1JGLL

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig kappa-chain
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL01
3HMXL 2D0FA 1IT9L 3U83A 4PR5A 1YQVH 1P4LB 1IAIH 1E4XL 2J8UA 1OSPH 2N7AA 2X40A 2CIIB 2EEDA 3QQ9D 3X3FL 1DQMH 4U1JA 1CD8A 5CEZL 2X4SB 1NCWL 1IGML 5T3XL 1CICD 4LSSH 3SHSA 4TUJB 4WEBH 1QNZH 4BSVB 5DO2C 2IBBA 1UCBL 3QUML 4MNQE 2CXKA 5DMIL 2DJSA 1H5BC 5EC1B 2V9RA 3GKWH 1MFAH 1IAKA 1YNLH 5GGVL 2PW2A 3U9PH 1KJ2H 3RDTC 4WFHD 3BD3A 4XVTL 2ZSVA 4J6RL 3QEUB 1S5HA 4ZUTB 2YUVA 5CP7A 4JKPH 3UAJD 2FSEA 2D0GA 1JYWA 2CRYA 4R0LB 1MRCH 5CLWA 1HIML 2KZ1B 1U8MA 4LF3A 1QSVA 4OZHA 2IAMC 3TV3L 1EHAA 3TVMA 5IR1B 3FN0H 5F1NA 2K7QA 3S5LB 3DUSA 2EE6A 4V1DE 4HEPG 3MBXH 4ODSL 2MQ3A 2JK5B 2HRPH 2F15A 1AD0A 4UINH 5CIPH 1OHQA 4KJWD 4EI6B 1I7TB 4EUPH 3EYFA 5FM8A 1IKNC 3KPOB 1HSBA 2XQBL 1RZ7H 4F3FB 2XKNA 5I1JH 3KPSE 5C70A 3IGAB 4GKZB 4Z7VF 5DMGC 1CR9H 1PW3A 4FQIL 3RNQA 3O3AB 4YGVA 2FWOB 2ZUXA 3X11B 1I3RB 1N6QH 3QUYA 4LARL 5DGRA 1X5YA 3KPPA 2PUQT 1G7IB 4XCYB 3QIWB 5I1GL 1CN4A 2OK0L 3E3QE 4MLSA 5DQ9A 3GDBA 5DHVH 3GO1L 5JW4R 2HWZL 4OI9A 4ZO7A 1KNOA 3AM8C 3B4NA 5FM4A 4JZJB 2BNUB 4JFOA 4M7ZB 4WVRA 4K7PL 5GJSH 3TO2A 5BVJB 4NC0B 4DGYL 2ARWA 4P5KA 3NOIA 4CU6A 4J12A 1ITCA 3I9GL 1QRKA 1UXWA 2XZAH 2WLZA 2UYLB 5DQDL 5E9DE 5C0BE 3UJIL 1A6WL 3CXDH 4N90E 3QYCA 4LCWA 3BP6A 5L7XL 3TN0C 1KPUA 3HE7A 4Y2DC 4KKBC 3O4LE 4HBCH 4PRDB 1JV5A 2ERJB 3KXFB 5I19L 1A3QA 2J88L 5F3HB 1TTGA 4R7NA 4ZYKA 2EYRB 3T4YB 5ICZB 3GMPB 3U30B 1MAML 5AZ2L 3EOAA 5C0RH 4AK1A 3TF7C 4HIEB 4GRWE 3P9LA 4MAYD 4ONFL 4Y8AA 2YA2A 5E2TH 5EU6E 5ALBH 5GISH 4HWEL 4OM1H 4WWKD 4JKLA 1Z9OA 1KJVA 1WCBB 4O51A 2HVJA 4J8RA 3D85A 4JKPL 1OW0A 4TQEL 1HKFA 4YWGL 5BJTA 1MUJB 4MB4A 5ESVB 1GPOH 3OKMB 1KTLA 3HG1E 2YEZA 2G2RA 4NO2A 1AJ7H 5HYSB 4XBGB 1QP1A 1IGCH 3JBG7 3LEYH 2A9NL 1UCBH 2VC2H 2OL3B 1AI1H 4H1LG 3RZCC 2X09A 4DZBA 3SY0B 4OZHF 2ZKHL 3NIFE 1QBLH 4J4PD 4KK9C 4KUCF 3WXWH 2V9TA 1QLEH 3G5VB 1I1YA 5FCSH 5HDBF 2VDRL 1MWAB 3TO4D 2E7LA 2B0SH 2P5ED 2J6EL 1WBZB 4JRYA 3WCYA 3KYOB 2EH7H 1P7QB 3NA9H 1AY1H 3RY6C 3KDMB 1ED3B 5GJTH 4I18C 4NN5C 3FZUD 1RUQL 1NAMH 3AXLA 1DQDL 2DQTL 4TPRH 3DVGA 5IFAL 2X1XR 4YR6B 1JN6B 2V7HA 2FD6H 3I2CL 4J23A 5KSAD 3RVUC 5DR5L 3QEGH 4KMLB 4NQEE 4NZTH 5ILTL 4IRSB 3Q48A 1Q9OA 1T2JA 2RB8A 2W38A 1K4DA 5FUCE 4Y4KB 2IANE 3PDOA 4TNVK 2R1WA 2IPUG 4U1HB 3KNBB 1SY6A 3SDAA 2AJZB 1G0YR 3E8UH 3QFJD 1MHEB 1A6WH 2IALB 5HGGS 2DLFL 1X5AA 4OLWH 5I8OL 2DQEL 2LFGA 4ZFZA 4PRPA 3HFMH 3C2AL 2V2TA 1YYML 5EU7E 2P49B 4YEFA 2YZ8A 4FQXB 5JW4M 4X6DA 1YEJL 5L8KB 1H8SA 2A0LD 4DVBB 2HTLC 4UU9B 3K1DA 4BYHA 1P4BL 2ZOLA 1M05B 2R9HC 4KHTH 5GGUB 1Q0YL 4DK3A 3BP7B 2QQKH 2LU3A 2NZ9C 3IU3B 5IK3B 1AQKH 4JM2B 3ZKSD 1MQKL 5EU5B 2P44B 4UOW1 5ICXB 4ELKA 4YK4C 5C8JB 5INDB 2IAMA 5JW3H 1A14H 1OAKH 4APQA 3RWFA 4RIRA 3D5OF 2Y5EA 1KIUA 1S9KC 2JF1A 3UTSA 1BEYH 3CFJB 1GGBH 3UDWC 5FB8B 4BH7B 3O6KL 4RMVA 4H1LB 1R3HB 1KIRA 5E6IA 5B4MD 5GRUH 4KI1A 1F4HA 3RVXD 2FIRT 3MGAA 4QOKE 1NGPL 4WW2A 1JYXA 4NKIL 4GAFB 3IDXH 5KOVC 5J4MA 5FYKE 3L5WA 3PWVA 3VXSA 4X4YA 3ARFD 2DI9A 1LEGB 1I1FB 1XGTA 3GHBL 1X7QA 1QLEL 3BP4B 4QHNA 1P69B 1JMXA 4KKCC 3MBED 4NQCD 4BH8A 3PGCA 3LS5H 5E9DA 5E2UH 5ETUB 4APQC 3V52L 2ED9A 3QDJA 3ARED 4NKOB 3FT4B 3QHZH 4LCUB 3GSNB 4G8GB 3IF1A 4MNGA 4U1IB 3DURB 1INQA 5EZOL 3C5SB 5FOJA 5KANI 2CDGA 3PWPD 4MAYC 5GS1C 5C0AA 3SDYL 1FORL 3ULUL 1IQWH 1FC2D 3WS3A 4YHYC 5T1LB 1Z3GH 3W9EB 3MREA 3ZSTA 4KUZH 4Q6IC 4N1HB 2DQDH 2J1KA 1DP0A 1QSFB 4FG6D 3VGBA 3O8XB 1FG2B 4HPYL 4IRJC 5DYOA 3F65A 4YHNA 3RWHA 5JO5A 2BJML 4GKNB 3UJTL 3N9GH 5T1DH 3LZFL 3MC0A 4MQ7B 1I9IH 15C8L 4MD4B 5IJVB 4O9HL 5TQ2H 1I85A 3S34L 3HAEH 5I1KL 3DTXB 4JFZH 3UBXI 5IT2H 4JKMA 4HK3J 2OXHA 3L7EA 1MCIA 4UIKH 2F19L 4JDVB 2XWTB 2AVGA 2Z92B 1U36A 1LNUA 3QQ3A 4OD3L 1ND0A 5LG1A 4MSWA 4Z0XA 4ZAKC 2E7HA 2HAZA 2OL3L 3F6IA 4ZUWB 1M6OA 2VLJB 1E0OB 5DK0A 1NAMB 1II4E 5DD3L 5IKCA 1MCNA 5E5MB 5HYQB 4JO3L 4PG9B 2I60L 5AUMA 1UG9A 4L4TA 1HQ4A 2AP2A 3BZEA 2BDNL 2VH5H 1Q72L 3R1GL 1B0GA 3X14A 2YZ1A 3FQWA 5GSRA 4ESKA 1DVFB 3NPSC 5HHNA 1T20B 4FS0A 4GRWH 1DANT 4JFHD 3P9WB 4WO4D 3P11H 3ZT6A 2MOVA 1OGTA 2CKBL 5EU6B 5C09E 4NQSB 4QRRA 2YRZA 4Z7WF 4G8EA 4OLUH 3ARXA 1KLGA 1WT5C 1RZJC 1HWGB 2X2YA 3ARBB 5D7LA 3PE9A 3IU4H 1TJGH 3KG5A 2VRAA 3MROB 2D3VA 4MHHG 3TWCL 1CVRA 3S96A 2APTA 3FQUA 4DZ8A 4EN3A 5F7LB 5GGQH 4YBHA 5DEGB 2X4OA 5TE4L 1CXKA 3KLSA 4ODSH 3WD5H 2VWEE 3AY4A 3O4LB 1F11A 5HHPA 1H3PL 4KJYB 5DD6A 2NXZD 5HHVH 3C5ZC 4RQQA 2ZNXA 1U6AL 5T1KB 2YR3A 3LKNB 4I48B 5IIEB 2ICEB 1QSZA 1WEJH 4L8CB 3BUYB 3EYSL 3MA9L 1FORH 4JREB 2DOCA 5IROA 2BVEA 4O2EB 5BW7A 2BNRE 3HE7C 3I6KA 5D71H 4FQLH 3TVMC 4EUPG 3EOBA 1RJYA 1RIVL 4PJAE 1RZJL 5E1HB 5ECJE 4L3CB 3ES6A 4GW5B 1A1NA 1W2KT 5ERWA 2VOTA 2J3SA 3CMOH 3RZCD 1WITA 3CLEH 5CJXC 3TA3A 2HFGH 3DUHA 4BSWA 1EVUA 3G6JF 1LK2B 4LKCA 2PXYB 3DX8B 3DUUA 1B4JH 4LGRB 5TDNB 1UCTA 2CIKA 2EYSB 3IDXL 4OIIH 4XPTH 5D1ZD 4JVUA 4ZG1A 5D1XC 2NY3B 2MPAL 1EFQA 4PLJC 1BX2B 1PFCA 1FZMA 4X98A 3UTQB 3QA3B 4PJHA 1KIQB 4WUUE 1HEZA 2ZUQB 4KQ3H 1ZHBB 1KJ3H 