1JGVH

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
b'EVKLVESRGGLVKPGGSLQLSCAASGFTFSGYAMSWFRLTPEKRLEWVASIYNGFRIHYLDSVKGRFTISSDYARNILYLQMSTLRSEDTAMYYCSRGDAYSRYFDVWGAGTTVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule keywords Antibody Light Chain
molecule tags Immune system
total genus 38
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvH01
2AKRB 4IIQA 2VZ1A 3TWCH 5EN2B 5E99H 5C0ND 1D5XB 2MPAL 2P24A 1MLBA 3QHZL 4MNQA 1A9EA 2DJSA 3QG6B 2X4UA 1ADQH 2KZ1B 1B4JL 1T80A 3FO0H 5EUOF 3MUGA 1D9KB 3MLWL 2VLRE 3PDOB 4XWOD 3C6LD 1KOAA 5GS0D 2Y23A 3ILQC 4ZDHB 3RY4A 5D7SH 4KJYB 1CR9H 5C0FA 1DL7H 2AJZB 4F58L 1QSFB 1KBGL 3GMNB 4I2XB 4ENED 3RU8H 4KUZH 1O0VA 4Y16D 2ATPA 2CK0L 2W1NA 1YEGH 2Z35A 5DR5H 4CDHA 4AL8L 1Z3GL 1Z9LA 4C57C 4QRUA 3DYPA 1WZLA 2IG2H 2XA3A 1LE9A 4CMMA 1JGDA 1G9EA 4Y2DA 5CWSA 1C8PA 1T22A 4BKLA 3BKMH 4Z77B 3BQUC 1CIDA 4G7VL 3MNZB 1U8NB 1FIGL 4XHJC 5A2LH 2Y72A 1NUFA 4YHYB 4GAYB 1KCKA 3QUZA 4PG9B 3PWNA 4HEPG 1T83A 3TNNA 3LRSB 5C6TH 2C1OA 2YUXA 1HHHB 2VAAA 1TZGH 4WI3A 4X5XB 3L3GA 3QWOB 4HWEL 5D2NA 2OK0H 5EFIB 5AZ2L 2ZPKL 4N9GB 5GGSA 5C07E 1M7IA 1UXWB 3DWTA 5HDQL 3ALPA 3WIFB 3B5TA 3TN0B 2GSIB 4FQ2H 3W5NA 5DEFB 1U6AH 3EHBD 1ITCA 1A21A 4KK9C 4E5XB 3MA7A 4PRPE 4KQ3H 3UZQA 2BCKA 2V9TA 1FBIL 3UO1L 2UVFA 5FHAH 3KLHC 4KRPC 3HC3L 5IBTH 1LO4H 2ZCHH 5KSAD 3HCVB 2LE9A 1N5YH 3U6RB 1G1CA 2QHRH 4K94C 1NKOA 4GW5A 5IWLA 2FATH 1DQQB 3VXQB 1EBAA 3KYOA 1NDMA 2FBJL 4MQSB 2D7NA 5T1MA 2F9BT 2GT9B 5FA3B 3I6LD 4PJ9B 5AWNL 5IV2A 3CH1B 2PR4H 2WBJA 4M61B 1JUFB 2ENSA 2B1AH 1BF8A 3QJFB 4Y5YC 3T2OA 1UQSA 5GSRB 4LCWB 1GGYA 4K71B 4PJCF 3HR5A 4FZEL 4D9RD 1AC0A 4P49A 3V8OA 1DUZA 4OQTA 4CJ1A 3BUYA 1DN0A 1OB1A 3RWDA 3U4BH 5ERWA 4XB8A 4TPRH 3ZHKA 4FNLL 1EUUA 1RJZB 4Y5XC 3V7AE 1AHWA 4GRWB 4U7MA 5D93B 4KDTA 1MIML 2VL5B 4XPGH 3G5VA 5I1AB 4AENB 4NNPL 1NC2D 4U6HB 1FNAA 4E41A 5TH2B 1IGFH 4R96B 3TO2B 4LHUG 1AGEB 3ALWA 4MD0B 2X40A 4ZXBC 3A6CL 5I1GH 1UYWL 1XF5A 1J05A 2Y36H 4I8DA 3VH8B 4P9ML 2CXKA 5F1IA 4JKWA 4MA8H 3U0TA 4BA8A 5EZLA 4X6EA 4G8FB 4QHNA 3QIBD 4F37K 4OZIA 1NAMA 2CMRL 1Q9OA 2YEZB 4ODXA 1QQDB 5CEZH 2R4RL 2B4CH 3Q6FA 3F58H 1MWAB 3I3DA 1SVZA 1M7DA 2F8XC 1BM3H 3FB6B 3N0PB 3RTQC 1ZA6A 3S5LG 5FYLE 3ZKXB 4JJ5B 1WT5C 5EH1A 2R8SL 2BXZA 2ZUQB 4HT1H 5BS0D 2GJJA 4UQ2B 5DRZB 2W9DL 3O6FD 2ORBH 2J5LB 5F96L 3KYNA 3I3EA 3SDDD 1CTOA 2DL2A 4G6KH 3O3EA 4I13B 