1JGUL

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
220
structure length
220
Chain Sequence
EVVMTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jguL01
1YPZA 2AGJL 1J05A 3ARDD 4KZDH 4EN3A 3DOSA 3MROB 2AKRA 5GRJH 1LE9A 3VDCA 1T80A 4OLXL 3SDAD 1K8DA 4C58B 5ACLA 5IFJA 4UU9B 4FQQB 3QWRD 3DTXB 3LS4H 1P4LB 1NGXA 3OB8A 2ERJC 3P3YA 5ID0B 4ZSOB 5M95B 3MPCA 4PJ5A 5C08E 3MFGB 4JM2C 3VFSB 1NC2A 5DK2B 3FFDA 3VG0L 1YDPA 3LSOB 5FYKD 4LSDA 2DDQL 4LLUB 3PL6C 5SWZD 2QJDA 1X7QA 4PRIB 1JHTB 4KKAD 1MCPH 1Q9LB 5D7JA 4O2CB 3PE9A 5GGTH 3DVNB 1H5BB 3VE0B 5IESH 4JFDA 4S0TD 2Z31D 3DGGA 3T0VA 3MUHL 1D9KA 5IROA 4QT5A 1S3KL 3I85A 4Y4FC 4K07A 4PJ7F 2M8XA 1BQLH 4L3EE 2AJ3B 1MFDH 5LGHH 1BQSA 1MFEH 1W72B 4Z0BL 2YD3A 2GTWA 2NPLX 3U4BL 3PWVB 2OJEA 4M7KL 5C7XH 3GI9H 3FO2A 5CD3B 2X70B 1EO5A 3H9SB 5ADPH 1A7QH 1J1XH 2V2XB 4UILL 4POUB 3AU1A 3U2SA 4UZGA 5C0FB 4XP9H 2Z9TA 4R90L 5JHDA 3BKCL 3V5DA 4QO1A 3T0EA 4NKIL 4G80A 4MJ5B 4J4PD 3VFPB 3BMWA 5K33A 3VXSA 1I7RA 4RWYL 5IMOB 3TO2A 5GISH 3OAYK 4C56E 1NBVL 1KNOB 4WHYG 4ZFGL 4XAKD 3V7AG 2L7UA 5CINH 1NBZA 5IR1B 3FAXA 3QAZB 1P4BL 3JZ7A 2E7BA 2UWEF 4HG4J 5DD6B 2OYPA 1NGYB 4JO3H 1YQ2A 3CH1A 4LLVB 3S3JA 5H2BB 4KVNL 1W8NA 3WNOA 3QQ4A 1FH5H 2CIKA 4LCCA 2X10A 3RKDC 2P7TA 3FAWA 2R8SL 4PJDA 4WTZA 1T20B 4Z7UB 2PKDA 3BYYA 4PG2C 4XNZC 2XXCB 2BCKB 2Q3AA 1U8OA 4R0LC 1IM9A 1H3TA 3LQMA 3HLAA 2NY4D 5E2VL 5ESQA 5CJQH 1QLRB 2R56L 4WJ5A 3GI8L 4XHQA 1KG0B 1HDMB 3T2NL 4PB9L 5T1DH 1ZSDA 3D0LA 3MLXH 4LHJB 4NWTH 1HHIA 4WDIA 3ZLQC 1IC4H 4YX2L 3SE4C 2QEJA 4Z7WE 4JAMB 2Z8VC 4NQCA 5HGDA 1KCVH 2VXSH 1AI1L 4QOKB 1ZGLB 1FNGA 4AH2A 3U83A 2XWTB 1FFOA 2JCCE 2C9AA 5IJVB 1G6VK 4U6XB 3C09B 3VFGH 4PJFF 4FQCH 4Z9KB 2AJXH 5D2LF 4OBRA 1GC1H 3FOLA 5FCSH 3TCLB 5B39B 4DK6A 3EOTL 4ODHL 3B9KB 1MAMH 3R4DA 1N7ML 1DR9A 3AC0A 3Q5TA 3W11C 3G5XA 3MOQA 5CCKL 4S1SH 5KG9A 3O2DA 4P46D 4WGVB 5IVXE 5GS0H 1A1NB 4WWKB 5F88B 4DGYH 4OAWB 3IFOB 4HMCA 4PJIE 3OR6A 2L0DA 4Y16C 1OP3H 2NTFB 5EC2B 1Q9KB 5DJXA 2UUDK 2UY6A 4JQVA 4LL9A 3JTSB 5DVOA 3ARBC 3K74B 2ICEB 1GAFL 4X0KA 2F53E 2I60L 4UMGA 2BY3A 3HTLX 3U9PL 3KPLB 1C08A 4PGDB 2CJUL 1J88A 4PJ7A 4GSDH 2E9BA 4GRLA 5H35A 2AK4A 3IFPB 1CZ8L 3MRCB 5H37H 4ODWA 1S9KC 1CGSH 3CC5A 4QRTB 4NN7C 4TQEH 2GQHA 5DJYA 4F9LC 1IT9L 3PWUA 1VPOH 2Y6SC 4HLJA 1EERB 3IJSA 3FJTA 1B6DA 5AZ2L 3TYGL 1XR8B 3KJ4C 2HG5B 1GZPB 3T65A 2XTJD 4ZNEA 3S37L 4TNVK 2YKLH 2EDEA 3PP3K 3LKPA 1NSNH 5BMFH 2NXZD 1U9KA 2VDPH 1ZE3C 5IB1B 3CFKA 1LDPH 3QI9B 4XXDB 2AEIT 1A7OH 5HD8C 1LHZA 3WHXB 1NGQL 1MCSA 3A6OA 3MGOB 3QXAB 2V7NA 3MSPA 3WYRA 2QKIB 1EO8H 4OLWH 4JCMA 3O2WH 3GJFH 3FRUB 4GQPH 4PFEA 5HI5C 2R23B 4LLWA 1G0XA 2DD8L 4Y1AE 1P84J 3S4SA 5JO5B 1L7IH 4Y4KD 3MYZA 1M05B 3BKYL 2P46B 4NKOA 5F8QC 2VIRA 4JPVL 5IM7A 3B3IB 4PD4J 5DQJB 1MVUA 4UDUB 3WN5C 1UQSA 4Z0XB 3DVGA 1Y6NR 4PLJC 3FQTA 2W1NA 5GRUL 2FJFA 1TCRB 1MI5B 3HRPA 4HKJA 4X6DB 8FABA 4JN1L 1ZLWH 4BKLA 2K1MA 2DQTH 2EZ0C 5D7LA 2ZPKH 3REVB 1PW3A 4QTIH 4NM8L 5EU5A 2VH5L 1GZQB 3R1GH 2XQBL 3UTPE 2L4OA 1LO0L 1QZ1A 2W0KA 1TVHA 1NCDL 3EYUH 1AHWC 3VXPA 1G0YR 4LSUH 2HTLD 4Y2DA 2W0FB 4TULH 2ADIA 1QNZL 3B4NA 2DWDB 4U1JB 4PJFA 3LV3B 3ZE0F 3IU3B 4P2RB 1S7QA 1ZVSB 2CLRA 4P3WA 1GC1C 2PYFB 3C08H 2HWZH 5HHNB 3FB7B 3UTQA 5KW9H 4H88L 5L2JA 4JFEB 1J0KA 3TWCH 5TDPB 4Q0XH 4MX7A 2FJGA 3VWKB 4IS6A 4DZBB 4GRMB 2E9JA 2Q20A 5GS0C 3C60B 1JWSB 4JFFD 5J06A 2A2QT 1I1RA 5C8JA 1IEBA 3M17B 2DQUL 4KHTL 3PGDB 4UDTA 3N85H 3OKEA 4HGKC 3TV3H 4QEGA 3D39B 3OKKA 1FLRH 2XY2A 5INDB 3FQNA 2F58H 2VYRE 1E4KC 2DBLH 1BF8A 3HMWH 2AQ3A 3BQUA 5ID1B 5H94A 3SJVA 3VXMA 2BVQA 1T1XB 2NY5H 4U1GC 3ZYIA 4W6XB 1F45A 1Z3GL 4TPRL 3MRPB 3QNXA 5C92A 3ZDXE 2XZCH 4KK5C 4HUWA 4OGZA 3VWJB 3QHZH 1AR1C 3JTTB 1B4JL 1FNLA 2JJUA 4S1QH 5JXED 5GRXG 2PW1A 4LLQA 3O6LL 4CDGC 1D3CA 3CSBA 3H7BA 4X5XB 4W4OC 4X83A 3RJDA 3RUGF 5IBTH 3BRDA 1GGUA 1A5FL 1KIPB 2APBA 2QLVB 3SDDC 3MRNA 1GOFA 1G9MH 4MNGE 5DA0B 2IMMA 1MRCL 2HT4C 4L8DA 5GQBA 3VGGA 4X4MA 1YC8A 5KSAD 1SBBA 3ZKMC 4PG9B 1NEZG 5B8CB 4MJ2A 5HVHB 4PUBH 1CLOL 3U7WH 6FABL 3L3KB 4GRWE 2FCBA 4U1LB 2NXYC 4MNQD 3WS6C 1CG9B 3AMKA 2X89D 3MXVL 5AG8A 1T1ZA 1YEJL 1BOYA 3AB0B 4XCFH 3GMNA 4JM4H 3MFFB 4NQSA 1UEYA 4G42B 3QPXH 4MXWH 4UOW0 3TA3A 3VFWA 4HIHB 3KXFB 4NO2B 5KSBB 3FFCD 4OKVB 2EIBA 3BO8A 3BWAA 1MLCB 1N3NA 2FX9L 2XRAH 4JDTH 3D9AH 1HSAB 1N0LA 4KUCF 4D8PA 4YHPB 1CFNB 4WW1B 1S5IH 4PGBA 3VCLA 5TQ2L 1T1WB 4KH2A 4YK4B 4M00A 2D03H 4UNUA 3IDXL 2QR0B 3DX8A 5CBEB 2VLLB 3D3VE 3RFZC 1PX4A 4ACPA 5DJ2B 5INCB 1AIFB 2A83B 2H45A 2Z35B 4YE4L 5C09A 1AO7B 1AXTH 3EOYG 3GMPB 3TIEB 4MA7H 1HHKB 4POZD 3WO4C 2NY2B 5MENE 4H1LH 3GIZL 4ONHA 4CU8A 3STLA 5IWLA 4EXKA 3ARTA 4G6AD 2AI0L 2X40A 2PTVA 4OZHF 3NPZB 2Q7YB 1G7QB 1JF6A 5DGRA 1Z0NA 1QSZA 3UTSA 2A6DB 3LB6C 3S34H 4NGHH 4OUUB 4JGUA 4QF1A 1A7RH 2C26A 4M4PA 1I7TB 1P7QA 1RHHA 2OI9B 2YA1A 3A6BH 3HMXL 4DCQB 4UT9H 3L3DB 4Z95L 1F90L 3QWOB 3SQBA 2W65B 3IFNL 1ZHKB 4R96B 4ETYA 1QBMH 5D1QC 1EFQA 5C0BA 1S8DA 4QXTB 5HYJA 3RL2B 2Y5TB 3X14A 1TQBB 3VFTB 1Q8MA 4F7EB 2ADFL 4UV7L 1IJ9A 2VSDA 2ED8A 1HQ4A 3IJYA 4ODTL 