1JGLL

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig kappa-chain
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglL01
4LVNC 4TNWK 4ZFOL 2XA8H 3WLWD 3GBML 4EI5B 4H26A 1OD9A 3WD5L 1QSVA 3ZKNC 5C0AA 4OZIF 2D03L 1TTFA 3TO2A 3QNYA 4QHNB 3FQTA 4YZFF 3NTCH 5I18L 1FLRH 2V5RA 3IFNL 1H3XA 1RZJL 4F7MA 3OKMB 4KFZC 5J3HD 1EAPA 1MCHA 4ZUUA 1A7NH 3MBEB 5EZOH 5JO5A 1P4BH 1EEUA 1KTLB 1MQKL 1DL7H 1I1CA 4APQB 3L3DA 4Y4FD 5D70L 2XYCA 5ANMB 4IRZL 4ZS7L 5CEYA 1YPZF 1NAKH 3ZYOA 1MWAA 4Z95H 1UYWL 4QRPD 3DUUA 3V6OC 2NXYB 5LGJB 4IJ3B 3TO4D 3TZVC 5IR1A 4LLYB 3RA7L 3KPSB 3PWNB 5A2KH 2IPKA 1JNHB 1J8KA 1FBIH 1Q9KA 2VWEC 3S5LG 1GHFH 3OF6A 1YEJL 4WFFD 4WFEE 5A2IH 1A4JB 1MEXL 2NCMA 3SBWC 1O7VA 3PWPA 1AE6L 2VTFA 1T3FA 3MRLA 5L88L 2OYPA 1I7ZA 2X4SA 2ZCKL 2IANA 5DMIL 2NR6C 2N4IA 1CDHA 4PREA 3IJYA 3K4ZA 1FL6B 5B4MC 3ARQA 3QPXL 3PABB 3QXTA 4XWOC 3ABZA 4J3SA 3VGFA 2IGFH 3VFNA 2H6PB 1FDLH 1WWCA 5GGRB 1PFCA 5GRJL 3U7WL 1KB5L 4YHZL 4R3SA 3U6RB 2HRPL 2X1XR 4LRIA 2IAMC 3G6AA 5IW6A 5KS9B 4LHJB 2DIJA 1ACZA 1CDGA 5DRNA 4QEGA 5DD0L 1IGCL 3SDAA 2D7NA 4ZODA 4HIHA 4QXUH 1MJ7H 1KIRB 2Z8VC 1HIML 3KLAB 4FP8H 4EEEA 4U1JA 2YRLA 5D96C 1KN4H 3GRWL 1R3KB 4YDKH 4X0KA 2VAAA 4DCQB 2YUXA 5EU4B 3LQZA 4LPYA 1MUJA 4KQ3H 4JCMA 2B0SH 3E3QC 4LVOB 5F9JA 3O81A 2WBJD 3A6OA 4KROB 5K9JH 1CTOA 2Y7QA 3G5XB 2F53B 4ACPA 1UM5H 5B21A 2X4TB 1WSST 2HKHL 3S9DB 1QKZL 4OBRA 4BA8A 2J7LA 2COQA 1RURL 4JANB 4OCYH 3BT2H 3F7QA 4LSRL 1T2QL 4CNIA 5HDQH 4PGBB 1SY6A 3E6HB 3S4SA 4QXGL 3ZE0E 3T77B 4ZPTA 2OZ4L 1NC4A 2R2HB 1R0AL 4APQD 3B9VA 1DBAL 2IF7A 3ARBB 4Z7VB 1CD0A 2VYRE 3C5JA 2WP3O 4X7TA 3PDOA 2WQRA 4G8GA 2NXYD 1IRAY 4RZCB 1GC1L 4EVNA 3SGKA 2AKRA 4KI5E 4ZD3H 2HN7A 4KQ4L 4X5WA 1A0QL 3U9PH 3QUZA 2DQHH 1J10A 5I66A 3T2QA 5FHAH 1XIWA 3H3PL 5IROC 1NMAH 4HJJH 1K85A 1I4FB 2ARWA 3QXVA 4IOFD 3Q5YA 3HFML 4TSBL 1WZMA 3BEVA 1QHPA 1KG0A 2C26A 1I9JH 5HYEA 3OJDB 4OFYA 3STZB 3FRPA 4JY4B 4QXWA 1J0IA 3MRMA 2EDJA 4GS7B 5IB2B 4IDJH 4PJCA 3TM6A 4KDTC 4G7VL 1U8OA 2VLJA 4WFHD 2W9DL 1VKXB 4GMSL 1FV1B 4YHNA 5F3HA 3X3FH 1FNGA 4L8BA 5D93B 3RDTC 3VGHA 3HS0A 3TLRA 3RI5K 3KHOA 3EJZD 4MAYC 3BVNB 1DLHB 4UB0H 1EGJH 5T1KB 4RWYL 1OCWL 1QPXA 2J2ZA 4FXKB 2GCYA 4RX4A 3BWAB 4UZGA 1KV3A 4FQXA 2DD8L 1OGAA 4MD5B 1OAQH 2DQIH 5F9DC 1W0YT 1S78D 2ZOLB 2B1AH 4FA8A 2F8VA 2X4RB 4UIKH 2HFGL 5EZLA 4ONFL 3G08A 4CW1A 1I3GH 5IV2B 1JWSA 2BNUA 2DYPA 4PJIE 5DVMA 3QXDA 5DQ9B 2UUDH 1WZKA 2H2PC 3QG6B 3WXVL 2NZ9C 1W8OA 1DVFB 4KROD 4HX1B 3C2AH 2F53D 5MEOB 4RAUB 4FQLL 1CXFA 5E9DA 2ADGB 3GNMH 4G7YH 2XPGB 3QIUA 5FO7B 1D5BA 3FKUS 5F88A 5C0AE 2QQKL 3VFMB 5GJSH 4NQSB 3FFCA 1IKFL 1BQLH 3QFDA 4S1SH 3LEYL 1CFSB 4HWEH 2PXYC 4URTB 3W0WA 1CXHA 5IM7A 1OOAA 4S1DC 4J4PD 1OLLA 3BPNC 5DDHA 3BO8A 3HUJB 4MSWA 4M5YL 3ARBD 3R0NA 4QT5A 5D7IF 4WO4B 1G6RH 1HCFX 2VC2L 4D9LL 4R7NB 3S5LB 4RMUA 1MFAL 3K74B 1K3ZA 2VMFA 1DLFH 1WTLA 5HXMA 1ZV5A 3FO2A 1U92A 4P2RB 3GB7A 5JQHC 3S35L 5I1GH 3BSZH 3PDDA 1KJ3H 3PWPE 4G8EB 2JELH 4X8XA 1U8KA 4YFEA 4GH7B 3MRHA 5DO2C 1JZ6A 1A3LH 1NGZA 5IIEA 2BVOB 4W4OC 4O4YL 1DQTA 4HD9A 4IRSC 2R2CA 2X42A 3WXWL 4PTUB 2GSIA 5F7WC 4LCCC 3SDDD 1JYNA 1EPFA 5T1DH 3BD4A 1WT5A 35C8H 4KV5E 1U6AH 2P49B 5E4IA 2QJDA 1F00I 5SX4H 5E8NB 3PHQA 4NBXB 2Q8AH 4J1UA 3LDBC 1RJCA 2L0DA 1FCCA 4OLZH 4YR6A 3ESVF 4M6NL 3L3IA 5I1CH 3LD8B 3B9AA 3K1DA 3EIFA 1CLZH 3K8KA 4FQCL 3RWIB 3TFKD 2GJZB 1FC2D 1RJLA 1CFTB 3RIAK 3U4EB 1CDIA 3BPLC 4JZJB 1BQHG 4FZ8H 2X2YA 2FGWH 3P4OA 2Z0BA 5FB8B 4YDVB 5AWNL 3S4SG 3DIFB 4JM2D 1B90A 3ARDD 5FDWB 2I5YL 3RWEB 3U2SB 2ZNWA 3U1SL 1KJ2H 1YJDC 2DI7A 1S3KH 3OKEB 4X4XB 3IVKA 2BP3A 1FE8H 2H8PA 5KANG 4LSSL 3O6ML 1QA9B 3DRTA 5CD5C 1G6RB 4K2UH 4WFED 2IH3B 4LSPL 1OPGH 5JUEH 3RVUD 5I0ZA 1FGVH 3O41B 3NFNB 1CXKA 1RJZA 3LN4A 4K3EL 3S36H 5B3JF 4PJFF 1U8QA 4BK4A 1NCCL 2W0KA 1OAUH 2B4CH 2C9AA 2A0LC 4XNQB 1IEBA 1RK0A 2DKUA 4U6YB 2QADC 3MLRH 3GSQB 4HG4K 5IVZA 2CK0H 3OKNA 3FRPG 2AXFB 1UZ8A 3O4LA 4PJ9B 1KIPA 3V6FB 4H20L 4OLVL 3WMSA 1A1NA 1LWRA 2M2DA 1MHHA 2AJ3A 5AAWA 4DUWA 2HFFB 3QFJA 1KACB 1KEGL 1Z9SA 3HG1B 3GBLA 2W65B 1E28B 3IT8D 4OLXL 5J6HA 3ARFA 2VISA 4P0DA 1LEGB 4WO4D 4G8GE 2QEJA 2KBGA 1FNEB 5DQDL 5EPMA 4QYOA 3D25B 3ULVH 1VA9A 2R56H 5EFIA 3KS0J 1HH9B 4FQ1L 1HXMB 3N0PB 1CE6A 4LCYA 1OARH 3WIHA 4G6MH 1MCLA 5IJVB 3BGFB 4AJ0A 4YIQB 2J8UB 3B5GA 3MGTB 3UBXI 3M1BB 3TGXA 7CGTA 4NWTL 4HC1L 3MLZH 3KLHD 1BF8A 4PJCE 3MA9H 2VLJE 2VDPH 2ZCHL 4IBLT 4X99A 3U0TB 4ZOAA 1MIEL 1R5IA 3QO0B 1JYWA 4QWWD 4N0FA 3HI1B 5GIRA 2Q86B 3DPBA 1C12B 3G5VA 4H26B 2J4WL 4X98A 4CU8A 1F90L 5AG9A 4WW2F 2BERA 1RV6X 4JY6A 5I75C 1TJGH 3MLWH 4FQHB 1OGAE 4XHJC 1EAPB 5J06A 1MF2L 3RFZC 3L3DB 3LEVL 1JBJA 2C3VA 3QWQB 4AT6A 5IOPB 1TZGL 5E1HB 3DUUB 1JGLL 4HUVA 3FAXA 3EAKA 3VFSB 4XCNB 5DVNA 2IPKB 2G5BA 3CZJA 4KI5D 1ZT4A 1EEYA 1CWVA 3CSYA 4J3XA 1F4AA 2P8PB 4J6RL 2BHYA 1QSEB 4LKCA 2HLAB 3MRLB 1C5BH 3V7AG 2FEEL 3OV6A 2A77H 3T4YA 1DQLH 3OKDB 3SQBA 2IANB 2CLZB 4PJGA 1H15A 5DI8A 5E9DE 1P5VA 1PG7X 5FEBA 3IJYB 2QQNH 1IAOB 1RULL 1PYWA 1YMHA 5F1SA 32C2A 5L8KB 4I0PC 4OBSA 1Q0XH 2Q3AA 4H1LB 1CU4H 