2YMXH 3SY0B 1FGVL 4NN7B 2CDGA 3D1MC 1RK0A 2NW2A 3ILPB 1E4XL 1QVOA 4HIHA 5HHVL 3DECA 1K8DB 4Y5VB 5D2LB 1BVLB 4FZ8H 1QBLL 5IHUL 4QRPA 5DMJB 1MI5D 3U9PL 2BX5A 3QEUB 4HCRA 3MV7E 4GFTB 3I50H 5D1QB 1U8PA 3IXAB 4O02L 2OYPA 5ILTL 1T66C 4ZOAA 5DUBA 5DI8A 1QR1A 4XX1E 4JFPB 5DS8B 1OAYL 1TTGA 1OAZH 4NO3B 4WU5A 3BN9D 4L5FL 2MMXA 1C08A 4TRPL 1F58H 3GBMH 4U1HA 1UB6A 4JVUA 1Y18B 3DBXB 4DVBA 5SV4A 4L1HA 4BH8A 4R90L 2CLZB 2GI7A 3MROA 1BGXH 2FJHA 4Y7MA 2NY3C 4NO2A 5BRZE 1KT2A 4Y4FA 3S35H 4S2SA 3LZFL 5GJTL 4M5ZH 4D0DB 5KTEL 1IBGL 4BZ2L 1GZPB 4ZFFB 1MIEL 5I0DA 3DO7B 1UKSA 4Q0XH 2LAGB 1R5WB 5GGTH 1XGRB 5AEAA 5HYJA 3E6FA 1YC7A 3PGFH 4N8VA 5CGTA 3P11L 5C9KA 3R06A 5E24E 2HVKA 5C2UB 1VB9A 5FA4A 2FX7L 5J1TC 1FFOA 1ZLSL 4LF3A 3D87B 3JV0A 4OUOA 4Z95H 1A1MA 1BQHA 4NRZA 2R1YA 5HVGB 5L0QC 1N6VA 4UDTB 4UUJA 3H9SE 1NCDH 5K33A 4XP1H 1YPZA 4Z7WF 3I02A 4HH9A 1A6VH 3MJ9H 1LVEA 3MYJB 1AI1H 4BZYA 4YO0A 1CDHA 3S3JA 4JRXB 1UCBH 3CSYB 3PJSA 5A2IH 5T3XL 5FF6B 1XF4A 3UTPE 4MAUL 4P4KB 4KTYA 2WSKA 2WK2A 1A7RL 2OJZL 3KS0J 1JGEA 2LTQC 5LKNA 1QP1A 5FO7A 1R0AL 1KEGH 1A7NH 1IEAA 3MRKA 2A9MH 5KVGL 2VISB 3VRLE 3HB3C 5B3NA 4H20L 3WUWG 1P4LB 5ICZA 2ZNWA 1NFDA 1CGWA 1X4YA 3QUYA 4PUBL 4XNUL 3UPRA 2AJYL 2WZPD 4LPYA 5JHDB 5EZOL 4HUMB 4LPVA 1M6OB 4ZTPL 5EO1A 4JDVA 2DM3A 2EDLA 1JRHL 3VXRB 1GOHA 4O2CB 5MEPA 1JWMA 1T4KB 1NANH 2VDLL 2GJZA 2NY6B 4Q74A 2BJMH 2W60A 2O5YH 4UDUA 3ARDD 3BGMB 2XTJE 4M9PA 5AYUH 4XCFH 1QZ1A 4R7NA 5DJ0B 1EX0A 4PFEA 1A6UL 2C4FU 1N59A 4LCCA 3HI1B 2P8PA 3FO2B 4X9GA 1RZJL 43CAB 3QA3A 3B3IB 4KK5D 2UUDK 2D9CA 3NGBB 4PJFB 1N64H 1MJ7H 2EH8L 3VD4A 2AKRA 4PP1D 5EN2A 1GSMA 1D5XA 1M71A 3HG1E 4K7PY 4GS7B 4TULH 4X6BB 3ARYA 1R3LB 4X7CC 3O11B 5ESVB 4J4PC 1GGIL 4XVJL 5DUPH 2P42B 3QG6A 2VE6B 4PLKC 2MNUA 5DJYB 3IDXL 3ALXA 1D9KA 3GMOB 3PDOA 4NCC2 4HQQL 2DMBA 4WW2A 3FT3B 2I60L 5KG9B 1VFAB 1UFUA 2J6EA 4L9LB 4ZDHA 1I85A 3RVXD 4PJ8C 1SM3H 4PRDB 4I2XA 3H7LA 3WFCL 4S10A 5KVFH 3OAYK 2UVEA 1U8LB 4YQXH 5TQ0H 4K9EC 1IC5H 4IMLB 4LHUD 3ZDYE 1J0YA 3HE6D 4ZFOA 4NJAH 3BP4A 2V5TA 4J3XA 3NMEA 2NY4B 5JW4Q 3P0GB 3MNVB 4LARL 3UTSE 3L6FB 1EO8H 3T77B 2DF3A 4XPBL 4JGMA 1G84A 1FNGB 4FQHB 1HHJB 1OP5H 1XGYL 5T3ZE 3Q0HA 4PG9A 5HI4D 3TYFA 4Z76B 1A4JB 5EO0B 4X8XA 3LRSA 2OI9B 2R4SL 1JMZA 1DFBL 5T1LD 4C4KT 2BFVH 4W6XB 4L3ED 1U8IB 1DQJB 1HHHA 1ULVA 1FYTE 4LOUD 3JUYA 5IEHA 3QWOA 5EFIA 4N9GA 5CMAB 4LVOC 3WIFA 