1JGVH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule keywords Antibody Light Chain
molecule tags Immune system
total genus 38
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH01
4KTEL 3HAEA 3NGBB 4KTDH 4NUJA 1ZGLP 1MJ8L 1E4WL 1QLRA 2YPVL 4LCYA 2HVJB 3T8XA 4XBPA 2PTVA 1BM3L 4F7CA 4JZJC 4R3SB 4Y5XA 3X11A 3Q3GB 3MV01 3UO1L 1SJHA 3FO2B 3QCVH 3VFGL 3IDGB 4NKOB 1GPOH 5F6HI 5DJYA 5HYSB 2CO6B 5I8EA 3CC5A 1OWWA 2AXFB 1NUFA 3D1MC 4OZIA 3PWJA 1IGIL 1F4HA 5DA0B 3NTCL 3V0WH 5C9KA 1X5YA 4NFCA 2CXKA 4N5ED 4PG9B 4IMKA 2AJZA 3LRSA 1IILE 1UWXH 2I60L 3ARSA 4ODWA 1P5VA 5EZLA 3RAJH 5B8CB 3C09C 3INUL 5F7MC 4LDOB 5BQ7A 4JFFD 2YMXH 1HZHL 1AR1D 5F88B 2OP4H 3W2DH 3MV8A 3FQNA 5EU3B 2B4CC 4O51A 3BN9D 4MA8L 4OQTL 4X6DA 4CL7A 3BO8B 4XMKL 2DTML 5CD5D 1HWHB 4OKVB 5FKAB 4Z5RA 2OLDA 4ZTPL 3MLUL 1IQDA 4ZAKB 2X42A 3OF6A 4ZS7L 1SJEB 1J8HA 2A74B 2NTSP 1BJ8A 2I9LB 4NQVB 1F3DH 4FFWD 1CTOA 1OP3K 3CIQA 3IXTA 4XBGB 5BRZE 3FFCA 1DL7H 4P2RE 2R9HC 1HEZA 2DN7A 4R6UA 3QJFB 4OZFA 1KJVA 4JFDE 5B4MD 1D6VL 4HCRA 1NGXB 2Q1EA 2QADD 3I02A 3MOBH 5D2NA 4LQ1A 3RU8H 4FXLA 4WI2A 1EO8L 2AEPL 3L9RB 4M7LL 2NY7L 4IIQC 1TZIB 5GJSH 3FTGB 4L3AA 2RCSL 1OLLA 3O4LA 1JWSA 3JTSA 4AZ8A 1INQA 2O5XL 2H8PA 2JIXA 1IFHL 5BV7B 3SQOL 1V05A 4K94L 4J3UA 1B0WA 5H35B 5DR5L 1T66C 4UAOB 4ZUWB 3MCLL 3FN9A 3QI9C 3AB0C 5JPNA 3EUUA 5TJWK 2PXYA 3I6LE 1MRDH 1NFIB 3DMMD 1FLRL 5BO1H 4NKIH 4PRAB 1YMHB 4X7CC 2BK8A 4Q9CA 5EBMB 4YR6A 1MCPL 1OOAA 4NKDA 4HFWB 4PRPD 5EZOL 4MA7H 1T21B 1NLBL 1H3GA 1EK3A 2VZUA 2GT9A 5LGJA 1NGYB 1T4KA 5HTSA 3GIVA 1K2DA 5IB3A 2CJUL 1C5BH 1P2CA 3I6KB 4HDIB 3BWUC 3SJVD 1T0MB 1WIUA 5FO9B 5EC1B 2E6PA 4MNGB 5FF6A 3AS3A 2K3TA 1A8JH 1UKTA 3RUGB 1ZANH 4OF3A 1HHJB 2ZOKA 3BP6A 1XIWA 4R97C 3QPQC 4PJIB 3KHQA 2GJZB 4P3DB 3QZWA 3WSQL 1JYVA 2RIKA 1P9MA 5DXWA 4EI6A 4JJHA 2DWEA 1EHXA 2QSQA 1UKSA 4XB7A 4YPGA 1MJ7H 4CADB 1IGCH 1QLRB 3LKOA 5C0DA 2V7HA 1I7ZA 3O2DH 2VDOL 3T8XB 4XBPB 4GXUN 3DARA 1SJXA 1SY6H 4F7CB 2VL5A 3O4OB 2VXSH 4Y5XB 3X11B 2CK0L 2OR9L 1MHEA 4XCYA 3QHFH 5JDJA 2B39A 5HGAA 4NBXB 3FFDB 4JRYE 2X7LB 2NY5L 5KJRL 5I8EB 4R8WL 4GKZA 1IAIL 4ODTH 4YHLH 4R4ND 4OZIB 2R0LH 2YBRA 1QRNA 4M1GL 3MV11 4FXGA 1AQDB 2VDRH 2AABL 3LRSB 1A3LH 1P4IL 3V4PH 2DQEL 2XG4A 3MV8D 3G08A 4M4RA 4D9LL 4N0YH 5CCKH 4ODWB 4BQCA 4N90D 4FTVA 2WSKA 5EZLB 4MXQD 5ACZB 1QRKA 4PB0H 4ZFGL 2ED7A 2B1HL 3TYGL 1NCBH 4F15C 1MEXL 5KTEL 1L6XA 3HLAB 3OF6D 3FQNB 1WISA 4O51B 3UTSE 3C9NB 3D87B 1JIBA 1J8HD 4X6DB 3TFKD 5DT1L 1I1AC 3V7MA 2YKLL 2OL3H 3V52H 2KH2B 5I1CL 2ADGA 4OCMC 4Z5RB 3GB7B 5FV2A 4HK3J 1QSED 5C3LD 5DRWB 3FFCD 1IQDB 1BOYA 4NZJA 4CN6A 3AROA 3FO9A 1JPST 3PUCA 5TH2A 4FFZH 3T4YA 4HUUA 3MV9A 3C6LC 3IXTB 2VOTA 4M1CD 1G9MC 3EJYC 4IRSB 1UCBL 4P99A 3LEYH 5DZOA 1Q0XL 2JIXD 3I02B 3MRMA 4U3CA 3ZHKA 5I1GL 1WTLA 1A7OL 5GRXG 1HIML 4I18C 4Y89A 4KRPD 2X4UA 3O4LB 1INQB 4ZODA 2NZ9C 3IDMA 4QY8A 1EUTA 2FIKB 2H8PB 2JIXB 5C09B 3QUXA 3MUY1 4YHYB 3KPSD 4WEBH 2X05A 2JJSC 4W81A 3B9VA 2PXYB 2E7LC 3GBMH 3KLHD 3VGBA 2CKNA 4HIEA 4LVNC 5JOPE 2F8XC 2Z92A 5LWYH 4JY5H 1OTTD 2IH1B 1L0YA 5D7KE 2H3NA 1MAML 2GT9B 1T4KB 4UI2A 4KV5F 4S1SH 1BJ1J 3DI2B 4ORGA 3HN3A 4OLVL 1P2CB 1NSNL 2HP4A 3SDDB 1VFBA 5JLZA 5F9OL 5FOBA 3ESUF 4U6VL 3T0AA 2ICWI 1MJUL 3M1BA 4MJ5A 3BD5A 3W0WE 5GIRB 1MCWW 4LSQH 5B21A 1FIGL 4H0GA 1WLHA 4DTGL 3BP6B 1XIWB 1MY5A 4Q0XH 3RVXC 5IIEB 1L4IA 1CZ8L 1AGDA 4OIAA 3H42H 1A7PH 4NM8L 2GITA 4M93B 4EI6B 2HFGL 2MTPA 2D0FA 2VLKD 3MODL 2E8YA 4TTDC 4X80H 5KVFL 2VZ3A 1UM5H 3MRNA 4NZRH 1CK0L 3WDJA 4CVWA 3NFNA 1CVRA 2VL5B 2FD6L 3QBTB 4PJBB 4PV9A 3QHTC 3LY6A 3IJHA 4CVXA 1MHEB 5I9QB 1S5HA 3GI8L 3PJSA 1EZVY 2CK2A 3ARWA 1E4XI 3TJEH 1IAKA 3G9AB 2P8PA 4PYGA 4APQA 4M5ZH 2VDLL 1CLOH 4TRPH 4ZUSA 4MNQE 2AJUL 4FTVD 5DJDA 4KK9D 4UDTA 3RL1A 4D9QD 4PGBA 2YBRB 3CX2A 2CRMA 1QRNB 2E27L 4JANA 5F96L 2E9BA 3X14B 1OSZA 3KR3L 4NP4H 3FONB 1WBYA 5DJ6A 5E2JA 5DD1H 4BK5A 3G08B 3V5DB 4XWGL 3SHSA 1EBAA 1LO3H 1M1SA 5FDWB 2EE6A 4ONGH 5C08E 3B43A 1B2WH 4LGSB 1NAKL 1YMMA 1U91B 3EFDL 1Q9WA 3GGWA 3L5WA 1BECA 1CD0A 1RZGA 3E2HB 4XCEA 3TZVA 5LQBH 3MV9D 3HG1A 3C5ZD 3J7HA 5I16A 4KV5E 4OLXH 5GJTL 1BQHA 2HVKA 1J18A 3BP5A 4XB8A 5GRJL 3FO9B 4H8WL 3VXPA 3ULUH 5D7SL 5TH2B 3UPRB 3SDAC 3T4YB 2Q8BL 2V5SA 4HUUB 4FZ8L 5FK9A 2AXJA 3B9DA 3HE6A 4IEFB 1A6UL 5MP6H 3ARFC 3CVIH 3P0GB 4L8BA 1R3KA 5I74B 4PJ8B 2X41A 2EXYC 1G6RA 3MRFA 2NXYD 1KC5H 1NBVH 3OQ3B 5BZWB 3QUXD 1IBGH 3EFFA 1AXTH 3PHQA 4GAJL 5B39A 2FATH 3C2SA 1JE6A 2HRPL 4EDWL 5FDYA 2X4UB 1GHFH 1OAZL 4QY8B 5D4QA 5ADPH 3QUXB 4J23A 3FQUA 3MJ7B 4EI5C 5E2TL 4YAQA 5IKCA 1XGTB 3S9DB 2BY1A 1LWRA 3MOQA 2XN9A 3O8XC 2IQ9L 2BFVH 4PJGA 4NO5B 4P46C 4WJ5A 1HOCA 1NCWL 2HJFA 2BSTA 2Y06H 3KYOA 2IPTH 4HIEB 3VFTB 3H3PH 3UPAA 4QRRE 4ZQKB 4ZFOA 2H3NB 4M8QA 2DIAA 4Q6IB 1EHLH 3S35X 5LGHL 4ORGB 1EFXA 2L4OA 4GS7B 4TUJB 4K2UL 3S88L 4HQQH 5JLZB 4YGVA 5FOBB 4GRLC 1AGCB 5IV2A 3M1BB 1BZ9B 4MJ5B 1B88A 1OM3H 3V6OA 2FRGP 4D9RE 1NL0L 2OM5A 5JNYB 1UKQA 4JPKH 5EH1A 4AEIL 2R0ZL 2NMSA 1VKXA 4NWUH 4X98B 3FOLA 3P3YA 3ROLA 3ARRA 3TJHC 5KZCD 1DBKL 1AGDB 3L3IA 1KN4L 2GITB 