2AJZB 2I07A 3FFCE 4HKJB 5CSBA 5D8JH 4PJ9D 1BLNA 4Y16D 3W0WE 4M6AA 1BZ7A 1FNSH 4XAWL 1JGVL 1U8MB 3CSPA 1TCRA 4YE4H 5F70A 4OD3L 3G6AB 3QCTL 1SVCP 3C08L 3PJSA 1QBAA 2E27H 4OAWB 5TH2A 3DBXA 5F1NB 1C5CL 2W38A 1QRNB 5E2UL 4FZEH 1FFOB 2EYTA 1JWMA 1F58L 4X80H 4KY1L 4I2XA 4WHCA 3O3AB 5F1IA 1DE4B 3K80A 2HVJA 2B20A 5H35B 3SDAB 2EE3A 3EGSA 4JAMA 4YBLB 4HIHB 1G0XA 3FRUA 1RZKH 4P3CH 5E94A 5SWSA 3T0EC 2DJSA 4JDVA 3QCUH 4NKIL 5LQBL 3TWCH 1HQ4A 2ZUYA 4NZTH 3FQUA 4I4WB 5BVJA 1Q9LA 4LOUC 1YY8A 3LQZB 3IFOB 1A7QL 2MSPA 2ILLA 5LVEA 4MZ3A 5F9JB 2ICWB 2WINA 3GMOB 1QLRA 3KXFB 4RFNB 4MDIA 4XXDB 1U8JA 2F54B 2XWJB 4L8SC 4X4ZA 3BAEH 3VRLF 4Q74A 4N0YH 4KUZH 2ED8A 3WV0A 1X5KA 5C0AD 3N50A 3NCCB 5F6HJ 1ZLWH 1WITA 1BQHB 1MAJA 2D3VA 2ZUXA 3LVEA 3VWKA 5LXGL 4LSTL 4NYLB 4PJ5A 4HUWA 4CMHC 1L7IL 4EZMA 5CZVL 2L7JA 3HPLA 5CJOH 2NY3C 4NNYB 1A3QA 3QH3A 3IJHA 4OFVA 1T83C 4KTEH 4X7TB 5IG7A 5CWSA 4A6YA 2BX5A 3GSXB 3D48R 1XEDA 4EVNB 5HYJB 3OJMB 3OF6D 5HGAA 1GJIA 3NBNA 1YEFL 4K8RL 5B8CB 3SKNB 3MRNA 3QWOA 3VMOA 3W39A 5I66B 3I2CL 3KJ4C 4AIXA 2VQUA 1CDCA 1BPVA 2IAND 4PLOB 4X9FA 4AEEA 2ENYA 3BEVB 1NL0H 3BPOC 3L7FB 4ZQKA 3UJJH 4LRNL 5D2NB 3I84A 4N90E 3QULA 4PJCB 1EUUA 4G6KH 1U8OB 2VLJB 2OTUB 3O4LE 4W6YB 1UADC 4O51A 4GSDH 2YPVL 4M6ML 1CLYH 1I3RB 1VADA 4W6XB 3RWGA 2I9TB 4L8BB 2X1QA 3SKMB 4TYUA 3QFJE 2AJUL 3HS0B 4GQ9H 2EC9T 3JUYA 3GUTB 2HJKA 4OLEA 2A6KA 4RMVA 1IL1A 1TZIB 4QF1B 4F2MA 1ZHNA 2CDEB 2GCYB 3IDJA 4XT1C 5EC1B 4K55A 3L6FB 5FOBB 1KB9K 3O3UN 3EYFB 1RJYB 2CKNA 1IM3B 3UTSB 3SDAD 4GG8A 3SDCB 3O6FB 1HHIA 3OAZH 5IBLC 4ODHL 3R8BB 4JFDA 3RWFA 1VENA 4IM8A 5BRZA 3CFBA 1FIGL 2FZ3A 4JRYA 1IGFH 1KPVB 2H32H 5D1QA 3IAPA 4QO1A 4GRLB 4M62H 3C8KB 1QFOA 4Z0BH 1OLZA 3D5OF 1T03L 2E7LC 3EOAB 1PKOA 3MROA 3N85H 2VXUL 4PY7A 3HE7A 5CMAA 1JHKH 4B5EA 2VXTH 5MI0C 3T0VA 3BIKB 5BMFL 3QIBC 5ACZA 4NJAL 4MA1B 3SKOA 4KRPB 5FV1L 3W9EB 3GHEH 5I76A 1D5XB 1Z9LA 2GW5A 2HJLA 5JMOC 3SKUD 3TH3T 2CDFB 5KSUA 1A2YA 5C0GA 3R0MA 4TTGA 2P7TA 5L8JB 1X3DA 1PSKL 5FM8A 1NC4D 3TYGL 3NFSL 2C7UA 4MSWB 4YGAB 3O0RH 1MY5A 2J5LC 3C60C 5D1ZA 4QT5B 4HCRH 3WN5A 1N2RB 4GKSA 3SE4C 5BOZG 3B43A 3FFDB 4X6DB 4X9GA 2Q76A 2D31B 3GB7B 4YC2C 2R4RH 4L4TB 5HYJD 3BEWB 1ZGLP 3ILQD 3T0BA 3QUZD 5IBTL 1U8KB 4K23L 2ZZUT 3A6CH 3I3EA 5GS1C 4HUMB 1NGZB 5IIEB 3DYOA 1YQVL 2JK5A 2X4PB 5I30H 3HZMB 2GSIB 4OFYD 4PRDA 1U3YA 3MRRA 1G9NL 3PL6A 3LN9A 1CR9L 2VLJD 3V6ZA 3SO3C 3PGDA 3ZKMD 2PTTA 1EEZB 3TIEB 2HRLA 2P8LA 5DUPH 1AGFB 3PHQB 5BV7C 5DXWA 5DGQA 4J1UB 3X14B 4HKZA 4V2BA 2YD9A 2CUHA 3BP4A 4N9GB 5HVGB 3U36B 2GJ6B 1S7UA 3L3IB 2EDEA 2VKWA 3V8CA 5DURB 3WS3B 1HH6A 2C1OA 3P3YA 4P59L 4KWUA 2VE6B 4K7PX 4KTDL 4RX4D 2YUZA 1IAII 4I2XE 1KC5H 4XPTL 4FQXD 1RJLB 4TSCH 1S8DA 1X5HA 1E4KC 3L3GB 2EC8A 3UTSD 4ZUTA 3IKCA 3MFGB 3P4OB 3O6FD 5SWSE 3QHTC 5DYOA 3IRPX 4Y5VB 2V5SA 2V7HB 4D0CA 4Y5YC 4DGYL 3BYYA 5EUKB 4HKBA 4HAFA 3G5ZA 2DTML 4ODTH 4OT1H 1A7RL 1UQSA 3SCMB 5KSVB 1MH5A 4MDJA 1Q0YH 2XKUA 4QXTA 1T5WB 4DOHE 4DEPC 2E6PA 3JVGA 2AGJH 5E9DD 1AY1L 3QIUD 3CDFA 5C0DA 4NC1E 5CSZA 1RK0B 2XZZA 4HV8A 2WLZA 4UT6L 4JY5L 1EH9A 1LK2A 2I26N 3QHFH 1UZ8B 2R2EA 3FFCD 1KIPB 2WWKO 2BNRA 2IFFL 1JHLL 4MD0A 3V5KA 1J88A 1ZT7B 4PJ5E 3OL2A 4PJBF 3W0WD 1N6QH 1MHHB 2H26A 4JHZA 4YHOL 2RGSA 2J8OA 3QFJB 1SEQL 1LD9A 1TPXC 4LU5L 2MPAL 3ARFB 4O2FA 1UFUA 1A7OL 5KJRL 1FG9C 4OCRL 5JORB 3PGCA 1K6QH 4QYOB 1Z3GH 1MPAH 5A1AA 4L4TD 2ERJB 4KZEH 2D0HA 1CE6B 2P5EA 5IVNA 5TPWL 1RZGA 4YAQB 1OSZA 3JV6A 3KPMB 1CGTA 4MMZC 5INCB 1PY4A 1AD9B 1P2CA 4JDZB 5JA9A 3O2DH 3LB6C 1P69B 2IH1A 3CH1A 5C2BL 4D0DB 1ZMYA 5IVXA 4QRQB 2D7PA 2XZQH 3IAQA 1T21A 2CLRB 1YYMH 4R7DB 4XP5H 3ULUE 4GBXB 3UPCA 4U05A 2VLLA 4EI6A 4OZIA 1HILA 4WV1C 1G7IA 2D9CA 2O5XH 1KPRB 2QLVB 4JFHE 5GIRB 1JYXA 2R0ZH 1PD6A 5B39B 3UTQA 2M26A 4M1GL 2XWTB 3RP1A 2K9UA 3MRDA 5DURD 4H5SA 1YMMA 3QUMA 1YPZA 3HMXL 2O26U 3VW3H 2EH7H 3VFPA 4PYHA 2GT9B 4HWBH 3JWOL 2ATPA 1JHTB 5C08A 1KEML 2HWZL 1J1OL 2ZKHL 3C9NB 1KBGL 4JFDE 4XCCL 4HG4J 1QBML 4UILL 1JVKA 5EORH 5BRZE 3T8XB 4HIEA 2GHWB 1BJ1J 3MJ7A 2DL9A 3VI4E 4BELD 4JRYE 2D0FA 1MJUL 4U33A 5IHZB 4ZPVA 2G5BB 1D6VL 2I9LA 4IIQA 4XBEL 3T09A 1JZ5A 1QFWL 1ZT4B 1TIUA 1EEYB 4GW5A 3C5ZA 3KPPA 1P1ZA 4JO2L 1LDPL 1KENL 2Y4SA 5LWYL 2PR4L 2NQCA 2Y1VA 4RGNC 4OFIA 3T4YB 1P6AB 4PJGB 1IE5A 4UOJA 1MI5B 2E3VA 2AK4B 5ALCH 2P47B 3ULSA 3IGAA 4QHUA 1FVDA 5E2WL 1W2KT 4RQQA 4N90D 1QLEH 1WCQA 4NNXA 5FFLA 1BLNB 4Z7WA 3PQYB 4U1KB 4ONGH 1RZFL 4UUJB 3B5HA 4Y2OA 3GZKA 1TCRB 3CX2A 3HMWH 5T1LB 5C0RH 4IS6A 3QFJD 4PJEA 2VQ1A 1B0RA 3PJSB 3VI3E 5D2LA 5TH2B 4DKAA 3DBXB 5GSRA 3ARFD 1MLBB 3FO1B 2EYTB 3W81A 3BPCB 4OLYH 5KSAA 4X4YA 3QHZL 1CFBA 3BFOA 3TNNB 3B9KC 3OG4B 5I6XC 3EGSB 2VOTA 2FJFA 2ZJSL 4FNLH 1GOHA 4XI5D 5CBAA 1ZGLM 5E94B 4WHDA 1A7PH 4ODXA 2ZSVA 4P23B 3M17A 4NFCA 4EN3B 4RAHA 3FQUB 1Q9LB 3O8XC 3O6LH 4PB9H 3GSWB 4HDIA 1MREH 1XCTB 5K9QG 3TCLB 3FQRA 3TYFB 5EC2B 2NLJA 4WEUD 2H41A 4P49A 2KQNA 2WINB 3CCHA 3H2WA 5I1JH 2VDOH 2DQCL 5JPMB 1C1EH 3SDXF 5CINH 4LEXH 1FVCB 1I8IA 1NUGA 4MDIB 4KAQL 5GQBA 2K7PA 4JFZL 3BN9C 5F71A 5IB5A 2DQGH 