1JGLL

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig kappa-chain
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL01
1E4KA 1FJ1A 4N0UE 3QEUB 1U8LB 2BK8A 1MFBH 1VKXA 4LK4A 4GW1B 3B9KC 5FOJA 1U8IA 4JKPL 1GC1H 5CJ8A 1BZ9A 4GS7B 4UDUB 1DJSA 4KKBD 3T8XB 2DQDH 1FYTA 2Z31C 2YUZA 1GZQA 5F88A 5C0EB 1BF8A 3UYRH 1T0MA 4AQOA 1A6ZA 3U36B 5E8EA 3LEXB 1IMHC 1XH3A 2VN7A 3BIKB 5MP6H 4IHOA 3EYSL 2Y1VA 4QRPE 4CMMA 3MUHL 3DX9A 2DWEA 4KVNH 2D7TL 4AIZA 3OXSB 4C56E 4PV8B 2LVEA 3CMOL 2R1XA 5FF6A 1QLFA 2DLEA 3RWFB 1MAJA 3X13B 1A3RL 3FFCB 4XPHL 3TBYA 1NGZA 4MSWA 3DRQB 4PTTA 5C0CA 1F8TH 4K2UL 5CUSH 3NMEA 2CLZA 3I02B 3L5JA 5DT1L 3RKDC 1IAOA 5D1ZA 4PJHF 4OZFA 2W0KA 1SEQH 1T83A 4X7CC 1ZS8B 5DRZA 4OZ4B 1E28A 1L0YA 1EA9C 2CK2A 1YEJH 3JV4B 1QHPA 2ZJSL 2ZUQC 3GSOB 2A73A 4MD4B 3LH2L 3PHOA 4X6EA 5ESAB 1HQRB 1J7VR 1P53A 5I18L 3EOAB 5KSAA 1WWCA 2VDNH 2BVOA 4AMKL 5M94B 1RZFH 2VLJE 2XI9A 4JRXE 2VQUA 2H41A 1I75A 1MCQA 1Q9OA 2DM3A 3QSKB 1JZ4A 4P3DA 4JHAL 1U3YA 4S1DC 5E9DA 1MHPH 1NBYA 5KVFH 1CICB 1S9XB 2QADD 2GT9A 2JJSC 1F11A 2BNQB 1EEZA 2OS7A 2JIXD 4OI7A 1NFIA 4X6FB 4Z78B 3ZTNL 4NQVB 1R24B 4LSQL 3HRPA 1OSZB 5HVWA 4N68A 1U6AL 4FQLH 1N6VA 2B5IC 1P5UA 2BXZA 3DLQR 4I77L 5J9PA 2DI8A 4YLQT 3GBNL 4G6MH 4HFWA 1N0XL 4HUWA 4WVRA 1S5HA 1XF3B 2ADIB 4RNRB 1PKQB 3U7YL 1I9RH 4N1EA 1L4IA 3HFML 1HHIA 1D9KD 3HS0A 4AM0A 1X44A 4YQXH 4MWFA 5H94A 3K1DA 4NUGH 1AO7D 1H15B 3V52L 3S4SG 3R06B 4UIKH 4ODWB 2ICCA 5CCKH 3MJ8A 2LU4A 1CDHA 2BXYA 3VE0A 5BV7C 4XC1H 3WMSA 5B21A 5I73C 5JOEA 3BP7B 3C5ZB 4P5KA 2AV1B 4OZGB 4B41A 5GGUB 2QQNH 4R7DA 3O11B 1IC1A 4HQQH 4PRBA 4NKDA 4OTXH 3HNSL 4QNPF 2GSGA 2ESVA 4XHQA 3MFFB 2AEPH 1OCWL 4HAGA 1DEEB 3TH2T 4YHIB 3H9SA 3SDCA 3VXUE 3MCKA 3BX7C 1BOGA 3MBEB 4XVJH 5DJDA 5BVPL 1FJ1B 4GBXD 1UYWL 5I8OH 3PQYA 5C0BE 1VKXB 4LASL 1U8IB 4P2RA 4U6YA 2H6PA 1GHFH 1BZ9B 3HRZA 3FN0H 5CJOL 3N85L 2J8UF 3ULVC 1FYTB 3ZMRA 4KV5F 4LRIA 2R2EA 4KJQC 1GZQB 5F88B 4MD0A 1FH5H 4MMXC 4PJ9A 2P5ED 2M1KA 1T0MB 2RJMA 1A6ZB 1CIUA 5E8EB 1IBGH 4XXCC 4YEFA 3F12A 5SV3A 1XH3B 1P84K 1LO0L 4H1LG 4IHOB 1CL7H 1TPXC 2VSCA 4CMMB 2XKNA 3DX9B 4MAUL 4XP1H 1YN7A 2DWEB 1D9KC 4LCWA 4U1MA 4AIZB 4JDTL 4XPBL 2XT1B 4OF3A 2CRZA 5C2BH 2R1XB 1BPVA 1UT9A 5FF6B 4HJJL 4J4PD 1QLFB 5GGSY 1OM3L 1ZAGA 5IHUL 3TBYB 1NGZB 4MSWB 4PTTB 5C0CB 4G6JL 4JQXC 3DO7A 5GJSL 4KZEL 1HDMA 1CFVL 3MJ6A 4NQED 1J1OL 3D39D 2CLZB 4P59H 4I5BA 1CD9B 3H8NA 5D1ZB 3SDXF 4OZFB 3VRIA 2XWJA 4JFZL 2FX7L 2HAZA 3UJJH 4OV6F 1NUGA 5DRZB 4EI5A 2JELL 4ORGA 1E28B 5DK2A 1G7HA 1HYRC 1KIPA 4NWTL 1KOAA 1HXYA 4R9HA 3VXOA 2A73B 3PHOB 3CZJA 3P11L 5J06A 4X6EB 3T09A 4P3WA 4GBXC 4F8QA 4S1QL 5KSAB 4Z8FH 3FT3A 3QUZD 2BVOB 4MCZA 3IDJA 3OKMA 5F7YC 1KENH 3G04A 2L7JA 5CINH 1I8IA 1Q9OB 4HUKB 5E2TH 2FX9H 3MNZA 2YD4A 4OLWH 4P3DB 5E9DB 1NBYB 3CMGA 3KPTA 5E99H 4N5UA 3O41A 1YYLH 2GT9B 1Q0YH 1CT8A 1IEAA 1F11B 3SKNA 1EEZB 4I18C 4JR9L 1NFIB 4RGNC 1Y6NR 3RWJA 1V7NH 4JPWH 4X4YA 1SM3H 4WW1A 4J4PC 4MJ4A 4OZIF 4NKQB 3FMGL 3NABH 2A1WH 5D7LD 5GJTL 1LDPH 3BQUC 4LLDB 5J9PB 4PFEA 3TWCH 4OFDA 4HFWB 1LE9A 4LQ1A 1KCKA 4YJZL 3NCFB 3ZE0E 4HUWB 1F4XL 1S5HB 2E7LA 4OZHE 3TA3D 3VWKC 4IRZL 5HGHA 4HWZA 1HHIB 4MJ2A 3HS0B 4AM0B 3GMPA 3OPZL 4G9FA 1JZ5A 4MWFB 5H94B 4HS8L 2Z35B 3NCJH 5DUPH 4NZRH 1BOYA 2W65A 3MJ8B 4JE4B 5ADPL 3VE0B 3DX6A 3P4NA 1IGCL 4C56D 1AI1L 4WO4D 4POUB 3L5HA 2IQ9L 4FG6C 2K3TA 4BZYA 5DHXB 3Q6GH 1EBPA 4OLYL 5LQBH 2GAZA 3HNVH 4P5KB 4PJEF 3GSQA 3F62A 4R7DB 4J3TA 4P2QA 4PRBB 4ZUWA 4NKDB 4ETYA 2GSGB 4XPTH 2ESVB 4KVCL 1QQDA 3GJFB 1KJVA 3PGDA 4XBGA 1MELA 3H9SB 2DIJA 3SDCB 3MCKB 1BOGB 3MLSL 5DJDB 5EBWA 3MLZH 1OAUL 4OF6A 3AY4A 2X1XR 5EZLA 3PQYB 5EOQH 3ZYIA 3HG1D 1E0OB 4U6YB 2H6PB 3PWVA 3HRZB 5DMIL 4F2MA 3I3BA 5EUOE 4AIXA 4HUVA 2R2EB 1MQKH 3MRRA 4MD0B 4PJ9B 5EORL 4NHUA 5F21B 3F12B 2Y6SD 1BZ7A 4JO2L 4Q0XL 3TA3C 1MEXL 1V3JA 3ARVA 4IOFD 2AAVA 3SO3C 4LVHB 3EJYD 2XKNB 1DEDA 4RCAA 5JHLH 1YN7B 1B88A 4LCWB 4QRRD 4U1MB 3EUUA 4JRXD 1RU9H 1NUFA 4NO0D 4GXVL 3QWOA 5I75C 1D6VH 3DO7B 1HDMB 4XVTH 2OM5A 3H9ZA 5JW4N 4G6FD 4I5BB 5E2WH 3DVNA 3L3JA 5TQ0H 2AJVH 5HJ3A 3VRIB 2XWJB 4WO4C 3SBWA 4WEBH 3UBXA 1NBZA 2Y25A 4EI5B 1CFTA 3MJGX 2WWKO 4ORGB 5C6TH 5DK2B 4MNHA 1G7HB 4G42A 1T04A 3P9LA 1KIPB 1OTSC 4F9PC 2VWEE 3LDBC 3WFBL 1HXYB 3VXOB 5DHYA 1PGRB 2YD8A 3SY0A 4R4BA 4C55A 3QZWA 2XACC 3RGVA 2VR9A 1LP9F 2NY3B 2DLHA 3GMLA 5I76A 3I50H 3VXMD 4XH2A 3FT3B 4LDOB 3IFPA 1JCKA 4QOKE 5KG9A 1CLOH 3G5YA 3IDJB 4MCZB 4MJID 1KN2L 4M1DH 3VRLE 3VXPA 3VXSE 3OKMB 2GQHA 2GY7B 3WUWG 3G04B 5DSCA 1L6ZA 1I8IB 3M45A 2VUYA 3FL7A 3MNZB 3IU4L 3N1MC 3VFVA 3V5KA 4JFHE 3JVGC 43CAA 5FYLH 1ZHLA 2Y6SC 3O41B 3WFDH 4R8WH 1CT8B 1IEAB 3T1WA 3SKNB 4MB4A 1MJJA 1CK0H 4NRYA 3ET9F 5BZDA 3RWJB 2QBWA 1QFUH 4X4YB 2AJSH 5SX5K 1OF2A 3RVXC 4WW1B 5DMYA 1RZJH 2MJWA 3V79C 1CGTA 4WI8A 5I17A 1KCRL 2IPUK 3X11A 5ITBH 3S98A 1JNJA 4O2CA 4MS8D 2X70A 1S7XA 1LE9B 4XHJD 3VXUD 3RDTD 1DLFL 4KTYA 3BRFA 3B5HA 5C0BD 1P4BH 1GPOH 5C92A 5HGHB 4HWZB 5HBBA 4YGAB 3D9AH 3GMPB 4G9FB 4HFUH 3GDBA 3OR6A 4BUGA 2Y5TA 1JGLL 4Y4KA 3PV6A 1RIVL 4PJIE 