2DLFH 3GSRA 3IDIA 4APQD 1SYSA 3AMKA 3BE1H 3BRGC 1A02N 5C0CE 2HFEA 4HGKC 5DD5L 2QQLL 2VITA 3T4AA 4PV9B 5KSAA 3IJHB 5KZCB 2XTJD 4WO4D 1S7RB 1PKQA 3PJSB 4LGRB 3V4VH 4HUKB 5D1XA 1A9EA 2P8PB 5C0AD 3SGDI 1NMBL 5T3XL 2IAMC 5F21B 3A6CL 1FRGL 4ZUSB 1T0NA 4D0CA 3MLPA 3RBSA 5DJDB 4XVTL 4OAWA 2H26A 5CKGA 4NZDA 1LILA 2RFXA 4TUKH 1HYSC 1WBYB 3NIFE 2FWOA 4V2CB 4DJMA 4HPOL 5CEZH 2XICA 25C8L 1UJ3C 3TZVD 2DQDL 4GKSA 3QIWA 4IJ3B 4RMVA 1FPTH 2R29L 3CZJA 1YMMB 2CSPA 2G9HA 5JUEH 3NAAH 15C8H 5SX5H 1RZGB 4R2GD 5DFTA 3B5GA 1W0WA 4ZO9A 1HSBA 2GYSA 3HPLA 3LIZH 4ODUA 4YXKL 1Q1JL 4O2CA 4PJFB 1P4BL 3IETB 3SDCC 3HG1B 5I16B 5KVEL 3HE6D 1RUPL 1A0QL 1TJIH 3RNQB 1BQHB 2G5RA 1P4LB 4JVPA 4R2GB 4RWYH 1CFBA 3HE7A 4XAKE 5INCA 4QTHA 2JCCB 4NRXB 4WY7H 2W0LA 4Q2ZB 5I2IA 5FK9B 1AQKH 4C56E 3ZTNL 3NGBC 2VRAA 3BGMB 3BD3A 4L8BB 3DURA 3FO1A 2FIRT 3SE3C 4YXLH 3MRFB 4FFVC 3UBXA 1BEYL 1JNJA 3EFFB 3CLFH 4QCIB 3PHQB 1D9KA 5EBWA 4U1GB 2DM2A 2EYTA 1F2QA 3RWFA 2XN9D 1FGNH 2XQYG 5D71L 4EZMA 1JGVH 4UTAL 4LLMA 1KCSL 4L9DA 4A6YL 3SBWA 3FQUB 1KTDB 4WGVB 1OT2A 4JKMA 4YAQB 5C2BH 1J8KA 1E27A 3ZT5A 1OVZA 3IDUA 5CP7B 5C6PB 1QA9A 2O5ZL 3TWCL 3BYTA 1HOCB 2HJFB 1EFXD 4P3CH 4X8JA 5B8CC 4XP6H 5BZDA 1JGUH 4TVPE 3QXTA 3L5XH 1OPGH 1PQZB 2PKDA 3HMWL 1U95B 2BHUA 3U1SL 4F58H 4KPHL 5D9SB 4ZFOB 4UV7H 4M8QB 2XWTB 4E41E 1KJ3H 4PG2C 3FQRA 3SKJL 1G7MB 4MD5B 2ICES 5DMIH 2DDQL 2X4TA 4DKFL 2PTUA 4M4PA 1KXTB 4YGVB 2QHRH 4DVBA 5L88H 5ANME 4DZ8A 5IV2B 1DSFL 2FGWH 4G8FA 1VFAB 2E9WA 4JFED 3Q5OA 2JELH 3BN9C 2VLLA 3P2TA 1RHHA 4JG1L 1S9YA 1HXMA 1BF8A 1ZGLM 1VKXB 5DC0A 3BGAA 3MXVH 3P4LA 3ROLB 3QO0A 5KSAD 5IW3A 1WV7T 2QQKH 5DJXB 1CFVL 1MREH 1T5WA 2HKHH 1MFCL 1YY9D 2HTKC 5D1XD 2H9GA 4R90L 3IU4L 2D2OA 1D5IH 4C58B 3FB6A 1SYSB 1VGKA 2X4SB 2Q7NA 4FFWC 5AZ2L 4M5YL 2VITB 3MLYH 1ZKAA 3P4NB 3ZE0F 5E56A 2P49B 1U8LB 3MFFA 3MACL 4DAGL 4MAYA 3S97C 2YD4A 4WUUE 4TSCL 3TGXA 5FGCB 2O5YH 4D0CB 1J0IA 1N0XL 5BV7C 4K9EL 4NC1E 4OAWB 3VXSE 1PW3A 5ERWB 2RFXB 1ZOXA 3QIWD 1J86A 1LDSA 5EPMA 1NBYB 1YEGL 2PUQT 1JNLH 3BH9A 3OAUL 2ZKHL 2ED8A 4UAOC 1LO0H 5HHVH 2X5PA 4UT7L 1IEBA 3RVUD 3PWVB 1OSPH 2NXZB 4U6YA 5IMKB 3EYSL 3RWJA 4S2SA 3QIWB 2C1OB 2IEPA 3QXWA 1FNGB 1J1PL 1P6AB 5C0ND 1LO4L 4JG0H 1TNNA 3SY0B 9CGTA 3PP3H 4CAGA 2DJ4A 3BUTA 3TIEA 5JHLH 4WTZG 1HSBB 4L1HA 1ACYH 4JQVC 4O2CB 4M7ZB 4WRLA 4NQCA 3PNWA 5JTWA 3QFDB 5LBSH 2AI0H 4LVOB 4M00A 3KDMA 4DGVH 4MGXA 5EIIB 5IVNA 2UUDH 1I7TA 2LFGA 2ZJSL 1RUML 2WM0A 3GSQB 3HE7B 5INCB 2NTFA 4QTHB 2VLMD 1LMKA 2NYYD 4PGJA 5I2IB 2A0LC 3RL2A 1XGRA 5TF1L 2P4AB 4YBLB 4FFYH 4IDJH 4N0FA 3MUGA 2WUCL 2C5DC 2NW3A 3WD5H 3A67H 2Z8RA 2LABA 4OIBA 4E42B 4ZNCD 1RZJC 1T89A 2FX7L 1KIPA 1PX4A 2XFXA 3O4OC 4Y5XC 3JV0A 1U8HA 1D9KB 2B4CL 1RIUH 3IYLW 2QSVA 1KSRA 2EYTB 3V2AR 3GHEL 2VDNL 3GO1H 4G6AC 4S0TD 5D6DA 3P77A 3UTTE 1E28B 4FMKA 4NN7B 3ZE0E 1PEZA 4MLSA 5GISH 4JFZL 1JPTH 3S35H 2B1AH 3P11H 4OLUH 1G1CA 2FLRT 1WZ1H 2VDML 4IMKC 3BAEL 2ATKA 2GTZB 2X4PA 3BKCH 1HILA 1NMAL 3JUZA 1W72L 2EH8L 4X8JB 5BZDB 1YYLH 2J12B 2GQHA 1P6FA 3OAYK 3HR5A 3D9AH 2OR8A 3DXAE 4HIJA 1KULA 5TE6H 4JFOA 1KB5H 2AEIT 2VERN 1CF8H 3UPCA 2X09A 5IEKB 2I07A 3FQRB 5CFHA 5T3ZD 5D7LE 3PWNA 1MIEH 5CINH 1SEBA 4G80B 3U30B 5EOTA 2AK4E 4YBQD 4G3YL 4GRWE 4DZ8B 1PSKH 5KAQG 3LS4H 3L6FA 1ODAA 1KT2A 5BRZA 4P2RA 4ZO8A 2FEDC 1BQLL 3BIKA 4JDZA 1KCUH 1DANU 2YD9A 4OFKA 4AM0B 2V6HA 1FYTE 1D5XA 1DN2A 4JFDA 3T2OA 4DW2L 4ERSH 3QO0B 1G7PA 3VD5A 4RQQA 1RULH 1A9BA 3WFEL 1T5WB 3FMGL 1FBIL 3AM8A 4MAYD 4IRSC 2H9GB 3IFLL 2PNDA 4P57B 3SDXF 1PKOA 5GGTA 2EO9A 1KJ2A 2GY7B 5T1KD 1IAMA 1VGKB 4TSAL 1GGIH 3PP4H 2FHFA 1FO0A 4NCDA 1OAYH 1GIGL 4MS8C 2MQ3A 4KKBD 4M1CC 1G9NH 3MFFB 4ONFL 4ZUVA 1RU9H 3W11D 2MCG1 3FCTA 4AIZA 4NCC1 2D0GA 1RJZA 1YC8A 2BOBA 2PW1A 3RGHA 1IQWL 1AC6A 1G7JA 4L4VA 3EOYG 3VFWA 1RZ8B 1MRCH 5SWSA 5TQ2L 5B22A 4AEEA 3D69A 3CK0L 3O2DA 1VGEL 1FH5H 3SGJA 3BH9B 5CJQH 1FV1A 1K5NB 1IEBB 4XC1H 5ITBL 3MRKA 2NY1D 3DV4A 5J12B 2PXYC 4WU7A 3T2NH 3LKRA 4POYA 1T1ZB 4R0LB 2CRYA 4NQCD 4LEXL 3MGTA 2B0SL 1XF4A 4DVRH 2F58H 2F5AH 4RGND 3U7WH 3IVKA 1B6DA 3TIEB 3OX8B 2F54E 5C86A 3V6ZA 2CLVB 2CKBL 4JM2A 3ULUC 4U2YA 3I9GL 4JDTH 4NQCB 3PNWB 2W38A 1ZLUK 1TMCB 3GMQA 3PV7A 1QOKA 5AG8A 1CI5A 1KELL 4LPWA 5MENB 4P23A 1QFWH 1FIEA 3DUUA 5DMYA 1I7TB 1CGVA 2NTFB 1XIWC 2X9XA 4L1DA 1NGQH 3B8YA 4GFTB 4MNHA 2J4WL 4L9LA 3RPIB 4KAQH 4N0FB 4LIQH 4M93C 3L3JA 5I8OL 1DANT 1NGPH 4PJEE 5T5FH 4X6EA 3MO1A 1D7FA 1BX2A 1KACB 2VZSA 4OCNC 1KIPB 3OB0H 1RIVL 1U8HB 1TVHB 4GQ9H 3BDYL 4HF5H 3GSNA 5I9QC 3SDXE 1QBBA 5FYKU 1QTYT 2R1WA 4I0PA 4LMQE 2VSDA 5DYOB 1T7WA 3FOMB 1FNAA 4PGZA 2J8HA 1F58L 1H3VA 2VXUH 3RVWC 3VFVA 2I26N 5J57B 5LAXA 5EZJA 4Q97A 1BAFL 1MF2H 3ZYJA 2X4PB 3OBAA 4UIKH 3KS0J 4U1SB 1FLTX 1T83A 5EUOA 3RWGA 3EDJA 4AG4H 3CDGA 5C2UB 3D25B 4KMTL 3ZL4H 1ZEAL 1AIFA 4JFOB 5CJ5A 4YHML 4J6RH 1BFVL 1Q72L 2HJKA 4H25A 2ITCA 4RA3A 3TBYB 3OGCA 1IEAA 2I07B 3E2HC 4P2RD 2MCPL 2XZAL 3RWHA 3O3EA 1SEBB 4JFDD 3OL2A 4Z76B 3TPKA 1MFEL 3L6FB 5E08H 2RHEA 1Y0LB 5BRZB 4P2RB 3DX8A 1LD9B 4JDZB 3VXOA 3CSYA 4XP9H 3KXFE 5IB4A 5DRNB 