1JGLL

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig kappa-chain
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL01
4K71C 3HMXA 2Y36H 5L2KE 1JNNL 3L3DA 1YEJL 2DOCA 3SDDA 3QHZH 5TF1L 3SO3B 3VFPA 3SE3C 2ZJSL 2C9AA 3D39A 4PRID 4E41E 3L3JA 2A83B 2QADC 2XQBH 4HCRH 3SGKA 1G0XA 2YWZA 1QR1B 1G1YA 1INEL 3BZDA 4PREB 3ZE0E 2IANE 2BFVH 4LIQL 4WHTB 4UILL 4YLQT 4PGBA 4R7NA 2I5YH 5IM7A 4OLWL 3HE7D 2D7PA 4KK6D 1KIUA 2IQAB 3L5XH 4DGVL 3C6LB 1A1OB 4X9GA 1FZKB 1UQSA 3QHFL 3RVUD 2DQHH 2ZPKL 4QCIA 3MREA 1BEYL 1P84J 4FQXC 3MJ9L 2FEEL 4Y88A 1BZ7B 5L2JA 1WAAE 1ZT1B 3UAJC 2Y9RT 1UKTA 3KR3H 3MYJA 2DWEA 5ENWB 4XVUD 4J6RH 1U8PB 4DKAA 4QOKD 4Z7NE 4QF1B 1I1AA 5LGHH 1T89C 5BRZB 3QAZC 2WIMA 1WBYB 3X14A 2OMNA 4L3EA 2BRRH 1F8TL 4LKXB 1CIUA 2CLRA 2MCG1 1MQ8A 4MNQE 4MXWH 3TNNA 2D0FA 5EZLB 2QL1A 4WU5A 3ARGC 3FB5A 4JFEB 4XPFH 3P73A 1MOEA 4JRXB 1FL6B 4YXHL 3MJ7B 4XCCH 3P4LA 4OJFL 2X1OA 1WUNT 3PGDB 4QT5B 3REVA 4ZUWA 1MCHA 2EDEA 1F90L 5DK2A 1OAZL 3T3PF 1N2RA 4TUOB 4EBQL 4IM8A 4P3DB 4GSDH 3OXSA 5D6CB 3QCUH 2CXGA 1MI5B 4YDVB 3RWIA 3GK8H 4PS4H 1AI1H 2VLRB 2EO9A 4E42B 5J12C 1FGVL 1Y0LB 5D7LE 4YDJA 1IT9H 3I50H 4P59L 5CZXC 3K4DA 3BIAX 4TSBL 2EYRB 4HT1H 2C1OA 3MFFA 3VG0H 1H0DB 3PABA 1MJJA 4P2QE 5HDBE 1FLRL 5IV2B 3NN8B 3GI9L 4XNZB 3L3IB 4IOFD 3CFBA 1UWXK 3X12A 2HFEB 4KDWA 2FD6H 1BM3L 1CLOL 1YJDC 2ENSA 4PJFE 4UB0H 5D5MB 3Q6FA 4GJTB 4LCYA 3QWOB 3QSKB 4FZ8H 2JCCB 4I18A 5INCB 3S88L 1IM3A 3LKQB 3NTCH 4RISH 4HMCA 4HMDA 4ETYA 3OB8A 3O4OC 5I17B 3DPBA 4XGZA 4JRYE 1BQLH 3MRDA 5HYJD 5DO2D 5JZ7C 4XPHH 5JDJA 1KULA 3UZEA 3MODL 4WW2C 4XNMB 1N7MH 2YD6A 4PP2B 3S96B 2A6JA 3RVWD 2OQJB 4OTXL 4DQOH 1GRWA 2IADA 4MQSB 5D72H 1AJ7L 5IHUL 4ORGB 1T7VA 1FFNA 2PW2A 1BVKB 1WZ1L 2P5WA 5F1NB 2CO7B 5HYSG 3WO3B 1QRNE 1NSNL 1FSKB 1X5KA 3JTTA 4RZCB 3ARFD 3IKCB 4F37K 5EIVA 3QNYB 3P30H 4U31A 4RFNC 5C0EA 5IR1A 3MV8A 5EWIH 1S8DB 1OTSD 2ADFH 4JM4H 5CGMA 3CZFB 3LKRB 2Z8SA 3OAYK 1IRAY 2ICWA 5I1HH 4PRBB 2B1AL 3FMGL 4JO2L 5KAQG 1A5FL 1UM4L 1A9BB 4UDTA 5SWSA 2CKBH 2CH8A 1FSKC 5CWSB 1VFBB 3EO1B 3S36X 1I7TA 2WIIB 1ZWIB 4OSUL 1TTUA 3AS2A 3PJSA 2PNDA 1CYGA 3MXVL 4MQTB 5EORH 1DL7H 1W0VA 1BP3B 1T03H 4J3SA 4HKJB 4RAVA 3JBG7 5JW4M 2GITB 3HE7B 4MAYB 3D3VB 4LSSL 1RUQL 3THMH 3H9SD 4UIKL 2NZIA 3HFML 2DS4A 4L3EE 3ZT7A 3WFCL 1D6EB 3DXAB 4UBDC 1EZVY 4HF5L 4D0CB 3I2CH 1UEYA 5K9QG 1TENA 5GGQL 1AO7A 4AEFA 2BVPA 4HXBH 2MJWA 5E99H 3VGHA 2R29L 3UTSB 1OGAB 3QXVA 1BIHA 1W72A 3EDJA 1XF4B 4X7DC 4ZUUB 5I8CA 1LMKA 5IG7B 2Y7QB 3IFOA 3RA7H 1KJ2B 3D87B 5I1GL 1MCLA 5BRZD 1K8DA 2FLBT 4P46C 1JPFA 3AUVA 3DBXB 1MY7A 1LEKA 1CG9A 2FSEA 2VXSL 4GAYB 3TLRA 4LKCA 4M1GH 3TIEB 3MLPA 5FGSA 1CFBA 2EDRA 4JRWA 2F5BL 3E8UH 1QSFD 3TO4D 3OL2A 4PLKC 3V5KA 5ADOL 2LV4A 1NBZB 4OLUL 4LRNL 4F15C 1OP3H 3CCHA 2XACC 2NY5L 3V5DA 1FO0L 1H8NA 1KELH 1RZKC 2HKFH 3GMQB 3SQBA 2FYYA 4K8RC 2XI9A 1JGVL 2D7NA 2YWYA 2O5YL 5D1ZB 1ACYL 1U8LA 3RWEB 3NCFB 4LF3B 4XTRC 1QZ1A 3LEVH 4H0IA 1CQKA 2FIRT 3QXDA 1SY6H 4N90D 2P7TB 3CVHL 5K33A 2RIKA 3MV9A 3GMNA 3OB0H 3D0VA 1MF2L 3WFHB 4HG4K 2ARWA 1U8IA 3PIQA 1HN1A 1J1PH 4WHYH 3DETD 4Z7VB 5AAMA 4E41A 5LCVH 2OR9L 4NM4H 1WWWX 1J0YA 5J57B 5DSCA 1DQQB 4IBLT 2DQTL 2XKNA 5I6XB 3UPRB 5CD5C 3G5YB 1ZA6A 4DGYL 1NCTA 5DHVH 4OLXH 2J4WL 3WUWA 5J6HA 4KVNH 1XGQB 3QUZB 5E4EC 2YRPA 1NJ9A 3FT4A 3SE4C 1ACZA 1T1ZB 3FOLB 2VDOL 1UZ8B 2NW2A 4M43L 4ALAH 1D5IL 1EO7A 3TBYA 4JFED 1IGMH 5I66B 3KYMA 1ES0A 2MQCA 1W8OA 1EO5A 3DSFL 4APQB 5ABDE 3ZTNL 3FQNA 3P0YL 1DQML 4FG6C 3ULVF 5D1XA 4FRWA 1AR1D 1L7TH 3B3IB 3CC5A 1IILE 4GH7B 4JDVB 3TM6A 3QP3A 1FVDB 1KJ3L 2W59A 3WHXA 3LDBB 2OZ4L 3O6FD 1ACYH 5JPMB 4QWWD 4WCYH 3ARBD 3QEGH 5IHZB 1UXWA 2HFTA 3OKDB 5FGRA 2QHRL 1I3GL 3HZMB 3STLA 5IB1B 4FFVD 3VRIA 3VI4E 1IBGL 1G9EA 1JHKL 2CKBB 4KC3B 2WUCL 3IDIB 5FF6B 5I2IB 5CCKL 5I1KH 1T0NB 1TZIA 3OJDA 1BLNB 2Q8BL 5CUSL 5T1MA 3QO1A 4LASL 43C9A 5L2KB 2FNBA 3DI3B 1XF5A 3E8UL 1K6QH 4PB9L 4KK9D 1P2CA 2NLJB 2R0WL 5KN5B 3ULUD 4LEOA 3BZ4A 5D1QD 4Z7QF 4ONGL 5C6TL 2Z93A 1UM5H 3RWCB 1CBVH 2D2OA 1XF1A 2HN7B 3OZ9L 3BMWA 1H3WM 2C4FU 3MJ6A 4I48B 4ZUSA 2ARJQ 3NCJH 3UTTB 3FQUB 5D2NC 3JV0A 3QUKB 3WNOA 5BXFA 3DO7A 1PKOA 4KI1A 1KC5H 1LD9A 4JKPH 2KUTA 5IFHL 3GJFB 1A6TA 1IARB 3UBXI 1EHLL 1HILA 4X5WB 3BKMH 1U8QA 2NX5B 1MEXL 4E41D 4LVNB 5F3HA 3AC0A 1VCAA 1MHEB 3TVMD 1V7ML 2B2XL 1BIIA 1I9RH 2WINB 5FGBA 5J9PB 1RIUH 3CFJA 2PXYB 4Y4HD 5E8PA 5FCUL 2EC9T 2DLHA 1NCNA 2EDBA 4B7LA 5DS8A 4N5EC 4FQHA 4G6AC 4M00A 3KYKH 3SGJC 4RMVA 1MHHA 5J12B 3MV01 2I24N 1RZ7H 2AK1H 5F72S 4TRPL 2XYCA 2QSCL 1CD0A 1ZT4B 5D2LE 1ZLWH 2RGSA 4KUZH 4LASH 1YUHB 2AERT 1HSAA 3K8MA 1PKQA 1DUZB 2ZCHL 3PUCA 4XP1H 2IF7A 3O3AB 1OAYH 1IC1A 4HGWA 4Y5VC 1LEGB 3FMGH 4JO2H 1NMCC 1UM6L 4PTTA 5GS2H 4HFUL 3O6FA 3KXFB 1CXHA 3ZE1F 4H20H 2NXYD 5DUBB 4WO4A 2QSTA 3NZHH 1FV1A 4K9EC 4G7YL 5D7LB 4E0RB 2BSED 2YRLA 1RZJC 5JDSB 1ZHBA 3TBSB 3O2DL 3GSXA 1MNUL 1G7MB 2C3HA 4W6YB 3KPMB 1F13A 2EZ0C 2KKQA 4LSSH 2WBJD 4S11A 4X0KB 2FX8L 1EEYA 2X9YA 4JFHE 4YHYB 1CT8A 3DTXA 3VFWB 2VN4A 5LWYL 1J0JA 1AGDA 1DDHB 4DOHB 3KS0J 1T03L 3HRPA 