1JGKA

Solution structure of candoxin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
66
structure length
66
Chain Sequence
MKCKICNFDTCRAGELKVCASGEKYCFKESWREARGTRIERGCAATCPKGSVYGLYVLCCTTDDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SOLUTION STRUCTURE OF CANDOXIN, A REVERSIBLE, POSTSYNAPTIC NEUROTOXIN PURIFIED FROM THE VENOM OF BUNGARUS CANDIDUS (MALAYAN KRAIT)
rcsb
molecule keywords CANDOXIN
molecule tags Toxin
total genus 3
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1jgkA00
5IMTD 1JBDA 1MAHF 1NTNA 5DU1A 1BXPA 1IDLA 1RGJA 1NYUA 2HLRA 5EBXA 1KU6B 2X8BB 1NEAA 3U73U 2H8UA 1CVOA 4FAOC 1KTZB 4AEAA 1CXOA 2N99A 1CDTA 1MR6A 3BT2U 1FSCA 1KBSA 2QJAC 4XJJA 2L5SA 1KS6A 1QKDA 3EVSC 4ZQYA 1QKEA 1XT3A 1B41B 1CDQA 1BTEA 2J8BA 2QC1A 1FF4A 1LJZA 3KFDE 3PLCA 1ERGA 2LA1A 1KFHA 2VLWA 1CREA 4DO8A 2I9BE 1UG4A 1ES7B 3BT1U 3U74U 5IMYC 4BDTB 1KC4A 2ABXA 2JVEA 1IDIA 1FFJA 1LX5B 2MFAA 1IDHA 2LCRA 3FEVA 4EY8B 1COEA 2PJYB 2FD6U 2PJYC 1IQ9A 1KXIA 1NXBA 3ERAA 3VTSA 2GOOB 2ERAA 2GOOC 5DO6A 3KFDI 1H0JA 1NYSA 1LXGA 2CRTA 2H62D 2MJ4A 3LAQU 1ABTA 1TXBA 1CODA 2UX2A 1V6PA 1LXHA 4OM5A 4UY2C 1CDSA 4P7UA 1W6BA 2L03A 2QJBC 4QTIU 1RL5A 1ZADA 1CTXA 4HQPF 2MHYA 1IDGA 1JE9A 1KBAA 1PLOA 1JGKA 2MUPA 2BHIA 2OFSA 2QJ9C 3HH7A 2BTXA 1HAAA 2H5FA 4OM4A 6EBXA 1HOYA 1IKCA 1L4WA 2K3GA 1CCQA 1NTXA 2HLQA 1CB9A 1HC9B 1IK8A 1QM7A 3NH7A 1REWC 2MJ0A 2CDXA 5DZ5A 1TGXA 1F8UB 3NEQA 1VB0A 1HAJA 2H7ZB 1KL8A 4FAOE 2CTXA 1KBTA 1DRSA 1NORA 1FSSB 1TXAA 3QB4B 2CCXA 4LFTA 1TFSA 2H64B 1G6MA 2H64C 1IJCA 1FASA 1YWHA 2UWRA 1I02A 3EBXA 2MUOA 1M9ZA 4RUDA 1HC9A 1CRFA 1CXNA 4IYEA 1F94A 4BIKB 2H62C 2CRSA 1S4YA 1FRAA 2NBTA 3NDSA 1ERAA 1CHVS 2H7ZA 1ONJA 2JQPA 1CDRA 2MJYA 1LSIA
chains in the Genus database with same CATH superfamily