4NO2A 1TZGL 2W65B 4OGYH 2VXTH 2YD2A 4JZJA 3HR6A 3DX6B 3Q48A 3P4NB 1F45A 4OIAA 3IFNH 4JREB 1Z9SA 3LKRA 2GAZB 1U9KA 1RUKH 3GSQB 4AQ1B 3QHZH 4HT1L 4P2QB 5CJ5A 4ZUWB 3BZ4A 2CDEA 1JN6A 4AENA 1QQDB 1ERNA 3A6OA 5D7SL 3PGDB 4XBGB 2AGJH 4X6CA 5EBWB 2ZPKH 1HKFA 5EZLB 2BY0A 4MCYA 3MV7E 1KXTB 3PWVB 4EN3D 3BN9C 3TT1H 1JHLH 4F2MB 2HJLA 4MS8C 4HUVB 3ZT5A 4YK4C 3MRRB 3MRMA 3CGTA 4L8BA 4NHUB 3RDTC 3U4AA 1BZ7B 1JWMA 6FABH 1KB5A 5T1MA 3EKCA 5CJQH 3HI5H 2F74A 2BOCA 4QHNA 1BECA 1CZ8L 4GRLA 3QUMA 5BJTA 1D5BA 3QWOB 5ANME 4M5YL 5CFHA 1HYSC 3ZKMD 2EIBA 4AT6A 3BI9X 1KYOJ 5C0AE 5E2UH 1IQWL 2ERJC 2V5YA 1Z9MA 3DVNB 3L3JB 4FQ2H 4ZOCA 3SGDH 4DVRH 1S3KH 5HJ3B 5H8DA 4N0CD 2BRRH 3UBXB 3PWPD 1NBZB 2DQGL 1CFTB 3TF7C 1U3HC 4P5TC 2IAMA 3SE9L 4MNHB 2VITA 4RAUA 4G42B 4YH6A 1T04B 1YC8A 3P9LB 2NXZD 3QCTL 5DHYB 3SY0B 5AWNL 4X83A 5BQ7A 4R4BB 3QZWB 3QUML 3RGVB 1DUZA 4Z7OF 4S2SA 3GMLB 5F1OB 5I76B 3IFLL 3O0RH 4XH2B 3IFPB 5KG9B 3G5YB 4PGDA 1CXEA 4PJCF 4X9IA 2CXKA 3VXPB 1OOAA 1GYAA 3NPSB 4ZOBA 3L95A 2CK0H 1JWSA 5DSCB 3F65A 5IJKA 4XAWL 1TLKA 2MQ3A 2EE9A 1RFDL 3VFVB 3V5KB 4JQIL 1O0VA 3K4ZA 43CAB 1ZHLB 1MCHA 4Y8DC 5K59F 1T2XA 1RIHL 1MJJB 4NRYB 3GI9H 2P45B 5BZDB 3D0VA 2Y07H 3PGFL 3I85A 3ES6A 2DLTA 1OF2B 1WK0A 4NNPH 3VI4F 1WWAX 3GM8A 4I3GA 2YC1A 3SCMD 5I17B 3ZKMC 1JTPA 3KGRA 3X11B 5BRZE 3OJ2C 4O2CB 4DKFH 2NY7H 2NTSP 1OGAD 1S7XB 1G7QA 2X70B 1NSNL 4YR6A 3UPRB 4N0CC 3SHSA 4JO3H 4MJ5A 5ID0A 3QI9C 3STZA 4IMKA 4PG2C 4LSPH 4S1SH 2G75A 1OPGL 3OR6B 2Y5TB 4Y4KB 2FO1A 4MNQA 5SX4H 3K8MA 1DBJH 3PV6B 1YEKL 4EQ3A 4LMQE 4NO2B 5IROA 1UWGL 4JZJB 5T1DL 3VU2A 2OQJA 3WN5A 3GSRB 5LGKA 4XWOC 4I0PA 2YS4A 4PBXA 4GLRI 5DD6A 3LKRB 4MGXA 4TQEH 1KCLA 3D18A 4MXVE 4KJYA 5E7BA 3BZ4B 2CDEB 4PJ8C 1JN6B 5IESL 4AENB 4Y4HD 2EDLA 4LLWA 5IVXE 4F9LC 4H1LA 2XTJB 4X6CB 2Q7NA 4TNVF 4MCYB 3SCMC 1QBMH 1VEPA 2HJLB 3GIZH 3QDJE 3MRMB 4L8BB 2XZAH 3IKCA 2E3VA 4NKOA 1IGIL 3W39A 1JWMB 4UT7L 1KB5B 1IKFL 5T1MB 1CLYH 4TTDD 4JPKH 1HSBA 4OCRL 1AHWC 5DQ9A 5E6IC 5DGRA 5ETUA 3VXSD 1MFAL 1QHOA 1YEEH 1F4YH 2BOCB 2F74B 4QHNB 1K3ZA 1YJDL 4NCC1 1M7DA 4TSBL 3MRNA 4GRLB 3QUMB 5BJTB 1OW0C 2AP2A 1D5BB 3WIFA 5IFJB 4AEFA 4OFIA 3BMWA 4JFHD 1PX3A 4RMWA 5I0DA 2Z8VC 4AT6B 4ZFZA 1BFVL 2CQVA 1N5AA 3D69A 1G9NH 5DMKA 4M5ZH 4XWGH 3LD8B 1KC5H 1BBDL 1MF2H 3UTQA 1CU4H 3ARBD 1RZ7H 3V0WH 4XP4H 2IAMB 2VITB 4RAUB 3MRGA 3ARDA 1F2QA 1V8HA 3HC4L 1WSST 5BQ7B 1UVQA 3WJJC 3UZQA 1DUZB 3FFDA 1OAZH 4S2SB 1ZHNA 2XXCB 3D87B 2CGRL 1WT5C 4HCRA 4PGDB 3L95B 2ILLA 3U46A 1JWSB 3AFLA 2VWEC 3RL2A 2OL3H 4Z7WF 1BD2A 2FJGA 1IJ9A 4UT9L 4XBEH 4GAFB 4P48A 2HT4D 3FFCE 4ZTPL 4EDXA 5CEZE 4R97B 3EFDH 4IMLA 1IFHL 2Y23A 4JKMA 3RAJL 2W9EH 5IVZA 3EW3B 4ODVH 5C07A 1LWRA 1SMAA 2FB4H 3D0VB 4NUJA 3FRPG 3EOTL 3ES6B 4WI3A 3RWGA 2QQKL 5J6HA 4M1GH 2NX5E 3SOBL 4KDVA 4P2OA 3RY6C 4HCRL 2YC1B 3R4DA 3HAEH 1T1YA 3ALPA 3O2VH 4OCSL 4KTEL 3PL6C 1EFXA 3KJ4B 5DJ0A 3AMKA 5ALBL 3IAPA 2NNAA 1T89A 4KRPB 5EU6A 1EX0A 1G7QB 2K9UA 3SDAD 2V9RA 4YR6B 5TF1L 4R7NB 3RVUD 3QUYA 3WNLA 1ONQA 3LQZA 3ARBC 5DRNA 4MJ5B 2PO6D 3INUH 1CDGA 5ID0B 3STZB 1JFQL 1UB5A 5C7XH 2JB6A 2C9AA 2G75B 4LARH 2K7PA 4U6VH 4MNQB 4YHLL 1BVZA 3F7QA 2FL5A 3OAYH 3C08H 2W59A 3KPOA 4LCIL 1WEJL 4ZNEE 2BNQE 2OQJB 2MHAA 3WN5B 3CFCL 5J11B 1GOHA 2ICWA 2F5BH 5I8KL 4I0PB 1QR1A 5D72H 5DD6B 1N4XL 4U0RB 1T80A 3D18B 2O5ZL 3DROA 1BM3L 4KJYB 3UTOA 3GSUA 4QHLA 1QBBA 1E4XI 4D2NA 5C0AD 4XNMA 1T7ZA 2LAGB 4LLWB 3L3GA 4H1LB 3EDJA 1AR1D 5I71B 5HI3C 2VDRL 3AU1A 1CLZH 5JO5A 5I1DA 1KELH 1WIOA 2EKJA 2X1PA 4ZMAT 3BFOA 4O51A 1X4XA 1I85A 3FAWA 2J5LC 2GJJA 1QPXA 3IKCB 3DIFA 4NKOB 4BA8A 3W39B 1UZ6F 4L4TA 4KKCD 1OAYL 3D48R 2PO6C 4RISH 1HSBB 3HI6L 5DQ9B 1AXSA 4YPJA 3S37H 1X5IA 5ETUB 1O7VA 2HMID 1M7DB 1U41A 1LO2L 4FMKA 3MRNB 4YHOL 1NGPL 1MWAA 1CFQA 3WIFB 1KJ2H 4BKLA 2EZ0D 2J88H 5CD3A 5LWYL 4ZFZB 4I3SL 1N5AB 5FEBA 3D69B 5J3HC 5DMKB 5LGJA 4XP5H 2JCCA 3O9WA 4NN6B 4QRQA 1NGXA 2XQBH 5DLMH 1MIEH 2Q76A 4ISVA 4LFHG 3UTQB 4B0MM 3QIBA 5KW9H 2B1HH 3MRGB 3VDAA 3ARDB 5D7KD 3LB6D 3THMH 4OCYH 5K9QI 5MEPA 4TSCH 1FYTE 1I3UA 1QRNA 1J0YA 2ZKHL 1MWAL 1AR1C 1UVQB 2DLGA 3FFDB 2O5XH 3NZHL 3SKJL 1GGYA 1ZHNB 3LEYL 1FO0A 2QHLA 2RB8A 4KUCD 4OT1L 3U46B 1YZZA 3MGOA 3RL2B 1HWHB 3ARQA 1BD2B 2FJGB 4Q9RH 1I1FA 4TSAL 1MCRA 4EDXB 2E9BA 1U8MA 4IMLB 5C0CE 2NY2C 3FQWA 3IU3A 5I0ZA 3IS1X 5E95B 4LQFH 4O58H 5IVZB 5C07B 1QBLL 4NUJB 2HMIC 1B0WA 5DK3A 4MXQD 3CFDA 1AKJA 3O2WH 3RWGB 1RUQH 5J6HB 3L5XH 4Z7VE 1FO0L 2MKLC 2X4PA 4UU9A 4P2OB 3W11D 3T2NH 2NZ9D 5F70A 3HLAA 2OI9C 1T1YB 3FN9A 1YEIL 5T1LA 1EFXB 5JA8B 3NTCH 5DJ0B 1MJ8H 1QLEH 1AC0A 2NNAB 5EU6B 1ROWA 1SJEA 1WC7A 2YRPA 4XCCH 3QUYB 2M26A 1ONQB 3LQZB 5DRNB 3I75A 3EJZD 1HQ4A 1RVFL 3RVVC 5I15L 3JWOL 4OIBA 4X8JA 1UB5B 4R6UA 2JB6B 3VXQA 3QDMA 5DEGA 2C3XA 1G1CA 1UCBL 3QDJD 4NP4L 1KF9B 5B39G 4LRNH 3P2TA 5E9DE 2FL5B 3MV01 1EMTH 1XAUA 1Q38A 3KPOB 1KTLA 4UTBH 3OG6B 2MHAB 5CJBA 4M61A 4LSVH 2ICWB 2FRGP 1IGYA 1JYXA 3ARFD 1QR1B 4NFDA 5FK9A 4NM8L 4URTB 1CDJA 1IGFL 4A2MA 2MOVA 3T0XA 1MQ8A 4PJAA 3G5VA 1NGWA 3DROB 3GSUB 4QHLB 1UJ3C 3EZJB 4RAHA 4XNMB 