1LDPH 3NABL 5DMKB 3A67H 5DZNA 4OZGB 1IAOB 2XZCL 1F4XH 4N8VG 3WCYA 4YHNA 4KVNL 3S35H 3FOMB 4FFYL 3EYFA 5EUKA 3DJ9A 1U58B 4DGYH 1ZTXH 4IMKA 4G8FA 1KEML 5FO9B 3RZCC 2X4OB 4U1NA 1RFDL 3P9MB 3CH1B 1BM3H 2OR9H 5F70A 3MV11 2BP3A 1JGDB 2A74B 2CPCA 4X6DB 4PBVC 4EJ1C 3RTQD 3X13A 4BQBA 4Q9QL 5E8OB 4K9EL 2JJWA 3BGFB 3GJEB 3CVHH 2HFGL 4LVEA 1MNUH 3RX8A 3RPIB 3UYOD 3BPCA 1FGNL 1ZMYA 4OCWH 3OG6B 5BJTA 5JMOC 3FO9B 2F53A 2LU4A 3BFOA 3O9WB 4WDIA 4YBQC 1U8KB 5HGDA 3RUGE 3BRFA 2UVEA 3ARDD 3CFEB 4L9DA 3VD4A 1G9MC 3D39D 3U7WH 4YXLL 2X4SA 4XPGL 3T4YB 4O2CA 3SE9H 3O6MH 1D5ZA 2NY2C 3QPQD 5SX4I 5MEPB 3NZ8B 1MH5B 4KMQA 4XXDB 3O9WC 3KPNB 4X7SH 1G7QA 2ENYA 1QQDA 5SWQB 2VAJA 1WTLA 5HHOD 3R06A 1D3CA 4M1GL 3HA0A 5B38B 1UXSB 5E5UB 1KIRA 5DFVD 1CDGA 1QBMH 1ZT7B 4YHKH 1WICA 1XGRB 4UNVA 2XWTB 1I7ZB 5CZVH 4OZFH 3RI5F 5DEGA 3TC9A 5C0RL 2I9TA 1A0QL 5CHNA 3ZMRA 1I7UB 1U95A 1HH6A 3DOSA 5E99L 2R29H 1C08B 1HZHL 2IAMC 1OGAD 5HHPA 4JFEA 2IAND 2VZ1A 2ZUTA 4OLWH 3SCMD 2CR6A 4QT5A 4X4YB 3F8UB 5E1AB 4OKDA 1CDIA 3O3EA 3HR5B 4KXZI 4R96A 3I75B 3WFBH 1ETZA 4O51A 3P77B 3VXPB 3MX0A 4XNYL 1BMGA 4M3JA 4R0LA 1KPRA 4HEPG 3EO9H 4QHUA 2X4RB 1WBZB 1M4KA 5M95B 3D9AL 3D3VE 4I18C 4JLRB 1RJYA 1I1YB 1W0WB 4I77H 4C4KO 3QDJE 4L8CA 1RZIB 5I1KL 3N9GH 3MR9B 2YPLB 3L3IA 3PDDA 3MRRA 2LABA 2LAGB 4YDLB 1IAII 3FQRB 2HYMA 3EAKA 3GO1H 2DI7A 1IE5A 2JB6B 1CQYA 3QUMB 5E2VH 3RWHA 2D9CA 1IM3B 1LEIA 1XT5A 1NFDB 3U36A 4OZHE 4XBGB 4JQXC 5KSBE 3O2VL 1P7QD 4AENB 4OM1H 2WBJB 5GGRA 2A73B 1RUPL 3WLWD 5MHSD 3ZKMC 4KK5D 2CUMA 5FA4A 4HUXB 4DZBB 4HHAA 2VISA 3VH8G 1FFOA 4PJEA 5I18L 4MJIA 2IEPA 4M8VA 1CF8H 3UJTL 1FNGA 5T33H 4ETQA 1H3XA 3L95B 2FH6A 3QQNA 3DX6B 3ZE0F 4F58H 2FO1A 5EC1A 4KRPD 1U6AH 5TF1H 4P4RB 1GGIL 3GZKA 3HZKA 1YA5A 4WHDA 1AIFB 2AAVA 4J23A 2I07A 4RISL 3VFVA 5CEZD 3LS4L 1AGBB 1KJVA 1PLGL 4J4PC 5C9KA 3UEZA 4PJAA 1W72L 3O41A 3VA2C 1MFNA 2FCBA 4HLZH 2VB5A 3GI8H 2FD6L 4Q0XL 1FN4B 5LXGH 3HN3A 4PRIE 4I3SL 1UJ3C 5LCVL 1JWUA 3KXFE 1KPUA 1XGTB 4U05A 3LN9A 1D9KC 3QJFB 4GAJL 2FO4A 3BZFA 4JZOB 2ARJA 5KG9B 4TSBH 1N3NB 4UTBH 3K2UL 1XFPA 4MNHB 1SYVA 3TV3L 2CD0A 4AG4H 2GJZA 1TQCC 5IROC 2VTFA 4LU5H 1NGPH 1KCUH 5EOTA 2RFXB 4H1LH 4Y5YA 1QEWA 2MSPA 4LHUB 3TO4C 1P6AB 4DCQB 4N0UE 3CD4A 1FNFA 4LNRB 1HCFX 3PGFL 3AS1A 2JLLA 5F7HA 4RFOH 2NY0B 1S3KL 3QEQA 5ITFA 4LGRB 4IHOA 4YC2B 1RURH 2R4SL 3MRJB 1HYRC 1EDQA 2OTWA 4P46D 1UB5B 4S1RL 4WUKH 1D9KA 4F7EB 4D9RE 2V17H 1ADQA 1OGAA 4OLZL 2YPVL 2FL5B 3QPXL 1KCSH 2PN5A 4OM0L 2GTZA 1OVZA 1NMAL 2LTQB 3QDJB 4RGNB 5C92A 4FQQA 5EUOA 2Q86B 3U4BL 1T5WB 4K3DH 5IVOA 4JHBA 4QRQA 2Z35B 4F3FB 2VXTL 4K2UH 3F58L 5T1LD 2IGFH 1MPAH 4FQ1L 4OZHF 1KLUA 1M7DB 2MPAH 5J8OA 2R2HA 3M1BA 2CDFB 1AKJB 1A14L 5ESVA 4IOIB 4I3RL 2IANB 5DD5H 4OGXH 2FJHB 3W0WA 2NX5D 3QUYC 1NC2B 4YPJA 3U9UA 4TNVF 3V5KB 2GJJA 3B9DA 3TVMB 3H9ZA 3IDYB 1SY6A 5FK9A 4PJGF 3LQAC 2V7HB 3EYSH 1RV6X 2DBJA 3CX5J 1NAML 3DLQR 2EC9U 3J7HA 1FHGA 3UMTA 3BDXA 5HGHA 4NJ9L 3DV4B 4Z76B 5DJDB 3L9RB 3VH8A 2XY1A 4PJ8D 3OKEA 1GL4B 1HQRA 3CVHA 3NGBC 4U0RC 3RWJA 5IBTH 5A16B 3LAFA 4NN6C 3HCVA 2X42A 1G6RH 4I0PD 3ULUE 5GGTL 5T3ZD 3QDHA 1A3LL 1N5AB 5JHLL 1AGCA 2HFFA 2EDNA 1PYWB 5JW3H 3BZEB 4J3VA 1PGRB 4YHYC 2Z31D 5IB2B 3PWPE 5IF0A 3D85D 3IDGA 1MFAL 4LSRL 1BF2A 5ANMA 4B5EA 1B88A 2A2QT 1SHMA 2YHGA 1JK8B 3DYMA 3UO1H 5IJVB 3DURA 1T1XA 5HVFB 5GGSY 3GSVB 1SVZA 1GIGH 2V17L 4KRPB 4OLZH 2VAAA 4WO4C 2R4SH 3P0GB 5HHVL 3SKMB 3C9NB 1WFNA 4JHAL 1A6WL 1CLZL 1FNSH 5DQ9B 3F7VB 3WLBA 1R3IH 4IOFC 2W60A 4JKKA 2EIZB 1MQKL 4AIXA 1DQLL 1GGBH 5DJ0A 1QFUL 3QULA 3FONB 4JFHD 5HYJA 1T89A 2BNQA 4OIAA 25C8L 4P99A 4NQCE 1NGQH 4N0UB 2D0GA 3F65A 2YPLD 3IKKA 3L1OH 1N0XH 3WFDL 4K94C 3CX2A 4OFYA 2HVKB 5CD3B 3PF2A 3ECBB 4L8DA 4M6OL 2XV6B 2Y06H 4Q6IC 5JA9A 5JORB 4FQCL 3QA3A 1CGWA 4X6BB 4U1JA 4XVSH 1IC5H 3ARFA 3LKPA 4HIEB 4POZD 4EQ2A 4Z7VF 5C71A 4KKAD 3DETC 3F7PC 1A02N 1OAZH 5HY9A 1U9KA 1YMME 3E2HB 4WWKB 4HV8A 1OSZB 4NZTL 1NGYA 4V1DB 4XPFL 1HILB 1SJEB 2OCFD 2QQLH 2AABH 3SDAC 2BCKB 4NGHH 5E2UL 5DD6A 1ZSDA 2R0KL 5H37H 2WWMD 3TN0D 1YEKH 4MXVE 4DVBA 4OZFA 2DQEH 1FLTX 5E8EB 2P24A 3KPRB 5GGVH 2J7LA 5SWSE 1JVKA 2YC1B 2GYSA 1DBBL 3QPQC 1RUAH 2NY2D 2RBLA 4LMQI 4F2MB 2BVQA 1JGUH 1LP9A 5EPMA 3HB3D 3KR3L 3L7EB 2MPAL 3MRFB 1S7VB 3LN5B 3EJZC 3O0RL 5I9QC 3LVEA 1RUMH 3BEWA 3E6FB 2PO6B 3VFMA 3NACH 2VN7A 1H3TA 4WY7H 5EBGA 3RY5A 4PUBL 4BZ1L 2YSSB 2GCYA 2NXYC 2HMIC 3VFSB 5IBTL 2GKIA 4FTVB 1MHPH 2UWEE 4O9HL 5CLTA 1WGOA 2AJVL 3QH3A 2XN9E 1DLHA 4FFWD 1Q9OA 5DJCB 1VEMA 4ODXB 5IKCB 1EFXD 4B50A 4M4RA 3OKNB 1FL5B 5HPOA 3S3JA 3IAGC 1BZ9A 1HOCA 1X5IA 4LARH 4LFHG 2P5EE 4F57L 5JOFA 1NCCL 4Z18A 4GW4A 5K9JH 3FTGB 4YHOH 2EYSA 1DQDL 3KPQB 5AZEL 1J7VR 3SDDD 3U6RA 3BD3A 3PWPD 2JELL 5FGCE 1QRNB 1S7QB 1NGPL 2APWA 4L3ED 3MA9L 3MRHB 4F9LC 5B39B 1AP2B 1XEDA 1YYMH 1D5XB 4V2BA 5JIKA 4JFQA 4PJ7F 4EDXB 5DD5L 2XQYK 2IQAA 1N64L 2AKRB 1U8NA 1EFXA 4FZEL 4XMPH 3VFOB 3GMPA 1R3JA 5F21B 5TQ0H 3EYQD 4GAJH 4OI8A 1S7UA 2DIJA 3I6KB 5DURB 2BOCB 4G7VL 4ZOCA 5FO7B 3BX7C 5DHVA 4Q0XH 3RGVB 4MMZC 4MD0B 5FA3B 1U0QA 1H5BB 