5IMTD 1JBDA 1MAHF 1NTNA 5DU1A 1BXPA 1IDLA 1RGJA 1NYUA 2HLRA 5EBXA 1KU6B 2X8BB 1NEAA 3U73U 2H8UA 1CVOA 4FAOC 1KTZB 4AEAA 1CXOA 2N99A 1CDTA 1MR6A 3BT2U 1FSCA 1KBSA 2QJAC 4XJJA 2L5SA 1KS6A 1QKDA 3EVSC 4ZQYA 1QKEA 1XT3A 1B41B 1CDQA 1BTEA 2J8BA 2QC1A 1FF4A 1LJZA 3KFDE 3PLCA 1ERGA 2LA1A 1KFHA 2VLWA 1CREA 4DO8A 2I9BE 1UG4A 1ES7B 3BT1U 3U74U 5IMYC 4BDTB 1KC4A 2ABXA 2JVEA 1IDIA 1FFJA 1LX5B 2MFAA 1IDHA 2LCRA 3FEVA 4EY8B 1COEA 2PJYB 2FD6U 2PJYC 1IQ9A 1KXIA 1NXBA 3ERAA 3VTSA 2GOOB 2ERAA 2GOOC 5DO6A 3KFDI 1H0JA 1NYSA 1LXGA 2CRTA 2H62D 2MJ4A 3LAQU 1ABTA 1TXBA 1CODA 2UX2A 1V6PA 1LXHA 4OM5A 4UY2C 1CDSA 4P7UA 1W6BA 2L03A 2QJBC 4QTIU 1RL5A 1ZADA 1CTXA 4HQPF 2MHYA 1IDGA 1JE9A 1KBAA 1PLOA 1JGKA 2MUPA 2BHIA 2OFSA 2QJ9C 3HH7A 2BTXA 1HAAA 2H5FA 4OM4A 6EBXA 1HOYA 1IKCA 1L4WA 2K3GA 1CCQA 1NTXA 2HLQA 1CB9A 1HC9B 1IK8A 1QM7A 3NH7A 1REWC 2MJ0A 2CDXA 5DZ5A 1TGXA 1F8UB 3NEQA 1VB0A 1HAJA 2H7ZB 1KL8A 4FAOE 2CTXA 1KBTA 4KSNA 1DRSA 1NORA 1FSSB 1TXAA 3QB4B 2CCXA 4LFTA 1TFSA 2H64B 1G6MA 2H64C 1IJCA 1FASA 1YWHA 2UWRA 1I02A 3EBXA 2MUOA 1M9ZA 4RUDA 1HC9A 1CRFA 1CXNA 4IYEA 1F94A 4BIKB 2H62C 2CRSA 1S4YA 1FRAA 2NBTA 3NDSA 1ERAA 1CHVS 2H7ZA 1ONJA 2JQPA 1CDRA 2MJYA 1LSIA
chains in the Genus database with same CATH topology
5IMTD 1JBDA 1MAHF 1NTNA 5DU1A 1BXPA 1IDLA 1RGJA 1NYUA 2HLRA 5EBXA 1KU6B 2X8BB 1NEAA 3U73U 2H8UA 1CVOA 4FAOC 1KTZB 4AEAA 1CXOA 2N99A 1CDTA 1MR6A 3BT2U 1FSCA 1KBSA 2QJAC 4XJJA 2L5SA 1KS6A 1QKDA 3EVSC 4ZQYA 1QKEA 1XT3A 1B41B 1CDQA 1BTEA 2J8BA 2QC1A 1FF4A 1LJZA 3KFDE 3PLCA 1ERGA 2LA1A 1KFHA 2VLWA 1CREA 4DO8A 2I9BE 1UG4A 1ES7B 3BT1U 3U74U 5IMYC 4BDTB 1KC4A 2ABXA 2JVEA 1IDIA 1FFJA 1LX5B 2MFAA 1IDHA 2LCRA 3FEVA 4EY8B 1COEA 2PJYB 2FD6U 2PJYC 1IQ9A 1KXIA 1NXBA 3ERAA 3VTSA 2GOOB 2ERAA 2GOOC 5DO6A 3KFDI 1H0JA 1NYSA 1LXGA 2CRTA 2H62D 2MJ4A 3LAQU 1ABTA 1TXBA 1CODA 2UX2A 1V6PA 1LXHA 4OM5A 4UY2C 1CDSA 4P7UA 1W6BA 2L03A 2QJBC 4QTIU 1RL5A 1ZADA 1CTXA 4HQPF 2MHYA 1IDGA 1JE9A 1KBAA 1PLOA 1JGKA 2MUPA 2BHIA 2OFSA 2QJ9C 3HH7A 2BTXA 1HAAA 2H5FA 4OM4A 6EBXA 1HOYA 1IKCA 1L4WA 2K3GA 1CCQA 1NTXA 2HLQA 1CB9A 1HC9B 1IK8A 1QM7A 3NH7A 1REWC 2MJ0A 2CDXA 5DZ5A 1TGXA 1F8UB 3NEQA 