1WBYB 1VEPA 3HNVH 3LKPA 2GEEA 3MRMB 5CEZE 3VI4E 2HJFA 4MNGB 5E6IB 2WIIB 1DE4B 4LVNC 3FQUB 5SWQB 2AJVL 1FC2D 4E5XA 4ZPTA 1QUNA 43C9B 5BV7L 2EH7L 3MR9B 5KANG 1QO3A 2HT2C 3THMH 2Z91B 4N1CA 1FZKB 2C5DC 5AZEL 4AG4L 3U6RA 3SDYH 5C71A 2A1WL 3WS6C 1DQQA 2BY1A 3IYLW 3VXQA 1MJ8H 4KFZC 3BIBX 3BXNB 4IBLT 4W4OC 4BQ9A 3KS0H 3QDME 1RI8A 3LKSA 1YZZA 3CH1A 5EOQH 1BJ1J 1NCUA 4KHXH 2DLEA 5A1AA 1JUFA 1C16B 3SDAB 2W9EL 5C08D 32C2B 4MB5A 4P3DB 5GSRA 7CGTA 3MLXL 5J57B 5C0RL 1L7TH 2R0WL 2E27L 3LB6D 4CJ0A 4RZCB 1SEQL 2PXYD 4EQ3A 3C8HA 1G7PB 4ODVL 4OFKA 5IB2A 2WUCH 1OW0A 1FE8L 2YPLE 2VL5A 2UZYB 3PL6C 5E9DE 5I1AA 4AENA 5FECA 4U6HA 2QQNH 4HGWA 4Y4KC 4EUPG 3QDGE 1A3LH 2EDXA 4RAVA 5TH2A 5F7DB 1XF1A 1OQXA 3TO2A 2IMMA 5B4MC 3PP4L 1AGEA 3GSRA 1DBKH 5HDOA 4YHML 4J1UB 3O8XC 1UB5A 3T1FB 2JKXA 5ALCL 1BWWA 4PJ5E 4WV1B 3GUTB 4F7CB 3EOYG 3WNOA 4OCWL 3B2UD 4G8FA 1RJYB 3F7YB 4RGOH 4RAUB 1D5MB 4B7LA 1D5ZB 3O6MH 3MQIA 3GSOB 4LCUA 1S9XB 4HS6B 4OF5A 1QBAA 1XCQA 1ZVHA 1D6VL 3EDJA 2UYLA 4OLWH 3SKJH 3QDHA 1PX4A 4MLIA 1T1ZB 3BO8B 3EYSH 5CJOH 4UQ2A 1PEZA 5DRZA 4ODBD 5I76A 4FABL 1WZ1L 1BHGA 2FEDC 1WLHA 3K8KA 5TF1L 1EEYB 2FHBA 1IC4L 4N0CC 1C1EH 1T1XA 4YHYC 4QOKD 1P4IL 4KC3B 5KSAB 2E6PA 4RMWA 4XPHH 5JLZB 5ENWA 3FMGH 3O3AB 3RWHB 3AM8A 4MCZB 5DJZB 3MOAH 2XWTB 3M45A 3LVEA 4XAKE 4M7LL 1K8DA 3FB5B 2HP4A 4Y5VA 4LIQH 1S7TA 3QCVL 2CKBB 4JHAH 3CVIH 3WSQL 1AO7E 1U9KA 3TN0C 4OZFB 3BDYH 2D0GA 3ECBB 4F9PA 3ZYIA 3TCXA 5HHME 3ARFB 3V6OC 3CDYA 3GSNH 4TSAL 3LSOB 1KPRB 1U92B 4M7KL 4NT6B 4P99A 4JFPA 3NBNA 4C56D 1RAMA 5GRYA 2C26A 2MPAH 1BQUA 3C5ZB 2E9IA 3QHZH 4D8PB 3RWGA 4Y19B 1Y18A 2WUBL 2V17H 4QXWA 2GCYB 1B4JH 5JOPD 2CLZA 3MLWH 4FMFA 1YMMB 2WP3O 4OIIL 2VWEE 4M7LT 1NL0H 1KIPA 2R2EA 1RK1A 4XT1C 3VXNA 1U3JA 4PJ9C 4D0DA 1BJ8A 1PG7L 1GZPA 3GHBL 4ZFFA 4JQXA 1EGJL 1E4WL 5I18L 4F58H 3L5WA 3BMVA 1KBGH 1QBML 4L29B 3V5HB 4MYWB 2XTLA 2MQ0A 4MA3A 2CK0H 3QIBB 2B1HL 4AL8H 4I5BA 1Z3GH 1SJHB 4MD5B 3MLSL 2FO1A 1Z9MA 4C59B 1PKQE 5BVJB 2IAMB 2VUOA 4XMKL 4UDTA 2ESVE 3C8KA 1BVKA 1UJ3A 5D93C 1XAUA 3S36H 4G7VH 5IMMB 4A2LA 4NIKB 2PO6D 5BS0B 1DBML 5D5MB 3R4DA 4HJGB 3SDDB 4PJXB 4JRXA 3CSYA 4NC1E 1U58B 4P0DA 1BJ1H 1KEML 4QXTB 3DVNB 3NCJL 1ORQB 3EZJB 2ZUVA 1FSKB 4HWEH 5IMOB 5AZ2H 9CGTA 2ZPKH 2A83A 5HDQH 5D1ZD 5F7FA 2BY3A 2R1XA 1I8KB 1EAPB 3L3KB 2IQ9L 2XZQL 4NN6B 2R23B 1YEIL 3DXAB 1FBIH 4PTUA 5F1NA 3SGDI 2VLJE 4P5MB 1P4LA 