1JGVH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
b'EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH01
4NDMB 5L8LB 4PJ9A 1N4XL 3VWJA 4L3CB 3A6CL 5KVDH 3QUZD 2VITA 4LNRB 5IBTH 5TGBA 5T5NF 1KPUA 3VGAB 2QADB 4PGBA 3IAQA 2JF1A 1HQRA 3EYOA 3VXTB 4HUVA 3S9DB 1DBBH 3T2NL 4DGYH 4NN5C 2GSGB 1R3IH 4JRXB 4OLUH 1ULVA 3KPOA 3INUH 4ZUSA 1BEYH 1NBVL 5GJTL 1S7UA 4I18C 4F15B 1J05B 1DBJL 3C5ZC 5BZDA 3R4DA 1R3HB 4PJ7A 5IK3B 2XKUA 1G6VK 4MLIA 3FAWA 3VG9C 2ZKHL 2R0ZH 4KK8C 5I8CB 1A6WH 1IAIL 3WS3B 1VERA 2EC8A 1FZJB 3E2HB 2GSIA 3SHSA 3VXUD 4PRHA 4UZGA 4KTEH 4PRHE 2EEDA 2YPVH 1X44A 2EKSA 3PWPD 4K7PY 4QCIA 5F7HA 3WUWA 5JR1L 3WD5L 5JHLH 3C6LB 2J88L 4OZHE 1GJIA 4K3JH 2R39A 4M00A 2XIDA 1F4XH 1F02I 3MGOB 1Q1JL 1S7SA 3QZWB 3NCJH 5F9JA 4UNUA 1I8LC 4UT9L 2CH8A 1EO5A 3KPRE 5A40E 2Z93A 2BOCB 2YWYA 3QHTC 2F8XC 4XCCH 3QJHA 4UIKL 5C0BA 1NUNB 3N9GH 5C0BE 3VH8G 1LE5A 3MCLL 2OTWA 5JA9A 4IRSA 3BFOA 5KAQF 3EW3B 5KVGH 4YO0B 5EU4A 4UT7H 2NMSA 5GGTA 1D3CA 4KU1A 5FK9B 5I30H 2X1XR 3MRCB 1KLUA 5EBMB 3SE4C 4EKXA 1AGFA 3HCVB 5BS0E 3C5ZD 1KIRB 4EUPG 4K55A 5HGAB 1LMKA 4NQDA 3Q3GB 3QWRA 4LCWA 4KK8D 4NQDE 3TP4A 4LCWE 3V5KB 1UJTA 3G04A 4GQ9H 1G7IA 1BX2A 1RJYB 5E1HB 3S3PA 1GSMA 4NZUL 3QH3B 1BFOA 4POZC 4HF5H 1JJUA 2GK0B 3SDDC 2ATPA 1TTGA 4PJ8A 4EEEA 3S35L 2IQAB 1CD8A 3MLUH 3T04D 4P59L 3LKPA 2W9EH 3D3VB 3S36L 1WFOA 2FJFA 3OGCB 5DJYA 1NAKH 2P47B 5B38A 3TESA 5DRWA 4JFHD 1YY8A 1DE4A 1JHTB 5I76B 1BQHA 1J0KA 1Z3GH 1D6VL 1MH5A 3TBVA 1XGUA 4YAQA 1FAIL 5GSVB 2ESVD 4OZGF 4ZFZA 3AXLA 4DEPB 3C8HA 3ULVE 3RIFK 2IAMA 5TFSH 3JV4A 3GO1L 4Q6YA 3SKMB 1LHZA 1AHWA 2MTPA 3LD8B 3FB7A 3TZVC 3MA9H 2VZOA 4XP9L 4WFFE 3UBXI 5A2FA 4ODTH 3IFOA 3TIDB 2DMCA 2V7NB 3ALWA 2O61B 2N7AA 1HQ4A 4BQ8A 1EEUA 3EIFA 3EYVA 5DD3H 4NP4L 5E8NA 3CD4A 3SDDD 1E0OB 1UFUA 3LEXA 1JGVL 3LRGA 3HS0A 1KJ2H 1F58H 4HKZB 1TZIB 4LHUD 3ECBB 4M1CC 4MQTB 3OKEB 1GOFA 3QT2A 4M8QA 3OR7B 2XZQL 4I5BA 1QQDA 3QBTB 1N3NA 1AIFB 4X6DA 4NZJA 3AS2A 4MDJA 4YZFF 2GJ6A 5KANG 3FAXA 5DJ6A 1LNUB 4ORGB 5C0DB 3SCMC 3SE8L 3MLYH 3PGFH 4FRWA 4GLRI 1T22A 4G7YL 5FXCH 2VIRB 4PJHE 4LKXA 4Y4HC 5C6PB 1ZHNB 3LPWA 4QRQB 1MJ7L 4UQ3A 3CUPA 1IGTB 3TBSA 5C0FB 4W6YB 3V4UL 3QG7L 3QIUB 3OF6A 3TZVD 1K6QH 2HMIC 1KOAA 1DTUA 3JSSA 4LLMB 2IADB 4NFCA 5MP6L 3TNNA 3BDXA 2W91A 1AGEB 1DVFD 4BZ1H 1BFVL 1R24B 1VEMA 4I48A 4UIMB 4Y1AB 1MAML 5JPMB 1DLHA 5CEXA 3BE1L 4M4RA 4DKEL 2O5XL 4LLYA 1RMFH 3VI3E 3EYSL 1CGXA 2OTUB 1QSEA 4LSTH 2AS5M 3MLVL 1W72B 4W68A 2JB5H 3P11H 4M1CD 3B5TA 3VI4F 4GW4A 1NCAL 5SWZB 1S3KH 1KCUH 1KNOB 4QXWA 5EULV 3T09A 3RHWK 4EN3A 5JHDB 4NUGL 3SCMD 2OS7A 4ONGL 2VWEE 3GSXA 4ALAH 1RZGB 3DRQB 4QY8B 1J5OL 4YBQC 2ORBL 3QXDA 4Y5XB 4NSKA 4Y4HD 4PV8B 4X6CA 4X6CE 3LV3B 1SBSH 4Z7QF 3MREA 2ITDB 5B4MD 2YUWA 3ISWA 5KS9A 2HMID 1MIMH 5KS9E 1UWEH 1MIEH 2F19L 2ERJB 2NXZB 4NJAH 2V5RA 4GH7B 2CDEA 4QOKD 4LFHG 2V5TA 4YC2B 4HH9A 2QQNL 4XZUB 1MCNA 2Y4SA 3B9KC 4H25A 1IEAB 3KNBA 4N0RA 1N6QH 3B5GA 5ISZA 4Q9CA 4Y4FB 5ISZE 4R26L 4JFEB 3WIFB 1RIUL 5EU6A 4V1DD 3IXTA 5CINL 5EU6E 3QISA 5IHUH 3DBXA 2YA1A 3MJ8A 3DRTB 4NO3B 5F1NA 3QCTH 5L9DL 1H0DB 2OM5A 2H1PH 1N59B 4RGNC 2VL5B 4CMMB 5I1LB 1IGJA 1TNMA 2X4PA 3SJVD 5KW9H 2OR8A 5HYSG 4IMKA 3GSQB 4DQOL 4WI4A 5D96B 2PR4H 4OAWB 2DB8A 1NGPL 1WEJL 5ALCH 1KEML 4YBQD 5KSVA 2X70A 1ZLVK 5JMOC 1A6UH 4TUJA 4P2RE 3E8UL 4QYOB 3DX8A 1G6RB 5D2NB 1DUZA 3OV6A 2QSTA 1TXKA 4MVBC 3U2SB 5I8OL 4P23A 1AR1C 1MCSA 2RJMA 1MRDL 3VFVB 3R1GH 5IKCB 3HC3L 4HMDA 5D6CB 5CKAA 1PEWA 5ALBL 3KPMA 1AXSB 4P46C 1CFSB 5ANME 3KPSB 1A3LL 2HFGH 2R1XA 4Y19D 3B9KD 2WLZA 4U6HB 4HIXH 2OR7A 3S3SA 3S36X 5DD1H 2MNUA 2J2ZA 2BVTA 2BHZA 2BHUA 1BJMA 1TJGH 1M7IB 2EZ0C 4ONOA 1OAQH 1ZANL 3TN0C 2EE9A 2DLFH 5D2LF 4RGND 5IVXF 3VFRA 1Q8MA 2ED9A 4JN2A 4UU9B 1KJ3L 4M6NL 4MA3B 1MY7A 2CSPA 2VISA 4PJDA 4PJDE 5JO5A 3HE6B 3O3DB 5FYJH 4Y16B 5HJ3B 2XZAL 4HHAB 1AC6A 2G5BB 4Y5VB 5HY9A 4NO0D 1NGQL 1MCQA 3H2WA 4MA1B 1TNNA 2WLYA 4JM2C 3MXWH 3RU8H 5AUMB 1MHCA 3EO0B 1A1MB 1JV5B 5CJXC 5C2BH 4RAVA 4JGJA 4JFDB 2DBJA 1OF2B 1LO3L 5EWIH 3STZA 4TVPE 4MVBD 2C5DC 4CVXA 2R56H 1I7RA 5FKPB 1AR1D 3BPOC 4JQVC 4XVTL 1JL8A 3MNVB 1NANI 4XNYL 4IMLA 2OXHA 1R3JB 1A5FH 4P46D 1LD9B 3HNSL 4HJGB 4CRPA 4PGEA 4XNUL 1ZS8B 4PJAF 1NBZB 2OYPA 5L0QB 3FONA 1BD2D 3DI3B 1IM3B 1R5WB 4GXVL 4NM8L 1C5CH 4XVJH 1CT8B 4QTIH 1NSNL 1K5NB 3OX8B 3WHXA 5AAWA 3CDGA 1U91B 3RX5A 1TMCB 1ZHBA 5HD8C 2EZ0D 4MLSA 1KB9K 1KCSL 4OCXL 3TN0D 4U6TA 3CLFL 4O58L 4PPTA 3M45A 4D8PA 3SKUD 4PFEA 4JRYE 5HDQH 4QXGH 3DMMA 3DUSB 5F3HA 3BIAX 4HCRH 4Y2DB 1EMTH 4RQQA 4QHKI 5GRXG 3AC0A 1F3JA 5C6WH 1FNEA 4QGTA 4JM2D 5DRNB 5SX4H 2VZSA 5B39B 3IDGA 4YFLI 3RGHA 5HDLA 1QBMH 1IC7H 3CC5A 2B1HL 3OJMB 4TN9A 1S7QA 2AJYH 1I7TA 1MUJA 4YHPB 1OB1B 3V4VL 1YPZE 1QFHA 5LQBL 2VR9A 4XPBL 4X5WB 3V6OA 3V6OE 5F9WC 1U8KB 3PL6C 4JANB 5FM5M 5I71C 3V8CA 2CKBB 5GS2D 2XPGB 3QUMB 1DUYB 3M8OL 4XNMB 5L2JA 3NABH 1KJMA 2IWGA 1QFOA 2VAJA 3WXWL 4PJXE 3S96B 4E41B 4X9GA 3AU1A 5LBSH 3GBNL 4OLXL 3DXAD 1N0XH 3DHMA 4JO1H 3GI8L 4WI3A 2FL5B 2Z8RA 3S88L 1MVUB 3D39B 3M17B 1N5YL 4YE4H 3B9AA 