1VB0A 1HAJA 2H7ZB 1KL8A 4FAOE 2CTXA 1KBTA 4KSNA 1DRSA 1NORA 1FSSB 1TXAA 3QB4B 2CCXA 4LFTA 1TFSA 2H64B 1G6MA 2H64C 1IJCA 1FASA 1YWHA 2UWRA 1I02A 3EBXA 2MUOA 1M9ZA 4RUDA 1HC9A 1CRFA 1CXNA 4IYEA 1F94A 4BIKB 2H62C 2CRSA 1S4YA 1FRAA 2NBTA 3NDSA 1ERAA 1CHVS 2H7ZA 1ONJA 2JQPA 1CDRA 2MJYA 1LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IMT D;  1JBD A;  1MAH F;  1NTN A;  5DU1 A;  1BXP A;  1IDL A;  1RGJ A;  1NYU A;  2HLR A;  5EBX A;  1KU6 B;  2X8B B;  1NEA A;  3U73 U;  2H8U A;  1CVO A;  4FAO C;  1KTZ B;  4AEA A;  1CXO A;  2N99 A;  1CDT A;  1MR6 A;  3BT2 U;  1FSC A;  1KBS A;  2QJA C;  4XJJ A;  2L5S A;  1KS6 A;  1QKD A;  3EVS C;  4ZQY A;  1QKE A;  1XT3 A;  1B41 B;  1CDQ A;  1BTE A;  2J8B A;  2QC1 A;  1FF4 A;  1LJZ A;  3KFD E;  3PLC A;  1ERG A;  2LA1 A;  1KFH A;  2VLW A;  1CRE A;  4DO8 A;  2I9B E;  1UG4 A;  1ES7 B;  3BT1 U;  3U74 U;  5IMY C;  4BDT B;  1KC4 A;  2ABX A;  2JVE A;  1IDI A;  1FFJ A;  1LX5 B;  2MFA A;  1IDH A;  2LCR A;  3FEV A;  4EY8 B;  1COE A;  2PJY B;  2FD6 U;  2PJY C;  1IQ9 A;  1KXI A;  1NXB A;  3ERA A;  3VTS A;  2GOO B;  2ERA A;  2GOO C;  5DO6 A;  3KFD I;  1H0J A;  1NYS A;  1LXG A;  2CRT A;  2H62 D;  2MJ4 A;  3LAQ U;  1ABT A;  1TXB A;  1COD A;  2UX2 A;  1V6P A;  1LXH A;  4OM5 A;  4UY2 C;  1CDS A;  4P7U A;  1W6B A;  2L03 A;  2QJB C;  4QTI U;  1RL5 A;  1ZAD A;  1CTX A;  4HQP F;  2MHY A;  1IDG A;  1JE9 A;  1KBA A;  1PLO A;  1JGK A;  2MUP A;  2BHI A;  2OFS A;  2QJ9 C;  3HH7 A;  2BTX A;  1HAA A;  2H5F A;  4OM4 A;  6EBX A;  1HOY A;  1IKC A;  1L4W A;  2K3G A;  1CCQ A;  1NTX A;  2HLQ A;  1CB9 A;  1HC9 B;  1IK8 A;  1QM7 A;  3NH7 A;  1REW C;  2MJ0 A;  2CDX A;  5DZ5 A;  1TGX A;  1F8U B;  3NEQ A;  1VB0 A;  1HAJ A;  2H7Z B;  1KL8 A;  4FAO E;  2CTX A;  1KBT A;  1DRS A;  1NOR A;  1FSS B;  1TXA A;  3QB4 B;  2CCX A;  4LFT A;  1TFS A;  2H64 B;  1G6M A;  2H64 C;  1IJC A;  1FAS A;  1YWH A;  2UWR A;  1I02 A;  3EBX A;  2MUO A;  1M9Z A;  4RUD A;  1HC9 A;  1CRF A;  1CXN A;  4IYE A;  1F94 A;  4BIK B;  2H62 C;  2CRS A;  1S4Y A;  1FRA A;  2NBT A;  3NDS A;  1ERA A;  1CHV S;  2H7Z A;  1ONJ A;  2JQP A;  1CDR A;  2MJY A;  1LSI A; 