3CH8A 4MXWH 1X9QA 3WIHA 1QA9A 1NFDA 3H0TB 4CMMB 3HNVL 4L9LA 3BW9B 3QUYC 5DJ8B 2I24N 1UWEL 1U92A 2NLJA 4WU5A 3JUYA 4RAVB 1UYWH 2EDKA 2R9HD 4C83A 3LKOB 4OCWH 3WLBB 1HXMB 3IXAB 5EBMB 5MEND 2WWMD 5I1EH 1RUPL 4ZO9A 4XPBH 4CN1A 5EIVA 1ZE3C 1U3HB 4LNVA 3WSQL 1S7WA 1IM9A 4O5LH 5FK9A 4XMLL 3DI2B 4OD2A 5C1MB 3LOWA 5C0CE 4K94C 3QQ4A 1T1XB 2VN7A 4G7VH 1C08B 3AAZB 3CSPA 5J8OA 4KY1L 3PXJA 5E1AA 4FXKB 5LGHH 1I1AD 3FB6A 4X4ZA 3VG0H 4U1GB 3MACH 3A6BH 4JFED 2ZUUA 3GO1H 4NO3A 3WE6A 5KAQG 1JZ3A 1ZLSH 3HFML 3FCTB 4O00A 4R7DB 2YKLL 3BIBX 1GIGL 2WLYA 5BOZG 2ICCA 4HQQL 1A4KB 4JO2H 3D18A 4YHMH 2VXSH 3QXUA 4BKLB 4QRTA 2IG2H 3GSXA 4PRNB 1BBDL 3LQZA 2NNAA 2FB4L 3QDMB 4O2FB 3AREC 4R3SB 1QSEA 2FATH 3NGBC 4KI5E 5T1LD 5CHNA 1N3NB 4CBPA 1NC4B 2I25N 1HHIA 2PW1A 4XB7A 1OAUL 5DJZA 5LXGL 3S88H 2EDHA 3NZ8B 1MHPL 5EN2A 4P2QB 2WINA 4CVZB 4L4VA 3VI3F 4OLVH 1FFOA 3E6FB 4QXGH 4ELMF 1RI8A 3RWJA 4X9HA 3U0PB 2PTTA 4S1SL 7CGTA 1MCRA 4QEGA 1J0ZA 2EC8A 5IB3A 3HR5A 4OD1H 4G3YH 1ERNA 1I9JH 3L3KA 2E5EA 4UT9L 4Z6AT 5F6HI 4ODVL 5KSBA 1MIMH 5SWSE 5E08H 3L3GA 5C0DA 3H9SE 1FCGA 5MEPB 3RWDA 1RJCA 2ZUVA 2R8SL 4UQ3A 5DVOA 1I7RB 5F71A 3MJ7A 1E28A 5CLTA 1KF9B 5GISL 4XCEB 5FYKD 1EJOL 3MLSL 5EBLB 5F1IB 1TIUA 1F3DJ 3F12B 3RNKB 3VFGH 3EDEA 1CGVA 4QHMA 3LN4B 2N4IA 2IANB 3MNVA 3HN3A 3QDJE 3ZHDA 2ZG1A 1ZA3B 2QV2A 5HYJD 4JQXA 5E6ID 1Q9KB 3QUKA 4N0FA 2APVA 2EDQA 1NGWB 2AW2A 4MS8C 1FFNB 3W82A 2YK1H 2W0FB 1NUGA 4JKWA 1FV1A 1ADQL 5DT1L 3CFEA 3F7YB 5FHAH 1TCRA 1K5NA 3W0WD 1XIWB 3V6OE 4NUGL 3S36X 3SN6N 2Z93B 32C2B 3L1OH 2GSGB 3KXFD 4YQXL 1P5UA 5F93C 1QVOA 4J1UB 1YEDB 4ACPA 1TJIL 4XNYL 4OLZH 1VFMA 1WIPA 4GW1A 4ZUUB 5D1XD 2DL9A 2AK4B 5D7IB 5MEQB 2ZUQC 5EOTB 4LPWA 3IJHA 1IILE 5LBSL 3V0AC 1PZ5A 2OZ4H 4JVWA 4BELD 4A6YH 3OAYK 1LILA 1TVHB 2F58L 3VXTA 4RWHA 1XZ0B 4Z7UE 5GRZA 4WI3A 3MLTA 4MA1C 4CU8A 4HDIB 2HH0L 3OWEA 5EC2A 2A6KA 2EYTB 3P4NA 5TGBA 2R29H 3EDJA 1LEKA 2BNQD 2WWMC 2CXGA 5DQJA 3T0AA 5BV7C 1B88A 3JV5A 3T0EB 2IQAA 4P2OC 4Y5XB 3WJJC 3IAPA 1YJDL 2A6JA 5DDHB 3ZL4H 2CO6B 1EERB 2XZQH 4IBLT 2X41A 4M8QA 4HKZA 2DMBA 2QADD 4PLKC 5I2IB 1AH1A 2OYPA 3GI9H 1MEXL 5CBEB 1TZGL 3PWLB 4LLUB 4KTDH 3UPRA 1FBIL 1KCLA 2B5IB 5B38G 3RAJH 1B0RB 1T03L 3SOBH 5T1MB 4Y2OA 1D9KC 4OQTA 4YDIL 5IB4B 4P2RA 5KVFL 2V5TA 4U6TA 3WNOA 5C2UB 3PHOB 5HHXH 4NRYB 4U2ZA 2BCKB 1R6VA 4R26L 5JORB 4KQ4H 5D1ZB 4YHYB 5HGHB 1QLRA 1YMHB 1OLZA 4YNYA 5ITFB 2R0LL 3DX7B 1U2HA 4ELMA 5J1AB 1ZVHA 3ROOA 3V7MA 3F7VB 1CK0L 2OCFD 3BI9X 5DHYB 1A6VH 4EOWH 1HH9B 3TT3L 5D5MA 4OF5A 4PPTA 1OTTD 1WGOA 4JB9H 4MA8H 3OKEA 1JCKA 4QRPB 2Z8RA 3QUXB 3VJ6B 3S97C 1LO5B 4PB0L 5GZOC 4D8PA 3GBNH 5C0AE 2X4UB 1UXSB 3V52H 3PDDA 4UT9H 5CKAA 3LRGA 2IFFL 2VJXA 3UZQA 1WK0A 3FQRA 3QUXC 1B6DA 4YEEA 3X3FH 4RX4A 3V6ZA 4HAFA 5TDPA 1ZVYA 2WSKA 4X7SH 3ZLQC 4KXZI 1WEJL 2B39A 4NT6A 3BZFA 5DURD 3G5XB 2FYYB 1HDMB 2VDMH 3ZE1E 5C86A 4XWGL 4L9DA 4NQDA 3RWCA 2RFXA 4EDWH 1HINH 4KQ4L 1QYGL 2ESVD 3KWWA 3TP4A 4FABL 1KB5B 3EOTL 3STZA 1T4KB 3GSOB 3PP4L 2XTLA 3QCVH 3UYRH 1X5XA 1J0YA 2Y5TB 2GTWA 1OD9A 1JJUA 1T04B 2R56L 5CJ8A 4KMTL 5KVDH 1YDPB 1C12A 1K8IB 3B83A 1A7NH 1TNNA 4Y4HB 3QPXL 1MEXH 1R3JB 4HHAB 5B39G 5IF0B 1QRND 5EIIA 3OXRB 4PJHE 2ORBH 5D1QD 4XB8A 1DL7H 1FH5H 1S7UB 1KYOK 5MERB 3ESUF 5ELIA 2GW5A 1FPTH 1MFEH 1CF8H 3DMMD 1AGFA 1JNLH 2XZZA 1EDQA 5IEKA 4OLYH 5EORH 5HHOB 2JJSA 1MI5D 5FV1L 4BK4A 1PG7X 2W65A 2H32A 2RBLA 1R3KB 3D1MC 2YN5A 3WBDA 1L6ZA 4DKEL 3KPSD 5JHDA 2ZSWB 4TTDC 3CSGA 1P4IH 2H26B 2DQHH 3FO9B 2OP4L 4GBXC 4X7EC 4K3DL 1T1WA 1I3UA 3OPZH 3WHE0 1Z0MA 4NOBA 4EDXB 4F37F 4QHLA 1MREH 2OTWB 3AROA 3G9AB 3NCYS 3T0BA 1K2DA 3LIZL 2FEDD 3IDUA 2A1WH 1Q9WA 3ARGA 4Q6IB 2AJ3B 5DD0L 3P77A 1LD9A 1JF5A 3GMMB 3IXTA 4P3CH 1HOCA 1HQRA 4XNZB 5C07D 3S34H 1SEBB 2YMXL 1CBVH 4V1DD 3JWOH 4EJ1C 5JPMB 2EH8H 4WDIB 3VFVB 3QZWG 4HIIA 4MX7A 1NPUA 3DVNB 3L3JA 4WI6A 3S4SA 1BQHA 1EK3A 3G5YA 1NAKH 3KPSA 3KPRD 3LPFA 2ZCHH 1HH6A 4MHHI 1EJ6A 1NMAH 1TQBC 3PABB 4YAQB 5EG6C 4H88H 1MCSA 1A1MA 3DXAA 3VFGL 4LQFH 4OUUB 4ZXBA 4PP1D 1T5WB 4JRYD 1FO0B 4AIZA 3FT2A 3V0VB 3B3IA 3QP3A 4NC2B 1CE6A 2BOCB 2YSSB 5EU4B 3BVNA 2FJFB 4X4XA 3UEZA 1T7ZA 3VFRB 4OZIF 4Y1AA 3GSVB 1N0XL 5DJXA 2YBRB 5DJ2A 3OHXA 1M4KA 5IGXH 2XN9E 5FKPA 4LCWD 1QNZL 1FQ9C 1MFCL 5D7SH 2X89D 2HJFB 4OFDA 4OZ4A 4WHTB 3EYQC 1CXLA 1CDUA 2VXTH 5DFVC 3IJSB 5EUKA 2BC4B 1ZV5A 2EICA 1HSAB 4PJEB 3EGSA 1CXFA 1QQDB 1MRDH 2AEQL 1ZT1A 3DXAD 1OTTC 4JN2A 5DJYA 4XWOD 1BFVH 1EGJA 1Q38A 3SDCA 4NQEA 3FONA 3HMWH 4NZUH 4JFPA 4N8VA 4M5ZL 3T09A 1VADB 1P4IL 1U3JA 4UOJA 1R24B 3ZT7A 5JXED 5DUML 2C3VA 3T3ME 2GCYA 2Q86A 4HS3A 1DFBH 3BDXA 1MOEA 3QIBB 2VXVL 1ACYH 1BEYL 3VH8B 3B9EA 3S7GA 4AL8H 4JQVA 5BVPL 2A1WL 2W9EH 4N0UB 2BVYA 1C1EL 4MJIA 4LBEB 3VXUB 5IMMB 5GSVA 1TZHA 3QPQC 3BWUC 1NCNA 3DETD 3IVKA 3GSRB 2HFFA 2R39A 3ZL4L 4F7EB 4LSVH 3VXNA 1CL7I 2XA8L 4Z7UB 1OTUD 2UWEB 4PJFF 1H8NA 5I9QB 4OGYL 4BZYA 5IW6A 3S35L 2J12B 2OLDA 5CP7B 5CGTA 2YPVH 2ZPKH 3V4PH 3LPGA 4QF1B 1W72B 5IB2B 5SWZB 3W11C 1QBMH 4M7KH 4ZUSB 4EUPA 5C0EA 5I9QC 4E41B 5T3ZE 4DKFL 1REIA 5A40E 3DUSB 2CK2A 