3VXNA 4KVNL 1N64L 4Y19B 5AZEH 4FQQA 4UQ2B 2C1PA 5E6ZA 4LAQL 3HE6C 1VPOH 4JPWL 4OZHA 3WIIL 1SBSH 4ELMB 5IEKA 1ZS8A 4Q6IB 1H5BB 5JZ7D 3RUGE 4NP4H 3B2VL 4M7LH 4YDLB 1C5DA 1HOCA 5IG7B 1WVZA 4I5BA 3U46B 4A6YB 3INUH 5ID0A 4BZ2L 1KXVC 3OAYK 4N5ED 3AC0A 4YBQD 3WE6A 3QWOB 1W0WA 3BIBX 2CQVA 1D7FA 5DTFB 4GXVL 4KZDH 4OUOA 2F74A 2ZCLL 2HYMA 5MEPA 4FFZH 3KYOB 5EOQH 4NZRL 3GEWB 4D9RE 2FWOA 4ZQKB 1IGTA 4I18C 1IZJA 1N6UA 3DRQA 1EX0A 5C6WH 5D7LB 5DF0A 4PJHF 2MHAB 3VXSA 3DMMB 3JWNC 2BNRE 5K9KB 3QDJA 5HHMB 4OGAD 1RIUH 4YNYB 5C6TL 3NIGF 4ZO7A 7FABL 1A3RL 2APTA 3EOBA 4WTWA 2Q6WB 2A6KB 1L4IA 5KVGH 2YN3A 2B2XL 4F2MB 1ZHNB 1BX2A 1AC6A 1GC1C 4OD1H 2DDQL 4CVUA 4DK6A 4KU1A 5ICYA 5I16B 1A7NL 3MFFB 2FR4B 2QL1A 3C09B 4P46A 5FDYA 1CG9B 2IALA 1EJ6A 5C92A 2P5EE 4JFXA 4GG8B 5A3IC 5IFHH 2D7TH 1HHIB 3ALWA 4ETYA 1S9VB 2CIKA 5SWSD 3IDYC 3KVQA 3FL7A 5DK2B 1T0MA 3CFBB 3NACH 3NCEB 2MQ0A 5IMLA 4EIZC 4M7ZC 2Y06H 2I27N 5IVXE 3BJ91 1IKNA 3BX7C 4N8VA 2PF6A 3V0WH 4ZO8A 1ZGLA 2BXYA 1HHJB 1PX4A 3NZ8A 3L3KA 4Y2DB 2FO4A 4L8CB 1GGCL 3HE7B 4OZIE 1AH1A 3LRSA 2E7CA 3I02B 1UH2A 4YZFE 4NQXB 4X7SH 1IGML 3BKYH 4Y89A 3TJEL 1EFXA 4KHTH 3SKOB 1A4KA 3L1OL 4F9PC 4DAGH 4O9HL 5I76B 3FTGA 2IGFL 1YMME 1DSFH 1YPZE 5TE7H 5CCKH 4HF5H 2VRAA 2AEWA 2HT2D 4JGMA 4DVBA 1A2YB 1LEIA 5D7IA 4MJ5B 3VWKD 5HHNA 4Q9QH 1S7VB 1J18A 2QQLH 3IS0X 1VESA 1LEKB 3MRCB 3TBVA 1T7ZA 5C08E 1CT8A 5GGSY 4BKLA 2PYFA 3KAAA 2C7UB 2NY6C 1ADQA 1AGEA 1JNJA 3S88H 4MAUL 1NGWA 5KAQG 1UM4H 4HFWA 5FV2A 4GKSB 2A2QT 5KW9H 2EIEA 1DBJL 1OP3H 1QACA 2GKIA 3AB0C 5I9QC 2FX7L 3AM8C 1HHGA 3I75A 2KL6A 5J6GB 3RVVD 4UDUA 2MTPA 5I8CB 4U6VL 3DSFH 1KCVH 1KB9J 1M6OA 1U42A 1IFHH 4KQ3L 1P4IL 3UTTB 2XTJC 2AJVH 3PL6B 2F9BT 3QAZB 1AP2A 2Y36H 3ULUD 5L9DL 5GZNC 3JV0A 3H42L 3KYAA 1T6WA 4TVPH 1TZHA 3R1GH 2FNBA 3PP3K 4PJEE 3BP4B 3ROLA 4OCYL 4H88H 2N56A 1S7UB 2BSRB 3OHXA 2H9GA 4XNZC 1HHKA 4ZS6C 4BQ8A 5T3XH 2IMMA 1ZLUH 3TBSB 4NN6C 1MCWM 5BZWA 2ATKB 4P9ML 1YZZA 1CIUA 1QFHA 2FECL 1DBMH 4GXUN 3S3JA 4JDTH 3MLXL 1H0DB 2W59A 1OGTA 2X1OA 3UTOA 4NCC1 5IWLC 5E1AB 4HZLA 1S7SA 2A38A 4JFDD 4D0CB 4LLVA 2GFBB 2V6HA 4HKBB 1IM9B 3G5ZB 4S0SD 5CBEA 4JRYD 3QR2A 5I1HL 5D1QD 1WJ3A 4NGHH 1UZ6E 4PJFA 3FB8B 2ZNXA 3B8YA 1F13A 1BFOA 3WFDH 4K3GA 3FJTA 2IG2H 5TDNB 2GUOB 2CMRL 1XGPA 3GJEA 3HE7D 3WL9B 3GM8A 4MQTB 2AABH 3IXAA 4LMQE 2EIZB 1I9JL 2OJEB 3O9WA 1SJHB 4MXQD 2NY5L 1TQBC 5C0DB 4YHKH 5CSZB 4HV8B 3SY0A 1TNNA 2X9YA 2HT4D 4P3WA 2R2EB 4OZHE 4Y4HB 3CZFB 3RI5F 5JLZA 2GTWA 4I0KA 3W11C 1BOYA 1FCGA 2D7MA 3GI9H 1EGJL 1LD9B 1M4KA 4NHUA 5D1ZD 5E7FA 5EU5A 4PD4K 5J1TC 5JDSB 3WUZA 2EO9A 5FHBH 2PTUA 5J1AA 1VEMA 1WBZA 5E6YA 1XF4B 3QNXB 4FQJL 4JQVC 4U1IB 5E5UB 3D69A 4R0LA 1OSZB 5KTEL 4LL9A 3ZKXC 1UACL 1FNAA 3LKPA 4MWFB 4YHMH 4M4RA 4OKVB 2R0LL 1KN2L 5CUSL 2RIKA 3MRGB 4R8WL 3E6FB 1G7QB 3UTTD 3VXSE 3PL6D 3O45B 4ZAKC 5EZJB 4N8VG 5DMGC 1TETH 3QDJE 1IMHC 1CD1A 4WW2A 1UA6L 5F44A 2OP4H 1NAMH 3X3GL 3U4BL 3GNML 1NLDL 2Z4QA 1MCEA 1OT1A 5EBLB 1TMCB 3EO0A 5I8KL 1OWWA 1TQCB 1IAIH 2EZ0C 2FO1A 4OGZA 4PLKD 5CP7A 2GYSA 2CJUL 1XF5B 1YMMB 2HLFD 4XC1H 4S1SL 3N9GH 3MO1A 1QQDA 4L5FL 4PRNA 4HWEL 3J8F7 1MCDA 3MODH 2ATPB 3C87A 3QRFM 2C5DC 3ARXA 4XNXH 4U1SA 1D6EA 5HHVL 1YY9D 2PCPA 3GMMB 2KUTA 3UZEA 1X6NA 5C0CA 4F33A 2XZCL 4HIEB 2D4FA 4S1RL 2YRPA 3MJ7B 1BVLA 3AAZA 1IM9D 3IDMB 4NFBA 4EIGB 5GGRY 2I9LB 2C3XA 2VL5B 3F12A 4LSQH 4GG6F 4EOWL 2G9HB 4HBCH 2H32A 3C5ZB 5GGQL 1GGBH 2F15A 1FL5A 5F72S 3UCRA 3IRZA 1MFBH 2FJGA 3RY6C 3OB0K 1J1PH 4PUBH 1ZT1B 1AGBA 4FMFA 5DJYB 3WFHB 5DJ0B 1YN7B 1UWEH 2BVYA 1WEJH 1EZVY 4OF5A 3GSNB 4RQQB 3UC0H 4XBPA 5GS3A 4TN9A 5D7IE 4NNXB 1DUYA 4Z7WB 3HAEH 2Q8AL 5HPMA 2E7MA 4P4KC 5LKNA 1S9XB 4TUOA 4R97C 2P5WA 1QFUL 1UCBL 4C55A 3KPOA 4PGJA 4PJEB 3WLBA 5I17B 4Z7OF 4Y5XC 5D2LB 4N1EA 3V6OA 3SKJH 1XF1A 5I71C 4QGYA 3TZVA 4P9HH 1NAMB 1MCFA 4C56B 1XGRA 4LIQE 3RIAF 3P4MA 4NN5B 2V17H 3V4PL 3CVHH 3F6IA 4HS8H 4WVRA 3MLVL 3FONA 4FOMA 4X4YB 5DJAA 3SBWA 5DJXA 4HCRA 2R29H 4WHTA 1LO0L 2P5ED 4PGDA 3BDBA 5DT1H 1KELH 2F19L 3OX8B 4MJ6B 4ODXB 3L7EA 4DFHA 3PE9A 2YD2A 4PY8I 1JGEB 2NY2D 5HPOA 1FE8L 4PRPB 4YGVA 5I1LA 4K7FA 1U8PA 5FK9B 5IK3A 3VFGH 1XGUB 3FQRB 5MEQA 1GVIA 1F4WH 3AVEA 5DHVH 2P43B 3EJYD 2R23B 4ZOBA 3CCHB 3QIWC 1XR9B 1CE1H 1EJOL 2IAMA 4P5MA 4OCSL 3DVGA 3O3DB 4P57B 4HFUH 5GHWH 1CLOH 1T1XB 2CK0L 3VXNB 1YMMD 12E8H 4UAOB 1MWAL 2DQEH 3KPQB 2NY0C 3IDXL 2VB5A 3RVXD 4OZHB 3SOBL 2LAAA 4UBDD 2OQJB 5C08D 2XI9A 5C07B 1G9EA 5IGXH 1MELA 2YBRA 1XZ0A 4E41B 3CLFH 4JO3H 1MAMH 4IOSD 5IB3A 3DJ9A 3KGRA 4XPBL 2FBJH 4S0TD 4I5BB 4HIXL 3ULVL 4JKPH 4XNYL 5B3JE 3P9MB 3QISA 3CMOL 5ESVA 4PJFE 2BMKB 1P7KB 2WWMD 3M45A 1YUHB 1RK1A 4OFKA 1FORH 1OARL 3WE6B 2Q7NA 1RD6A 3C5ZD 3WNOA 1W0WB 3NH7H 3MACL 3VXMA 2V5TA 5EO1A 1F3JA 4E42A 4HIIB 2F74B 4PJAB 3HPJB 1NUFA 1E4XI 4ZTPL 1RZ7L 1IGTB 2RB8A 1CICB 3MRIB 4KGJA 2NY4B 1Z5LA 4XX1G 4F9LC 3AS3A 4CMMB 1OP9A 4AIOA 3OGCA 4GAGH 3MV8B 2UYLA 4L9DA 4U2YA 5EBWA 5EH1A 1PKQE 2EYSA 3N06B 1G7MA 3IFPA 1XGYH 4YQXL 1A7BA 3F7YB 3MLWL 3FT2A 2XZAL 1LP9A 3TA3C 5IHUH 2WNGA 3O11A 5KSAD 1MNUH 