4LLQA 3STBA 3U4BH 3L3GB 4TN9A 3X3GH 4ELMF 2BFVH 3B43A 5GRYA 4MXQC 5AZEL 3AU1B 1MFEH 5JO5B 4G9DA 2XRAH 5I1DB 4HEME 3W11C 2AJUH 2NZ9C 3QPXH 4I0KA 3ETBF 2C3VA 2NYYD 2ATPA 1OTUC 2H3NA 1BLNA 4O51B 4HXAL 2JK5A 1MAKA 3UDWC 2APBA 1KIUA 2MPAH 3DIFB 1AXTH 4Y8AA 5I2IA 1NL0L 4L4TB 2J6EH 3EJZC 1FAIL 3RU8H 4KI5F 3V7AE 1AXSB 4CU8A 3TJHD 4P49A 1OAKL 1XGUA 2EEDA 1PD6A 1MWAB 1CFQB 4GMTL 4GRWH 4BZ1H 4R26L 5BS0D 1CBVH 2DQEH 4JN1H 4BKLB 2NTFA 4UAOC 5CD3B 4NZTL 2GK2A 3HKFA 4O02L 2ESVE 3QO1A 5LGJB 2JCCB 3O9WB 4QRQB 4P5MA 1NGXB 4Y4FC 3W0WA 4LIQE 1IC7L 1YEGL 2Q76B 3ARFC 4ISVB 1J11A 5HPMA 3QIBB 2Z8WC 1QYGL 5DI8A 3PQYE 1S7RA 1RZGA 3GHEH 1VSCA 4P2RE 5T5FL 3M8OH 5KTEH 3LN5A 3WXWL 4XNZB 1KV3A 5IHLB 2GYSA 2GCYA 5MEPB 4YC2B 2VISA 3WDHA 1QRNB 3VI3E 5ACLA 2DM2A 4NCC2 5GZND 1FO0B 4WI6A 4BSVA 2I9LA 1VB9A 2VZUA 2P42B 1DCLA 4OM1L 4LCWE 1IAIH 3IKKA 3MGOB 1KLUA 1YYML 2C5DC 4PB0L 4I3RH 2ITCA 5F7EH 2YN5A 1I1FB 4O9HH 3VFOA 1AP2A 1U8MB 2NW2A 1CICD 4R3SA 3FQWB 3IU3B 1F4WL 3DNKA 2BNQD 1QFOA 1Q0XL 3NGBB 1IC4H 3H3PH 3ARWA 3OAZK 5D7IF 4ODUA 1G6RA 3CFDB 1AKJB 5TQ2L 1II4E 4M4RA 1ZVSA 2EXYC 5DHVH 5F9JA 2X4PB 4UU9B 3RZCA 1J0KA 4Y1AD 3KLSA 1WAAA 3HLAB 5FHBH 2FH6A 5T1LB 1NCDH 4LCYA 4OD3H 5IFHH 4JGMA 4U1GB 4XMKL 5JHDA 1I7ZA 1SJEB 1WC7B 2APVA 3V4PL 3I75B 1KPVA 3CNKA 5E8DH 1QKZL 1HQ4B 4OLVH 1V5JA 4QHMA 3H9YA 35C8L 2X6MA 3RY5A 4X8JB 2PYFA 2ZP0T 3VXQB 3QDMB 5DEGB 5HI4D 4J3VA 1N7ML 3B2UC 1DFBH 2ZSVA 3D25A 1QO3A 3O6LL 5GZNC 1J8HA 2KL6A 1KTLB 2NY1B 4M61B 3SE8L 5DD3H 1IGYB 1RJZA 1UCTA 5FK9B 1RPQA 1UADC 2YR3A 3C5ZD 4PJAB 3G5VB 2A6KA 1NGWB 4I13B 1CICC 4U6HA 3RIFF 3FTGA 5K9QG 4J3WA 2MCPL 4LLQB 3KPRD 4G8FA 1MLBA 3MBED 4WU5A 2A6JA 4PJ5A 2DD8H 2FATH 5LXGL 5A2FA 4GAGH 4UV4L 4AEHH 1TETH 4D3CH 1HXMA 2C3VB 3KPLA 2ATPB 3N9GH 1E4JA 2H3NB 1BLNB 1IEBA 1T2QL 4G9FE 2YSSA 2JK5B 4GMSH 1FYTD 3V5DA 4JHWH 3SE3C 2XIDA 1MHEA 1NQBA 1O5DT 4L4JA 5EUKA 2AW2A 4NWUH 3MLTA 4X6BA 1CR9H 3Q1SL 1XGUB 3K46A 3NAAL 5EO9A 1K2DB 3HZVA 3DRTA 4MA1B 4P4KA 2GKIA 1MJUH 4KK9D 4XB8A 2NTFB 2ZUTA 4ELKA 3QB7C 5E08L 4P2QE 3TZVA 4G5ZL 1TIUA 4M7JL 5C0CD 4KHXH 4KK8D 5E5MB 3QO1B 2AVGA 3RJDA 4JRYD 4X80L 4P5MB 3W0WB 1EZVX 1QNZH 2EDDA 5T33H 2VDMH 2ORBL 5HPMB 3UTSA 2EDKA 4NN5B 5D1ZD 5DDHA 2BJML 1V3MA 2A6DA 3QEHA 5DI8B 1S7RB 1IT9H 4NRXA 1RZGB 2D3VA 2ICWJ 5IJVA 2YPVL 3LN5B 1DE4B 3QA3A 3CH8A 2ZUVA 2GCYB 3EDDA 2ZSWB 2D7PA 2VISB 3L7EA 3G9AB 2XG4A 5HDQL 3W82A 1FL5A 4P0DA 1E4KC 2NXYB 3NZ8A 3CJJA 3P4MA 4M7LH 5C0RH 3CSBA 3UCRA 4XPGL 2I9LB 4BSVB 3GMQB 5SWQA 1NKOA 4XI5D 1KLUB 4L5FL 3BOVA 4RFOH 2ITCB 1Z3GL 3VFOB 5E9DD 1AP2B 1KCUL 2NW2B 1VPOH 4PRPA 4R3SB 5LGHH 5DMGC 2ZNXA 3QPQC 4WUUA 2EDRA 4ODUB 1G6RB 1ZVSB 4HSQA 5F9JB 3CH1A 3RZCB 3TJEH 1D5ZA 1WFTA 1NAKL 1NLBH 4GG8A 4LCYB 2E7CA 1FPTL 1U8PA 3UEZA 3OWEA 4LDEB 5JHDB 1I7ZB 4YO0A 3S35X 5CLWA 2YHGA 2HH0L 4DUWA 1B6UA 2OR7A 3QNZA 5GGRA 2I60L 5JQ6H 4A6YA 4PRHD 1KPVB 2DTSA 2B39A 3JWNC 4UTAH 4QHMB 3R0MA 2PYFB 4BM7A 2G60H 5E8OA 1MRDL 5IQ9A 2X4NA 5HI5D 2ZSVB 4YHZL 3D25B 1QO3B 4XNYL 4FABH 3BISA 1J8HB 5CBEA 5KSAC 4KRMB 4XC3H 4YE4L 3VFWA 3TFKD 2A38A 2H2SD 3RIAF 3S5LA 2IPTL 3UJIH 1RJZB 1JPSL 5E6YA 2OZ4A 4ZXBC 2AV7A 1QP1A 4PGCA 3OGOE 2A6KB 4U6HB 1N3NA 4TULH 2I07A 3JUZA 3FTGB 1IQDA 1YNKH 4FQHA 5J12C 3QULA 3PP4H 4G8FB 3RVTD 2EXWD 3H9SD 5GISL 3SDCD 1MLBB 4WU5B 2A6JB 5E94A 4PJ5B 3QNXA 3PQYD 2NY5C 4U1LA 4LPWA 1HXMB 4JKPH 4PJBF 3M17A 2B0SL 3KPLB 1FGVL 1CGSL 2E6JA 1CDCA 3PHSA 4M7KL 1IEBB 3FCTA 2YSSB 1YN6A 2OZ4L 3O6FA 3V5DB 1XT5A 2IFFL 1UH2A 1MHEB 5GZOC 4J8RA 2OK0L 3OL2A 5EUKB 1S78D 3T0BA 2R0LL 3MLTB 4X6BB 4Z7UA 4I0CC 5EO0A 3OAUL 2QSTA 4LCWD 2D7TH 2H1PL 5MEQA 1CI5A 5EO9B 4R4FL 3CMOH 3HZVB 5HHOD 3DRTB 2WANA 3BPCA 2J1KA 4P4KB 5HI5C 2C3WA 4RBPH 1A3RH 4XPHH 2DM7A 4ELKB 5IFAL 2GTWA 3TZVB 4Y16A 5MEOA 3GMOA 1Q8MA 4GKNA 4K2UH 3BGMA 4LP5A 2NY0C 5DT1H 4NQSA 1KT2A 2XTJE 3UTSB 4X6CE 5DDHB 4XMPL 2A6DB 3QEHB 3LCYA 4NRXB 1SVZA 5IJVB 4PJGA 4EI5D 3WHXA 4OF0A 3QA3B 3MV9A 2ZJSH 4KRLB 1HZHL 3L7EB 1U95A 5DUBA 1P5VA 3LH2H 1FL5B 3RVTC 3SGJC 2HP4A 3W5MA 4IDLA 5C86A 2NY3D 3NZ8B 3P4MB 5I18H 5I1GL 1AQKL 4GSDL 1FGNL 5DA0B 3GB7A 5I1EL 5SWQB 4NGHL 1J0ZA 4JHAH 4PJDE 4ZUSA 1XGQA 4PJ9C 4KJWC 4PRPB 2ZUSA 3RHWF 1S78C 4ERSL 4WUUB 3ZTNH 4CMHB 3KPPA 3CH1B 4LSQH 3U0WL 1D5ZB 3MODL 1U6AH 2Z31A 4XX1E 1B4JL 4GG8B 1MCPL 1XGTA 2EECA 1U8HA 1U8PB 1P7QA 4I77H 5KOMC 2YOCA 3GBNH 4YO0B 2AK1L 1N0XH 3VD3A 5GGRB 3QNZB 2BSSA 3MOAL 2IEPA 3MUY1 4FQJL 3W9DA 5GQBA 4PJHA 1J87A 5C08A 4A6YB 3U7YH 4EI5C 3LRHA 3HFMH 4KKLC 4DZBA 3S35L 1MH5A 5E8OB 4RMQA 4G9FD 5C09A 3BKJL 5IQ9B 1UM5L 2X4NB 3OV6A 4ZOAA 2RAMA 3DHMA 2EKSA 2GJZA 3V52H 3TO2A 3WNNA 5CBEB 3VFWB 4N8VG 3S5LB 2AV7B 2CRMA 2DMKA 4F7PA 3KLHC 2FD6L 5E24E 2VIRA 4NC2B 1FE8L 4PLKC 4MD5A 1CFNA 1N3NB 1DQLL 4P2QD 2I07B 1MLCA 3HNSH 1JZ8A 1J10A 1XR8A 1IQDB 3C9NA 4OKVA 4FQHB 4YXKL 1OCWH 3QULB 1PY9A 4X4ZA 5BVPH 5DRXA 1JBJA 2R2CA 4XP6L 1TNNA 1UYWH 5E94B 2EDJA 2OJEA 4G8EA 3LVEA 3QNXB 1TJGL 4LASH 4U1LB 5GRZA 3M17B 3QAZC 15C8L 4DGIL 2XA8L 2CDGA 5CJOH 3FCTB 3N85H 4DTGL 5ICXA 1WJ3A 1YN6B 3PABA 5I19L 3O6FB 