#chains in the Genus database with same CATH topology
 5IMT D;  1JBD A;  1MAH F;  1NTN A;  5DU1 A;  1BXP A;  1IDL A;  1RGJ A;  1NYU A;  2HLR A;  5EBX A;  1KU6 B;  2X8B B;  1NEA A;  3U73 U;  2H8U A;  1CVO A;  4FAO C;  1KTZ B;  4AEA A;  1CXO A;  2N99 A;  1CDT A;  1MR6 A;  3BT2 U;  1FSC A;  1KBS A;  2QJA C;  4XJJ A;  2L5S A;  1KS6 A;  1QKD A;  3EVS C;  4ZQY A;  1QKE A;  1XT3 A;  1B41 B;  1CDQ A;  1BTE A;  2J8B A;  2QC1 A;  1FF4 A;  1LJZ A;  3KFD E;  3PLC A;  1ERG A;  2LA1 A;  1KFH A;  2VLW A;  1CRE A;  4DO8 A;  2I9B E;  1UG4 A;  1ES7 B;  3BT1 U;  3U74 U;  5IMY C;  4BDT B;  1KC4 A;  2ABX A;  2JVE A;  1IDI A;  1FFJ A;  1LX5 B;  2MFA A;  1IDH A;  2LCR A;  3FEV A;  4EY8 B;  1COE A;  2PJY B;  2FD6 U;  2PJY C;  1IQ9 A;  1KXI A;  1NXB A;  3ERA A;  3VTS A;  2GOO B;  2ERA A;  2GOO C;  5DO6 A;  3KFD I;  1H0J A;  1NYS A;  1LXG A;  2CRT A;  2H62 D;  2MJ4 A;  3LAQ U;  1ABT A;  1TXB A;  1COD A;  2UX2 A;  1V6P A;  1LXH A;  4OM5 A;  4UY2 C;  1CDS A;  4P7U A;  1W6B A;  2L03 A;  2QJB C;  4QTI U;  1RL5 A;  1ZAD A;  1CTX A;  4HQP F;  2MHY A;  1IDG A;  1JE9 A;  1KBA A;  1PLO A;  1JGK A;  2MUP A;  2BHI A;  2OFS A;  2QJ9 C;  3HH7 A;  2BTX A;  1HAA A;  2H5F A;  4OM4 A;  6EBX A;  1HOY A;  1IKC A;  1L4W A;  2K3G A;  1CCQ A;  1NTX A;  2HLQ A;  1CB9 A;  1HC9 B;  1IK8 A;  1QM7 A;  3NH7 A;  1REW C;  2MJ0 A;  2CDX A;  5DZ5 A;  1TGX A;  1F8U B;  3NEQ A;  1VB0 A;  1HAJ A;  2H7Z B;  1KL8 A;  4FAO E;  2CTX A;  1KBT A;  4KSN A;  1DRS A;  1NOR A;  1FSS B;  1TXA A;  3QB4 B;  2CCX A;  4LFT A;  1TFS A;  2H64 B;  1G6M A;  2H64 C;  1IJC A;  1FAS A;  1YWH A;  2UWR A;  1I02 A;  3EBX A;  2MUO A;  1M9Z A;  4RUD A;  1HC9 A;  1CRF A;  1CXN A;  4IYE A;  1F94 A;  4BIK B;  2H62 C;  2CRS A;  1S4Y A;  1FRA A;  2NBT A;  3NDS A;  1ERA A;  1CHV S;  2H7Z A;  1ONJ A;  2JQP A;  1CDR A;  2MJY A;  1LSI A; 
