 1FBBA 1GZMA 4EJ4A 4GP4B 5H2LA 4GRVA 3QJTB 1JGJA 4LDEA 1GUEA 2ZIYA 3EH5B 2KS9A 3AM6A 3DDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAP A;  1H2S A;  1VGO A;  4FA7 B;  4GBR A;  2KSA A;  1E0P A;  4NC3 A;  2I21 A;  1Q5I A;  3OE9 A;  2JAF A;  1TN5 A;  2HPY A;  1M0K A;  4A4M A;  2YCW A;  5JJN A;  3C9M A;  3AYN A;  1M0L A;  4BVN A;  1S53 A;  3UZC A;  4UHR A;  3DQB A;  5AX1 A;  5B6V A;  4BEZ A;  4DKL A;  1KME A;  4G71 B;  4JQ6 A;  5H2M A;  3S8G B;  1R2N A;  1E12 A;  4MD1 A;  3NS0 A;  4XTO A;  5AHZ A;  1QKO A;  4J4Q A;  3T45 A;  1QM8 A;  3UG9 A;  4GP5 B;  2Y01 A;  3UTX A;  3PWH A;  2Y03 A;  2Y02 A;  1S54 A;  3ZPR A;  1XJI A;  4JR8 A;  5BR2 A;  2R4S A;  3OE6 A;  2F95 A;  1P8I A;  3QBI A;  2X72 A;  3S3B B;  3COC A;  4G70 B;  4BV0 A;  3QJR B;  2BRD A;  5J7A A;  1F4Z A;  4X32 A;  1UCQ A;  1BRR A;  5AX0 A;  1FBK A;  1BRX A;  5G2C A;  1Q5J A;  1AP9 A;  4XTL A;  4UG2 A;  1O0A A;  3ZEV A;  5ITE A;  3WQJ A;  5B6W A;  3P0G A;  3AYM A;  3QBG A;  1BRD A;  2LNL A;  4OV0 A;  5DHH A;  4LDL A;  2I20 A;  3VW7 A;  3QBK A;  4IB4 A;  5B6Z A;  3UON A;  3D4S A;  4GP8 B;  3PXO A;  5DYS A;  3QBL A;  5ETZ A;  1XME B;  1X0K 1;  3HAN A;  4N4W A;  1X0I 1;  1H68 A;  3HAP A;  1C8S A;  2YDO A;  4FPD A;  1QHJ A;  3OE0 A;  2NTW A;  4PXK A;  1JV6 A;  4KLY A;  1KG9 A;  4TL3 A;  1DZE A;  4MD2 A;  2Z55 A;  1S52 A;  4FBZ A;  3PQR A;  2YCX A;  4GYC A;  4JKV A;  4IAQ A;  2YCZ A;  1HZX A;  1CWQ A;  5G53 A;  3REY A;  3ODU A;  1PXS A;  5H2N A;  5B6Y A;  5FJG A;  5C1M A;  1MGY A;  1KG8 A;  3OAX A;  1L0M A;  1L9H A;  3PBL A;  3ABW A;  4G7S B;  5KKH A;  4DJH A;  2RH1 A;  3QJQ B;  4HYX A;  3HAS A;  2WJK A;  4DAJ A;  5G28 A;  1PXR A;  3MBV A;  5EN0 A;  3X3B A;  1P8U A;  3HAR A;  1XIO A;  5AHY A;  1VJM A;  2R4R A;  4G72 B;  3SN6 R;  5G36 A;  4XT1 A;  2Z73 A;  1X0S A;  4QI1 A;  2KSB A;  1P8H A;  2KSY A;  3QJU B;  5LWE A;  3S8F B;  1BM1 A;  5AWZ A;  1JV7 A;  4XT3 A;  4MQT A;  3NY8 A;  1TN0 A;  4K5Y A;  3QJV B;  3NSB A;  3VVK A;  1IW6 A;  4AMI A;  3EH3 B;  