1T2QH 3MLSH 3FHQA 2Y1VA 5E7BA 4YPGA 2EH8L 2YD2A 3QDMB 2R69L 4TTGA 4PJDF 3QYCA 4N9GB 1TJIH 1JNHA 4C56A 1S5HB 2DQDH 4ZDHA 3ZSSA 5ESQB 5GSRB 3TT1H 5HDQH 4NWTH 2ORBH 4YUEH 4NQCA 2F58H 1QG3A 3GGWA 5GIRA 5CEYB 5EN2B 4KV5E 4CRPA 3HMWL 3K1KC 2XRAH 4Y0GA 2RAMA 2QLVB 1UENA 4NJAH 5EIIA 1AQDB 3TZVA 2W9LA 2IBZX 4MCZB 4O02H 3AGVA 2DRUA 2C1PB 3BI9X 4G8GE 1HSBA 5SWZB 4YBQD 4YDJB 5HGAA 4N8CL 2VYRE 3QQ9D 3WO4C 1JHTA 3WO4B 3VG9B 3MV7D 3P9LB 5FHBL 3KYNB 3JWDL 3QIBC 3B8YA 4U6HB 3KPRE 1QFWM 1QSEA 3Q5OA 3WFZA 3TF7C 3LS4H 2X4TA 3KNBB 1A7PH 1PEWA 3TNMB 5DJ2A 1TITA 3GSQB 3PXJA 2X4PB 4TNWF 2HJKB 5F3BA 4R2GC 4K3JL 1Y18A 3G6AB 3HNSL 4JEGB 3T77B 1A6WH 4XNYH 1VDGA 1IQDB 2CDGB 4R3SB 2WAHA 5JNYA 2GT9A 3LEXB 3QIBB 2PYFB 43CAA 4PJ8C 4RWYL 3UJTH 5HHVH 2KZWA 3FKUS 4HJGB 4JQXA 4PJBA 5C07E 2QKIB 3G5XA 5HHXL 2VL4A 2NY2B 1M1SA 2W92A 1INDL 4G3YL 4HX1B 2H6PA 4PJCB 1EBPA 4U1HB 4GKSB 2AEIT 3QI9C 3P0VL 3HG1B 1KCLA 2Z91A 4OQTL 3TYFA 1LO3H 1T1WB 1O0VA 2WM0A 3SN6N 4LSVL 5C09B 5DGQA 4XCYB 4QOKB 1J5OL 4HWBH 4MJ5A 1CFQB 3RL1A 4R8WL 4NOFA 4PLOB 3HAEG 4PV9B 1J12A 1CU4L 4UOW0 2KQMA 5H35A 5D5MF 3KPSB 3LKSB 4HSQA 1XIWD 4YHIB 2X40A 4NHCL 2R1XA 3D9AH 3T4AA 1QO3A 5LVEA 3P4NA 4X99B 5TDOB 1A9BA 1T20B 1DE4A 5CBAA 5SWSD 5MERA 2E6QA 4KUCD 3OR7A 2F54D 2SEBB 3MGTA 4APQC 2NX5E 3OGCA 4MWFA 1MCRA 1CDYA 2YN3A 4NO5B 1OP3K 4WU7B 4MQ7B 1JMXA 1FFRA 2D31B 1M71A 1U3HA 4LVHC 4KQ4L 1ADQH 4L3EB 4Y4HC 3QUXB 3D25A 3H0TB 4OT1H 1BOGB 1B4JH 5FYKL 4DZBA 4HHAB 2R2BB 5EO9A 3N1QC 1TCMA 3SGDI 1WFUA 3FN3A 1F11B 3Q5YA 4DTGL 4YBLC 5M7QA 4ETQB 3BE1L 4H5SB 2ZP0T 3H3PH 2W65A 2RCSL 3UTQB 4J4PA 2OTPA 5IB3B 2DM4A 4OGYL 5D2NE 4FQLL 1PVHA 5ERWB 5B4MC 4K7PL 4P5MA 2HKHH 4FXLA 5IESH 4WEBH 4K7PX 2EYTB 5JPNA 1UCBH 3FO1A 1NCBH 3CZJA 3HZYB 1AIFA 3OX8B 2EZ0D 4XNUL 2C3VA 3ABZA 3QDMD 1GCFA 1A6AA 3M8OL 1K8DB 1CZ8L 3I3DA 2R0WH 5D7JA 2ED7A 4RDQG 2IH1A 4B0MM 3HAEH 1CG9B 2WV3A 2DQGL 4HUKB 4X8XA 1PEZA 5BMFH 3OKLA 2WWMC 4XAWH 5HHNA 2VE6A 3MNWA 2MMXA 2JJTA 4N68A 5JXAL 3ESUF 1I8LC 1G6RB 1HIML 1UZ6E 5INCA 4PRHA 2E7CA 1NBZA 1R3LA 2V5SA 2W0PA 3JWOH 1M6OB 5A3IC 1HDMB 3WEXA 3DMMC 1K4DA 4C54A 3W2DL 4LU5L 1J5OH 5K93A 3B8SA 4DCQA 3MRBB 3ZDXE 2Y5TA 3D2UB 1MCKA 1DANU 2VXUL 1SMAA 3QXWA 3C5ZD 3VXRB 1CGVA 4KK8D 4PP2A 4ZS6D 3S96A 4MDIA 4A6YL 1IM9B 1C12A 2OR7A 3WLWC 3NFPA 4W4OC 4K94L 4K7FB 3VGFA 1ZLVK 1PJ9A 5EU5A 3WFHA 1DANT 1FNEA 4HS8H 4NHUB 4S1SL 1T04B 5GGUB 5DA4A 4ZFFB 4YZFF 4NNXA 4ZO6A 1BVLB 3RVVC 3M17A 5MP6L 4YDLC 2R0LL 3H3BC 3L5HA 3QNXA 1FCGA 5GGVY 4A2LA 1S7WB 1VADA 4XHQA 2ZUVA 1XCQA 5DUMH 4X4ZA 3OAZH 5F9WC 2VLLB 3MV8D 3GIVB 4KTEL 5DQJB 1JRHH 2B7DT 2CDFA 2RB8A 5DJYB 1AGEB 2DQJH 5FV1L 1S7XB 3ARED 5H94B 1MF2H 2VKWA 4Z7OF 3W81A 4XCEA 4WFHD 5F96L 5DEFA 4OQ1A 3BMVA 4AEHH 3ARBB 3B6SB 3JV4A 4LCWA 4IRJA 4XTRD 5I1CH 4CADA 4G8EA 3L5JA 3A6BL 1T22B 2J5LC 4OCMC 1A21A 5FYKD 3PHOA 5H37G 1FO0H 3JV6A 3T2QA 5ADPH 2ZCHH 2ZNWA 4HH9B 4NQDB 1N5YL 1SEQL 2QQKL 5F9JB 1G9NL 4CAGA 2CK0H 3EYOA 3HE6D 4Z7UF 2DM3A 3H9SE 1CR9L 1LWRA 4PTUA 2UWEA 4U2ZA 5TDPA 1XCTB 1VHPA 5JIPA 3S4SB 4EDWL 4PGDB 4NCDA 5C08A 2ITCB 2DLFH 5C3LD 1P53A 3UDWA 4X9HA 4QHKI 3DX8B 4Y4KA 1OTTC 2ADGB 2B2XH 4QRSB 3PWLB 4KQ3H 5B22A 5I71B 3GSVA 3TZVD 5EU3A 2XZQL 1EAPB 3MROB 3IXAA 3FO2B 4NO0B 3QQ4A 1EFQA 3UC0H 5DI8A 3RL2A 4PGJA 4K7PH 1J9CT 2E8YA 4MD5B 5DVLA 4O4YL 3DUUA 4HUVA 4PJDA 1URLA 4AZ8A 3PWVA 1CICA 4H1LA 3U0TA 1BIIB 2CDEB 1EV2E 1MFCH 1NCCH 2X7LA 4UU9A 3FONA 4Q6IA 4PB9H 2E7MA 2OZ4A 4MA3B 4NN6B 3QEHA 4WW1B 4LDLB 1MCOL 5DEZA 4FFYH 2XZZA 3CX5K 5FKPA 1C7SA 2O61A 4QKXB 3QIWA 1LDPL 1OP5K 1Z6JT 3RPKA 4G8IA 2VC2L 3WD5H 2VDPH 3PL6A 4U1LB 1CLYL 4PJIB 1HSAB 3MLVH 2YPKB 1ZAGA 3OKOA 3ZE2E 5T5FH 2FX8H 1Y6KR 4ZUTB 1T0MA 4EQ3A 5ICXA 4Y1AA 1JCKA 4QRRB 3VXRD 1UGNA 3O6FB 3W9DA 3O8XB 3QI9D 5IWLA 3C8HA 1QA9A 3F7RA 5F6HI 1C5DB 1JNLL 4LOUC 4C59B 4L3AA 1L7TL 2JK5A 4PIRF 1R6VA 2PYEE 4EVNB 3EOAB 4Q2ZA 3MRKA 5ICZA 1HEZB 3T3ME 3O4LB 3OSKA 1P7QA 4JFPB 4XP6H 3PXHA 3D18A 4HXAH 2HJFB 3EDKA 2JCCE 3OGOE 4JVUA 4C56D 3INUH 4D3CH 4OCNC 5DYOA 1G7HB 2G5RA 2WZPD 3C5JA 3WE6A 2P8MB 1TMCB 1E0OB 2DKUA 2AS5M 2NY6B 5TQ2L 4JFOA 1T7XA 4LSQH 4CN4A 4MNGE 3DTXB 3VFWA 3IDNB 1HI6B 1F4XL 1RY7B 4TRPH 3M8OH 3H7BA 4GFTB 4XP9H 2V7NB 4XNUH 5FECA 4Y4FA 3UYRL 4ZAKB 4KJWD 1GOHA 2ERJB 1WIOA 4JDTL 1JGLH 1HHHB 1RZJH 3NPZB 4JZJB 4EN3A 5GRVK 1RJZA 3QDGD 4O4YH 4OBRA 4FQLH 4PRAB 3GSWA 4KKNA 4HBCL 3IFLH 3NH7H 4DGIH 1PSKH 1V7MH 2X4NA 1F6LL 4Z95H 3UC0L 1MIML 5HYFA 1VESA 4KK5C 4EUPG 4P2QB 2EDOA 1B4JL 4R2GD 1V7NH 4AH2A 2VOTA 1BZ9B 1XGUB 1DBAH 5DK0B 4LSUL 4X6CB 1FIGH 3MV7E 5BQ7B 4NQVA 3C6LA 1J18A 1JI1A 3U6RB 3EGSA 5HDBF 5JHDA 4MXWL 5LBSL 4J8RA 3GNMH 8CGTA 1UKQA 1AC6A 2YR3A 3OKYA 3HPJA 3QR2A 4JO1H 1T7ZA 4I9WD 5TE4L 2JIXA 5D9SA 2IPKB 3RDTB 1K6QL 2VZTA 3GMPB 1JTPA 5J7CC 4ERSL 5FYKU 4M9PA 1BD2A 5EU4A 3W11D 5L9DH 1GOFA 1JN6B 1QFWI 4O58L 4G6KH 1QYGH 3GB7A 1DN0A 1MWAA 4PRHE 2P5WD 5IGXH 5AYQA 3RBGA 3UBXA 4ELMA 4Y2DB 4QRUA 4LGPB 1H5BA 2P1YA 1DBMH 1T1YA 5DO2C 4EOWH 5ESAB 5D1ZD 1F4WH 2VDKL 1P7KA 4DK6A 5DFWH 1VPOL 1OTUC 1OSPL 3PNWA 4FFVC 5GRZA 