3VE0A 3PGFL 5C0JA 2OR7A 1I7ZA 1NGZA 5HY9A 3TBYA 4EIGB 3LPWA 1UWXH 1UACH 4Z7VB 1UWGL 1A8JH 2VIRB 5J13B 5B38A 3EYUH 1N59B 1YY8B 3D9AH 3P4OA 1ZHNB 5E5RB 5KSAB 2HJKB 4HCRA 1OSZB 1VDGA 2X10A 2DQUH 4U0RC 4PGEA 2FIKA 2IFGA 3ZE0F 3QI9D 4RDQG 3W9DA 1EFXA 1J05A 1FVDA 1HK6A 2NY0C 4K7PX 2XTJE 5CEYA 3KPTA 2UZIH 3GBNL 4HIHB 4PJFA 3QIWA 5C0FB 1DQDH 4KMQA 1E6JL 1I8MA 1RU9H 3LN5B 5L2KB 2VITA 5K9KA 2NY2C 2VUYA 4PTUB 1U58B 3MODH 4HG4K 2W07A 5K9QG 2Y07L 4W81A 2CKBB 1MQ8A 4KK6C 4ZD3H 1HHGA 5TF1L 5IESL 4JZJA 2R2BA 5JA8B 4ZS6C 1FE8H 5HI4C 4L5FH 2CJUL 1XIWC 2OX5A 5F7DB 1JUFB 2KBGA 3AC0A 4Y4FB 1T83A 3HC0A 2YOCA 4HIJB 1N5YH 1CDCA 3IRZA 3LMJH 5F1KC 1BVKA 3FHAA 3ZDXF 3MRMA 5E8NB 3IDMB 3U1SL 4FOMA 1FL5B 4LP5A 2O5ZL 4K3EL 3D3VD 4NO0A 1DDHB 3MOBL 2AK1L 2BFVL 7FABH 2LABA 2AJYL 2V2XB 1M7IA 1ZT7A 1MIML 2IAMD 2JJSC 4FZEL 4GS7C 4S1DC 1AC0A 3BGMA 5JPNB 5CKGA 5T5NF 2R1YB 1S7SA 5C08B 4DVRL 2YC1B 5J12C 2FLBT 2X9XA 4PY8I 4OT1L 3AVEA 5JR1L 4LGSB 1MCPH 4PJEF 1I85C 5A3ID 1TQCC 3PWUB 3HUJA 5J12B 4LKXA 5I30H 4E5XA 1X4XA 5JLZB 4F9LC 4HWBH 1V7NL 4HIEA 2QEJA 1F6AB 3FQTA 1HKLL 5BV7B 3MRPA 4GRLD 1CI5A 8FABA 1LO0L 1HI6B 5IMKB 1VFAA 3I50H 3U36B 1GGCH 5KTEL 2UVEA 5BJTB 4R4FL 2W1NA 4P59L 2CKBH 1JHKL 2NXYB 5ID1B 1ACZA 5TE7H 4NCC1 4MDIA 2Z8SA 5E24E 2EE9A 1D5ZB 4LGPB 5A16A 5FGCE 4U7KA 3B6SB 4HAGA 3I75A 1RZIB 4NRZB 5HPMB 1A7OL 4RISH 4KXZH 3ZDZF 1LE5A 1W0WB 2CRZA 4YQXH 4PJ9A 1G7PB 5HJ3A 1DUZA 2OK0H 1S5IL 3MRLB 5K33A 5F1SA 1WBZA 4JRYB 4WW2F 1UZ6E 1RZKL 5DFTA 4KTEL 4KK9D 5J11C 3KJ4B 1CT8B 3U6RB 3HZYB 2C4FU 5FUOH 3DVGB 2H45A 4TVSa 3OB0H 1RFDH 1JP5A 4OLZL 1N5AA 1FNFA 4AM0A 4O58L 1SEQL 5MP6L 5TH2B 3MUGB 3GIVB 1BQHG 2DRUA 1D6VH 1KJMA 5FCUH 1U8QA 3CFDA 4TSCL 4RNRA 4DKDC 1EHNA 4FFWC 5J9PB 2JJTA 4ODTL 1CXIA 1UWEH 2VZSA 5DRWA 2GUOB 3WL9A 1HZHH 1RUKL 4HH8A 2HLFC 1D6EA 1LP9F 2MNUA 1YEKH 2X4TA 5GRVK 5DD1L 4UINL 5IV2B 3VI4E 1Q9LB 1KXTB 3DGCR 5ALCL 5I8EB 4JHWL 1HILB 2VL4A 2J6EH 2M8XA 4XZUB 2ZG2A 4OF7A 1XF1A 1W72L 1S78C 5INCB 3D48R 3HPJA 3D0LB 5GS1A 4M1DH 6FABL 4NZJA 1RHHB 1M05A 5GGUA 5D72H 3CSBA 4UT7L 2DJ4A 4WV1B 4K94H 3UPCA 1VHPA 1S9VB 3EO9H 3BYTA 3GJFA 4QCIB 4QRUB 5GS0L 4FXGA 1PVHA 2N1KA 1AJ7L 3NN8A 3CMOL 1Z2KA 3WEXA 3IDNA 4X5XA 5FO7B 3UX9B 1SYSA 5HVFB 5K59E 4KROD 4Z7NF 2IAMB 3QH3B 4ISVB 2H9GA 2P5WA 4YHOH 3ROLA 3TJHC 4JE4B 3VFNA 2IBZX 5EU3B 1AXSA 3FQXB 5GPRA 4HT1H 5C2BL 2EDDA 3HNTH 4U1KB 3FFDB 1JPGA 2B4CC 4DEPC 1N7MH 4X6BB 2GTZA 2LU7A 2HVKA 2IGFH 4M6OH 4TUOA 3RY5A 2X7LA 1CTNA 2FO4B 5CJOL 4HLZG 1ZANL 4G6KL 1I9EA 4NWTL 4X99A 3AFLA 4LDOB 2NXZC 3O0RL 3HNSL 4AEIH 3V5HA 4R4NC 3LS4H 4QHNB 1IBGL 3BHBA 5E94A 1HHKB 4GLRI 4LIQE 1T1ZB 4R0LC 2EKSB 4LAQH 4XXDB 1RFDL 1Q0XL 4GKOA 5EUOA 4NKOA 3FT4A 3S98A 5J56B 5ESQB 3TZVC 2GJ6D 4LCYA 4U1IA 5BV7H 3VI4F 2IMNA 2NY5C 1IAIM 1JRHH 3D69A 2VISB 2PYEB 1MFNA 2P8PA 3BQUA 4G8IB 5DLML 1MJJB 1BLNB 3EJYD 2ATKB 1K85A 1OCWL 3IETA 4XP4L 5C0AB 2AXHA 5CGYC 5GS0D 1Y18B 2M26A 3N85H 3FTGA 4D0DB 1CLOH 3T3MF 4NQXB 4JO3H 4Z7WE 1UJ3B 5K93A 3BPOC 5T1LA 5I8OH 2NY0D 4LSQH 4IDJL 2QADC 2ORBL 4ZPVA 3JZ7A 4K23L 1FGVH 3IDGA 3ARRA 4HH9A 4YE4H 5JO5B 3VXSE 3ZTJG 3NMEA 1YYLL 5F9OH 3BP5A 5CEXA 3V7AE 5ACZA 3QO1A 4OZFA 43C9B 5HVHC 1XF2B 5IBTH 2AEPH 2X1WL 2IH3A 2RJMA 2FGZA 1Q0XH 3I6LE 5F8QC 3T4AB 4B41A 4NYLA 4P0DA 5JA9A 3BEVB 4QXTB 3RKDD 5FHAL 2FBJL 4TSBL 4LU5H 5GS0H 4J3WA 4XNMB 3WUWB 3EHBD 1P7KB 1G6VK 4E42B 4I3SH 3BJLA 3W0WB 3TYGH 3U4EB 1R3IH 4JLRB 5DHVB 3ZO0A 5IB5A 5BW7C 3DYOA 3RL2B 3B9DA 3EOTH 4XHJD 5TF0A 2QLVB 1F97A 2MKLC 3RQ3A 3BN9D 3HAEB 3MZTA 3QFJA 1LHZA 4RGND 5C2BH 4L4TB 4MCZA 1IGFL 4IOIA 3VDBA 3MRNB 4JO1L 2DM3A 1I1AC 3P30H 4GLRH 5I8KL 4I4WB 3FO1B 3HS0B 2F5BH 2P5EE 2NY5H 3QCTH 4HKJB 3KYAA 1ORSB 3KYMB 4C57C 3VWKD 3ZT5A 4F7CA 1BJ8A 3MV9B 5JHLL 1KB5L 2F5AH 4JFYB 3RPIA 4X7TB 2Q8AH 2EDEA 1JIBA 3P40A 1D5MB 1RK1A 3K46A 5DC0A 3MNZA 3MGTA 3SGEI 3H42H 2OR9L 4FQCL 2GYSA 2VO5A 3BDBA 2AS5M 2B2XH 4K9EH 3ZZ1A 3I3BA 5EZLB 5CUSL 4ZFOA 1MREL 4O4YH 1U8HB 3O6FC 3O6KH 4DUVA 1CIUA 2NX5A 4EEEA 4KTDL 1K3IA 2NW2B 1MCDA 3GSNH 2HN7B 4LSQL 1N2RA 2AXGA 3L9RA 4UOW0 4U3HA 4NC1C 3RZCB 2X4SA 1C5BH 4GW4A 4LLYA 3LEXB 4PP2B 5I8CA 5DUBB 4L3EE 1JTPA 2P4AB 4QNPE 1UH4A 1A6TA 1GGBL 5CJBA 5JZ7D 2NY1B 3B9KB 2XTJD 3TN0B 4R4BA 1L7TH 1DQQB 4Y5YB 1TQBB 2F9BT 5CZXC 1RUML 1H3TA 1RJYB 1R0AH 5AD0A 1RMFL 2AKRA 4PUBL 1PLGH 2K3TA 3R8BB 3O45B 2LE9A 3OF6D 1X5FA 1IKFH 4Y5VB 3RJQB 2MSPA 3MBEA 4DGYH 5L2KE 2G60H 1U8KA 2QKIB 1XEDA 1T2XA 1T22B 3JSSA 5TFSL 1SJEA 3ARUA 4NUGH 3SGEH 3DUUB 2OS7A 3BIAX 4NM4L 1IBGH 3STBA 4M62H 3ARTA 4HCRH 3LRHA 2NY4D 4EQ3A 3AU1B 2C3GA 4U31A 4KVNL 3UTPD 3EO1A 4KKAC 3TC9A 3S5LA 1MCQA 4K2UH 3KPQA 3WN5A 3CFBB 1KLUB 2Z4QB 5F7HA 5D2LB 1QA9B 1MPAL 1G9MC 3CGTA 1A7QH 3RA7H 5D1ZC 3MLWL 4NJ9L 1AKJB 3HC4L 2JJTC 3ZE1F 5I6XC 3VWKB 4PD4K 4DK6A 3FB5A 4LCIL 4WFHE 1JNHB 4ALAH 2D4FA 1RVFL 2H3NA 1FL6A 2JB6B 1A6PA 5IVOA 1P5VA 2Q3ZA 1U95B 4FFYH 5DR5H 3NA9L 5EO1A 4DTGH 1G7IA 3O2VH 4LLVB 5BOPA 2VB5A 5JXEA 4ZAKB 1FVEB 1QRNB 4XCYA 4HLJA 3Q2CA 1FYHB 3BPCB 5GGTA 1T1XA 4H20H 5DWUL 4NQED 1MRDL 3GJEB 5C0CD 