4K8RC 2HMIC 2EDDA 4JB9H 2FEEI 2IALB 4WNQB 1C16A 3V5DA 2FATH 5IROA 4PIRF 4JRXB 3TH2T 1T0MB 1INQB 5DS8B 3BE1L 2WUBL 4PRPD 4XX1E 5LGKA 3V9FA 4NPYB 1YNKL 4AL8H 4KDTA 2LQRA 3M07A 1ZGLB 5EOCL 4JREB 3U0PA 1NFIB 4R26H 3FN0H 1BGXH 4OB5H 3QA3A 2VQTA 3RDTA 3VRJA 1IC4L 1CF8H 1BWMA 4LP5A 2ADIB 2LTQB 1HQRB 1J05B 1SY6L 4JFOB 5HI3D 1U3HC 2X4NA 3WDIA 3IETA 1Q72L 1JGDA 1PQZA 3WUWG 3MGOA 5D8JL 3WHXB 2DWDA 2QHLA 5DJZA 3WFEL 4XNMB 1TXKA 3TBVB 3RWCA 1CT8B 1FYTE 1IC5L 1SEBA 1WZ1H 5C07D 1SM3L 3CU7A 4CKVX 5C0CE 3VCLA 1S9WB 2OR9H 1HNGA 1NGWB 3CDGA 4HFWB 4X80L 1R5VB 1J5OL 3CPLA 4X6FB 4CL7A 2NNAB 4P5KB 4LKXA 4YK4C 1RZIA 4W6WB 4N0RA 3GBMH 2XWBA 4F8TA 4MQ7A 3H0TA 3WD5H 4P3CL 2HTKC 3IDUA 2YPLA 4O2CA 4YHYB 2D03H 4UDUB 3LQAH 4EJ1C 1A1MA 5I18H 1S7TA 3IFNH 5F1KC 1RZJH 3TPUB 2CRIA 5IW1B 1MQKH 2IJ0C 5D70H 4ZS7H 4IRZH 1JUFA 5ITFA 2JJTC 4RMRA 2Q8BL 5TDPA 1UYWH 3VXSD 3F65A 2PXYA 1O7SA 4QKXB 3VFOA 2FIKA 3RA7H 3RWDB 3DURA 1LO3L 1T7XA 2OCFD 4U1LA 1EO5A 2P5WE 1YYLL 1YEJH 1IGJA 2EDQA 3ROLB 4ZTOL 1MEXH 1RHFA 4HJ0D 3V6OE 4F7PB 5CEXA 2FHBA 4K71C 1BIIA 2H9GB 4KJWC 5L88H 3CUPA 1HHKB 1I85C 2ZCKH 2VWEE 5FO8A 5DMIH 5L7XL 4PV8B 2FEDD 3BXNA 2BHZA 4G9DA 3T1FB 1CIDA 3DI2B 3UXFA 4P46D 5J1SC 3QPXH 2ADFL 3F8UB 5CJOL 4DZBA 4KJYA 4QOKA 1ZK9A 4L3CA 3ARPA 4OM1L 3RZCC 3QNZB 4W4OA 1S7SB 2DQFA 3I3DA 3UPRA 5EU6B 4NJ9L 5GRJH 3U7WH 1KPUB 4IRSA 1L6XA 4NO0A 4U1GC 1MCWW 1KB5H 4X8JA 3UBXA 3CVIL 2DTSA 2HRPH 4LCCA 1G9NC 5EUOF 1SYVB 5C09B 3VFWA 1BFOB 1CGSL 2WMPA 4DKDC 2DM4A 3D0VA 1OB1A 3QI9C 2FYYA 2AP2A 5C0IA 3GJEB 5I8EB 4MS8C 4ZUSA 4ORGB 4DGIL 1IGCH 3T04D 4U2ZA 1EFXD 4GQPH 2WANA 5HVHC 4PJBA 4OGYL 1AO7A 3RKDD 1SMAA 3N1QC 5L2KB 1ZTXL 4Y4KC 3L5WB 5FM5M 3GRWH 4H25B 1TTGA 1CLYL 1UVQA 1XAUA 3TN0B 2PETA 2GTWB 2FSEA 1UWGL 3GDBA 5HHPB 3JBG7 1YEIL 5L2JA 1IQDA 5EU5B 2H3NA 3RJDA 3E3QE 2HKHH 4LHQB 4PRAA 2UWEF 4NFDA 5E2JA 4E0RA 3MLYL 4X6CF 1WTGT 1RURH 5E5RB 4WCYH 1Q1JL 4R0LB 1WCBA 3VXME 1GRWA 1T2QH 2E6JA 3LKPB 2W07A 2QKIB 3CFCL 3VGEA 1ZOXA 4HK3N 4QXGH 4X6EA 3RPIB 1NSNL 4R90L 2JB6B 1AGDA 5BS0A 5KBNC 1DBAH 3S98A 3Q6FA 5MENA 3D87B 3V6BR 4X5XA 1KB5B 3F7VB 3N85L 1U95B 1GGTA 2VXQH 1G9MC 1CD1B 2VXTL 1BZQK 2Z35B 3EUUA 1GC1H 4S10A 1FQ9C 3MMEA 1DEEB 4N1CA 4BFIA 3H9SA 4R9HA 4KQ4H 2BOBA 3LQMA 5E0QA 4KK8C 1RHHB 4G9FE 5FUCC 3P4NA 1FVEA 4YFLI 4QHMB 3H3PH 1LP9E 3FOLA 4ENEC 1QQDB 2X70B 3B8SA 3HFMH 4LBEB 4TSBH 4WUKL 1YNTA 3VE0A 1SYSA 1Y18A 2V2TA 3QEHB 3MV9B 3NAAL 4U1SB 4YFDB 5E4EC 1KULA 4G7VH 2E9WA 5C0CB 3F6LA 3PHOA 2W9DH 1T2XA 4GMSH 5GS0C 2CR6A 3S37H 5HI5C 1JTPA 1T0NB 5DJ6B 3REWA 3QDHA 4DZ8A 2WLYA 3HRZA 4HWZA 1D9KC 4BQBA 4FFWC 5ISZB 4RWYH 3ARGC 4WJ5A 1OCWH 5T1MB 5ADPL 4PD4J 3ZL4L 4KMLB 2CIIA 2KDGA 5D7JB 3PIQB 2NXZB 3UJIL 3GHBL 4AM0A 1AR1C 3MGAA 3O9WD 2VNCA 5ESQB 3WUWB 3QXAB 2VJXA 2MCPL 4KDVA 4N0CD 5B38A 5C0FA 3TO4C 1AHWB 1IAMA 3QUXB 1HYSD 4M00A 4TUOB 5DEGA 5DVKA 4G6FB 4OZFB 2SEBB 2AV1B 4P2OB 4LVHB 4XPAL 3AUVA 3ES6A 3WXVH 2VIRB 4PJDB 4L9LC 3OR6B 3TZVB 4YH6A 2EXWD 3B6SB 3MRQA 3FT3A 4NRXB 5GS2H 1QSFA 4U1NA 5D1XC 3ZT5A 1YN6A 4TSCL 6FABL 4FQLH 4KKCD 4U0QB 5DEFB 1NFDB 5CLTA 1CVRA 5INDA 5F9OL 3L5IA 4WHTB 1BFVL 4RISL 2YPLE 1U8NA 3X12A 2QQKH 3GMRA 1NMCC 4DKFH 5E00B 1IKFH 3LEYH 2BVEA 2D4DA 2OL3A 3BZFA 4RBPH 4S1QL 1Q94A 4I0PA 3RWHA 4YGVB 4K7FB 3EHBC 3NCMA 1KIQA 1TJIL 3SDXA 3D18A 3AXLA 4MQSB 3RQ3A 2VC2H 3EYUL 4R96B 1MFAH 3VJ6B 1CQKA 3DTXA 3S35H 1R3IL 1WBYA 4OI8A 5F96L 2E7HA 1JMZA 2EDNA 3HNSL 4NSKA 2IBZY 4Y7MA 4M8VA 4P3DA 4O4YH 3VGAC 3FO0L 3WXWH 3AU1B 1RI8A 5A16B 3OQ3B 4QOKE 3T0EA 3MV9D 5IVOA 3G6JF 3AREB 3GGWA 2WBJC 1XZ0B 2ZG1A 4V1DA 2WIIA 5C0CD 1AQKL 1UEMA 1E6OL 1VFAB 2FB4L 3SQOL 1Z3GL 4WI3A 5K9OA 1YDPB 1T1WA 2WUCL 4EI5C 2XOTA 4M6NH 5ISZD 4JFPB 5DJ2A 3LKRB 1CL7L 1OAXL 2BSED 4FQCH 4JQIL 3RL1A 1S7XB 1NGQL 3VFTB 4PBXA 1F3JB 1WFUA 3P0GB 3MBEC 1HYRC 2F5AL 5J8OA 4L8SA 3VXQA 2X7LB 4PJBE 3MA7A 4APQC 1AO7E 2XZQL 4LLQB 3ZKND 1YYML 2DL2A 4TRPH 5AWNH 2JB5L 2I5YH 2FX8L 3U1SH 1VSCA 1JNNL 1Z5LB 5GSVA 2NXYC 2ZSWA 4IJ3C 1TDQA 1DCLA 4XP1L 3SPVB 1J8HA 1PX3A 4LSSH 2IMNA 4L3EB 3IDGB 4AMKL 2P5WD 4G6FD 2X1WL 2VH5L 5GGVL 1T83A 3TJHC 3NVQA 4GW4A 4LSPH 2O61A 2A9ML 3L3HB 3TZVD 5EU7C 4RDQF 3FT2B 5GRUL 1QFWI 1LP9B 4K3EH 3DETC 2P46B 4G8IA 4HWBL 4Z78B 1CDYA 1NCCH 3RNKA 4DKEL 3CSBA 2PW2A 5EO0B 2YC1B 4ZFFA 3QPQC 3V5DB 2EDWA 4JVUA 3LKQA 1P7QB 4R2GB 3ZMRA 5I1DB 2NR6D 3K8LA 4H20H 2A74A 4PRHA 2VZSA 1BZ9A 5IT2L 4LEOA 3SO5A 4XWOD 5BS0E 1KIUA 1KEGH 4GT7A 5MENE 5JW4Q 3Q3GB 1XGTA 1L0QA 5EBGA 2O5YL 5DQDH 1F8TL 5HYSA 3VRJB 3VH8A 1U8LA 3H9SE 1ZLWK 5DD5L 4FQ1H 4XWGL 5ALCL 1H3TA 4KXZI 2ADJA 2CKBB 3QQ4A 4D0BA 4U1HA 2DKMA 1JGDB 4LCUA 1QLEL 1PQZB 3JWDL 1U36A 1UB6A 2CSPA 5C0BB 4XZUB 5DUBA 4PJ7B 4J3UA 4BSWB 2R4SL 4A6YL 3OR7B 5B38G 3LEXA 2NTFA 4I8DA 4NWTH 3KPLA 4HC1H 2I60L 1BMGA 1UB5B 1SEBB 3SGEI 4LVOC 1HKLL 3P11L 1T7WA 3HRPA 2ZCHH 4KROC 3HNTL 2YD7A 4M61A 3CDGB 1MIEH 4C59B 3CPLB 3P30L 4LKXB 1RZIB 3DX8A 3CGTA 4F3FA 2E7LA 4FNLL 3S96A 2LFGA 4LCWA 3VFRB 2J4WH 5HBBA 1F90H 1Q9WB 1GCFA 1B9ZA 1BOGB 4OUUB 2WZPD 5C9JA 3VXMD 5HDBF 1EHLL 1WK0A 3QIBA 