3QDJD 3UO1H 3BW9A 1EGJA 5IVZA 3ZKXC 4Z0XB 4YDLC 3UTTD 4PJEB 4AZ8A 2J5LC 1BD2E 5HI3D 1IGML 1CXIA 5E8EB 2FBJH 1TETH 3VXRA 4AM0A 1T4KA 2J8UB 3IRPX 3RIAF 4Y5VC 3T0AA 4LAQL 3FQTA 5HGDA 1J0IA 1QFWL 4HMDA 2YUVA 4HMEA 4MS8C 3BGMA 3CLEL 1ZVSB 4LPXA 2XNAB 5DJ0A 1P6FA 4A6YL 3KG5A 5D1QC 5ETUB 3OX8A 4PV8A 1TVBB 3B3IA 4FNLH 3JVGA 3EYVA 3M17B 3TJHC 2PCPA 1FG2A 1EPFA 2JJSC 1IAIM 4Q6YA 1MIMH 3QNZB 2WW8A 3N50A 4HIEA 3Q5OA 2WNGA 4NNPH 3O3BB 1DLHB 1G0YR 1PZ5B 3QEQB 1MY7A 4G6ML 5ESVA 4XP6L 1OARL 5C0JA 5DJYA 3A6CH 3CMOL 1UYWH 4V2CB 4BK4A 2YN5A 2FLRT 3BKJL 3GMOA 4UBDD 4P9MH 5BZWA 5C6WH 4EIGB 5KG9A 2IPTL 4XNZB 3Q5TA 3ZKND 5TF0A 3HS0B 2CKNA 3UCRA 4LLWB 2CMRH 4PRDA 2WWMC 2R4RH 4HJ0C 3KLAA 4JJHA 5BZDA 3K7UA 1NEUA 1IQDB 3EYFB 1IKNA 2NY7H 3DVGA 2HMID 3D3VA 4IMLA 5DMIL 4PJBB 1NLBL 4X0KB 2R8SH 1SJVA 3CPLA 1WWCA 1A2YB 2ZWLT 2W9DH 3CMGA 2Q3ZA 3TT3L 4LLQB 3MNVA 5F96H 2OZ4L 4X98B 3L6FA 1MQKL 1FL3A 4A6YA 1F3DJ 1FNGA 1HHJA 1FGVH 2PTTA 4PJ7E 1A4JA 3BN3B 4OBRA 3VXPB 3VXME 2CRYA 1E4XH 4NC2B 4XP9L 3VJ6A 5HHVH 5K9JL 1CTNA 1UACL 1N0LA 1U8IA 1DQJA 5IJKA 1CDBA 3BPCB 4P4KC 3RWJA 3PWJB 3ARBD 5DTFB 1QBLH 2GKIA 2VXVL 4JFDE 4LCYB 5IHUH 3S6CA 3IFOB 5CMAA 5E5MA 5FYJH 2AI0L 3ARDB 4XGZB 1DEDA 4O02H 3MRMA 3L5XH 5E6IA 5ILTH 1DE4A 3FQUA 3MC0A 3NIFE 5SWQA 3LV3A 5C3LD 1MNUL 4R0LB 4XCEA 1OAYH 3D69B 43C9A 3SO3B 3MRIB 3VXTA 4JO1L 3MR9A 4L5FH 2QSCL 4UINL 3F7VB 1HNGA 2UWEB 3D39D 4TRPH 2FH6A 4OCYH 1FZKA 1L9NA 3Q48A 4Z0BL 2C3VB 4R90H 3LS4L 1X5AA 4HXBL 3WJLC 2XA8H 3SEPA 2EXWC 1CE6B 3TZVB 3KPSD 1M4KA 3LZFH 5GJTH 2ZJSL 5KTEH 3RGVD 5CILL 4BZ2H 1CI5A 1MIEH 3C6LA 2NY6C 2A6IA 2DLHA 3E0GA 3BRDA 1AY1L 4LDEB 4LIQE 2Y9RT 1MH5B 1C16A 1JZ7A 3MJ6A 3QO0B 1C5BL 3D9AL 2WINB 4ISVB 2FX7H 3V7AG 4TVPD 1ZLSH 2IF7A 5CBAB 4NOFA 4Y16A 1QRKA 1LO2L 4GXVL 2RHEA 1G7PA 4LHUB 3LH2L 3H9HB 3HE6B 2B0SH 4NUGL 2VLKD 1JZ6A 1NBVL 5FHBL 5GIRA 1I1AB 1ZXQA 5TQ2L 3FZUC 3MRRA 3CZFB 1SY6H 1KCVL 3NFNB 1OTUD 4MAUH 5K9OB 5CSBA 3T1FA 2Q8AL 4LAJH 4L3EB 1A7RH 2OJZH 4L9LC 4KRMB 4WV1A 1AE6L 3UROR 3GUTA 2OTPA 4F7CA 1HKLL 3MUZ1 4YPGB 5DFVC 4P46D 1R0AH 3WIIL 2F15A 1RJYA 3F7YA 5KVGH 1D5MA 2GW5A 1N26A 4RISL 2VXUL 4GG6B 3GSOA 4DFIA 5CSGA 3MRJA 5TPWL 4HS6A 3B83A 5J06A 3U4EB 2MCPH 1B0RA 2CLVB 4JZNA 1BZ9B 3SDCC 1T1ZA 2NY4C 2QTEA 1MPAL 2ZKHL 4HUUB 4XNUH 2ICCA 2L7JA 2AJYH 3VE0A 5EZOH 3B9AA 1MCPL 1LP9A 2C3XA 4K94L 5KSAA 3I6KB 1FJ1A 5JTWA 3DX6B 2NW3B 