5MEOA 5E1AB 4MAUH 1YN6B 4YLQT 1A6VL 4PJGB 4EVNA 3P4LA 4PJ9C 3MR9A 1OTUC 3PWPE 4KDTC 4PJ5E 2AI0H 1KB5H 4OFKA 3V4UH 3QNZA 5CEZE 2ZKHH 3QWQB 3VRJB 3BPNB 4K3JL 3T0WA 2FJHA 4CDHA 4N0YH 1NLBL 3CFKA 4P23A 1IGTA 3U4BH 5FECB 2DQUL 2FBOJ 5DA0B 5DMIH 1KPUB 1DN2A 2DMCA 3AREA 4P2CG 4ZDHB 4QKXB 1N0LA 4C58B 1X5ZA 2D7TH 4HUNB 5B22A 4L5FL 3DBXA 4HQQH 1A1OA 1S9WB 4TVPE 2R0ZL 4FQJL 1MLBA 3C87A 4E0RA 3C6LA 3PHQA 3D2UD 3MFFB 2Y07H 1WLHA 1ZEAL 5DJAB 4LDEB 1AD9A 3MRGA 4P57B 2ADGB 4YDJB 5BS0A 3HMXH 1N6VA 1XCQB 1MHHA 3MUJA 4JM4L 3RA7L 3MRKA 2EH8L 3P9LB 2ARJQ 4U6HA 3FRPA 3IDJB 2FL5A 3FN3A 5CINH 1A47A 3ZYZA 1Q1JH 2FNBA 1TJGL 3WUWG 1U9KA 4KFZC 5IVXA 3IDYC 1JL8A 4GXVH 5CSBA 3OR7A 3G9VA 2Y6SC 4LHJB 5I1AA 1BBDH 2KL6A 4GRWF 2XY1A 1K8DA 2I27N 4LPVA 4MMZC 5F9WB 4Q9RH 4M61A 3LIZH 1SM3H 2H2SD 3ARYA 3J8F7 4NQCB 5F97E 1EIBA 5HHOE 3UTSD 5GZNC 4PLOB 1J18A 5HBBA 1VGKA 4AMKH 4PGCB 1XH3B 2YPLE 1A7QL 3O11B 3MLPA 1CTOA 3GUTB 3FO2A 3C6SA 3X12B 4Y16A 1RAMA 2WV3A 4KY1H 1MRFL 1B2WL 5C0CB 3OXSA 3PL6C 3MACL 3H8NA 4JR9L 4U6YA 1F00I 4DJMA 4KKCD 5TE6H 3MBEC 3DROA 2VKWA 3MA7B 1KFAH 1X5KA 3IFNH 5FOBA 4XVUC 5B39A 1A9EA 1CDJA 4LVOB 4PJ5B 1XGQA 4MJ6A 1CXHA 1IC1A 2N7BA 1DL7L 4KK5C 3HE6A 2DLHA 4X80H 5D1XA 4P9HC 4JFQB 1U8LA 4DOHE 1V05A 1VEPA 2GJ6B 4L29A 1T1YB 3CVHB 4D9RD 1Q94B 2P47B 2VLMD 5TPWH 4YJZL 4PRIB 1ZT4A 2HRPL 2XV6B 3N9GL 4U1HA 5T1DL 1GXEA 4GW1B 2WAHA 4QXUL 4AY0A 4RGNE 3G6AA 2I26N 4PRID 2X9YA 1MFBH 1JGVH 2E6PA 3WHXA 4JGJA 3RTQA 2C1OA 3VXTB 3RZWA 3N1GC 4KRPB 4PJHF 1OTSC 3BH8B 3BKYH 5ADPL 1BPVA 1OARH 5L8JB 5I18L 5EC2B 2NCMA 3VXRE 4D0CA 3PP3H 4FQ2L 1DUYA 1DBJH 2C7UB 5E2WH 4OI7A 1VEMA 2ZOLB 4HS6A 3TYGL 4OQTL 4QXGL 2XICA 3VI3E 5I15H 3Q0HA 3P0GB 3PIQA 2Y7QB 2IAND 1E4KA 1MNUH 1JK8A 2BNQE 1PG7H 2PN5A 4YDLC 1F2QA 4NHUB 3RFZC 5DZLA 5C8JA 4RRPG 5F72S 2MCPL 5E0QA 4L8SC 5I2IA 1VPOL 2K7PA 4Z0BL 1W0VA 4PFEA 3L95B 3F7RA 5FUZH 4UUJA 2P24B 3UTSB 2A74B 1IEAA 3BIKA 1UB6A 4KRNA 2EDOA 2A77L 1BZ7B 1NKRA 1A3LH 1EEZA 1QLFB 3VXSD 3WN5C 1OF2A 4XNQB 3QHFH 4QXWA 1E4XH 1TVBA 3SDCC 1S7TA 5AYQA 5HGHA 3QXAA 1NBYA 2GT9A 3MLXL 3TM6A 1NH6A 1QSED 4NKDA 2HTKC 2HKHH 1S3KH 1A0QH 3MLZL 1B2WH 1H0DB 2RCSH 2ZPKL 1IQDA 3V4PL 5DI8B 3MGOB 4YDVB 5IVXF 4G43A 4YHLL 3GBML 4X80L 4WY7H 3R06A 4XVJH 1P9MC 1CCZA 4PJ8D 4BUGA 1BFOA 4XH2B 5KSVA 3SDDB 4WU7B 3CFCL 1JGLL 5ACLA 2I07B 3DURA 3IS0X 4JAMB 5FO8A 5DJDB 4JFZL 1YYLH 5DJ0B 5F9OL 4ETQA 1UKSA 1F5WA 2W0PA 4L8BA 5E8OA 4D9LL 1VFBA 4QOKD 4HJGB 1B90A 4JY6B 3SKOB 1VKXB 3W11D 4N0CD 4F2MA 1WFNA 4KKLC 4HZAA 2BVQA 4U3CA 5HI3D 4OCRL 1DN0A 3MRCB 4NKMA 3N1QC 2FJGB 4A6YL 3DMMB 1BM3H 1UM5L 4BQBA 3HZKB 3OQ3B 1ZHLB 5HI5C 2ADFL 3DECA 4JY4A 1KT2B 2X4RB 1DVFC 3PWPA 3BD5A 3IRPX 5CJOH 1QHPA 3PGDA 1EV2E 5C9KA 5D1QA 3UP1A 2ZJSH 4PREA 2ICES 3MJ6A 1KV3A 4ZS7H 3QUYD 3O2DH 4AIOA 2I9LB 3QQNA 4HGWB 1OM3L 1U3HD 5IFAH 2VDOH 2B1HL 1F2XK 5I1IL 3X13A 4I0PB 1SQ2N 3MLRL 3WYRA 4KZDL 4KDVA 4N1CA 3MCKB 4KKBD 4DQOH 4JFDB 2DQGL 3SKMA 5FYLD 3UBXG 2BRRL 5IB1B 3X17A 1T0PB 4MD0B 1DBJL 4H25A 3CLFL 2XZCH 1INEL 3JV0A 43CAB 4DVRH 5I1LA 4ZS6D 4Y19E 4U6VL 1HINL 3EBAA 3C5ZB 4ZQKA 3OKLA 4PY7A 3TO4A 4AT6A 2CK0H 3SEPA 4X0KA 5I73B 1D5BB 5EOCL 1MJ7L 1X4YA 1C5DB 1KCKA 1Z9SA 5ITBH 1IGJA 3CXHJ 2ID5A 2ZCHL 3UTZA 4ENED 3RJDA 4DCQA 5F7UA 2DTMH 4YDIH 4TRPH 1LGVA 5HHNB 4EDXA 1T20A 4Z7WB 2G75A 1VCAA 3CPLB 4HWZB 1GC1L 1U8JA 3T77A 3U9UB 3ARBD 4IIQB 1KN2H 4M6MH 4LK4A 2VLLA 5C3LD 2FEEL 3ARSA 4ZOAA 4Z77B 3K74B 3MJ8A 2ITCA 4EOWL 3M17A 5FUOL 3M8OH 4MJIE 1M71B 1U42A 1EUTA 3QRGH 2G9HA 2A6DA 2DBLL 3RIAK 3WNMA 5LWYH 4NP4L 4PJIA 3VCLA 4PJ5D 3G5YB 1BQHB 3LN9A 1QKZH 1FCCA 1AGDA 4LPCA 3PNWB 2FX8H 1F11B 2X42A 1KG0A 2F54E 2VL5B 4NCDA 3K1KC 4LLWB 3VGAB 1BWWA 1PX4A 3N1FC 1DEEA 3LH2H 4NM4H 4XGZB 5LGJB 4OLWL 4UTBH 1D6VL 5KW9H 4MNHA 2HT3D 5EO0B 5ISZB 1P84J 4F7TA 3TZVB 3GB7B 3D39D 1BMGA 1SEQH 3U4AA 2FHBA 3SO3C 3TA3D 4P23D 1YMMD 4L3CA 5FYKL 1R5WA 3L3HA 3EZJB 3OAZH 1CGSH 4CNIA 1RUMH 2GJJA 3V4VL 3RGVC 1MQKH 1LK2A 4LKCB 3QHTC 3P9MA 3C60D 4I2XB 5LGHL 3N0PB 4ZSOA 1S5IH 1BZ9A 3EHBC 1FNGB 4GXVL 4OZHB 1A22B 4AG4H 2KQMA 2P5EA 3QXDB 1T66C 4JCMA 3C2AH 3EFDL 5J6HA 2D9QB 5T3ZH 4S1QL 4JPKH 5LGKA 3BD4A 5F89A 1VACB 3BZ4B 5J1SC 2HYMA 3BT2H 4PJBE 5IW1A 5DEFB 5C0BB 4JEGB 3BRGC 3CZFA 4IRSD 2CR6A 5AWNH 5J0BA 12E8H 1MF2L 1SJHA 3O6FD 4ZNEA 4MXVF 2NQCA 5MI0C 2MWCA 1NAML 3ZKNC 2Q8BL 3HI1B 3JTSA 4XTRC 4Z0BH 2Q8AL 1I3RA 4NZUL 1L7IH 3KPPB 4IJ3C 4FZEH 4Y2DB 4OCYH 1TNMA 3GSRA 2X6MA 4DUWA 4XP6H 5I30L 1RUQH 5DQ9B 4NM8H 1TTFA 3MCLL 4G5ZL 2X4PA 2Z35B 4LMQI 3U79A 4UNTA 2R1XA 3O6ML 3MNWB 3GMLA 3KR3L 2MCG1 4Z5RB 4M1DL 4YHZH 1N4XL 3Q3GB 5DSCA 5GXBB 4EUPB 3L6FB 2O5XL 4NO3B 4P2QD 4OKVB 2V17L 4K07A 1RZ8B 5B8CA 2AEIT 1F4XH 3V9FA 3EO0A 2YPLD 5K9QI 4DTGL 1WFUA 4TN9A 4HX1A 4DQOL 1MH5B 3MRIB 1OGAB 4PJXF 5H94B 3CX5K 2VUOA 1KCRL 3N50A 4MQTB 2Y36L 1ZLUK 5IG7A 3HCVB 5TQ0H 1NEZA 2Y23A 4LCCC 4BKLA 1N6UA 5KZCB 4OTXL 1L7IL 3DNKA 3MV7A 4JZJC 2BSSB 4BQCA 5DD5L 4JO2L 3QWOA 4W6YB 3V6BR 1OAKL 4MLIA 4QWWC 3IKKA 3V5KA 4OF0A 4YE4L 2IBGA 5F9JA 5KG9B 3WXVL 5H35A 3MOQA 5I19H 2KZWA 