4LHUA 2NX5A 1A9BB 2OTWB 4J4PC 3MLTA 1RZ8B 1LO5B 5F7FA 1MF2H 3LEVH 4K3JH 4BK5A 2OMBA 1W8NA 3ARBC 5CZXD 5ITFB 1MJJA 1TZGH 2VDLL 5TDPB 3VD5A 1FL3A 1AGCA 4QTIL 1FZKA 1JGLH 3C2SA 3VFOB 4ZNCD 4KKLC 4U1LB 1C1EL 5C6PB 5C3LD 4IMKA 1IGJB 3C60A 5DLML 4G42A 4JO4L 5FKPA 4AQ1B 1U91A 2DQGL 3HAEA 5CEXB 2YHGA 3SE4A 3WS6C 4WGWB 1N59A 4C57C 1BIIB 1ORQB 3CUPB 5FA3B 1A14L 3OAZK 4JFFB 1AQDB 1O0VA 4G9DB 1RULH 5DA0B 3X11A 1JZ2A 4DZBB 5GS1A 1M05A 3GK8L 3CVHA 4GS7C 4Q97A 2BRRL 1P7QD 1JP5A 1P4LB 2NY1C 1GGUA 5FYLD 4TVSa 4I1NB 3INUL 4UDTB 3T4AB 4XAWH 1JGVH 3D85B 4BH7B 3IDIB 3OKOA 4LCCB 4IOIA 3QEQA 5TDOB 4OD3H 3WJLC 3SDXE 3DLQR 3KLSA 3QCTH 3VDCA 2ICCA 3C08H 4WI7A 4Z7UA 1C5CH 1OB1B 1BQSA 1J0HA 2X4UB 4BFGA 5E2UH 1L0XA 2VXSL 3TFKC 4BQ6A 1F58H 1G7LB 5EOTA 2DIBA 3MNWB 4QRSA 4YDJB 3RDTD 3KLDA 3LDBB 4FFZL 3T2OA 15C8L 5DHVA 1CFNA 2P8MA 3L3JA 3MZGB 1KT2A 4TVPE 4HPYH 5ICZA 2IQ9L 5BVPL 3DV4B 4X5LA 1E4KA 1K8DB 4NKIH 5LQBH 4UINL 1SMOA 1D5IL 4BH8B 1UVQB 1OAYH 2BSTA 3QQ9C 4XXCC 3T0EE 3B2UC 4KMTL 1A7QH 1F02I 4ONHA 2DM7A 5DGRA 5L2JB 4Y5YA 3CFEA 4V1DE 4Z5RA 1VGKA 1DVFC 4CN4A 4X7CC 4POZD 5JW3L 1DUZB 4NKQB 4PRAB 4NQDB 4KK9C 2H2PD 5IFHL 1JIBA 2NZ9D 5FM4A 3QZWA 3WEXA 2UZIL 2YPLD 1QPPA 1TLKA 5CD3B 3BRGC 1UXSA 5A40E 3JSSA 3BGAA 1BVKB 1FGNL 4LSTH 2NY5C 4OFPA 3QSKB 1NCWH 4K3DL 4GUPB 3NIGE 5CZVH 3V0WL 5DZLA 5BZDA 5MENB 3MJ9A 3JV4A 4WO4C 4U6HB 4W70A 1B6DA 4S1DD 3GSOB 1B4RA 1J8HE 3MMEB 4BFIB 1A47A 1BWWA 5HYSG 2BOBB 4RAVA 1YEFH 4K8RH 3VH8G 2IPUK 1EO7A 1FVEB 1JL8A 2ITDA 2I25N 5FF6A 4QRRA 1HZHH 3FOLB 4CAGA 2A83A 4XPFL 4MCZB 1T20A 1PBYA 4LSVH 4P5TB 4JFFD 1S9YB 1JF5A 1A5FL 4PYGA 2NYYC 1YNTB 1SYSB 1Y18B 3NFPA 3FAWA 2QV2A 4LRNH 5DO2D 2HG5A 1CDJA 4QOKD 4GG6A 1YA5A 1VHPA 4UOW1 2DQUL 2EO1A 4MA8L 4PTTB 3V5HA 4PRHE 2NW2A 1CDUA 2YPVH 4NO0D 4M6MH 5AD0B 2YZ1A 2AJUH 1ZA3B 5CGTA 3EYOA 4DUVA 5KG9B 3S7GA 3LD8C 4E5XB 3UYRL 1NQBA 1TTUA 1XGQB 4WV1A 3LKNA 1I8LC 1A6TA 2VZUA 3G6DH 4HSQA 1KGCE 2Y5TB 1BBDH 4JZJC 1R3LB 3PNWA 1X5IA 1JPTL 4KKNA 3V2AR 3LS5L 4LHUG 4UNTA 1ORSB 2YD3A 1AO7D 5ITBL 3VFUB 1OL0A 5GGVY 2Y36L 3I6GA 4ODHH 2FECI 4JCLA 4XCEA 5B38B 1FIGH 5JA8B 1F97A 5IB1A 4OSUL 1KLGB 3RL2A 1ETZA 4KI1A 4YPGB 4XB8A 1S5HB 3V52L 1MCKA 1X5AA 4QCIA 3ES6B 5EBMB 1BQUA 2VXUH 3GJFH 2AI0L 3FT3B 3EYQD 1A1OA 1GZPA 1QSFB 3HAEG 5BMFH 1E0OB 4NJAH 3TBTA 4NQDD 5CD5D 3NA9L 3QQ3A 4FXGB 1J0KA 1S7RB 4LCWE 4L4VB 3PV6B 4OLWL 3FZUD 1U8NB 3X12B 1MHCA 1IZKA 4I3SL 2R39A 4LDEB 3HZKB 4ZFOA 2HFEA 1ONQA 4PJ9C 2NX5E 2ZUWA 4JJ5B 1EXUB 3VG0L 1PSKH 1Z2KA 4YO0A 2V2XA 1Q94B 2A0LD 3RWHB 5I1KL 3TYGH 5GXBB 3NFSH 5BS0D 2XG5A 4M9OA 3MREB 2H45A 5B3NA 2IG2L 5MEND 4HH9A 3DI3B 3QUYB 1REIA 2AABL 1L6ZA 4J2XA 4Q2ZB 3DROB 1B88A 1UXWB 3H9SD 5T33L 1WBYB 2W0FA 3V8OA 2N7AA 4WWKC 3NN8B 5KSBF 4NSKB 1WLHA 3BGFC 1YQVH 4P5TD 3B9KA 5EN2A 1LNUA 2YK1L 2B1HL 4HPOL 3MRJA 1TVHA 1G9NH 2APWA 4NUGL 1CR9H 3GGWB 5HY9B 2G75A 2WK2A 2DWEB 4NRZA 1QUNA 1VFBB 3O8XA 2YXMA 3L95A 3P4LA 1ZA6B 1B4JL 3QEQE 3L5XL 1N5AA 3PXJA 3AMLA 3GJFB 3QQNA 1JK8A 1Q38A 4P59H 4Q0XL 3MRBA 3B4NA 4KTDH 4GKNA 3GSNL 4XPTH 1BD2E 2Y9RT 2B4CC 3R06B 3WDJA 1YEEH 1H3GA 2A73A 3V79C 2VZTA 1CN4A 2XKSA 3HI6L 2EE9A 2XTLA 3HE6A 4MD4B 4DUXA 4XHJD 5E70A 3TIDB 2OJZL 1AKJA 2MJWA 1TVDA 2DTMH 1EMTL 5E5MA 1A7RH 2YEZA 3BH9A 2GQHA 5ECJE 4YUEL 3FQXA 3OKLB 4OI9A 4O58H 3KWWA 4MXVF 3ULVC 5SWZB 3GMNA 4G5ZL 1QSFD 1EERB 4UOW0 1FAIL 3BGMA 4NOBA 4KHXL 4FN0A 3RNKB 4PV9A 1AY1H 5DJDA 3ZDYF 1OAKL 3IJSA 4I48A 3LKQB 2O5ZL 4UT6H 4JY5H 1ZSDA 1ZHKA 2IFFH 1JHLH 4PRHB 2V7NA 1NBZA 1BZ9B 4LEOB 3RTQC 3A6BH 4I0PD 4YHOH 4LSQL 4CADB 1RUKL 4O00A 1URLA 1T66D 4HBCL 2DKSA 4NQEB 4Z8FL 4LU5H 2MPAH 1A7OH 1XGTB 3QUYD 2OZ4A 5JR1L 3EDKA 5KJRH 3DUSB 5JOPE 4OCRH 4TTDC 1UJ3B 4OD2B 4WEBH 4UU9B 1IAKA 3T65B 1U8LB 3LKOB 3VH8B 4ZUVA 3ECBB 5FIEA 1KOAA 4TUJA 3U4AA 4YBLC 2XNAA 3WIFA 5TPWH 1UWEL 3QQ4B 4TVPD 5EA0L 3BZEA 4QRRE 4LCUB 5E8OB 3UC0L 1HK6A 5JTWA 1FZOA 4WGVB 5F9WB 1J86A 5DUBB 1MQ8A 3GMPB 3K3QA 3QEUB 3KJ6L 2Y6SC 1CFQB 3OZ9L 2NTFB 4EDWL 5TE4L 2KZ1B 4R4FL 2ZUTA 4DFIA 4GG6E 2YD8A 1K4DA 2Z31C 4KPHL 4P9HL 4V1DD 4L8DA 1PY9A 5B22A 3I6KB 4KDWA 4LOUD 2DLFL 4RFNC 3CFKA 5CKGA 5FO9A 4WDIB 1HEZA 4NC2B 3S96B 4M1GH 1KELL 4JGJA 1F5WA 2HFTA 3HMXH 1NEZB 5KS9F 4LHUB 1CXEA 2K7QA 4QY8A 1XMWA 3MLTB 3RGVB 4F9PA 3MUY1 3JWOH 1QTYT 1KEMH 3ARYA 1J1OH 2ZKHH 3SGJC 3O4OB 1KBGH 3TBYA 1QBMH 4UILH 4Z7OE 2YD6A 1AGCB 1MVUA 4XCYB 5JHDA 2BCKB 2QSVA 3ZT7A 1MJUH 3MRPB 4QHLB 1M1SA 1J8HD 4XBEH 2NY3D 5IMMA 4NN7B 1QFWH 3IXTA 2EXYC 5B8CC 3MNZA 1CLOL 5TQ0L 1U91B 4AIZB 2RFXA 4JO2H 1LDPH 1KENH 5LWYH 2PR4H 2Q20A 4JFEB 5SWZD 5I15L 1FO0A 4JEGB 3MCKA 3AM8A 1RZKC 3X11B 5J9PA 5D2NC 5E2WH 1EDQA 5EUOA 4RGNE 3U48A 2JCCA 1VGEL 2PO6C 2GIYA 2LU4A 3ZKMC 4WW1A 3C6SA 1MJ8H 4PRHD 3GSVB 4MNGA 1RQ5A 1RZFH 4Z77B 4NQVA 1DFBH 1BBJA 4IOIB 4XBGA 2Y07L 1W0VA 3P0VL 4PGEA 4KC3B 2KKQA 4AENA 1W72A 1ZHBB 4Z7UB 1ZVSB 3MOAL 4HXAL 5D5MB 1MFDL 1BJ8A 1U3JA 1LE9A 4KXZH 4OF8A 5EOTB 4QRSB 5E08H 1FN4A 4Z7VF 1M7XA 4LLAA 3QHZH 1PG7L 1YECL 4YHLL 1KGCD 4OZGB 4Y4FB 3L3JB 2FCBA 3SDCC 3O6FC 3OPZL 1OM3H 4X6BA 