4WU5B 3UXFA 2Z0BA 4G3YH 2XPGB 5BOPA 2A77H 2Z92A 3C09C 1HWGB 1YDPA 5F96H 7FABL 5ESQA 1RUQH 3RFZC 2BFVL 4KZEL 1A7QL 1JWSB 1JRHI 5EN2A 3MRNA 1VKXB 3SKNA 5CBEA 1DEEB 4XBPB 3WNPA 1ZHBB 2B5IB 4YFEA 4A2MA 1O7VA 3HRZB 2W0KA 4KDVA 4GBXC 3PE9A 3DV6B 1AQDA 2UUDK 2H32H 4OSUH 1G0DA 1EXUB 3IS0X 1ITCA 2GUOA 4ZOAA 4JJ5A 1KPRB 3U46A 5I8EB 3EYVB 1A4KA 4NKIH 3JVGC 4IMLB 1FVCA 1OQOA 5I1HL 5D7JC 2QR0A 4RFNB 3RWFA 3ROLB 1RZFL 4NRZA 3GMRB 4G5ZL 3GI9H 4GBXB 4KROB 2YPLA 3AAZA 4QRTB 1BZ7A 2Z31A 5E1HB 3FRPG 2EDKA 4A6YH 5EUKB 3FQRA 2Q1EA 2DWEB 3B2UC 3DROA 4HH8A 2CXKA 1PG7L 5FO9A 3QO0A 5GQBA 2EXYC 3BAEH 3P3YA 4JANB 4PB0H 3QCVH 1GZQA 1Y18B 4DUWA 2GK2A 2APTA 5M94B 5KVEH 4LCUA 3RIAK 3U9PH 4U6XB 1CCZA 1CFTB 2IQ9L 2AW2A 4ELKB 2VQ1B 5GS1B 1SBBA 3U7YL 5JW5B 3QPXH 5CFHA 1LO2L 4XPHL 5F89B 3TCXA 4UT6L 1QLRB 5CILH 2Z31C 1FL6A 4YHPB 4M43H 2YBRB 3PDGA 3PV6A 2I26N 3OAYH 2F53B 2AK4B 2DBLL 1JZ5A 5IMOB 2VXQH 1GC1L 3FCTB 1NBYA 3I02A 4KPHL 5DRZB 3C6SB 4WNQB 4G9DA 1R24A 4M7JH 2MNUA 4BZ2L 1PD6A 1OAKL 5E2JA 5KTEH 1WZKA 4D9QD 1CFQA 1V3JA 1KENL 4TVPE 1FC1A 4QTHA 4K8RL 1INQA 3VRJA 1ERNA 3EFDL 1I7TB 4XVSL 3BAEL 5TQ0L 3LRSA 1P4BL 5HYJE 3MBXL 4MLIA 3CLEL 1GPOH 3QIUC 3I50L 4P59H 1K3ZA 5ALBH 5DTFB 3CFIC 4OCRL 2Y07H 3MLUH 3TH2T 1SEBB 4NQXB 2EKSA 4PY7A 1G7JA 2NW3A 1WCBB 2EDWA 5HGBB 4MQXC 1XIWB 1I8MB 4RSVA 4FXKB 2XNAA 4RAUA 5CEZL 4MAYA 5E2TH 5E4EB 4HUWB 3VXMB 5IFAH 5K9JL 2GJZB 4I4WB 5FYJD 5C0BE 3O4LD 3MLWL 4NKIL 2PXYD 5FYLH 2GTWB 4YXHH 5ISZB 4HIHA 4QXGH 4OLUH 3TJEL 1QFOA 1B6DA 2FGWL 4QO1A 2IG2H 4TPRH 2ITDB 1T66C 3QEUB 4YE4L 1JWMB 2M1KA 1I8IA 1OY3B 3RNKA 3QUYB 4P5TD 2BRRL 1E28A 3C5SA 2C5DC 3QUXD 1UVQA 4O2EB 1FYTE 2DF3A 3HR5A 4YXKH 1NCDH 1KJ2A 5D5ME 4CVZB 2NY1C 4EUPA 2WWKO 4A6YA 5HYEA 1TETL 3P77A 4N0FA 1JPFB 2CRYA 4HKZA 3MQIA 3VA6A 4JE4B 3NCYS 4HBQA 1NFIB 1WIPA 4Y16D 1KCKA 3O0RH 4AY0A 3LKOA 1IFHH 1IGFH 3CUPA 4YNYA 5IB5B 2WLYA 4G9FA 5EUOB 5I8OL 4GRMB 1X5JA 3MRMB 1U91B 1SBSL 1QLFB 4NPYA 4OCSH 2ICWB 1U36A 2BNQD 4OI9A 3QIWD 2E27L 5B8CB 1FFPB 1AKJA 4LSRH 4XP4H 1IGFL 3FFDA 3HC0B 4ISVB 4KMTL 4M5YH 2JJSC 1U3HC 1B6UA 3BYYA 2MKLC 4JFZH 1CGXA 3BRDA 2JJUA 4GUPB 4NQED 4NRYA 4GO6B 3QG7H 3VDBA 3S37L 3KHOA 4UNTA 4GMTL 1A2YB 4XH2A 1G7PB 3ALXA 3SY0A 5KS9F 1DQJB 1HDMA 2V7HA 4D8PA 3BH9B 1RVFH 1XF3B 1OB1B 2YUVA 2ESVB 1UYWL 3MRBA 4NJ9H 1MCJA 1LNUB 1YEFL 2BSTB 2FGWH 1BPVA 1SJVA 4QRPE 5F6IB 1FNGB 4G9FD 2Q7YB 1YN6B 5DK3A 4D9RD 2CKBL 3S88H 3T0EA 3SPVB 2HT4C 1DBAL 1BBDH 5DD3L 4LVNC 5A2KH 4FQCH 5HYQA 1YC8A 1KBGL 3LDBC 3BD4A 1GH7A 4JPKH 1VFUA 4YFLI 5E56A 1Z5LA 5LG1A 3RWDB 1JZ8A 4GKNB 5IFAL 1KLGB 5AUMB 4JM4L 1VPOH 2XXCB 1Q9KB 1FH5H 4ZFFA 5HGGS 5B3JF 4OKVA 5GGSB 4HBCH 1YEEL 2X70B 2OM5A 5I1DB 5GJSL 1MUJA 4L1HA 1Q72L 1IT9L 2JJVA 1MJ7H 1QFUH 1QYGL 1NEZA 4P2RB 3KYMB 4O58H 5IHUH 1AGFA 3KJ4C 4NZRH 3K7UA 4PJEE 4ERSH 2D0HA 2J88L 2WUBL 4QEGA 4R9HA 1P5UA 2A9MH 5ID0A 1NAKL 3NFNB 3BPOC 1F90H 1EX0A 5IWLC 4IDJH 4OF5A 1OW0A 3HLAA 1JE6A 2AK4D 4NWTL 2HG5B 5DFTA 5EZIL 4TTDC 1IZJA 5DHYB 4R90L 1T4KA 5L8KB 4S2SB 4GAFB 4UDUA 5TQ2H 3WIFA 3ULVD 1H3VA 3SE9L 4NNYB 3U7WL 5EC2A 1S3KH 1U8MB 5BVJB 1ORQA 4L3CB 3WLBB 1F42A 5J1TC 4JPIB 3G6JB 2OL3H 3L3GA 5TGBB 1ZOXA 4U3HA 3UTZB 1GZPB 5SV3A 3VWJA 1QSEE 2LU3A 2C3XA 3CK0H 3NFSH 4ZPTA 3WJJC 3BSZH 1EJ6A 2X89D 3GMNB 2BXYA 1X5ZA 1C5BL 1MJ8H 2CUHA 2XG5A 3TV3H 4D0BB 5IOPA 5HHMB 3BP6A 2A6KB 3IT8D 4P23B 3GSUB 3RTQA 1T66D 2VLJD 1EZVX 3V5HA 3FJTA 4PS4L 1LE5A 4NKOB 4PGEB 5CEZE 4RRPG 5J3HC 1CVRA 1WTGT 3CSPA 1SM3L 1ZA6B 3N1PC 4TVPL 5HYSA 1KEMH 3P4OB 3GSRB 4LRIC 2HWZH 2MCPH 2PYEA 4MQXD 4ONFH 2IMMA 4U6VH 2QHLA 3W39A 3LQZB 4KZDL 2VDLH 3RKDC 1FYTD 2CIIB 5BV7H 2UYLB 4L5FH 4XWGH 1OARH 1RHFA 1KIQB 2DMCA 1JZ7A 5E08H 1GGCH 3L3OB 5D6DC 2APFA 4OD2B 4JFXA 1OLZA 5D7KD 2E7LA 1Q0YL 1RJLA 4ZS7H 3D5OF 5T33L 1ZSDB 5MHSE 2DLGA 4XHJC 4G42B 2VLKB 4PRPA 1NC4D 3BGAA 3VI3F 3EJZD 7FABH 2FHFA 4P4KB 1RQ5A 1Z0NA 4H88L 1KXTB 4X6FB 2IFFH 3CSYA 4PLNC 1UXWB 4OGAC 3OKEB 1NGXB 2W9EL 1KGCE 2G60L 3CU1A 3NZHL 5IB1A 4MA3A 4L8BA 3IJSA 5GS0C 5E2VL 1AKJD 3PWNB 2HFFB 5E24E 3CLFH 1K2DB 2P5WE 2VC2H 2Q6WA 2DYPA 3FAXA 3WD5L 1TJHL 1R5WB 3QO1B 5JLZB 1S7TA 1U2HA 3VGAC 4NM8H 1BQHA 3BIKB 1GVIA 4ZFOB 4FTVA 5KZCD 2KQNA 2IPUG 4M7ZC 1GAFH 3BWAB 5A2LH 4PBXA 4FFZH 4UBDD 3ARPA 1JL8A 5F88A 1IKNA 1OGTB 4Y19A 5EUOE 4HK3J 1GJIA 2F5AH 5D2LF 1PX4A 1HHKA 1CWVA 2ZWLT 1WWBX 4GKOA 2VH5H 4XMLH 3SKOB 5LBSH 3U4EB 3FHAA 4PGZA 3RDTC 1KB5B 1FORL 1P84K 2P45B 1HOCB 3LSOA 1QPXA 2CMRH 1E6JH 1DUYA 3CFDB 5AAWA 1DBKL 4JFPA 3QIUD 5CJQL 3E6HA 1DVFB 1Q9WB 1WQVT 2O5ZH 2W9DL 3SE3A 5DQ9A 1QRNA 1S7QA 3K81A 1OTTD 3U0PB 2J8OA 1JHLH 1T2XA 4K3EH 1I3RB 4MJ6A 1MIMH 1A64A 4XC1L 3KPOB 5D71L 4YO0B 5IVXE 1MFDH 3F62A 3V6BR 3WV0A 3VW3H 3RGVD 3HAEB 4M8QA 5DFVC 1U58A 1REIA 1P4BH 2H2PC 5IK3B 3I6KA 1TTGA 4PJXE 2EDFA 4OUUA 1Z0MA 5DLML 1DP0A 1EHXA 3SQOH 3VXQB 4F7PB 1ND0A 5I1IL 4G80A 1OAKH 5IQ9B 1ZT4A 4HWBA 5CGYD 3MCLL 4I0PA 4Y5XA 3GBLA 1PKQB 2VXQL 2NY0D 3N85L 3GHBH 4BSVB 1UEMA 5DJAB 1HKLH 2IALB 4NUGL 5ADPL 4JY6A 4PJGB 5I73B 3TIDB 2YEZB 1KB5H 1OM3L 5HY9B 2PCPB 4KJPD 