3NAAH 5D7JC 1QBML 5E95B 4KTEH 5DVLA 1P53A 4KJQD 2DQFB 4HUWA 4JPIA 3VGDA 5JMRA 1KJVB 3OAYH 1WC7B 2Y72A 1BWMA 1JWSA 5GGRB 4C4KT 1MHCB 1DQJB 4Z18A 4ZOCA 4XC3L 3Q5TA 4U1MA 3L5XL 1RJZB 4NBXB 1E4XI 1KTLB 2YEZB 1OP5H 3OKKA 1ORQA 2PCPA 3F58H 3MRMB 5E8NA 4XBGA 2RAMA 4X4ME 4GKSB 4LPUA 1KPRB 3RVVD 5GJSL 4X8JA 3HI6L 1YMMB 2VH5L 1SM3L 1PEWA 4MQXD 4GRMB 4WWKA 5F88A 4YXKH 4YHLH 5D9SA 1MY7A 4ODUB 2NR6D 3JUZA 1I1YB 3GSWA 3KLDA 3ISWA 2J8UF 5I1GH 1CYGA 2R2EB 4XC1H 3MRQB 4MNGE 4A2LA 3CIQA 1Q9KA 4N0FB 3WLWD 4UV4L 2XFXA 2HLAA 1QFUL 4HUXB 2R23A 4XPAL 4WUKH 4KJPD 4GSDH 4OGAD 3O41B 1JGDA 2EXYC 2EIEA 2JIXA 3FQTB 4XNUH 4HK0A 3RL1A 4JM2F 5T5NG 5GQBA 2AJXL 4P46C 3TFKD 3SPVA 3QUXD 4P2QE 1QVOB 3KGRA 3PWNA 1OGAD 2CRIA 5HSFA 3PDOB 4GXUN 3NIDF 4GOSA 2NY2D 2R4RL 2Y36H 5ID1A 3UBXA 3IDIA 4GRLC 4PJGE 3QCUL 3HB3D 3T0DA 3FRUA 3JTTB 4JRXA 5JDSA 4HPYH 3WO4B 1NBZA 1OAYL 2XKUA 4GG8A 4ZO6A 5HGAA 4YPJA 1NUFA 4LIQL 4GRLB 3AMKA 2WQRA 4ZFFA 3QISA 4MAYB 3L7FA 5EZIH 4FQ2H 1LE5B 2WBJB 4IRSC 4PJ9B 5ENWA 1QUNA 3H9HB 5HYSG 3FB8A 1IAMA 4QRSA 1R3IL 2FX7L 3Q1SH 4OCXL 4ENEC 4X8XA 4JDZA 1XR9B 4IJ3B 1I8LA 5I1IH 3U7WH 3HZVA 4LHUB 3O2VL 4HXAH 2MHAA 3EFFB 5DF0A 2DQGH 5L88H 3RP1A 1FO0L 1JPTH 5JW4N 2XQYK 1T89A 3HE7D 5A1AA 5GS2H 5C07B 3KYNB 1NFIB 1G7MB 2ERJC 2NY1C 4LOUD 1IAOB 5D6CA 2AXJA 1YEGH 5T1MA 3O9WD 5MENE 1UZ8B 1UM5H 1EEUA 2YKLH 1XR8A 3RVWC 2A6IA 3LQAL 1H3XA 4PJ7A 5J1AA 3VDCA 2VDLL 4YHKL 1BM3L 1D9KB 5KSBE 4RZCA 2DQHL 5L2KD 5DHYA 1GGIL 4FQHB 3E3QC 3NCJL 5D2LE 4Y4HC 5KAQF 1FJ1B 1KPVA 3PGCB 3QIWD 5HYJA 2P5WD 4HFWA 5ETUA 1YQ2A 5HDQL 3DIFA 3GGWB 3FFCB 4U7MA 2A9ML 3NPSB 1MLCA 1FZOB 2CLZB 2EDTA 2F19H 2WWKT 1AGEA 4L4VE 4WNQB 1MCFA 3IDNB 5DZNA 2QQKL 4XPBL 3DO7A 1V3LA 2XWJA 3A6CL 3MRHA 1KACB 2OP4H 4XRCB 1E27B 2DQCH 1U8IB 5EA0L 5C0IA 2FYYA 5ESAB 1J8HB 1FNEA 5J13C 4GAYA 1F58H 4S10A 1AQDA 2VLRB 3GSOA 3Q6GH 1X44A 2VXUH 2DBJA 2X7LB 2ESVE 4YO0B 3RIAF 4PGDA 4DKAA 1P6AB 2WP3O 1YEHL 1ZTXL 1T21B 2MPAH 4RGMB 3SJVB 5FUZL 2ESVB 2PTUA 3BSZL 5C0AD 4M6NH 3PG2A 5DTFB 3V5HB 3L3DB 2GK0A 3QEQE 1B4JL 3GIZH 1J9CT 4R2GD 2XWBB 4U1LA 4HT1L 2LAGB 3L7EB 2BSRA 2DLEA 3DGGB 3ZYJA 4CW1A 2AXFB 1I8KB 3WFHA 1ZGLP 4H5SB 2F53A 3T65B 5IEHB 2WZPD 3WIHL 5IUSA 1MFAL 4AEHH 1G6RL 5E4IA 4HXAL 5DJ6A 1EXUB 1I1AA 3BKCH 5BMFH 4PGZA 3NABL 2GEEA 1A7BA 3IETB 2VZTA 5ID0B 2PO6B 2R2HB 4OV5B 4H26A 2NTFA 1G7HB 3FTGB 1I9RH 3A6OA 4NQXA 4OGXH 1U8PB 1FN4B 1INEH 2P45B 2EE3A 5K9OA 4HH9B 4QXUH 5FGBA 4GFTB 1C5CH 3UO1H 5CEXB 2OTWA 3OAZK 5CIPA 1U3YA 5ACZB 4NQSA 1B0WA 4RFOL 1JGVL 1YC8A 1KTRL 2J5LB 1KLGB 2ITDA 2OQJA 1FZJB 4RFEB 5GIRA 2SEBA 4ONHA 1QD0A 1FVCA 2DIJA 3C08L 3ZDZE 4NZRH 4HKBA 1K4CA 4NCC2 1YNTA 3KPNA 3BEVA 1J0KA 3MOAH 1OPGH 2CUMA 3O3BB 4B7LA 1G84A 5FKAB 2GI7A 3MZGB 4G42A 3C09B 1TITA 3ARGD 3HRZB 5FGBC 1V5JA 3ULUD 3ULSB 4TTGA 4E42A 2VTFA 3NACL 4I2XE 1F42A 2J8UB 2DIBA 4KVCL 5D2NC 2HJLB 2APBA 2XN9A 3RL2A 4H0GA 2W91A 2NW3A 2ENSA 1WVZA 2HKFL 1A1MB 4EI5B 4PJ8C 1JVKA 4PJ7F 1CGUA 2CGRH 3O3EA 3MO1B 1KN4L 1OD7A 2GFBB 2Z31B 5D96B 1F45A 2RR3A 3I85A 4ODXB 3CAFA 3FZUC 3PJSB 4HV8A 4DN4H 5EC1A 1NBVH 3OJDA 4OCSH 3DI3B 5BV7L 1ROWA 3TBVB 2X5PA 5D2NA 2AK4D 3S5LG 4FMKA 1GGCL 4IMLB 4XPFH 4ZUTA 2VAJA 3G6JA 1EZVX 1V7ML 3BOVA 3GHEL 2BC4A 1SVCP 4FQXD 4FQQA 4HUVA 4LSTH 4G9FD 4IIQC 3HB3C 1BX2A 5DC9B 5JOEA 5LQBL 1QFWL 1U2CA 1T7WA 5CILL 5B3JE 3C8KB 1IZJA 4U4BA 4QT5B 2G5BB 4ZTPH 1XGUB 2NX5B 2C1PA 5EO9A 1A4JA 5HHOD 2XKSA 3CDYA 1BAFH 1R5IB 2ATPA 3I6GA 3QIUC 4KUZL 3TFKC 1DQLH 1HNFA 2VDML 3QEHA 1SYVB 2ZCKL 2F54A 4GG6E 2CIIA 4RAVA 1YEFH 2R0WH 3BH9B 5DRXA 4QO1A 3D3VA 4NO0D 1UYWL 2CDEA 3RNQB 5CZVL 1TJIH 4XNYH 2H8PA 4YIQA 3UTOA 2X1QA 2FWOA 4PRBA 1HHJA 3U1SH 2Q20A 1KN2L 3VFPA 2COQA 1UVQB 1TZHB 2XI9A 1SBBA 3KJ4C 4PRHD 4HEME 2E27H 4FMFA 2QJDA 1ADQH 5GRVL 1FC1A 5GGSB 3REVA 4YK4B 4JB9L 4MA8L 4N5ED 1RULH 1CFBA 1JF6A 3R0MA 3QAZC 2MQ0A 2J7LA 4RAUB 1CK0H 5J6GA 3BWAB 2O5XH 4K3GA 3MCLH 4G5ZH 4ZUSA 2FSEB 2CJUH 1ONQA 5FEBA 2WUCH 1RU9L 3WE6B 4R0LA 4UQ2A 1EEYB 4Z9KB 1D5IH 1KJ2L 3BEWB 1H5BB 5JOFA 1MFBL 3LKSA 5HHXL 4MA3A 4LLDB 4XX1G 3D18B 4XAKE 3T8XA 2FBJH 3BXNB 4TSBH 1CE1L 1TXKA 5CP3A 2WBKA 1ZWIB 3ZKMC 1UACL 1T7XA 4Y88A 3AY4C 4U05A 2H6PA 4CMHC 1UB5A 4RGNB 3CCHB 2VABB 4MVBC 2ZUSA 4YGVB 1J05B 4A6YB 1S8DB 3QUYB 3V8OA 2AV7A 1IEHA 5F3BA 3GMPA 2YN3A 1QFUH 4I18A 4OFYD 2DWEA 2ADJA 2VQ1A 5JMOC 4JFFA 4HC1H 2A83B 5L9DH 2GJ6E 3GMOB 1BVLA 5BZDA 3QUMA 2OSLA 4N8PA 2Z8VC 1JHTA 3TNMB 1CFSA 1FDLL 4P3DB 4MA7L 1KNOB 3HR5B 3RBGA 1JWMB 3TNNA 3OKOA 1QZ1A 4LHQB 4JFXA 4QYOA 4X4MA 2IPTL 4ORZC 2IG2L 4X9IA 1JUFA 2VLRE 1PYWB 1TJHL 4RFNC 1AO7B 4XMLH 1R0AL 4O5LL 2EDBA 4AL8L 2DB8A 2FECI 3HMXA 2P43B 4G7VL 3VRLE 2OL3A 5FYKU 4RFNB 4JRWA 2A73A 5I16A 3OB0K 4XCEA 2I60H 5EFIA 3TO4C 3TN0D 2RCSL 2VZVA 2DL2A 1S3KL 1ZVSA 4WO4C 4KVCH 1NDMB 1MVUA 5EBWB 3MNVB 3PP3K 1NGXB 5BO1H 2WUBL 1ZA3A 3GK8L 3LH2L 4KK6D 4L8SA 4F33B 3R0NA 3WS6A 1G6RA 1FGNH 2DYPB 4TVPD 1O7SA 1XCQA 2OR9H 5CEZD 4XPTL 1CLYL 4LEOA 3EIFA 3KPLB 4XP9H 5F6IB 3SDXB 3BX7C 3QNXB 2R0ZH 4R96B 2X70B 4U1JB 8CGTA 5CD3B 2DBLH 5KVEL 1NJ9B 1TZIB 2JCCF 