5B34 A;  4GPO A;  5G54 A;  5H2K A;  5TGZ A;  5H2J A;  4IAR A;  3EH4 B;  1LN6 A;  4PXF A;  4EIY A;  3RZE A;  3PDS A;  3V2Y A;  1M0M A;  2YDV A;  2L6X A;  2G87 A;  3QAK A;  3S3C B;  5H2H A;  4QID A;  4MBS A;  1S8J A;  5A44 A;  3BVD B;  1PY6 A;  1QKP A;  3NYA A;  2I35 A;  2QPE B;  3HAO A;  4MQS A;  2NTU A;  3UTW A;  4EA3 A;  4AMJ A;  4L6R A;  4WAV A;  2Y04 A;  5H2O A;  3RFM A;  1C3W A;  5F8U A;  5A8E A;  4XXJ A;  4HYJ A;  3VGA A;  4WW3 A;  1R84 A;  3A7K A;  4FAA B;  5A45 A;  2ZZL A;  2Y00 A;  3QDC A;  4XTN A;  5B6X A;  1GU8 A;  4HWL A;  4LDO A;  3QAP A;  3X3C A;  1S51 A;  5B35 A;  3UTY A;  3S3D B;  3NY9 A;  4X1H A;  5BR5 A;  5H2I A;  1S8L A;  1JFP A;  3EML A;  5B0W A;  2JAG A;  1AT9 A;  5G2D A;  1U19 A;  2WJL A;  5ITC A;  5AZD A;  2VT4 A;  2AT9 A;  3VHZ A;  3OE8 A;  5G2A A;  1IXF A;  3V2W A;  3COD A;  4G7R B;  4QRY A;  3ZPQ A;  4X31 A;  4KNF A;  4G7Q B;  1KGB A;  3VG9 A;  2F93 A;  3UZA A;  1C8R A;  4BEY A;  5JJJ A;  5DHG A;  4N4Y B;  2QPD B;  3KJ6 A;  2M3G A;  2YCY A;  3C9L A;  3QJS B;  1IW9 A;  3UTV A;  4BUO A;  1UAZ A;  5B2N A;  4Y9H A;  3VI0 A;  4BWB A;  2PED A;  4N6H A;  2I1X A;  4L35 A;  1F88 A;  5H2P A;  2J4Y A;  2EI4 A;  2ZFE A;  1F50 A;  1EHK B;  3HAQ A;  5JJE A;  1FBB A;  1GZM A;  4EJ4 A;  4GP4 B;  5H2L A;  4GRV A;  3QJT B;  1JGJ A;  4LDE A;  1GUE A;  2ZIY A;  3EH5 B;  2KS9 A;  3AM6 A;  3DDL A; 
#chains in the Genus database with same CATH topology
 3CAP A;  1H2S A;  1VGO A;  4FA7 B;  4GBR A;  2KSA A;  1E0P A;  4NC3 A;  2I21 A;  1Q5I A;  3OE9 A;  2JAF A;  1TN5 A;  2HPY A;  1M0K A;  4A4M A;  2YCW A;  5JJN A;  3C9M A;  3AYN A;  1M0L A;  4BVN A;  1S53 A;  3UZC A;  4UHR A;  3DQB A;  5AX1 A;  5B6V A;  4BEZ A;  4DKL A;  1KME A;  4G71 B;  4JQ6 A;  5H2M A;  3S8G B;  1R2N A;  1E12 A;  4MD1 A;  3NS0 A;  4XTO A;  5AHZ A;  1QKO A;  4J4Q A;  3T45 A;  1QM8 A;  3UG9 A;  4GP5 B;  2Y01 A;  3UTX A;  3PWH A;  2Y03 A;  2Y02 A;  1S54 A;  3ZPR A;  1XJI A;  4JR8 A;  5BR2 A;  2R4S A;  3OE6 A;  2F95 A;  1P8I A;  3QBI A;  