1KJ2A 5TE4L 4D3CL 2C3VB 3PABB 4HDIB 2IQAB 4J23A 3DX7A 2NY5C 5D5MB 3VU2A 3RIFF 1BBDL 2A6JA 1OAXH 3PNWA 5CZKA 4XCEA 1IAOB 4EI5B 4JZJC 3LAFA 1I1FB 5KZCD 2XWJB 3U6RA 3VDBA 1H3GA 3NIGF 1JPSL 2Q86A 2ZSVA 3KLSA 2MHAB 4G8GE 3OGCA 3RX8A 4YZFF 4AQ1B 1T66C 3RUGA 4E0RA 5C3TA 3Q1SL 1QVOB 4RISH 3O3AB 5KAQG 1BM3H 1IGML 1G9MC 3MV8D 4CJ0A 4LVHC 5J89A 5TF1H 3KPPB 1I1AA 3VG9B 2FX8L 3QRGL 5C07E 2FHCA 2O5XL 1XZ0B 4PRAA 4ELKA 1AGBA 3RNQB 1ZLUH 2BZDA 5D72L 4R97B 1U8HB 1FVEA 1JFQH 2C1OB 3HZVB 4RGNB 1G7IB 5E56A 2YPKB 2VLRE 3FN9A 2VZ3A 2AJZB 5D96B 2ADGB 5C0GA 4OI8A 4XP1L 1W0VB 2DYPB 3JVGC 3KG5A 3BOVA 1PZ5B 3QUKB 1DQML 1X5GA 3GSNA 4NJ9L 3BUYB 5L8LB 1HSBA 5TE7L 2WM0A 1XF2A 4APQD 2R2BA 4DKFH 1Q9OA 3AM8A 5IHBA 1IARB 2FNBA 1RJLA 1NGWB 1YEFH 3IDGB 1CFVL 5CKAA 1JGUH 2FSEB 5ACZB 3RPIA 4URTB 2DMBA 4TTGA 3WD5H 1NPUA 1QQDB 2AABH 4IMLB 5J0BA 1XGTA 1EXUA 5IT2L 1S7VB 4OZ4B 1FORL 4OZGF 2NW3B 2Y9RT 4NPYB 4DN3L 4MYWB 1L0QA 4L9DA 3LQAH 4PJAA 1W72H 3OGOE 4LLDB 4DN4H 3DYOA 2DOCA 1UJ3C 4EUPH 4YHIB 1GHFL 3SDCD 2XOTA 5CILL 4G8IB 4PYGA 2GY7B 3M1BA 3P0VL 4XVSL 3SE8L 4HMDA 2VQ1A 5HHMD 2RQ8A 4KROC 4KAQH 3MLVH 1WFNA 4KKCC 4KY1H 4PBWD 3SDAA 5BVJA 5F7DA 2GFBA 3U7AA 2CMRH 2BNRE 1SYVB 2FIKB 3DVIA 5JLZB 1MY7A 3BDYH 2V5YA 3QWRA 2OK0L 5D2NC 2NY0D 5I15H 4LRNL 3MRDA 2EO9A 1G6RH 3E8UL 3VFRB 3LKOA 3W0WE 3IVKA 1OW0C 3VD4A 2VUOA 1FNAA 2UZYB 5IW1B 5E70A 4U2YA 5JMOC 1G84A 4O00A 3T1WA 4KRNA 4UB0H 4F15B 4OCYH 2BMKB 4GXVL 2CR6A 5I30H 1KBGH 3EJJX 5SWZA 3BKMH 2BNQB 3VXRE 5ICZB 1Q0YL 4G7YL 2FJHB 4NZJA 4MQXD 2DF3A 3IAQA 5HHOB 4BELD 3HUJA 4AEHH 1YJDL 2Z31A 4GRWH 2O5ZL 1E6OH 4PJCF 4YDJA 3WFCH 4KPHH 3NAAL 4E41E 4JPWL 5DK0B 4MA8H 4JRXE 3N9GL 3SE3A 3I2CL 3DX9A 4ODUA 1N26A 1I9RH 2IALA 2LVCA 4HQQL 1MEXL 4DEPB 3WIHL 4RGOH 1RSFA 5KSVA 3QNYA 2R0ZL 3CLEL 5KAQF 4BZYA 3QDAA 1F3DH 2F5BL 4OCXH 2P5ED 1N59A 3VGAB 3GIVA 3C5ZC 1YEKL 4Y7MA 5A2KH 1Y6MR 3GHBH 2PXYB 3STBA 1TPXB 4HUXB 1NEZA 4ZD3H 4YPGB 1IE5A 5KVEH 1WBZA 5AUMB 3T4AA 3KPRB 4GMTL 5HGHA 3CSPA 1NAKL 3BPNC 1U91B 4HPYL 1LWRA 3QISA 5F7WC 2MCG1 3RL1B 2R4RH 2X4PA 4PJXF 4GKSA 3T0BA 3CCHB 1ZKAA 5HVFB 3HRZA 3O9WB 3KNBA 3BEVB 5HHVL 3SGKC 1MCHA 3TZVD 3PXHA 3KPQB 3C6LB 3U36B 1M7IB 4L8CA 4WCYL 3F62A 4R7DA 5ELIA 2XWBB 4LLAA 4UINH 2R1WA 5K9KA 4PRBA 1DVFD 4FHBD 3MLZL 1EHLL 1CU4L 1BQHG 2P45B 4R2GD 1CLZH 4JRYD 4EEEA 3B2VH 3SCMB 5FUZL 3I02A 4KK9D 4Y5XB 1RUAH 1ONQA 4I2XB 4JKMA 4J3VA 4L8SB 3U7YH 4CMMB 3RVXC 1NKOA 2VC2L 1JK8A 5IHUL 5EBLB 1NC4B 3F6IA 4G6ML 5GS1A 1QSFA 3EIFA 1CDBA 1X5ZA 1H5BC 3OB0K 1JYWA 2EDTA 4M1GH 1MREH 4LKCA 3DXAD 3EW3B 1R3HA 3VW3H 5F9OH 4OT1H 2WV3A 1A1OA 3UBXG 3FO0H 3T09A 3LQAC 1T0PB 2JK5A 3P11H 2GY5A 3NTCH 4NKMB 2BDNL 3BN3B 4QRSA 4DGVH 2EKSB 5F1NA 1IKFL 4JFZH 5TDOA 2PYEE 3P73A 4KZDL 1UGNA 4CN4A 4Y89A 2MPAH 3X3GH 5GRJL 4TVSa 1MCEA 4P2YA 3Q2CA 3WIFA 3RTQA 3C2AH 1S5HA 3Q6FA 4LDEB 1YNKH 4HAGA 5C9KA 5KJRH 1UT9A 3QG7H 3LS4L 5DZLA 4C55A 4XBPA 1OB1A 3AS2A 4P46A 2BSED 4F7MB 2XG5A 3QAZC 2JF1A 4MQTB 4YWGH 3NFNB 4MSWB 1DN0B 1GXEA 5D1ZB 4I5BB 1IBGH 1D5XB 4WV1A 1QBAA 4CADB 3BESR 1J0ZA 1N5YL 2XFXB 4ZS6C 3MOBH 4AENA 1WBXA 3F65A 3IDNA 4PJHE 1GJIA 2H9GB 1MCPL 2JIXA 5GGTL 5IK3A 5C0IA 5IESL 2KQNA 4KQ4H 1JZ4A 1NDMB 4XNQA 1OTUD 4LP5A 1WT5C 4K23H 4ZTPH 1WFTA 1RK1A 2FHFA 4HH8A 1H9VA 1IZKA 1HHJA 1BQLL 3DRQA 1MFDL 3ULSB 4HWBH 5LGHL 1MFEL 4XNMB 5EBWB 3SDXB 5F93C 2NW2B 4RGND 1R3JB 2JKXA 5C7XL 3GI9L 2NYYD 5CP3H 4MWFA 1DN2A 1MCRA 1UJTA 5ADPL 3IXAB 1A7QL 3PGFH 3PIQB 2FYYB 3ZDYF 3EO1B 1J1XL 5ITFB 5J6HA 3ZSSA 5KANI 3C2SA 4XP9L 4P3CH 5JZ7C 3THML 5F6HJ 4FQ2H 4CU7A 4NUGH 1U8LA 5KVFH 5GISL 3C09C 1YUHA 1JL8A 3TO4D 1FL5B 2MMXA 2YXFA 1IKNA 4ZFFA 5CINL 5CLTA 2VDQH 3HE7D 3BP7B 3ALPA 2CDEA 1WTGT 4P2OD 5E9DD 4JO3L 4NUJB 1CLCA 4FN0A 4ZO8A 3B9KC 1FH5L 4XI5C 5EDXA 2YPLB 4LKXA 3IF1B 1E4XH 4I48A 4S2SA 4M62H 1IGIL 2YHGA 3ARXA 3WL9A 1G0DA 5F9JB 4WWKC 5CP7A 2FATH 2F8XC 5CEZE 4XMLH 1L9MA 3QQ9D 1H3UA 3BMVA 3QDHA 5IQ7H 1CE6B 2FEDD 4Y4KA 1IGJB 4OCRH 4GW5A 1UZ6E 1FZMA 1QLFB 1PKQB 3TFKD 2NY7H 3G5YA 4P3DA 4LFHD 4HKXA 4K3EH 5CJQL 1ZHBB 1PG7W 2BC4A 1LO3H 4YBLB 5EZLB 3K80A 3OJDA 4ODSH 5D1XD 5E6YA 2P8LB 3IJHA 5SV4A 3MRGA 4WFGE 2YUVA 4G8FB 1B90A 5T1DL 4WUUA 3MLXL 1AGCA 4QHNB 1A7PH 2HJFB 1AR2A 2OTWA 3KPOB 4GS7B 5JORA 1EEYA 3BD3A 4YAQB 3L95B 2R29H 1MELA 3SGJA 1KCVL 1NJ9B 3PHSA 3FT4B 4KK6D 5HGBA 2VXSL 3QIWD 3GGWA 1ZEAH 1FG2A 1G7LB 1MJUL 3P77A 4ZDHB 3VFGL 4FQCL 4WI5A 3KPMB 1NFKA 3GSQA 3ZYZA 4R4FL 2AJXL 3PWPB 2VOTA 3IXTB 2JB5H 5EPMA 3L3HA 4P4RA 1CFSB 1SMOA 3UZQA 5JW4N 1MAML 4OLUH 1WC7A 1HHHA 3QI9C 4F9PA 4V1DB 4S1SL 3RX7A 3KYNB 5GS0L 3SBWC 4JFFA 1AGDB 1RZGB 4DGYL 5IIEB 3OXRB 5CJXA 2HT2C 2VQTA 1WCBB 2EDYA 1BJ1H 4OGAD 2ATPB 4QTHA 3OXSA 3FQUB 4LEOB 4X5WB 5KVMC 3O6KL 4G3YH 4HXBH 2BHUA 2RB8A 2YRZA 3K4DA 4L9LC 4XVTL 2WIIA 4LQ1A 1DTUA 3WXVL 4BH8B 2BSTB 2AEQH 5E6IB 2CSPA 1KLFA 4HLZG 1II4E 4YEEA 4FP8H 5CIPB 5LJYH 3MRHB 3PWNA 4P4KD 3E0GA 2QSCH 4MQ7B 2I9LB 4MAYB 3LZFH 3V6BR 3OHXB 4FTVD 5AZEH 2XKSA 5JXEA 1CGSL 4MJID 1T21B 2F54E 3TBTA 4EVNA 5HI3C 2BSSA 3GKZA 4LBEB 4JDVA 2X2YA 4TQEL 1XAUA 5J6GB 3QPQC 