1FFNB 3D5OF 5HD8D 3UBXB 3CGTA 4JDVB 1Y18A 4PRIB 4KFZC 2CDGA 2MCPH 2GJJA 2HP4A 3NA4A 3QQ4A 4H1LB 5F3BA 1QNZL 4LLDB 5HHQB 1MFNA 4FFWC 1YMHA 4KDTA 3MUGA 3HI6H 4GRLA 2Z91A 2A1WL 1BVZA 1F4YL 4HXBH 3SKNB 4U1GC 1OOAA 2VLRD 1F97A 1BBDH 4X5LA 2VNCA 2IPKB 1SEQH 4ODSH 1FVDA 5D5MF 4FXGA 2DIBA 4F7TB 3G6JA 1G84A 1J88A 3P2TA 4U3XA 4U31A 4FQ1H 1I8KB 4KHTH 1NAML 3R8QA 5F96H 4LLWB 2AGJL 4KV5E 5GGSB 2AK4D 3PL6D 4LP5A 3RWDA 5FHBL 2ZSVA 3QO0B 5F8RC 5I1AA 4GXUM 3GMNA 5EZLB 1UGNA 2Z31C 5F89A 5C2UB 3QQ3A 3FB8B 1J8HD 4H5SA 1U92A 4MXQC 4OFIA 1MCRA 2G9HB 1JGUL 1XMWA 4QEGA 1DANU 4OGXL 5IW1A 5L2KA 3RBSA 4LHJB 5L2KE 5HHVH 5J1AB 1U41A 2XQBL 5EN2B 2NY4D 1FRGH 3QDAA 2EDTA 1WWCA 2W0FA 3P0VH 2XG5A 1NGZA 2YEZA 5DQDH 2VXSL 4EVNB 5GS2H 4K94L 1DSFL 1MEXH 2VJXA 4LPCA 3IDIB 4R4BA 3TF7C 3W0WE 4JFZL 2H32B 2GYSA 2J6EL 2DI8A 3HZKB 3RP1A 4KJYA 1Q9WB 1CFVH 2BVPB 1KB5B 3QI9C 2BC4B 2GTZA 2ARJQ 2C1PB 3LRHA 1V05A 4FQCH 4TSAH 5JDJA 4IIQB 3RJQB 4TQEL 1A7BA 1HH9A 1SJEB 1S7TA 4CVZA 1FN4B 4CNIB 1UG9A 5DUBA 2C7UA 2Z31D 1T89A 1AFVH 3VD5A 3PGDB 4JCMA 2OZ4H 2XTJB 3FFCA 4MXQD 3FFCE 3O6ML 3I3EA 5CP3H 3EO9H 3S4SA 1KGCD 2GITB 4LEXH 2NX5B 3MLXH 2J5LC 1ZLUH 2D31A 5I8EA 2WBWB 5J7CC 4HKBB 5C09D 1AKJA 2UY6A 1NDGB 1A1NB 5D1QB 3LRSA 1FH5H 4UQ2B 3CFEB 3U9UA 2ZUUA 2GCYA 7FABL 3MBEB 5FM5O 5DQ9B 4LLQA 3ARQA 1QP1A 2N7BA 1R5IA 4LNVA 4FQLL 4QRPE 2Z8SA 4M5ZL 2FBJL 4PLJC 3RX8A 3DX9B 2E8YA 3QI9D 3T2NH 5C08D 5IR1A 4LRIC 3OMZA 1NBVH 2LU3A 5EOTA 4D0BB 1FLRL 4GG8B 3F7PC 1CU4L 2G2RB 4OV6F 2HJKB 1KCVL 1IQDA 4LASL 3ZLQC 4BUHA 1U6AH 2ZKHH 4XC3H 1DBAH 3WS6C 1A9BB 3T0EA 3T0EE 1LEGB 3PQYA 1MF2L 3CFJA 3PQYE 5F93C 3QB7C 4OKVA 5F7MC 3SQOH 3C9NB 4AZ8A 1EVUA 4F9LA 2XKSA 2ZUQB 3VJ6A 1Z5LA 1NMBL 5JR1H 3WD5H 4R7DA 2FJHB 3WFHA 2J88H 4RGMC 1AO7A 1CE6A 5T3XE 1HHIA 1AO7E 5DUML 1YEKL 3P9LB 3MGTB 1Q1JH 1ZA3A 3CSYB 3EGSA 3VRJA 1CFBA 2AEQL 3AY4A 1I9JL 4UT9H 3BH9B 3KYMB 2R9HC 3H7BB 1E27A 1ZHLB 5ERWB 1GHFL 3ARWA 4PRDA 4UIKH 1JNHA 5DMGC 2DQDL 4PLJD 1G7LA 1JHLL 3JUZA 3RGVB 4PB0L 5IV2B 2XN9A 3CLEH 3G5VA 4NQCD 5F7EH 3BZ4B 2AQ3A 3DVNB 3TO2B 2ZNXA 5T1LB 4QKXB 1MLCB 1J1XL 3WUWG 4G42B 5CIPB 4WI9A 4UDTA 2XKNB 5E2WL 5D7KD 2J3SA 1AJ7L 1EGJA 4FQ2H 1UXSB 1YEGH 4ZUVB 1U3ZA 4MNQB 2DYPB 1NEUA 3L7EA 1NL0H 1G6RL 1YMMD 4FQQB 1ED3B 4NZUH 3PNWB 4OZFH 1MLBB 1INDL 2HJFA 1CQKA 1RHHB 3LN4A 1L6ZA 5EB9A 4L8BA 3OJDB 3L3OA 2J1KA 4TVSa 4D9RE 3FRUA 5K59F 1CCZA 3HLAB 4P59H 2ZCKL 4MA7L 1V7NL 3S36H 3F7QA 3GM8A 3T77A 4YDJA 3VMNA 2W60A 2MPAL 1NMCB 3HPJA 5EZJB 4Q9RL 5JW4Q 2PW1A 4FQHA 4M3JA 4M61A 3V7AG 1NCUA 3O4LA 5K9JH 1D6VH 5DMGD 2IH1A 4L4JA 3VFMB 2R2BB 2L7UA 5SWSD 4NCC2 1C08A 3U82B 2OLDA 3AREB 2J4WL 1IBGL 4ZG1A 3FB6A 3RWGA 5AD0A 1WT5A 3FJTA 4UDUA 3KPPB 3NFNB 2WM0A 1X5FA 4R0LB 3T08A 5E5MB 3HI5L 3B9EA 4XP9H 3UJTL 3SDCB 4ZAKD 4MB5A 1U8NB 1ZT4A 3QUYA 1T4KA 1L7IH 4WHYH 5JOPD 3DVGB 3I6LE 1WFTA 3KJ4B 4NP4H 5ABDE 3A6OA 4E5XB 3MGAA 3KLHC 1KSRA 3HR6A 2IBZX 5B38G 4HC1A 2E9IA 4E9LA 1NCTA 5K33A 3F8UB 4LQ1A 1BQHG 2YKLH 4OCSL 4PP2B 4Z7VA 5A2JH 1UWGH 4WNQB 4Z7VE 5IESH 4H0HB 2F5AH 5JZ7C 2FGWL 1TLKA 1ZV5A 1JPST 4YLQT 1FJ1B 1RUPL 1S5IH 1XGYL 2UWEB 3LKQA 4JAMB 5I16B 3OXRA 2XZQH 4I3SL 3U7AA 1OSZA 1L0XA 4ZXBC 4J4PC 1TFHA 2EYRB 2A74A 4NO5B 1RZIA 3SE8H 1SVCP 1FZOB 2Q6WB 1EX0A 2DLEA 1S9XA 3N1GC 1FE8L 1XFPA 4XBGA 3V6BR 2YPLA 2YPLE 1MJ7H 3BHBA 3V4UH 3QG7H 2AVGA 3UTTB 4XCEA 3VXQB 1YN6B 3S5LB 4JY4A 1YYLL 4N0UA 5ENWA 4QHKJ 2IH3A 2H8PA 2J8UF 5DK2B 4JREC 43C9A 2UZYB 1BFVH 4LLUA 1VFOA 4QRUB 2XFXB 3KLHD 2JB6A 1MAMH 2VLKD 2EE6A 3V0VB 1U8QB 5BJTB 4X9HA 3STBA 3BE1H 3HUJF 4DKEH 2O5XH 3RWFA 1ZSDB 3BH8B 2BNRA 3D0VA 5JZ7D 2BNRE 3HG1B 5INDA 1T04B 3QUML 3TIEB 5IHZA 5FUCC 4DGIH 2QADC 4HDIB 4RZCA 2DI7A 2I5YL 1GGCH 1UKTA 3MV7A 1NCAH 4S1SL 4PLNC 4G43A 3GKZA 1JNNL 4ZXBD 2VLLA 2CRIA 4FFZL 3B8SA 4NUGH 3JTSB 4ONGH 4YBLB 3IDUA 4ELMB 2AAVA 2WQ8A 1J5OH 2ORBH 5FGCE 1XF5A 1MHHB 3GGWA 3GB7B 1NLDL 3E2HC 5SV3A 1Z9LA 2WIIA 2EH8L 1S7VB 1C12B 2F19H 3BPNB 4HV8A 1EHAA 2ADIA 1CLZH 4Q58C 5KANI 5CJBA 3MYJB 4QRRD 4XAKD 3H0TA 5EOCL 1A7RL 1ZEAL 4L8CB 3OPZL 1QFUL 5ICXB 4JFOA 4ERSL 4R26H 1B2WL 4P2OB 4F80A 3N06B 5F6HI 5GGVH 1VPOH 3EOBB 5L9DH 1MCBA 2A83B 2QADD 1OHQA 4LARH 1CDJA 1B3JA 1T03L 1TITA 4JRXD 3VXUA 3VXUE 5DMIL 4EIGB 2FECI 2K3TA 3PWPA 3BPLC 1WEJH 3MO1A 3IDJA 1KEMH 4CVWA 3ESVF 3L3DB 3LS4L 4WO4B 2VQ1A 5KSUA 3GSNL 1OT1A 3N50A 2Y23A 4PBVC 1U58B 3UTZA 3LEVL 3E8UH 4N0FB 1CK0L 2BMKB 4AM0A 3W9EB 3L6FA 1T7ZA 3F5WA 4X6FB 5MEQB 5JPNA 5I8OH 2KKQA 5ID1B 1YECL 4OIBA 4WVRA 1WISA 1MRDH 3SE9L 1Q72L 1KPVA 3UO1L 1KB5L 3HC3H 1U8LB 3F7RA 3H6JA 5ALBH 5MERA 1ZVSA 3NFSH 3X13A 1U42A 4BSVB 1A3LH 1MJUH 5F7DA 1SJHA 3H3PL 1HIML 1YNLL 3L3IA 5E1AA 3T2OA 3OHXA 1DR9A 5T1KB 5DJDA 3PWNB 4N90D 1BWWA 4XP6H 3IKCB 2FATL 3LCYA 1UB5B 4I18A 3C8KB 3Q2CA 5GSRB 2EDHA 3OAUL 4FP8H 2EE2A 2AEIT 4DEPC 1IEBB 1ZT7A 1KJ3H 5F7LB 1N26A 5IFJB 4M6NH 3WJLC 3REVA 3ZL4L 2OL3H 4KC3B 2YSSB 2CRMA 3OG4B 1CDBA 1J1PL 1GH7A 3FQRA 1SM3L 4IOIA 4PJ7F 1CFNA 4NKQB 1JF1A 4Z0XB 1M71A 3TYFB 1W0WA 1NBQA 4G9FA 2BVOB 4G9FE 5KVEL 3SOBL 3O45A 5MI0C 2WINB 