2X72 A;  3S3B B;  3COC A;  4G70 B;  4BV0 A;  3QJR B;  2BRD A;  5J7A A;  1F4Z A;  4X32 A;  1UCQ A;  1BRR A;  5AX0 A;  1FBK A;  1BRX A;  5G2C A;  1Q5J A;  1AP9 A;  4XTL A;  4UG2 A;  1O0A A;  3ZEV A;  5ITE A;  3WQJ A;  5B6W A;  3P0G A;  3AYM A;  3QBG A;  1BRD A;  2LNL A;  4OV0 A;  5DHH A;  4LDL A;  2I20 A;  3VW7 A;  3QBK A;  4IB4 A;  5B6Z A;  3UON A;  3D4S A;  4GP8 B;  3PXO A;  5DYS A;  3QBL A;  5ETZ A;  1XME B;  1X0K 1;  3HAN A;  4N4W A;  1X0I 1;  1H68 A;  3HAP A;  1C8S A;  2YDO A;  4FPD A;  1QHJ A;  3OE0 A;  2NTW A;  4PXK A;  1JV6 A;  4KLY A;  1KG9 A;  4TL3 A;  1DZE A;  4MD2 A;  2Z55 A;  1S52 A;  4FBZ A;  3PQR A;  2YCX A;  4GYC A;  4JKV A;  4IAQ A;  2YCZ A;  1HZX A;  1CWQ A;  5G53 A;  3REY A;  3ODU A;  1PXS A;  5H2N A;  5B6Y A;  5FJG A;  5C1M A;  1MGY A;  1KG8 A;  3OAX A;  1L0M A;  1L9H A;  3PBL A;  3ABW A;  4G7S B;  5KKH A;  4DJH A;  2RH1 A;  3QJQ B;  4HYX A;  3HAS A;  2WJK A;  4DAJ A;  5G28 A;  1PXR A;  3MBV A;  5EN0 A;  4DS7 E;  3X3B A;  1P8U A;  3HAR A;  1XIO A;  5AHY A;  1VJM A;  2R4R A;  4G72 B;  3SN6 R;  5G36 A;  4XT1 A;  2Z73 A;  1X0S A;  4QI1 A;  2KSB A;  1P8H A;  2KSY A;  3QJU B;  5LWE A;  3S8F B;  1BM1 A;  5AWZ A;  1JV7 A;  4XT3 A;  4MQT A;  3NY8 A;  1TN0 A;  4K5Y A;  3QJV B;  3NSB A;  3VVK A;  1IW6 A;  4AMI A;  3EH3 B;  5B34 A;  4GPO A;  5G54 A;  5H2K A;  5TGZ A;  5H2J A;  4IAR A;  3EH4 B;  1LN6 A;  4PXF A;  4EIY A;  3RZE A;  3PDS A;  3V2Y A;  1M0M A;  2YDV A;  2L6X A;  2G87 A;  3QAK A;  3S3C B;  5H2H A;  4QID A;  4MBS A;  1S8J A;  5A44 A;  3BVD B;  1PY6 A;  1QKP A;  3NYA A;  2I35 A;  2QPE B;  3HAO A;  4MQS A;  2NTU A;  3UTW A;  4EA3 A;  4AMJ A;  4L6R A;  4WAV A;  2Y04 A;  5H2O A;  3RFM A;  1C3W A;  5F8U A;  5A8E A;  4XXJ A;  4HYJ A;  3VGA A;  4WW3 A;  1R84 A;  3A7K A;  4FAA B;  5A45 A;  2ZZL A;  2Y00 A;  3QDC A;  4XTN A;  5B6X A;  1GU8 A;  4HWL A;  4LDO A;  3QAP A;  3X3C A;  1S51 A;  5B35 A;  3UTY A;  3S3D B;  3NY9 A;  4X1H A;  5BR5 A;  5H2I A;  1S8L A;  1JFP A;  3EML A;  5B0W A;  2JAG A;  