1VPOL 1CT8B 4YFDB 1T03H 4OCLC 1F3JB 1KIUA 4X7CC 2YD5A 4WFHD 5F9AC 4J3UA 1T0NA 4WI4A 3RY4A 3FHAA 4PLNC 1SVZA 4ELMA 5KSAA 4QWWC 4OZIB 3WKMH 2YKLL 3NN8A 2XA8H 3T3ME 2ADJA 4E9LA 3WDJA 2VDPL 3BW9B 1LDPL 4HKZA 5HPOA 1ZS8B 4X6DF 3FN0H 5ERWB 1P7KB 1N5AB 4MNQA 1BQHA 2X89A 1YEHH 3IFLH 1UWEH 1T7YA 4NYLA 3VA2C 2D7TL 4UT7H 3A0OA 4LHUB 3SKMA 4FRWA 4YHKH 3ZKND 5IF0B 4EBQH 5C08D 1F11A 2JB6B 3RHWF 4OLWL 5FO7A 5L0QB 3VWKC 3MRKB 3C60C 1OPGL 4CVXB 5BZDB 2C3XA 3L3IB 2CDGB 4RZCB 1IGTB 3L5HA 5LAXB 4GAGH 1KB9K 1L7IL 4KKBC 5FDWA 1VB9A 3UBXA 2B1HH 3BJ91 1H0DA 3ZE1F 1R3LA 4N1CA 3FQWA 4PJ9D 3T4YA 1PDKA 5BOZG 5IP4A 3F5WB 1T3FA 4XMPH 4R26H 4HK0B 1FNEB 4L3ED 3ILQC 5I76A 1BEYH 3X3FH 3B9AA 1JPFB 3I6KA 2AAVA 5I8EA 4ZFZB 3ULVE 2ZPKL 3V0WH 4PJ8A 4QTIL 1F6LL 1NDGA 3VMOA 2FWOB 3VWJC 4Q6IB 1U8PA 1QFOA 2XZZA 4HC1H 4TULL 1OF2A 3HMXA 3DMMD 4PP1C 1CXIA 1NGZA 1NANH 5IHLB 1A6AA 1BFOA 1QEWB 4K8RH 3C08L 4HULB 2HWZL 4P49A 4C56D 2CD0A 5KW9L 2VB5A 2FR4B 2A1WH 1ND0B 32C2A 4F7TA 3OV6A 5HVHC 7FABH 3EYFB 3TWCL 2NLJB 4Q0XL 2A9MH 5EU3A 5DJ0A 1E4XI 3NA9H 3OKOA 2IH1A 1KCKA 5AWNH 1NLBH 1MCFA 4H5SB 2GTZB 2VZSA 2GUOB 3N85L 5D71H 3TV3L 1T2XA 5BCAA 4ZO6A 1SYSB 1CDHA 2YD1A 2F58L 5EULV 1CDIA 1TZGH 2BOBB 2VE6B 3LN4A 4FZ8L 3G6JA 4HXAH 5K59E 1EHXA 4Z8FH 2PO6D 4YO0B 2NY5L 4U6VH 1EMTL 5SWSB 4N1EA 3QXUA 2VISA 2DICA 3BVNA 3MV01 5CGTA 2HKHH 2A6IB 3MRBB 4PRHA 5I1GH 3BHBB 4Z77B 3ZTJH 1XGUA 4YK4C 4YR6B 1TCMA 5KSBF 3QHZL 3S5LG 2UY7A 4S1QL 2HP4A 3GZKA 3VI4F 1J87A 2IQ9L 1V3MA 1MWAB 1L0XA 4GUPA 4JY5H 5IBTL 1MJ7L 1WQVT 4EOWL 5SWQB 3VRLF 1CFTB 1G9ML 1K4CA 5SX4H 3QEQE 2X44D 3HE6B 3V79C 3WFZA 4HMEA 5MP6H 4BSVA 2WQ8A 1J0JA 3G6DH 1YN6A 2NZ9D 4HJGB 3B6SB 4WWID 2NY2C 2ICWA 4PUBL 5HPMA 3Q5OA 5IBLD 2N1KA 3I6LE 4S1RH 3U7WL 5BS0E 3MJ7A 1CQKA 1IAIH 3MREB 1WEJH 2YOCA 3MRFA 4XCFL 4JM4L 2VXVH 4FNLH 3FCTA 3QPXL 4MXWL 3ZMRA 4JZOB 5LGJB 3QR2A 4PREB 1KYOJ 2ZKHH 1OY3B 2R39A 3D6GA 15C8H 2Z8SA 4Z7OF 1G1CA 2OI9C 2IG2H 4APQA 1I8IB 4F58H 4UTAH 2AK4E 2Q76B 1R3KB 2WBJD 4WU7B 4JDTL 4ODVH 1A4JA 3D9AL 4MA3A 2EDOA 4I4WB 1IM3A 3AREB 4GKOA 3DRTB 3L3JB 1R5IA 5FKAB 1WBYA 4HKBB 3MYJB 2ZOKB 2XQYG 1S5IL 1TQBC 5DHYB 5BW7C 2QADB 4IHOA 2P5WB 5EZOL 1BPVA 2ZSWB 5BZWB 3HNVH 2D03L 4M1CD 1CL7H 5LCVL 5IB3B 2BFVH 4LFHG 3S6CA 1JRHH 5EUOA 2ICES 4YHOH 3SDCA 4WEBL 3ULUH 2V17H 1C16B 1N64H 1JWUB 1MCNA 3GBNH 4PTUB 3RWIA 1MY5A 3QXTA 5BV7B 3RDTB 3E3QE 4JM2A 1GH7A 3OG4B 4U1HA 4EI5C 1AXTL 1IGCH 1YY8B 4NQXB 4S1DD 3P4MB 1KPVA 4OZFG 4MA7L 4TUKH 2CPCA 1WZMA 1YNLH 4L3CA 2DL9A 5DEGB 4D0DB 3ARGD 5F3HA 5D5MF 3GSVB 1EHNA 4YDVB 3P0YH 3S34L 4NGHL 1XCQB 1LO5B 4K8RC 3QIUB 4YDLB 1A7RL 5L9DH 4R4NC 1M7DA 5ALCH 5EUKA 5KS9A 2CK2A 4R97C 4ETQB 4QY8A 4GW1A 3A6BL 3CZFB 5DRWB 4HZLB 2ITCA 3F7PC 1HHGB 4UT9L 4OQTH 3EDFA 5J1SC 5E5MB 1DBAH 4LSSH 3H9HA 2V2TB 1QSEA 3PGCA 3MRIB 4E42B 2VXTH 1TITA 2NMSA 1KEMH 1DQLH 2VLKE 1LD9A 1GGBH 1K5NB 2R0KH 4HGMA 5DUPH 3ARYA 4KDTA 4Y1AD 4F2MB 1EJOH 4PJEA 2H2SD 1VGKA 2RCSL 2OR7A 1JF1A 2GCYB 4YDIH 3CUPA 5IOPA 4Q97A 1FAIH 1YC7A 1B0RB 4LOUC 4K71B 5HDOA 5TJWK 2P5EA 4TSCH 3NOIA 4Y5YA 3U0TA 1OAXL 1W8OA 2C4FT 4DZ8A 3QDGB 1EBPA 3TESA 1F4WH 3BYTA 5I1LA 5I1AB 5EO9B 5DMIH 1RK0B 3UTPD 2QHRL 4Z7VE 5F72S 4RDQF 5CKGA 4TRPH 4PGEB 4WW2A 5F7LB 5C0EB 1NFDE 4I77H 5K9OB 3AGVA 1BM3L 4O02H 4PG2A 4XZUA 1Q72H 1NANI 5TF1L 2AV7B 4D0BB 3VDAA 1ZV5A 2BY0A 2VR9A 3TZVA 3BXNB 4V2BA 2H8PB 1IQWL 5DUBA 1I1YB 4XBEL 1JFQL 1Z6JT 1DUYA 1EHAA 1DVFA 1SM3H 4UIMA 2ESVA 4IOSD 4JRYA 3L5WA 4N1HB 1MCLA 1VESA 4W4NA 5J1TC 4RMSA 1TJGH 1FIGL 4F15C 3SE4A 1S7UB 3T77A 1BGXH 1KCUH 1NCWH 4GMSH 1IGYB 4L29B 4DKFL 3QZWG 1U92B 3ILPA 5T3XH 3ARZA 2XTLA 4AEEA 1YEFL 2X05A 1JGUL 4PJBB 2R4SH 1A6UL 3DXAA 2X4UB 2AABL 4L4TE 2I24N 5EO0B 1NUGA 4G7VH 2KPNA 4H8WC 4JJ5A 3LKQB 3FB6A 4BFIA 3ARVA 3IKCB 1W72L 3ZL4H 4DN4L 3MCKA 4KQ3H 4DEPC 4QRQB 4UBDD 1KJ3H 4XHJC 3ULUC 2HLAA 3MA7A 4IOFC 5MEOA 2EEBA 3VD9A 3VGAC 5BRZE 3MR9A 4KAQL 3HPLA 3MLVL 5BXFA 2X9XA 1MUJA 2PXYC 5E94B 1TPXC 3HC3H 5SX4I 4DFIA 1QO3A 1I7UB 3M45A 2CMRL 4IIQA 3KS0J 3BDYL 3WJLC 2Y7QA 5D7IB 3KYOB 1BFTA 1MHCB 3O2VH 5I15L 3OPZH 3HZKB 3PDOA 1IAII 5B3NA 3C5SA 1G6RL 4M6NL 2Z92B 3MCLH 3V7MA 4G9FE 4HGWA 3WUZA 4ZQKB 4HPOH 4J8RA 3O9WC 5FFLA 4ODXB 4BFBD 4YBQD 4UB0L 4R8WH 1IAKA 2XN9B 2DJSA 2ZG1A 1ZMYA 4F80A 3C6LC 3DETC 4OCYL 4RAVB 4P5TB 1KBGL 4LPXA 5J3HD 3BKML 2V9TA 3DNKA 2ORBH 2CGRH 3SCMC 1KPRA 4AEHL 4PTTA 4Y5XC 3WFCL 1FZKB 4KPHL 3S5LA 3QULA 3W2DH 2G75A 2RFXB 4L8SC 1RI8A 4MA8L 5I73C 1XIWB 5F7NC 5E8OA 5C0NC 1REIA 5C0DA 1K3IA 1SY6A 1I9RL 3U48A 4MD4B 1CL7I 1QBBA 4X8XA 4LSRH 3WUWG 4RGOL 2XY1A 4PBVC 3KYMB 1P69B 4IRSB 1JRHI 4BQCA 5B3JE 4ORGB 3RA7L 1X5FA 4X4YB 3CK0H 4TUOA 4OCXL 3BH9B 2NX5E 2Z0BA 3MJ8A 2CKNA 3D3VD 1S7SA 5GGSA 5L8KB 3GHBL 3P9MB 4ZD3L 2J12B 5KVEL 1SJEB 2EIZA 1KV3A 1AGFA 5JUEH 2V9RA 4ZUSB 5JR1L 5JA9A 3TO4A 1H3PL 2VN4A 1DDHA 1IAIM 5TH2B 3NCYP 4XCCH 3D2UB 4OB5H 5MEND 4WO4D 1FL3B 1HILB 4XRCA 1F4YH 1RZIA 1AP2B 3HE7A 2R2HA 4P2OA 5E9DA 3F7YB 5C0BE 3IB4A 3VD7A 3E6FA 2C4FU 5ISZE 2PTTB 4E5XB 3P4LA 4UINL 4ZUUA 4JG0L 1FIEA 1YY9C 2K7PA 3P0GB 