1IZKA 4FQIL 1E4KC 1N2RB 1YEHH 4OM1L 3QDJD 4WW2F 4WO4D 3OKMA 4MSWB 2VQUA 4DAGH 4C58B 1IC7L 5K59F 3MRLA 5FDWA 3P11H 4ODSH 4S0SD 4X6EA 4UQ2B 4FQ2H 1WAAA 1G7MA 4TULL 4ONOA 1G7IA 5F7EH 4Q9RL 5C0GA 5LAXA 4RGOL 2QADB 4ZAKC 4DN4L 1IEAA 3MJGX 1OF2B 4JO3H 1Y0LA 4NFDA 5K59E 4WW2B 2P8PB 3O3BA 2Z4QB 4Q9QH 3P0YH 4WUUD 1D5MA 2F15A 1UXSA 4CW1B 1KIRB 1XAUA 5ITBH 1X4XA 4LPVA 2OYPA 5DMKA 4ODTH 3DX9A 4F7MB 1S9VB 5CZKA 5C7XL 1D5IH 2HFEA 3BGMB 1WV7T 3IGAB 1QSED 3K80A 3CVIL 1TZHA 4G8FB 1L4IA 1ZK9A 1N4XH 1W8NA 3B5HA 5KS9E 1JGDA 4JQIL 3TBVB 4OFVA 5DMIL 1GGUA 1MI5D 4JB9H 5GPRA 1N8ZA 3STZB 1UWGL 2GJ6D 3Q2CA 3HZVA 2OQJA 5CSGA 2RR3A 3MYZA 4Z6AT 4KJWC 2DMBA 2PUQT 2R4RH 3ALPA 1CD9B 2DN7A 4RBPH 1AY1L 3MRNB 1QPPA 4OGXL 3ZDXF 3RY4A 1WIUA 1SJXA 3I6GA 3NPSB 5EB9A 2QQQA 3JWOC 4NC2B 4DVRH 3G04B 1QBAA 3ARDC 1KJMB 3IJYA 3DYOA 2NY1D 1V3MA 4PRNA 1AR2A 1YPZB 4OF6A 1A6ZA 3LKRA 4CUCA 5IR1B 5ALCL 3K0WA 3WXWL 2NY7L 4LSTH 4HFUH 4KKBC 3MMEB 1FIEA 5IGXL 4AMKL 3R1GH 3NZ8A 3WDIA 3QDGA 4WI3A 1YMHA 1VFMA 1HNFA 1S9YB 1JF1A 2BC4B 2DQGH 1R5IB 3C2AH 1YNLH 5KVGH 3PJSB 4RFOL 3OMZA 4ZODA 3C08H 4HKBA 3QO0B 3TCLA 2BMKA 3PL6D 4ZTOH 1QVOA 3AMKA 2N1KA 4GMSH 2CLRB 1CFNB 1GZQB 4UT7H 2VIRA 2A6IA 3HB3C 5I1GH 5KSVA 3ROOB 5CHNB 1JNHB 4PG9A 4WEBL 1RIUL 5DJXA 3FFCA 3SJVE 1AY1H 5FM8A 5IMMA 1QLRA 1L6XA 4LCCA 2BNUA 3TJHD 4OZ4B 1TQBC 3VI3E 2YZ8A 4M7LT 3VG9C 5GZOD 4JY4B 3UPAA 3C6SA 1N26A 3GJFK 2FX7H 3LS5L 1KSRA 4U1MA 4NFCA 4PJXA 1H0DA 4XCFL 2VXVL 2DQJL 3QT2A 1PLGH 3S35L 2DJUA 4JRYA 3W9EB 2FZ3B 4HIJA 4KTEH 5BS0D 5KSBF 1RZGB 2GFBB 3RAJL 5HJ3A 5DUML 1WBXA 4IS6B 3FQWB 4ODTL 4MLSA 1SJHB 2HP4A 5D7IA 4I18B 1R3HA 1A7PL 2X4TB 3KNBA 1ZA3B 3ZE2F 5L8LB 1KXQE 3E2HC 3V0VA 4L9LB 2B1AH 3FRUA 2Q76A 4M6MH 4HWBL 3ZZ1A 1CDUA 3VWKA 4YHZH 2E9IA 1R3LB 2ADFL 2QHRH 1F4YL 4HK3N 4XP6L 2AJXH 2HVJB 4JFYB 4X7TA 1X5XA 4OV5A 3O6LH 4NO2A 5ACZB 4TUJA 1IAMA 1AD0A 4G6FD 5EFIA 5C70A 4C83A 1X3DA 5MEOA 3K3QA 1I7RA 3BH8B 2PO6D 4MA8H 5JO5A 1BAFL 3ZL4H 5D7SH 4K23H 4DUVA 1L0YA 5F7UA 5J11B 3SDYH 1N59B 1DQMH 4BSWB 2HJLA 4L4TA 1DBJH 1N6QH 1HIMH 4M62L 5EOCH 4HGMA 3MBEA 3TO4B 4NQSB 2XKNB 4K3JH 1GHFL 4O2FA 4GRLC 1LK2B 5CSZA 4R4BA 1H3PL 2EDDA 3RL1B 4N5ED 2JJSA 4WEMB 5CD5D 1IGCH 5ILTH 1M7IB 5HHOA 5MEQA 2Z9TA 3MRGB 5ESVB 3RBSA 2MHAA 2FHCA 1DLFL 3ZLQC 5CWSA 4UIMA 5T1KA 2EDYA 1H15A 1KPVB 3FAWA 1NJ9B 3FT4B 5FAAA 4QHLB 1ES0B 3ARWA 4K3HA 2WQ8A 3AREC 3QJFA 4YWGH 1C5CH 3RVTC 5F8QC 4UUJA 1J1PL 4APQA 2X1XR 4ODUA 3TT3H 5C09E 3E0GA 4MQ7A 3Q6GL 3TVMC 3Q3GB 1QHPA 1A0QH 3RNQB 2NY1B 2UZYB 2UZIL 1QEWB 3MBEC 1EGJL 5KSAA 3V4VH 4DTGH 4RFEA 3F6LA 3QCTH 1RD6A 1K5NA 2CIKB 2ESVA 1KT2A 3BUYB 3HMWH 3W11C 1I8KB 1QBML 3DNKA 1CBVL 5DUPH 1RU9L 2VH5L 3HE6C 2GJ6E 4ELMF 4HPOL 5INDB 1G9NC 2HLAA 5D1ZC 1CXEA 5EU6A 3VRIB 2Y7QA 3GFUA 3LMJH 5FF6A 1G0YR 5EG6C 5CP3H 3I3BA 1T0NA 3FQTB 3IDJA 3CDGB 4KRMB 4HK0A 3BHBA 3IFNH 4JFFE 3SDXB 1W0YT 4AT6B 5I8KH 4AM0A 4LEOB 4YXLH 4CN6A 1MCQA 1A6AB 4NN7B 12E8H 1EEUA 4YAQB 1ZGLA 3O3DB 1L0XA 2FEDC 4U3XA 4Y16C 4CNIA 3D2UD 1WISA 3CXDL 4OFIA 1JFQL 4IOIA 1FZOA 2P5EA 3C2SA 3C5ZB 4M4PA 2OL3A 1DVFD 4NYLA 2NQCA 1NUFA 3K2MC 3Q6GH 3MTRA 2HFGH 4XNXH 3TT3L 2PXYC 4HWZA 1YQVH 1BFVH 4Z7WE 3L3JB 3P2TA 5HI3D 4LPUA 1UWGH 3MV7B 4YHZL 2OS7A 1ZHNB 3OHXB 5DJ0B 1D6VL 1XZ0B 1ZVSA 3CFKA 3IETB 4ALAL 1CD1A 1IGIL 4YGVA 1H5BC 1DLFH 4M48H 3VXRA 1FE8L 4M1DL 3VJ6B 5D93B 1UCTA 3WFEH 1T83A 2G5BA 4X7CC 2NTFB 3WMSA 5CJXC 4OZIB 4DW2L 3L5WB 1YN7A 1DL7L 1R3KA 4FMKA 3DGGA 4DN3L 2GK0A 3OJMB 5IBLC 3VXOB 3EJJX 3GSUA 3RTQB 3L3HB 4LAJH 3C5ZC 1S7SA 2BOBA 2IFGA 4GG8B 1YEGH 4HGWB 4ZFGH 3PL6B 4U1LA 3OKKB 4FQJH 4R26H 3U1SL 3RUGA 3VXSA 5FHBH 3V4UH 4ZUTA 4YH6A 1DBBH 1RUAL 3CK0L 3NFSL 4LLWA 5DD0H 4WFGE 4WI6A 4WWID 4U1KB 2DD8L 2C3GA 4LPXA 2BRQA 4MXVF 4ODVH 1FYTA 5JDSA 2R0KH 4D2NA 4M93B 3EUUA 1FCCA 4ZTPL 4UT9H 3VCLA 3LY6A 4HIIB 2J3SA 4HQQH 3MODH 1ZGLM 3OJ2C 2YOCA 4F2MA 2VSCA 2VLRA 1X5YA 4KJQC 3GMOB 3RAJH 4EI5B 4H8WL 4JZNA 2VITA 1YY8A 1S7VA 2A9NL 5TPWH 3IDNA 3SOBL 4OZGA 1VACA 1XGPB 1ZLUK 1TZIB 3BQUA 5EO1B 2FBJH 1GIGL 2EXWC 1JNJA 3IXTB 5DC0A 1OAXL 3NCMA 3GMMA 5IMKB 3MLSL 5E2WH 3UO1L 5TE6L 5D2LA 2I9LA 2Y06L 5D5MA 3QRGH 4BFIB 4X5XB 3BXNB 1JHLL 1BHGA 4EKXA 1KFAL 3WFDH 3HNVL 5GRVL 1XCTA 2BVEA 1X9QA 2J8HA 3WDHA 3RZCA 2P42B 1FL5A 1Z9OA 2H9GB 5IW6B 5EZLA 1MHCA 5D6DA 4P0DA 3ULVL 5JHLH 2XTJC 4JRXA 3FO0H 1CIDA 3RVVD 4ZO9A 1FORH 2XRAL 4Y2DC 1IAKB 4EN3C 3FZUD 1XGYH 5HI4C 2UY6A 4IJ3C 4H26B 4V1DA 2HRLA 5DJ6B 1YNLL 5L0QB 1YJDH 4QRPB 1E4XH 3MNVB 5K9OA 2ESVE 2I60H 4MJ6B 4HS6A 5T3ZH 3R1GL 3VI4F 1WK0A 1JF6A 4AQOA 2YC1A 3ULVE 1N6VA 4QRRD 1CL7L 4OCSL 3LN4B 4MD4A 1CDJA 2DIAA 3QUML 3QISA 4PJ9C 2OZ4H 3ARZA 1KIPB 4Q6YA 1LEGA 4WTZG 2D7TL 1S7RB 3MJ9H 5IJKC 2OBGA 5EA0H 4FQ2L 1J8HD 3VXUE 1Q0XL 1YYML 3ARDB 3S7GA 4NQCB 2JELH 3O11B 5KVFH 5GGVL 1CXIA 2EE2A 1C08A 2IALA 1DQDH 3D3VA 1Q0YH 2VABB 5E08L 3B9KB 5DVKA 1LGVA 4RA3A 2VR5A 1VKXA 2HAZA 2JK5B 5BV7L 1CGUA 3H9SA 5MENB 3MFGB 3VDAA 5IM7B 2EEAA 1V5JA 1QR1A 4GW4B 2ICWI 4Z7WA 2J4WH 2ZNXA 2Q20A 4JFFB 5FYLL 3SDXE 1A1OA 1NDMA 4QHNB 5KSUA 2O93L 1I85C 4IIQB 