4MNQE 2ZUXA 3N1PC 4J8RB 5JW4Q 3KXFD 1LO0H 2J4WL 5DK0A 2E7LC 4AK1A 4Z7UB 2Q7YA 4MAUH 5EO0B 3GJFH 5MEQB 4JDTH 4XPBH 4WTXA 4YFEA 2VXQL 3BPCB 4HJJH 5F96L 3WYRA 3MLVL 5IHUH 5K33A 1JVKA 3RI5K 5JDJA 2OJZH 2GTWB 4Y16B 4G6JH 5MEOB 3GMOB 5GJSH 2Z4QA 3WBDA 5DVKA 1CFVH 2HT2C 4GKNB 4LSUL 1J1OH 3R8QA 3BGMB 3CCHA 4JM2D 4NQSB 2PTTA 4EBQH 1KT2B 2F53A 4JFZH 1Q9KA 2FX7H 4JY6A 4O4YL 1AQDA 2NR6C 2JELH 4PJGB 3H3KA 3I6GA 3WHXB 3JBG7 3BJLA 2VZVA 4PD4K 3MV9B 5F9OL 4NWTH 4QRTA 1NCAL 1U95B 1QSFD 1ZVYA 5DUBB 1BQLL 2L4OA 3P11H 2VQ1A 2EIDA 1YDPA 4TVPE 3H0TA 3RGVD 3QWRA 2HRLA 4S1QH 3AY4C 4IIQC 2B2XL 4XBPA 2WW8A 4WV1C 1XF4A 4X0KA 5LBSL 1C7SA 2DDQL 5DZNA 2EYTA 3DYPA 3GB7B 1QSEE 4ZUSB 1XGQB 4JO1L 1T66C 4AEIL 5D96C 1RZ8A 2QSVA 2CPCA 3DGGA 5GRJL 4JR9H 1BIIA 3TN0D 1OLLA 3KPPB 2ENYA 1S7SA 2X4OA 1FNGA 5BV7L 2Z31B 4KHTL 3FMGH 4F57L 4EDWL 5GJTH 4TNVK 1XGTB 1U8HB 2OTPA 1P7QB 3MXVL 4EQ2A 3T08A 4K7PX 1I9JH 1S7QA 5DO2C 3SDDD 4QXTA 3UO1L 2BSSB 3SBWC 1F4XH 3W9DB 4RGOL 4PJHB 5SWZA 3SDXA 5C08B 1G7IA 3CXHK 3O3EA 4XTRD 4KAQL 1KULA 4LPVA 2DM4A 4DZBB 3OPZH 1MH5B 3ZE2F 5C09B 1BMGA 2WM0A 1CD0A 2XNAA 3ULUF 3BRDA 2Z92A 4YEEA 1BD2E 2EKSB 4Y4KD 4HS8H 2WWMD 2GK0A 1J05A 3ULVL 2QKIA 4RFEA 3TO2B 1DBKL 2FZ3A 1A3QA 1UEYA 4WU7A 5C07E 3NPSC 2OP4L 1IGCH 2IQ9H 4F7PB 2UUDK 3BAEL 3QFDA 4OLYH 2VIRB 1UWXH 2ZUQB 1SYSA 4UILL 4MD5B 1CFNB 4AZ8A 4JY5L 2XG5A 1MLCB 4S1RL 3T3PF 3RNQA 1XR8B 3C9NB 4KVCH 2XWBB 4OKVB 3NFPA 5EU6E 2B1AL 2WSKA 3F7YA 2XTJD 1T21A 5DRXB 4YDIL 5DVMA 1OAUH 2OJEB 4G8EB 2QJDA 4WHYH 2SEBA 5KVEL 5GS3A 2R4RL 4OZIA 5DMIH 2CDGB 3LKSA 3MLRL 5ICXB 3PABB 4QGYA 1SQ2N 3QG7L 1N59A 1NMAL 1FAKT 4JO2H 3TLRA 4KC3B 4Q0XH 1QRKA 1MEXH 3B4NA 5DK0B 3VD5A 3MUJA 2Q7YB 2ZG3A 3QYCA 3L3HA 2FIKA 1I8KA 4GRLD 2B5IB 4Y4KC 3BQUA 3KJ6H 4GXVH 2WWMC 1MFNA 4RQQA 3ZTJG 3QRGL 1UWEL 4LGPB 2Z4QB 4H0GA 1BWWA 1P69B 4TPRL 3UPAA 4JZJC 5SWSD 4EXPX 3CCHB 3DX7A 1A7NL 1NCNA 5D8JL 2PTTB 2F53B 2BX5A 4XB7A 3VWKA 1Q9KB 1ZHKA 3QXDA 3JZ7A 2IFGA 5TDPA 4KROD 1H8SA 1YQVL 4JY6B 4LEOA 4ZNCD 2PKDA 1AQDB 3HUJF 3I6GB 3CSYA 2IAMD 1XR9A 2VLME 2YA1A 3QFJA 5J8OA 1Q9LA 3WFBH 4QRTB 4Z7NE 2VQ1B 1N0LA 1YDPB 5DQDL 5HYSG 3H0TB 3RUGF 1F2XK 4FXLA 5LCVL 5I6XB 2DJUA 4HUXA 5CGTA 4L4TE 1PVHA 4L9LC 4XBPB 5I73B 4X0KB 1XF4B 4LLAA 4QRUA 1KN2H 1A02N 1EVTC 2EYTB 4OFVA 4TVSa 3CK0L 3DECA 3TO4A 4NKIL 3IU4H 4PRID 4Y19A 2UZYB 4ZSOB 3PDGA 1RZ8B 5HY9A 4ODXA 3DGGB 1DBAL 3LPGA 3B9EA 4GAJL 3SKOA 5MENA 5C0NC 3S36X 2JCCE 3T4YA 2YXMA 1BIIB 1S7SB 2X4OB 1FNGB 4O5LL 3U83A 3OKOA 1KCRH 3CAFA 4R0LA 1QRNE 1S7QB 4KRPD 4IJ3B 3LD8C 2V2TA 4QXTB 3U2SA 1DLFH 5F3HA 3SDXB 5SWZB 1HCVA 4RGMC 1G7IB 4N0YL 3O3EB 2VXVL 2E27L 3VFRA 3GSVA 2QQLL 2IAMC 4K7PL 1CL7I 5EIIA 5HHPA 2HT3D 4XPFL 2C4XA 1YNLL 2PETA 2QHRL 2XNAB 2Z92B 1ED3A 1JGLH 1R5VA 4MNQD 5KOVC 2GK0B 4QRPA 1J05B 1RIVH 2QKIB 3ZHDA 4RFEB 1TZGH 1LP9A 2FZ3B 2YBRA 4WU7B 4ONHA 5FFLA 2AEQL 5HGAA 2CJUL 8CGTA 2HTKD 5IJKC 4UOJA 3QFDB 3TPUA 5IT2L 1CDBA 4I8DA 4U2ZA 1SYSB 4HT1H 4R97C 3RNQB 2CO6B 2Q86A 5D7SH 4LHUA 3NFPB 5IBLD 2YXFA 1EEYA 3F7YB 1CF8L 1T21B 2B20A 5IP4A 2ZCHL 3EOBA 3HN3A 4BQCA 2ARJA 4U6XA 2SEBB 1RUML 3VGDA 4OZIB 2P46B 3EYUL 3LKSB 4CL7A 2BNRA 3K7UA 1RV6X 1CIDA 1N59B 5DURB 1CXFA 4MQSB 4TVPD 2VLJA 3ARYA 1S7UA 3MRHA 5TE4L 5HHXL 4LOUD 2FECL 2HT3C 1CZ8H 3L3HB 2B4CC 2FIKB 1I8KB 5HDBF 2WQRA 3BQUB 1A6AA 3F5WA 4WRLA 4M5YH 3BEVA 4PJAE 4RQQB 2BHZA 3WLWD 5IROC 3HMWL 3G6JF 1IQWH 1WZLA 3MNVA 3DX7B 4H0HB 4HJGA 3T0DA 5FCSH 3VWKB 3MACL 1ZHKB 3QXDB 4I0PC 5TDPB 4ZO9A 4LEOB 2DQGH 4U0RC 3ARTA 4D0BA 1EFQA 3SE9H 3CSYB 2VRAA 1UH4A 1XR9B 3CSGA 3NA9L 3QFJB 3ARDD 4NFCA 1Q9LB 3RRQA 1P4IL 1R3JA 3QCTH 4U33A 5AWNH 3QDAA 5AG8A 1TENA 3ZKQD 2D4DA 5JIKA 3QUMH 4H25A 5HVHB 1YJDC 5I71C 2I24N 3DURA 5HDLA 1KPRA 4HUXB 4M7LT 3IFLH 4X6DB 4P9ML 5CIPA 3U7AA 4QRUB 1BZQK 3GNML 2JJTA 1U8QA 3GZKA 4FFYL 2A9NL 2IAND 2VLRA 5CSGA 4XAWH 3TO4B 1RFDH 3BZFA 4NC1E 1BD2D 4Y19B 5KZCB 2UWEF 4JQIH 4MHHI 1OTTC 3Q0HA 3SGEH 3GSNA 5HGBA 2GHWB 4ODXB 5HY9B 1I3GL 1NC4A 3SKOB 5C0FA 1RIHH 4GJTB 5C0JA 5MENB 3ABZA 1GGCL 5C07D 3PGFH 1ORQA 1DANT 3E2HC 3NH7L 3QEQA 1SJXA 3MGAA 4WW2C 2X9YA 3VFTA 4L8SC 5K9KA 4P2OD 1L9NA 3MZGB 3OKOB 1JGVL 2XWTA 1CTOA 3S36L 3LZFL 2P1YA 1EFXD 2OXHA 1F97A 4R0LB 1BJMA 2AEWA 2V2TB 3U2SB 1NSNH 2A0LD 4QHUA 5F3HB 3QUYD 4N9GA 1PZUB 3VFRB 1CGWA 3GSVB 1MJ7L 1RHFA 4R90L 3UTPE 3ARDC 5EIIB 5HHPB 3FT2A 1OPGH 2MMXA 1ED3B 1XCQA 4WFEE 1KEGL 1R5VB 3IDGA 5C0IB 1NBQA 1YEKH 3DI3B 4QRPB 3EDKA 3FAXA 1LP9B 4GRWF 1UWGH 3D6GA 2YBRB 3L5IA 5T1DH 3UZEA 4ONHB 4U31A 4OCWL 5HGAB 3BE1L 4FN0A 4PJCA 5IF0A 1U3HA 4X7DC 4P5TA 3PF2A 1X5KA 5I1KL 3TPUB 5IOPA 2Q1EA 4UBDC 5IESH 2Q86B 1FZJA 3ZE1F 3SE4C 2YUVA 3BYYA 4LHUB 4YUEL 5JHDE 1Y6MR 1EEYB 4ZPVA 2YZ8A 4DEPB 3EOBB 1LGVA 4JKKA 3IJHA 2DQHL 2ARJB 4Y2DA 2EC8A 4NJAL 4ETQA 4FXGA 2BNRB 1X5GA 1S9KC 4X5XA 1H3GA 4X4MA 3HE6A 1CCZA 1T89C 1G9MH 5E4EC 3WS6C 2FBJL 2LTQC 3QUYC 4UT7H 2VLJB 1S7UB 3MRHB 4L4TD 1BBJA 1FZOA 5C70A 5AZ2L 4OCRH 1KCVL 3X3FL 2WINA 4LVOB 1A7RL 1EJ6A 1FNLA 3DX8A 5BZWA 1YJDH 2PYEA 1TJIL 4TSBH 1VFBA 1A6AB 3F5WB 4AY0A 3T2PA 3BEVB 