1HCVA 4PRPD 4RAUA 5I1GH 4XWOC 4PJGB 4XP1H 2XT1B 1LO3H 4J3VA 5HGBB 4WTXA 1I8LA 4FA8A 4JFHE 2YD9A 1ZLUK 4XXCC 3DO3A 4XVTH 4YEEA 4XNYH 3M1BA 1R3LB 3PIQB 3LN5B 1U8HA 2Q3AA 5DJ2A 4K94C 1P6FA 5FDYA 2BRRL 2ESVA 5IP4A 4XNUH 2ESVE 2BY1A 4DTGH 3P9WB 4OCRL 4GXVH 4NM8H 4POYA 1KC5L 2ILLA 2Z4QB 4ODXA 3KYOA 1NSNH 5HHOD 3T0VA 4P2RB 1X4XA 4KI5C 4RFEB 3SE4A 2D7QA 3Q5OA 2WBJB 1KCSH 4ZPVB 5H35B 3EHBD 3LQZB 2C1OB 1DQMH 2F53D 1YEDB 2HKFH 3CLFH 4O58H 1U8JB 2NLJB 3DETC 3WCYA 5DGQA 2BY2A 5CCKL 3UTSA 2GT9A 3UTSE 4HGWB 1A14H 4IRJB 2Y36L 3SDDA 4U1SA 1V3LA 1B9ZA 3ES6A 3F65A 3QAZC 4NKMA 1UVQA 5MEPA 4CMHB 4PTTB 3DJ9A 1IT9L 5I9QC 4P5KB 2VXVL 3HE7C 3MRNA 4KJQC 1RIHL 2EYSB 1K4CB 3SKJL 2JLLA 2LQRA 1R3KA 2B1HH 4XWOD 2F74B 4AT6B 1ADQL 4LHUA 1UM5H 2ED7A 1B4RA 1NJ9B 3V4VH 3CK0L 4WV1C 1WTLA 5LQBH 4XPBH 3G5YB 3VFUA 3ZYIA 1L7TH 5HHXL 5F72S 1T1YA 3MLSH 1PAMA 2V9RA 2DN7A 4B53A 3H9SD 5DSCB 3M8OH 4WUKL 1S7XA 3IETB 5DDHA 3WXWH 2Q8AL 3DNKA 4M7ZC 4HUKB 1A0QL 3GBNH 4PJIA 4OLXH 4NKOA 5BCAA 4PJIE 3GI8H 1IKFH 4PJFB 4QHLA 1AD9A 5FGBA 3VXRD 5SWQB 1N5YH 4KI5D 2ITCB 2P44B 1KTDB 5D2LB 4K3HA 1UJ3C 1INEL 3VCLB 3HHRB 1VCAA 5BV7B 1QFWL 4KK9C 3U46A 3DETD 3QPQC 4YXHH 1K4DB 3RFZC 5TF1L 2E9WA 2QHRH 1QNZH 4OF6A 5DMJB 2BSTB 1DVFA 5K9QG 1MAKA 3MRJA 5FF6A 4GBXB 4UOW0 1JGEA 2FB4L 3D9AL 1JUFA 4S1QH 4CU8A 4KI1A 1VGKB 2VDQL 3S37X 3MOBH 5EOQL 5IVZA 1KULA 1F4YH 2NZIA 2DTML 3JV0A 1TZHA 1JNLL 3VG0L 1B0RA 2EXWC 1QTYT 3HE7D 1LP9A 4KJQD 4HWEH 2X4OA 4D0CA 3ABZA 2Q86A 1Z9MA 1D5XA 1NAMH 1WAAE 4R96B 1FV1A 2GK2A 2AGJH 3FB5A 3MRIA 5IFAL 1G9NL 1CFTB 4QRSA 1PKQA 3IDYB 2VH5L 1PKQE 4JJ5A 4LKCA 1CL7I 3WFZA 4U1LB 4BZYA 3QEQB 4XGZA 3PDGA 4MGXA 2HT2C 4BK5A 1BWMA 1T7YA 4Y4HA 1QKZL 5SWZD 2CLVA 1G1YA 4YWGH 4OGXH 3BGFC 5KJRL 4NZRL 5MENA 5MENE 5FUOL 4UTBL 5J6HA 5JHDD 5F88B 2XQBH 2FDBP 4PJHF 2ZUWA 4KK9D 4DN4L 3QPQD 5HTSA 3GMPB 1EDQA 1ZGLP 2D3VA 4HKJB 4QOKA 4PY8I 4I2XB 4QOKE 4XP4L 5I73B 2VXSH 4K94H 4NWUL 1DSFH 2FO4A 2P5WE 1URLA 3MUZ1 3WFBL 4XX1E 4F37F 4PBXA 5KG9B 4K2UL 4WUUA 4JFZH 4WUUE 2EXWD 2J6EH 3D2UB 3MRRA 4AIZB 3L3JB 5DC4B 3F6IA 4V1DA 1ZWIA 3T0AA 1MJ8L 4V1DE 1OAXL 3QQ9C 1SYVB 5D8JH 5E6IB 1ITCA 3RPKA 4MMZC 4ELKA 1RZ8B 3GHEL 4DKFL 4RNRA 4U3CA 2D03L 3VI3F 2WUBH 4BM7A 4U7MA 2FH6A 4X5XA 4Y4KC 5C0AE 4OCMC 4HFWB 1L9MA 1CE1L 1T1XB 2LVCA 4Y4FD 3ILPA 3SJVA 3CVHH 4JFED 4OFKA 2D9QB 3C60B 3QO1B 5F21B 4P9ML 2HT2D 1BZ7A 3MLWL 3OKNA 4LLVB 1I9IL 4OZIA 1W0YT 3BT2L 1G0YR 5TE7L 3E0GA 2ZUTA 2X9YA 1WIPA 4MMXC 1TENA 3WXVL 1UWXH 4Y16C 2BFVH 1TQBC 3TYGH 4Y5VC 5IT2L 4HCRA 4MA1C 1H3GA 4X6CF 2R0LL 3HAEA 1FC1A 3ULVL 2WNGA 4GKSB 4R97B 3WBDA 5KS9F 3PWVA 2EC9U 5I1JH 3REWA 4FQLH 3B9KA 1A6VL 5EH1A 1PYWB 5GQBA 2EDNA 5F7NC 5HPMB 3ZHDA 5LAXB 5E6ZA 1N8ZA 2DRUA 4ZSOA 3IDMA 3F12B 3OXSB 4QHMA 4ZSOE 1T83C 3SY0A 3QQ9D 5C7XH 1AP2B 4FTVE 1KYOK 4RFOL 3K4AA 4NJ9L 2HH0L 4P2CG 4PJBA 3KPSD 4PJBE 5BQ7A 1FLRH 1SYSB 4RGNE 4Y4KD 3S4SG 1CU4H 2APBA 3BEVA 2WWMC 3MJ7A 3ARPA 1XGPB 4PJ5E 3AROA 1NEZB 3FN9A 1KCVH 4FHBD 4KWUA 4LASH 3ZYJA 4PD4J 1HH6A 2UVFA 5E4EB 2ZG3A 2Y6SC 1JWMB 4IHOB 4NO0A 1H5BB 1S9YB 1MF2H 2CLRA 1NCBL 3K1KC 2BDNL 2HG5B 4HS6B 1FL3B 3W0WB 2Y1VA 3B5HA 1BLNB 1XCQA 2HKHL 1EXUB 4HPOL 5B21A 1T0MA 4HULB 2FJGA 3HE6D 5DUMH 2AJ3B 4GRWE 3KPQB 1YEKH 4Y16D 5IEHB 3S3JA 1CLOL 3LKOB 2AEQH 5EBWB 5DHVH 5IOPA 2VDNL 1QA9A 3BWAA 3EOTH 1Y6KR 4P46A 2W0KA 4LSQL 3DOSA 1R5VB 4LSSL 3WL9A 4L9LB 5DJAB 1MWAH 1GHFH 3H9HB 1GPOL 4ODUA 1X4ZA 3W39B 4FZEL 4HZLB 1A4KB 5E8OA 3ROOA 4K7FA 4ODHL 4JG0H 1JHLH 4NM4H 1MAJA 3GMMB 3JV6B 1Q9KA 4YHNA 1T3FA 3UEZA 3SO5A 4UAOC 4AEHL 3RAJL 4KQ4L 5J0BA 4DCQA 3D85D 1J1XH 1MHPL 4NRYB 1DDHB 5ILTL 1VB9A 5CHNA 4LHQB 5TDOA 3FO1B 3UYOD 3V6ZA 4HUUA 1AJ7H 3KJ6H 3MX0A 1J87A 2Y6SD 1ZK9A 1KELL 3GUTB 1DN0B 3BRGC 4NZDA 4YGAB 5BZWA 3X3GH 1IGIL 1G6RH 1IL1A 1CR9L 4XPGH 4XCYB 3JTTA 4ETQA 2NY7H 5E9DB 1INDH 5JORB 4PJDF 5CJXA 3KVQA 2R2CA 3RNQA 3BVNA 1AGBB 3I84A 4JDZA 3ZTJG 2L0DA 3D25A 4OSUL 5T1DH 4MA7H 2IJ0C 3ARGB 5ID0B 4JQVA 4BQ6A 3RNKB 3VFTA 4M43L 5DEFB 1FL6B 4B50A 1NPUA 1S8DA 4Q9RH 4OFPA 2OSLA 4QHNB 3OQ3B 2XTLA 3V5HB 1I75A 1HSAA 5INCA 1RK1B 3DXAA 3DXAE 1Q0YH 5DYOA 1W8NA 3BP6B 1IBGH 2EIZB 4PLKC 1U8PA 2XACC 3H9YA 3KXFE 3HI5H 2Y7QA 5GGUA 4MAYB 5CSZA 5GRJL 4GXUN 3BP4B 3F7YB 3TBTA 4XTRD 4PTUA 4TUOA 3D39D 3BD4A 3W2DH 1I1AB 3FQUA 5EG6C 1F3RB 3KWWA 4NZTL 4O2CB 2VLRA 2VLRE 5EIIA 4MJ5A 1GC1L 5J13C 4RAHA 2X4NA 2IQ9L 1UKQA 1Q9OA 1EAPB 1QD0A 2C4FU 3PGCA 4XPHL 4OGZA 5JOFB 4R8WL 2X4UA 1I8IB 1J0JA 1RUPH 1XGYH 1IKNC 2AK4A 2EH7L 3PL6A 5CEZE 2AK4E 5IMMA 2BNQB 4LOUC 4FZ8L 1C5DB 2DKSA 4YDVA 4J8RB 3U7WL 1D5IH 1DQDL 1YPZF 4ZPTB 3DTXA 1OSPL 5L88L 1OP5H 2FWOB 3I6GA 2R1YB 1J8HA 1XR9B 2AQ2A 3P9MB 4IIQC 3FT4A 3MA7B 3KPNA 2BNUB 2R69L 5HVWA 1FE8H 3CFBB 4J2XA 4HBCL 3BAEH 1SJXA 2MQCA 1KPRA 2V9QA 4N9GB 4PJXF 3FKUS 4X8XA 4PLKD 5DK0B 5ESQB 1P7KA 1KG0A 3CXHJ 4L9DA 1II4E 1GZQB 4PG9B 2VDLL 1U9KA 4OLZL 4TOYL 2EDXA 1P84J 2FH8A 4IRZL 4DVRH 3ULUE 5HYJA 5HYJE 3FFDB 1C16A 4FXKA 2X4TA 1WWAX 3T65B 3RWIB 5F1IB 1OQXA 5EIQA 1F2XK 4M1DL 1DQLL 1M4KA 1YQVH 1A21A 1HN1A 1XH3A 3QDMA 