#chains in the Genus database with same CATH homology
 5IMT D;  1JBD A;  1MAH F;  1NTN A;  5DU1 A;  1BXP A;  1IDL A;  1RGJ A;  1NYU A;  2HLR A;  5EBX A;  1KU6 B;  2X8B B;  1NEA A;  3U73 U;  2H8U A;  1CVO A;  4FAO C;  1KTZ B;  4AEA A;  1CXO A;  2N99 A;  1CDT A;  1MR6 A;  3BT2 U;  1FSC A;  1KBS A;  2QJA C;  4XJJ A;  2L5S A;  1KS6 A;  1QKD A;  3EVS C;  4ZQY A;  1QKE A;  1XT3 A;  1B41 B;  1CDQ A;  1BTE A;  2J8B A;  2QC1 A;  1FF4 A;  1LJZ A;  3KFD E;  3PLC A;  1ERG A;  2LA1 A;  1KFH A;  2VLW A;  1CRE A;  4DO8 A;  2I9B E;  1UG4 A;  1ES7 B;  3BT1 U;  3U74 U;  5IMY C;  4BDT B;  1KC4 A;  2ABX A;  2JVE A;  1IDI A;  1FFJ A;  1LX5 B;  2MFA A;  1IDH A;  2LCR A;  3FEV A;  4EY8 B;  1COE A;  2PJY B;  2FD6 U;  2PJY C;  1IQ9 A;  1KXI A;  1NXB A;  3ERA A;  3VTS A;  2GOO B;  2ERA A;  2GOO C;  5DO6 A;  3KFD I;  1H0J A;  1NYS A;  1LXG A;  2CRT A;  2H62 D;  2MJ4 A;  3LAQ U;  1ABT A;  1TXB A;  1COD A;  2UX2 A;  1V6P A;  1LXH A;  4OM5 A;  4UY2 C;  1CDS A;  4P7U A;  1W6B A;  2L03 A;  2QJB C;  4QTI U;  1RL5 A;  1ZAD A;  1CTX A;  4HQP F;  2MHY A;  1IDG A;  1JE9 A;  1KBA A;  1PLO A;  1JGK A;  2MUP A;  2BHI A;  2OFS A;  2QJ9 C;  3HH7 A;  2BTX A;  1HAA A;  2H5F A;  4OM4 A;  6EBX A;  1HOY A;  1IKC A;  1L4W A;  2K3G A;  1CCQ A;  1NTX A;  2HLQ A;  1CB9 A;  1HC9 B;  1IK8 A;  1QM7 A;  3NH7 A;  1REW C;  2MJ0 A;  2CDX A;  5DZ5 A;  1TGX A;  1F8U B;  3NEQ A;  1VB0 A;  1HAJ A;  2H7Z B;  1KL8 A;  4FAO E;  2CTX A;  1KBT A;  4KSN A;  1DRS A;  1NOR A;  1FSS B;  1TXA A;  3QB4 B;  2CCX A;  4LFT A;  1TFS A;  2H64 B;  1G6M A;  2H64 C;  1IJC A;  1FAS A;  1YWH A;  2UWR A;  1I02 A;  3EBX A;  2MUO A;  1M9Z A;  4RUD A;  1HC9 A;  1CRF A;  1CXN A;  4IYE A;  1F94 A;  4BIK B;  2H62 C;  2CRS A;  1S4Y A;  1FRA A;  2NBT A;  3NDS A;  1ERA A;  1CHV S;  2H7Z A;  1ONJ A;  2JQP A;  1CDR A;  2MJY A;  1LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...