5GGRY 1O7SA 4N1CA 1BFVH 1JPFA 3BP6A 4XMLL 3MNVB 4WGWB 5DJXA 4HJGB 4KUCF 3O9WD 4WWID 5A16A 3B5TA 1DQTA 4JO4L 1BBDH 1JNNL 3K8KA 1HH9A 3QI9A 3QIBD 4D0BB 1JHKL 3DXAE 4N90E 1TCRA 3CFEA 4M6ML 4XT1C 3HC4H 1NFDF 1R3JB 1QRND 4H25B 4IDJL 3DURB 3VH8G 1KPRB 4LCCA 5JIPA 2EDEA 2CGRH 5ACMA 2R29L 5CIPB 2CMRL 5FGSA 3PGCA 1U8QB 3MLXH 5F7UA 2WP3O 1N6UA 2VLRB 3NIDE 3FO2A 1RIUL 3QIUA 1I85C 3BZFB 4UT9H 4WENB 2N1KA 4EKXA 4PJ8A 3I3DA 4ZTPH 2FGWL 5HGBB 4F9LA 2FX8L 1WCQA 2LABA 1NC4B 1IFHH 3KNBA 3ZYJA 5C0FB 1MHHA 5C0JB 3RAJH 1K4DA 4ALAL 2VDKL 1ORQB 3EOTH 5FDWA 4YHNA 3RIFK 3UTSE 1FZKA 3QEQB 3S3JA 1AKJD 2QQKH 3VFTB 3SOBH 3PG2A 3CFIC 1WFOA 4HCRH 5K9KB 3UTTA 3I2CL 4QT5A 4OCSH 1TMCB 2XWTB 5GGSA 4DAGL 4KTEH 1MCCA 2DF3A 3OHXA 5ALBH 3GRWL 3SKMA 1KCSL 5A3ID 4QHUB 5TF1H 1AHWA 4PRNA 5E6IA 3NIFF 4N9GB 3QIBC 4HWBH 2ADGB 2YZ1A 3RQ3A 1JFQH 4XNZC 1OL0A 1OW0A 3TC9A 4U1JA 3FT2B 2LQRA 3UAJD 3QDMD 1XCQB 5HHVL 3IDGB 4YHLH 2X10A 1VEOA 4HKJA 2FECI 5JORA 4LCIH 1WEJH 5L8KB 2NY1D 2YD1A 2ZCLL 3BGFB 3CFCH 5I8KH 5D7JA 4PJCB 2OR8A 1U3HB 5IF0B 5B4MC 5HXMA 1NDMA 4P5TB 1N4XH 3AS3A 3BXNA 3GHBL 3SGDI 3MLYL 3BZDA 5IOPB 4Z7WA 2O5ZH 4QKXB 1BM3H 3B2VL 2X44D 3WJJA 1FZJB 2VH5L 3JWOC 3VFNA 4FS0A 3NGBC 2UY6A 3AB0C 3WD5L 4ZPVB 1EAJA 5ITFB 3TV3H 2VDRH 3U9PL 4C54A 3IJHB 2XN9A 4JZNA 4Y2DB 4ETQB 1QEWA 3IDYC 4X5XB 4U1GC 3HE6B 4M9PA 4QOKA 4MHHG 4PRAA 1RUPH 4K8RC 3ZHKA 1OAYH 1BBJB 1FZOB 1X7QA 3HI6H 2WINB 5HGDA 1KXQE 4MVBC 2WAHA 2R9HC 4FZ8L 5I66A 3DX8B 5BZWB 2PYEB 4YHOH 3UAJC 1LO2H 1NGPH 3CDCA 2QSQA 1VFBB 2ZZUT 3PL6A 1A6WL 2WWKT 5GS2H 3FN3A 2L7UA 3QQ9D 5LWYH 5JTWA 5IK3B 4Z76A 1JPFB 2CR6A 3BP6B 4I3SH 2NY1C 5IKCA 1R5IA 1T0NA 5DJXB 5A16B 3FB7A 3W0WD 4JFDE 1HH9B 3QI9B 4IOSD 3CVIL 4J2XA 1QFWM 1A7QH 1TCRB 3CFEB 3KYMA 3KPQA 2ZKHH 1MWAH 1RSFA 4H0IA 3WFCL 3NZHH 3SKJH 1AE6L 2ITDA 2D31A 4LCCB 3LEYH 4KPHH 4NT6A 4EOWL 2NXYD 2WLZA 5D1XA 1TZHA 2CUMA 3DYOA 3HB3D 5JPMA 5EZOL 1B2WL 4Z7UE 3PGCB 4QHKJ 5I30L 4GW5A 4JFOA 4BELD 4OT1H 3G5ZA 2QEJA 3FO2B 3QIUB 1D7FA 1JYWA 3ARGC 1NUDA 4PJ8B 4TSAH 3DVGA 5GS0L 5JW3L 1U8OA 2IBGA 3KNBB 1MHHB 3LMJL 4FQPA 3T3ME 1K4DB 2JJUA 1BGXL 5SX5H 1QBLH 4U1NA 5L2KA 1VENA 5FDWB 4YHNB 2EIZA 1HH6A 2P49B 1FZKB 1NJ9A 3KR3L 1FO0H 4NC1C 5JLZA 5DR5L 3RZCD 3UTTB 4PJGE 4QT5B 1YEIH 5GGSB 5H37H 3OHXB 1HSAA 5JXED 3SKMB 5JHDD 1AHWB 4PRNB 4NN5C 5E6IB 5EBGA 1LE5B 5IUSA 3OGCA 2P43B 1RVFH 3VA6A 3JWOH 1MFDH 2VR5A 5I15H 4GKSA 4OZGF 1TTFA 4U1JB 1I8LA 1HHGA 1UCBH 4NP4H 4HKJB 5JORB 5T1KA 1BJ8A 1J8HD 3IRPX 3HB3C 1WLHA 4YFDB 1EHXA 3B9VA 2HJFA 3MQIA 4ZUUA 3SO5A 4ZO6A 2EC9T 2YN3A 1X5HA 4TUKL 5D7JB 1NDMB 1Q72L 5I16A 4NM8H 3IF1A 1DTUA 1P4LA 3BXNB 3IAGC 3N1GC 3MLPA 1IGFH 2YK1L 4Z7WB 5A1AA 1UXSA 5D9SA 4OB5L 3LOWA 3HR5A 1OQXA 1YY8A 3BDBA 3VFNB 2P48B 4QTIL 5AZEH 3GKZA 4HLJA 1HINL 4ODHL 4HWEL 1ZT7A 4PJHE 2XN9B 4PJ5D 5C08E 3PV7A 4JZNB 3RZCC 5J6GA 4JFEA 4XNUL 4OF5A 3HE7A 4Q74A 1QEWB 1IZJA 1OP3K 1TXKA 4EZMA 4MXWL 5C09E 1FFRA 5L9DH 1QG3A 2D0FA 2A9ML 1MCWW 4QOKB 2WK2A 1ZEAL 4PRAB 2W9LA 1A4KA 4OLUL 1FAIH 2H26A 1WZ1L 1X7QB 3LS4H 5HGDB 3LIZL 3MPCA 1OAKH 2LFGA 4PG9A 1FIGL 1GIGL 2H9GA 5I66B 1CLCA 3OB0K 5KANI 4GG6F 4GMTH 3LN9A 4PIRF 3LKPA 4R26H 5I74C 3PL6B 4MQXC 2M8XA 4P4KD 3QWQB 5GGTA 3TBVA 1DN0A 4Z76B 5ADOL 4O02H 5IKCB 3PUCA 1R5IB 1T0NB 1MFBL 1IC7H 1YEGH 3FB7B 1X5FA 5JR1L 3HPLA 3UTSD 1QYGH 1LDSA 4RA0C 4FOMA 2DQDL 5T5FH 5BRZA 2PW1A 4CW1A 4Q7DA 5C1MB 1DLHA 5KN5A 3UROR 4HS3B 3KYMB 1PKOA 4NNXA 3KPQB 1Z0MA 4RX4A 2ITDB 5CSZA 2D31B 2UY7A 3WUZA 4ELMA 5GGTL 4NT6B 5D1XB 1TZHB 5IB3A 5JPMB 1YEFL 3AC0A 3ARSA 1VGEL 1RMFL 1J1PL 4OM1H 4GW5B 4JFOB 2R1YA 3WIHH 3G5ZB 3QCUL 2CH8A 2VMFA 1YYMH 4PB0H 3QHFL 3DVGB 4PRPD 3MGTA 1U8OB 2A2QT 1F4WH 5DWUH 4J3OC 1FC1A 1Q0XH 2R69L 4WUUD 4U1NB 5L2KB 2EIZB 3B8SA 4PD4J 5TQ2H 1NJ9B 3CFKA 5JLZB 4P4KC 3T1FA 3UDWA 5EDXA 3F7PC 4YHYC 5IVXA 3IXTA 2J5LB 3TZVC 3DVFA 5CKAA 1HSAB 1H3TA 2IMMA 4XMKH 3K1KC 4LVNC 4QNPE 4YNYA 4L8DA 2BP3A 5J7CC 2Z8RA 3V4PH 1RZFL 3P0VL 5KSUA 3OGCB 1QKZH 2DAVA 2F9BT 35C8H 4GKSB 4UOW0 4U7MA 1HHGB 1N7MH 2J8UE 3BRGC 4KV5E 3O6LH 5T1KB 3GMMA 4BH8A 4Y4FA 1JRHL 3GFUA 2HJFB 4ZUUB 1N2RA 1TQCC 3ZDXF 2PR4L 2X9XA 3ELAT 3RZWA 5B38B 5I16B 3IF1B 1P4LB 1W0WA 1AD9A 3MLUL 1UXSB 3GK8L 5EA0L 1A3LL 2KQNA 3HR5B 3AS0A 1UH3A 1YY8B 2MCPH 3CXHJ 1F3RB 5B3NA 1CXIA 3DOSA 1C1EL 4CN6A 5D7IA 1X5ZA 3SDXE 1ZT7B 5SWZE 5LXGH 5J6GB 4UV4H 5DFWH 4JFEB 4JKWA 1B3JA 3HE7B 4NOFA 3RVWD 1T2QH 4P4RA 3B9AA 1FNSL 3O6FD 4ZQKA 3PDOA 2NY2B 1A4KB 2X89A 4O2FA 4OF8A 4DCQA 2H26B 5E56A 3BUTA 4UV7L 4PG9B 4RMTA 2V7HA 3MRJA 1VFOA 1JNLL 2H9GB 3Q1SH 4OFYA 5EU7E 3NAAH 2CR3A 4W70A 4WI9A 3NFNA 3DUHA 3LKPB 5E08H 4G5ZH 3TBVB 4M7JH 1DN0B 4Y16D 1ZTXL 2R2HA 3O4OC 4X80H 4NPYB 2PXYC 1F6FB 3MA7A 2NX5A 3I3EA 2ORBH 2OXGA 3HPLB 2BJMH 4WGVB 1ZXQA 4HIXH 5BRZB 2PW1B 4NQUA 3TVMC 2YPVH 4CW1B 4Z6AT 1DLHB 5KN5B 4OZIE 4FP8L 3MV9D 4NNXB 5DMJB 4G6AC 5CEZL 5HDQH 2FEEI 5CSZB 4ELMB 1ZSDA 2HWZH 4XPGH 5IB3B 2X9WA 1MCNA 3BVNA 3FO9A 1ZLVK 2R1YB 5GGVY 2Y5EA 4V1DE 3WIIL 1LO4L 4L5FH 1VEMA 2MKWA 3E3QC 2Q20A 3O6FC 3WO4C 1Z3GH 4Q58C 3VJ6A 3BO8B 4FFWD 