32C2A 3QDME 1D9KC 4X7CC 4EI6A 6FABH 1A9EB 2YRPA 1CVRA 2XZCH 2PF6A 4U1MB 4XNZB 2QHLA 3OWEA 4LOUD 2V2TB 1RZ7H 4K9EC 3RUGB 3LKNB 5D72L 4JFXA 3TO4B 2EC9T 4H8WL 4OTXL 1JNNH 3CX5K 4Y7MA 4KV5F 3RIFF 4YIQB 5C07B 4AENA 5BV7L 1CL7H 2VUYA 5I1IH 3QNZB 4DZBB 5C0CB 5T1MA 1LGVA 3S37H 5C0GB 4OCYH 1FGNH 1UXWA 1QR1B 1NLDH 3LY6A 1OARL 4P4KC 2X4SB 3HA0A 2EH8H 4QRTB 2PN5A 2ZWLT 5CJQL 2HN7A 5I17A 1R0AH 4X98A 1ETZA 3IRPX 3K1DA 5JXAL 3VW3L 1G0DA 1UZ6F 4M7JL 3GSOA 1MFDL 2WZPD 2NX5D 5JDSA 4W70A 3ARFB 5EZOL 5AWNL 4Z7UA 4HK3J 4OLVL 4Z7UE 1YEFH 3WLBA 2LV4A 5DK3A 5EOCH 1A7RH 3I6KA 3OAYH 3QQNA 1ZEAH 3OPZH 4MHHG 1QFUH 3QI9A 5DRXA 4ERSH 4UINL 1B2WH 5C08A 4L8SB 2KQMA 3MROA 3PWJB 1D9KD 1CQYA 4GAGL 4HMCA 1LEIA 3SDAC 1FL5A 4P9HL 3BPCA 4JO2L 2MQ0A 2E6PA 3RGVC 4U1NB 3RTQC 5AZEL 4K07A 2CMRL 3LHPH 1YQ2A 3NH7H 1JZ5A 2KPNA 3HZYB 3U36B 1ONQB 5DVMA 4RCAA 4ETYA 3K8LA 2AKRA 3OKLB 3T4YA 4QNPE 5DMIH 2R2HB 1CDCA 2DS4A 3LS4H 3MRMA 3WNKA 4XNQB 5LCVL 3QFJB 4KK6C 1F45A 3GSNH 2IMMA 5JQ6L 1U8IA 3OKMB 1JZ3A 2DWEA 1T2XA 1CK0H 3VWJC 1WIOA 5H94A 2VKWA 2DJ4A 1JPSL 4P4KD 2DM3A 1NCCL 4PY8J 2J8UB 5IMOA 1QSZA 3HZMB 3Q5YA 1OWWA 2HTKC 4WFHE 3FO9A 2H32H 3WJJC 5C0EA 2FX8L 5EU5A 3SE9H 1Q72H 1XCTA 1KB5H 2G75B 3UO1H 5HXMA 3IU3A 2BXYA 3BMWA 3MV9B 5IFHH 1A6ZB 3SGEH 5GGRA 2UYLB 3H3PH 1HIMH 3GSVB 3H3BC 1J12A 4NNYB 5FB8A 1D7FA 5EUOE 3QIWB 3I02B 4NQCA 2ZJSL 3L95A 2FATH 1G9MC 2FLRT 4HK3N 4LRIA 5FYKE 3KLAA 4H26A 3O4OB 4MCYB 4JFYB 3SDAD 3QUXC 1K2DA 2HFFB 1RU9L 1WV7T 1F4HA 1H15A 3RGVD 3HNVL 3R0NA 3RHWF 3RTQD 4N0CC 4U1HB 1KIPB 5HGHA 3WS6A 1G9NC 2YBRB 3AREC 3ZL4H 5E99L 1YMMA 1J1PH 1YMME 5T1LD 2VDOL 2XWBB 2ADJB 3Q5TA 4R0LC 4X99B 4FN0A 3VGHA 4Z76A 1EFXB 2HJLB 3IKKA 4KK6D 1KTLB 4XRCB 2YHGA 5F70A 4M1GH 3TH2T 5KVEH 1BVLB 2R4RH 3ZE0F 1P4IL 3T2PA 1I8MB 4MNQD 3TPKA 3CPLB 3MACL 4XMKH 2JIXB 3G08A 4PD4K 1JPGB 2A9ML 4F7EA 5JA8B 4A6YH 4K9EH 2CIKA 1E4XI 3IFNL 4ZFFB 4IRSC 2D7PA 1UWXK 1BZQK 1B90A 1XZ0B 1XEDA 3BOVA 4WU5A 4MJIB 2D0GA 2BRRH 4K23L 4IOFC 5SWSA 4J3SA 3TLRA 1FG2A 2JCCA 5SWSE 4WJ5A 2XNAB 2JCCE 2YUVA 4M7LT 4OCRH 1OPGL 4NN6C 3FQNA 5KVMC 4JFFB 1NC2A 1ZHKA 2NW3B 3LQMA 2ZPKL 3QUXD 1JTOA 3MRFB 1G7JA 4K7PL 1BOGA 5E70A 4ZAKA 2FHBA 4GRMB 4R7NB 3VFOB 1E6JL 1LEKB 4N0CD 4MQXC 1IAOB 4G8GB 3GSRA 3ARED 3IFPA 4X6BB 1FFPB 3IDNA 5CCKH 3UJJL 4BSWB 2VC2L 1KLFA 2Y36H 4BJLA 35C8H 4PRAB 1WIUA 5E8PA 4RMQA 3BKYL 1NFDA 3SKOA 1HI6B 3NIFE 3E6HA 1MFAL 3ELAT 1ITBB 3SKJH 1AGDA 3KPRD 3TCXA 2HLFC 3BP5B 1ADQH 1IM9B 5CGMA 1XGQB 2NTFA 3WEXB 4L29B 5C0BD 3CK0H 2HLAB 4X4YA 2IFFH 4QO1A 1PSKL 5HHXH 3ULVC 3DV4A 5AG8A 1YEEL 4IRSD 2IAMC 3L7FA 5DLML 4D0DA 1U8MA 4WUKH 1A4JA 4IOFD 8FABA 1REIA 2J7LA 4S2SB 1WCBB 3MRPA 5BS0D 1WZ1H 3BYTA 5CIPH 4OF8A 4P3DB 1A0QH 3LVEA 1KPUB 5GGQL 4AIOA 3QWQB 4PGBB 1LE9A 3C09B 4CJ1A 4HUVB 3G5XB 1INEH 2YOCA 3KPOB 2NY0B 2NQCA 4ZUSB 2P24B 4PREB 5I15L 5HHME 4MQXD 1HKFA 2DD8H 1ZLWH 5BZDB 1OM3L 4BH8A 4LHUG 3W5MA 3DX7A 3VDAA 3D9AH 4IDJH 5E00B 4MQSB 1S78C 3L1OL 5EA0L 2IGFL 3UTTD 2PYFB 2RCSL 3OZ9L 2DTMH 2GSIB 4NUJA 3K80A 4AQOA 1CD9B 2PTUA 3BPNC 4BA8A 1WC7B 2EKSB 4KXZI 1G9MH 2HLFD 1VADA 5HGDA 4P2QB 4Z7VF 3NBNA 2GQHA 4DGVH 4QHUA 4DWHA 1NC4B 3ULVD 3NACH 2IAMD 4YGVA 4J6RH 5IFAH 4ZXBA 3FT3A 1JRHL 4XWGH 4ONHA 2VH5H 3UDWC 5T3XL 5E2VL 1SY6L 2DQUL 3W11C 4DZ8B 4WFFD 1S7WA 1LE5B 3EYFA 5KJRH 5CD3B 5IB3A 1X5ZA 5FUOH 3N85H 4UTBH 5ITFA 4FQIL 1OTUC 3VD7A 4ONFL 1QEWA 4DN4H 5F1SA 4HGMA 1KLUB 4WO4C 4GG6A 1OW0A 4GG6E 2HFTA 3LZFH 4CADA 2I27N 5CJ5A 1U36A 4RISL 4XP4H 1TCRB 2YMXH 4MXWL 4XPTL 1S78D 1WWBX 5DRZB 1XGTA 2DJUA 4TYUA 4ZUTA 3WFBH 2PYEE 2YXMA 2F58L 4K2UH 3CFDB 1BBJA 2X6MA 3K8KA 1BFOB 4NDMA 5IBLC 1CD0A 5GGSY 2ATPB 1MJ8H 2VXUL 1OAXH 4PJ8B 3DSNA 1ACYL 2LFGA 1MCWM 5HYIA 4LNRA 4DKFH 3GHEH 3HC0B 1MFBL 2IPTL 4EN3C 5T33L 2HRPL 2Y9RT 1FNAA 3LKPB 2R1WB 2VWEC 3VXTA 1CE1H 2FJFB 2XQYG 4L4TB 5DJYB 4XI5C 4JRXA 4L4VB 5K9QI 4G8EA 4JRXE 1O5DT 5DRWB 4CU6A 1YY8B 3ARBC 4I0PC 4P9MH 3W11D 4NQSB 1MH5B 3MLWH 3TBVB 4RMTA 3H7LA 3QG6A 1I9IH 1LO0L 5I8CA 1CD1B 3BT2H 4ZFZB 3LB6C 2F8OA 1FZJA 4ZTOL 3HN3A 1AE6L 1OP5K 1OTUD 3WXVH 3EAKA 3QR2A 3ZKXC 2CD0A 1AHWB 3ZMRA 4F2MB 1QBBA 4KZEL 2R0LH 4WO4D 3RKPA 3FB7B 4LAJH 4XNXL 3ULVH 3C6LA 3DGCR 4LAQL 4LF3A 1JPTL 3LQAL 1IQWL 2F9BT 3MGOA 4O2EB 1HQ4B 3GI9L 4GS7B 4YR6B 4V2CB 5MHSE 5E8NB 2ICES 5IROC 2DQTH 5IBLD 3PV7A 4WDIB 5A1AA 3OR6B 1GC1C 3OKOB 3WIIL 5CFHA 1AI1L 1AR2A 1A6AB 4RFOH 4ZOAA 4YDKH 3FL7A 4NJ9H 2HH0H 4EN3D 3IJYB 3L5HA 4YBHA 4XI5D 4YO0A 5EO9B 3O3BB 5C9JA 2WK2A 4KHXL 3MRDA 5FA4B 5I74B 1QQDB 1UKSA 3ARBD 4X9IA 4GKZA 3HCVA 4X6DB 2XXMB 2X1QA 4I0PD 3O6KH 2P5WB 1MCEA 3HAEG 1NCBH 2GJ6B 5DJ6B 5C0RL 5D4QA 2BDNH 3V5KA 3LB6D 2V17H 4PRPA 4K7PX 1PG7L 1F00I 2HKHH 4HPOH 1RJYA 1CGYA 4YK4B 1JZ8A 2GK0A 1LO2L 3P77B 3CUPB 5GS3A 3SQBA 3WHE1 1ZVYA 5C0AB 2IQAA 4W81A 3RX7A 1EBPA 3VGDA 5LGJB 2QR0B 1BIIB 4LSSH 4LK4A 5EU6D 3D3VE 3T3PE 1GPOH 3OGCA 2FYYB 5D6DA 4FZEH 2QTEA 3V5DB 3GM0A 4I48B 4YHKL 1T0NB 1JHTA 5I76A 2H6PB 4PV9B 1OGTA 3GSWA 5E0QA 1NAMA 5KZCB 4AEHH 2F53A 1QSEB 5GSVA 4HZAA 4NNPL 1MHPH 5HDBE 4NO2A 1MCLA 5JXEA 