4G9DB 1ED3B 5DQ9B 2NXZD 2VZVA 3O3AA 4GKSB 4MCZA 3QIUC 2VDLH 3VRLF 2XWTA 4KMLB 4JO4L 4LHJB 4WFFD 2ATKA 2P5WB 1A6UH 5E2WL 2CJUL 4PY7A 1JPSL 2GAZA 3VGAB 1KPRA 1V3JA 2EH8H 3HFMH 2IMNA 5MERA 2X4TB 3SN6N 4UU9B 1F3DH 4GW4A 1U42A 1JZ2A 5C0IB 2YD4A 4DUVA 3BZEA 1GGIH 4BFBD 3UPAA 1PQZB 3MLRL 1NC2A 3QQ4A 1MFCL 3HI5L 4BFEA 3IDXH 1IRAY 2XICA 3GI8L 3LN5B 1KB5L 1MHPH 4HQQH 4GUPB 4JR9L 3DX7B 2I60H 1OP3K 2J3SA 4NJ9L 4P2RE 3QBTB 4O00A 5DD0H 4RRPG 5GS0C 5FV2A 3ARWA 3O6LL 4FQIL 4Z7VE 4PBWD 3RUGB 3SDAC 4AIZB 1C5DB 1YNLL 2X4NB 2G5BB 5I6XC 3ETBF 4PJGE 5DRNA 1JPST 3QIBA 1I8LA 1SJHA 4MD5A 4PJHA 4Y1AE 1KTKE 2BNRB 1HE7A 2CRIA 3DI3B 4BSVB 5BVJA 3HC4H 4W4NA 1HZHL 2EZ0D 4PGCB 4LARH 3G6JB 4NN5B 3UTQB 5I1CL 3S37L 4XPBH 5BS0A 5AYQA 3QHFL 3WMSA 2ICWJ 3O6FA 5D5MA 2ARJQ 5KS9B 1JN6B 4HJGA 3ZTNL 5B3JE 2R4SH 3WO4B 3SDDA 1KENL 1DFBH 1IGIL 4QOKB 3ZTJH 1F8TL 3OAZH 3ZMRA 3MLUL 1U58A 15C8L 3TT1L 4AMKL 4EOWH 1UM4L 4QXTA 5BOZG 4KI5D 3ZDYF 2DIJA 5E8OA 3WUWB 5IMOA 1MHHB 2EO9A 2LFGA 2GFBB 3H7BB 3CU1A 3JTSA 1I8KA 1EAPA 3L3KA 3DROB 5DMGD 3TPUB 1MI5A 1W72L 1RULL 3MRCB 4TYUA 2AJVH 2Q1EA 4QRRE 3RP1A 1XGQB 1K5NB 2IH3B 5JIIA 3FN0L 5BV7H 4KJWD 1Z0NA 3QB7C 3QG7L 3TBSA 2D7OA 4P5MA 4UAOC 4X4YB 3RWEB 3QFJB 4Z0XA 3IRZA 4C56B 4KZDL 4GLRI 4PJEA 1CICC 4FQXD 5AZEH 3GB7B 4AG4H 2D9QB 2FX9L 2A1WH 4PRAA 2V5YA 1KACB 1U8OA 3G5ZB 3SE8L 4PGEB 1MLCB 3VI4F 3U83A 2YXFA 1FFNB 4PJIB 2W9EH 1S7QA 2NNAB 4TQEL 4N0FA 3QZWG 5C0EB 5F7LB 5FYJE 1DDHB 3CDGB 4D0CB 1E28A 5J6GB 3MLXH 5MHSE 5D7JD 1KIQB 1P9MA 1LHZA 1AKJD 2XNAA 2APVA 3IETA 1TENA 4TUJB 2DAVA 2R0WH 2KPNA 3GGWB 3ARFC 1SEQH 2XOTA 4WUUE 5F7EH 4ODVH 5BJTA 3M17A 1GRWA 4IOFC 4YR6B 4KKCD 1FE8H 3RHWK 3V0VB 2DJUA 3C5ZC 1DLHA 1HWHB 4R26L 4RGMB 1PZ5A 4NQCB 4ZFZA 4NZJA 1DQDL 2V9QA 3IKCB 2PO6B 1W72A 3TV3L 2XZAL 3PP4H 1T04A 4YHMH 3RWCB 3FQNA 3U2SA 5ALCH 2D7TL 3QPQC 5EC1A 1VACB 2VXTH 1WZKA 1HHIB 1J0JA 3MRFB 3HS0A 5SWZB 2O5XL 4KK6C 2GJ6D 1QFWM 3NCYP 3ARVA 3BD5A 3BJLA 1WAAA 1ONQB 2HLFC 1DBAL 5FCUH 1MFAL 5HHOB 5E2TL 4WENB 3EYFA 4MJ2A 1IILE 4NQDD 4YAQA 4PJBA 2IAMC 4U1GC 1VEOA 1D6VH 5I71B 4XI5C 3TC9A 2AABL 2NR6D 2ADJB 1INQB 4QWWC 4FABH 1WZ1H 2F53E 5TF1H 4X98A 3VWKD 1IC4H 3HMXL 3GMQB 4LLYB 4APQD 1EMTL 1OAKL 1P4IH 4NZUH 1TQCB 2Y7QA 3V4UL 5J56B 3RKDC 5HYSB 1YY9C 4HHAA 3PXJA 1DQML 3L3IA 1WFUA 2VQTA 3VW3L 3CCHB 4H1LH 4RBPH 2R0LL 2CDFB 4O58L 2DDQL 4M7LH 3X12B 3BPCA 3PWJA 