2CD0A 4WEUD 1UH2A 3U36A 1K4DB 2VLKE 4WO4A 4F7PA 4K8RD 5KS9F 4YXHL 4QRRD 1KB9J 1VPOH 4TYUA 4X9FA 2AJZA 4PJDB 3PDGA 1J1XL 5L0QB 4M6ML 4NRXA 5MEQA 1D3CA 2G2RB 1H15A 2DI7A 1ZSDB 2PW2B 4LSDA 4AQOA 1PZ5B 3RX7A 4ZPTB 4NNYA 4UV7L 3UZEA 1BD2B 2B5IC 3S8WA 1Z5LA 1KEGH 2BZDA 1NCDL 4UILH 4NNPH 1WZKA 4HK3N 3OXSB 1S7XA 5IESH 3LD8B 4CJ1A 5TGBB 3ZKQD 4M8VA 3MV8B 1U8MB 4MDJA 5KS9E 1RULL 3RKPA 3HPLA 4HJ0C 4IS6B 4CVXB 5JHDD 5B39B 4PJ5A 3MLRH 3V79C 3BO8A 4P46A 3I3DA 1CDYA 3QDMD 4NDMB 4WWID 4NUJA 4LSPH 4OKDA 1ED3A 2A6JB 4LEXH 4YZFE 4O2CB 3SGJA 1AGCB 1MVFA 3IKCB 1CQYA 3C60B 1LDPH 5FYLE 4RIRB 5GGQL 3R4DA 5CBEA 3PL6B 3B2UC 2PR4H 4NIKB 3QO0B 1ZT4B 1UENA 5B3NA 4BSJA 4YPGA 3OKNA 5E6ZA 2Q6WA 4HMCA 1HXYA 4O58H 3RVVC 2D2OA 5D7JD 1KIRB 4YBLC 4TOYH 4DEPB 4OLUL 3FOMA 2VDKL 4N9GB 1RV6X 4WW1A 3JWDC 4CN6A 5ISZD 1JRHI 5D1ZA 5KJRH 1A6UH 5LQBH 1C16B 4GG6A 4YNYB 5EWIH 4DGIL 4ZFZB 1I1FA 4PRPB 4RGOH 4OCLC 4IDJH 1MY5A 3ET9F 4KK5D 3V6FA 3BP4A 1BHGA 3SE9L 3T2QA 5E9DB 3VXOB 4QRQB 5IOPA 1S9YB 3IU4L 1JBJA 1IGYA 3BQUC 3VFWB 4PJXA 4XP4H 4ZOBA 1JMZA 3TIDB 4MNGB 4KGLA 3V8CA 4YXLL 1MCOH 1NCTA 1P1ZB 2X4UA 5D7JA 5I1KH 4D9QE 5TE7L 1C7SA 1CFNB 1MFDH 2W9EL 1ETZA 2V5MA 4F37K 2BVPB 2GAZB 3B9VA 5F1OB 4XVJL 3V6ZB 3FQXA 1NKOA 1CQKA 4FQXC 3UJTH 2BVUA 2VQUA 4HUKB 3N1MC 1NGYB 4UZGA 3OJMB 3CFJA 1CFQB 2AERT 4C56A 4M93C 3DRTA 1RZKC 4FABH 4LCCA 3AUVA 1FG2A 3T4YA 1ZHKB 3QG6A 5HVGB 4LCWE 4M5YH 4M9OA 5TDOB 4X7SL 2DQIL 1JTTA 2GT9B 1FZKB 1NMCB 3SCMC 3PWVB 3IFPB 1ZXQA 3D6GA 1OQXA 1DLHA 2FHCA 4I3GA 4MJID 4B7IA 2VXTL 2APXA 3BHBB 4ZUVA 4F80A 4IMKC 1IQDB 3W2DH 2W9LA 2EKSA 3T2NL 3P3YA 3N1PC 3P0YH 1M7DA 1VESA 3BDYH 1ND0B 5D6DC 5K9JL 1IC5H 4ZMAT 1DLFL 4KHXH 4G8IA 3OX8B 5A2IH 1OARL 1IE5A 1TVDA 4QY8B 3GMQB 4OD1L 2CDGB 3PV6A 4PTTB 1ES0A 4JHWH 1DN0B 4UV7H 3TT3H 1QSEE 3HLAB 1G7QA 4IDLA 3NABH 4K8RC 2VC2L 1NEZG 3OJ2C 3BKCL 4EI5C 3ARDB 4WWKC 1J1XH 3SDDC 2APWA 2BMKB 5FF6A 3VA2C 1PG7W 2VLKB 3MJGX 2VXUL 1L0QA 4KI5D 3O8XA 3AXLB 2WP3T 4WHDA 5BRZA 3ULUF 1OW0C 1Q9WB 4QRRB 5DUPL 4JPWL 1F13A 5DJCA 3WNNA 2BVOB 3FOLA 5MP6H 4EIZC 3VXMA 3OF6A 5T3ZD 4IRSA 4ZOEA 3CDGA 3K2UL 4FFVC 3GIZL 3W0WE 3KLHD 3IXTB 4LNRB 3NFPA 5I17A 3WHE1 1OAXL 2W60A 3S96B 5JPMA 3A6CH 5HVHB 1IEBA 3MRFA 4PJEE 2Q3AA 2XWTA 3LKRA 1PKQE 2X9WA 3ZE2F 3SKMB 4YXLH 4ZFGL 3CC5B 4NKIH 4JLRA 5DHVA 3W39B 1CGYA 3PABA 4LSTL 4ZUWA 5HYIA 5J89A 4UV4H 3T1FA 1U8NA 3JWNC 3NH7L 5JQ6L 1T5WA 3EDFA 1ZS8B 1GOHA 5BO1L 1TTUA 4G6ML 2DLFH 1QOKA 5EWIL 1NLDH 3QR2A 1G9NH 1YJDC 3IU3A 1NCBL 3EOBB 2AJVH 5EU5A 4OFIA 2LVEA 1BIIB 4XI5C 4GO6B 1ORSA 2A0LC 2JCCE 1SMOA 3KYMA 1FH5L 5DK2B 3MRDA 4ELKB 3BRFA 3CPLA 3HI6H 1HN1A 2J8HA 3U0TA 3UCRA 3ILPB 3RPIB 4IIQA 5IMLB 1XF4A 4TULH 3RU8H 2NY7H 2PYEE 5C9JA 5KSUB 1BBJB 4M6AA 1JZ2A 5C6TH 3MNZB 1ZKAA 1QBBA 3MROA 2VKXA 4GQ9H 4XMPL 3NZHH 2UZXB 3NFNA 2Z31D 4S1RL 2G9HB 2NY0B 5ABDE 4YH6A 3VCLB 1ZHBA 2DTSA 3SDCB 2X4OB 1U3ZA 5CMAA 2DQTH 3MLYL 1XGPA 4L3EA 4J3UA 4CMMA 1NC2B 4EDWL 2JELL 3QZWB 4LLYB 5CSZB 2MMXA 4PJAA 4Z7VE 3K2UH 3QIBA 1RZ7L 1KCRH 1KELH 3B9KA 5JIIA 1UGNA 2D7QA 5EOQH 3CDFA 4JPWH 4ONOA 2E8ZA 5GS3A 1KIPA 3CK0H 4KZEH 5ANMA 1ZAGA 2QL1A 3G04A 2WIIB 3AS3A 4BZ1L 5FGCB 2VE6A 4G7YH 4G3YL 3DLQR 5CP3H 1DBAH 5E2UL 4P49A 5B4MC 3EYSH 4YHPB 2HG5B 1YEIH 1W72A 1CG9B 3QIBC 3L3OB 2IADB 3G08B 3S88L 5DWUH 4RAHA 1N4XH 2IPUK 4JZNA 3KPQB 4OAWB 1E4WH 4N0UE 2I5YH 3TVMB 5IR1A 4YX2L 4KHXL 5D2LA 3GKWL 1YEKL 2V5SA 4P9HL 2L7JA 2VDNH 3O8XC 4IRJB 4PB9H 5IQ7H 2V2WB 5DVKA 3O4OB 5E8EB 5IJVA 3BKJL 4LASH 1UH3A 4F3FA 5IVZB 1OSZA 2H1PH 1I1RA 3E2HB 3DTXA 3LKOA 1CWVA 1OQOA 2E7MA 3C09C 1D5XB 2V9QA 4M4PA 1F3RB 4ONFH 2PW1B 4S2SA 3UTPE 3U82B 3HA0A 3CVHL 1NL0H 4P2QA 1GGUA 3ZTJH 4NJAH 1JPSH 4FQPA 5K59F 1V8HA 3TT1L 3TWCH 5IKCB 4PJGA 4KC3B 1PQZA 1T0MB 3H7LA 3P73A 2XA8H 5J3HD 4K7PH 1LK3H 2VAAB 4LAJH 5C6TL 5BXFA 4OI8A 4R97C 5D2LF 5E2VL 2J5LC 3L3GB 2FJHB 3ULVD 1MCHA 5E8DH 4U6XB 1UXWB 1JPFA 5IMOB 4S0TD 1CGSL 2QSCL 4KAQH 4UQ3B 4WFFD 2BDNH 5CGMA 2HRLA 4GUPB 3D39B 3L5XH 3ARBA 3BPNC 3SKNB 2B7DT 5EBLA 4DN3L 3BGMB 1OTSD 4LVHB 4M3JA 5KW9L 1AIFA 1GZPA 3W5MA 4CDGC 3KXFA 3OBAA 2YWYA 4M7JL 1EO7A 3RWIB 1XGRA 3WFCL 1JZ7A 1NMBH 4N5EC 4POZC 4P57A 2AEWA 1F3JA 3ZKMD 2YK1L 3Q5OA 3O4LA 1P4LA 4UI2A 5DJZB 4UAOB 4NQTA 3PUCA 4NP4H 2V17H 2BOBB 4JQIH 5TQ2L 4X6CF 2JCCB 1JWUB 3D2UA 4G9DA 3CJJA 3M8OL 1T3FB 5IB3B 1JZ8A 1KEMH 4BSVA 5KS9B 3M1BB 1I3GH 1DQTA 3A67H 3DMMC 5I71C 2PF6A 1PSKL 4GKSA 3QUMH 5KN5A 4XP6L 4K7FA 1YMMA 3B6SA 1TVHA 4QWWD 4FTVB 2F5BL 4Q9QL 1I9JL 1FAKT 3VWJA 3K80A 4M6NL 3IYLW 3SY0A 3SO5A 4YHZL 5F9AC 4Q7DA 4OGXL 3P4NB 3L3IB 1NANH 3HE6D 1UJTA 4S11A 3VG9B 3LB6C 2GQHA 3MODL 5DQJB 1G1YA 5C07E 4WI7A 4PJHB 3F5WB 1I4FB 5EZJB 3QUKB 1CLZL 2IQAB 2FO1A 5AZEH 3WFZA 3WKML 2XN9D 3SDXE 5D7LD 4AEHL 4P3CL 1CBVL 3LSOA 5SX5H 3RVTD 1G9ML 5E99L 2Q7YB 5D7KD 3DRQA 4P5MB 3CX2A 3WFEH 2VDPH 4PJ8B 2NPLX 3UYOD 3IGAA 3CH1B 1OT1A 3PXHA 3WJLA 1KJMB 3O3AA 4JG0L 3GM8A 1HXMA 3IXAA 5FA3B 4Y4KA 3X11A 4K55A 1PKQB 3ARGC 4LFHD 5JUEH 1OP5K 4JRYE 3WL9B 2CDFB 3SDAB 1J8KA 3PV7A 3N06B 3O6FA 1Z9LA 3QQ4B 4OCSL 2J4WL 