4P2OC 4Y7MA 3T65A 3IYLW 1AGDB 1DDHA 2YD4A 1DSFH 4JJ5B 5E6YA 1WBZA 1WT5A 5DLMH 4IOSD 3WXVL 4L8CB 5JW4Q 4P57A 3OTTA 3MLYL 1LK3L 4YDIL 3S36H 5ETUA 4GS7C 4XI5D 5JIHA 3U83A 2NYYC 1ZT1A 1NFDE 3G5ZA 1S7UB 1FGVH 2CSPA 2JB6A 1I1AB 3OAZK 3BSZL 1CFSB 4KHXH 5FECB 3GK8L 1NGWB 5I76A 4MVBD 2HT3D 1RJCA 3DROB 1JGEA 4QF1A 5CZXD 5H2BA 4JPVL 1AQKH 3HI1B 3O45A 4K55A 5CEXA 1I85A 1XH3B 3R4DA 2DQEL 2F19H 5HVGB 3REWB 3G5XB 1YEKL 2PTTB 3DVNA 3HZVB 4FQXD 2GJ6A 3OF6A 2R1YA 3NCBB 3DX6A 3VXTB 3BDYH 1AHWB 3VXRE 2VJXA 4JAMA 3N85H 3TT1L 5HGDB 3FT2B 2NY6D 2ATKA 2C26A 2X6MA 3EOYG 2R15A 4KMLB 1TJIL 3TGXA 3TN0A 4MZ3A 2J88H 4JM2D 1MLCA 3WNLA 2H2SD 1KN2L 4G9DB 4JG0H 2EIDA 1IGTA 3AM8A 4Z5RB 1U93A 3MFFB 4XPBH 2AI0H 2BNQE 5DRXB 4GW1A 5GJSH 2QTEA 4PRDB 2HA1A 1MWAH 1QQDB 1NLDH 5F9OH 1MFDL 3X12B 5MERB 4HWEL 1NH6A 3P4MB 4MXQD 1KN4L 4OF0A 2IFFL 4JDZB 3BT2L 2NW2B 3FT3B 2BXZA 3LRHA 4DKFH 3WFCH 4PR5A 5C0JA 3MA9H 1T2JA 1CL7I 4ZYKA 3H0TA 3M45A 5AZEH 3CGTA 4JGJA 2BY3A 1YEFH 2OMBA 4QRPD 5DVOA 3V0AC 3FB6A 1RVFL 1YEJH 3BN9C 1EEQA 43CAB 5KS9A 2F5AL 1P4LB 1P1ZA 1G7LB 4XB8A 1CDBA 3WHE1 4ZMAT 2B20A 1BVKA 3I9GL 4M9OA 3MRQB 1ETZB 4O51B 4EI5D 3AY4C 4YBLB 3TPUA 2VDQH 3JTTB 4RZCA 5CP7B 1JPGB 4GBXD 4TVPH 4U1HA 3W5NA 2B39A 4JQVC 4XC3L 3ME0A 4D9QE 4PJCE 2Z91B 4N0FB 4D0DA 4BZ1H 4HWEH 3HKFA 4C56E 5DD1L 4QHKJ 1EHNA 4F7CB 1ZLSL 1DQQA 3QNZA 5K9QI 4PV9A 2DL9A 5DT1H 1XF2A 4GW5B 1RK1B 4Y4FD 5TDNA 1ZWIA 1P2CB 2NLJA 3B43A 3HI5H 4QNPF 4TQEL 3ZKXC 1HHIB 1CL7H 5GGTH 3QUMA 5C2BL 5JOPD 4X98A 4P9MH 4F7TA 1FP5A 4POYA 4CGTA 2N4IA 2XN9D 2Q8AL 3NIFF 3EHBC 4ZD3H 4GKZB 3L6FB 3RZWA 4IRSA 4P46B 4MMXC 3D85A 1MVUB 4LNVA 1FAKT 3K8LA 5C86A 2V2WA 4YHML 3F5WB 3MA7A 5EU7C 2FR4A 2X9WA 4KH2A 4U6VL 3VFTA 4J3OC 1FIGL 3ULUL 3VH8B 3KGRA 2MOVA 1HE7A 4E9LA 5E2TL 3Q1SL 1EMTL 4P4RA 3C8DA 2P8LA 4XZUB 3MLRL 3BKYL 2B4CL 3RY6C 1I7RB 4N0YL 4DUXA 1I1CA 1AO7B 3VGEA 5T3XH 3BKJL 3S34L 3MLUL 3MOAL 3C8KA 2HJLB 3BVNB 3IDYC 5TJWK 1YNTA 1TIUA 2H8PB 4HT1L 3IB4A 3QXAA 3CLEH 1MCFA 1KJ2L 1RZJL 3IDGB 4OKVB 3V79C 2WP3T 1KN2H 1KYOK 1FH5L 3DWTA 4IRSC 4M6NL 4GAYA 4ZSOA 3QRGL 3WL9A 1QFHA 1KENH 1MUJB 3K8KA 3MRGA 2DKMA 2V2XA 4I3SH 4KV5F 3O3AA 1E4WH 1B0RB 3MCKB 1HK6A 3TYGL 2VAAB 3PWJB 4OJFH 3BJLA 4V1DD 3SOBH 1A1NB 5FYLD 2K7QA 1L6ZA 1KF9B 3EJYC 4R90H 2ZOKA 3ALWA 4F33A 4HC1L 3DMMD 4XCNA 4XMKH 5MEND 2D4DA 3GEWB 4LLUA 1LO5B 1F8TH 1U6AL 1ZVHA 3MC0A 2ICWJ 5ISZA 4CDGC 5I74B 1KTLB 2P7TA 2JE8A 2K9UA 4KMTH 3ARGA 4IMKC 3QULB 1RUPH 2OJEA 5BVPL 3LOWA 4GRLA 4NN7C 3C5SB 4G7YH 3QUMH 3D0VB 1BEYH 1YMMA 4R4FL 5CGYC 1E4XI 3WXVH 2A0LC 4JN2B 4EZMA 4FABH 2ZCLL 5B38G 4Z77A 3SJVD 4BFBD 5JHDD 3JXAA 1X4YA 1RFDH 4JO4L 5EZJA 4EI5C 1XGQA 1BFTA 5DHXB 3BW9B 4ORZC 4X80L 1MAKA 2VDQL 4JKWA 3QFJB 1UZ6F 3EO0B 1UWXH 5I16B 4MB4A 5F8RC 4MJIE 4FXGB 3X11B 3NABH 4NDMA 2CRZA 4OCLC 2R2EB 4LCWE 3VE0A 3IU4L 1JPSL 3LIZL 2HH0H 3QUYD 3TJEH 1JV5A 3MACH 2BCKA 1FJ1A 1IGIH 5FGCB 4ESKA 1MRCL 5E8DL 3VWKD 4DEPC 4JHZA 1NL0L 5EA0L 1RJLB 4NO3A 3L7FA 3I6LD 3V7AG 1XF3A 3MGOA 3KG5A 4JVPA 2VLMD 4CVWA 2WQRA 4ZQKB 1EA9C 5GHWH 5CAYB 4KROD 1NCAH 2X4SB 3OKDA 5FIEA 4OGZA 5GS0L 1CT8B 3VGBA 1X5FA 5IT2L 1MRDH 1A9EB 1MH5A 4JKPL 3GO1L 3VRLE 2H41A 1IFHL 5F93C 3QIWB 2VXTH 4K2UL 3LN5A 4LCIL 1YN7B 1KLGA 1BZQK 3BEWB 4X6DE 3ZYJA 4NQDE 3CFBB 4RA0C 4I77L 5KZCB 3EYOB 4L4VE 4PJHF 4Z8FH 4JZJC 3QH3B 2NY6C 2F8XC 2EXWD 1KTRL 2JCCA 2JB5L 1S7TB 1HHJA 3ARXA 5DJCA 3ILQC 5IJVA 3ZKNC 4RIRB 4M7LL 2CGRL 1B90A 1SEQH 5DEGB 5C08B 3CU7A 5FUCC 5I15H 2BERA 1HXMB 3QUKA 1KUMA 2CR3A 3G08A 2H26A 3RP1A 1OTSC 2DMKA 4U1IA 1LP9F 4TUKL 3W5MA 3UZQA 3MRKB 4NQUA 4AQ1B 1LD9B 4OD1H 3VFGL 4YX2H 4YHLH 4JPVH 4AL8H 2AJUL 3I75A 2V5RA 3VCLB 4PREA 3BQUC 2Y07L 4Z95L 3K4ZA 4KKAC 5EH1A 5EO0A 3IFLL 4PV8B 4WIQA 3PQYA 3SCMA 1IEBB 5TGBA 3KYOA 1R0AH 4MS8D 5L2JB 4QY8A 2BOCA 3WYRA 4WFFD 5I1AB 3UYRH 1FPTH 1JYXA 5C8JB 5CD3A 2LFGA 2VLKE 1J86A 1U92B 3IXTA 4RCAA 3U7AA 4XP9L 3WSQL 1JIBA 3NAAH 1WBYA 4I5BB 1ZT7A 2J8UE 5D2LB 1Q9LA 4JCLA 5ENWA 4UT9L 3E1F1 3MLTA 3QDMA 5FO8A 1RIVH 3EZ8A 4KJPC 1CXFA 4PRIB 3PWUA 4Z7OE 4ODVL 4PJ8B 1X5AA 3E3QE 4LKXA 2VLRD 2L7JA 2EDQA 5L0QC 1A7QH 1TVBB 2DM7A 32C2B 4X6CA 4K07A 4P3WA 3HNTH 5FUZL 1JPST 1T3FB 3L95A 1I4FA 2YA1A 3HS0A 4FN0A 3L3OA 2NXZB 1OAUH 2BVPB 4U33A 2C1PA 3T09A 1G9ML 2R56H 3HI6H 3WS3A 2JIXB 3V9FA 4TOYH 1NBVL 2AQ2A 4HUUA 5I19L 4ZPVA 1HINL 4P2YA 4FP8H 3C60A 4LLMB 1CLYH 4R97B 2YMXH 2XWBA 5GRWA 1KB9J 1IGYB 1QSEB 5KJRH 2ICEA 2VDOH 2GSIA 5JQHC 3OPZL 4HLJA 4GOSA 3O6KH 5HI5C 5CINH 3C60D 1QNZH 3H7BB 1GXEA 3D0LA 5D7KE 5ESAA 3WSQH 2W38A 4Z78B 4WI2A 3K46A 2GT9B 3B9AA 1Z3GH 5JLZA 3QIUB 3DVGA 4XCFH 4ZNEE 4ZFOA 3QIBA 3RA7L 2ZUQB 1DZBA 2XKSA 4PJEB 4NUJA 4PJCA 5EULV 4EN3D 2HTKC 4KRNA 2EH7L 1VB9A 3H3PL 4LNRA 3U4EA 4HX1A 4P2OA 5HHOE 1QFPA 1P5VA 3JTSB 3WN5A 2E9BA 1JGVH 2DM2A 3QXDB 4XRCA 3CFEA 4WGVB 3MV9B 5IEHB 1MRFH 2YUXA 3BIBX 4KQ4H 3EYVA 3HFMH 5CZVL 4XWOC 1RI8A 4MGXA 4PRNB 3RVTD 5J56B 1MCWM 3LH2H 5CIPB 1JGLL 1UJ3A 4JM2F 2EC8A 3ROLA 4CVXA 5ILTL 4RX4A 1AHWC 4JN1H 4XP5H 1QOKA 5DSCB 1J1XL 3BPLB 4KUZL 2ZCKL 3O2WL 5GGRY 4AIZB 