4Q9RH 1CLZL 5DDHA 2OJZH 3B2VL 4ISVB 4OUOA 2AP2A 5D1ZC 3RWDB 1RUAL 3D85D 2VLJB 1R5WA 3U7YL 4KRPB 1DUZB 5D1XA 4JG1H 1FYTE 1U3JA 2K3TA 4PRPB 5CIPH 3ZDZE 5DC4B 5TGBB 3SN6N 3GBLA 4Z7QE 3DURA 4M1GL 1MREL 3TH3T 2BVYA 1E27B 3VW3L 5JA8B 5IKCB 2EYTA 5F9OL 4OT1L 1BD2E 4GLRH 2WWKT 4KVCH 4OZFA 4RFOH 3FO0L 4XBGB 1BFVL 3AY4A 3GK8H 3P11L 3QIWA 4KJYA 3GMLB 3NTCL 4IRJD 4Y4HB 4WVRA 4MB4A 4DGVL 5MERA 1PLGH 3QJHA 4WHCA 1UH4A 4JFZL 5DJ6B 3EJYC 4J1UB 3SY0A 1BVLA 2EO1A 1HNGA 4G8GD 1RIUH 3SE9H 4YHNB 4XC1L 1JJUA 2W9DL 5ESAB 1C7SA 4ZFOA 4HFWA 1AKJD 3UTTB 1BOGA 4LSTH 4NRZA 2KDGA 3CNKA 3WFDH 4F57H 3TNNA 1SHMA 3MXWH 5ICYA 5FK9A 1YNKL 2FGWH 5KJRL 2PR4H 3QG7L 3SDXF 4P2CG 5E2TH 5C07D 3MLWH 4FQLL 5DUMH 2FBOJ 1XF3A 2ZNXA 4YWGL 4NO0B 3V6ZA 2PNDA 1IBGL 3QIBD 5CSGA 4AM0A 3WHE0 1UC6A 2VLRD 1KFAL 3U0PB 4X7DC 3BD5A 2IAMD 5KN5B 3MOBL 4QHMB 1LP9A 2YEZA 1JHKH 3R06A 1Z0MA 2B39A 2AEPH 4P4KA 1OGAB 3H9ZA 1GOHA 2BVOA 3REWA 4KQ4L 5HYIA 4BH7B 4JKPH 1A9BB 2EDKA 2ARWA 3P4OB 1AGEB 1PYWA 4CL7A 1IEAA 1YMHA 3MV7B 5FGCE 4FTVA 1UA6H 1KCRH 2UYLB 4YBLC 5F96L 2M1KA 4MJIA 3H9YA 2EDFA 2XPGA 4HJ0D 1YEDA 2YWZA 3LKSB 3QO1A 1CD9B 2HLFD 2H32A 4GG6B 3HNSH 3ECBB 4ZOBA 5AD0A 1MPAH 4GS7C 3PGFL 4NWUH 5IEKA 1OWRM 3CDFA 1JN6B 3DX6A 1RUPH 1BLNA 4P3CL 1WITA 3QG6A 3EYQD 1F8TH 4MS8C 5DGQA 4FQ2L 4NUGL 1F00I 5KVFL 2FX7H 4L8BB 5IFHL 3W39A 4M7JH 4JN2B 3TM6A 4X8JA 5IMKA 5IEHA 5DFTA 1HOCA 2YSSB 4D94A 3U1SH 2VDQL 3MODH 3HG1B 1IRAY 3W0WD 4RFNC 5GSRB 5C08A 4GBXD 3QZWA 5EOQH 4X6CE 1E4XL 1PY4A 4PJIF 4YXHH 2ZCKH 2X4SA 4O5LH 3M8OH 1LDSA 2FATL 4XMLL 2D0FA 4RQQB 4NC0B 4C54A 3V8CA 2HJKA 3VXRD 1TJIH 4HEME 5DT1H 1QYGH 2ATKB 3MX0A 3LH2H 3CXHK 1DQQA 4DUWA 4K3EL 4PJ9A 3WXWH 1LO3L 1LEGB 5E6IC 3CX2A 4ODSL 4PJGB 4E41D 5E8DH 1J8HE 1ORSA 4L3EA 2P47B 1VHPA 4JRXD 1TENA 4PR5B 2OXGA 5EC1A 5EZIH 1N2RA 3GUTA 3MV9E 1A7PL 4JHAH 4MAYC 4NNPH 2CUHA 2J8UB 2R29L 3QO0A 2G5BB 4CKVX 1JUFB 2IH3B 1MWAH 1ZEAL 4NRYA 3BZEB 3HS0A 1HH9A 2ZUTA 4LVNB 3DMMA 3PQYE 3U0WH 5FIEA 5L2KB 2JJTC 1S9VB 1TZHB 1X5IA 2VDNH 5IVZB 1MHEB 3UJJH 2JB5L 3HI1B 3RVUC 5DEFB 4CAGA 1I9EA 5EIIA 3KPSB 4C56A 4EDXA 3HC0B 2G9HB 2DWEB 5IQ9B 4OLZH 1YPZB 4PS4H 4Y19D 1K3ZA 4FFVD 2VMFA 3L5JA 2HT3D 2Z8RA 1J05B 3TBSA 4EN3B 2AKRB 3O6FD 3N1MC 1QSFE 2VAAA 5EORH 1LE9B 1PGRB 1CXHA 2DB8A 2OL3L 1K8DB 5IFJB 5D9SA 1AD9A 4OZIF 4G3YL 4HXBL 1NGXB 4JZJA 5L0QC 4Z5RB 2YZ8A 3WUWA 2HTKC 1KT2A 3KDMA 2AEQL 1KCSH 1KB5A 1T2JA 4PJ5B 1M6OA 2PO6A 4FP8L 5GRVL 3DV4A 3QUYD 2QSCL 2F15A 2C1PA 3FFDB 1YDPB 3LZFL 1X6NA 3NH7H 2IBZX 1X7QB 4GLRI 1FHGA 3AFLA 5D7JB 5GZNC 2NY1D 4Z7WA 2EDWA 3P40A 4JFDB 1V7ML 3DGGB 2K7QA 3PWJA 1T03L 1D9KB 4QT5B 2UV3A 1FN4A 4TNWF 2MSPA 5D93B 1DE4A 2JCCA 4PLKC 3M07A 1YNTA 4A6YH 2PYED 4GJTB 3WKML 2GTWB 2BY2A 2OJEB 1L6XA 3ARPA 4RBPH 3FO2B 1OGTA 4C4KT 3FN0L 3A6CH 4AIZA 1AY1H 3P4NA 1YEHL 3C8HA 1RULH 3IFLL 3UTOA 3U2SB 3AU1B 4BQ8A 2GSIA 1IQDA 1FZOA 3JWNC 4UT7L 5KOVC 2N7AA 2QV2A 5JHDB 4YHKL 3V5DB 1PSKH 3T0EB 4XX1E 4G80B 4EBQL 5IVXA 1EAPA 3VXSB 1I7RB 3TO2B 4PJIA 3CGTA 2WBJA 2YD9A 4LCYA 5FGBA 4HWEH 2CO6B 5J12B 1HQRB 1NBZB 2ITDA 2AXGA 4M9OA 4ZAKD 1LILA 2VL4A 4GAGL 4JFPA 4ZUWA 3CH1B 3VH8G 2F53A 3OKDA 5F7FA 2CIKB 4XVUD 2DM7A 4LCCB 2B1HL 3T3PF 2EXYC 1C8PA 1A64A 1IAMA 2P7TB 5FYLD 1Z9LA 4NQVB 3CFEA 4PJDB 1KJMA 3HPJA 3IDMA 5F1OB 3VXQA 1JZ7A 4XMPL 4R26L 3VI3F 4H1LA 1S9YA 1OP5K 3X3FL 2BP3A 4NIKB 1IM9B 3D69A 4I8DA 1ZOXA 2H2PD 1U58A 4KI5C 2DLGA 5ESQB 1JGDB 1KXQE 3WMSA 4Z7NE 4WJ5B 3SO3B 1AQKH 3L7FA 1I3VA 4HC1L 3PUCA 5GIRA 1S9WA 2HKFH 1ZSDB 3D0LB 3P30H 1HHIB 4WDIB 3ARGA 3AS3A 1N8ZA 5I17A 5DJDA 1CD1B 4NQCB 5HGDB 4K94H 1JPGA 3HE6C 3VFUA 4KI5F 1AFVH 2OQJA 2AXHA 3KHQA 2A1WL 4QYOA 3QEUA 1KF9B 2HYMA 1MQ8A 2DJ4A 5T1LD 3Q3GA 3NA9L 5IG7A 3OZ9H 4PIRF 1CGXA 1X9QA 1NLBL 1BZ9A 3FOLB 4RAUA 4Q7DA 1TZIA 1U8NA 1DLFH 5D7SL 4XC3L 4WUUE 3BIBX 4GKZA 5CEZD 1RZJH 4Y1AA 3G5XB 1CICD 1TZGL 5KG9B 4G8EB 2PCPB 4Z8FL 5I74B 3FOMA 4W6WB 2Y72A 4HUMB 2B4CL 1P1ZA 3AREC 3QFJA 1AQDA 4U6VL 3OR6B 3WLWC 4HFUL 5DJXB 2HKHL 3OKLA 4CGTA 1I3GH 3TN0D 2C3WA 5I1GL 2QADC 4WFGD 1NCAH 3BRGC 4XXCC 2E6JA 2MFNA 1KEGH 2LQRA 5E4EB 3LMJL 2XKNA 1FJ1A 1C08B 1RU9L 2HH0H 3HG1E 4PJ7B 4GRLB 5H35B 4LSPH 3RDTC 2F5AH 4ODWB 5MP6L 5I0ZA 5L88H 3CC5B 3AAZA 3WEXB 4MXVE 3BPCA 4OFIA 1S7XA 5DJYB 1UH3A 4CBPA 2FH6A 3S88H 1IAIL 3IJSB 1JHTA 1WEJL 2NY3B 2UVEA 5FECA 25C8H 1C7TA 2XNAA 2VXVL 4FNLL 3T65B 5F7HA 3ZHLA 2HMID 3QIUC 4IM8A 4YDLC 1EFXD 4XPTL 3ZHDA 1B6UA 1KTLA 3LKPB 2ZKHL 4XPFH 2X42A 2F74A 15C8L 4MHHI 3CFKB 4F58L 2IG2L 3TIDA 1HXMA 1KGCE 2XQYK 4WI2A 4ODVL 5C6PB 1V7NL 2EDQA 2ARJQ 1YYLH 5GS2D 4EUPA 2WWMC 2Z8WC 5IB4A 2Z93A 2VR4A 1OQOA 4LCWE 2GJ6E 2ZUYA 5C6WH 1FGVL 2V7NB 4U3CA 2A73A 4IJ3B 1ADQH 2VXUL 1CBVH 4GOSA 3HNVL 3LVEA 4LLWB 1YN7A 1JRHL 4U49A 3S4SB 5FF6A 3BZDA 3NCMA 4YHOL 2XA3A 4PYHA 3ULUL 2V17L 2G60H 1G6RA 4K71C 1N64L 4NKOB 3GBNL 2VIRB 5IM7B 2F54D 1NEUA 2MNUA 1MVUB 5IR1A 1FE8L 1PKOA 1UQSB 5EIVA 4GAJL 1HKLH 1IGCL 3MRRA 3FQTB 4J3OC 2FJFB 4V2CB 4DKAA 1BBJA 8FABB 4TUKL 4MNGA 3NVQA 1IILE 3H8NA 5D7LB 4J7RA 1X4YA 3TF7C 4UT6H 3Q0HA 1OP3K 4Z7UA 1NC2D 