2NW3A 4KWUA 1KCUH 2MTPA 3H6JA 1YEDA 3MGTB 4ZOEA 3LS5L 1SJHA 5HHMB 4NO5B 2D9QB 1J12A 4JB9L 2R0WL 3B9KD 4PJ7F 3CFKB 3U1SH 2BHUA 3T1FB 3W5NA 4MQ7A 3ESVF 2Z31D 1EGJA 1V3KA 3IXTB 1NAKH 3QFJE 4Y16C 5IVXB 5EZIL 1FPTH 3SE3A 1P7QD 4YNYB 5FHAL 2HH0H 5F1SA 4L8DB 5EH1A 4W81A 2I60H 2K7QA 1AFVL 2KKQA 5C08D 4DGVL 5KSUB 1NANH 2ED9A 4NIKB 3G08A 2GI7A 1MRDH 5KANG 3CVHA 3FJTA 1Q0YL 2JIXA 3MMEA 4XNYH 4YHZH 5BXFA 3GMMB 4BH8B 4Y4FB 1EGJL 3RKDD 4YE4H 1N2RB 2R15A 1NFKA 4EUPA 5MENE 2DQFB 2LE9A 2IPTH 1JPSH 5AAWA 1W0WB 1KGCE 2Q3ZA 3Q3GA 1AD9B 1IAMA 2ATKA 4WTWA 4J3XA 1F42A 1ZA6A 2XKSA 5BO1H 3CVHL 4U3XA 2APWA 3Q5YA 5GISH 3DGCR 1A47A 5HSFA 4OV5A 5D7IB 2GJ6A 2P5WA 5E6ZA 3CXDL 1FFPA 2B0SH 1CFSA 4JVPA 1NEZG 5LJYH 1FGVH 3K8LA 4PGZA 2AI0L 2LU3A 4M7KH 4P4RB 3VG9C 4S1DD 1C08A 2OZ4H 1X5YA 1IAII 2IFFH 4ZQKB 3PDOB 4JM2F 3FZUC 4J7RA 2OK0H 4LVEA 4P2CG 4O2FB 1LP9E 4DCQB 2R0LH 2G5RA 3OAUH 3W81A 2V7HB 3MRJB 2H1PH 4R4FH 3NCYP 2DKMA 3NFNB 2X4SA 3RGHA 1IARB 1ZOXA 3QCVL 4JJ5A 4QY8A 5IFAH 4LBEA 4N0FA 2R2HB 3PP3K 2IG2L 4LF3A 1EVUA 5EOQL 4Z7VA 3MA7B 2NX5B 1HE7A 2F53D 4XMPH 1C5BL 5FUOL 1KIQA 4WI5A 3RNKA 4L4VE 3BH9A 4LMQI 3HHRB 1MY5A 3QO0A 4KDTC 2BNRE 1L7IL 1HZHH 4LHJB 4AH2A 3BP4A 4CJ1A 5FB8A 1ZSDB 3QWRD 4X9FA 4ODBD 5I1GH 1A7OH 3VFGL 1AQKH 4GSDH 3V6ZA 1FGNH 4K3DL 5B3JF 3BVNB 4D9RE 3FO9B 4ZXBA 3VWJC 5DC4B 4PJBA 2X05A 5I1EH 4NGHH 4CVXA 5IG7A 3VJ6B 4UI2A 4XVTL 2NW3B 1YEDB 2E9IA 1JGUL 4RRPA 4HF5L 1SJHB 4ERSH 2VZOA 4N0RA 5CWSA 4DKAA 4KU1A 1XIWA 3U0WH 1YQ2A 3HZYA 4MQ7B 4MB3A 1B4JH 4K94C 3ULVD 1URLA 1RUAL 1MCPH 4KJQD 2VXUL 3HNTL 2I5YL 2AK1H 4F7TA 3I50L 3PNWA 1OB1A 3MOAH 1E4WH 4FQJH 5EIVA 5IBUG 2VC2L 5SWZD 4LLUA 2O5YL 3KPSA 3G08B 5EU3A 4J6RL 4P9HC 5BMFL 2YEZA 4UMGA 3S35H 4OGAC 2VLRE 2NY5L 2QADB 2YRZA 3BKJH 4TUJA 4M3JA 2EICA 3CVHB 1UM5H 2DI9A 5GHWL 2JIXB 3MMEB 5BXFB 2NY6B 5I6XC 3PWUA 4Z77B 2KBGA 1Y6KR 1G7PA 3MLWL 4EUPB 3CDYA 5CP7B 4X9BA 5KS9F 2IBBA 4M93C 1VADA 4X7SL 3QEQE 1CE1L 3Q3GB 5GIRA 2ATKB 4PYHA 1KEML 1FE8H 3KYNA 1DQLH 1QUNA 4Z7QF 4QF1A 5DEFA 3SGJA 4YXKH 1ZA6B 2YWYA 2HFGL 4B53A 2EH8L 1NAMA 5FDYA 2B8OT 4HXBL 2E9WA 4OV5B 2ARWA 4MMZC 3PWJA 4XP6H 2GJ6B 2P5WB 1TJGH 1FFPB 15C8H 1CFSB 4ZD3L 4DGIH 2XA8H 3P9MA 5IHBA 4DTGH 1HHKA 5I19H 1C08B 1H3WM 4CAGA 4OCMC 1ZLSL 2ZUUA 2CRIA 3CUPA 3C8DA 1FORL 1TNMA 5DURD 4IJ3C 3N1FC 2OSLA 4CU7A 2J4WH 4RGND 4U1IA 4LIQL 4YBQC 4D8PA 4Z7OE 5FGRA 1NAML 3MFGB 4PJCE 1BQHG 4HK0A 5D70L 1SBSL 1BQUA 2VXQH 5F96H 2A83A 3FB5A 2X4SB 3MLVH 3DETD 3D3VD 3BQUD 4JJ5B 4U05A 3SJVA 4QY8B 2CKBA 3AAZA 1B9ZA 4LBEB 1MPAL 4N0FB 1M71A 1IAOB 3RWEA 3ZDZF 4OQTA 4YBLC 4LF3B 4KK6C 3HG1A 4Z7VB 5EU7C 3U9UA 3VWKD 1KIQB 3RNKB 4K3EL 1JV5A 4O4YH 4PLOB 3BH9B 3VI4E 1WIUA 5EBLA 3QFJD 5F9OH 4P46A 2JF1A 4AH2B 2Y36L 1TFHA 1BQLH 4X4ME 3BP4B 2X41A 3RTQA 2V9TA 2XY1A 3MXWL 5FB8B 2NPLX 5CJQL 2CKBL 3HI5L 5E1AA 3T0EE 3V6ZB 3WNKA 2B2XH 3BHBA 3GJEA 5LBSH 4ZXBB 4OQTL 1P6AB 2DDQH 1UZ8A 4FG6D 4PJBB 2R4SL 1G7LA 3O2DA 2PYEE 4UIMA 4HK3N 1A6VL 5IG7B 4JO1H 4CVXB 4Y19D 1JI1A 4AEIH 4BFGA 5J12B 5EC2A 5GRJH 3OAZH 3PE9A 4YDKL 3DSNA 4DKEL 4LU5L 5CGMA 1U91A 3T0WA 3QJHA 2JE8A 5CWSB 1U3JA 1XIWB 2KPNA 1DVFC 2VKWA 3DETC 4C4KT 3HZYB 5BV7H 2XZCL 4KHTH 4F57H 4EDWH 2IF7A 3MXVH 3ILPA 3VGFA 3O2DL 1ZK9A 2YA0A 3BKYL 2VR4A 1PAMA 3BKML 4F7TB 3PNWB 4FTVE 1OB1B 2F8XC 3A67L 3UO1H 1Z2KA 4RGOH 3DJ9A 3IFOA 4FRWA 4LLUB 3KPSB 3K4DA 5EU3B 2PW2A 4M6AA 2YEZB 4CN1A 4TUJB 4JZOA 3QRFM 1KJ3L 4HDIA 5HVHC 1SHMA 3CSPA 3BKCL 4QRPD 1NMCB 2VYRE 1MI5A 3PWUB 4ZG1A 3ULVH 2NY0B 2EH7L 1INEL 1DBKH 1WWBX 1HILA 1G7PB 2RCSL 4HG4J 3VW3L 4UINL 2QLVB 4NQDE 4WNQA 2OP4H 3BUYA 3MSPA 4BSJA 1VADB 4JEGB 3BAEH 5A2KH 2CIKA 3TO4C 1A5FL 5GIRB 4ESKA 1OTSD 3UTTE 4UILH 2V5TA 2MWCA 4OJFL 2E5EA 2WV3A 3KYNB 4JY5H 1A6TA 4QF1B 4S1RH 5C8JA 4EXKA 5IW1A 5DEFB 4WJ5A 5FM4A 4ZTOL 3GUTA 4I1NB 1ZGLA 2JB5L 4UOW1 2BY1A 4IIQA 4LHUD 1NAMB 2B1AH 1JI2A 1I1AA 4YDIH 4P2RB 3MRCA 4WV1A 3PWJB 4WHTA 4NSKA 3TH3T 2AXGA 1U2HA 5KVEH 1PEZA 2R4RH 1CD1A 3P9MB 2DQUL 4UQ2A 1XMWA 2W60A 3MLRH 1HHKB 2X4QA 1GSMA 3CUPB 4O2EA 4R0LC 2XQYG 2WZPD 5FYJE 5L2JA 3MV8A 2OSLB 4OI8A 5DFVD 2VLJD 4U1IB 4D8PB 3F6IA 3RVXD 3MROA 4YX2L 5IW3A 4HK0B 5A2LH 3NCBB 5HHQA 2A83B 3FB5B 1JGEA 1UJTA 3SJVB 4Z7WE 2CKBB 2FSEA 3AAZB 3QRGH 3SGKC 3UC0L 1I7UA 1UWEH 4HUNB 1M71B 3BYTA 4TPRH 3RWEB 3BDYL 3HG1B 2DQIL 1A7NH 5D8JH 1OVZA 1A6UL 3U9UB 1YQVH 3IVKA 1JV5B 1FIEA 2XN9E 4EJ1C 5EBLB 3PDDA 3TYFA 4P46B 1MCKA 3RTQB 4YGVA 3DSFH 5J89A 3O81A 5DQDH 3GO1L 3ULUL 4DEPC 5LCVH 2FWOA 4U2YA 3P3YA 3L3IA 1F90L 5E1AB 3BHBB 3T0AA 3GJEB 2HFFA 1UZ8B 3HC3L 5ICZA 3JWDC 1G7LB 2DJSA 3CK0H 4UIMB 4NKIH 5I8EA 1PBYA 3B6SA 1PJ9A 1CYGA 5EC2B 4MAYC 1DBAH 2J8HA 5DFVC 4GAJH 2VDQL 1NC4D 3U48A 1MF2L 1BX2A 3PWPA 4LVOC 1ADQA 1LNUA 1U91B 3QJHB 2AJ3A 4D0DA 3QAZB 3QHTC 5FA3A 3BN9D 3QEQD 5EOCL 3C6LA 4O5LH 1LK3L 3ILPB 4XNQA 3AROA 3T4AA 3HAEA 3V0VA 2FLBT 4CBPA 3IFOB 4N0YH 1B4RA 2VXVH 2E27H 3ZL4L 2AQ1A 1AH1A 2PW2B 4X5LA 5C3TA 4K7PH 3HUJA 1ADQL 3L9RA 4XPFH 1T5XA 1YNLH 2QHRH 4JZOB 1HYSD 1SJVA 4HDIB 1R5WA 2VDPL 2ZOKA 1VFMA 1M7IA 1MI5B 2BSED 4HMEA 