1Q9LA 4TSAH 4M5YL 5I8EA 5EOTA 3PWJB 5LCVL 4M93B 1N64L 1RSFA 1FNLA 3ROOB 3ZDXE 5IHZB 3ZTNH 1GOFA 2HT2D 1KN4H 2UZYB 4FQXA 4W6WB 4DN3H 1HH9A 4JHBA 2P7TB 2W9DH 1S9VA 2G60L 2DQEH 4GAJH 4ZNEE 4BQ9A 4QRPA 3WMSA 2UYLA 4NO5B 5D93C 5JXEC 2EIBA 5I1HL 2EDRA 3E8UL 3DXAE 3T0EA 4X6FA 2MHAB 3WIFB 4X6EB 1PKOA 5I75C 4HUMB 2NTSP 4MXQD 4PGBA 4X6DE 4CMHB 2H9GB 2P5WB 2BVTA 1CICB 5EU3A 5CS7A 4MCYB 5DVMA 2EIZB 1YEJH 1JV5B 4PRNA 1QFPA 2QSTA 5BZWA 3KPMB 3MSPA 1UQSA 5DXWA 4C55A 4OM0H 3SE4A 5IM7B 4M5ZH 5CHNB 4ZXBD 1NC4A 1KJ2B 4MXWL 1UM6H 4P46D 4P2OB 4Y5XC 3MBXL 2HFEB 2J8OA 1RHFA 3QIUA 1S7QA 2XPGB 2AQ3A 3BPOB 3AB0B 4LLQB 3L5WB 3VXSB 3HR6A 5F9DC 1WCBA 2H2PD 1CD1A 1Q8MA 1HHKA 2BNRB 4TVPL 3RVWD 2PYED 4G8FB 4XXDA 1I7UB 3ECBB 4R90H 3TZVD 5D5MB 3IFLH 1S9XA 1ZLUH 3WFEL 2V6HA 3RUGB 3E6HB 4Q9QH 5HYSA 3VMNA 5IHBA 4APQD 4MGXA 3FO0H 3QIWC 1UWXK 3D69B 1LO5A 5D72L 4UMGA 2NYYC 1MJJA 1NC2D 2B1HH 3CUPA 3TIEA 2HT4C 4DZBB 1EX0A 3SDCD 1HWHB 1RZFL 3JV6B 1ZLWH 2W65B 4Z7UF 1NBQA 4JG1L 4LQFL 2ZWLT 3HUJF 1BOGA 5C0IB 3ARZA 1MCKA 2E9JA 3IB4A 1LEIA 4KRPD 2XZCL 5ISZE 3FO9A 1HDMA 1A7PH 1ZHLA 1ZLWK 1NGWA 1A9BA 2FEDC 5TE4H 1N8ZB 1XF3B 3GBLA 4NPYA 1LVEA 4L8DA 4UDUB 3MJ9A 1T04A 2F53D 1X5LA 5DS8A 2R4SL 3RIFK 1S7RB 4YBQC 2IQ9L 3LKQB 2ZJSL 3EJZC 4LHUD 2OJZH 1WTGT 3RWEA 2NY6D 4G8GD 1QPXA 2QADB 5I1DA 3AMLA 5HHMD 3LB6D 4OQ1A 2AJUH 4S1QH 3STLA 2DWDB 4K23H 5I1HH 4GSDL 1EXUA 4IRJD 3ALPA 1T2QH 4GQ9L 1XF5B 3C6LC 4GBXB 5IQ9B 5ID0A 2VLJA 5FDWA 3MLTB 5ICYB 4JVPA 4XMKL 5FYJU 5IEKB 3RHWK 2XNAB 1U93A 1Z6JT 2XOTA 3OKYA 4PJBF 5KBNC 4MCZB 2O5YL 3F7PC 4IOIB 5LBSH 5L9DL 3MRNA 3NA4A 5DMKA 4OZFG 1IAII 3QDGD 4NC1E 5SWSB 4JM2A 3BMVA 1Z9MA 1F4YH 3L5HA 5K9OB 3S37X 3PQYB 3OV6A 5HYJE 2XZAL 4PJCB 4HWZA 2BRQA 5INDA 1F4AA 2O61B 4HD9A 1NL0L 4X7TA 1NLDL 2IPKA 2X4NA 1AFVL 5BVPH 2YUWA 5CFHA 4JCLA 2SEBB 4ONHB 4FQIH 3DV4A 3NH7H 4Z95H 1HYSD 3JWOC 3MJ8B 2XTJC 4W4NA 1MJUL 1RJLB 2XG4A 3GMMA 4OZHE 3ARDD 4NNXB 2VLME 2WMPA 3HRZA 3QEGL 5H37G 2CLVB 3CXHK 4WW2B 1BFVL 4U1NB 4NQEB 2F8OA 3FONB 3EAKA 5F9WC 5J57B 3ARWA 1QO3B 1Z3GL 3MCG1 4EI5A 1BZQK 4PJBA 2GSIA 5E56A 3WXWL 4I77L 2ARJB 1E4WL 4YAQA 2AV1A 3JV4B 4GMTL 4KJQC 2ICEA 2NY4C 3DXAB 4JG1H 1U91A 3IAQA 4J3VA 5FM5M 3MX0A 4C56D 3EZ8A 4OCMC 4RFOH 5FM5O 5AD0B 4NQVA 3VGAC 3QUXA 3VJ6A 4AJ0A 1GPOL 4EBQH 4F58H 4WI2A 4Q0XL 5D2NB 5IBUB 3LEYL 1OP3H 2Q8BH 4HKXB 4UT6H 4TQEH 1OOAA 3P30L 4IMLA 4FP8L 5I1CH 5C71A 3TA3B 4LVOC 1WT5A 3LRSA 5I18H 1IARB 3MV9E 3QWRA 3AU1A 2E6JA 1KTDA 3BZFB 4YHIB 3VA6A 2Y6SD 3G6DL 3MREB 2QR0A 4LF3B 4WCYL 2EDJA 2JJWA 1G7LA 3QEQB 5ACMA 1YNKL 1QSFA 4QT5A 5F1NB 1FZMB 3FO0L 1IC7L 4WW2C 5DYOB 5KVMC 4F57H 4XP5L 2Y5TA 4Y4KC 3TBSB 4AEFA 1FRGL 4JDTH 1CFVL 1GAFL 3MLVH 4FTVD 4JFPB 4N8VB 1I7TA 3P4OB 1WWBX 5DRXB 4Z7OE 1ZK9A 1NANI 5F7FA 5HD8D 2XKNB 3BT2L 1L6XA 3D0VB 9CGTA 1OAQL 3GSQB 1GHFL 3C60C 3EYUL 4MJIB 5H8DA 4Z0XB 3BPCA 1I8MB 4DAGL 3VXPA 4K8RH 2R69L 2PYFB 3QFDB 5C09A 3ARFA 2O5YH 3VXQA 5MEOB 3RWGA 3ARDC 1YN7B 1AXTL 5IW6B 4NBYB 1ZA6B 1WICA 2YS4A 4NHCH 5AUMB 2Y9RT 4Q6YA 1LO4H 4G8GE 1IKFL 1Q1JL 3VG0L 3OGOE 3HRPA 1Y6NR 4UQ2B 1CF8L 3TO2B 5TJWK 4M1GL 3EYVA 3X14B 4MZ3A 4P5KB 1HHHB 2P42B 3VE0B 1MCOL 3CFKB 4P23B 1OGAA 3LKPA 3CVHH 1DDHA 3SJVE 4RX4D 2CLRA 1I7ZB 3IFOB 1OGTB 4Y19A 3T8XB 5FYKH 3W5NA 1JNNL 4FQ1H 1AGBB 4FHBD 4G8EB 1RUAL 2KH2B 5D8JL 3TPUA 4RA0C 1QEWB 5MENB 1A0QL 3EOYG 2YPLA 1YY8A 1RUPH 1HCVA 3VFUB 3WJJA 1GOGA 4XX1E 1S9WA 4PBXA 2HJKA 1QFOA 2F74A 4PJIF 4X9GA 4DZ8B 4L9LC 1LE9A 3TVMD 3MFFA 5GZND 4LRNL 4JRXE 2P8MA 3CVIL 4MX7B 2AV7B 5M95B 1FVDB 3QCVL 3DHJA 1QPPA 5KG9A 2EYRA 3HUJB 4MQXC 2YXMA 3S3JA 3EKCA 3LVEA 3REWA 3TNMA 3QRGL 3RWJB 2GKIA 2AEQH 3FFCE 3TNNB 4M4RA 3BUYA 5DO2D 3D85B 1PDKA 4PLJD 3UPAA 5CJXA 3F6LA 2GJZA 1NMCC 3SCMB 3VFRA 1MCWM 1P84K 1VGKB 2E27L 5HGBA 5ERWB 5A16B 3U9PL 5HTSA 4LSSL 4PV8A 4GRMA 2AI0L 3DVIA 3QEUA 2AABL 3FN9A 1S5HB 4ODUA 5E00B 2VNCA 4EXPX 1ZVSB 5TDNA 5CZVH 3H9SB 3MRLA 4U6YB 1EAPA 3T2NH 4I8DA 3VFSB 3EGSB 4I5BB 1QQDA 3W2DL 4TVPH 3DROB 1FIEA 3KXFE 1G6RB 1NCWH 2WIMA 1CT8A 4U1SB 3KLAB 4G9FA 1YPZA 4RRPA 5LXGH 1P7QA 4IOSD 5BMFL 3THML 1KCSH 3NIGE 2YUXA 1VENA 2KDGA 5J3HC 1R24A 5DJ8A 5I66A 2PETA 3F7YA 2GJ6A 1WWAX 2NLJB 1FFRA 4IHOA 3ALWA 5IJKC 3MV01 2AEPL 4F9PC 3SCMD 5I0ZA 1BF2A 4GS7B 2Z93A 32C2A 3S35X 3RBSA 4NZDA 3MYJA 4KDWA 3WDJA 5E8PA 4XP9L 1ZGLB 1IM9B 1UKQA 4F15C 1D6EB 4HUUA 4XPAH 1DSFL 4M7LH 1NBZB 1ZSDA 4PD4J 3H7BB 2VQTA 3TH3T 3P11L 4PP1C 4X5WB 2I9TA 1MHEA 2UWEA 4DKFH 3GK8H 3ZTNL 3ZE2E 2CR3A 5I71B 1J88A 1EZVY 2IF7A 5D7IE 2B4CL 1A6ZA 2OTUA 4JFOB 4QTIL 3SQOL 3MV8A 3D25B 2E9IA 3INUL 3NFSH 2FR4B 4ORGA 3EYOB 2DQCL 1H9VA 1XAUA 2L4OA 4V2BA 2YPKB 4ZFGH 1NGZB 1BD2D 3AS1A 1EMTH 1A4KA 3QRFM 1S7VA 3ULUE 4ZODA 1UM4H 1NFDE 4Q9RL 4FQCH 2HTKD 1EHXA 4HKZB 2P8LA 4UUJB 4Y4HD 4QRTB 4MA7H 4LPXA 3H9YA 3VXMD 3L5JA 1G7MA 5IT2L 1VEOA 2R0KL 2Z31C 5D96C 4BFIB 5JW5B 4OBSA 4R3SA 1G1CA 4BH7A 4X6BA 4AEIL 5AZEL 3VW3L 1R3LA 1N3NA 1OWRM 4N9GA 4M7LT 4YDLB 3RX8A 1C5CL 3UO1L 1EUUA 1FYTA 3LN5A 5L2KA 4XHQA 2ILLA 2HP4A 3H42L 3MUY1 3VDAA 3U0PA 4XZUA 1AE6H 3MRJB 