4F7EB 3PV7A 1P84K 3ULVE 4M7JL 2CD0A 4NQSA 5DTFA 3QCVH 3QXAA 4K2UH 4LCYA 3WSQH 2NY5C 3IFOA 3P0YH 3ARDA 4XGZA 4NN6C 2ADGB 1X5ZA 3RGHA 1URLA 1J8HD 4TSAH 4HPOL 3QO1B 4M7KH 5B21A 2VYRE 4R0LA 3D69A 3LS5L 2MTPA 3GMLB 4HZLB 1RVFL 3PF2A 4D9LL 3MV7D 5C8JB 2H6PB 4PRHD 3BN9C 2IANE 2WUBH 4LEXL 5F6HI 5HHQB 1F6AB 1RSFA 2IH1A 3VGHA 1CE6A 5CJXA 4RFEA 4OIIH 1TJIL 2RFXB 3DTXB 1I8MB 3QRFM 3SE9L 1IEHA 4J7RA 2HAZA 3GHBH 1PG7H 1U95B 4NFCA 1K85A 1EGJH 1E4WH 2PW2B 3UXFA 4YXLL 3IDYB 5JMOC 1FL5A 4N90D 5DF0A 2RIKA 3QXDB 1IAOB 5DC9B 1MH5A 3ISWA 4HGMA 4OIAA 1PG7X 5FFLA 1T1WA 4U1IB 3U7WL 2B1HH 4ISVA 4LSSH 1CDCA 1J88A 3MLSH 4NWUL 3CJJA 4K9EL 5CBAA 4EUPB 2V5RA 3RVVC 1IM9D 4XNYL 4XMKH 2F8VA 4XH2B 4LHUA 3WIHL 1PYWB 2IGFL 3S88L 3H9HA 3HE6A 4P5KB 3HAEH 3FO1B 2G75B 1DBMH 3WJJA 1UM6L 5LQBL 4UNTA 5CINL 3PNWB 4KTDL 1XT5A 3H9SD 4XCCL 5CS7A 3RVWC 4N0RA 1KEMH 3OR7A 2Y5TB 3NCJH 2E9WA 4L3EA 3TESA 2XY1A 5KSUB 2ICEB 3S5LA 4YPGA 2YK1L 4I9WE 3WN5A 2XTJC 3O2DA 4KZEL 1NGPL 2IQ9H 4FTVE 1YEIH 3UTPD 1RY7B 4BSJA 1BECA 1ES0B 3I84A 4YBLB 4WFEE 3AY4C 1ROWA 3KPOB 3E3QE 3F8UB 4BFIB 3U4EA 2AK1H 5J1AB 1OTTD 3REWB 5CD5D 3W0WD 1CFNB 3KPQB 1Q0XL 4AT6B 2DWEB 1N5AB 1IGMH 1VENA 1WTLA 2PUQT 3UZVB 5ADPH 4X6FB 1FVCB 2N7AA 1P53A 3I6KA 1VCAA 1Y6NR 1ED3A 5E5UB 2HT4C 4GKSA 1SEBB 3JV4B 1YYML 1CL7L 3KPRD 3V6BR 1KTDA 4UIKL 5H8DA 1A22B 1P2CB 2B7DT 4I0PC 3RGVB 1I7TB 4KXZI 3QUXD 3CLEH 4PJCA 1Z9SA 1MFBL 4ZD3H 3D0LA 4Z18A 2DMKA 2FDBP 1U8HB 2BVOB 5C08A 2WQRA 2YZ8A 1AR1C 5FUOL 4U1JA 2C3GA 4R7DB 4ZOBA 3VFUA 2K9UA 4ONGL 1SJXA 4JRYE 5DK0B 3SO3C 5FO9B 1TIUA 2PXYA 1HKFA 2D31B 4WTZG 4UU9A 1I4FB 5F7MC 1D5IL 4E9LA 2IJ0C 4J3WA 5C0IA 4G6MH 1VSCA 2VLKB 4XP6H 5BMFL 1OARH 3RWFB 1PQZA 4WUKH 1DVFC 4Z8FL 2VC2L 1KGCD 3MBEC 5MENB 3CMOH 3TZVC 2B2XL 3LN5A 3BKJH 4GBXD 4YIQB 4HK3N 4GUPA 4OZHE 3V6ZB 1UZ6E 2IPTH 4JQIL 3H3KA 1G7HB 1TVHB 4ORGB 4X7TA 4CU6A 4M62L 4AH2B 2X4PB 3MRLB 3RUGA 5GGSY 3CX2A 3OKMB 3OJDB 3OHXA 4WI8A 2NY2B 4ELME 2OSLA 1ZLWH 4P2QD 5DMIH 3MLYL 1NLBH 4UTAL 2F54B 1UENA 1S5IL 4BSVA 3S8WA 4EBQL 2ENYA 4CVZA 2N1KA 3DHJA 3TT3H 2FCBA 4ZTOL 2L0DA 4PGCA 5ECJE 3SE4A 2OZ4H 4LK4A 3G6JA 4IS6B 3PHOA 2H41A 1MQKH 3ZDZE 3UTQA 1FVEB 4HKZB 2WLZA 2AJUL 3M07A 1I1AC 4MHHI 5KS9A 1JN6A 3QQNA 4P4RB 4QOKA 4XP9H 5K9JH 1UACH 3ZO0A 2XFXB 3PWPB 4LFHG 4EI6B 4PG2C 3BI9X 2VXVH 3HLAB 3WUWA 5T3ZD 2EYSB 2QJDA 4H0GA 3H7BA 2AI0H 3OGCB 2FNBA 1Q94A 2X4SB 