3T4AB 5EORL 5J6HB 5EOCL 3ULSA 1JN6A 4LQFH 4U7KA 3O6KL 1N5YH 4KKBD 3SDYL 1VFBA 3EO1A 3FN0H 4MDJB 4YIQA 2D31A 1FO0B 2K7PA 1NC2A 3U9UB 2UWEF 5IBUB 4N9GA 4NO5A 1VFAB 2MFNA 4U1SA 3WIIH 4OGAD 1HH6B 4URTB 3UTSD 4O5LL 2DD8H 4LSDA 4Y5YB 4W4NA 1JUFB 4OQTH 1VGKB 4RAVB 2XQYG 4LVHB 3HE7A 4PG9B 3IDXL 3B4NA 2ZOLA 2R9HD 1G9MH 4Y8AA 1CE1H 1MAMH 1C5CL 3FFCB 5EBLB 3OXRA 2YEZA 3V6FA 4HF5H 2EYTA 2ATKB 4LCCB 5ERWA 1BX2A 1JTOA 3QZWB 5F7FA 1F4HA 4WV1A 2Q3ZA 3QQ3A 5DVMA 1C16A 1YY9C 1LE9B 1QSFB 2CKBA 1OL0A 5AWNH 3HNSH 2GTZB 5EBWA 4YJZL 4Z5RA 4RBPK 1CXLA 4LPCA 5D1XC 4JQIH 5FOJA 3MV8B 3ESVF 4GW1B 2ZZUT 1ZTXL 1NCWH 4KKCD 1FVEB 3C09B 4M1CD 4BJLA 1Z9MA 43C9B 5L2KA 4GG6A 2GAZA 1RJYB 1TVDA 3ZDYE 4PD4J 2J6EL 5ID1B 1LO4L 2BY2A 5C0AB 3SJVA 4FZ8L 2VR9A 1UM4H 1XR9A 4FMFA 2FSEB 3OR6B 4NRZB 5D7IE 3G6JE 4GG6E 3WKML 1SJHA 4DZ8A 1K4CA 3RWHB 3RKPA 3VXMA 2OK0H 5ISZE 3IGAA 1NFDA 5I1EL 3AXLA 3PWPB 2WANA 4G6ML 5C0DA 4NZUH 2VLKD 3VG0L 4HC1A 3UTSE 4TN9A 2FJFA 4GRWH 4HDIA 3MZTA 5T3XE 2DJSA 1NMBH 1K9TA 1C12B 3SDCB 3ZT6A 3ZKMD 4OD3H 1D6EA 3DXAA 2P5ED 3EBAA 4GMSL 1OHQA 4ELME 5HSFA 4LQFL 4LLDB 1JTTA 2ORBL 2FRGP 5CKGA 4GXUM 2J12B 3LHPL 12E8L 1BREA 5JXAH 5CMAB 3V4PL 2VL5B 4BSWA 4NHUA 1JYNA 5C0BA 2X4QB 5KSBB 5BMFL 4OZHB 3MRIA 3LH2L 3IU3A 1OPGL 2MTPA 4OLXL 4ODHL 3M17B 2HVKA 2VDRH 1IVLA 3DBXA 1E4WL 4HUMB 2JB5H 3GIVA 1FN4A 1VEOA 3ELAT 1DJSA 4BH7A 1XCQB 1FPTL 3B9VA 5AG9A 4MX7A 2XT1B 4W81A 3IS1X 5D7JD 3WUWB 1H15B 1S78C 5CP3A 2YD7A 5KANG 3TWCL 1KJ2H 5HHQB 1KACB 4ZXBA 5FUOL 4PTTB 2NNAA 4Z7QE 4HS3B 4HKBB 3ZKQD 4GAGL 2LU7A 3TCLB 4ODWA 4EIGB 3VFNB 1OB1A 5E8NA 1MEXH 4IRJB 4J1UA 4E0RA 3IF1A 3MUGB 1I9IL 4G8EB 1U3HD 3NIFE 1LDSA 4MHHI 1OP5H 4QXUL 2W9DH 2VLJE 5BW7A 2XN9B 4YWGL 3MOBL 5D70H 4CMHB 6FABH 4FTVE 4LARL 2EECA 4PJ5A 2HT4D 3H9HA 2ITDA 4RX4D 4HH9A 2VQTA 2OTWB 4L8SA 3KPRA 5D1QB 3IVKA 3ARTA 4TNVK 2FL5A 4RGMC 2LAAA 3WNNA 1D7FA 1UVQB 1CFVH 3UTPE 2DWDB 5DF0A 2AJ3A 1L0QA 2OTUA 4HAFA 4DK3A 3D69B 4DKDC 4YHNB 4AIOA 4NKDB 5TF0A 3RWGA 3TEUA 1AO7D 4LSPH 4PUBH 4X9FA 4PJ5E 1AD9B 4LP4A 1WVZA 4X80H 3P9MA 4M61A 3CH1A 1AXSA 3G9AB 4DVRL 2E5EA 4X6BA 3T2OA 4WFGD 1B2WH 2FIKB 1F3JB 4WFHE 1S9XB 3X13B 1SYSA 5E8OA 5E9DA 5CJXA 3T1FB 3IXAB 2F54E 3TBYB 4ISVA 3PL6C 4DAGL 3MRCA 5FK9B 5DI8B 3RL2B 3BPCB 3ILQD 1RK0B 1CE6A 1F4YH 2BNRA 3J8F7 1T5XA 1AR1C 4JB9L 3UX9B 1YEIL 1UH2A 4LIQH 3B5TA 5D2NA 4HUVB 4Y4KC 5IW1A 2HH0L 1EVTC 1IM9A 1WWCA 1F2QA 2WINA 4MA1B 5FGBC 1AE6L 3ARVA 2IWGA 3EOBB 5C0FA 1QLEL 5MI0B 4E5XA 1EBAA 2C7UB 3RGHA 3L7EA 2UVFA 4PP1D 2NTFA 1ZHKB 2Z8WC 4X7FC 5FB8A 4WENB 2J8UA 5GRJL 4CU8A 3AREB 3GBML 4RGND 4XB7A 5AEAA 4P48A 3TH3T 2QBWA 3BP7A 3BRGC 4WUUA 4YX2L 3P30L 4KWUA 4NWUL 1T0MB 3SBWC 5E00A 5HPMB 1YC7A 3VFPB 5IVNA 2RCSH 4XCEB 3AB0B 4NJAL 4LLWB 2ATPA 4Z7VE 4IEFB 4ZUWB 4LOUD 4UV4L 4ZXBC 4WHTA 1A6TB 1EAJA 2GIYA 4HIXL 4JGMA 3GRWH 1MCIA 2G2RB 1F58H 3GSOA 1V3KA 2A83A 1FZKA 3KPLA 4U1GB 4FQXA 5F3HB 4NP4L 4XAWL 4HIIA 4LBEA 1PAMA 4JFDB 2AXGB 3KPMA 4PGBB 4JPIA 2FWOA 1KT2B 3C5JB 3WE6B 1MCPH 2CRIA 2R69H 4W68A 3ORJA 5FYJU 1X4ZA 2V7NA 1CZ8H 2YK1H 4JHWL 1UT9A 2EXYD 4DKEH 1NKOA 3GIZH 5C2BH 4L8SC 1R5WA 5EU6D 5GRXG 3QDME 3MLXL 3QAZB 1MREL 4LLYB 2X89A 5E5MB 2FB4L 5F88B 1S5IL 3S35X 3AU1A 2ZG2A 4NO0D 3MZGB 4YAQA 3QHTC 3U36B 2DQCH 4QRSA 5F1IA 3P0VH 3T2PA 4R3SA 3RZCB 2DL2A 2GSGB 1FRGH 3PGDA 1EAPA 2A73A 3MROA 2EDHA 1BJ1J 4CU7A 3KS0H 4FQPA 3MLRH 4U1IB 1U8OB 5ICYB 2A1WL 2AQ3A 4UIKH 4GRWB 1FV1B 3MLZL 1J87A 4L5FL 3U0WH 4I0CC 5F7NC 5BJTB 5CJ5A 1TDQA 1NGYB 3X3GL 5L88H 1FZMA 3P9WB 5IP4A 4J8RB 4NM8L 3EYSL 3QHZL 1CI5A 3MV7A 4QXWA 2V9TA 1HXYB 1GGTA 3DRTA 5J06A 4MAYC 1SM3H 4L4JA 3NN8A 1AGBA 3T4YA 2L7UA 3KLAA 4M02A 1UKSA 1HQ4A 1T6WA 4P4KA 4J6RL 4MHHG 1DFBL 4QGYA 4OUUB 2EYRA 2R8SL 2AV7A 1H8OA 3GSNA 5L8JB 2N7BA 4HULB 4U6HA 2O61B 1JWUB 3WIHA 4XNQA 5IFJA 1XGRA 3UBXG 4UV7H 2YA2A 3QG6B 1U92A 4JZOA 5KG9A 2ARJB 5AD0A 3U2SB 2ZKHH 1NLDL 2DQHL 2RHEA 2ZPKH 1J10A 3JSSA 4G6FB 4RMQA 4ZS7L 5F3BB 1SYVB 1NMAH 4WJ5A 4X6DA 1UH3A 2AI0L 1OAQH 3ZDZE 1GGCL 3W9DB 3R0NA 1DLHB 1FG2B 2Z92B 3S98A 4QHMB 3NIGE 4XWGL 5F1SA 1QA9B 1I7UA 1U95B 4NUGH 3VD7A 4WTXA 1H8SA 1YJDL 4G8GA 4MSWA 3RIFK 5I75B 5JOFB 5C6PB 3PGCA 3IKCA 4LPTA 1FBIL 1XF4A 3H9SB 4M03A 5IG7A 4ZOEA 3BDYL 5DYOB 4D9LL 4IRSD 2P5WB 5F1NA 4XVJL 2P8MA 4Y2DD 4OCXL 3F6IA 3O3BB 4PJ9B 2PF6A 4NIKB 1VEPA 1L7IL 4HUUB 5T1LB 4U4BA 3KPSE 3BD5A 3BOVA 4CW1A 2V6HA 5CLWA 2KPNA 4UTBL 1R3JB 3BT2H 4M6OH 1PG7X 4KKCC 4QRQB 5FO7A 3RGVA 4H0HB 1J0HA 4PRBA 1V3LA 4IDLA 5EUOF 3LD8C 3HUJA 3VFRA 3DMMA 1MWAL 2VUYA 3BQUD 5BRZA 4M1CC 4YK4C 5TFSL 1CFSA 4XNZC 5I76B 3F7YB 3SDCD 1RUKH 3RHWK 3HI1A 3O45B 4CVUA 1X5GA 1S5HA 2VSDA 1LEIB 4XPAH 1Z9SA 4C55A 1RAMA 1F6AA 4BKLB 1FNAA 3RRQA 1G6VK 3RWEA 5IROA 3FB7A 5DC4B 4AH2B 4D0CA 2UV3A 1AC0A 1KB9K 4GMTH 4JAMB 2G9HB 1B0GB 4L29B 3PHSA 1KJMA 5I8CB 4PJIE 3KHQA 5E1AA 1T21B 5A16A 4PJAB 3X3FL 5IEHA 2N56A 2YPLE 3FO1B 3VXPA 5IIEB 1AQKL 3GM8A 3S9DB 5F7MC 5J1SC 4WW2A 4QTHB 1EO8H 4HS6B 5J13B 3QNXB 3KLDA 3CH8A 4G6JL 2R8SH 5F7DB 1JP5A 4CMMB 1JYVA 3T8XA 4L4VB 2FDBP 1IGJA 1KG0B 5BS0A 