3RUGA 5ILTL 1HILB 3R1GL 4WEUD 2NMSA 4PBWD 1UZ6E 4N8CL 3S96A 2JJTC 4ZAKA 4BFIA 2AEQH 4WNQB 2F8VA 3BUYB 5L2KE 2CJUH 1J88A 5T3ZL 1U3HD 4P5TD 5IT2H 2CIKB 3G6DL 4I2XA 3WDJA 3MJ7A 1OGAA 4Y5XC 1KJVB 1A6TB 5C8JB 3GUTB 5IW1B 4WJ5B 2PN5A 1ZGLB 4JFXA 4EIGB 4ODSL 4IIQB 1I1AB 4L9LA 1CF8H 2EDNA 3MRCB 4WV1B 5DVLA 4WHTB 4NSKB 3VG0L 5KSBF 2ZCHH 3B5GA 2AXGB 1ZKAA 1RUMH 5IMMA 1CD1B 1EHLL 2P24A 2W60B 4UQ2B 1KN4L 2X4QB 4XAKE 1BFSA 5DVNA 1IZKA 4O2EB 5D96B 2H2PC 1I9EA 5L2JB 1OT2A 2X40A 3MV8B 2F5BL 2KQMA 5TE4H 5HHXH 4F58L 1UKTA 3MROB 4NQXA 1HHHA 3BDXA 4PJDA 5IR1A 4X9HA 2PYED 1FC2D 2F5AL 5HHQB 1JGEB 2CO7B 4OSUL 1JNHA 1AC6A 2FSEB 1I7UB 4YDLB 4QYOA 5IWLC 3MX0A 3HMWH 4YHML 1CLZL 3BGFC 1KJ2A 4OD1L 3T65A 4M03A 1KB5L 1IEHA 3CIQA 3QI9D 3IVKB 2APXA 1BAFL 3MA9L 1SEBA 2PCPA 5CMAA 3OKDA 4JFEE 3NA9H 3J8F7 3T04D 3ARRA 5GRXG 3TYFB 4HLZH 4WI4A 4YXHL 1P4IH 1FLRL 1KSRA 3QQ3A 4YGVB 2EEAA 4HPOL 2WQ8A 2FWOB 1D5IL 3L3IB 1UEMA 4P9MH 1CGYA 3KHOA 4AG4L 4Y2DC 4XWOD 3GNMH 1DR9A 2HFFB 5ICZB 4FFYH 2A9NH 1C7TA 2AJZA 5ACZA 3HE6C 3QIUD 5I8EB 3TGXA 1KBGL 1PG7W 1XEDA 3B6SB 4PJ8D 3P9WB 2I9TA 3MCLL 1QTYT 1I3GH 1UKSA 3T0EC 4XVUD 3ARPA 2VERN 3PWPB 1BX2B 2R0KL 4MDJA 3FOMA 1LNUB 2HVJA 3V8OA 2X1QA 2AJ3B 4D0DB 3ARUA 4U3CA 5FA3B 3NH7H 4GQ9L 1VACA 1DANU 3A0OA 5TJWK 5CGYC 3C6LB 5F9DC 4JFPA 3S4SA 1JGVH 3S36H 3IJSA 1FHGA 3LZFH 3QR2A 1RK0A 4XNQB 3G6JA 3T4AB 3HAEB 5F8RC 3V0VB 3CLFL 1LEKA 4ELME 2YA2A 1EPFA 5E6ID 1LMKA 1LO5A 1MJ7H 4R90H 4YZFF 5DA4A 4F3FA 3HUJB 3L9RB 5TGBA 3ZDYF 1T5XB 1NCCL 4HKBA 1RZIA 3WL9A 1KEGH 2HKFL 1R5WB 4FQXA 1WF5A 4FXKA 2HA1A 1M7IB 4UT6L 4LCCC 3RUGB 1X5LA 3O8XC 2DKSA 5CZVL 5HHME 1QD0A 3S96B 4ZAKB 3TCXA 4BFIB 1WWWX 4OCWH 4KI5E 4L9DA 4OBRA 4XGZA 2RR3A 2O61A 1JPST 3FQNA 5I1KH 3QIUC 1T03L 2V5SA 4I2XB 4U49A 3WJLA 3NTCL 3MJ7B 4X7EC 1OGAB 2B4CL 1H3PL 2UWEA 4KQ3L 4XVUC 4HKXA 4JFXB 4YUEH 1EK3A 4BUHA 4L9LB 1KPUA 1YECL 4S10A 2D03L 2DQHH 4K55A 1RZKL 2XN9D 1FBIL 4NJAH 2Z8SA 5IMMB 1SMOA 4PP1C 2P24B 2Y72A 5DD5H 2YKLH 2FBJH 2CIIA 2VZ1A 3Q2CA 3S88H 1FV1A 4QOKD 3UBXI 2WUBL 1U36A 2MSPA 1I7TA 1ZLUK 1KCVH 3VFUA 3X3FH 1Z9OA 1GGUA 3S97C 1A7RH 4NQXB 1HHHB 1CQYA 1T7VA 1QSEA 2G9HA 4PJDB 4WW2A 4L8SA 1UGNA 5IR1B 1TJIH 2J6EA 4H88L 4CUCA 1PYWA 1JNHB 3PL6D 3KDMA 3TNMA 5CAYB 4QYOB 5EO1A 3QG6A 4XMLH 1KYOK 4XCYA 2BRQA 4TVPL 1MFEL 3LY6A 1KJ2B 4RGMB 4WHDA 3T65B 4RMVA 4W6XB 1JNNH 3QPXL 5D7JC 1NDGA 3FOLA 2OTUA 5D7IE 2KUTA 1N64L 3UTZA 4EVNA 1SEBB 2PCPB 5CMAB 1LK2A 3OKDB 1JHKH 1W72H 5GS0D 2MPAL 1TCMA 4NDMA 3QQ3B 1E6OL 4IDJH 1TVBA 3B8YA 4L3EE 1EUUA 4DN4L 3LAFA 2R29H 3TCLA 3OXRA 5C6PB 1RJYA 5D1XD 3FQUA 5DQJA 2CMRH 3DWTA 3NIGF 5IGXL 1WAAF 2P7TA 5MHSE 2AJZB 5ACZB 1RIUH 3E6FA 5D2NA 3FO0L 1FN4A 3SE4A 1JTOA 2FGWH 2I9TB 2FX8H 5EULV 4XVSL 3K2UL 4MDJB 4TNWK 4ALAH 3FOMB 5HI3D 1H8OA 2VDKH 2EDHA 5F9AC 2HVJB 5L2KD 2DOCA 3M8OL 4G7YL 3ZYZA 5KTEL 4PS4L 4EI6A 1VACB 1AY1L 3I2CH 4JFPB 3S4SB 4DAGH 3IJSB 3WS6A 1RK0B 3GRWH 4M6NL 4UZGA 3G6JB 1KCSH 1A9BA 3MV7D 1LEKB 4POYA 3SQOL 1LO5B 4F3FB 5GS0C 1A0QL 3NFSL 3BD5A 5C0DA 5TGBB 4XAKD 4HKBB 2NZIA 1RZIB 1SVCP 3WL9B 5HHVH 1NFDA 4FQXB 4FXKB 4JHBA 2KH2B 1L7TL 5J3HD 4KMTL 3MUGA 5D1XC 5DRWA 4GT7A 2ZCLH 3M07A 2ZCKL 2FO4A 4BK5A 4XGZB 2UUDH 5EOCJ 4KJPD 2O61B 3O6KL 3FQNB 4JFFA 5ISZA 3D1MC 3MLYH 3K3QA 1W0VA 2BVTA 2UWEB 3B2VH 1QVOA 4OCLC 5ESQA 5HVFB 5F44A 2W0LA 4HKXB 2VH5H 3V8CA 4JG1L 5FIEA 2F58L 3QEGL 3WD5H 2DJ4A 4OLVL 4F15B 1C5CH 3U9PH 1V7ML 3PXJA 4PREA 1A4JA 1YMHA 4HH9A 3ARZA 4JFED 4MYWB 3HE7D 3ZT6A 2V2WA 3H3BC 1FVEA 2MQ0A 4LSSL 2FR4A 1MREL 4UNTA 2DRUA 1WITA 2CIIB 2NY2D 3MR9A 1FV1B 5E8PA 1I7TB 2Y06L 3VFUB 3SGEI 3E2HB 2FLRT 2G9HB 1QSEB 4FZ8H 4WW2B 4L8SB 2O93L 1I8LC 2NLJA 1ZMYA 1PYWB 2VZSA 5GXBB 8FABA 1A6WH 3KDMB 5D5MF 3FQRA 1GGBL 1JPGA 2IBZY 3ZSTA 3TNMB 1BEYL 5J1TC 4XNXL 4WHYG 3QG6B 1QACA 5EO1B 5JUEL 1G0YR 2W0PA 4XCYB 3AVEA 4KJPC 3WUWA 1NDGB 4ZFGH 1PSKL 3FOLB 3RVVD 2OTUB 2GJ6E 2P5WE 5HD8D 3UTZB 3CVIH 4EVNB 5TH2A 1LK2B 5BRZD 4HW6A 2CXGA 3MO1A 3OF6A 3PWLA 5H2BA 3EHBC 4PJXF 5AYUL 4NDMB 1TVBB 3STLA 3WFCH 1XZ0A 1AE6H 4RX4D 4NN7B 4XPAL 4EOWH 4PLJC 3TCLB 3OXRB 2QL1A 1RJYB 5DQJB 3FQUB 5EZOH 1B2WH 1EUTA 4HGWA 5BS0A 2DQCL 2P7TB 3HE7C 5I30H 4MZ3A 1J1XL 2W91A 5LKNA 2HFTA 5T3XL 3E6FB 3ZZ1A 5D2NB 2G5BA 1I9IL 1FN4B 3D85A 3KLDA 1GC1C 5JW3H 3L7FA 2UYLA 3LMJH 1NH6A 1IGML 1PDKA 1BGXH 5E2VL 2N56A 5E1HB 3KR3H 3HCVA 4KH2A 4EI6B 4BQ8A 5DR5H 1OTUD 4HIEA 5KBNC 5IBTL 1KG0A 4NZJA 3VCLA 2V7NA 5E4EB 2A77L 2LTQB 2RFXA 2R56L 2VZ3A 1A9BB 3OKYA 4F33A 1MCLA 4M48L 4PJFF 3UBXG 2EDYA 3CDGA 5HD8C 5FUCE 4JQVA 4PLNC 4XRCA 4FZEL 1PLGL 4PJBE 5C0DB 3O3AA 5D2LF 3QZWG 2EDBA 1ZGLP 4NQEE 4NQCA 2OLDA 1T20A 3MUGB 4Y4FD 5DRWB 1VERA 2FO4B 4A2LA 4Y1AA 4K8RL 4TUKH 2XZQL 1Q72H 5FYLE 4JFFB 3L1OL 5ISZB 1JWUA 2EC9U 5JDSA 3HZKA 3V4VL 2YK1H 1W0VB 4ZS7L 5MI0B 1AIFA 4OB5H 4Q2ZA 1QVOB 4OLZL 5ESQB 1PFCA 3QJFA 4WWKC 5GGQL 1C8PA 5FO9A 1F58L 2RIKA 4KI5C 4QTIH 4KZDL 3WCYA 5F8QC 1HINH 4ODHH 4G8IA 4HWEH 4PREB 1A4JB 1YMHB 4BJLA 3KPSE 4RFNB 4HH9B 4XNUH 2Q8BL 2V2WB 3ARGA 1FVEB 5IHZA 1T1ZA 4MXWH 1BFOA 2FR4B 3C5JA 4UDTA 