1A7QL 1D5XB 2QSCL 4C59B 1G7PB 4OM1L 2FX9L 4RQQB 4AL8H 1W0VA 1EJOH 2QHLA 3F6IA 3ROOA 1TZGL 2H32A 2EC9U 5I74C 4PJ8C 3ILPA 4OD1L 2IQAA 1PVHA 5MHSD 4TOYH 4OF5A 4L4VD 3I6LD 3UTPD 4YHOL 5SWSD 2AJVL 1Q9LB 1FZKB 4HC1A 1MCRA 3K8MA 5E6IA 4ZUVB 4WUKH 3Q6GH 3VXNB 1X44A 3IAQA 1S9KC 5IHUH 3G04A 2BOBB 1GH7A 2PW1B 1G7JB 3EGSA 2WINB 4QT5A 3VWKA 3QUXC 3ULVF 3VD7A 4Z0XA 3VFWB 5KW9H 5F7NC 1XGPA 3ZKXB 3D69B 2V2XA 1FV1B 3MRKB 4KUZH 3T65A 2VABA 3DV4B 1B90A 1I9IL 1V3KA 1X4ZA 3LKRB 5D7JD 1NKOA 4HUXA 3BPCB 4JM2D 4LL9A 1BGXL 5C0EB 2VZTA 3MGTB 1XF4B 3C87A 3OKYA 4HUWA 5IBLD 3IVKB 4OUOA 1QG3A 4P23D 4Q6IC 4PGEA 4Z8FL 3T2PA 1MLBB 1JFQL 4XMPL 3V6ZB 3W0WA 2X1XR 2YPKB 4GS7C 2HT4C 3V7AG 2E8ZA 4NIKB 3M8OL 2YA2A 4LLVB 1ZWIA 3MX0A 2ZCHL 3U9PL 1PBYA 4FG6D 4P23B 2YUVA 3DUUB 4I0KA 4LLQA 5DEGA 3D18A 3RWCA 4S1QH 3RKDD 2VH5H 3BRFA 4LOUC 2IGFL 1NC2A 5L7XL 4GAFB 1RI8A 2I5YL 4MNHB 3CU7A 4AYFA 3PV6B 5IROA 1SYVA 1CIDA 3L3JB 4JPVL 4X6EB 3MO1B 1VFMA 1FFOA 3ZSTA 5HDBF 5DWUH 2GK2A 2IJ0C 5FYJH 1EBPA 4JRYB 1NDGA 4HBCH 4MNQA 4LDEB 4JDVB 3UBXI 3PIQA 3NZ8B 3GSNB 1F4YH 4LSPL 4WFFD 4KDWA 4U1LA 3WUWA 4DKEH 3QQ9C 1F3DJ 4I0PB 4JHZA 2R1XB 3B9KA 1H8OA 1OARL 4QWWD 3WNOA 1SBSL 1VHPA 2V9TA 1JHLH 4OD3L 3VFVB 12E8L 4P9ML 3HZYA 1MWAH 4PLJD 1ZVSA 4M43L 4OZGF 5F70A 5DJ2A 3W39A 4FQ1L 5C08A 3UZVB 2P5EB 4JN1H 5IFJB 32C2A 1HI6A 4MQSB 3ULVE 4KU1A 1VESA 1Q94A 1I75A 4H20L 1RSFA 4QHUA 5E5UB 4G7YL 4G6KH 1MJJA 2FECL 3UTSB 4NCC2 3RWGB 4IJ3C 4NJ9L 3VI4E 2R8SL 1I3GH 4WV1A 3SDYH 2NY4D 4Y5YA 2HJKB 2ITCB 3OGCB 1IEAB 4MVBD 2XRAL 1F5WA 3T08A 3RWHB 3O3EB 4PBXA 1LNUA 4OFYA 5KVMC 2DLEA 2X6MA 2KKQA 5EZIH 3WIIH 3NPZB 1YJDC 5H94A 3IRPX 1FFQA 3F7VA 2GAZB 4R2GC 3DX8B 2APTA 3VXOB 3RWIA 3ETBF 5T3ZL 1MCQA 5KAQF 1OD9A 3NCFB 4KJYA 1YNKL 5C3TA 1JTPA 3GRWH 1W0VB 3EYQC 4N1CA 5FUCC 3ROOB 2FR4B 1T7VA 2WW8A 2H32B 4Y4HB 4TNWF 2CDFA 2AV1A 3ILPB 4MXWH 2IQAB 4FQLL 4WDIA 3L5IA 3LQZA 5DJ0A 4YDKL 3QEGL 3LS5H 1RMFH 4U1GC 5E8DL 1NLDL 3F7YB 2AXGA 3UTQA 3UYPA 5E6IB 2R4RL 2WP3T 5FHBL 3EKCA 4L8SB 3G04B 3F58H 5HDBE 2EDTA 3NA4A 3E8UL 5D7KD 3EGSB 4QT5B 2VSCA 2WWKT 3VWKB 1EEYA 1C5CH 4Z7QF 4R26H 3EO9L 1AXSA 4KTDL 1XGPB 2V2XB 5E5MA 3HI6H 4Y1AD 3SE9H 1C8PA 3DNKA 3NOIA 1FFPA 4F3FA 1FORL 3T65B 1MIML 2VABB 2YK1H 4QRRA 4NC0B 3QUMH 5KS9F 5IGXL 1TQCB 4RAUA 3S8WA 1AD9A 1YEKH 4HUXB 2J1KA 3FQTB 4PJAF 1M05A 3QCVL 4OZGE 1GPOL 1U8IA 1T03H 3HRPA 2CDGB 1S3KL 2F15A 4BA8A 1JI1A 4DQOH 1JL8A 4PGEB 3DRTA 3KYAA 3CFDA 3D0LA 3JZ7A 4ODBD 4I4WA 3W0WB 4ZXBA 3QDMB 1J0JA 4NZTH 1NC2D 5KANI 4KTEH 1S9WA 4KJWC 4GRMA 4JPIA 3O81A 1OAUL 5DC9B 1C1EL 1FNEB 5DEGB 4JQIL 4LLQB 1MJ8H 1UVQB 3RAJL 3RWCB 3CZFB 1B3JA 1QFHA 4YC2B 1IT9H 2DQIH 2YMXL 1BM3H 5J1AA 2OP4L 4LCWE 5C0CA 5FYKL 4MNQD 3NCYP 1SYVB 3HAEG 1S7XA 1V7NH 1K3ZA 3N85H 1CDYA 3M07A 3PWPE 1G84A 3B9KD 1ZTXL 2CIIB 5H37H 3QCTH 1M7DB 2BNRA 1NDGB 3BHBA 3FB8A 3WFDH 4MNQB 2YUXA 2XPGB 4OGAD 1ITCA 1MI5E 1S8DA 2EKJA 3ZTJG 4U1LB 4QHKI 4BM7A 3WUWB 4JLRB 4RDQG 1U0QA 2G75B 1ORSA 1DZBA 3P40A 4MHHI 4HG4K 4YHZH 1PY4A 3BX7C 1DL7L 2ZUYA 5I1HH 3W81A 2OTWA 1SVZA 3MA7B 3HNSH 4YZFF 3N1MC 3STLA 3HZYB 2HKFH 1HZHH 1ZVSB 3G5YB 3REVA 3W39B 5GS0D 5DJ2B 3O45A 3UP1A 4P5MA 1BHGA 3LZFH 3BESR 5C08B 4LHJB 2NXZC 32C2B 1F90H 5JMOC 1Q94B 3MOBL 1E6OL 3RU8L 4RISH 4Z7QE 4S0SD 4QHUB 5TGBB 3TA3B 1PG7L 4XMKH 1F6AA 3DHMA 2BSRA 1U92A 3QIWC 5SWQA 5GJSL 4JZOA 4OFYD 1RURH 1RZKH 4RFOH 3JTTA 5CIPB 1P84K 4ZTPH 5KS9E 1G7QA 3U9UB 1KB9J 3B5TA 2F8VA 3H9HB 2AQ3A 4AMKH 2EZ0D 3PQYE 1F4XH 4N9OB 4PJAE 5FAAA 4JN2B 3O6LL 1SMAA 5EN2B 4J3XA 1LNUB 4M7ZC 3BIBX 3FT2A 3QCUL 2IH3A 2PYFB 1H9VA 1EO7A 4LVOC 5CS7A 4YHNA 5BO1L 3QNXB 5H94B 4NKIL 3AXLB 4C56A 4IM8A 4KGLA 4NQSB 3F7VB 4Z7VF 4F7TA 4U7MA 5CZXC 4L8CA 3L3HB 3HE7C 1C7TA 1WCBA 2VWEE 4UV4H 1SMOA 1IGMH 2YN5A 4KJYB 4U3HA 1MVFA 1EO8H 2XXMB 2AEPH 4M7LH 4YBLC 1OAQL 3L5JA 3GM0A 4IRZH 1C5BL 5DO2D 2AV1B 4OZFG 2XV6B 3EIFA 4XTRD 5HYFA 2HLFD 1IFHH 2FZ3A 4HV8A 3GDBA 4K94H 3LQZB 2NYYC 5DJ0B 4URTB 1D9KC 1KENL 2MQCA 1JHKL 1YN6A 4MDIB 5GZNC 3VE0A 2AXGB 2ARWA 3UTQB 1JRHI 2KDGA 4QRRD 2WK2A 4AEFA 3LMJH 4NN7C 1FE8H 2XQYK 3QUKA 4XVJH 4LSTH 3CFIC 4FQIL 4NO0D 3RA7L 2MFNA 1KGCE 2R15A 5E5MB 4IOFC 3C2AH 3EDDA 1NLBH 1IGCL 2CIKA 1NQBA 6FABL 1FFPB 4F3FB 3GEWB 3IDYB 4PJXA 4QRRB 1SY6L 5E9DE 2GJ6A 1OF2A 4OZHF 2CJUH 1AD9B 4PIRF 1YPZF 4ZXBD 4YZFE 4D9RD 4E41A 1IC7H 3B4NA 2NY3B 3ARTA 3L3GA 3QHFL 3R06B 4HS3B 1DN0A 3PHSA 3UZQA 3UTZA 2DQFA 1Z9OA 5CEZD 1U8IB 4O4YH 4EDXA 1WZMA 4K3DH 3DRTB 1ULVA 3CFDB 4YHLL 4ODTL 5ANMA 3T1FB 2R0LL 5K9KA 4I4WB 3SOBL 2VDRL 3U30C 3D85A 1A3LL 5CIPH 4FNLH 4N0YL 1S9WB 5CCKL 2IBGA 4GRMB 2UZXB 3IXAB 3BKMH 5J56B 3GSVA 2VDOH 4HHAA 2H45A 4WI8A 1QFUL 5J1AB 2BNRD 5H8DA 5C0CB 1HHHB 1MHCB 2OR9H 3KAAA 3MBEA 3QZWG 4HIHA 4Z7VE 3S96A 4UOJA 3ZDYF 5TFSL 3KLDA 4OD2B 4MJIE 3V52L 4L4TE 3TF7C 4J4PA 1QYGH 2NY5H 5KJRH 4R8WH 1K8IA 1XMWA 1IAIH 1OAKL 5HY9A 4WUUA 4WI6A 4MMXC 4HKJB 1DUZA 1UH4A 3BH8A 3PE9A 2F5BH 4LPTA 3VGDA 1S8DB 4Z7OF 3VXSA 2AABH 3ZKQD 4HIXH 1PY9A 1P4IH 2FLBT 4OCXH 4WTWA 3TBTB 5E94A 4W4OA 5ITFA 1ORSB 3DX9B 3UDWA 5EFIA 3JWDC 3O3UN 4PJ5D 