3UZVB 1JGEB 1EBAA 1LEGA 1XGTB 1K6QL 4MNQB 3OL2A 4QGYA 2QQLL 2IH1A 4FG6C 5HYJB 4HFWB 4NQDD 1FAIH 5I76B 1RK0B 4Q74A 4WJ5B 2BY3A 3DIFB 5HI5D 4Y4FA 3QUZA 3O3DB 4LLMB 3QJFB 4HIJA 3SDAD 2JTDA 4XH2A 2LTQC 2BXYA 3TGXA 1IMHC 3GKZA 4JHZA 2BXZA 1U0QA 2DKUA 4YXHH 4UDTA 3C5SA 2NXYC 1E27A 4Q58C 2EC9U 2GAZA 3BKYL 5ADPH 4PRAA 3EO9L 2BVQB 3F12A 3OAUL 4C54A 5C6WH 4NKMB 4D0DA 1IRAY 1FL3A 1LDSA 4OZGA 4M3KB 4NFCA 5E2WL 5EPMA 1CFQA 5E2TL 5AAMA 3KYOA 1MIEL 4UAOC 3WS3B 3D3VE 3KHQA 2GTZB 4XCFH 1QG3A 1T4KA 2DF3A 2FGWL 4LU5L 4OZFB 5GZOD 2NY3C 43C9A 1TCRB 1JN6A 4X6CA 3IFPA 2FRGP 2BHZA 5IFJB 3GI9L 2NZIA 2WW8A 3AM8A 3EW3B 3L3DA 1YDPA 1H8OA 4RMRA 4LCIH 2VXSL 5HXMA 4HGWA 5E94B 4HHAA 2ENYA 3TJEL 3SE8L 3MRBB 2QSCH 4KAQL 4LLAA 4TULL 4MB3A 3AB0C 5EIIB 1MFDL 1W0YT 4JDVA 1DBMH 3ZSSA 3GMNA 4ZTPL 4QHUB 2M1KA 5DJ6B 4MD0A 1J1PH 3U48A 3OR6A 1WIOA 3HI5H 5IW3A 2FLRT 2VISA 4WTZA 4WY7L 2PYEA 4XBEL 3I75B 1XZ0A 2V5RA 4NRZA 1X5JA 2X1OA 3C5ZA 4ZQKB 4X6DB 4XNXH 4HDIA 4OB5L 3NIFF 5DK0B 2F58H 1NAMA 3HAEA 5H37H 5HHOA 3X3GL 2EYTA 3MLZH 1RZGA 5C3TA 3SKJL 1UA6L 5E5MA 5HYQA 1AO7E 1G7QB 2H32B 3MMEA 4JFEB 4AMKL 1UT9A 2HH0H 1MFEL 2EDXA 4RISL 4KV5F 5F7WC 3U6RA 2LU4A 1GHFH 4ZPVB 3MV8E 3SGDI 1QR4A 1IJ9A 4NJAL 4XCCL 4YZFF 4U3XA 4N1EA 1L7TL 2CSPA 2OJZL 4JFFE 5DMJB 3RWFB 35C8L 2OQJB 3QO1B 4FZ8L 3TYFB 5TH2A 4A2MA 1J5OH 1H3UA 5MI0B 3O2WH 2XQBH 1F90H 3QDGB 2QHLA 1GSMA 1HQRB 1A2YB 1R3HA 4MZ2A 4QRPD 3TA3C 4HSQA 4NSKB 5CZKA 4NGHH 3CSYB 4XAKD 5DFWH 1AGDB 2G5RA 3PNWA 4WRLA 4N9OB 3W0WA 1RQ5A 4PR5B 4XP5H 2APFA 1KULA 3DX9A 2AXGB 3L9RB 1T0NB 4YFLF 5LVEA 4DUXA 2O93L 1MJ8L 4XGZA 2GFBA 4DGVH 2JJVA 5ISZA 3GMRA 3ARQA 3OZ9H 5B3JF 4U33A 4I1NB 2DLGA 4F9LA 5T3XE 5DUPH 3OKEB 3T2PA 4O2EA 4NFDA 4G8GA 4U7SA 1INQB 1OWWA 1T5XB 3L3HB 3U0TB 1IAKB 3ILPA 3PL6D 4WUUD 1AHWA 4YFEA 1KELL 3FT3B 2D03H 1T22A 1P7HL 3OHXB 1I8IA 4AZ8A 3B5HA 1K6QH 5JIPA 1QR1A 2UY6A 2WUCL 5HGDA 2DICA 5J06A 4AH2A 1T66D 1J8HD 4MJ5A 3KS0H 4KJWC 1R5VB 4I77H 4MAUL 1KLUA 1IT9H 3SDAC 1NGPH 2FZ3A 1HEZB 3C8DA 2FB4H 3D39E 1NC2A 2DMKA 1UJ3C 4XCNB 1SYVA 2BX5A 3H0TA 2F54B 3EYFB 5GGVY 2DKSA 4KH2A 3LEXA 1AXIB 1ULVA 4YIQB 4Z7QE 2JB6A 3P0VL 3UXFA 1A6TB 2YD7A 4GXUM 3TN0A 4FQ1L 1YEFL 5ANMB 4LBEA 1U3HA 5D93B 3VXUA 3RU8L 1EMTL 5C0GB 5IBLD 2OMNA 2WIIA 4P48A 1H3WM 4NBZB 3WFBH 3IVKB 3O45A 3BQUB 4CADB 5CSGA 4Y5VA 4Z7UA 1P4BH 1YN6A 2B20A 5SWQA 1LO4L 2HKFH 4RAUA 1CG9A 2LQRA 4LVNC 3L3OA 1U8OA 4QRPE 5I73C 3T04D 1UJ3A 1YY9C 1CZ8L 2H26A 3HHRB 3EO1B 3FQWB 3I84A 4UTAH 1IGTB 4KKAD 3WN5B 4QHLB 4IRJA 1DSFH 4X7DC 1J1PL 3SE8H 4BFGA 2ICWA 3GSUA 4KRLB 3BXNA 4UBDC 5ADOH 3QULB 3K4ZA 1AKJA 5SV4A 3V6OA 4Z7VA 2AJ3A 3WSQH 3MV7B 4NWUL 3VWKA 1CGTA 4O9HH 1LO0H 1ZHNA 3TCLB 1SEBA 3VD4A 1FNSL 1A6AB 1UB5B 4OCNC 4C4KO 3KJ6H 1I3VA 3FQUB 2B8OT 1CDHA 1C8PA 4O2FA 4HWBL 2VERN 4OLXH 2R56H 4TPRL 3U46B 1VFOA 3H6JA 4JANA 4K9EL 3V5KB 1U95A 4F57L 3CMGA 5HD8C 2XT1B 3THMH 2ADJB 3H3BC 1ADQA 2ED7A 2FECL 2XG5A 2WINB 2MKWA 4LQ1A 4PTUA 4CVZA 2BHYA 3LKNA 4I48A 1WC7A 1SJXA 5IWLA 2PR4L 4MA1B 4QHKJ 4AIZB 3QFJB 3OGCA 4IMKA 5KOMC 4U1MB 4EVNB 3V5DA 3V0VA 3ULVH 4DW2L 3KYKH 4KU1A 1QSFE 1AI1L 4P9MH 5DMYA 5JIKA 1YECH 3H9SD 4FRWA 4FXLA 1CLCA 4FFZH 3VFMA 3IS1X 5CD5D 4BZ1H 4KTYA 4PGCA 2HTLD 4X8JB 1IGFH 4MJ4A 3RKDC 5MEPA 1VFUA 4HJJH 4NO0B 3X12A 4WWKB 3OKDB 4R9HA 1BECA 4GAGH 1DBBL 1OL0A 1T6VN 4FQLL 1UEYA 3QG7L 4DGVL 2OJEA 5IWLC 5ITBL 1H3PH 4UB0L 1NDMA 2BNRD 1I9RL 1TENA 2BY0A 1MWAA 4S1DD 3QEQD 2VMFA 3RDTB 1FGVL 4W4OA 1PBYA 1E6JH 3DYMA 5DJAA 3V95A 4XT1C 1FFNA 5GRUL 2ICWJ 4YDJA 3PWUA 5BCAA 4L9LB 4YBQD 1AR1C 3RAJL 4Y89A 4M7JH 5EDXA 5CD3A 3RZCA 4KVNH 4GW4B 4WU5B 1ODAA 1F6AA 3TBTB 4JJ5B 1IKNA 5TPWL 4ONGL 4ODWB 4PRIA 3WLBA 2J6EA 4QOKA 4O02H 3OR7B 4LSUH 4W70A 1RUAH 1AFVH 3O81A 4HXBH 3KNBA 1EO8L 5JXAH 3DHMA 4NQCA 1GIGH 3D87B 2AK4A 3O6LL 3BN9C 2HT3C 5FDYA 2E3VA 3CFIC 4OF8A 1YMME 2ADIA 3H3PH 3ZDYF 4FTVA 1RZKH 1SHMA 1LO2H 4X7CC 4KPHL 2PO6D 2ZSVB 2NYYD 2PTVA 4UTBL 5D5ME 3ULUC 5C0CA 4MDJB 4OCRH 4DVBA 5KJRL 1Y0LA 2VZOA 1ZOXA 3FCTA 3C8HA 3S36L 4NHUA 4OFYA 3F58L 3NACH 2A77H 1H3VA 3BGFC 4Y5XA 3HE6C 3BP6B 3WNKA 4PJ7E 2DLTA 3QPQD 1F4WL 1E4JA 3CH1A 4POZD 1ZLVH 3KPOA 3GSXB 5ILTH 2NX5E 5I1JL 5FA3A 3LQZB 4GKZA 5F3HA 2FIKB 3QDMA 1FFPA 2MCPH 1FYTE 1QSEB 1FRGH 4JDTL 5FB8A 3CNKA 1A7NL 3FQNB 4ZYKB 2BHUA 3CU7A 3RGVD 3LZFH 4PJFB 5L2JA 2VITB 3NZ8A 3T0EC 5K9KB 2BCKA 1NBYB 3EOAB 1A7PL 1FLRL 3G6DH 3WFDL 1ZGLM 2DI8A 5ITFA 2F8XC 4GAGL 4J8RB 1DR9A 4NFBA 5GHWH 4OCXH 4LIQH 4D0CB 2BNUA 4Z78B 3BRDA 3U30C 2NY6B 4XVTH 5EZIL 4F8TA 3SDDA 4RSVA 1J8HE 1KCUL 1NLBH 3U4BL 4F58L 2BERA 1OB1A 5FECA 4WI4A 4PY8J 5DJ0A 4CUCA 2V7NB 1D5IL 1CICA 1VFBB 1FLTX 2GITA 4CAGA 2DD8L 1VKXA 4MCYA 5EOQL 4ZTOL 4BQ8A 2P24A 1NGYA 2FX7H 3ZE0E 1VERA 4QTHB 1FNEB 4M48L 4C56B 3SGKA 2IWGA 4E0RB 4N8CH 4BK5A 3G5XA 4M1CC 5AZ2H 1XMWA 3O4OC 3MRGB 3GJFH 4X83A 1NQBA 5ALCH 4K71C 1MHHB 4XC1L 3NIGF 1HNGA 4WFGE 5CJQL 5ICZA 3RWHB 1S7TB 4YHNB 1KENH 4YR6A 3G5ZA 4PS4L 1XIWA 5E7BA 3QXAB 5T5FL 4OM0L 3MRPB 1FGNL 2R0KH 4MQ7A 1VFAB 3ARPA 1JTOA 1KC5L 1EEQA 3GHEH 1PY4A 4Y4HA 3S3PA