1BVKA 2A9MH 3MR9B 1EBAA 1ZEAH 4XP9L 4W4OA 5E8PB 4OLUH 4OKDA 1WZ1H 1K4CA 3LIZH 1DDHA 5CJXC 1KTDA 3IRZA 5MHSD 4FQIL 2EXYD 1FIGH 1GIGH 4OFYD 4JHZA 3FFCD 2NLJB 5CEZD 2GITA 8FABB 5CEXA 3KPRA 2UZIL 3FQRB 1JPGB 3RA7L 4YHIA 5ADOH 1FVCA 2DIAA 3QDHA 4KRNA 4PR5A 2VLLA 2GEEA 3WUWB 2NX5D 5JR1H 4KUZL 4MNGA 1MFCL 5TH2B 2BCKA 3MO1B 1P1ZA 1P84J 1PY4A 1ZHBA 5FV1L 4RAVA 5INCA 3PWLB 1BQSA 3T2QA 5H2BB 3VFMA 3B2UD 3QNYA 2W0FA 5F6IB 3ZYOA 3STLB 2W1NA 1XZ0B 3DTXA 4NZDA 3EJJX 3U7WL 5GGTH 5KVGL 1YEFH 3FRUA 1VGEH 2IGFL 1RMFH 4HGWB 1J1PH 5BS0B 2VQTA 1Q94A 4PRDA 3MOBL 3D5OF 1FYHB 1FL6A 3PXHA 3QCUH 2DBLL 4GOSA 3QHFH 3EYOA 2G5BB 3D85B 1ZVHA 4JRYA 2YD9A 2ADFL 3SJVE 3CX5K 3L7FB 4E0RA 3AB0B 4LGSB 25C8L 2UYLB 4GKOA 4TOYL 3HG1E 2R69H 3D2UA 3U0PA 5FGCB 5DZOA 2UVEA 3OJVC 3V5HA 3HCVB 4NNYA 2YRLA 2D7OA 3IDYB 4GG6A 4HIEB 3OKLA 1KG0B 3VCLB 2C4FT 1JF5A 2V7NB 2QTEA 4NOBA 2VO5A 2RFXB 3MRQA 5GPRA 2ICWI 3NVQA 4OLXL 3ULSA 4QRSA 4F33B 1GH7A 4QRRE 3CDGB 1IGJA 3P0VH 4KKBC 1N5YL 3I6KA 4GW4A 4XX1G 3L6FA 3ZO0A 1G6RL 2BSTA 4XRCB 5FECA 3O3AB 4XZUA 4NQCB 1T20B 2NY6D 1JRHH 4M8VA 1R3KA 4Y88A 5F6HI 4Y1AB 2PR4H 3S3SA 4ACPA 2E6QA 3NCMA 4CVWA 1JWUB 5TPWL 5JDSB 3HZKB 1VCAA 3MRDA 3MLUH 4QEGA 4LLDA 3GK8H 3IB4A 1AIFB 4Q2ZB 5EA0H 1A3LH 3P0YL 3GGWA 4HHAA 3QJFB 4PRHA 1EV2E 2XZZA 3EO9L 2VB5A 3VXME 5FO9B 4G9DB 5JNYA 4NJ9L 1C1EH 4MJIE 2IADA 3U82B 4G8IB 3BPOC 3DXAA 2GJ6D 2P5WD 5DJCA 3WSQL 1T7XA 5JZ7D 4G7VL 3ARGB 4K3HA 5IHZB 1MAML 2Z35A 1S7VA 1T1ZB 4IRSA 1BFOB 1DQML 4FMFA 1FNSH 2Q8AL 3C5JB 5I2IB 4UDTB 1BVKB 5DMGD 1MI5E 4I9WE 4X4XA 3MBXL 3QPQD 1YPZA 4FQ1L 4MX7A 3FONA 1K4CB 4W6WB 5EC1A 5CKGA 3DBXA 3GMRA 4RMSA 4UV7H 3EO1A 1DDHB 1QFWL 4DGYL 1KTDB 4DOHB 1FFNA 1EXUA 1JNLH 1NCWL 3TT3L 1UA6L 2W9DL 4MA7L 2QADC 4FA8A 2GITB 4OFPA 1UC6A 3RX8A 5CEXB 3KPRB 3S7GA 1NPUA 3GJFA 3SDYL 2NY6C 2CDFA 1ZTXH 4HK3J 1FVCB 3VGHA 2LVCA 4PR5B 2V5RA 2VLLB 5GRVK 4HEPG 2Q87A 2YWZA 4TRPL 2IALA 2HYMA 4MNGB 1KXVC 4JRWA 2BCKB 1P1ZB 3MV11 1ZHBB 2VABA 4BFEA 3OX8A 3JUYA 4RAVB 5INCB 2WP3T 4ONOA 4FP8H 2L0DA 3VFMB 3QNYB 5BW7A 2W0FB 5CEZH 3BMVA 5B22A 3FRPA 5KSAD 1NBVL 3DTXB 3SEPA 3DMMA 4BYHA 2APFA 3MV8E 3EOYG 2X2YA 3FRUB 5JZ7C 5HHOA 2UV3A 1Q94B 3LHPL 3W2DL 1U2CA 4PRDB 4ZXBD 4K23L 3J7HA 3ULVF 1AXIB 1FL6B 3WIIH 1YEHL 1LO4H 1OSPL 1YUHA 2OJZL 5F6HJ 2E8ZA 3ZE2E 1MCFA 3EYOB 1UKQA 4JRYB 4DN3L 3ULUE 4EBQL 4E0RB 2A6IA 3LS5H 2XOTA 3E0GA 3V6OA 1FLTX 1F4HA 3D2UB 3U0PB 1MIML 2CLVA 4JB9H 2R0WH 2X42A 5FYLD 2IQAA 1XIWD 3V5HB 4NNYB 4RA3A 4GG6B 3FB6A 2V17L 3OKLB 5BOZG 2BDNL 1Z5LA 4M9OA 5EZIH 3F6LA 2VXSL 3KVQA 3MRQB 3S3PA 3O45A 5GZOD 3T3PE 5FHAH 1S7WA 3KYOA 5F1KC 3ULSB 4QRSB 1K6QL 1HWGB 1AFVH 4H26A 1IGJB 3AM8C 4LEXL 32C2A 4DGVH 3I6KB 4GW4B 3KPSD 3L6FB 4FFVD 1MY7A 2BSTB 4DJMA 5I74B 4CGTA 3BP5A 2IC2A 2GIYA 1P7KA 5FECB 4ONGL 4QXGH 5D71L 3V2AR 1JMXA 5I9QC 1RULL 4XZUB 1QOKA 3DUSA 1QFPA 5F7FA 3S34L 4WCYL 2PXYA 1EGJH 5FUCC 1CGVA 2NY0D 3ZKND 1GL4B 1R3KB 3PWPE 5C71A 1KIRA 2J2ZA 4A6YL 3TVMA 5HYEA 3P40A 1CDUA 2DWDA 3MRDB 1KTRL 1NGYA 1EHNA 1I9JL 2ESVD 4OAWA 5AYQA 5L88L 3GGWB 3MCG1 4H20L 4PV9A 4HHAB 1D3CA 3EDFA 4JFDA 5T5NF 3NACL 3QUKA 4PRHB 3HI1A 1F3DJ 5JXAL 3CVHH 5JNYB 4LSTL 3ROOA 3K2MC 3LKOA 1QSVA 5T3ZE 2IADB 2LAAA 5I1IL 4P2RD 1WBXA 1XIWC 3DXAB 4PJ7A 5DJCB 3CXDH 3TIEA 1DSFL 4EUPH 3U30C 3HUJE 2AI0H 2YMXL 1S7VB 2V6HA 4IRSB 1U0QA 4PJ9D 3SN6N 1ACYL 2BVEA 4KJWD 1H8NA 3QUZC 3F58L 1RZJC 3EYSH 4B50A 4X4XB 5ENWA 1YPZB 3RUGE 3RWCA 3TP4A 4Y5VA 4MX7B 3FONB 5EC1B 3DBXB 3GMRB 4FFVC 3EO1B 1FFNB 1RJCA 3JXAA 1EXUB 4LNRA 1WBZA 4L3CA 3NN8A 4PGJA 2WNGA 4YHYB 4I2XE 3QCVH 3N06B 1Q9WA 3CU7A 3P30L 1OGAE 4JVWA 4LVNB 3SJVD 1NMCC 2I25N 2CDFB 2PTUA 1A9EA 3ZKNC 2IG2H 2DTML 4X6DF 1J0IA 1EO8L 3BW9A 1C5BH 3KHQA 2IALB 5FUOH 1ZGLM 4GO6B 3UJTL 4KKLD 4NM4L 1UM6L 3K81A 1DQJA 2VABB 3OX8B 1L7IH 3KXFA 3DYMA 3GBML 4P46D 1HEZA 4LDLB 4FFZL 1YA5A 3RTQD 3BD4A 3DMMB 1TQCB 3EIFA 1ZANL 4AMKH 3VFGH 4K3DH 5HHOB 2AXJA 4OZFH 4OUUA 4HC1A 4HWUA 4E41A 3KJ6L 3KLHD 5FM8A 1YUHB 1H9VA 4PLKD 2XXMB 1RURL 4CVUA 5C9KA 1EJOL 5B8CA 1TDQA 4JM2A 1CWVA 1JGUH 4HF5H 2A6IB 1MSPA 3NBNA 1MRFL 3TYGL 1OAQL 2CLVB 4ZPTA 2FHBA 2IQAB 5TF0A 4P2YA 5B39A 4YFLI 4JPIA 1QSFA 3FB6B 1Z5LB 1RUAH 4HC1L 5AUMA 4KMLB 5HYIA 5J57B 3O45B 1J8KA 1PG7X 2VXUH 4FQQA 3HNTH 2I5YH 4XXDA 1S7WB 3KYOB 3A6BL 3A6CL 3KYKL 4OM0L 4L8CA 4H26B 2VC2H 3X12A 1UACL 32C2B 4PY7A 2O5YH 3GKWL 1BJ1J 4J6RH 5BMFH 3BP5B 1P7KB 4HS6A 2NY5H 4P46C 4Q6IA 1J9CT 2R39A 4JDZA 3DUSB 4IOFC 3RTQC 1H5BC 3EJYC 1K3IA 1QFWI 5GHWH 1A14L 2HT2D 3O4OB 2R0ZL 2PXYB 1MI5D 1C12A 1QBAA 2IPUG 4I9WD 1S5IL 3TN0A 4ZUTA 3MTRA 4O00A 1AD0A 3MLWH 3S8WA 1A7PL 2VE6A 3R0NA 5H37G 1KIRB 4ZDHA 4PGCB 4F7MA 2NR6D 3TVMB 2ADJA 3VFSA 2BSRA 3DO3A 4X7SH 1CE1H 4KDTA 2DWDB 1NGYB 1KEMH 5HGGS 5HDBE 3SDDA 1CVRA 4OAWB 4WI2A 4PV9B 3WNOA 4JFDB 5I1JL 3UPRA 2HFGH 3QUKB 3HI1B 2EH8H 2OCFD 3L3KA 3G6JE 3ROOB 1X5XA 3LKOB 4HXBH 1L0QA 1I1AD 4E5XA 1WBXB 2WUCL 3VWJA 3OZ9L 4PJ7B 4QO1A 2ID5A 5E4IA 5E8NA 4FNLL 1OP3H 2A74A 4DFIA 3TIEB 4ZD3H 5L0QB 3WO4B 3IJYA 1ZLSH 4C83A 1AGEA 1T66D 4YXLL 1FORH 5D93C 3ISWA <