3CPLA 3WLBB 1DLFL 2OTWB 2EE9A 4KKBC 3NIDF 3STLB 4KKAC 1BIHA 2Z93A 3NFSH 2FBOJ 1M6OA 2AKRA 4P5MB 3VCLB 5J12C 5DT1H 1RJCA 2YZ8A 4I9WD 2YKLH 4LPCA 1F6AB 4R0LC 1U92B 5SWQB 4JZOB 3DBXB 3WN5A 1ZGLA 4XAKD 3JTTB 2JE8A 2Z8SA 3BWAA 4F7MA 1DQTA 2QTEA 3MNWA 3QWRA 1G7QB 1RZJL 2X1WL 1OTUC 4OZHE 1YA5A 2CR6A 4C56D 1YPZE 1B0RA 4PY7A 4HZAA 4R4BA 3K8LA 4QRPE 5AAWA 3BGFB 1WBZA 3LAFA 4OGYH 4WEBL 2XZQH 5HBBA 4X0KA 1ZLVK 2YEZA 2IH3B 2PYEB 1HSAA 4YHNB 1QBMH 2EXWC 3GBML 4LU5H 1UCTA 4B41A 1UCBH 3T0EA 4L8CB 4UOW1 3SGKC 1Q0XH 5LWYL 5EU6D 4KY1H 4P48A 1OGAE 1WCBB 1KB5A 1JN6A 3ULSB 1NDMA 4YDJB 5SWZE 1ADQA 3OG4B 4CDGC 5MERA 5FXCH 1A7OH 2NW2A 1FGVH 4S1SL 3TEUA 3V7AE 1VA9A 1ZA3A 3GJFK 2I27N 2ADJA 3RWEA 4EVNB 2VQTA 3EYFA 1YEDA 2ZUTA 1JZ2A 1T89C 3O3BA 4LCCA 1L6ZA 1KEMH 4HV8B 5L0QB 3UTTA 1AKJA 1YN6B 4G5ZL 3ZDYE 4KTYA 4LSQL 3VE0B 5C9JB 1JZ5A 4TVPD 7CGTA 3MLXH 2LE9A 2Z0BA 4UIMA 1W8NA 1MCLA 2H2PD 1R3LB 3LRGA 2GJ6D 3QO1B 2PCPB 3ARBA 1UZ8A 1QBAA 4E41D 3H42L 4Z7OE 1JGEA 3T77B 3VFPB 3MRBA 3DVGA 1B9ZA 1NGZA 4XNXL 1CGWA 3N1FC 3T0BA 1MAMH 5AD0A 4X80L 3DXAA 3MRIB 2AJ3A 4OLVH 5CJBA 5GRVK 1NSNH 3NIDE 4E41B 3L3GB 5D7LA 3D85D 3UTZB 2DQFB 4HD9A 2XG5A 4U6VH 4HWBA 3KPRA 2P8MB 1MJUH 4M5ZL 1CLOL 4MYWB 2ARJA 2JK5A 4J3OC 4O02L 5ANMB 1FIGH 5K9KB 1H8SA 3LPFA 5HPOA 5CGYD 4DTGH 1DVFD 2YOCA 4PTTB 4UQ3A 2QBWA 4G42B 5DD1L 1CZ8H 4CVZB 1FYTA 4NM8H 4M6NL 3G6AA 1LO3L 4D0DB 4MB5A 3LD8B 4TYUA 3MODH 4OLEA 3LV3A 1FAIH 5C0JA 3I50H 2GHWB 2FBJH 3GSVB 4K07A 1ZMYA 5KVFH 3EDKA 1B2WL 2CXGA 3VGEA 1DQLL 1BQSA 1CDIA 4HIIA 3RDTA 3GSUA 3ARDB 1ZLUH 3MBEB 4HIHB 4YDIH 3VXSD 1J87A 3S96B 4JFFE 3AM8C 4HMDA 4TNWK 3D2UB 1CQKA 3GMNA 5LQBL 4HS8H 1F4WH 2AJUH 2XT1B 1MRFH 3PWLB 4JHAH 4WUUB 1U41A 2E27H 4PTUB 5CMAB 4P4KB 3VXSB 3T3PE 1KXQE 3WFHA 4IHOB 5T1MA 2OZ4H 3ULUL 3GUTA 4XWGH 3WXVL 2FJFA 1MHPL 2Y1VA 5HVWA 4RDQF 1QLEL 4BQ9A 1V5JA 3CVIL 5E24E 4Y88A 3ZKXC 3GKWL 2OS7A 1EO5A 3SGJC 3WIHH 3QWRD 1M6OB 4DWHA 1KC5L 1NBVL 3EFDH 4U6XA 5GS1A 3ARVA 3I3EA 1IBGL 3MREA 3ARZA 4LPVA 1AXTL 2EE2A 3TN0A 4NZUH 2DLTA 4ZD3H 3PHOA 2F54A 2LU7A 4X6FA 1YEIH 3WN5B 3F12B 2IPKA 1ZGLB 1AHWB 3ARPA 3QNYA 4F7MB 5E8PA 4ODHL 5GJTH 1GHFL 4GBXA 1UEMA 3P0VH 5ADPL 4KZDH 4OBSA 3KYKH 4PY7B 4WU5A 2IWGA 4R4BB 5GRJH 3T0ED 3HUJF 5JDSB 1VADA 4OJFL 5D7SH 5IW6A 2QJDA 1WBZB 3ES6A 2EC8A 3DTXA 5IUSA 3GSWA 2Q8BH 5F7DA 4X0KB 2BFVL 2YEZB 3JV4B 4P23C 3S6CA 5E00B 2OCFD 5BCAA 2IPTL 2CRZA 1CFTA 4RZCB 4UT9H 3H3PL 4ENEC 1JN6B 4PJEA 1NDMB 3UTTD 1V8HA 2LVEA 4NHUA 4X99A 1Z9SA 1AKJD 1EHLL 2A6DA 2NW2B 4WFEE 1RPQA 4PRPE 4FG6C 3CXDL 2ADJB 3RWEB 4EDWH 2FJGA 4XNMB 2A6JA 2Y25A 3R1GL 4S10A 3O3BB 4HQQL 1F42A 1GZQB 1FL3A 3ARBD 1AKJB 1OM3L 2VO5A 1G1YA 3SJVE 5B39G 4JPKL 1DQJA 3P30H 5ENWB 3ZO0A 2IQ9H 4ZOAA 4I0PC 3HCVA 3O11A 4NWUL 4UIMB 3B2UD 2AERT 1A1NA 3DXAD 2MPAH 1UZ8B 3OKDB 3MRBB 5D7LD 3DVGB 4UZGA 1CGSL 3IGAA 1MH5A 3TO2A 4LASH 1NGZB 2VLJD 3KPRD 1I1FA 5AD0B 4HWEH 1F2XK 4AENA 2NR6D 3DXAB 2AJ3B 2AVGA 4CMHB 5T3XE 2V7NA 5DHXB 3TPUB 1T83C 5HHPB 2WAHA 5EWIH 5LKNA 4K2UH 5D7LB 5CBAA 3V4VL 4MA3B 4PLJC 5A2JH 3FZUC 2MHAB 5C0GA 1VCAA 2AK4B 4NM4L 2A9NL 4X6CF 5T33L 4S1DD 4AEIH 5GGVY 1T1WB 4FQ2L 4UQ3B 2J6EA 4JE4B 2HMID 3RDTD 3TCLA 3KXFA 3GJEA 3UXFA 1BZ7B 1DBKH 3WFCH 1FYTB 3G6AB 4G6FB 4UUJA 3CVHA 3HUJE 3LV3B 4O2FA 3MV8E 1TFHA 2QQLH 1I9RH 4N90E 4HIIB 4UBDD 4QXUL 3HC4L 5HVFB 3GSUB 3NAAL 4OI9A 5HHXL 5J6HA 1CG9A 4N0CD 1W8OA 5F8QC 5EO1A 4Y4HC 2XKSA 3GMNB 3LIZL 3MA9H 1NCDH 1NMBH 5I0DA 1L7IL 4NFBA 5DK0A 1U8QA 4XVTH 4W70A 4PRIE 2VE6B 1TJIL 4FQXA 1IEHA 1S78D 3IFPA 5DUMH 5E6IC 1QSEE 3K0WA 4FQQA 3B9AA 2DL9A 5ISZE 3GUTB 1PLGH 4L8SC 4FQHA 4WY7L 2XNAB 3VWKC 1DCLA 4HKBA 5ALBH 5DFVD 43CAA 2DQDH 4YEEA 3TN0D 1QEWA 3C60D 2R29H 2P8LA 1RZKC 3VDAA 2X1PA 4YXLL 2Y36H 4GBXD 2JJTA 5GS1B 2W92A 1TQCC 3MREB 1X5KA 3IDJA 5HHME 1C12A 4BJLA 4YXKH 1Q1JH 2F54B 3FT3B 4X7FC 1FGNL 1P4BH 2IPKB 1KLUA 2OXGA 1NBQA 3QNYB 1JGVL 4I2XA 2D9CA 4GBXB 4PLKD 1IC1A 3WHE1 3HMXH 5K9OA 4Z18A 3RZCD 1VADB 2J8UE 5IW6B 4GO6B 3DTXB 2FL5B 3N06B 3MNZB 3V0AC 1AGEA 3ZTNH 1M7IA 1CICA 4X6CE 3S3PA 3KPSE 1JGUL 1CFTB 1R5VB 1OPGL 4LEOA 2H2SC 4YC2C 1EAJA 5HHQA 4PJEB 4O5LH 4NHUB 4X99B 3MR9A 5KSBA 3CDYA 2JKXA 2ICCA 5IROC 2E6JA 2DMKA 4Y19D 2W65A 2FJGB 2A6JB 2FEEI 2DLGA 3SDXB 3JXAA 3UBXG 5ICZA 2QHRL 5F72S 4JHWH 1FL3B 2G5BA 3NFPB 1PX3A 3OG6B 1AXIB 1LQSR 3K3QA 2JELL 3KPMA 5F3HB 1DQJB 5IFHH 4PJ9B 1U3HD 1V3MA 2NY6B 2O5ZH 4PRBA 3GRWA 1A1NB 1ZE3C 3LPGA 5C6TL 4TQEH 1DLHA 2QQKL 3BW9A 3T2QA 1MREL 3EHBC 4LCIL 5BW7A 2HKHL 5ETUA 3VFMA 4JY4A 8FABA 5IM7B 5IF0A 4YHKH 3HMWH 1ZT7B 5IVOA 1BBJB 1MH5B 1YECH 1REIA 1I1FB 1WVZA 5JPMA 1TNMA 2VR4A 4AENB 1JGLL 3V9FA 4Z78A 4XAWH 2VLKE 3MLYL 1S7QA 2EDEA 3TA3C 1MCFA 1LEGA 1JGDA 3PGFH 1N6UA 2ATPB 2GK0A 5GS0C 2O5YL 5C0GB 4Y5YC 2VKXA 3N9GH 4G9DA 1E4KA 3C09B 1Q9KA 2DYPD 3FQXA 1JNLL 4HJJH 3IKCA 5HHVL 3VDBA 1ROWA 3EZJB 4FTVE 3KXFB 4D9QE 2D7NA 3KGRA 2DKUA 4PYHA 4NC2B 1CFVH 4J3SA 4RAHA 5HHNA 4NOFA 2IMMA 4LP5A 5IQ9B 2X4OA 5HGHA 1YNLL 4O2FB 3H3KA 5FA4B 4M5YH 3DYMA 2G60H 4JG0L 5FKPA 2ITDB 3ZSSA 4FQXD 5T1DH 4CMMA 3AS2A 4DAGH 