1AT9 A;  5G2D A;  1U19 A;  2WJL A;  5ITC A;  5AZD A;  2VT4 A;  2AT9 A;  3VHZ A;  3OE8 A;  5G2A A;  1IXF A;  3V2W A;  3COD A;  4G7R B;  4QRY A;  3ZPQ A;  4X31 A;  4KNF A;  4G7Q B;  1KGB A;  3VG9 A;  2F93 A;  3UZA A;  1C8R A;  4BEY A;  5JJJ A;  5DHG A;  4N4Y B;  2QPD B;  3KJ6 A;  2M3G A;  2YCY A;  3C9L A;  3QJS B;  1IW9 A;  3UTV A;  4BUO A;  1UAZ A;  5B2N A;  4Y9H A;  3VI0 A;  4BWB A;  2PED A;  4N6H A;  2I1X A;  4L35 A;  1F88 A;  5H2P A;  2J4Y A;  2EI4 A;  2ZFE A;  1F50 A;  1EHK B;  3HAQ A;  5JJE A;  1FBB A;  1GZM A;  4EJ4 A;  4GP4 B;  5H2L A;  4GRV A;  3QJT B;  1JGJ A;  4LDE A;  1GUE A;  2ZIY A;  3EH5 B;  2KS9 A;  3AM6 A;  3DDL A; 
#chains in the Genus database with same CATH homology
 3CAP A;  1H2S A;  1VGO A;  4FA7 B;  4GBR A;  2KSA A;  1E0P A;  4NC3 A;  2I21 A;  1Q5I A;  3OE9 A;  2JAF A;  1TN5 A;  2HPY A;  1M0K A;  4A4M A;  2YCW A;  5JJN A;  3C9M A;  3AYN A;  1M0L A;  4BVN A;  1S53 A;  3UZC A;  4UHR A;  3DQB A;  5AX1 A;  5B6V A;  4BEZ A;  4DKL A;  1KME A;  4G71 B;  4JQ6 A;  5H2M A;  3S8G B;  1R2N A;  1E12 A;  4MD1 A;  3NS0 A;  4XTO A;  5AHZ A;  1QKO A;  4J4Q A;  3T45 A;  1QM8 A;  3UG9 A;  4GP5 B;  2Y01 A;  3UTX A;  3PWH A;  2Y03 A;  2Y02 A;  1S54 A;  3ZPR A;  1XJI A;  4JR8 A;  5BR2 A;  2R4S A;  3OE6 A;  2F95 A;  1P8I A;  3QBI A;  2X72 A;  3S3B B;  3COC A;  4G70 B;  4BV0 A;  3QJR B;  2BRD A;  5J7A A;  1F4Z A;  4X32 A;  1UCQ A;  1BRR A;  5AX0 A;  1FBK A;  1BRX A;  5G2C A;  1Q5J A;  1AP9 A;  4XTL A;  4UG2 A;  1O0A A;  3ZEV A;  5ITE A;  3WQJ A;  5B6W A;  3P0G A;  3AYM A;  3QBG A;  1BRD A;  2LNL A;  4OV0 A;  5DHH A;  4LDL A;  2I20 A;  3VW7 A;  3QBK A;  4IB4 A;  5B6Z A;  3UON A;  3D4S A;  4GP8 B;  3PXO A;  5DYS A;  3QBL A;  5ETZ A;  1XME B;  1X0K 1;  3HAN A;  4N4W A;  1X0I 1;  1H68 A;  3HAP A;  1C8S A;  2YDO A;  4FPD A;  1QHJ A;  3OE0 A;  2NTW A;  4PXK A;  1JV6 A;  4KLY A;  1KG9 A;  4TL3 A;  1DZE A;  4MD2 A;  2Z55 A;  1S52 A;  4FBZ A;  3PQR A;  2YCX A;  4GYC A;  4JKV A;  4IAQ A;  2YCZ A;  1HZX A;  1CWQ A;  5G53 