3P0YL 1KIQB 1FNSH 1GYAA 4ALAH 3MUGA 2GK2A 1TVHB 2YS4A 5L9DL 1WT5A 3VXPB 3LEYH 5DVKA 4Y2DB 3V52H 5ALCL 4RNRA 2ADIB 4PJFB 4X99A 3PP3H 4XT1C 1S7QB 4OQTL 2CLRB 3VXNA 1DBAL 4LSSL 3EHBD 1NUFA 1D9KD 3HFMH 3SKNA 1HDMA 4JO1L 2E3VA 3V6FB 4O2FA 2VXTL 3UTQB 1KEML 1DQLL 3NCYS 2YA0A 5L2JB 1DBKH 3K46A 1GGBL 2R0KL 1RZJC 4QKXB 5DUPL 4MX7B 5CUSH 2FJGB 35C8H 1EJOL 4CVZA 4IS6B 3CFJA 1HWHB 4OFDA 1WIOA 2EYSA 3SOBH 5C8JB 2OR9H 4YDIL 4UDTB 5EIQA 4LEXH 1FAIL 3OKEB 1XCTA 4YEFA 4JRWA 4TSCL 3OKKB 4YFEA 3MA9H 3O4LE 3GJEA 3D3VA 4ZYKA 3FQNB 1IZJA 4LASH 3ULVD 3SKJL 4U1IA 1F4WL 1TNNA 3BQUB 5DMIL 4HF5H 5H94B 3SJVB 3VXMB 3NIFF 5IBUG 5F3BA 1WZKA 4I77L 3QNXB 4O02L 1V5JA 2N7BA 1I3RA 4WWKA 3OJMB 2FEEL 5HDQH 5MENA 1PEWA 1Q72L 4HUWB 4WO4A 1GCFA 3VMNA 2BHZA 4NRXA 2PW1B 4LLQB 3FB5A 3GBMH 3ROLA 2C3HA 3QHFH 3FO1B 3IETA 2GJZA 4L8DB 1ZA3A 3VH8A 3T04D 5C0CE 1TJGL 4JEGB 3D85A 3NCFB 5JOPE 1B88A 5SX5K 4OCMC 3IFPA 3LS5H 1BGXL 4P5TC 1KCUL 1NCWL 3MRCA 4GMSL 5GGQH 1ZA6A 1N6VA 1T83A 1T1ZB 5T3XL 3KPNA 1DBBH 3GMNB 3E1F1 4K3JL 4NQSB 4LPCA 2EDNA 4YHLL 3OSKA 5A2LH 3TA3B 3EGSA 2R4SL 4KMTH 3VFWB 3CDYA 4ZG1A 5DR5H 3VGFA 5F44A 3BO8B 3AXLA 3BWAB 4R6UA 4G7VL 3S8WA 3DUSA 1KLUA 1N3NB 4NZTH 5C0JA 2VZOA 1XIWC 3ZL4L 4IRJA 3W9EA 4LMQI 3H42H 4IRSC 4MVBD 2YC1A 4D8PB 1KJ3L 4BYHA 4MCYA 1QOKA 4M1DL 1S7RA 4PGBB 3VCLB 3QDJE 4G8GA 2V5TA 1AKJA 3HC3L 4X9BA 3DX8B 4J3XA 3V6OC 5DS8B 3KLHD 2IGFL 2FECI 2BNUA 2YUXA 3QEQD 4L9LA 3O2VL 3OPZL 5T3ZH 5FYKU 4Y8DC 1MF2L 3GSOA 2A0LD 3FZUD 3MCLL 5C09B 1WV7T 2QL1A 2ZZUT 4HPOL 4NQDE 3I6LD 5BS0D 3D1MC 3L6FA 2P42B 2DI7A 4R8WL 3QIBA 1G7PA 2VLRA 1BJ8A 3B3IA 2AJUH 4ONHB 5F21B 1E4JA 1JYVA 2IAMA 4N5ED 2AEWA 4RMQA 3BEWA 2DQFB 3UTSB 2ORBL 4Q2ZA 2YK1H 5C0AE 4QF1B 2AK4D 5EUOE 2VZUA 2LU4A 3MJ9H 4KZEH 2MOVA 3TT3L 1P7QB 1VSCA 1CD8A 3N50A 5H8DA 1RHHB 2WP3O 3OL2A 5HYSG 5JMRA 4KRPC 2FLRT 4M5ZH 2R0WL 4TNVF 1Q1JH 4FQXD 4GW4B 4LSRL 3LY6A 1S8DB 5HYJB 4HD9A 3LV3A 1CGUA 4P2RA 3CK0L 3T0WA 1MJJA 1HQ4B 3ROOA 3IJYB 1KJ2B 5D6DA 2BJML 1A6VH 2VSCA 3FB7A 5CAYB 5EC2A 3QDME 4Y4HC 3DX7B 3WSQH 5JUEL 1EBAA 1AJ7L 5GPRA 3VD5A 3UJIL 2BNRA 3TJHC 1PX3A 3PNWB 4XCCL 4XCEB 4OB5L 1QSEE 1RZ7L 1F4YL 3NPSB 3U6RB 3L5XH 1F4AA 1A3LH 4JY4B 2ZSVB 2Q86B 3W0WA 1X4ZA 4EDWH 4GBXA 2UWEE 3RUGB 2DIAA 4DUXA 4E0RB 3GM0A 1RMFL 2H1PL 5J56B 1QR4A 5T1MB 3DYMA 3TC9A 3BE1H 3INUH 4HIIA 5HDLA 1I1AB 4Q9RL 1U3HD 2OJZL 4R3SA 3O41A 2WINA 3BN9D 3GSXA 4PRAB 3VXRA 1AGBB 4AY0A 3MRPA 4ELKB 2HFGL 4MDIA 1DZBA 4TN9A 2HFFA 4UTBL 4JKKA 1FVEB 5FM5M 4FFWD 3L7EB 2VLKD 4JG1L 2QSTA 4E41A 3ISWA 2VWEC 3MLTA 5CJ8A 5C0GB 5JIHA 4U1KA 2H26A 3GSNB 1T0MA 1HSBB 2DLHA 5MEPA 1XF2B 1MRDH 4JZNB 1ZXQA 2R2BB 3QJFA 4U31A 3GK8L 1Z2KA 1U42A 4NZDA 1RJLB 1HI6A 3RPIB 4H25A 2YUZA 3G5VA 1UVQA 2EXWD 3CVHB 4DTGH 5DMGC 1EXUB 4P48A 5EH1A 2D9QB 4LPTA 1RIUL 3SE9L 5DJAA 3R0MA 2OL3A 4G42A 3NZ8A 5E1AA 4CJ1A 4ONOA 4PJAB 3WFDL 4F57L 5D2LE 5C9JA 5T5FH 2FGWL 5HHQA 3PF2A 2PR4L 5E2TL 3M1BB 1RIHH 1X5LA 3ARDB 5DUML 5I16A 2XIDA 3O6FA 3OBAA 2X41A 5TF0A 2APFA 3SDAB 2E7HA 5F7DB 1OTTD 5GZOD 4KWUA 2MQCA 2EYRA 3MRDB 4OZHB 1JHKL 3LKOB 4OM1H 3IVKB 3B8SA 2AEPL 4KU1A 1C1EH 5GS3A 1JGVL 1YEGH 5B4MD 1ZTXH 4JKPL 3QT2A 5DJ2A 4MZ3A 4ZS7H 2A83A 1MCJA 1UG9A 4U1NB 1KSRA 1UA6L 1KCRL 5SWZB 12E8H 1F3DJ 4L4TD 3GMPA 4I0PD 3OKMA 4M6OH 5FOJA 3TIEA 1HHKA 1M71B 4GG8A 3HUJB 1JNHB 2Z31B 1LMKA 3RNKA 5A3ID 4JFQA 4YDJB 5KVGH 2IC2A 1MPAL 4NWUL 1RUPL 5JPNA 1BAFH 3V7AE 3DPBA 3DX9B 4P9HH 3RIAF 4ODUB 4XPHL 2IALB 1UM4L 2OS7A 5F1KC 2PYEA 5KSVB 3QNYB 5BRZD 1RIVH 4RIRA 4D9RE 2X1QA 2FX7L 4PJGF 4KKLD 4M7JL 1QFPA 4LVNC 1WAAF 1N59B 1JNLH 3GIVB 3JWOH 3U1SL 1NEZB 2J8UF 3MODL 5ILTH 4WTXA 1D6VH 1CTOA 3RVVD 1WBZB 3T4AB 5HGHB 2GEEA 2BVEA 1U6AH 2J88H 4G9FD 4WTZG 4YXHL 2X4PB 2ZCKL 4GKSB 4O5LL 4O51A 4EN3C 2C3VA 3M8OL 3DI3B 5LXGH 1EUTA 4LCIH 3HRZB 4ZAKA 3KNBB 5FKPA 4ERSH 4M61B 1TJIL 4PJHA 3DWTA 3I3DA 1QYGL 4S10A 1D6EA 3GRWL 3LH2L 1NAMA 1V3JA 4L8CB 4R7DB 4H0IA 3ARFD 1I1FA 5FDYA 2R1WB 5K9KB 4NC1C 3TP4A 1YPZF 5E8DL 3RVTD 2WZPD 3F6LA 3I02B 1ZHLA 5C09D 5EZIL 1ONQB 5IB5A 4JHAL 4NNPL 5ADOH 1UB6A 3HR6A 4PGJA 3RU8H 2NY4B 1OAUL 1JK8B 5CZXD 5DFVC 5GS1B 3OJVC 5D7JC 4ENEC 1NQBA 1RZFH 2BVPA 2NX5D 5FYJD 1MWAL 1YMME 3UTSD 3CMGA 1LK3H 4LKCB 1R3HB 3DSNA 3HZVA 1TJHH 5IROC 3U0WL 2WMPA 5FV1L 5D93C 3OR7A 1A1OB 2AVGA 4JVPA 4N9GA 2JK5B 3SHSA 3P9LA 4NQEE 3UYOD 4QRSB 3O3DA 4MMZC 3K4ZA 4OLZL 4OF7A 4PS4L 3ME0A 2EC8A 1B9ZA 4FXKA 5T1LA 5C0BD 3FT3A 3P73B 4RMTA 2A74A 2DLTA 5EORL 4G6FD 3WIFB 5ISZD 1S5HB 1L7TH 1QQDA 3Q6FB 4KXZH 5FA4B 5HYSA 3T0EC 3B8YA 1VEOA 4RSVA 1CTNA 5T1KD 1KIRA 5GGVH 4LU5H 4KJWC 4G6JH 4XBPB 4X6EA 1IGFH 3S96A 5J12C 1DBMH 1OAZH 1JPTH 4P46B 5C86A 1KCSL 1D5IH 4KGLA 3IAPA 1HXYA 4TSBH 5K9JH 1MHPL 1VGEH 4YHIA 1TFHA 4QRRE 3T8XA 1NLDH 1CGYA 3O11B 1OP9A 3DO7A 4G6KL 4WV1B 1FYTD 2CH8A 2CLVB 3TN0A 4WY7H 4LCCC 3SGDH 3UTZA 3NH7L 4AENB 1WBXB 2M26A 4N0UE 3ULVF 3IDNB 3RAJH 3DSFH 1CF8H 2VRAA 3N1GC 5IK3B 3T1FB 5C0IB 4IOIA 4XNQB 1OTSC 2D31A 4OLYH 1RK1B 2YR3A 3VFRA 5CD5D 3OB0H 1FRGH 4JGJA 1HHJB 5K9QI 3BD4A 3DRQB 3EJZC 4GT7A 5IVNA 3FTGA 4P9HC 