4QXTA 3PABA 3GJFA 1ACYL 1WC7B 4K9EH 3MZTA 4YE4L 5DJAA 1KG0A 5LBSL 3BVNA 1I8LC 4DGVL 5BJTB 2X89A 3RX8A 1X5IA 4CKVX 3OAUH 2Q3AA 3IFPB 3V5KA 1U6AL 2AAVA 3QJHA 3MV9E 3Q1SL 4FQQB 5FM5M 1SBBA 2NY0B 1CDCA 4HKBB 43CAB 4BZYA 4FFYL 4IDJL 3WD5L 4U4BA 5GXBB 1QEWB 4PS4L 4YK4B 1FSKB 1LO4H 1X6NA 3OXRA 1UACL 3FQWA 2Q3ZA 3MQIA 5F1SA 1GZPA 3GMLA 3IDYC 4K3GA 4CRPA 4HKXA 2K7QA 5E1HB 5DHVA 1UB6A 1IGFH 2NY3C 4MJ6A 2WBJA 4XRCA 1CGXA 4YEFA 4QRTA 3DO3A 1HHKB 3CUPA 2FYYB 1CL7I 1JPTL 4OB5H 5K9OB 5CGTA 2B1AL 2Y5TB 2Z31A 5FYJU 3IJSA 3P11L 5FCSH 1WZ1L 4LRNH 5GGSY 3MLZL 4OQTA 5TF1H 4JZNA 4X4YB 2VB5A 3SO5A 1M7IB 1CICB 3BKCL 3GBNH 1A7NH 4LCWA 1T7ZA 2VMFA 4RNRA 2XWJA 4LEOB 5A2FA 3P4OB 1I9JH 1ZT1A 5FYLH 4KMQA 5E4IA 3PWPA 1BP3B 2B4CH 2ZSVA 4TSBH 4J3VA 4PGDB 2VDNH 5F1IB 4LLAA 4LKXA 1MIEL 4WWKA 4JKWA 2AEQH 5I1AA 4HJ0D 2G5BB 1PSKL 4JFZH 3BZEA 4U1HA 4NO2A 3KPLA 3LS4L 2V9RA 4KKCD 3KPMB 3ISWA 1HHIA 1MNUH 2C3VA 4MHHG 2FHBA 1KCUL 3BAEH 5F71A 5C0RL 2EDYA 4PRBB 4ERSL 1NMAH 5J1SC 3UAJC 3IDNA 2EH8H 5AAMA 1DLHB 2HLAA 3BW9B 5ETUB 4FQPA 3VFMB 8FABB 1NCAH 2B20A 1ORQB 5JPMB 2R2BA 5HYIA 3S7GA 1GGIL 3F7RA 3ALPA 4Z78B 4NBZB 3PP4L 3WNNA 5KS9A 4YIQB 1S7QB 4EKXA 1OAYL 3PQYA 1LEGB 2X4QA 4PJAA 2ZPKL 4PJGF 1J05A 1JGDB 1RU9L 3K8KA 1R24A 2GK0B 2LU3A 2VZVA 5CJOH 3O9WA 1IRAY 4GLRI 2XTJE 4G9DB 1Q9KB 1BQLH 1MRCL 1Y18A 5CP3H 3BGFC 5C0AE 4NO3B 3FQXB 1OHQA 3VMPA 5ILTH 5CJQL 2V2TB 3UJJH 4DW2H 1MQ8A 2XKNB 4XC1L 3W9EB 4POZD 3T2NL 2DF3A 3FMGH 3MCG1 1LE9B 5HHNB 3CCHA 3K80A 3IAGC 2ZOLA 4TSAH 2WWMC 1NUDA 3QHZL 1KNOB 1U8PA 3VFUB 1RUQH 2F58L 2F5AL 1GIGH 4CMMB 4KI5D 3DSNA 1UM6H 3JWOC 3IRZA 4QXTB 3PABB 3GJFB 1JV5B 1F13A 1EXUA 5DQDL 5AUMA 1IQWH 4U49A 1V3LA 5BS0D 5DJAB 3RGVD 1KG0B 5L0QC 2JJVA 3THML 2QLVB 1GRWA 1CDGA 1TLKA 1QFWL 5DURB 3CK0H 4LSRH 1YY8A 1QFOA 1VGEH 3WS6A 1ND0A 2HN7A 5ITBH 2Z4QA 5GGVH 3E6FA 1NGQL 1Y6KR 4N1EA 3X12A 1QHPA 4KWUA 4KAQL 3LN9A 4LIQL 2ENSA 5E9DA 1NUNB 5JQHC 3FJTA 1D5BB 5T5FL 4OZ4A 3BI9X 4XCNA 3OXRB 3ZT7A 4E9LA 3FQWB 4OZGB 1NJ9B 1GZPB 1A6VH 3GMLB 1UH2A 2B7DT 2FNBA 5TE4L 3CLEH 4HKXB 3HZMA 5M7QA 2BJMH 2CKBH 5EU7C 5DHVB 4F2MA 2VUOA 2Z31D 3NH7H 2VKWA 5FM5O 4UQ2A 4MX7A 4MJ6B 3I9GH 2WBJB 4XRCB 4ZSOA 1AGBB 1OWRM 3BFOA 4KRLB 5L2KD 4UILL 3CUPB 2EYRA 4LCWD 1G7HA 5HI5C 2XN9E 1BVKA 2N7AA 4PJGE 4H26B 3IJSB 1IL1A 3GM8A 3TYFB 1OB1B 4MAUH 1AO7E 3PWPD 2J4WH 4JZNB 1PZ5B 4YLQT 1MF2L 5C0BB 1HH6A 3RVVC 4JO4H 4XP4H 1UH3A 3LD8C 5I8OH 1WT5C 4RNRB 4WWKD 4AG4L 2CPCA 4Z0BH 4NRZB 2CQVA 3O6KL 4N0RA 4QNPF 4MJIA 1RIVH 2P47B 4L4TA 2CLZA 4LP4A 2ZSVB 5HDQL 3V5HB 4J6RL 4F37F 1KJMA 3ARDC 4TUOB 3MBEC 1WK0A 1LGVA 3H9ZA 1MFAH 3VWJA 1KPRA 1T04A 1MI5B 2J8OA 4PP2A 4WWKB 4J4PC 3LHPL 4HMEA 5I1AB 3OSKA 4J1UA 1F58H 3BZEB 3QR2A 4U1HB 4NO2B 4YO0A 3V0VA 3U83A 3KPLB 3HHRB 4NC1C 4P4KC 5E08L 4LMQI 4PRHE 4DN4H 2BX5A 5HPMB 5I19H 3U0PA 2C3VB 4XP9L 5E0QA 4CU8A 4W4OC 4JFEE 4P2OD 2AV7A 4U1JB 3IDNB 4AL8L 1EJOL 3CXHK 3PQYD 2BC4A 1OW0C 1G9MH 4QLRA 3H6JA 1J1OL 1ZEAH 4X7SL 1QNZH 3O9WD 4Y2DA 2R2BB 1K85A 1Q72H 3STBA 3BEVA 4TOYL 4ALAH 4IOSD 5KS9B 1PKQE 3U0TA 3QDAA 5I0ZA 2MCPH 4OZHA 5AYUH 1FVEB 1R3HB 1YPZA 3PQYB 4LLDA 4PJAB 5D2LF 4JO1H 3WN5C 1J05B 3C5JA 1AHWC 4XGZA 4WUKL 3Q6GL 5IHUL 3DOSA 1PG7X 3O9WB 4GW5B 2N7BA 2EDHA 4PY8J 4RAVA 3PWUA 3KPOB 2ADIB 5K9JH 4ZFFA 1Y18B 1WZLA 4DUXA 4DZBA 5DDHA 1A7QH 4NKQB 2QSCH 5L9DH 4OM1H 2FX9H 4PD4K 1OGAA 2WNGA 5SWZA 2N4IA 1ETZA 2CLRA 3PL6A 3CCHB 4ZUTA 1MCJA 4HWNA 1ZHNB 3V6FB 5FV1L 1ZS8A 4KJQC 1CXIA 2ZOLB 5ID1A 1XGYH 1MUJA 1XGUA 2UV3A 1TVBA 3NCCB 5DVLA 1CXLA 4QOKE 1MVUA 2NPLX 3GSXB 3N1QC 5F7YC 1YEHL 2W0PA 4QNPE 3SDAB 3VG0L 1TCRA 1ZLSH 2DM4A 3QIUA 4N0UA 1I7RA 5J89A 4OT1H 4FXKA 4H88H 2Z8VC 1CE6A 3K4ZA 4KKLC 2YZ1A 1YY8B 2K9UA 2G2RA 4AJ0A 5DJCA 4LSDA 2VH5L 2VDKL 1CR9L 5IOPA 4KK5D 3E6FB 3KWWA 5IJVB 4MCYA 4NNYA 1MFBH 3X12B 1WFOA 5GRWA 3ARGD 3HI5H 3SEPA 3FRPG 1ZVHA 5E9DB 4TNVF 1KCVL 3I3DA 4K8RC 5DJ8A 1A6ZB 4XCNB 1HQ4A 5IBTH 5CHNA 5DWUL 4XMPH 2OX5A 4IRJB 1CFNA 5FYJL 3HZMB 3MLTA 4CMHC 2LTQC 4KXZH 2BY2A 4HBCL 2O93L 3L95B 1BWMA 1I8IA 3U4EA 4UQ2B 5FUZH 3M8OH 2MOVA 5GGTL 5IBUG 3K2UH 4XPFL 2BMKB 2B8OT 1QP1A 5CWSA 1H3XA 2NR6C 3VXQA 1G7HB 3CDCA 4JFHE 1BVKB 1BD2E 1JHLL 5D2LE 1WFUA 3MRGA 1IL1B 3N50A 1M71A 2IGFH 4LBEA 4F9PC 1MWAL 4MJID 2QKIA 4JN1L 2VXVH 5LG1A 1GCFA 3VD3A 1HH6B 2P7TA 1QKZH 2XIDA 3VWJD 1A2YB 3KPQA 3UMTA 2VQ1B 4Z7VB 3WEXA 1B0GB 3F5WA 4RFNB 4Y16B 1LE5B 1I3GL 4L4TB 2CUIA 2CLZB 3RDTC 3SDYL 4B7LA 1LO2H 1OTSC 3MMEA 1KF9B 1KJMB 1UXSA 3BRDA 4LSPH 3OJMB 5JZ7D 4ZOBA 1T04B 5ESVA 4I13B 4PP2B 1LHZA 2NNAA 5EC2A 4DFIA 4D94A 3WBDA 5CJ8A 1BOGA 1DBML 2Q86B 4UBDC 2CUHA 5EZIL 5T3ZE 3LCYA 4RA0C 1SBSH 3Q5TA 3V0VB 1I4FB 4OD3H 4OFIA 12E8H 4P9MH 4XI5C 5FGSA 3RVTD 1SJVA 3LKNA 4KQ4H 5I66B 4Y2DD 1W2KT 5CSGA 5DMGC 3LB6D 4Z77A 1FVDA 3DGGB 3KS0H 4G7YH 5ESAA 3ZE1F 2BNUA 2Y6SD 5HYQA 4M03A 1S78C 5EO9A 1A14H 2R8SH 3K74B 1UT9A 4PP1C 5GS1C 2WBKA 2OMNA 1U3ZA 4KI1A 3U0TB 3LS5L 1UENA 4OZHB 1RMFL 5DEFB 2GSIA 1VEPA 1YPZB 3C08L 4QRPB 3M45A 4XGZB 2R69H 3S3JA 3QDJA 4GBXC 5DD6A 3QDHA 5SWZD 2ZCLH 1O7VA 4RAVB 3PWUB 4I3GA 1CD8A 