1F6FB 5ILTH 4H8WC 3SKMA 4M6OL 4P2RD 4RGOH 1KELH 1IGIH 2I9LA 5BV7C 3GMLB 2EICA 3AM8C 1KXQE 5I1DB 3TIDA 5E2UH 2OI9B 2V7NA 2O61A 3D0LB 3Q1SL 4C56E 4K3DL 5FO7A 2YZ1A 2X42A 3VMPA 1F13A 3KDMB 4OSUH 3HR5B 3CJJA 4XXCA 1RUAL 3I2CH 3MREB 4M43H 5D7SL 2B8OT 1UQSB 4MDIB 3TA3B 3CCHA 5DD0L 1PLGL 1PJ9A 4HIHB 5HHPA 4HKZA 2ATKB 1TZIA 1D5MB 3ECBA 2OJEB 3L3HB 2J6EA 3OR7A 2X4RB 1B88A 3BZDA 3MLPA 3VXRA 4OD2B 1J11A 4KI5E 3DROB 1LNUA 1OGAB 4G6ML 3NPSB 4ORGA 5C0DA 4LVOB 3BMVA 1U2HA 4P9HC 1XF3A 4I3GA 3VFGL 3MJ8B 1A6TB 2VIRA 3X11A 5KOMC 1CDUA 3QCUH 4N9OB 5LWYL 3MBXL 3S6CA 4XH2B 1ZHNA 2CJUL 2MQ3A 4HUXB 1KXTB 2B1AL 1IGTA 4MD4B 5C0FA 4P3WA 1EO7A 2J8OA 1EEYB 4OLYH 3LN9A 5EBGA 4Q9QH 4TVPD 4LLMA 2IADA 4NZTH 1RHFA 2MMXA 3HE7A 2I07A 4J12A 1GC1H 2PW2B 3V6OC 5DURD 5KSVB 2IQ9H 5DS8B 1MNUL 1T80A 1EZVY 4HQQL 4UIMA 1BHGA 4Y1AA 3BI9X 5E8DL 3ZKSD 4Y1AE 5JPMA 4HXAH 5J1TC 3T0DA 1PQZA 4TUJB 4OM0L 4R8WH 3AAZA 4WV1A 4OV5A 3DX8B 1VFUA 5IB2B 1WZKA 2EH7H 5T5FH 4FZ8H 1P4LB 2WIMA 4P23B 5C3LD 4RA3A 1A7OL 1DQDH 4E42A 4PUBL 3STLA 1OSPH 2VLJB 2APFA 1UYWH 3EFDH 1CICB 4L3EE 5SWZA 3U48A 4JRYD 5SWZE 1KNOA 1UJ3A 4LSRH 3WV0A 1EUTA 2A77H 4MNGB 5JHDA 5JHDE 4BQBA 5L6YL 1EV2E 1RZGA 3DRQA 4QY8A 4PJIF 5HYFA 2IG2L 2AXFB 1BAFL 1RAMA 5EORH 4W6WB 5KSBB 5FECB 1LK3L 3WFCL 4PV8A 5F9AC 4YDLB 4IRZH 4LDOB 5HVHB 4JLRB 3VE0B 5F6IB 2ITDA 5J12B 5BMFL 2VISB 5IVOA 3RVVC 4M1DH 1A8JH 1DQLH 1DEEB 4DN3L 4OB5H 4JKPL 1OP3H 4C4KO 3FQWB 5IM7A 3CFCL 5F7WC 4HS8L 3PXJA 1JZ2A 4KXZH 4RAVB 1LP9F 5B3NA 1J0HA 3NFPB 4Y4FA 4JFEA 1I3VA 1VFMA 3NMEA 4P57A 5D72H 3WIFA 3GMOB 4OTXH 3VD9A 3ARTA 3DRTA 4NO3A 1IAMA 3MLZL 3O8XB 5DZNA 1NGWA 2P42B 4Y5YB 4M62H 1N59A 2YK1L 5BV7H 2VL5A 3IJHB 4CMMA 4TVPH 5I1LA 2EDLA 1YNTA 3KLDA 4PGEB 5F7FA 5FEBA 1N2RA 3FONB 3GSQA 1TVHA 5E4EC 1D5ZA 1T1WA 4OAWA 1OARH 2AV7B 3V6FB 3O11B 1T0PB 5CJQH 4HUNB 1U93B 4EJ1C 4M03A 3WSQH 1OAZL 4X6EB 5JXAH 3VW3H 4M7JH 5JIIA 4HK0B 1MFDH 4QYOA 4TPRH 5AWNH 1G6RA 3T0XA 5D2NA 5D2NE 4OLVH 3DI2B 4GUPA 4DUXA 2IC2A 4RQQB 3RVVD 1Z9SA 2BRQA 4NQVA 3NOIA 5IKCA 5D6CA 5TF0A 3KPSA 3O2DL 4L9LC 3KPSE 3FOMB 4GAGH 2H3NB 4NWTL 3CC5B 1J1OL 1HEZA 4LGRB 1HXMB 4JO2H 5EBLB 4LVHC 1MUJB 4LDLB 5AZEH 5I1CL 1S9KC 3SEPA 2E9BA 3QHFL 5EC1B 1SHMA 1KFAL 5FO8A 5D7LB 4LSVL 1GAFL 4UU9A 2ADGA 1Z9OA 4L8DB 1HZHL 4RIRB 5LCVH 2A6IB 3JVGC 2FNBA 3HE6A 3O3DA 4Y16A 5ECJE 4Y5VA 3ZSSA 4MZ2A 3QCVL 1JPSH 1NCCH 5GGVY 1MFEL 3BSZH 4RX4D 5AUMA 2X44D 3EO0A 3W0WD 1JV5A 3G9VA 5FA3B 4UB0L 4JFDE 1OF2A 3D18B 1I3GL 2IPUG 5K93A 2Z0BA 4WTZA 3EJYC 5FKPA 1T83A 4OT1H 3MNVA 2Z91B 4LCIH 1MHEA 1R3JA 3HI1B 1FORL 3QNYB 1LD9A 3G9AB 4K71B 4XBPB 4HJGA 1FVDB 3D85A 1ZS8A 1KBGL 2DI9A 4Z5RB 5BRZB 3G6JB 1RU9H 1IM3A 1R5WA 2V2WB 1CS6A 3UROR 5BO1H 4YUEL 1CT8A 4H0IA 1K5NA 3OX8A 4PJBF 1U91A 1XAUA 4OUUA 3QIBB 5DMKA 3RWDB 5E99H 1KEGH 2ZSVB 2VDOH 1AKJD 3GMNB 3VXOB 3DUSA 4MAYC 4Y2DA 5DI8A 4JHAL 4MHHI 3AY4C 2VQUA 4Z7OE 1P4IH 4OQ1A 2YXFA 5E2TH 1JIBA 4QRPD 1I1AC 3MACH 1E4JA 2VAAB 2GAZB 5DRNA 3EOAB 1KT2A 5FYJU 5E9DD 1MCJA 2I24N 4PS4L 4GRWF 3IFNH 1UCTA 2YUZA 4I77L 1NGZB 4YHPA 1FIGL 2APVA 3EJYD 4K23H 3RA7L 4WFED 4WEBL 4WI7A 4WI2A 1U8KA 4YEFA 2APTA 3JZ7A 4WY7L 1ZAGA 3WO3B 2D4FA 4JANA 1OPGH 4WIQA 4XC1H 1A3RH 4F58L 2XPGA 4ODWB 2IFGA 3GRWL 1DUYA 3QUMA 5D1ZC 2H9GB 4XNMA 2ZPKH 4AL8L 2BP3A 5E94B 3WN5C 2GTZB 4ZOBA 4K7PH 4E41E 1XIWB 1E6JH 3PHOA 4GO6B 4JY6B 3ARDB 3S8WA 4HSQA 1MVUA 3D39A 3M17A 1Q38A 3D39E 1FFNA 4F7PB 4S1RL 4JDVA 3UJJH 4CVZB 4PRIE 5T3XD 1AO7D 5GRUH 5E8EB 4H1LA 4MAYD 3BKYH 3UTOA 3P4OB 4PYHA 2CLZB 1MFAH 5HHQA 3W5NA 1T21B 1GOGA 4JKMA 1I1FB 2YD8A 4I4WB 2P8MB 1J0IA 3O2WL 2MKWA 1I1AD 3SKNA 3U0PB 2D31B 3ZHLA 2IPKA 1CIDA 3MV8B 2C3WA 1PSKH 3LRSB 1NCWL 3LQAC 2YD7A 2VMFA 1Q94A 1I8KA 4JKWA 4NRZB 3U9UB 2ZSWB 4Y0GA 4LLWA 1WT5C 4LLQB 5GRVL 1AXTL 1R5IB 5GGSA 1L4IA 2WW8A 3NA9L 4XNZC 1M05A 2VZTA 4L1DA 5GGQH 1HKLL 3TO4C 3OKYA 5D1ZD 5DQJB 3V0WH 2A73B 1RZFL 2B7DT 3FB8A 4PR5B 5DXWA 5IR1B 3C5JB 2VABA 4YHLH 5I15H 4F37K 3RWHA 2CO7B 3BUYB 1OM3H 3K8MA 4D9RD 1IQDB 5J1AA 3U4AA 5EN2A 1ROWA 3TV3L 3AVEA 3DX6B 3LIZH 3U0WL 3L1OH 5EA0H 4NQUA 3VU2A 2IGFH 2RCSH 4PB9L 1KN4L 1EIBA 2D7OA 3LS5L 2XA8L 2R4SL 2R23A 5IB4B 4LSPL 4N0YL 1CXIA 1MOEA 4OKVB 2BVEA 4ZOEA 4EOWL 3O3EB 1IRAY 4EVNA 3OKKB 5EUKB 1B0GB 2ZUYA 3MR9A 4GSDL 2NZ9C 1IKNA 4TSBL 1HHIB 2H32A 2BVPA 2MWCA 3VRJB 1ZA3B 3EGSB 1KB5A 5GJSL 5DWUH 2FHCA 2C1PA 3BX7C 1JRHH 5EPMA 3FMGH 1MCCA 4IIQA 3UJIL 4HWZA 5T3XH 4UT6L 5E2VH 1UH3A 1RJLB 2JJSC 3O6FB 3QULA 1FN4A 1JNHB 4ZFOL 4CNIA 3TO4D 1LO5A 1I3RB 1HNFA 1KUMA 4JQIL 4XBEL 5D71H 2XN9B 3G5VB 2YA2A 4FQIH 4LCCC 4ONFH 2XTJE 1KJVB 5KTEL 1X7QA 1YJDL 1N0LA 3B3IB 4WHTA 5F9DC 3ZTJH 3RZCB 2GITA 1W0VA 4G3YL 2NX5A 2BHYA 5D1XB 3DURA 2NX5E 3SE3A 1W8OA 2ZZUT 4HKBA 1UM4H 3THML 2KQNA 1IZJA 1NDGA 3SGKC 3IAGC 1A1NA 1NBYA 5D1QA 3JWOH 1YA5A 3BW9B 4RBPH 1GZPB 3ULUF 4UQ2A 1ZMYA 5DEGB 3CFEA 4M7LL 3P4NB 3D69B 3MBEA 3O3AB 5DQ9A 1S7RB 3ARFD 2ICWB 4L8BB 1ACYH 3L3OB 4EDXB 1EGJH 1JBJA 4NKIH 2IBZY 1JGDB 2NZ9D 3HMWL 1MFBH 4D9QD 5T33H 2HRPH 1A1OB 3SDXB 4K3EL 3DX9A 2GW5A 4G6FD 2W60B 4TRPH 2NYYC 