2UZXB 4A6YL 3SO3C 2Y5EA 1HZHH 4Y2OA 3HN3A 4PJDF 1FYHB 3AROA 5JNYA 3B2UD 5CJOH 4BSWA 4P5KA 1B2WH 1MCWM 4EIZC 3A6CL 4Z76A 1AY1L 5ICZA 1RULL 3JWOC 5J6HB 2XTJB 3V4PH 3BDBA 1K6QH 1EFXA 5JXAH 2B8OT 5LWYH 1CDJA 1PSKL 3WIIL 2VKXA 5C2UB 3G6AA 3OG6B 2NXZB 5E00B 4MD0B 2A9NH 1YUHB 4M02A 4HWEL 3EFFA 1L6ZA 4NCC1 5I1IH 3FB8A 1F2QA 2ZUQB 5DD0H 3O3UN 3RY6A 4HH9A 5B22A 5EU6E 1U95A 2CDEB 4NDMA 4FXGB 5CGYC 4LKXB 2DMKA 3MJ6A 2X09A 4O9HH 1C5CL 1D5ZA 2PXYA 3CDGA 4I48B 4S2SB 5CEXA 4H20H 3RVWC 3WL9B 1U8QA 5CEYB 4AIXA 5CP7B 3WJLA 3L1OH 4MB3A 5HHXL 1F58H 1MCCA 1QFUH 4Y4KB 5C0RH 3O3EB 3MGTA 4GW5B 3N0PB 3AUVA 1FZMB 1T4KA 4Y5VB 2F54A 4JQIH 1OD9A 2V6HA 4QRPE 5ACMA 3SEPA 3G5YB 4JQVC 4P3DB 3I3BA 4HKXB 1A3QA 1XGRA 1KN2L 4EI6A 3FO9A 3MOAH 3OJDB 1LO2H 3IJHB 3A67L 3MRGB 1J10A 1X5YA 2XACC 1U8JA 5E4EC 2HKFL 3MNZA 1AGCB 3P30L 4OQTA 2OTWB 2AXFB 1EEYB 2Z91A 3D25A 4GRLC 4N5UA 4K94L 4FG6D 1TLKA 4XWOC 4O58H 3TPUB 1AFVL 4QLRA 1Q9WB 4YXLH 1FG2B 3P77B 4L8SA 1NBYA 2KUTA 4WHYH 4MD5A 2IBGA 4NNYA 1KC5L 1BJ1J 4HBCL 3GSQB 4TTDC 4N68A 3OZ9L 2NY3C 5FYKE 4CRPA 5EPMB 3L3HB 3QP3A 4P4RB 4OLEA 3BZFA 2A38A 3MRJA 2BVUA 4B7IA 1WC7B 1RZJL 2LE9A 1HHHB 2ZOLA 5GGRA 4JHWH 4XTRC 4JFFB 3WE6A 1FG9C 4NKMA 3NACH 2Y36H 4KFZC 4DKDC 3GSUA 4G43A 4QTHB 3U4EB 3OXSB 1UCTA 3EYOA 5EU7C 3KAAA 1U2HA 4IJ3C 1J8HD 2CRIA 2WIIB 1CFBA 1KEGL 3ELAT 4TYUA 4QRUA 4FQIH 3CH8A 2XV6B 1W0YT 2NY6B 3PWNB 5I1EH 3NIGE 3TNMA 1ZLSL 2HH0L 1R0AH 3KLAA 4XPBH 3TEUA 4LSPL 4BUGA 2F5AL 5DZOA 4PGCB 2FECL 5E8PA 5L88L 3PQYD 1ETZA 3TBTB 3TVMD 3WNMA 3CAFA 4EVNB 2BSSB 2FBJH 4XNXH 1S78D 2Q6WA 4AEIH 3S88L 2XFXA 3L9RA 2X7LA 2YN5A 1FDLH 4HIEA 25C8L 1JTTA 4L4VE 4LDLB 4KTEL 2EIEA 2MCPH 4ELMB 5KSAB 2CKBH 4DOHB 3NN8B 2ADJB 4KXZI 1RZKH 4Y2DC 4XPFL 5DJ8B 1QSFD 2R9HD 4HKZB 3TBYA 3VXUE 4MNQB 1FVDA 3EO0A 1BQHB 1VACA 2RAMA 1PBYA 5I1CH 1M4KA 4XNMA 5J57B 4L1DA 1FPTL 1YYLL 4JO4H 4NYLB 5FHAL 3JV4A 5DYOA 1JHLH 1UACH 5F6IB 4M3JA 3MBED 1KPUA 2J5LB 1XH3A 2AV1A 4N8CH 1ES0B 3FFCB 2BSRA 3EO1A 1F11B 3OTTA 1A7NH 5FO7B 1CBVL 5FM8A 2AJSH 3SGDI 3KLDA 5I1KH 2DTMH 4OZGE 1QFWL 4OV5A 1X3DA 3X12A 3H0TA 1NCNA 1G1YA 1NCTA 3RTQD 1DP0A 2G60L 5FDWB 3UBXB 1IC5H 2QHLA 5CSBA 1H0DB 4PGZA 1KJ2H 1OT1A 1R3LB 3FQWB 3T4YB 1HKLL 3BP7A 1MCKA 1NFDF 3G08A 43C9A 1T3FB 4PV8A 3BQUC 5F1SA 1CQYA 1OOAA 3S36X 2YPLA 1MFAH 3QEQA 5I76B 3I6KB 5I8EB 4LVEA 4B7LA 1SBSH 1RJZB 2EDRA 3RI5F 4UT6L 2NR6D 2IANE 5DQ9A 2KZ1B 2YA2A 5BS0A 3ZYOA 1U8PB 1IGJA 3LEYL 4O2EA 3AS0A 4FZEH 1OF2B 2JIXD 4YHZH 3I9GL 3O8XD 2OMBA 1R24A 4K7PY 1WUNT 1NGZB 1A6AB 5DLMH 1BFOB 3HFML 1QSVA 2CK0H 3VXTA 5F7YC 4G9DA 5D2NE 5F89B 32C2B 4F7TB 1SEBA 4YIQA 2H6PA 5CUSL 5KOMC 1S9XA 2YZ1A 5ICXA 4YGVB 35C8L 5EU3B 5DJ0B 2PTUA 4PJCE 3OKOB 2IH1B 3NMEA 4P2QE 4FQXA 4HWNA 3SOBL 1BIIA 4KK8D 4BQ6A 2AQ1A 1JMXA 4MXQC 1G7LA 4LAJH 2OR9L 3EDDA 3TA3C 4WI6A 4LEXL 5HHPA 1QRNE 3D87B 1FV1A 1QA9A 3PWPA 4HG4K 3MA9L 2FO4B 1DEEA 3LN4B 3G6JB 1ZT4A 2R15A 1QTYT 1I4FA 2LABA 4HF5L 5MEQA 2WQRA 5D4QA 4OFPA 5ANME 3CVHH 3BVNB 4PRHB 2R1YA 1BWMA 1T22A 1F6AA 3N1QC 1AGDA 1XGUB 3FQRB 2EDDA 4X6BA 4X7SL 3I75A 4DKEH 5HDQL 4IMKC 1T04A 3RWHA 5KZCB 3KGRA 4PJXE 1VADA 4Q9CA 3WFHB 4GUPB 3K3QA 3QHFL 5JW3H 3CPLA 3MLRH 1A4KA 4KMLB 2BSTA 1H3VA 4NBYB 3MV8B 5CIPA 1K4CB 3MRHA 1O7SA 1U3HA 5ITBH 4BSVB 3QFJE 1YN6B 4OD1L 3ZSTA 3VG0H 1RZKC 4GQ9H 2ICWB 3DHMA 4JQXC 5HPMB 3LS5L 1B0WA 4KJQD 3I84A 5GGQL 1KELH 3VFNA 2VLKA 3GO1L 3MRFB 3KYKH 4WUUD 1DBBL 5B38G 5J6GA 1UXWA 4KMTL 5HY9A 3UROR 3UCRA 1S3KH 1W2KT 1GGIH 5DR5L 4ZSOE 5FYKH 2VN7A 4ZXBD 4APQB 4NZTL 5E5RB 1O5DT 2BHYA 5J4MA 2HFEA 3LIZH 4PP2A 1A4JB 4MA3B 5FM5O 4I3RH 1O0VA 1IM3B 4M7KH 1R5IB 3H42L 4BQBA 1MNUH 3SDYH 1OL0A 2GW5A 1EVTC 2Y4SA 4PRIE 4Z7VA 4IHOB 1BP3B 3GMQA 1A9EA 5TFSH 1FCCA 4JB9L 2HA1A 5JIKA 5EU4A 1NFDA 1XF4A 5IF0A 1FFQA 1BREA 4NM4H 5EN2A 3LRGA 2NTSP 3SDCB 4NQUA 2ERJB 1WFUA 5T3ZL 1WTLA 1NBVH 5HGAA 5HHMB 1OARL 1U8KB 4U1HB 1I75A 3NPSC 2WP3T 1KPVB 4KVNH 3CFDA 2QQLH 4L3CB 3H9SE 1C12A 2AJUL 3TCXA 2NY0B 2NY6D 5HI4C 3K4AA 3O45A 4TSAH 4X7TA 5F3HB 1J1OH 2IADA 3V4UL 5DXWA 1PEZA 5FO9B 1HINH 2YK1L 1I1AC 1KGCD 1TMCB 2A77H 3LCYA 3RY5A 2DIJA 3MJ9L 4KZEL 1M7DB 1SMAA 1BVZA 2GIYA 3ZT7A 2VDRH 3BP5A 5EUKB 5KS9B 3LKRA 3DV6A 4QY8B 1JGLH 3MBXH 4GW1B 2ITCB 2GJ6D 3GDBA 3QUZD 4L4TA 4I0PA 4M5ZL 3H9HB 1Q1JL 3PGCB 3CFCH 1TQCB 1JI1A 2DQGH 3U9UA 1LD9B 4YX2H 4P5MA 3LOWA 4PJEB 4Z7UE 1QEWA 1VGKB 2JJWA 2XKUA 4OSUH 1JF1B 3AM8C 3HB3C 3ZDYE 4UQ2A 4LARH 4XB7A 4U1MA 2FR4A 5BRZA 5DO2C 2DQCL 2VABA 4Y8AA 2V9QA 5IOPB 4WI7A 2EEDA 5IHZA 3RIAK 1WWCA 4FQJL 2AK1H 2P5EB 1P84K 5EO1A 4Y5YB 3U0TB 3RGVD 3QUMA 3NCJH 1INDH 1U93A 1XGYH 4FQPA 3L5XL 4NO5B 2GUOA 1A3LL 4NZRH 4ODHH 4PD4K 1J5OH 4JVWA 3GRWA 4EDWL 1EDQA 4G9FA 4WW2B 4HV8A 3QUXD 2MTPA 5F9DC 1ZHNA 1RV6X 3PP4H 3ARDC 4O4YH 1MAJA 4XZUB 5DMYA 4QOKE 3INUL 3HZYA 4YLQT 5DVLA 3SDAC 1LE5A 1E28A 5FUCE 2A6IA 3TZVB 3EDJA 3MRMA 1I8KA 1OAKL 3PHOA 1MRFH 5DUBB 4PJAF 4LRIA 4QXUH 3ARFA 5M94B 3G5ZA 5J1AA 1GAFH 5FM4A 1S7WA 1DVFB 4UIMB 3IDJA 5SV3A 2I60H 2ESVB 1JCKA 4PJ8D 4R2GB 2X9WA 1A2YA 3F7VA 3L5WB 4JRYB 4LK4A 5ENWA 3UAJD 