A;  3REY A;  3ODU A;  1PXS A;  5H2N A;  5B6Y A;  5FJG A;  5C1M A;  1MGY A;  1KG8 A;  3OAX A;  1L0M A;  1L9H A;  3PBL A;  3ABW A;  4G7S B;  5KKH A;  4DJH A;  2RH1 A;  3QJQ B;  4HYX A;  3HAS A;  2WJK A;  4DAJ A;  5G28 A;  1PXR A;  3MBV A;  5EN0 A;  4DS7 E;  3X3B A;  1P8U A;  3HAR A;  1XIO A;  5AHY A;  1VJM A;  2R4R A;  4G72 B;  3SN6 R;  5G36 A;  4XT1 A;  2Z73 A;  1X0S A;  4QI1 A;  2KSB A;  1P8H A;  2KSY A;  3QJU B;  5LWE A;  3S8F B;  1BM1 A;  5AWZ A;  1JV7 A;  4XT3 A;  4MQT A;  3NY8 A;  1TN0 A;  4K5Y A;  3QJV B;  3NSB A;  3VVK A;  1IW6 A;  4AMI A;  3EH3 B;  5B34 A;  4GPO A;  5G54 A;  5H2K A;  5TGZ A;  5H2J A;  4IAR A;  3EH4 B;  1LN6 A;  4PXF A;  4EIY A;  3RZE A;  3PDS A;  3V2Y A;  1M0M A;  2YDV A;  2L6X A;  2G87 A;  3QAK A;  3S3C B;  5H2H A;  4QID A;  4MBS A;  1S8J A;  5A44 A;  3BVD B;  1PY6 A;  1QKP A;  3NYA A;  2I35 A;  2QPE B;  3HAO A;  4MQS A;  2NTU A;  3UTW A;  4EA3 A;  4AMJ A;  4L6R A;  4WAV A;  2Y04 A;  5H2O A;  3RFM A;  1C3W A;  5F8U A;  5A8E A;  4XXJ A;  4HYJ A;  3VGA A;  4WW3 A;  1R84 A;  3A7K A;  4FAA B;  5A45 A;  2ZZL A;  2Y00 A;  3QDC A;  4XTN A;  5B6X A;  1GU8 A;  4HWL A;  4LDO A;  3QAP A;  3X3C A;  1S51 A;  5B35 A;  3UTY A;  3S3D B;  3NY9 A;  4X1H A;  5BR5 A;  5H2I A;  1S8L A;  1JFP A;  3EML A;  5B0W A;  2JAG A;  1AT9 A;  5G2D A;  1U19 A;  2WJL A;  5ITC A;  5AZD A;  2VT4 A;  2AT9 A;  3VHZ A;  3OE8 A;  5G2A A;  1IXF A;  3V2W A;  3COD A;  4G7R B;  4QRY A;  3ZPQ A;  4X31 A;  4KNF A;  4G7Q B;  1KGB A;  3VG9 A;  2F93 A;  3UZA A;  1C8R A;  4BEY A;  5JJJ A;  5DHG A;  4N4Y B;  2QPD B;  3KJ6 A;  2M3G A;  2YCY A;  3C9L A;  3QJS B;  1IW9 A;  3UTV A;  4BUO A;  1UAZ A;  5B2N A;  4Y9H A;  3VI0 A;  4BWB A;  2PED A;  4N6H A;  2I1X A;  4L35 A;  1F88 A;  5H2P A;  2J4Y A;  2EI4 A;  2ZFE A;  1F50 A;  1EHK B;  3HAQ A;  5JJE A;  1FBB A;  1GZM A;  4EJ4 A;  4GP4 B;  5H2L A;  4GRV A;  3QJT B;  1JGJ A;  4LDE A;  1GUE A;  2ZIY A;  3EH5 B;  2KS9 A;  3AM6 A;  3DDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...