2WP3O 5HYEA 3C08L 3IYLW 4OGYL 3EZJB 4YH6A 4GG8A 2HVKA 5C8JA 3MRLB 4WW2C 2G2RA 2PW1B 2HJKA 5HI5C 3QDJB 3O4LB 2YA0A 3BKJL 5ESAB 3N0PB 2IH1B 1LO0H 5A2LH 1INQB 2LTQC 4J3WA 3P0YL 1C08B 4ZTOH 5I19L 1AE6H 1X6NA 4KZDL 4DVBA 4P4KA 3WFEH 4FQXB 1J8KA 2PCPB 4R2GB 4UDUB 4TUKH 1EPFA 1FAKT 4XNXH 3CAFA 2FJHA 3RWCB 2W59A 4OF5A 4LAQH 1JPTH 3LQAH 4MJ4A 3BRDA 3P9LA 4WU7B 3QUYB 2FEEI 3WO4C 3GI9H 3QEGL 5E7BA 4OIIL 3MV01 1FLTX 1J7VR 3BH9A 3EKCA 1MRCL 3KYMA 3H7BA 4Z7UF 4D3CL 1NH6A 1ZHLA 1QO3B 1ADQA 1AI1H 1FDLL 4FMFA 4NQEB 3SDAA 3QRGL 1OTTC 2CR6A 5CBEB 2EEAA 3MV9D 5ACLA 3HB3C 4MX7A 2ZUSA 1D5BB 1V3KA 1HOCA 1LDSA 4KY1L 3RGVA 3VFWB 3RTQA 2WWKO 4MWFB 2QBWA 1OP3K 1K85A 3LKQB 3BZ4A 2NYYD 3DVNA 4KHXH 3WFDL 1YEJH 3QHZL 3TO2A 3MJGX 5T1LA 4F3FB 1MLCA 2BX5A 5CIPA 5HI5D 3K2UL 1UT9A 1PZUB 2PYEB 1RZIB 4NC2B 5CEZL 4ODBD 1UXSA 4QNPF 4Z0BL 1T20B 4MNQA 5DJCB 4MNQE 4XBGB 5DUPL 3MNWB 4OFYD 3NZHL 5DMYA 3PNWA 3GJFH 5EU3B 3UPAA 1CN4A 1MLBA 1CTOA 5IG7B 3WJJA 2ADFH 1RHHA 2OTPA 4XAWL 1NGXB 3BHBB 1Z6JT 1EFXD 3OJDA 2Y07L 2GKIA 3PABA 5KVFH 4JY4B 4N0UB 1NFKA 3HLAA 3X14B 2IH3B 4R9HA 3TT1H 2VZ3A 5J89A 43C9B 4LLUB 1NDMB 2E7MA 2JB6B 4WHDA 4Z95L 1FFOA 2YD5A 4HGKC 5E6YA 2AP2A 4H0GA 5DC9B 1PX3A 1RIVL 3QUXA 1BQUA 5FYLE 3ULUL 1OTTD 5C0IB 4PJEB 5EUOF 3VFMA 3HB3D 4NNPH 3VGGA 3RVUC 3VA2C 3U83A 5INDB 1FGVH 1QZ1A 3LKSA 3IT8D 4CVUA 5ELIA 3AREA 1C1EL 4POUB 2XWTB 1FNHA 4M6OH 4OZHA 3KPPA 3C09C 2XRAL 3NFNA 4FQJH 1CLYH 4JPKL 4R0LA 3BDBA 5E5MA 1EFQA 4LBEB 2LVEA 5IB5B 3G5ZB 1KB9J 3IDXL 2NY0C 2M2DA 3BO8B 2OBGA 3DVGA 1OCWL 3KPRA 3Q1SH 2F5BL 2ZCLL 4K3DH 2NTSP 3BKCH 3ROLB 1C5BH 1RUAH 4PP2A 1M7XA 4WNQA 5TE4H 5D7SH 3I50L 3P4LA 3EDEA 5LXGH 2ED8A 1FNSH 1RUKH 2DAVA 5DD0H 4AMKL 3KYNA 4IM8A 4W4NA 5IWLC 1J86A 3CMOL 4HIIA 3GBML 1FJ1A 2NY6C 5BS0A 2UWEA 3QUZB 4XPAH 2UWEE 5GS1C 1IFHL 4JAMA 1FYTB 5I16A 2A6KB 2CQVA 4P48A 1T2QH 2EEBA 2GTWB 4H20L 2EYRA 2R29L 2VUOA 5JLZB 4JFOB 2JCCF 2XY2A 5SX4I 1FZOA 2Q6WA 2D0FA 1WICA 3G6AA 3RVUD 1F3DH 3VFGH 5LWYH 2FIKB 5J8OA 3MBXH 2CRZA 4U4BA 2CJUH 4X8JB 4G9FD 1HYSC 3T1WA 4LDEB 2QQKL 3UTTA 3DECA 3UTTE 1YN6A 2NY1C 4HKXA 3DV6B 3S5LA 4OZ4A 2X9WA 2NY0D 3PWPB 3MO1B 3IDJB 3U9PH 4QRUA 2XFXA 2CK0L 1MNUH 2VQ1B 4HQQH 2V5YA 5E8DH 1ND0B 5F71A 5BJTA 1NFDF 3NIFF 4OM0H 5CILL 1LO4H 3BQUB 4AM0B 1ZSDA 1AQKL 4YHYB 3BH8A 1YDPA 4LRNL 2G60L 4KGJA 1GCFA 1B0WA 3HG1A 3GK8L 3UTPD 1JZ4A 3HG1E 2C3VA 1A7OH 5FGBC 3BXNB 1UCBL 4JR9L 4PUBH 3TIEA 2NY6D 4OLWL 4JM4H 4P2QD 2FO1A 1QUNA 3S34L 1F3DJ 5ITBL 2C3HA 2NNAB 2VDML 4M6AA 1A7NL 2DOCA 1NC4D 1SJHB 2L7JA 4YQXL 2APWA 3OHXB 5E7FA 1DVFC 4C56B 2B4CL 4NN5B 1KJ2B 3MXVH 3QXAB 3JTSA 3UTSD 5L6YH 4ELMA 1I85C 2PXYB 4ELME 3LAFA 2IG2H 4I18B 1BAFH 1E28A 3C5ZB 5TDNA 2B2XL 4MJ6B 1MHHA 1HYSD 3GB7A 3MNZB 5FYKL 5B8CB 2NY1D 3NGBC 3REVB 2G5RA 1S7VA 3LKRB 4M3KB 3SGJC 2OR9L 3DSFL 3TEUA 4JKPH 4MYWB 2AV1A 1W0WB 1A64A 2X1PA 4HS8H 3DPBA 1PKOA 4GS7C 4L8CA 3MOQA 1CXFA 2PTTB 5ICXA 4JY5L 1CXLA 1J0ZA 3NAAL 4PJHA 1J0YA 1DFBH 5DHYB 3OJ2C 3UDWA 1SJVA 1ES0B 1FVEB 2DL2A 3EOBA 3MLZH 4M5YL 5B4MC 2YK1H 1IC4H 3U0TA 4LGSB 5EO1B 4EZMA 4L4TD 2DICA 3TH4T 2ARWA 4L4VD 4OKDA 4OQTL 2YS4A 2AJVL 2JELH 4HWBL 3HFML 3KYOB 3ARUA 3GMRB 5C86A 1IGFL 5KSAC 3L3DA 2VSCA 4WO4A 1OAZH 1U58A 4URTB 3UZQA 4N0FA 2NW2A 4PJCB 5CSGA 5DD6B 4X4XB 2HT3D 3SDYL 2L4OA 4BK4A 4X6FA 5FDWA 4HPYL 4YK4C 2DM7A 1AD0A 4YX2H 4GG6F 2GT9B 5CP7A 3CDYA 1M6OB 4NBYB 3ZDZE 4L3EB 4V2BA 3ES6B 3TBYB 2P4AB 3GBLA 3JWDL 3DYPA 5MEPB 4HEPG 1U8LA 3NTCH 1N5AB 2FLBT 2FX7L 4BSVA 1A02N 3O2DH 1JN6A 5DR5H 1J1OH 3UZEA 1F6AA 4JPWL 4DUVA 2AJXH 3PWNA 3MRHB 3IKCA 4NN7B 5DA0B 4N5UA 4XMPL 1UB5A 1ZTXL 3VFUB 1TVDA 3ARBA 3QHFH 3GJEB 3WKNA 3C8KA 4U6VL 5MEND 5GSRA 3RPIB 4I0PA 2KL6A 1U8OB 4JO4L 1KFAH 3KYKL 5I75B 4LSVH 1IEBA 3SBWC 1QR4A 3OBAA 2YD3A 5IFJA 4U2YA 1RZKL 2W65B 1F42A 1HZHH 3WKML 4G8IB 1FO0L 1T5XB 3UYRL 2YSSA 4U6YA 4Q0XL 4J3TA 4CAGA 2FEDC 5FOBB 1HHHB 3O0RL 1AD9B 3QCVH 5KSAD 2P5WD 1MFEH 2D2OA 1HDMA 1V8HA 3TZVB 1WBXB 4WUUD 2BVOA 4NQXB 2WINA 4Z7QE 4PJGA 4PJGE 2QQLL 4UB0H 3VGBA 1I7UA 1I3GH 4NFBA 4CBPA 5HGBA 4R4FL 5JMRA 1Z2KA 4J7RA 4U2ZA 1JUFB 4YNYB 5IROA 1ZA6B 4LL9A 5J11B 3O2VL 4XMLL 5C0AD 12E8H 2QSCH 4NOFA 1FYHB 3PIQA 1QRKA 3LN5A 3RDTB 1PD6A 4GT7A 1LP9B 3DVIA 4RBPK 2ZNWA 2EIBA 4D0CB 1XR8B 1F4WH 2EDQA 5AYQA 3OKDB 3QWOB 1RULH 4WWKB 5FCUL 3U30C 1EA9C 1FV1B 4XHJC 2R0WH 4JFPA 5H8DA 4P2RA 2FRGP 4RFEA 5KZCD 2BSRA 4MXVE 5H35A 1F2QA 3LQZA 1KV3A 2Q1EA 3A6BL 1U8JA 4PRNB 2NLJA 5F1KC 3SCMB 5IHBA 1BFSA 4LP4A 1FZKB 1KIQB 1GGIL 4EQ3A 4Y4HB 2FEDD 4HGWA 4WTZG 5A3IC 3S35X 5ANMA 2D0HA 1QLFB 3LEYL 3UC0L 4Q9BA 2VERN 4P5KA 2DKMA 3B9VA 2EYSA 4PS4H 3I75A 1WZMA 4FTVD 4AT6A 1QBAA 4PP1C 2QSQA 5ADPL 1TPXC 2ZOLB 4I77H 3UPCA 1FIGH 1NJ9A 1E6OL 3RA7H 3DWTA 1K3ZA 4WEBH 4EI5B 2FO4B 4LQFL 5CD5C 3ALPA 4R3SA 2V9TA 4PJ5D 4JQXC 4MZ3A 3T3PF 4CN4A 1XT5A 2VL4A 4F58H 3GRWH 2Q7NA 2VZUA 3WMSA 4WI6A 4AL8H 1PG7W 1CXEA 4KVCH 5GISH 5DTFB 1FG9C 2B5IC 5IBTL 1CICC 2HA1A 2A9NL 2EDFA 4PJFA 4XHJD 4PJFE 4O02H 5SWQA 2DL9A 2ITCA 2OP4L 2EO9A 4S1RH 5D2LE 3L9RA 4DGYL 2ZP0T 3VCLA 5HDBF 4OLUL 