3FHQA 5IV2B 3U9PH 4LLYB 3H2WA 1KTRL 2DQJH 1EK3A 2VL5B 1MRDL 3ILPB 4KKAC 4F37F 1JIBA 2EE2A 4HJGA 2F8VA 2NX5A 2JELH 4UQ3A 3O4LD 2F9BT 2F19H 4JREB 4UUJB 3DXAB 2Z31C 5LVEA 5GGUA 4DTGL 5E8EA 3IGAB 3S37X 3H6JA 5TE6H 1RURH 2D7MA 4JJ5B 3SE3C 3FB6B 4BFIB 3D18A 4RRPG 2QSVA 4HEPG 3MCKB 5DHVA 4WHDA 1OWWA 1RJCA 4KJPD 3QFDA 2HLAB 3MA7B 3K0WA 5MEOB 4M5YH 3HUJF 4P23D 2V7HA 3MR9B 3HPLB 5BXFB 5L6YH 4I4WA 5ISZA 1JI2A 1MUJB 3AREA 4X5LA 4BM7A 1QO3B 1V8HA 4IIQB 4RGMB 5DHYA 4J4PC 2DQHH 2Y7QB 5T1KA 5I19H 3PDDA 3PDOB 5JDJA 5C0CD 1N6QH 4OM1L 5JOPD 1E4WH 3RZCD 1Y18A 2DD8H 4HGWB 5LGKA 5EOTA 4PRHD 4J8RB 4XX1G 1C1EL 2IPTL 1YEGL 1ZTXL 3T0XA 4P57B 3WHE1 1FYTA 4PTUA 1CR9H 1J1PH 3TT1L 4ZS7L 1NCCL 2DQIH 5AYQA 2AJVH 4A6YA 4M6OL 4LGRB 1ROWA 3T0DA 1BD2A 1Z5LA 1KPRB 4PTTB 2XZAH 3ES6A 4NSKA 1X5JA 2X4RA 3S5LB 3B5HA 3QULB 2G75B 2NY4C 1LO4L 4NHUA 4UI2A 5E8OB 4P9HL 4M43H 5C0DB 3S9DB 1CVRA 1EV2E 2V5RA 5GS1C 3U46A 3C5JA 3QDJD 1VFMA 3WNKA 3MV8E 3JUYA 3VMPA 1RIVL 1JZ8A 1QNZH 2VLME 2FO1A 2QQKH 4Q9BA 5F71A 5DJCA 4XP5H 3WLBA 4TUOB 1I8LA 4D0CA 5E5MA 2MJWA 3JV0A 2V2TA 3MJ8B 1TETH 4M7ZB 1MI5E 1S7SB 2W9EH 4U0QB 1N6UA 5GGSB 4X6DE 3MLYL 3LEXA 3DJ9A 3QXWA 3FMGH 5ILTL 3IDUA 1D6VL 2P8PA 2VITA 1U6AL 1K5NA 4U2ZA 4RFEA 2J88L 1AGFB 3FL7A 1FFNA 4NQDD 3TO4B 2GSGA 5B38A 1DDHB 1AD0A 3U82B 5IFAH 1BF2A 1U2CA 3L3GA 1I8MB 5LXGL 4XRCB 4OQ1A 4LCIL 1RZIB 3QNZA 3HE7B 4NKDA 2R2HB 4P2OB 5E9DB 3S35L 5GJSH 3HZMA 1FO0B 4ERSL 3E6FB 1IC7H 1DSFH 4P2RE 2EECA 5C0AD 2I5YH 5J7CC 3OF6D 4JHBA 2GAZB 3L3OA 3MLSL 4P46C 3JV5A 2OCFD 3ZE1E 1JGEA 1A14L 2Y07H 2V2WA 5DDHB 4JFEE 4JM2D 2BK8A 4PGEA 2C7UB 4XWGL 3NIDE 2XYCA 4WV1C 5ADOL 4ZTOH 3RU8L 5FA3A 4LPYA 2E5EA 3QEHA 4CMHB 1QUNA 5JW4R 2AV7A 5J9PA 5D1XB 3PL6D 4EJ1C 1ITBB 1RZFL 2DTSA 3DURB 1OT2A 5DMKA 3D39E 5L7XH 1LK3L 1A5FH 5EA0L 3HNTH 1TJHL 2ED9A 2EYTB 3QDMD 2X4TA 1T7ZA 1DQJA 4OZFB 4Y4FD 5FEBA 5KSUA 1QG3A 1A21A 1INQA 2HVKA 3QIWB 4KJYB 3X11A 1CLOH 5MERB 3QJHB 3LD8B 3MO1A 1F42A 4WNQA 6FABH 5LQBL 1QSED 3SY0B 1BVLB 3MXVH 4ZFOB 1UWGL 4HFWB 1I85A 2XTJC 4X6CA 3TBVB 1L7TL 1BOGB 4NRZB 3EAKA 3TNNB 3V9FA 5ICYB 5FK9B 2Q8AH 2DMCA 2NXZC 1PG7H 2B2XH 4XAWH 5GGVL 2J7LA 3LKQA 1DL7H 4LU5L 3NBNA 4G6JL 5ETUA 1OCWL 2KH2B 1IGFL 1DBML 1JPTL 1D5IL 1LK2A 5K9JL 1VGEL 4QRQA 1ORQB 1XF3B 4ZO9A 3V6ZB 3J8F7 2D9CA 4AM0B 5JQ6H 4MLSA 4WY7L 4M7LT 1J8HA 1T2QH 5E94A 4KTDH 5DD5L 1LP9B 2YEZB 4L3AA 3R06B 2AERT 3RKDD 3RAJL 3DSFL 1CF8L 3MV9A 4Q6YA 3KXFE 4P4KB 5D7IA 5KSBE 3REWB 2BVOB 5J8OA 4Y4KC 4OLYL 5E8NA 3VI4E 4Z7NF 1PYWB 2Z92A 1FRGL 4Y5VC 1IEAB 1KULA 3CX5J 3GMOA 1YMHB 1WISA 4AK1A 4FTVB 5IMMA 4ZQKA 1D5MB 3V5HA 4RMRA 1TTUA 3VRLE 3PQYA 4MJIB 4OIIL 3TVMA 1HZHL 1YEDB 3QO1B 3W5NA 3EO9L 1MQKH 2ESVD 4P5TA 2H32B 5CJOL 5DSCA 4AYFA 5AD0B 5IEKB 5DVNA 3DX6B 1HH6A 4XCYA 1BLNB 3G04A 3V4PL 1FFPA 4JFOA 1T89A 3BKJH 3QG6B 5JXAL 5LWYL 1RZ8A 2HTLC 1JYXA 4Y88A 4AJ0A 2A9NL 2RFXA 3W39B 5DC0A 4W81A 4X8JB 1AO7E 5ESVA 5IMKB 5IEHB 3EFDL 1HOCB 3IFNH 1BVKA 3PV7A 5DD0L 1CWVA 3BIKA 5FB8A 3MBEA 4ORGA 4HWZA 4K7FB 1AXSA 1NH6A 2W91A 3RWJA 2ADFH 4WENB 5C08B 5LBSL 1RJYA 3QZWB 3LDBB 1DQTA 4O9HL 2GJJA 1URLA 4F9PC 3W11D 2X4SB 4H20L 3QH3A 1JVKA 3L1OL 2G2RA 1EGJH 3IYLW 4L1HA 1F58L 1RAMA 3OX8A 3HAEG 4NT6A 2HJKB 2ZP0T 4ZOAA 5D6CA 1T5XA 4Y16D 4JPIA 4RRPA 4JQIL 2ENSA 3D2UA 1DQQB 2WWKO 4LSVH 3CVIH 4PJ9B 1WK0A 1H3XA 1AE6H 1LO2L 3ARBD 4RMWA 4RA0C 3BDXA 3CFBA 1ORSB 4L3EB 4U6YB 5CLWA 5EC1B 4LIQE 1N2RB 3GUTB 1EZVY 4MB5A 2R1XA 1MFCH 1IGMH 3IS0X 5D1ZD 3DIFA 4ZUTA 4MXVF 1ED3A 3TH2T 2OR8A 4D9RD 3QO0B 5D5ME 3ZHKA 5JXEC 3QQ3A 4X9GA 5E7BA 3PJSA 3RI5K 4NRYB 2QTEA 3HS0B 1HH9B 1FL6A 1F5WA 4XH2A 5M7QA 5DQDH 3O8XA 3V95A 3DMMB 1ZT7A 2ZWLT 2Y6SD 2WAHA 3J7HA 4XP1H 4WU5A 4C56B 4R7NA 5KSAC 4EDXB 1CDGA 3CIQA 1A6PA 2OZ4H 5IKCA 1BZ7A 4OFYD 1OVZA 3R8BB 1JTOA 4BK4A 4YJZL 3OAZK 4JHWL 3TBSB 5GGVY 5HD8D 3GMLA 2VAAB 4HIJA 3ARQA 4PY8I 3HI6H 5F6IC 2DN7A 1WZLA 3S35X 2J5LC 2WLZA 4J1UA 3DUUA 4ELMF 5D9SB 1AD9B 4RGNE 4OTXH 4DN3H 2ZCHH 3WUWB 1KT2B 3KDMB 1MIEH 3E6HA 5E4IA 5HYQA 1KB5B 1JV5A 5FUCC 4FQIL 4IDJH 1M6OB 1XEDA 2PO6B 3VJ6A 2Y06H 3DV4B 5HI5D 2L7JA 1GHFH 5FAAA 3SKOB 5I75B 3UPRA 5I1EL 1EVUA 5CILH 3BAEH 2C1PB 2E27H 1R0AL 4LVHB 4BUHA 4XPBL 4HUVB 1Z9SA 1YMMD 1WGOA 3QXDA 2RJMA 4PLJD 2FBJL 4Z7WB 4X9HA 4XNXL 4AEIL 4KV5F 4QHMA 1BX2A 1FN4B 1UB5A 2EZ0D 3LRSA 4NQED 1DE4B 2JCCB 3UPAA 1P2CA 2MCPL 1YNTB 2CKBL 4LP4A 3NZHH 2XZQH 4POZC 2CUMA 4EQ2A 1OGTB 1SQ2N 1FAKT 4AIZB 4G6AC 3P4NB 5I1CL 1Q0YH 4NWTL 1H15A 1IC4L 4JO4L 2GSIB 1IQDB 1FZOB 2YD4A 1JHLL 1UACL 2YBRA 4KUZH 2APWA 4QCIA 5IVXB 4N8CL 4B5EA 2CIIA 1NMAH 2R69H 4ZXBA 2W92A 1OSPH 4QRRD 1FVCB 4HLZH 4PJIB 4N0FA 2AJSL 2WBJB 4LCYB 1X44A 1VA9A 2HJLA 3I50H 5GS0D 3QRFM 2R0ZH 3JXAA 3CLEH 2ITDB 2AXGB 4FQHA 1GC1L 1Y0LA 4JFPB 4ORZC 4ZUWB 4AT6A 2F5BH 4JN2A 4M4RA 4XPGH 2F53B 3OKDB 1K9TA 1JZ6A 1A6TA 3MRLA 2DQDH 2BNQE 5GSVB 3UBXI 1KJ2L 3CFEB 1KJMB 1DEDA 5HHOE 4FQ1H 3IDMB 3HG1A 3VXQB 4FOMA 4HPYH 3QCVH 1SBSL 3D69B 2BY1A 2X4NA 4KDWA 4UAOB 4RQQA 1QR1A 3KPTA 4KK5D 2GT9A 4MJ4A 3MJ9A 3ULUE 3L7FB 3PV6A 2ATKA 3VFMA 5GIRB 3G6JF 4FZEL 