5ICZB 3DYPA 1N4XL 3F7RA 2AV7A 1ADQL 2XKNB 2VDML 4YEFA 4NKOA 3SGEH 2X10A 1PZ5B 4Z0XB 2BSTB 3EJJX 4GRLC 1F11B 4LIQL 4D3CL 2OM5A 3STLA 5IWLA 5DD1L 5IBLD 5CS7A 1OP3K 4ZNEE 3CFEB 4X6CA 5DMKB 1XF3B 2DS4A 4JPKL 1BVZA 5ACLA 4CVZA 3TBWA 4JFYB 2DQCH 4MA1C 3VMPA 4KRPC 4KAQH 4AEIL 4JFZH 2OK0L 2WQ8A 2BC4A 4LCWD 4N8CL 3UYOD 2OI9B 4LCIL 4J12A 3ZLQC 2RAMA 3F62A 3C6LC 4D8PB 1N64H 4V2CB 2IBBA 3QIBD 4J3WA 4LHUD 2NX5D 4JPWH 1C08A 5I74B 3WIIH 4CN1A 2ESVA 4R4NC 1HHHA 3JTTA 3PDGA 3B2VH 4GLRI 5CIPA 5KANI 4BJLA 4HGMA 4Z76A 4OB5L 5EIIB 4RMWA 5T3ZL 3OXRB 3PWUA 4PGCB 4I3GA 3ZDZF 5F7DB 5CJBA 4XH2B 4BZ2H 1ZLUK 3X13A 4DW2L 4F80A 4B7IA 1EK3A 4AEFA 4ZFZB 1TPXB 3SEPA 2GEEA 3C60D 1X7QA 1OTUC 2BXZA 3IKKA 2OS7A 2IADB 3BUYB 4NKMA 5FF6B 3D39E 4GXVH 4QRRB 4JFED 3HZYB 2ZCLH 5H37G 1B0GB 2E8YA 1H3UA 4NZRH 1PEZA 1K4CA 4KK6D 4NHCH 4U3XA 1JF1A 3K2UL 5IFJA 5C6TH 3P9LB 5IQ9A 4HS3B 3BIAX 4H8WL 4M8QA 1V7NL 7FABH 1A3RH 4G80A 1FLTX 4HKXB 4ERSH 3BP6B 3QO1B 4B7LA 5L0QB 4ZAKA 4L29A 2B2XH 3LQAL 2DDQH 3HUJF 3P0YH 3VD3A 4Z7QE 4S2SA 2AS5M 1T7YA 4U1MA 3AROA 1T04A 2DMCA 3CC5A 2R0WH 3VGBA 3WBDA 3TVMC 1WIOA 4LASH 5SX5K 2FJHB 3OXSA 2A1WL 4Y5VC 2M1KA 3G9AB 2ITCA 1AXSA 4MA3A 3SCMC 4JZNA 5TF0A 2CPCA 5DFVC 3TF7C 4TOYL 1MCIA 4XMLL 4UT9L 4JLRA 3ARTA 3VG9B 3QDMA 1GGCH 2ARJA 4HC1A 3OGOE 3ZE1F 4MX7B 1IGMH 3TJEH 4LF3B 5CILL 3K1KC 3TBTB 3DVNA 1K8IA 3TNMA 4BQ9A 3L1OH 2NW3B 2IEPA 4O9HH 2GJJA 1DBBL 1KCSL 4NO3A 1MHCB 4G8FB 1G84A 3KDMA 4M9PA 4J7RA 3RY6A 1CGVA 4Y8DC 3V0VA 1FG2A 1ZWIB 1IARB 1X5GA 4O2EA 2V2XB 4MNQA 2AEQL 3MYJB 4JM4L 3ARFC 5JHDE 1DANT 1JV5A 4G43A 4MAUH 1VEOA 4P4KA 5JOPD 4PG2C 3P40A 1DBJH 2FX7H 4Y5XA 2ERJC 4PJXB 3SJVA 3PXHA 2Z92B 4XI5C 2HKFL 4JE4B 5JOEA 1A9EA 3FO9B 1WQVT 2ZUQB 4QRRD 3G6JA 4ISVA 4U6VH 1T89C 3LN5B 4HXBH 4XC3H 1HWGB 5FOJA 5EN2B 5I6XB 2CLVA 3NCJH 4ODBD 3O2VL 4TPRL 1P4IH 4UIMA 1TVHB 5EUOE 1WV7T 2JCCE 1E6JL 1K5NB 2Z91B 3DO7B 4GBXC 4JKLA 2CO7B 3LB6D 5L9DH 1K2DA 5H94B 2NTSP 3H42H 4MNGE 4F37K 4OCXH 1NMBL 2LV4A 5HJ3A 2XTJE 1V5JA 2C4FU 1N5AB 3HR5A 1MFEL 8CGTA 4WCYL 4HQQL 1JK8B 1GL4B 3QIWA 4HUXA 5F89A 1D5MB 4UT7L 2B5IB 3DV6A 2RBLA 5FGCE 2EH8L 2P24A 4P9MH 5C0JA 1FJ1A 1NCAL 2FGZA 4JZOA 4XGZB 2RQ8A 3U9UB 1FNLA 3MLXH 1KFAL 4C58B 2A73B 3MJ8B 1TVBA 1KYOJ 3CXHK 1ES0B 4JHWH 2VXQL 2C3GA 4XP9L 3ZT6A 1AKJB 5E5MB 5I1HH 4LNRB 2UWEE 4ZUWA 5CKAA 2J8UF 3MYZA 4X6CE 3U79A 3VA6A 3ZHLA 2CMRH 2XACC 1RUPL 4K7PL 3KWWB 3QEGL 4HGWB 4M6OH 3ZO0A 3D9AL 1WUNT 3FOMB 3BGMB 2VKXA 5JMRA 4WUUA 5D7KE 3RPKA 3GMQA 2NY5H 4NKDA 3SDDB 4JN1H 1GYAA 4IMLA 1HI6A 3HN3A 1ZSDB 3DYMA 3RY5A 3MV7A 1R3HA 3S37L 1RVFL 3RX5A 2ESVE 3WCYA 3FB5A 1H8SA 5HHXL 4GRWE 3GSRB 5HYIA 1MFCL 4FXLA 5CJ8A 4F9LA 3UAJC 3PP4L 4LLMB 4L3AA 4ZFGL 4KGLA 3DGGA 4OGXL 3B3IA 1UC6A 4HS6B 5TFSL 1IAKB 4ZUVB 4FQJH 4GKZB 4OI7A 4JM2B 3ARDB 2NPLX 5KTEH 5CGMA 3TA3A 4FTVA 1UACH 3ZSTA 4P23C 1QLFA 4XVSL 4OIAA 4EN3C 5F21B 3HA0A 2MQCA 1S7WA 2BHUA 4O5LL 2R0LH 1KN2H 5CUSH 1FZMB 2E9JA 2M8XA 3HLAA 5D6CA 4R8WH 3ULVF 1N8ZB 3LKSB 4JN2A 4F7TA 4WI5A 1NCTA 4L8DB 1UA6H 2BVPB 4PJ8C 3X3GH 1QBBA 3U4BH 2X4OA 4U0RB 1NLDH 1HEZB 1R24B 5I8KH 4DKFL 2CJUH 2ED9A 2HT2C 1AD0B 3Q6GL 3DO3A 4ZOEA 4L5FH 4NM8L 2OSLB 3ZZ1A 1I7TB 4Z18A 4Q9RL 5DJ8A 3BN9D 3D0LA 1U3HA 4Q6IC 2EDTA 1H5BC 4AH2A 1NGYA 3JWDC 3MCLL 5HHVH 3RRQA 2LU3A 1QEWA 2X4QA 5J0BA 4M03A 3TBYB 2JJWA 2XZCH 2VUYA 4YDLC 2ZG3A 4S1RH 1MVUB 3HE6D 3W9DB 3CK0L 2AXHA 2APVA 1AKJD 2A6IB 3G5YB 5DC0A 1V7ML 3EYVB 3JXAA 2XN9A 4F58L 3K8MA 5IMMB 5F7UA 4EOWH 3MOQA 3IXTB 3QDME 5F1OB 1KJVA 3VXUA 5TGBA 2FH8A 1ZLVK 5GGQH 3OAUL 4ODWA 5I9QB 3WKML 3TT1L 5FYLL 3MCKB 3NPSB 1N0LA 1DN0A 1CL7I 4UMGA 4ZSOA 1UM6L 4KMQA 5J9PB 1WFTA 2BOCA 1RFDL 2JCCB 4DN3L 3DMMC 3GSUA 1R3JB 2EECA 4BZ1L 3C6SB 4WWID 1BBJB 4OCLC 4F7EA 1QFUH 4M7KL 4MNQE 2GTZB 1UCBH 2JJTA 4XBGB 4X83A 3VU2A 4OQ1A 1WC7B 1EBAA 4AENB 1AFVL 1W72B 4B50A 2CXGA 3FQWB 5BO1L 2BVQB 2CKBL 5FYKL 3ZTJG 3OJVC 1DQJA 4HJGA 1LE9B 2YN5A 3V4PH 3JTSB 1MHEA 3CX5K 1FN4B 3MLVH 4RFOL 5FGCB 5ICXB 2DJUA 3SJVE 4TRPL 1LO0H 1I85A 3MR9A 2F19H 2CR3A 4LLUA 3G6JE 1VCAA 3IYLW 2HJFA 1NLBL 4NN6B 2YD4A 3EFFA 5ADOL 2YXFA 4XMKL 4ONOA 5IQ7L 3RZCA 1CK0L 2WAHA 4RDQG 1KTRL 4MJ2A 5FECA 1LO2L 5GRWA 4Y2DC 2BSSA 2QSQA 2VXVL 2QR0A 4AG4L 4HLZG 4PJCF 3TBWB 1EJOH 3MUGA 1K3IA 4OCSH 1EV2E 3KNBA 1HSAB 1A6VL 2XFXB 3QI9A 1G1CA 4NZDA 1XH3B 4JO1L 2YKLH 4JG1L 3SE3C 2GK0A 1F6AB 2AXGB 2R1XA 4Y16B 5E7BA 1MWAH 1NDGB 3IDXH 2FHCA 3THML 3NCFB 1VACA 3SOBH 1TQBB 1AIFA 4Y4KA 3JTTB 4J8RA 1WBXA 2DBLH 3GMLB 4W68A 4LFHG 4GRWB 2W0PA 4XPBH 4E9LA 5JHDD 2GY5A 4HIXH 3O3EB 4XNYH 1HSBB 3CMOH 1JPGB 2NY6D 4A2MA 4CVXB 3S36X 4Q7DA 3U30B 3MACH 4H1LH 4MHHG 5EU3A 2J88L 1CD8A 3ARWA 4NO2A 5FYJE 5AYUL 3I3BA 4WUUE 3VXTB 5DD6B 4ZTPH 1RZ7H 2AW2A 4NUJB 1INEL 1JPFA 4PJIB 2YA2A 3QAZC 2Z93A 2XXCB 3GIVA 1JF1B 3MV7E 5HI4C 3HB3C 4HK3J 3GKWL 2Y72A 3CDYA 1FZJA 1NBVL 1IC7H 3K4AA 2X1PA 5C0EA 3I9GL 1M7IA 3SE8L 3HC3L 3F5WA 2XTJD 4Y0GA 1JRHL 2WIMA 5GGTA 3S97C 5GZND 3GKZA 4ZDHA 3DHMA 5C0AB 1E4XL 3TO2B 2HLFC 3QNYB 4YQXH 3FQTB 2XZAH 4F7MB 1MCJA 1M71A 4IRJA 4ZUUB 5JO5B 5BW7C 3WJJC 