2Q76A 4LPVA 3AM8A 4YJZL 4Q97A 5IQ7L 1BEYL 2P7TB 3L5WB 1BZ9B 2BSTA 3DGGB 3QSKB 4XB8A 1Z0NA 1P5VA 4M8VA 3OKNB 1WK0A 4RWYL 5A3ID 4OZIB 1YNKH 2R0ZL 1A6WL 5F6IC 1VGKA 5J12C 3HZVB 3PDOA 4O5LL 1IGCH 4KDWA 1QYGL 1RURH 1S5HA 2FGZA 4PP1D 3K46A 2CDFB 3GJFK 1U3HC 4R96A 3PWVB 4RMRA 3REWB 4JRYA 4Y19B 1YN7B 3NA9H 5CD5D 3GIZL 4MD5B 1YUHA 1ERNA 4I8DA 2ZUXA 3HAEH 3SGDI 1MJJB 4U1LA 1FBIH 1RZFH 3SY0B 4H1LG 1B6UA 1KN2L 3QEQE 4XCCL 4KI5F 1CICD 4KGLA 3BEVB 3DO7B 4NCC1 3MMEB 5F88A 2JE8A 2W0LA 4UT7L 1TVBA 3O9WB 1YPZA 5DVOA 4PB9H 1JPFB 4YHML 4NO0B 1KN4H 2XA8H 2CLRB 4HKJA 4N0YH 4I2XA 4EOWH 4I2XE 3ZO0A 4NPYA 4KRLB 4GQ9L 4GSDH 3F7VA 4TSBH 4PJXA 1FNGA 2FJGB 5C1MB 3HNTH 3D2UA 4HF5L 4AIZA 2FSEB 3L3JA 1EHLH 4APQC 5GJSH 1SYVA 2ZG2A 2A6DA 3MLUL 1RZ8A 3BWAB 1U3HD 1O7VA 3UJIH 4UT6H 2W9EL 4GRWH 2NY4C 4HFWA 4ZQKB 3KXFD 4R4NC 4QXTB 5FFLA 1A2YB 1T1XA 5KN5B 4JPVL 1QVOB 1BD2B 4MJ2A 4KKAC 4W6XB 3KR3H 3C60A 4P5MB 43CAB 5CZVL 3ULUC 1F11B 4JQIH 3QO1A 4YHNB 3O8XD 2X5PA 4HJJH 5KTEH 1KLGB 3NIGE 4LLVA 3TN0B 3PWLB 3VRIB 2X4QA 5BVPL 2LAAA 2NY2C 1JTTA 1V7MH 5TDOB 3THMH 3UPRB 2H26B 3V6ZB 3EDKA 5IEKB 1QBLL 1NCNA 3AGVA 4BH7B 2AABL 1N64L 2VDRL 3MA9L 5HI3D 5CEZD 4M7LH 4JM2B 5BXFA 4GKSA 3B6SA 2NY5L 3RNQB 2Z92A 3ETBF 1PYWA 3BVNB 1H8OA 3HMWH 4LVNC 4JDZB 5LAXA 4O51A 4K3EH 3F12A 3OXSA 5C70A 3GKWL 1T5WB 4LMQE 5I8KH 4APQD 4ZDHA 3BPOB 3FN0H 3VFTB 1WFUA 1A6PA 4OGYH 4FFYH 1KJ2L 1SYSA 1S8DB 1IGMH 3GNMH 4R4ND 2VDKL 1XGPA 1H3XA 1NEZA 2K1MA 4KKAD 3V0AC 5INCB 1H8NA 1JWMA 3ULUD 4IHOA 4M93C 4X80L 5HYJD 5I19H 4L5FH 4KZDH 3CDCA 3KPTA 1S9YA 2GY7B 5D7LD 4RX4A 1FL3A 3W0WA 1IJ9A 5D7IB 3PHQA 3H42H 3PGFL 3T1FB 1EXUA 2NY2D 2Y7QB 5GGUB 4JZNB 3DARA 4LGPB 1Q0XL 3QDMD 1FFQA 4BZ2L 5IEHA 4PG2A 2ARJA 4PTUB 1F8TH 3LKOA 3P30L 4FS0A 2QSVA 4BFIB 4OIIH 5EBWA 4YPGB 5E2JA 5EFIB 4C83B 1BF2A 4D3CH 1R5VA 4L9LA 5DJAA 1FDLH 1W2KT 3H9HA 1MSPA 3C2AL 3QRGH 4BZ1L 3W39A 1FNLA 1CTNA 2X4NB 4HZLA 1A4KA 2IANB 1JYNA 3VFPB 2D7MA 1Q9OB 3PGCB 1UH2A 3JV6A 5ESVB 1QRNB 2X4UB 4AG4L 1DJSA 2DWDB 1JWUB 4QGYA 1U3JA 5I18H 5IMMB 4PRBB 5CWSB 3WFDH 2F54B 3QHZH 4EDWL 5CKGA 4TSCH 4IJ3C 5BRZD 3K2UH 4NKDB 2JB5L 3R06B 3I6GB 3LSOB 3FO1A 1J8HB 4WTWA 3JVGA 1XIWC 3ILQC 5CEZH 3UZVB 1WF5A 2X7LB 1N4XH 2DIAA 3AS1A 1DN0A 3MQIA 4X83A 1S3KL 2B4CC 4Z0BH 2PO6B 3GUTA 3A6CH 3MRBB 5DUPH 4QRPA 1OT2A 4RDQG 2BVQA 4XCYA 3TT3L 1MREL 1W72L 5E9DA 1JK8A 5E9DE 4QWWD 3ARRA 3AS0A 3FO2B 4XAWH 2VRAA 5DFWH 1QLRA 2Y07H 1AGBA 1V3JA 2YZ8A 5FO9B 4JFQA 2P8LB 3OGOE 4Z7WB 3MCKA 2RAMA 1SBSL 5GJTH 1C16B 4WFEE 4DJMA 5JIKA 1DBJH 3RNKA 5DEFA 1MIML 1FL6A 4U1GB 1UWEL 4Z95H 3NPZB 1MIEL 4QHNA 4Z78B 1RIVH 1IAIH 5FV2A 1I9EA 3AB0C 3V5HA 3ULUH 1WSST 32C2B 4NBZB 1RK0B 1RPQA 3DHJA 1VKXA 4EI6B 1P9MA 4PLOB 4BFGA 2EXYD 1PVHA 1N6QL 4RFNC 4K8RL 2EIZA 1DLFL 4JPKH 1SY6A 2EDRA 4P5TB 2Z31B 3ZDYE 1VFAA 2C26A 1HNGA 4MAYA 3BGMB 3R0MA 3IDXH 2E7BA 1XIWD 1QSFB 3ILQD 5DFVD 3KS0H 4WFHD 2FEEL 3BP4A 3F7YA 2F5BH 5BVJB 4DW2L 5HHNA 1I1AA 2DLIA 4HLJA 4O2CA 5C09B 3CIQA 4Z7OF 4CGTA 3TFKC 3MCLH 3MZGB 3I50H 1CG9A 2EDKA 1QPXA 5I17B 5I2IB 1EAPA 2KBGA 5D70L 5FYKD 5AG9A 3GSOB 3CMOH 1I8IA 3FQTB 1E4KA 1IFHH 3HPLB 2BNQA 1C5DA 2BNQE 4OZFB 3TC9A 3MV8D 3U6RA 4ZAKC 4J8RA 3JWDC 3I6KB 1H3UA 2E7HA 5D1ZA 3CH1A 4ZPTA 3R1GL 3WN5A 2FWOA 4QTHB 2R1YA 5EDXA 3P9MA 5C08B 1EHNA 1IARB 3MA7A 2BNUA 2HFGL 3KS0J 3S35H 2HTLC 4LCYB 4N9GA 2N56A 2CK2A 5ESQA 4X0KA 1TJGL 3TVMB 1FZMA 1GZQA 4PG9A 1OAQL 5EU7E 3LH2L 3T4YB 5IJVB 5DFTA 3ARYA 1RZKC 1L0YA 5CZKA 1FCGA 5D1XC 5FKAB 3VXPB 3FFDA 1Q9LB 4JKKA 1GVIA 2CK0H 2J5LB 5ICYA 1ZT1B 3FRPA 3T65A 1U8IB 3RWIA 5F1IA 2RQ8A 5FYJL 5CILH 1FAIH 1QG3A 2DWEB 4XCNB 4ZUUB 3TFKD 3FO0L 1Y0LB 1P5UA 3MXWL 3RU8L 3GO1H 4LRNH 2G60H 2YD4A 2QQQA 3FO9B 1NC2D 5EU5B 1A9EA 1UCBH 5C2BL 1OLZA 1WGOA 4OLWH 4U1MA 4EQ2A 1OQOA 1HYRC 2Y5EA 3IU3B 3S34H 3FTGB 5ITBH 2V2TA 3EOYG 3RUGA 2DLGA 3RUGE 1RUQL 1A7NH 2VXTL 3LKNA 5GGRB 4YQXH 1BFTA 3TO4A 1FQ9C 2YRZA 1MCKA 2XQYK 4NQCB 1OWRM 3S5LG 3K74B 4YIQA 5C07A 5C07E 3SGDH 1HINL 2X09A 5HVGB 3O6FD 1FIEA 1DANT 3OL2A 5C0CE 4ODVL 2HTLD 5C0GA 1CBVL 4OFDA 1JGVH 4Q6IB 1GRWA 1C5CL 4P0DA 3DIFA 4MB4A 1QR1A 4ZYKB 5FYKH 2EDBA 5HGHB 1SMOA 4QRTA 3CZFA 4GJTB 4E0RB 5J9PA 2UVEA 4CJ0A 3RZCD 2OR9H 3DSFH 5HDQL 5D1XD 3ARFA 3QFDB 4QXGL 5JIHA 3TPUB 5GS0L 3GJFA 4KMQA 3TNMB 1EMTL 3RI5F 4RGMB 3ALXA 4G8FB 4ZNEE 4D9QE 1GL4B 4KMTL 3MFFB 4JY5H 4G7YH 3VRLE 4AJ0A 9CGTA 3E6FB 3NAAH 4KROC 1EK3A 3BGAA 3MLTB 3WYRA 2DM2A 4M5YH 2JJSA 4I9WE 4IS6B 5TDPA 2MKLC 1UACL 4J3OC 4U1NA 5MP6H 1FG2B 5HHMD 5GZNC 5H2BB 4LIQE 3HZYA 3U36A 1OW0C 1DQQB 3BP7B 5GRVK 2AJVH 3FQNB 3OKLA 4HWBH 4LCCA 1GGUA 2R2HA 1WWWX 3VXMB 5F97E 1IGFH 5EO0B 5L8JB 1AGCB 4XNQA 3BZFB 1A7QL 2NY3B 3QFJE 3CDFA 1G7JB 3EYSH 4KJPC 3OKMA 3TCLB 3X12B 5LBSL 1X3DA 3QNXB 1N0XL 4H88L 4JO1L 3SGKA 2O93L 2CKBL 4LPYA 2ENSA 3SDYH 1DQJB 3GSRB 5J56B 3MLVH 4ZS7L 5D9SB 2J8UE 4F8TA 1IC5L 3HZMA 3VGAC 4D9LL 4XCFL 5I1HL 2EDYA 2GJZB 3JWDH 3C6SB 5CMAA 3SKOB 3CU1A 3MV9A 4OZGB 3MV9E 2FX7H 5GIRB 1A6ZA 3WHE0 2FR4A 3BIKB 4JKLA 2UYLA 5KBNC 1WVZA 4NNYA 4F15C 3HI6L 4YHZL 3I02A 4HXBL 