2YUZA 3NBNA 4KHTH 3CSPA 1QR1A 4R26L 4U3XA 1EJ6A 4DZBB 3HI6L 4LQFH 5DDHB 3TLRA 3VI3E 1RZIA 4M7JH 4KJPD 2X4NB 1XCTA 3L7FB 1OGAB 2YK1L 5C8JB 2APFA 3QUML 4D2NA 3DMMA 5SWZB 5C07D 1U3JA 4WW2A 3X3GL 1ETZB 3PL6B 1JI2A 2ZUSA 3MUZ1 4ZUTB 5C1MB 3P73B 4H5SA 4PRPA 5DK2B 1JK8A 1QPPA 5ID1B 1MUJB 2D7OA 1XGUB 4LSSL 1T03L 4YDKH 2JLLA 4DQOL 1S9XA 1MVUB 5E8DH 2CDEA 1NLDH 4KKNA 4GW4A 4P5TB 3GMMA 1FG2A 4HJGA 3SJVA 4RGNE 5FM4A 3JBG7 3E8UH 5KN5B 3QIUB 1I3RA 1I7RB 5J9PB 3EO9H 5SX4H 4FXKB 3TVMB 1CE6B 4AIXA 4N8VA 2G2RB 3QUYA 5IOPB 1FORH 4PJ9C 1MIMH 4P49A 1IT9L 2DQIL 2NY6C 3GZKA 5IGXH 3KWWB 3IS0X 5J3HD 2MSPA 4MCYB 4NNYB 1O5DT 1OT1A 5CEXA 4ZO7A 5DJ8B 1V7NL 1QSZA 1F6LL 4JQXA 4WI4A 1WBXA 3N85L 1S3KH 4L4JA 4G9FD 5I75B 1JPFB 2BY3A 4UDUA 5A16B 3LN4A 5A43C 3ZE1E 1CFNB 1AFVH 3MLTB 3QCTL 2DI7A 2WZPD 2P44B 3WFDL 5EOQL 2D7TH 2C4FU 1MPAH 2ZUWA 1I8IB 1XR8B 3HFMH 4UINH 5ICYA 1JZ6A 1BLNA 5A3IC 4PB9L 2ORBH 1X5JA 1OAUH 2MNUA 3QXDA 1C1EH 4OCWH 5CWSB 4JQIH 1F97A 2B2XL 3PGDB 3STZA 4YHZL 2C3GA 1UA6L 3HRZB 5I1HL 3HS0A 4W6YB 3HUJA 3HNSL 1M71B 4LBEB 2HKFL 5A1AA 2GIYA 1YDPB 3KPNB 4ZS6C 3LZFL 4JKPH 5FYKH 1F90L 2P7TB 3RY6A 1XF3A 3L3DB 4RISL 1J1XH 4JM2F 5E99L 4AH2A 2H1PH 4UT6L 2D4DA 5IMOA 1V7ML 1C16B 1EGJH 4JFFB 3NZHL 3WEXB 1RURL 5GSRB 1RZKL 4RFOL 3F5WB 3TO4A 1ZTXH 2ERJB 1T7YA 3BP7A 1ZXQA 3MMEB 4WEUD 1PYWA 2WUBH 4AMKL 1F4XL 2QL1A 4N8CL 4PRIA 3BQUA 5HD8D 4YX2L 3JSSA 1D3CA 1QSEA 1BOGB 5ISZA 4Z9KB 5GQBA 2Q6WB 4NBYB 4JRXE 1ZSDA 2XZCH 1T6VN 4UV4L 1IGML 1E6OH 4Z77B 1TTFA 2NY0C 1OGTB 5ESAB 1PG7H 1TQBB 1U8KB 4MQXD 1L0QA 5D1QA 2GFBA 4IRZL 5HYQB 3BXNA 2AJXL 5IMLA 1SQ2N 2ID5A 4RFEA 4JKKA 4YK4C 1UFUA 3VXRD 1FSKC 3VXMD 5BMFH 3QH3A 1AH1A 4A6YA 3AAZB 4Z7WF 5IWLA 3QDJD 4DEPB 2JJTC 5IW1A 2QADB 3G5ZA 1T2XA 3EBAA 1E4XH 3D39D 1NAMA 4N8PA 3O6LH 1CN4A 4C4KO 3KNBB 1F3RB 4EOWL 5MHSE 4E0RA 4XNYH 3EDFA 3WDIA 1MLCB 3QCUH 4L4VE 2J8UA 3WUZA 3ZZ1A 3UTPE 3LMJL 5SWSE 1S5IH 1FE8L 5EUOF 4XVJL 4LSTL 4OLYL 4F9LC 4MZ2A 5AEAA 3D0VB 4WFED 3QEQA 4HUMB 4X6CA 4JO2L 5L8JB 4I1NB 3C2AL 3KPSA 1RZIB 3ARED 2IADA 2Z35A 3X13A 4KK6C 2ED9A 2AJYH 1OAQH 3PG2A 2RBLA 1GL4B 3DMMB 3U4AA 5DQ9B 1CICC 4WW2B 2WV3A 5BXFB 2AS5M 1CD9B 3GI9L 4JFXA 1IC7L 4H5SB 4PRPB 3RX5A 1P1ZA 1JK8B 1GJIA 3G5VB 4O4YL 4G6JH 4L8DA 3RP1A 4F37K 1KENH 4HK3N 3DRQA 4K3DL 1JHKH 1S9XB 1WTGT 4RGOH 3EYUH 5F9DC 4C57C 3S34L 3MNVA 5DQJB 2OXHA 1A1OB 2A73B 4GW4B 3QUYD 4CJ0A 5EUKA 2ZSWA 1FG2B 3SJVB 2IALA 4M7KH 1NFDF 4FNLL 4IBLT 4BQBA 4FQIH 1I3RB 3HAEB 4OGZA 3RA7H 5I18L 4X9GA 1NKRA 4U0RB 3T0XA 1F3JA 3BN3B 4NUJB 5T3XD 1DEEA 3BKML 4P59H 4WVRA 3S37L 4DFHA 5FO8A 6FABH 2BSED 4LCYB 2D0HA 5DVNA 1G7LA 3OKLA 4MJ4A 3OV6A 1SJHB 3ULVC 2VLKA 1JUFA 1WWCA 3KHOA 3OHXA 1Z3GL 3EJZC 1KLFA 1XH3A 5DJYB 1LDPL 1QYGL 3CC5B 2AXHA 4XWOC 1Z6JT 1VFOA 3LN4B 5DS8A 5ELIA 4XHJD 2DWDA 5GRZA 3MPCA 1TZHA 3PWJB 2F5BL 3SOBH 4HXBL 3EOBA 4CJ1A 4HIXL 2AJZB 4OCXL 5ICYB 4Z7WE 5CEYA 1BLNB 2VDPH 5IEHA 3K1KC 1EPFA 5BV7H 5DUPH 3QXDB 4WFFE 3MLVH 1E4KC 3V4UL 3QSKB 3HS0B 5B3JF 4PJIE 2HA1A 3CMOH 3H3BC 5BQ7B 3HUJB 3TNNA 3SGEI 4ZYKA 3TO4D 3SKOA 3TH2T 1QFUH 4LSUL 3NFSL 4JZJA 4ZNEE 1DBJL 3MV8B 3B9EA 1G0XA 5EUOE 5JR1L 2OJZH 4JFPA 3F65A 1CBVL 2IMNA 5T1LA 1XF3B 5EIVA 5DUBA 4PRID 1R3JA 5TFSH 2IG2H 3BQUD 4AH2B 1NMCB 1BJMA 3CH1A 3VRIA 4Q9QH 3UTOA 1OAKH 4MB3A 5ISZD 1T80A 2V17L 1CXHA 2BOCA 1JYXA 3E6HA 1PYWB 4JCLA 1J8HB 3QXUA 4KVNH 3WJLA 1ACZA 3BQUB 1B4JH 3MJ8A 4OGYL 2XZQL 4U31A 1QSEB 3C5ZA 2A2QT 3H9SA 3FFCB 3C5SA 1DLFH 1HEZB 4P2QE 3LKQA 5D1QD 1QBML 4LU5L 5HHMD 4OZFB 1KJVB 4GG6A 4M9PA 1NFDE 1F8TL 1OP5K 4KY1L 3LEVH 5EBGA 5D8JH 5D2NB 1A22B 3ARXA 3P0YH 5KSUA 1JZ4A 1RZ7H 4TNVK 1FGVL 3WS3A 1TTUA 2GFBB 2N1KA 5IMLB 5HHMB 4WFGE 4RFEB 4RIRA 1JWSB 3JTSB 1NCCH 3RI5F 1RZJH 5MI0B 1MAJA 4BKLA 1KEML 3G5ZB 4UNUA 3LSOA 3ZTJH 3QEQD 3SGDH 1NAMB 4FZEL 4KRPB 1RV6X 2WBJC 1TIUA 3MLXL 5CKAA 2WP3O 5JPNB 5DMJB 2ZP0T 1W72A 4L3ED 2WWKO 1T1YA 4ELME 4YR6B 4WFHD 4NKDB 1CQYA 4X6CB 4WI3A 1EFQA 3ELAT 3KPSB 2C1PA 1WAAF 2IADB 3X13B 4HWZA 5LGJB 2JB6A 4DCQA 1UGNA 1FL6A 3FO0H 1NGWA 3GIVB 1DEDA 1K2DB 3VMNA 5IB3B 3VXTA 1IC5H 1N6VA 4HUNB 4K7FA 4Y1AE 3X3FL 2WANA 5B3JE 4D0BA 2RGSA 1P1ZB 4WI7A 4L8DB 1XCQA 4RX4D 3DRQB 4LSVL 5FF6B 4G5ZH 5CP3A 2AQ1A 4KK8D 5H2BA 2V5RA 1GSMA 1DFBH 3RY4A 3QI9A 3DROA 2ZOKB 4WWKC 5C09E 2ZSWB 2IALB 4KROD 4CNIA 1TETH 4OFDA 3QZWB 2IPUG 4NGHH 4WTXA 3ZDXF 4F7PA 2DWEB 1F3JB 4YPGB 1DEEB 1BBDH 1FAIL 3LKOB 5C0DB 4XNXH 2V7HB 1I7ZB 2FBJL 3I50L 5KVGL 4IMLA 4ESKA 3WE6A 2W9EH 1A21A 4Y8DC 4KROB 4MZ3A 5SV4A 1G7LB 1CLCA 1WF5A 4XCYB 3QG7L 3D3VE 4YDIL 5IJKC 5HGAB 2VLKB 5KVDH 4OCRL 4OZFH 1RJYA 4G8GE 1EHAA 5J4MA 4HS8L 2GEEA 3KLSA 1F4WL 1FZJA 4GKZB 4JHAL 1MRFL 4O02H 5DS8B 2DWDB 3ULUE 4QXWA 6CGTA 4E5XA 4FXGB 1A7BA 1N26A 3JWOL 4WO4A 3EOBB 1QQDA 2L0DA 1K4DA 4MWFA 2OZ4L 5C0AA 1XFPA 2YPLA 5IEHB 4M6NH 3O9WC 5T1LD 4FTVB 4KQ3H 1DQLH 3TNNB 3SKOB 3UYRL 2EEAA 3WIHL 4EQ2A 2CKBA 4F80A 1MFNA 4Y5VA 5B38A 1ZHKA 5DUBB 2A38A 5K9QI 4NZUL 1QZ1A 4ZD3L 1IM9A 1D6EA 2ADGB 1UZ6F 1BMGA 1YEIL 1WAAE 2DIJA 5GGRA 3VRIB 5K33A 3H9SD 5HXMA 5GZOC 4IS6A 4QF1A 2BOCB 3P0VL 