2YD1A 3VWJC 2FO4B 3BZFB 1DQTA 1FL3B 4GRWE 4KAQH 2VIRB 1S7XA 2NY4C 1ORSB 1J1OH 4HUWA 2Y25A 2ESVD 5L88L 4JPWH 3BP5B 4LEXL 2ADIA 1JBJA 1JUFA 3MRPA 3ARDA 2A6JB 2AXFA 3MLZH 5E6IA 4U7SA 6FABL 5F71A 3BEVA 1E28B 2AGJH 3DUSB 4OZ4A 4KJYB 2LE9A 2W60B 4P2RE 2PYED 4QYOB 4EI6B 3B9KA 5JIIA 2CLVA 2E27H 4CVZA 4EUPB 3JV6B 3JUYA 3TA3B 1P6FA 1X5LA 2ZUYA 3G9VA 5C09A 3TH4T 1E27B 1OTUD 4KKLD 2GUOB 4HJ0D 5EU5B 4GS7B 1WWAX 8FABB 2H3NA 4G6JH 1S5IH 1A14H 1NANI 1F5WA 4MJ5B 4MNGA 1V05A 1MPAL 1NDGB 1YPZA 2AJZB 4FQ1H 4KY1L 1MLBB 4NT6B 4KI5D 1H3GA 5GXBB 3RVWC 3ZTJH 4RGMB 5D7IB 5E95B 1FFPA 4HJJL 1QLFA 1EK3A 3GIZL 4I2XE 5HI5D 4Z7WF 1R5VB 3EHBD 4YC2C 3WIHL 5CKAA 3QWRA 3QUZC 3T04D 5I8KL 4X7SL 1GC1H 4QWWC 3VXNB 1F00I 2V5TA 2FJHA 3V6ZB 3ES6B 2EICA 3GJFA 5H94A 1G7PA 2SEBA 3MGTB 3SY0B 1M71B 3AVEA 2GITA 3KJ6L 4U6XA 4UT6H 4IRSB 4P46A 4XH2B 1CLZH 2F19L 2F53D 3GRWL 4M5ZL 1OOAA 4MA7H 4OLYH 2P47B 3BH9A 2A6IB 4HIXH 3MSPA 4JFFD 1AH1A 5BZWA 4MD5A 4NZRL 5EO9B 5CJOH 5JZ7D 3STLB 3PDOA 1A4JB 5C0ND 2HT2D 1MI5E 5J1AA 5ALBL 2PETA 4NWUH 5HHMD 1PG7H 1SVCP 1MHHB 1BLNA 1HQRB 3CVHB 3LRGA 4K8RH 3PP4H 1WLHA 2ZUWA 4ONHB 4QOKE 2IPTL 5E03A 3T2NL 3EDFA 4P49A 2QQNH 3NH7L 2A6DA 3NIGF 3BYTA 5KTEL 1DUZA 3EFFB 2IH1B 3LPWA 2JTDA 2FHBA 4KFZC 4YR6A 5I1DA 3ULUF 3FZUC 5HI4D 4JJHA 3OWEA 3DURB 1TJGH 1F45A 4LLVB 5IMLA 5GJTL 3S4SA 3DARA 4JDTH 4MCYB 1HYSC 4Y16A 3DO7B 1QFWL 4FOMA 3A67L 1CGSH 3DX8A 4Y4KB 3ILPA 3O81A 3RWCA 1HH9B 3MUY1 2CLZA 4NOBA 3FT3A 4JHAH 2DLIA 5J6GB 1DBJL 1N6QL 3DECA 5E7FA 3FQUA 2NX5A 3MUJA 3SDDB 4KZEH 4FHBD 4P5TB 5D7SL 2HT2C 3VXME 1RMFH 3VXSD 4XCNB 2EIZA 4YQXH 3IF1B 3RUGF 1J8HE 4JFZL 1AXTH 4X5WA 4J3UA 2EYSB 15C8L 1U8QB 5B39G 5GRUL 3Q5TA 4PJ9D 2Y5TB 1UQSB 3D2UA 3B9EA 2ICES 1MHEA 5L6YL 3IDXH 5DS8B 1P4LA 3MREB 4Z76A 3CJJA 2VDKH 3H9HB 3OAUH 5A1AA 4KTDL 3RVUC 4YFDB 4DEPB 3D1MC 4G5ZH 4H20L 2OXHA 5LJYH 4UV7L 3FOMA 4LVOB 3QDAA 5I8OH 4L4VD 4P23A 4E41B 4Z7VA 4XVUC 3WHE0 1M7XA 4FQJL 5GGUA 5IBLD 3QXUA 1B4RA 1YUHA 5BRZE 4ENED 1EEZA 4KI5F 3HPLA 3GBNH 35C8H 5LQBH 4LSPL 2OI9B 1VADB 4NKOA 4PGEA 2BVTA 4HJ0C 3EO9L 4GQ9H 1NFKA 4JO1L 4N5UA 1RZ7L 5DRNA 3ARYA 2MHAB 5I1LB 1XF2B 1P69B 2IG2L 4TPRL 1KPVA 4MNQA 3FQNB 4ZDHB 2J2ZA 1HHGA 1T1XB 5AYUH 4Q97A 4J7RA 4HWZB 4OD2A 2W0LA 3MOBH 3TA3D 1FG9C 1Y6MR 3CC5B 5D70L 1YEDA 2X1QA 1KIQA 5DZOA 4GKZA 5LKNA 2OSLB 4XI5C 4APQD 3WS6A 2Q7NA 5D7LA 3UTTE 2ZUQC 3O4LA 1LP9E 1MVUA 4J3WA 1BFVL 4JGUA 1DVFC 1F4WL 5BQ7A 1IEHA 4IJ3B 5JPMA 2WK2A 1SJEA 4AYFA 4NN5C 2I27N 4S1DD 5JXED 3VFTB 4DGIL 4I3RH 4O5LH 5TE6H 3ARUA 3UTPD 4F37F 4ZQKA 2FGZA 2B0SH 2ZSWB 4XZUA 3QJHB 4YHKL 5HGAB 2G75A 1ZHLB 4KQ3L 3OJDB 4PJIF 5IV2A 4L8BB 4BFEA 3OBAA 4BZYA 1ZHKA 3C08L 4P2RD 5AZ2L 4Y5VA 2DJ4A 2X4UB 2YPVH 4NRXA 1I7ZA 3MUZ1 5C6WH 5DR5L 3HG1E 1B9ZA 2KZ1B 3AREA 4MJID 3U4AA 1QHOA 3GSQA 2X4PA 5IKCA 4XPGH 3G5VA 2XWJB 3T77A 4R4NC 4I1NB 4ZO7A 3PWLA 4IRJC 1ZXQA 3B5GA 4M7ZB 5C2UB 5MI0C 1Q9OB 1FZOB 5IVZB 1AFVL 3L3KB 3NVQA 2FX9L 1ROWA 2B8OT 1XGUA 3KPRD 1FGNH 4PB0L 2H6PB 1YYLL 3MRHA 5B39A 1PQZB 3UROR 5BVJA 1YECL 1T7YA 1Q94B 2G2RA 1HYSD 1BWWA 2NZ9D 4G6MH 1IQWL 3L3GB 4NQTA 5I0ZA 4JG1L 2EE3A 5IB4A 1AXIB 3DSFH 3O8XC 3V52L 1I1YA 1W0WA 1Z9LA 4DN3H 3OB0K 3BQUB 5DGRA 5EO1A 5FYKE 4L4TD 3GUTB 5SWSB 5IOPB 3VMOA 1QSFE 3GMMB 4WWKC 1LO4H 3GB7B 3WFEL 3MYJB 2XWTA 2DQUL 5A40E 3CVIH 1IKFH 3B2VH 4RQQA 1DE4B 1M05A 2DQFA 5KJRL 5C0NC 4OAWB 1LO0L 3SDAB 2W0FB 5I73C 4PGCA 4HKJA 5FKAB 4ZUVB 5LWYH 4NM4L 5C0AE 4X6CE 2PO6C 5MP6H 1HINH 3MLTB 4OIIH 3HC3H 2YPKA 2EEDA 4Q9BA 3JV5A 2XA8L 3SE8L 6CGTA 2ADJB 2PTUA 1K85A 2I9TB 5KANI 4UTAL 1BFOA 4HS8L 3TPKA 3O8XA 5SWZD 4S1QH 2JF1A 1BGXL 1OSPH 3SKNB 4ZNCD 2FX9H 4TUOA 1NMCB 3D18B 4NCC2 2DLTA 3VFGH 4ZUUA 5F7KC 2D03L 1FZMB 3FTGA 2I07B 1DBML 4LK4A 1ZANH 5TH2B 4PJFF 3TFKC 4EDWH 5E6ZA 3U46B 1MJJB 3QUZD 1HI6A 3EYQC 4RMUA 5I75C 4BUGA 5ACLA 3O6FC 4ZTOL 2XWBB 3MRRB 3NAAL 1LEKB 2XZAH 1N0LA 3O2WH 2ZCKH 3LN4A 2DKSA 4MD4B 1BFSA 4V2CB 4R6UA 2YN5A 1RZIA 3BGMA 3CMGA 5DTFA 4XP5L 5HDOA 4X7EC 5CIPH 5B21A 4FG6D 1IQDA 2EKSB 4PY7B 3MBED 4LCIH 4KRLB 4OUOA 1OCWL 5GGRB 5BV7C 1YPZF 5I17A 5EZOH 5FA4B 1YMMD 4X5XA 5F9AC 3T0BA 2Z8VC 5J89A 1TXKA 2O5XH 5J11C 1U8LB 3MJ7A 4HIHB 3REVB 3BKML 3R8BB 1IAIM 3I6GB 4LHUD 1Q1JH 3PV6B 4HWNA 2F74A 2IAMB 1KC5L 5CS7A 2VLJB 2DLFL 2CMRL 3TESA 2CK2A 2EO1A 3LV3A 1A6ZB 2FECI 3QI9A 5T5NF 1CDHA 1D5ZB 1UM5L 3IU4H 1Z3GL 5EOQH 5MEPA 2C1OB 4KJQD 1T7WA 3HC4H 1BBJB 5CGTA 2CKNA 3T3MF 2VDRL 3S5LB 3MNZB 2R0LH 5EOCJ 1ULVA 1GAFL 4YEEA 1BWMA 5CUSH 1RHHA 2Q8BH 2N7AA 4UDTB 2IBBA 2AJSH 4HKXB 5FHAL 3SGEH 5FM5O 2XZCH 1NLBL 4TSCH 4NQEE 4FNLH 5B3NA 3W0WB 3V4PH 1BD2D 3QWOA 4PJCF 3KPPB 1ND0B 5DQJA 2D7OA 4D3CL 3HUJB 4KDTC 3VFRB 4NQXA 1P4IL 1KNOB 3HE6A 5DJYA 1GGYA 5I66A 2BY1A 3MRDB 5EWIL 3VRLF 3EYUL 3DRQA 3OAUL 3D25B 2NXZD 3DVNB 4AEHL 2W9EH 4MWFB 4U1SB 3G6AA 2AJXL 1BGXH 2PR4L 3PNWB 1YECH 4JO3L 2BSRA 1YYLH 2GTWA 3ROOA 2XPGA 1VGKA 3HG1D 5EU6E 4Y4HB 3IFPA 3QUXA 4QTIL 1RIHH 1Z2KA 4K9EH 2AEPH 1KTKE 1MCNA 2J5LB 3RNKB 1CVSC 1YEHL 5D1XD 4Q58C 2W65B 3AROA 3NIDE 3UTQA 5IEKB 1UJTA 2BVOB 3KPSD 4GKSA