4WWID 5A2IH 1S9WA 4GW5A 4KROD 4XXDB 1CZ8L 4XMPH 3K81A 1MCHA 1ZTXH 4MCYA 4JFYA 1SEQL 3DV4B 4WW2A 2HFFA 4U6VH 2BERA 1U2CA 1KYOJ 3L7FB 4JO4H 3KYKH 1HXYA 4KHTL 3R8BB 4XP5L 2WV3A 5CLWA 3VXNB 1RZKH 4U1HA 1KIPA 5GZND 3MRPB 2YBRA 1FO0H 4NBXB 1IILE 4PIRF 3UYRH 1EJ6A 3SPVB 3C6LC 4OFYA 1K3IA 2NXYB 1G7HA 3NCBB 2XWBA 3O0RH 3ORJA 2ADJA 1LE9B 2QQNH 4BKLB 4UTAL 4YXKL 3NVQA 1EFXA 2HJLA 2PYED 4UNTA 4XRCA 4KJPD 5CEYB 1BVLA 1I8MA 3GIVA 1RIUH 4CL7A 5CINH 2QQLH 3HRZB 3IVKB 4G9DA 4GKNB 3CPLA 4R4FH 1KACB 5HHVL 1YC8A 1UB6B 2VLKB 3O2VH 1JPGA 3DUUB 4XMLH 4NIKB 4UMGA 4ZFFA 2E6QA 4NUJB 1WBYB 1XZ0A 4MJIA 4MJIE 4DQOH 4RDQF 1VADB 2XNAA 4WGVB 1NGPH 4JFFE 4AEFA 2NW3A 1CFVL 2ZG1A 3BN9C 5IMLB 4ZOCA 1GGBL 1CGUA 2MOVA 1JYXA 4GRMA 4R7NA 3E1F1 3VFOA 3IU4L 1LEKA 4U6XB 3CH8A 4G8GE 4X6BA 1FFPA 4S11A 3C6LD 4BSWA 1I1RA 1S7WB 4BUGA 4PGCB 3NIDE 4M48L 4G6KL 4PRAA 5IB3B 4OD3L 5A16B 2XI9A 5MHSD 3LEYH 3SN6N 5D6DC 2OZ4L 4X7FC 4GKOA 2VLME 1G0XA 2AXJA 2I26N 5JOEA 3EO9L 4JREB 5DD5L 1IM9A 1UC6A 2OL3B 3MLXL 3TJHC 1XGQA 5ADPH 3WEXA 4L29A 4CADB 1CI5A 3EHBC 4OCNC 1G7MB 2HLAA 1KIUA 1ZANH 1R6VA 1CF8L 3BQUC 4QRRB 2VE6B 1XGTB 5F7YC 4HS3A 5JXEC 2F8VA 1BBJB 2HFEB 1I1YB 2NY5C 4S2SA 1EEZA 3VWKB 1WCBA 2XZAH 3LD8C 1NGQH 3ZKQD 1FYTD 4P3DA 3KHQA 4KKCD 3IXAA 4MS8C 2A9NH 3BN9D 2OP4H 3FHAA 2EDOA 3G5XA 4N1HB 4NC1C 4G8EB 1HHJA 1LVEA 2BJML 3EJJX 2XICA 5IQ7H 4U1KA 2PXYC 2P24A 4PREA 3U79A 2AW2A 1N7ML 4BFEA 3QRFM 4OZHF 3T8XB 4PJ7E 2M8XA 4GAYB 4L1HA 4TTDC 1P53A 4RWYH 1U6AL 3QG6B 1L0QA 3MOAL 4PGDA 4XC3L 5E00A 8CGTA 3TWCL 4DAGL 2V2XB 1DBAL 3HNSH 2PYFA 3WDJA 3D3VD 5B8CC 4KUCF 3RY6A 4M7KL 4CN6A 4BQ9A 1FFRA 1RUML 4O5LH 5GRZA 1WC7A 3SQOL 4YFLF 1QYGH 3UTPE 2I60L 5IWLA 4M4PA 3VFNA 3OG6B 3TJHD 2Q7YA 4R90L 1RZJL 4TULL 4P2QA 5GS1A 4LF3B 4P2QE 2X40A 4OCXH 4ZUWB 4MD0A 3BQUD 1NC4A 3GIZH 5JXED 1MCOL 3O2DA 4XVUC 2UWEF 2QL1A 2E27L 1GGTA 4Z6AT 2DLHA 4HAFA 1P1ZA 1KN2H 3QIUC 2P8PB 4RMVA 4DZ8A 1V3MA 4W4OC 4F7CB 2OQJB 4Q7DA 1ORSB 2C4XA 1PW3A 3WIHL 3IRZA 4MS8D 5CD3A 4CW1B 4C56D 3CLEL 5F7EL 5C9JB 1M7DA 2LAGB 1WUNT 1E4WL 3MRDB 3U4EB 1JWSA 1T1ZB 2PXYD 2DM4A 4YHMH 2YD2A 4GKZB 1K8DA 3BPLB 3FT2B 3V7AE 1YYML 4XPFL 4TTDD 5EZIL 1TCRA 2HRLA 4FQ2L 5D7JB 5DRZA 1YEGL 4PRPB 1FSKB 3DVFA 3Q6FA 4KMLB 3EO1B 1NL0L 3CFDA 4NNXB 1JYVA 5I1KL 1CGWA 3Q6GL 3S88H 3HC0A 1EBAA 5IVXB 3ULVF 4Q2ZB 1U0QA 3ZYZA 2R1WA 3IS1X 1BP3B 4L4TA 4L4TE 2UV3A 4JPVH 2JTDA 3DYMA 4L4VA 4L4VE 4Y5XC 4NN7C 3CU7A 4XVUD 3VH8B 5CZVH 2DKUA 5B22A 1T7VA 1I85A 5HHOB 4NRXB 3QIUD 1OGTB 3NN8B 3CX5J 3GSWB 1NAMB 4NQSA 5K9JL 2A1WH 5I75C 2F53B 2V7HB 1CD1A 5BVPH 2ERJC 2CRYA 2NXZC 4K8RC 4NFDA 4NO2B 4ELMF 1H3PL 4HX1B 4EUPB 3GSUB 5FYLL 4Y1AD 1QBLH 1WAAA 3IJSA 5TH2B 4YC2C 3SGJA 2WAHA 5M95B 3PG2A 5H37G 4F2MA 2FZ3B 2ID5A 3IGAB 2AABH 1BGXL 1N64H 2BOBB 2I9LB 2VDRH 4O2FB 3FOLB 4Y4FC 5FHBH 1L7IL 5MI0B 2XWJB 4O2EA 2RHEA 2NY5H 4PJAB 1U95B 4YR6A 3EJZC 1NKOA 5FO7B 2YD6A 1B4JL 2IPUK 5J11C 3BN3B 4POZD 4WDIA 3OR6A 3OKOA 1BJ8A 4YHIA 4L3ED 3GKWH 1JGUH 1LDPL 1A6AA 2YKLL 4WW1B 5IESL 1UWGL 3B2VL 3RDTC 4U1JB 2F5AL 3FCTA 2D9CA 3CCHB 3H9SB 3A67L 3IJYA 5D96C 2JJTC 5HHPB 5B3JE 2VDKH 1G7PB 1S5IL 1D6EB 3BESR 3O3BA 5EO9A 4WWKC 5K9OA 3GRWA 5FA4A 4X80H 3VXRB 4X6DE 2DQCL 2HT4C 1QFPA 5KSAA 2P5WA 3PP4L 5D2NC 2AXGB 2GJ6E 1S9VB 5TJWK 4MNHB 1XF3B 5CBAB 4C54A 2NXZD 4K8RD 2Z8VC 3CVHB 4IBLT 3D1MC 3X11B 4XVSL 3VDCA 1Q0XH 3H3KA 3QDGB 4BZ2H 2MHAB 2BCKA 2EYTB 3L3KB 3P77A 3P30H 5C0AA 4MCZA 4TQEH 3QAZB 5EIVA 5I9QB 5LGJA 2QR0A 3HE7B 1BIIA 2I07B 2OCFD 1NQBA 3C2AH 2FYYA 2ENYA 3EJZD 4GAFB 1P2CB 3ZDZF 3RL2B 1NEZG 3V5DA 4LU5L 1IVLA 3O6MH 1MI5B 1PQZB 1T0NA 1WCQA 4EI5C 4OUOA 2N4IA 3AAZB 2V5MA 3P73B 4WV1B 4AG4H 2H6PA 3IF1B 4OV5B 4OI8A 4PV9A 1EO8L 4HBQA 2R0KL 3RDTD 1X5LA 5CUSL 1QSEE 3K0WA 4EDWH 3QEUB 3HE6C 3SBWA 4OI7A 4E42B 1WITA 4X7EC 4JPIA 3STLB 3C5SB 4WWKD 4DGIL 3OB8A 4M7ZB 2XA3A 1GGCL 7FABH 3K2MC 3SGEI 1ODAA 3T4AB 2HT4D 3QA3B 1UJ3B 3GMLA 3TT3H 1MREH 5I1DA 4M5ZH 3OB0K 5IMKB 1W72H 4P4RB 2FBJH 3VXSB 1DQTA 1QSVA 5D5MB 3D0LA 3RWEB 2BSSB 1SEBA 3AUVA 1AY1L 1T66C 4FTVA 3W9DB 5T3ZE 3KDMA 4FNLL 3BEWB 3P3YA 3O41B 3NCMA 2D7TL 2V6HA 3HR5A 4HD9A 4U33A 3JUYA 2FBOJ 5L0QC 4PJGF 4PJ5A 1UQSA 4MDIA 1I9RL 3PV6B 3TA3A 4N8PA 4HIHA 2ATKA 5GS0C 1D5MA 1CLZL 5CJOL 2OJEA 4PBWD 1ORQB 3L3HA 5DJXA 5FYJD 5IM7B 2X4RA 3BKML 4EI5D 1I4FA 2W92A 2HWZL 4OD2A 2DQFB 5DHVB 4Y2DC 1NMBH 1OGAA 3DROA 4K8RH 1OGAE 1DLFH 4P57B 1MWAB 2X1OA 4JHBA 5GGVL 2MFNA 4ZFOA 1A6TA 1VPOL 3CXDL 2BXZA 3MRQB 4TNVK 1NGWB 4MXVF 5ICZB 2A0LC 4LARL 4XH2A 1I9JH 4HUXA 4MQ7A 4U7KA 3K7UA 4MD4A 1YNTB 1RJZA 3BGFB 4HWUA 1EEYA 4DW2H 4JFDD 4OM1L 1N2RB 3ZYOA 4LPUA 3F6LA 1TVHB 4B7LA 2BK8A 2H2PC 2P48B 3O9WC 2DQDH 4F57L 1D5ZB 1T1WB 5IJKC 1BVKB 2PW2A 4PB0H 3WNNA 3S7GA 1T66D 1NGYA 5DS8A 4U1IA 2VOTA 5D70H 5DJ8B 4J1UA 5IB2A 3QJFA 4JQXA 5E2WH 2IBBA 2A6JB 1P4LA 4GUPB 5GS0D 4JB9L 4XTRC 4NQVB 2VLJA 5CGYC 2VLJE 1BQLL 1JNJA 3D48R 2OMBA 3NFSL 1CICA 4NYLB 1MJUL 2ICEA 1HEZB 2FD6L 4Y4KB 4Y2DD 5EC2B 4MNGA 2AK1L 2ZUVA 4MNGE 1HILA 4XP6L 3C87A 1CDGA 4BELD 4U0RB 3UTQB 4JZJB 2ZCKH 1V7NH 2AXFA