3E6HB 4KZDL 3KYKL 3DYOA 5D70H 5FYLD 2JJUA 2R4SL 4FOMA 4BQ6A 3WXVH 1MHPH 3MV9B 4YFLI 3C5ZB 1YEEL 5JW4R 1A7RL 3C5SB 1QLEH 3LKQB 3QA3A 3LKPA 3GKWH 4GKNA 1RUAH 5DD0H 1UG9A 1EEQA 3MOAL 1HXYA 2GCYA 4UT9L 4WHYG 1EZVX 3V8CA 1S7TA 3LOWA 3MRMB 5C0IA 2YA1A 3ZDXE 3MV7A 4NNPH 3HTLX 3WS3B 4CDHA 2EEBA 5MEQA 1GOFA 4RIRB 4ODHH 2NXYB 3IDMB 3NIFF 4C54A 4KK5C 3HZVA 4IRJC 3LSOB 5E03A 1KTLA 4JM4H 4OJFH 1B4RA 3O6MH 3P30L 1YYML 2WBWB 2JJWA 4WWID 1W72B 2MPAL 4JAMA 1AO7A 4ODXA 2Z92B 4FN0A 1F6FB 3DI3B 3IT8D 4U1IA 1Z9MA 4LVEA 4LASL 3QRGL 1WUNT 5HVGB 1HNFA 2EDBA 5KSVA 4HWEL 2LV4A 2BNQA 1NGWB 1T66D 3CXDH 4I18A 3VXTB 2F9BT 1ONQA 4D0BB 3MGAA 3QI9D 3R1GH 4NRYA 2LAAA 5EWIL 2BDNH 1OY3B 1VFBB 5IQ7L 3L1OL 4RFNC 5TE7H 4Y16C 1RK0A 4HGWA 1XCQB 2UVFA 4WHDA 3SPVA 4Z6AT 1R6VA 5H2BB 2AEWA 3QIBA 4EUPA 1UZ6E 5CEZE 3O2WL 3BJ91 3DROB 4PRHA 3A0OA 2F74A 1A5FH 3CFCH 5IR1A 4CNIB 2Z9TA 2APVA 4P9HH 4PJ7A 1CL7L 1N5YH 4Y8AA 3WFCL 1E0OB 3WO3B 4JFEA 5D93B 5F89A 1CGSH 2D31A 3BP4A 3FAWA 1QVOA 4IMLB 4QEGA 4FABL 1A1MA 3MRNB 4G7VL 3MJ9L 1I9RL 3NFNB 3IS1X 2P45B 5LCVH 3UJTH 4CVXB 2ZCKH 3PXJA 1S5HB 4KDTC 1RJYB 1IAKB 3RVTC 4APQB 3MA9L 2OYPA 1NCDL 2YPLD 2BNRE 4WI5A 5I76A 4NM4H 4LLYA 2RJMA 3NVQA 4UDTB 3RL1B 2A9NH 3LB6C 4PGBB 5T33H 5I1JH 4E5XB 4JANB 2A83A 2XTJB 4FQ2H 4WO4B 3I85A 1QQDB 3MRPA 5DUML 1OSZB 5DJ6B 4PJXF 5C0AB 4B53A 1PLGL 1FZOA 1FHGA 2UY6A 3DHJA 5ALBL 3QRFM 1IM9D 4U7KA 2ZUVA 1KB9K 4OBRA 1I8MA 1L0XA 4PJ5E 4QXUH 3HC4H 2Y36L 4P4RA 5JXAL 2HT2C 1Q9WB 3GGWB 3L5WB 4FS0A 4LGPB 4Y5VB 4BFIA 5HHXH 5HI4C 1ZHKB 3PL6C 4XCEB 5ALCL 4HG4J 3TZVB 4QOKA 3RPKA 4RCAA 1D6EB 3OJ2C 1XEDA 1L7IH 4K8RL 5GGRB 4X83A 4AY0A 4IS6B 1T20A 3O3DA 4QF1B 3DETC 4I9WE 2C3HA 2HVKB 2PETA 3BP5B 4WEMB 4MLIA 3ILQD 3LDBB 3HMXL 3VXPB 1U8JA 4P5TC 3BPLB 1GXEA 4PJCF 4AEHL 1CDBA 4CVUA 4HWBL 1AD0A 3MV7D 3HE6B 3QIUC 1I1AD 1P84J 2VJXA 3QA3B 4J12A 3LKPB 4GKNB 2KPNA 3TVMC 1R3KB 3VU2A 1IZKA 4OLWL 1G6RB 2GCYB 4QYOA 1J9CT 1N7MH 3BT2L 4DGIH 4O5LL 1N5AA 3CFEA 3QXVA 4YH6A 5B39B 5DTFA 5EU6E 5MEQB 4H1LA 2IBBA 1OCWL 3C6LD 4OGXL 5I75C 1AO7D 2K7PA 5D6CA 3HZVB 3EJYD 4JHWL 1K4CA 1GC1C 3ARQA 1S7WA 4PJFE 4O2EA 4PUBL 2DTSA 4U33A 5IKCB 4BFGA 4MQTB 2XN9B 3NPSB 5CD3A 1BD2A 1RJLA 5D2LA 1INDH 4PJGB 1FQ9C 5IFHL 2BNQD 4KVCH 2DQGH 4MD4A 4WJ5B 3ARFA 3CJJA 1CDUA 3MGOA 4JAMB 4TQEL 3WNMA 2BSTB 3KYOB 5D96B 1MCIA 5CAYB 4ODXB 1AGFA 1P7KA 2JCCE 3PDDA 2NZ9D 4POUB 4YHKL 4N5EC 4PJXE 4U1IB 1YECL 5FHAH 2GJ6E 3JUYA 3MROA 3UC0L 4HBQA 4BFBD 4OM0H 4XAWL 2DD8H 3QIBD 1EFXB 3JV5A 1ONQB 4PRHD 4BUGA 3WIFA 3PGFL 1RK0B 2EDXA 1AR1C 2ERJC 3U0WL 4HGWB 1KLGA 2E3VA 3SPVB 1OD7A 4H8WC 2XXCB 4JB9L 1EEZA 3N9GL 3QIBB 4LAQL 1DQML 5CD5C 4PRHB 4D8PA 2F74B 4HJJL 3FOLB 3S5LG 1CIUA 5C6TH 2W9DH 3KPTA 3GSOA 3L3IB 4JGJA 1YJDH 4LCIH 4JFEB 2DMBA 1CT8A 5F89B 4X4XA 5JIHA 3GSRB 3IDIB 3BP4B 4NSKA 4R9HA 1CLYH 4ONOA 4M6OH 3NABL 4PJCE 2HFEB 1A1MB 5EA0H 1JGLH 3M17A 3T4AB 2G60L 3UCRA 3RRQA 5KSAB 1TQBC 5T1DL 2C4XA 1FN4A 1PKQB 3RVXD 1MELA 5D1XB 3RI5K 1A9EB 4NDMA 5T1KA 5B4MC 3MUJA 4JY6A 4XPAH 1H0DA 2XACC 4DEPC 1T0NB 1A4KA 2R1YA 5I76B 1KFAH 4LLYB 2QADC 2H26B 2EE3A 1O0VA 2FB4H 4M6AA 2A83B 1OP9A 1XF2A 3MRPB 1L9NA 2FWOB 2NX5D 1NC4A 1FZOB 2QQNH 3MRQA 5HSFA 2DBLH 2DB8A 4QOKD 2X4RA 3WFBL 4GKSB 4QXGL 1YNLH 5I1KL 1BZQK 3AVEA 5I1EH 5CSZA 3RNKA 5F44A 1I8MB 2G9HB 4GRWF 1L7TL 4P4RB 4OI7A 1BFOA 3DMMC 4WW2C 1W0WB 4QOKB 3HPLB 4ODUB 4QRUA 2VAAA 1IGFL 1U58A 3FT4A 1Y6MR 4YE4H 1T0PB 1AJ7H 3O6FA 4ETYA 1T20B 4UU9A 4I3RL 1S7UA 1U8OA 3GK8H 1I3VA 1U6AH 2WIIA 4OB5L 3Q1SH 1U8JB 3Q2CA 5F9AC 4ZPVA 4BSWA 4LRNL 4F8QA 1AD0B 1JTOA 1N64H 1WJ3A 1UJ3A 3T0EE 2BRQA 4U0RC 3P9MA 4PS4H 3DURB 3GBNL 1A7NL 3FO1B 1RUKL 1T2QL 1UACH 1N2RA 1O7SA 3UBXB 1I9JL 5FYLL 5JHDE 2WQRA 4XPGH 5E5RB 3G6JF 1N5AB 3H2WA 2VIRA 3CFEB 3HNTH 4GAGH 5HGBA 5EU5A 1OP3H 4TSBL 5EBWB 4YPJA 5CGMA 1JMXA 1CWVA 1ED3A 3LKSA 3RWFB 5DTFB 5L6YL 1X5ZA 5TPWL 4JFHD 3ZMRA 1BD2D 3C8KA 4JQXC 1HE7A 3J8F7 4LLMB 2AEQL 3B2VL 3ARFD 1NCNA 5H37G 1K4CB 2EXYD 1S7WB 1J0ZA 1GGUA 3BKJH 1MHHA 1CCZA 1INEL 1E27B 3AY4A 3MLZH 1MNUL 1BD2B 1RJLB 2OTPA 5D2LB 5CILL 1QA9B 1I9EA 1QFWM 1NANH 4JVUA 5E2UH 1AY1L 4R4NC 1AGFB 3C8DA 1P7KB 2Q76A 3SE3A 1CU4L 3EYVA 1R3IH 1NCAL 2P46B 3H8NA 3QPXL 5HYJD 3ECBA 2FO4A 4ELKA 3ZKSD 3VGFA 3ESVF 4EI5D 5F6HJ 3TP4A 5MEPA 4YGAB 1R5WA 1EDQA 4ORZC 2BVQA 2ILLA 4MXQC 3O8XD 1AR2A 5HHOD 3KPRE 2VLJE 1NMCC 2X4TB 4V1DE 4P46D 1N8ZA 1CLZH 2AXFA 4LNRA 1Z0MA 4DVBB 4P5KA 1KLGB 5C92A 3VH8G 4G8FB 2XQBL 5CJOL 1KN2H 4EBQH 3TFKC 2VLLB 4PG9A 1RHHB 2GKIA 5C0RH 1S9YB 1HXMB 3BQUC 3OKMA 4LHUD 4PJEF 3QAZB 2BSSA 4JRXA 5ILTL 3UJJL 2ENYA 4P3DA 1W0YT 2VXTH 5I8CA 3AS1A 3SO3B 3SN6N 3FB6B 5F97E 4WI9A 5F88A 4WENB 3M17B 5D2NC 1RUQL 3BO8A 1UM6L 1OLZA 1FN4B 4MAYB 2ZPKH 5FKAA 5LXGL 4NDMB 1NC4D 5T1KB 5EOCH 3TJHD 4JY6B 5IWLC 1H0DB 3G6JE 3QEUA 1A4KB 4ZAKA 5MI0C 1VFUA 2A74A 5EPMB 4NQVA 4LSRL 4KRPC 1SY6A 4LIQE 2DQJH 4U6YB 35C8H 5GGVL 1I7UA 4RMWA 2ZWLT 3QJFA 2JB5L 3L7EA 3RWJB 4S2SB 3MJ6A 4HGMA 2IAMD 2YRZA 3QHZH 3RNKB 3IJYA 1NGXA 5FUOL 3O6FD 4OCSH 1I1CA 1KXVC 2EDFA 2NY1B 4XC3H 1A6VL 1BFOB 1EH9A 