4U1MB 3T3PF 2YMXL 4OIBA 4WI4A 5E03A 4K3JL 5JIHA 3KPRA 5CEYB 4X6DF 1MWAB 4FTVE 4ZS6D 4IDLA 3QUKA 1YJDL 4OIIL 3MLPA 5IR1B 4K7PY 3BE1H 2WUBH 4P4RA 4QRUA 2CUMA 1Q9KB 1L0YA 2A9NL 5JXEC 3B9DA 1YNKH 5J11B 1YEDA 1HCVA 2AK1L 2VABA 3OKKA 3PWPB 2R69L 5J57B 1T3FB 5EOCH 1Y6NR 1I7ZB 2X4SB 4YBHA 3RAJL 1IC4H 2QSTA 5HDBE 2ZPKL 5HGDA 1JFQL 1D9KA 4PREB 4NCC2 3ARGA 1SY6H 3L9RA 1Q72H 3VFNB 2DBJA 1OVZA 3KDMB 3MRKA 5HDLA 4Y4HC 4R3SB 4GLRH 4MQXD 3WFEH 1QR1A 4O2EB 4PS4H 5MERA 2ICEA 3PF2A 4XMPL 5IP4A 1IC5H 4OQTA 5IW6B 1SM3H 3GIZL 4Q58C 5I1IL 1NGXA 3TO4A 5F93C 4G43B 5DRNB 5KSBA 1J5OH 3EDDA 3W11D 2L7UA 1JNLH 4D2NA 5IKCA 2XN9E 5T5NG 1CFVH 4OV5A 4Y5XB 2DI8A 2FL5A 1SJXA 4HPYL 3VXUE 5I71B 5J7CC 2YSSA 3OJ2C 3OWEA 5D1XA 2J6EA 4U1JB 4ISVB 4Y1AA 3SHSA 4X0KB 2VAAB 3C8DA 1OAYL 2DQDL 1KCRL 5BXFA 1MUJB 4ZSOE 2PKDA 5D9SA 3MBXL 2DF3A 4RMTA 1O5DT 1UH4A 1U58A 4YHIA 2Q8BH 4M5ZH 1SBBA 3T2NL 2Y7QB 4EUPA 5D7SL 1EBPA 4OZ4A 1DN2A 4IEFB 4GO6B 1F4XL 1LO3H 3PGFL 3DXAA 1KSRA 1YYLH 4LLWA 2Y23A 5F8QC 5HJ3B 3QJHA 5DSCA 3AS0A 4ZTOH 2UV3A 1TQCC 1VFOA 5DMGD 4ALAL 4MB4A 4CNIB 3DV6B 3BMVA 5L7XH 1CCZA 3S4SB 2H2SD 4JGUA 1NCWL 2P24B 4HUUA 4MXWH 4ZPTB 1MHPL 4JZOB 1NC4B 2EZ0D 1RUQL 4HMEA 2ADFH 1OY3B 4XP4L 5IEHA 2QHRL 5HD8C 5FXCH 4OM1H 3KYMA 3L3OA 2KZWA 3C5JB 1I75A 3PDOB 4NJ9H 5K9QI 2EKSA 4CJ0A 4G8GB 4XRCA 2XRAL 5CFHA 1T7VA 2G5RA 1H3PL 3SDYL 3CVIH 3L5HA 2AKRB 5T5FL 2ZUSA 2HN7B 2WWMC 3BP5A 4X5WB 4ZUWB 2WBJA 3QUZB 3G04A 1CGSH 3PWPD 1JGUL 4MCYA 3QDMD 1ED3A 4PBWD 1XIWB 5DR5L 5FYKU 1HZHL 2X41A 4LSVL 1IQWL 4DGIH 1KG0B 4EI5A 4WUUB 2OL3L 2JF1A 4NKDB 4OGYH 4XTRC 3MRMB 4RBPK 4QHNA 4MA7L 3OMZA 1ZTXH 4LARL 3WFBL 3OKMA 1C8PA 1I9RL 3MBEA 1KXTB 1KTLA 5F3HB 4YHNB 2CDGA 4APQA 1FNGB 5ANMA 4U4BA 2UY6A 3FB5B 1UWGH 4WFGE 3UDWC 1YEIH 5LGJA 4PPTA 4U7MA 4LLYA 1F3DH 3KPSA 3PWNA 1JNHA 4XPGL 3CD4A 4NN5C 4P4KD 4FQXB 4FQIL 1OGAB 3B3IB 2DB8A 4M02A 3G6DL 4HWNA 5IFAL 1A4JA 1BBDL 3UPAA 3MLYH 1F4YL 3SJVD 3ZE2F 3Q1SL 1Q1JH 3Q0HA 2VZOA 3BZ4A 4FABL 5A43C 5EZLB 4CW1B 3G08B 3CFCH 1FL6A 3NIDF 5L6YL 3IFLL 1S7WB 1NSNH 3P73A 1BJMA 1JWSB 2BNUB 4R90H 2DYPB 3HLAB 5ALBL 3QXDB 4PJGF 5TE6L 4DN4L 5I73B 4F7TB 1GGYA 3PHSA 3CXHJ 2OLDA 3U6RA 5BOPA 4HK0A 5IJKC 5CEZE 5IBUG 1G7HA 3S8WA 3ILPA 5M7QA 5E9DB 1UJTA 5KS9A 2AJSL 3QIUB 5SWQA 1D5BB 1DQDL 4U3CA 5F88B 1BM3L 3QIWD 3FFCB 3QFDB 4UAOC 1I9EA 3S3SA 3W0WB 4DVRL 5IM7B 1U2CA 4WUKH 5DDHB 5DJ8B 5FUCE 1I8MA 1KIRA 3BO8B 3KPRE 3KLAA 2VDRL 2F5BL 3NAAH 1NGYB 2OXHA 4BFBD 4NNPL 1R3KA 1AXTL 1DEDA 2NY0D 4J3TA 4G8GD 3RVWD 1UCTA 3VGGA 2HT3C 4KKAC 3NZHL 3FO2B 1U92B 5DHYA 2XN9B 3JUZA 4DQOL 1ND0A 4JPVL 4P9HC 3MRHB 1KJVB 3DECA 5ADPH 1J0JA 2D7OA 1XIWD 2X4TA 3TCXA 3ZL4H 4OCNC 5DD3L 4B41A 1I1FA 4G6AC 4YK4B 4ODWB 2F58H 4QRTA 3UJIH 3GHBH 5FYJD 4JANA 4WUUD 3ESUF 1GOFA 2MCPH 1CICC 2NY4C 4PGBA 3E6HA 4J4PA 5CZKA 3EYSL 3T77A 1Y0LA 3MV7D 3EOYG 4FFVC 3ARBA 4EUPG 4LFHD 4PFEA 2XQBL 4YR6B 1N26A 4XPAH 3QXUA 4ELMF 3N1PC 1J1XL 4LSUL 5KSBE 5D71H 3IDNA 6FABH 1OGAD 2FEDC 3ROOA 4LNVA 1YEEL 5F9OH 5LBSL 3WS6A 1BFVH 4RISH 1RPQA 1RY7B 4K71B 4QHKI 3RUGA 3T08A 5E99L 3K4DA 3MR9B 3BD5A 3TA3D 4XPHL 1G7PA 4Y1AE 5IUSA 3IVKB 4WTZA 3OJDA 3STZA 2HMID 2H8PB 4S1QH 4JY4A 1MCBA 1KCUH 3LHPL 5FUOL 2DYPD 5IB2A 3DRTB 1TJIH 4D94A 3LOWA 4BSVA 4EDXA 1VKXA 1FV1A 4O58L 3EYUH 4KKBC 4LMQI 1RJZB 3LN4B 3DXAE 1U8QB 2VL4A 3C8HA 3WJLA 1R3IH 2LTQC 3BVNA 1DLHA 5T1KA 3KNBB 5D6DC 4LPTA 1IEBB 4FXKA 2JLLA 5F96H 5SV4A 1RUML 5IVZB 2P1YA 3BWAA 3HNSH 2YA1A 3OKNB 1MOEA 3O4LB 2R1XB 5KVDH 1X5FA 4MD5A 1A1NB 3FO0H 2AJ3B 1FC1A 1VACB 3A6BL 2ZOLA 1U3HD 3HR6A 2G2RA 1WBXB 5J6HB 5JNYA 2VISB 1QRKA 3KR3L 1AQKH 3WO3B 1E6OH 5IV2A 4RGOL 2J8HA 4MXVE 5EPMB 2FB4H 4WEBL 4XXCA 3WSQL 3SQOH 3BD3A 2DMBA 5EFIB 1L7TL 4EXPX 4W4NA 1OHQA 5DQ9A 2XN9D 2Z9TA 2WUCH 4JFQA 4LPXA 4LCYB 25C8L 3ZDYE 1DVFA 4X7FC 3WNMA 4TQEL 3VXUD 4YHYC 4K94L 3RBGA 1CL7H 1OAXH 4JQIH 5F7NC 5MEOA 4RAUA 1NGQH 1MRDL 3MXWL 2XPGA 3CX5J 2F5AH 5FCUL 3VFMA 2JB5H 1WWAX 2FX8H 1UKSA 1JNNH 1CFSA 3CXDL 4X99B 4KJQC 2CRZA 1HDMA 1R5IB 4YX2H 4XP1H 5ANME 3HUJA 4N0FB 4AZ8A 5BV7L 1GXEA 5TQ2L 4AMKH 1VEPA 3F5WB 3G5VB 5C1MB 4LQ1A 2VH5H 5GGVH 1SHMA 4X98B 3H9YA 4OTXL 2CH8A 1A6PA 2A9MH 4JY6B 3KPSE 4AYFA 5GRUH 4P2RA 1M71B 1EGJA 4IRJB 5J89A 3ET9F 3M8OL 4G8EA 4DKEH 4HMCA 5EU7E 2C3VB 3MOBH 4AT6B 4KJWD 3PWJA 2DJ4A 5FUZL 1S5IL 5DK0A 3QUKB 3AY4C 4HUVB 4PTUA 1QFPA 43C9A 2MKLC 4P4RB 5IT2H 4QRUB 2VLRA 4KTYA 5E4EB 3RZCD 3CSYB 3OKKB 2VABB 4LKCB 1A6WL 1P6FA 8FABA 4HT1L 5E8NA 5A2LH 2O5YH 4X4MA 4H8WC 4F8QA 1F8TH 1H15B 5DI8B 5HGDB 1WIPA 3QBTB 5KS9E 5DD5H 4XWGH 2PW1A 5H8DA 3D3VA 1PYWB 1YMHB 32C2B 3ARGB 3L9RB 3LQAC 2GJZA 3IU4L 1RZJC 2D0GA 1I8LA 2I07B 4ZXBC 3JWDH 4N0CC 3J7HA 4MS8D 3O4LD 5MP6L 3MJ9L 1BZ7B 1MJ8L 4JZJA 4N5UA 1I1AA 2FLBT 1DFBL 2R4SH 4A6YH 5FB8A 4YDVA 3TN0C 3B5TA 1DBKL 5FDWA 2ICEB 2I60H 3RWEA 3U2SA 4Y4KD 3RY4A 3ZDXF 1HKLH 3P11H 4WFGD 1RMFL 3FT4A 3OKEA 4X4XA 2P44B 3HNTH 3I50L 4Z7NF 1JWMB 2DM2A 4U7SA 5E08L 4I2XB 1T2JA 1SVZA 3P30H 5F1IB 4YDIL 5IKCB 4AEHH 1G6RA 2HVJB 2IH3A 3ELAT 4OV5B 4JAMB 2FL5B 2X89A 3FRUB 4PLJD 1OM3L 