5C70A 3SPVA 4YHZL 3ARGB 2P8MA 5CBAA 1N8ZB 5I17B 5DJDB 3TGXA 5DLML 3SDDD 3KPRE 4GSDL 1QRKA 1JPGB 1JTPA 2CK0L 4U6HA 5FUZH 4PR5A 3VFUB 43CAA 2HT4D 2KKQA 2OQJB 3EOBA 4QYOB 5E5UB 3QEUB 3V0VA 3ZKMD 1EX0A 5EU6D 4LCWA 3K8MA 1ZGLM 2GJ6A 2QQNH 3QUZA 4G6MH 5IG7B 1UXSB 4QHLA 2NXYD 1BZ9B 5A16A 4RAUB 1TZIB 2FD6H 1U8NB 3ARSA 3BZEA 3JUZA 3IS1X 4FFZH 4GKZB 3DGCR 4Y1AB 1S9VA 4Q74A 5IVZA 4GH7B 4APQC 1NSNL 1WWBX 2NNAA 3HI1A 5BMFL 3LHPH 1OD7A 1EJ6A 1TVBA 1A7OL 3HC0A 3FOMB 4QRPD 1P1ZB 4I2XE 1AQDB 1CGTA 3MACH 3CVHL 3OKLB 4JFYA 2MKWA 1OP5H 2EKJA 3RP1A 3K81A 3RGVA 1VENA 4DKEL 3BGFB 4X4XA 1EO8L 4D9LH 3O2WL 4XP6H 4WFFE 2XKNB 1FJ1B 3SDCC 5JIPA 5JW3L 3QUXA 3MLRL 1BHGA 3B5GA 4Z5RA 4C4KO 2CXKA 3DARA 3RWFA 2BRQA 1FC2D 1Q0XH 2FGZA 5JDSA 5ITBL 4LIQH 3AAZB 5LG1A 3BPCB 3EDEA 4GQ9L 3MUY1 1S7XB 1N5YH 2NY0C 2ICWI 3OAUH 2FL5A 1Q38A 1J18A 3OWEA 5EUOF 2DQTL 1KELL 5FECB 3KYKL 4OF0A 3ZT6A 3HAEA 2XNAB 3R1GL 1VEPA 2OSLA 5TDNB 1YJDC 3LB6D 5IJKC 3EZ8A 4JM2F 3OKYA 1T6WA 1KTLB 2PW2A 1G7HA 2F74B 1F4XH 1GGIL 1GVIA 3KVQA 5FYKL 3EYUL 4LSUL 3TIDB 1HXMB 1J86A 3LIZL 4NP4H 4I3RL 4ZPVA 3VD3A 4EUPB 5IB4B 2Z93B 2WW8A 4MQXC 1TQCC 3O4LA 3EOAA 3MMEA 1MNUL 3SDYL 5D1QD 3DECA 3MRQB 3C6SA 4XVJH 2A73B 3EUUA 3CDCA 5DMJB 4F37K 4Y0GA 5T3XE 4KDTC 2X4OA 5MI0B 3C87A 5TFSL 5B8CC 5KS9F 1SY6H 3B9VA 5DRXA 3THMH 1YN7B 4LQFH 4NM4L 2G5RA 4LPUA 5FF6B 1NFIA 4R4BA 3AB0C 2YMXH 4U7MA 1EEUA 1G6RB 4GAYA 1HQRA 3FN3A 4P23A 1EEZA 1UWXK 4Y5YC 3SDXE 3BT2H 4BZ1H 1QHPA 3MRRB 3QCTH 1FLRL 1TDQA 2J1KA 2CDFA 5HDBE 4PJEF 1BBJB 2QQLL 2DBLL 2FZ3A 2DL2A 3HMWL 4MNGB 5C6TH 4L4VD 1V3KA 2BERA 2DS4A 4WW2C 1D5BA 1ZK9A 1U3ZA 1T66D 1IGIH 4TSAL 1J1OL 4NQVA 2B1AH 5C0CA 2P48B 1U8IA 4AL8H 1R5VA 1P5UA 3RZCA 1YEEH 1HINL 3LQZB 1F3RB 3MUGB 4GRWB 3VXUD 1XR9B 2XZCL 2A77L 1SJXA 1FO0H 3TZVC 4C59B 4K2UH 3CSYA 2VDRL 4POYA 4RNRB 1G9EA 2X6MA 4PV9A 1JGLL 3MBXL 4X99B 1JGDA 2HN7A 5GRWA 2AS5M 3VXNB 1DVFC 1MCQA 4I3SH 4K3GA 4WW2F 4ZOEA 2D3VA 3SKNB 4JY6A 3CFCL 1HNFA 4R2GC 5A2JH 4O2FB 2YPLE 2DQGL 3UDWA 2E6QA 1U0QA 4KK9C 1SJVA 5I66A 2XT1B 5I8KH 2N56A 3RWGA 1CD1A 1CGVA 4CVZB 1F97A 5E0QA 3CFJB 1JP5A 4OSUL 2EYSB 4LARL 5FOBA 3QDJA 1P9MA 3MGAA 5C2BH 1MJUH 3LKNA 1PKQE 4OGYH 1HIMH 3BP6A 4JREC 2CLZA 1XCTB 5DTFA 1F13A 4H26A 4R4FH 2AK1L 3E2HB 1WLHA 4HBQA 3GJEB 3D3VB 4HS3A 3QA3A 4WFEE 4ZYKB 3GMRB 3NCJL 4OZFH 4U1IB 1INDL 1XGYL 3K2UH 1J7VR 4NZRL 1J5OL 3B9DA 2XRAL 3C8DA 2IAND 5CZVH 4UIKH 3NA4A 3WNPA 3BJLA 2IEPA 5F3BB 2AQ2A 4NQDA 3R0NA 3H3PH 3PP4L 1UM6H 4G8EA 1I3RB 2PCPA 4J3WA 4O4YL 2EC9T 5MENB 4WO4B 3L5IA 2F53D 3U4AA 3F12B 3HA0A 2NCMA 5I6XB 4KROD 4NRXB 4H8WH 4KKCD 4IIQC 4RGMC 3FB5B 1ZLVK 3O6KH 3ROLB 1MRFL 4XVTH 5C0AA 4QXUL 3PWPE 3WXVH 1FLTX 3OF6A 3IETB 3FQXA 2GJZB 3PHQB 2GHWB 1ZA3B 5CHNA 5EOCH 3VH8B 4HS6B 2I07B 5BVPH 4P0DA 4M03A 3F8UB 3D85B 3GSWA 4V1DE 4P2QD 3N06B 2DQJL 3EZJB 3PXJA 3Q5YA 1ZA6B 3CLFH 2RBLA 1QRND 3PL6A 3WEXA 3KPNB 4N8VG 2JELL 5EBMA 1A6ZA 1T1YA 2F19L 3EGSB 5GXBB 1OTUC 3VG9C 2ED7A 4NO3A 3QDMA 4QHKI 3AXLB 4U4BA 1A7BA 1RURL 3DUSB 4N90E 1KLUB 5TE6L 5C0JB 4Y4FA 1N0XH 1G7MA 2SEBA 2OX5A 5C3LD 1UEMA 4IRJB 4RGNC 3W9EB 3WIHA 4FS0A 2YC1B 3ZE2E 2NYYC 4XPAH 4MCYB 4CUCA 3MV11 2H32H 1S7RB 1B3JA 1QBML 5D96C 4L5FH 5IMLA 4GKNA 4M5YL 4G8GB 4MGXA 1E0OB 5L6YL 4M7ZC 2D7TH 2UWEA 1AKJB 3C5ZD 5DURD 2J4WH 1DQDH 4HHAA 5EG6C 2DQHL 2BNUB 4ZPTA 5I19L 4L9LB 5H37G 5C07B 3TO4C 1HEZA 3QFJD 3GSOB 1N6QL 1OPGH 4GXUM 4OZIE 2EEAA 1E4WL 3ESVF 5CMAA 4ONGH 3HE7C 2W59A 4F3FB 4NCC2 4P2OC 3L6FB 1BMGA 3QIBB 1G7PB 1CR9L 1J1PL 1R3IH 2VLRB 2DQIL 4LPVA 2IAMB 2X1WL 2AJVL 3BEWB 2OM5A 5SX5H 2EDBA 2YD6A 3FT2B 4RISL 4Q2ZB 3QQ9C 3LRHA 2FEDC 3KR3H 2XZAL 3TBWA 4R0LA 3TFKC 2LV4A 1KIQA 4WHTB 1KYOK 4CMHC 4M43L 5DZNA 3Q6GH 4WEMB 5D1XC 3RVXD 1J0YA 4NFCA 4BZ2H 4PRID 3MNVA 3KWWB 1ITCA 2QQKL 1JNNH 1V3LA 1WFOA 4HZAA 1MCOH 4XP5L 5D2LA 1MJJB 4ZMAT 5JOFA 3ROOB 1I7ZA 1TETL 2W9EL 3V6FA 5DI8A 3X13A 3AY4C 3FMGL 4KK6C 2ZCLH 3QIWC 4FABH 2WUCH 3LD8C 3BZ4A 1S7TA 4RX4D 3WD5L 2BNRB 1YA5A 5IFAL 3H9SD 2HVJA 4HAFA 1NCUA 4YDKH 5GJSL 4I18B 3W0WB 2EDJA 1IC7L 1C5DA 1DSFL 3ALXA 3LQAL 4GBXB 1ZWIB 2VTFA 2I5YL 4FZ8H 1PQZA 3DBXA 5E08H 2P43B 4QGTA 3T3PE 4HIIB 4F7PB 2Y07L 4R3SB 2APVA 1EMTH 3O41B 2WINB 3GSXB 4OGAC 3UZEA 4KY1L 3VXRB 2EC9U 4MDIB 4Y16A 5IUSA 4Q58C 3Q48A 3VI3E 3OKNB 2HFFB 4ZTOL 5F7MC 3RWEA 1J12A 5IW6A 2VNCA 3ARBA 4ZS6D 4LDOB 1KB5H 1CFQB 3GSRA 2IQ9H 2BOCA 2OP4H 4E41B 4MZ2A 3MLTB 4P4KC 3BI9X 4JRXB 5GGTA 3ESUF 4NNXA 5L7XL 4TVPE 1XF5A 3FO1A 4U1KB 5HYEA 2H26B 1P5VA 1T0MB 1MJ7H 1X5XA 3HNTL 4EOWH 2WK2A 5MEPB 5EFIA 4JDZA 1NMBH 1UZ8A 2VAJA 3QJFB 4TUJA 3WKNA 4HJJH 5SWSE 3W9DA 5I30L 1HI6B 4KI1A 4DWHA 2OMNA 1LP9F 5BJTB 4H25B 3G5VB 1CDCA 1UVQB 4KI5E 4F9LA 4J2XA 4LGPB 3RQ3A 4DGIH 1E6OL 5DJAB 5HBBA 2OL3B 3NZ8B 5E1AB 2PF6A 4JLRA 4J6RH 3T2QA 3W82A 3BFOA 3UC0H 5C71A 1Y6KR 5C9JB 4AZ8A 1G7JA 1UFUA 4I9WE 2Q8AL 4QOKD 5HHQB 4OFYA 5JZ7D 3UPCA 1PG7L 4Y19B 2B2XL 1YQVH 4XAWL 2VZ1A 1DL7L 2VDOH 3CZJA 5I16B 4WTWA 3O6FB 1K4DA 5E03A 3T08A 1OSZA 1K85A 3C8KA 3ZKNC 3ALWA 2Z4QB 5I2IB 5JQ6L 1I1CA 5FXCH 1EUUA 5EZOH 2DLIA 4BQ9A <