5DJCB 3VA2C 5IQ7L 1CLYH 4HW6A 5I75C 1GZQB 5HHPA 3TPUA 4G8GB 3MRCA 5SX5H 1FYTD 3MCLL 1MNUH 4PJ7F 1QA9A 4PB0H 4Y0GA 1WEJL 3RL2A 2V2TA 1JMXA 1IAII 1EZVX 4JO1H 2QSCH 4MJ5B 5FUCC 4UINH 1NMCB 2MQCA 3ZLQC 1CDGA 4X4YA 4YJZL 5D7KE 4C56A 2DD8L 1I7RB 2R69L 1JGVL 4S11A 5CEXB 5CEZD 5GS2H 3C9NA 1A8JH 4Z0BH 5FYKH 3O4LD 3U48A 1AGFB 5IBUG 3FT2B 3BJ91 4HXBH 1S7SA 4WI4A 2EDQA 1MCRA 2JCCE 1T0NB 4U0RC 2HVJA 4PGEA 1JRHI 3ZHLA 5H37H 2ZJSH 5CILH 1ZE3C 3NIFF 5DA4A 1QBBA 4MZ2A 4G6AC 2ZUUA 1FFNA 5E1AB 3EYOB 3H6JA 2BOBB 2FJGB 2VABB 5D1XD 5C0EA 3T0EE 3CDGA 5J6GA 3QWRD 1PZUB 3QDMD 1ZT7B 1PSKH 1LO2H 4TUJA 4OM0L 3VXOB 4GXVH 2VKWA 4GKZB 4P5TD 5E7FA 3DETC 2FLBT 4NUGH 2Z9TA 5C0AE 3V0VA 1NBVH 3GEWB 3OKEB 5C0CE 5D71L 5F1OB 5TQ2H 3OWEA 2PO6A 3QJHA 1R5VA 3DPBA 1FPTH 1X9QA 3RWCA 2I27N 4TSBL 1B3JA 4IMKA 5IKCB 4HG4K 1K2DB 1J0KA 1J5OL 4M1GL 1HHIA 1AE6H 3V4VL 1HKLH 3MRFA 3QDGD 1JHKL 3WIIH 1XF3B 4JKPL 5DZNA 1NDGB 4RISH 5ANME 5A3IC 5D1ZA 1FDLL 1ONQA 2VXUH 1MWAL 1YEEL 4TUKL 5TPWH 3BDXA 3OKKB 5J4MA 1RQ5A 3IFPB 3GRWH 4S1SL 1SYVB 3U7YL 3UDWC 1GHFL 4WW1B 5T5NF 1MPAH 3DMMB 3L1OH 5E2UL 2ADJA 1INQA 3QDJA 1JPTL 2VN4A 4G9FE 5EU4B 1MCPH 3UTTA 4LLYA 4K94H 4QYOB 4KROD 4OD2A 2JELH 4H88L 3CCHA 4FG6D 1CDJA 1EFQA 4M6OL 2VWEC 3GMMA 4JO4H 4PGJA 1EDQA 1BIIA 3RIFF 1Q9LB 4F7EA 1XMWA 4GAJL 1CFBA 2UV3A 1WSST 4P23B 1MCWW 4XTRD 2B8OT 1KYOK 1X5KA 3E8UH 3SDXE 2LU3A 5E2WH 2CJUH 3VDBA 1FRGL 2HLAB 1I1YB 1FZMB 1JPSH 1LWRA 3QO1A 4FFWC 4OD3L 3NTCL 3RNKB 3ET9F 2VDOL 3QIWC 2WBKA 4NQEE 1AO7D 4Q9QL 4HZLA 2IALB 2EDHA 3QUKA 5C8JA 2H6PA 1FV1B 3MLRH 1MFCH 3HI5H 4POZD 1FAKT 1G7MA 1FNFA 5HHQA 1F6AA 3GI8H 5EWIL 4LLVB 5D96B 1KB5H 5CGYC 3OQ3B 1Q9KA 2RFXA 2X41A 3DTXA 4JR9H 4NJ9H 5DQDL 2R56L 2OL3A 5FB8B 1U95A 3O6LH 4FQIH 1JTOA 2PW2A 1N6QL 1YNLH 3QXDA 2FEEL 1IAOA 3HA0A 3EOBB 3B9KB 3BD4A 3AREB 4HWBL 2GJ6B 5BW7C 1IEBA 2R1WB 3V5KB 1LEKA 4EUPA 5DVLA 3NN8A 3EJYD 1HZHH 4NQDB 3P3YA 2KQNA 4XH2A 5KN5B 1BFOB 1TTUA 2QQKL 1NGZA 3FO1A 5I1CH 3S37H 2G75A 4MJID 3QHFH 2VTFA 4M6AA 2CRMA 4LCIL 4Z7VF 3VWKB 2H45A 3S37X 3MJGX 4FQCL 1XH3A 1KENH 2I9TA 4PJGF 3SCMC 3VD7A 1F8TH 2IC2A 3PNWA 2ESVD 1HHGB 3MLUH 1HCVA 5F88B 1S9WB 2FRGP 2YOCA 3TT1H 4AMKH 4OM1H 1UM4H 3PWUB 1KLFA 4TVPL 1CLOL 4F7TB 5KSUA 2ICEA 2EKSA 2IEPA 3BZ4B 3ARBA 4Y8DC 2R39A 4LSRL 1RIHL 1RULH 5DZOA 2FX8L 4J3TA 5KOVC 4Y88A 5E4EC 3FN0H 3FRPG 5B3JF 4OQ1A 1S78D 3QG7H 2R15A 3KPOA 3VG0L 