2F53E 1MCNA 1IBGL 1RUAL 5SWSB 3NFNA 1L9MA 2YSSB 4EBQL 4JDVB 3Q2CA 1EHLH 4NBZB 3ULUH 1HQ4B 5BVJB 3WO4C 2XIDA 1YY8B 4XNQA 5BXFB 4U6YA 4P2YA 4WTZG 2LVCA 2AXFA 5HVFB 4BSJA 3V6FA 4GRMA 2VDLH 3HNVL 4QTIH 4DOHB 4EUPB 4NCDA 3BYTA 4OZ4B 4JRWA 5DWUL 4CU6A 1QLRB 5JXAL 5CEZD 3HG1A 4Z7VE 6CGTA 1E28A 1U8JB 2ZUVA 4I77L 5DLMH 1LEGA 4JO4H 5C0NC 1NDMA 2CO6B 1FNEA 1OW0C 1KCLA 4MVBC 3P77A 1HH9A 1A14H 1EHAA 3VWKB 4IRJD 4PJ5B 4HUWB 2AJYL 4KK8D 4WWKA 2LU7A 3HPLB 2LVEA 1QBLL 3KPRD 3GK8H 2BRRH 4ENED 3QH3B 4YIQA 2J8UA 3HHRB 3IJHB 4KUCD 5F7HA 1JPST 1J9CT 3MGTA 5CWSB 2X44D 3VGAB 4YLQT 3M1BA 5C7XH 3GJFK 1Y6MR 1ACYL 1KJ2A 2DQTL 5HGAB 5HDOA 3BP5B 3REVA 3MRNB 3UEZA 3W39B 4MCYB 4JKMA 2VXSH 3QO0A 2VDNL 4FG6C 2BJML 5GS0D 5HI5D 4CBPA 5JDJA 3HI1A 2Q86A 1C12A 5D7JC 4JHAL 2NXZC 3QRGH 15C8H 1D9KD 2OBGA 4KK5C 3VRIA 4FFWD 3TPKA 3ARGD 4LK4A 2HTLC 4NHCL 3QULB 4FQHA 2IQ9H 1EA9C 5BVPH 3UMTA 4O51B 4UINH 1AHWC 1D5IH 1TJHL 1ZE3C 1VADB 1AR1D 2CDGB 3QUXC 3RWGB 3ZDZE 1P9MC 3EZ8A 4MGXA 1YC7A 3B83A 5IOPA 5GZOC 4KMTH 2UZYB 4ERSL 2HJKB 4P2OC 4LVHC 2Q1EA 3B9EA 1QR4A 1IL1B 3A67L 3VFSA 5BQ7A 3P0YL 4XCNA 3IDJB 1N5YL 5K59F 4LGSB 5JW3H 4L4JA 1GPOL 2P8PA 2R0WL 1QSEA 3FB6A 3GI8H 2HLAA 4LASL 2W9EL 2UZIH 4FQPA 4JFDB 3RWFB 3OKDA 2CLZA 5D1XD 3T3MF 3BZ4B 5BRZB 2N1KA 3E8UL 1FGNH 4Y1AD 2FZ3B 1IAOA 4JRYB 5D1QB 4M3KB 3P73B 4K3DH 5DMJB 4H1LA 2EEDA 2AJZA 4HKJA 3MROB 5CMAB 4PY7B 1J11A 1U8MA 3RTQA 2MMXA 4HK0B 3HUJE 3VDBA 3D1MC 1G7HB 3EHBD 3DXAD 2AJXL 3ILPB 5ACZB 4OAWA 5F1NA 5SWQB 3EDJA 4HUNB 1QRNA 4Z7WF 2HJLB 1FFOA 5E56A 5HGHA 1CBVH 5KSUB 4P2RE 5C0GB 3O3AA 4PJEF 4XPFH 3UTPE 2FHFA 5KAQF 2P7TB 1DE4A 5H35A 5D2LF 2B7DT 1QVOA 4PJ5D 4CVWA 1A5FH 1I8MB 1OSPL 3AREC 5D1ZB 1TCMA 2DQUH 4MA8H 3WN5B 4I4WA 1F42A 1NCDL 1A02N 1ITCA 3IFOA 2Q76B 5DHYB 2VLRE 4HULB 3ZE1E 3VXPA 2Z31A 1ND0B 2ICWA 3GMOA 3GFUA 2DLEA 3UYRH 4X4ME 4M1DL 1B3JA 3KXFA 4EXKA 1UZ6F 4HXBL 1I1FB 4XC3L 2JK5B 3RBSA 4ZMAT 4XXDA 1GIGL 3SE9L 2EE2A 3D3VE 3NCJL 4QRTB 2F54A 2XWJA 4GXUM 4EI5D 1JPTH 4PRDB 3LS5H 5HGGS 1X4YA 3V4UL 3MRRB 5ITBH 5CZXC 3RNQA 1BQHA 1FNHA 5DRXA 4F37F 3V6ZB 4NYLA 3PGDB 2PTTB 3MBED 2P8LB 4OCXL 1Y0LB 4OSUH 4HKZB 4WI8A 3SGJA 4JFHD 2PTVA 2VDKL 4NNYA 1LHZA 3U7YL 3V52H 4OZHF 1HH6B 2C1OB 1I3UA 2DN7A 2AQ3A 3GSXA 2AI0H 3KPSD 4HZAA 3IDNB 5HYJA 1S8DB 4XNUH 4XVTH 4RRPA 3ROOB 1DR9A 3LPGA 5FGSA 4ZUTB 5B8CA 3SKNA 4HW6A 3WFCL 3NA9H 3TJHD 1MAKA 3IKCB 2VLME 4OLWH 3NGBB 4OKDA 3RUGB 4R2GC 5DYOB 4I3SH 1CYGA 3DETD 4JHWL 3FQNA 4PP1C 4OLUL 1G7PB 5BRZD 3CFDA 3L7FA 3VG0H 4BQCA 1UQSB 2BDNL 3QPQD 5D2NA 5I1KH 1C7TA 2OTPA 1MH5B 2PO6A 2NY1B 2OTUA 4MDJB 1RU9L 1X6LA 4BSVB 4PJAF 3V7MA 4QXTB 4EDXB 5IESL 3EOTL 1UH3A 1HXYA 1I3RA 4OCWL 2I9TA 3QCVL 3SKMA 3QUMH 2FDBP 4M6OL 3GUTA 3HG1E 1I1YA 4KJPC 1KLFA 5T33H 1TZIA 4JN1L 4QF1A 2CDEA 5EC1A 3L6FA 5FOBA 1LK2B 4UV4H 4PY8J 3EYFA 1RJYA 1IM3A 2BNRB 4MD0B 3UTSA 3V5KB 2VITA 2VSDA 5SX5H 3WNLA 2H26B 2R2BA 3O6FA 4M93B 3SDCA 2YK1H 2FRGP 2B1HH 4HPOH 4WU5A 4NUGH 2G2RB 4YPJA 2J8UE 2MOVA 5CJXC 5JNYB 1PKQA 4O2FB 4P48A 1GGIL 43CAA 1KPVA 3PGCB 4TSAL 4POZC 4GRLA 2IPTH 3BH8A 1AJ7L 3C8KA 4JKWA 1MCSA 1B4JH 2BFVL 3L5XH 1FO0L 4GAJH 2P5EB 4JFQB 2RHEA 4RGMB 3EOAA 2CRYA 4M7JH 1RZGB 2OR8A 3JV6B 3EZJB 4ODSL 4Q0XH 1P2CB 3VD4A 5JHLL 3BIKA 2NY2B 3GSNH 4MJIA 4N0UA 2IH1B 3CH1B 3W9EA 3OKYA 5DFWH 3NCYS 1NPUA 4OJFL 1D5XA 5IVXB 4WRLA 3NABL 1T21B 2CDFA 3C6LA 4JVWA 4LPVA 3HI6H 4H1LG 1W72L 2VLLB 4EI6B 3HC4L 4CJ1A 4OZIB 1HILB 2OJZH 1HDMB 2YWYA 1ZLSL 1EHXA 1G7IB 1EMTH 1KNOA 4YUEH 3UTQB 1N2RA 1D5ZA 3MRDB 3H7LA 4H5SB 3QUMB 5IF0A 5ABDE 4G3YL 1YPZB 4KKLD 3FFDA 1ERNA 1EAJA 3UROR 4X6DA 4G5ZH 5CHNA 2D31A 3VFPB 1FAIH 4L4TA 5CGYC 3BEWA 4RIRA 1OTSC 4KHXH 5ILTL 1QSEE 5C08B 1FYTA 3ARUA 1OAKH 3ULVE 3BW9A 2APBA 3PWJB 2O5ZH 2IANE 1MRFL 1CQYA 3OBAA 5DK0B 4MYWB 4XCFL 2PUQT 2IBGA 2X4PA 2BNQA 1EO8L 3HZMA 43C9B 4ZPVB 3CAFA 3VWJC 4IIQB 1RUKH 2VLRB 3KYKL 2NY1D 4GW5B 4Z8FH 3KPPB 3ZTNL 1EEZA 1P1ZB 1Z6JT 3TIEA 8FABB 5JR1H 1AGFA 1NKRA 3CNKA 3X14A 4N9GA 2V5MA 1LE5A 5CP3H 2H1PL 2PW1B 3U36A 2GJ6A 3D3VB 3ULSB 1QRNE 3IGAB 4QHUB 5T1KD 4D9RD 1FVDB 3WS3A 4I13B 2VE6A 5C2UB 5EA0H 2ZG2A 3BDYL 3L3GA 2GITA 2BNRD 4R4BA 3RU8L 1I1AB 3KJ6H 4ORZC 3OZ9H 3TVMA 4IS6B 4EDWH 5TE4H 2VQ1B 4HH8A 4R4FH 4Y5VA 1B0RB 5F7YC 2V7HA 5GSRB 2AQ2A 2YOCA 3FT4B 4KPHH 5EUKA 4CRPA 1S9KC 3EYQC 3FMGL 1YEHL 2DLFH 3SCMA 3QQ9D 4M48L 5K93A 3B2UD 5KSAB 5KSVA 1J0YA 2DLIA 2FJFB 1T5WA 4ELKA 3FZUC 4RRPG 1DVFD 2ZUUA 5CBAB 2ZSVB 3KXFE 3M17B 3T0XA 2DM3A 1GAFH 2F54E 4KK9D 4FS0A 1TENA 4HDIB 5ESAA 3MZTA 1DJSA 2NLJB 4GRMB 1ZT7A 5D72L 2L4OA 1OT2A 4LVEA 4BUHA 5E2TL 3RIFK 3H9ZA 1MCOL 1N7ML 1I8IB 5IB5B 1NDMB 5TQ0H 2YKLL 5JORA 4PG2A 3O3BA 4FQQB 3P77B 5I15H 4YXHH 5HYJE 1UG9A 4P2RD 2C1PB 4P5TC 3UTPD 1M7DA 4KVCH 5IEKB 4NM4L 1ZS8B 4YAQA 1NCBL 3KPMA 4WWKB 5M94B 3TT3L 4OM0L 2DBLL 5INCA 1AD9A 1FH5L 4JDZA 5FA4A 5TF1L 1VGEH 1ZEAH 1T89A 1C5DB 1HOCB 3QDAA 4ZO9A 1IT9L 4D0DA 2NYYD 4QRQA 5ID0B 5D2NE 2CLRA 4R7DA 1KJ2B 2Y07H 2VLRD 1MCPL 1P7HL 3REVB 3P0VH 4GBXA 4XVUC 3MOAH 4HXAH 1MFDH 1KPRA 1JRHI 1BF2A 4DGVL 4CGTA 1CGYA