1N4XH 3CLEL 5FCUL 5JXEA 2IFFL 4PV8A 5D7JA 3KLHC 2BJML 3FTGA 3ULVL 1GGBH 2VAAB 1U58B 3NH7L 4QRUB 1XZ0A 5FYKD 5DQDH 1OTTC 3O6FB 4GT7A 3OR7A 3RIFF 4RGNB 1B6UA 3THMH 4K71B 4KC3B 3KDMB 2DQHL 4R7NA 4JKLA 1S7UB 1U8OB 2WIIB 4RMRA 4S1RH 5C6WH 2ZUXA 4BSWB 1DQQA 1F4AA 2FO1A 1NFIA 3QWOA 4MAUL 4PRAA 1XGRB 1YMHA 3RL2B 5EBMA 3MUGB 2NW3B 1P9MC 3P9MB 4JO4L 2OL3A 4XP4L 4HFWA 1T21A 1TDQA 4Z0BL 1A6TA 4B5EA 1NGYA 3ALXA 2XFXB 4KROC 5TE4H 3WLWD 5HGBB 1FCGA 3OKNA 3BKYL 3I6KA 4HDIA 3LKSB 1MFAL 1UXWA 3C8KB 4V2BA 5FO9A 4KDVA 3P77B 2BCKA 5EC1A 4MNGA 4LLWA 5IB5A 3MRHA 4Z7WA 4UILH 4XCFL 3VGAB 4X4ME 4Y19E 2E7HA 4X9FA 4FFVD 1HQRA 3MLRH 4EIZC 4DN4L 2OBGA 5I19L 1E4JA 4PJIA 2ATKB 5L8KB 4F7EA 3JWDH 4ZNEA 1HILB 4KK9C 4YHPA 5INDA 4CADA 3DVNA 3LPWA 2Q76B 1G9ML 3EYVB 3O6KH 3QT2A 3REWA 3HR5B 4HIJB 3ECBB 3KYMA 1PFCA 2FO4B 5HDQH 1QNZL 4ELKB 3LEXA 4ALAL 5MEPB 1R5WB 3PWNB 4GG8A 4W6XB 3FB5A 2BVQB 5L8LB 5AYUL 5I6XB 2F8OA 2OMBA 3LHPH 3FFDA 1KBGH 2M8XA 4JRXD 5EOTB 2X7LA 1FZMA 1G7IA 4JO1L 1N8ZB 4LNRB 4OUUA 4P9HC 1EVUA 4P5KB 4PJDF 1BF2A 4M62H 3WJLC 1KT2B 1AQDA 1XR9A 3PP3K 4P2QA 3BIKB 5K9JL 1UQSA 3OKMB 3DIFA 5GRVL 2BSSB 4JRXB 4JFDB 5KSBF 3QULA 1FC1A 1NFDA 3C5ZC 1G9EA 1GAFH 5L9DL 1A9BB 4YWGH 5ACZA 5I8CB 1XGQA 1S9VA 1J1OH 1HDMA 1KJ2B 4U1KA 3GBLA 4X7SH 4Y2OA 4DOHE 4ZAKD 1A64A 2X2YA 2UUDK 3HLAA 3U7YH 1XGYL 2AW2A 3C9NA 4I77L 1FO0B 1K8DA 4BUHA 4ZUUA 1JP5A 5ICXA 5IB2A 3GB7A 1MQKH 1HCFX 4AIZB 3FCTB 5K59F 1RJZB 5DRWA 2NXYC 3QEUB 1ZLSL 3B6SA 4L4VB 2HTKD 3FRPA 4G8IA 4HXAL 5JORA 4OT1L 5AWNL 5SWSB 4H88L 4ELMA 2BHZA 1XT5A 4BSVA 3VI4F 1I3UA 2UZIH 4WU7B 5JXED 1I7UB 3DVIA 4HMCA 1MFBL 4IRSA 3HI5L 3L7EB 3VXUE 5FYJE 5TQ0L 5GRUH 4BZ1L 2AGJL 4Y1AA 5J06A 4QGYA 3IJYB 1ZK9A 2HG5A 4QTIL 3KVQA 5J6GA 5IBTL 2DKSA 4PV8B 5TDOA 5D7JB 1SEQL 1YEHH 1P53A 4JM2B 1PDKA 2CGRH 4KXZI 1XZ0B 4I2XE 3VG0H 5LJYH 4X7EC 2WQ8A 2FIKA 3MLSL 5FUZL 5I30L 3GMQB 1DBAH 3K2UL 5C09A 3OR7B 5C70A 5F7HA 4R7NB 1BVZA 1X5XA 2VDKH 1CR9H 2EIDA 1YQVL 2V5TA 1DQQB 4HPYL 4PJDE 3QWOB 4L9LB 2VXVL 2EDDA 5D93C 2OL3B 1QKZL 3IKKA 1KCVH 3MYJA 1LEIA 5CSBA 2IPUK 2WIMA 3Q6FA 3MCKA 2IH1A 3D3VA 1BX2B 5KSBE 1A6TB 4ODVL 4Z7UF 1BFTA 4G8GA 2K1MA 3S37X 4KI5F 1LO2L 3OKNB 2EC9T 1KIRA 3SDDA 3NCMA 5FECA 2ICWJ 1UXWB 4ACPA 1F11A 2R1WB 5GGTH 1KJ2H 5KG9A 3V95A 3QFJE 4I48A 4XPFH 2A0LD 2VN4A 4APQC 2BCKB 1MCOL 5D72H 4LLWB 5IB5B 3MRHB 4Z7WB 1H3WM 5GIRA 1FO0H 2NQCA 4H0IA 5EG6C 2J3SA 1JRHH 1HQRB 2XTJC 3FRUA 4WO4C 5K59E 5LAXB 5EZJB 2I24N 4S11A 5IIEA 4KQ4L 4RMTA 4F7EB 2HAZA 2M1KA 3K1DA 4YHPB 4XMLL 3VGGA 5INDB 4G6AD 5EUOB 2HT3D 4FHBD 2C3XA 3DVNB 2BVYA 4MDJA 2FECI 3CDGB 3REWB 2P5WE 1A14L 1F45A 1AIFB 4PJBA 3KYMB 1WAAA 5K9QG 3LEXB 4H25B 4Y5VC 4OTXH 3Q5YA 4YQXH 3QQ4A 4GG8B 3O2VL 4P2QD 4XCCL 3FB5B 3TZVC 4R4FH 1LP9F 5CJXA 1FZMB 1G7IB 3SE8H 2R69L 4OUUB 1DBMH 1QSFE 1CGTA 3CX5J 1CE1L 1AE6H 2NY4B 2VNCA 1DP0A 2ZCLL 1IZJA 3LDBC 4KHTL 1XR9B 4P2QB 3CSYB 3X14A 1UQSB 3HC3H 5IB4B 3FONA 2E6QA 3DIFB 4WFGD 3BPLC 4JFYA 4LQFL 1CFQA 3V5DA 1X4YA 4M7JL 3QULB 1NFDB 3HE6C 5JW3L 5FDWA 1XGQB 4XXCA 2P5EE 4HAGA 5ACLA 1S9VB 3ILQC 2BZDA 1HDMB 2R23A 4U1KB 2WMPA 4XPHH 3T3MF 1U91A 3CFKA 5GHWH 5J13B 4LK4A 1K8DB 3TBWA 4ZUUB 2FEDD 5ICXB 1VERA 1YEFH 5IB2B 3EOAA 3C08H 4CN1A 3IDXH 5E7BA 4Z7UE 1WCQA 4NWTL 1RY7B 4OLZH 4KI5E 2ZNXA 3B6SB 4G8IB 5JORB 4IRSD 4Z0XB 1AC0A 3GSNH 3OB0K 4ELMB 3O3AA 3UPRA 5SX4I 3WHXA 3NPSC 4BSVB 1IAOA 2GSGA 5BS0E 4MS8D 4UTBH 2BERA 1JTTA 4JPWL 3X3GH 4AIOA 2YXFA 4NO0A 5D96C 4PJ8A 3O4LD 2L7JA 5IBUB 1MCNA 3LQAH 4Y1AB 1TJHL 2CUMA 4LSSH 5BZWA 2HG5B 5C09D 4P2CG 4UNTA 4HUWB 4XP5L 5J6GB 2FX8H 4LKCA 5EU4A 7FABH 2OSLA 3SE4A 5D5MF 3VW3L 5TDOB 1AFVL 2F53E 4ZPTA 2D7TL 1MPAL 1KIQA 3HFML 4UINL 3TH4T 2A9ML 2PXYD 4M3JA 4U1NA 2X70A 3U36A 2UZYB 1ZWIB 3MJ7A 4X7TA 3V6OC 2ORBL 5M95B 4OCWL 1D5ZA 1XGTA 3D18B 1LP9E 3QUZA 3QIBC 3D3VD 3RIAF 1N0LA 3MRCA 3IF1A 1WQVT 4NO5A 5FOJA 1NC2B 4G8GD 3WNLA 2C9AA 5L2KE 4JKPL 2VDQH 1GGCL 3VFTA 3SDDD 3MYJB 1EIBA 3ULUD 1LEIB 1J1XL 2KZWA 1JBJA 3GFUA 2H1PL 3K4DA 3PXHA 3Q6FB 2FH6A 3MCKB 4ZQKA 3D3VB 2O61A 3H0TA 4N8VG 1EGJL 1FFOB 3CFBA 4ETQA 4G8GB 4Q6IA 2YWYA 2KBGA 2DQUH 4HLJA 5KSAC 1VPOL 5EOQH 5E2VL 3NIGF 3PIQB 1DBBL 2WUBL 1Q0YH 1KIRB 5FECB 1XIWD 2H32H 2HJLA 1YY9C 2DMCA 4TUJA 5D1XC 1F11B 1FNLA 5KG9B 4I48B 4QHLA 1VEOA 3NCJH 4YHIA 3T3ME 3U46A 1AGCA 4PB9H 5CBEA 1BZ9A 3B9KB 5EDXA 2B2XH 3WCYA 3QDME 5JNYA 1UA6H 2EDNA 4HC1H 3FRUB 1U8MA 1R0AH 3KG5A 4X98A 4QO1A 5EORL 2YN3A 2XZCL 1MOEA 1HI6B 2VTFA 4JO3L 2PF6A 4PJ5A 3DWTA 5E99H 1HH9A 3HNVL 1MJJB 4UT6H 4PREA 1U9KA 3KPPA 1V7MH 4MDJB 3NZHH 1JCKA 5BMFL 4WV1B 4C83A 4TPRL 3RVUC 1CVSC 1QRND 2D4FA 4Y5YB 1XF1A 3RVWD 1E4XL 4GMTH 3QQ4B 4N8CH 5CLWA 1S7RA 4YXHH 1VSCA 4YX2H 2YWZA 1IAIM 5C0NC 3LQMA 2YD7A 4XNYL 3RIFK 3QYCA 5D5ME 2BVOA 1S5IL 1HYRC 1GC1L 5C7XL 1H3PL 2N56A 5FB8A 3RWIB 4YDLB 1NH6A 4JFYB 2LQRA 1CFQB 5GGQH 2E9IA 4FP8L 4X9IA 5BOZG 1MCEA 5HDOA 3ALWA 2AJYL 2KQMA 1NEZG 4G8EA 1KIUA 5AYQA 1I1RA 2AJXH 3LVEA 4OF6A 4XHQA 4X5LA 2CDFB 2R23B 2P43B 5EU6A 1T7XA 5IMMA 1ES0A 4WDIB 3CFKB 4J8RA 4G6JL 1CYGA 3S36L 3TBWB 3LN5A 1KTKE 5F7UA