5I71C 4BFIA 4LFHD 1JTPA 5J1AA 3CFKA 4KZDH 2ZUYA 3REWA 5FIEA 2HT3D 3KPQA 2DWEA 2FX9H 1I7UB 2X5PA 3D39A 1WFOA 1N5AA 1WUNT 3IDMA 4PRHB 4U1KB 4W68A 4HBCL 4XPFL 3SE8H 2P5EB 3ARGD 3BKYL 2VLJD 4HUXB 3KPSA 3ESUF 3JV4A 4RDQF 1ZANL 5DSCB 5ISZB 1P2CA 3R1GL 4RA0C 4TQEH 4R4BA 3RGVA 4ODWA 4YHPB 1I7TA 3UPCA 4CMHB 5C09D 1FAIL 1FVDB 5KSVB 4ONHB 3D85D 3P40A 4WO4D 1N8ZA 5KAQF 4R7DA 4R3SA 5LXGH 1T7ZA 4UTBH 5D72L 1IM9B 5DK0A 4H0HB 3BEVB 1RUML 3AMKA 4IHOB 3G9VA 5I74B 3UJTL 1FFRA 1DQDH 5FYKE 2VLKA 3VI3E 3SJVE 3RWFA 2XZAH 5F21B 5SWSB 2X4OB 2QKIB 5I8CB 4QY8A 3NPSB 5EORL 4WJ5B 4YIQA 2I5YL 2D7TH 3V6ZA 2HWZL 5GSVB 4ODSH 3IVKB 1G7HA 1TVHA 4ORGA 3IDYC 3M1BB 4AH2A 3VFMA 4DQOL 3AS0A 3HZYB 3GJFH 3INUH 3MRLA 4MVBC 3ARTA 3OJDA 3ESVF 1DBAH 4UI2A 1MFAH 4XBGB 4P46A 3I6GB 1ZHKA 5E2TH 3VFWB 5I30L 2ZNXA 5M94B 5E8PB 4NKIL 3L7EB 5GGQL 4YHKH 4KGLA 1JF5A 2DQCL 4KJQD 2P4AB 5EIIA 1XIWD 3LEYL 4CW1A 3IGAA 1U2CA 2AABH 4PJAE 1XF2B 2XN9E 3OAUL 5IFAL 2LVCA 1UA6L 4ALAH 2VL4A 3HMXH 4JFHE 2EYTB 3WFDL 1OAKH 4OV5B 3MV9B 3W0WB 1HILA 3V4UH 3F7PC 4CNIB 1JV5A 2DLTA 1DQMH 3VW3H 3LKNB 2R0LH 3SKUD 4DCQB 4DEPC 2XFXA 2AK4D 1R5IB 4O58H 5T5FL 3PWPA 3FQXA 4M7JH 3KPRB 4IRJD 1BF2A 2NY1C 3HLAA 3QUML 4JPIA 1PJ9A 1FO0L 4RDQG 4NSKB 1PLGL 1MAMH 3OGCA 1S7RA 3QUXB 2X10A 1IQWL 5GGVY 3IF1B 4KVCL 4HPOH 1JBJA 4ZOCA 4QHKI 1DQTA 3REVB 3WEXA 4O51B 3VFOB 4JFDD 4KKAD 4WWKD 5EB9A 1RVFH 1RZ8A 4MJ5A 1QHPA 3LDBB 4IRSD 4QRQB 4NOBA 2C3WA 3ULVF 4WEUD 3SQOL 3PWVB 4LEXH 3TIDB 1MY5A 1AGFA 5CAYB 1T21B 3MNWB 5B39G 5C2BL 6FABL 4PJDE 1KJ2L 1TJIH 5C0DB 3SE9H 1T0NA 3OG4B 2K3TA 4MD4A 3PG2A 5D7LD 4GBXB 4KTEH 1II4E 4ONFL 4KQ4L 4ZSOE 2GSGB 4EI5D 5K9KA 4JM2B 5E1AA 1QFWI 2YD9A 3WFBL 2BOBA 4X6CE 3WDHA 3U7WH 5E7BA 2VITB 5TDNA 4NKMB 3MJ7A 4K9EH 3WV0A 5LGHL 3VXOA 4XNYH 3MRQB 1AIFB 4P2QB 2EIDA 1JGUH 3W9DB 3WIHH 3Q6GL 2IGFH 1F6FB 3S88H 4K55A 2F8OA 2XZCL 3LKQB 1G7IB 4YXKL 2YRZA 4ONOA 3MUJA 3JWOC 1UM6H 1J87A 5GZOD 5LQBH 4MNQE 2R9HC 4Q2ZB 5GRUH 5F3BB 1S7VB 5CINH 5F7HA 3BAEL 4KTDH 3D5OF 3KXFE 1ZT4B 4XCCH 5DEGA 1MAJA 2JCCB 2NYYD 4L9DA 1CXFA 1RUKL 2OP4H 3MA9L 1IVLA 1I9RL 3G04B 3STLB 5AUMB 4KDVA 2C9AA 4P9HC 1CDUA 4D9QD 1ZT1B 4X4ME 4ZPVB 3G6DL 4G42A 2YK1H 1JNJA 4KZEH 1NGPH 5F72S 1QFUL 1XF3A 1CFTB 1WIPA 3T8XA 2NY2C 1KJ2A 1QFHA 2Q6WA 4F33B 1XR9A 3S9DB 4FXKB 3WNLA 3OKKA 2EDJA 3FFCB 1AGCB 1SYVA 2AAVA 2IQAB 3O2VL 4WW1A 1GH7A 2X4RB 1FZOB 5HYQB 2XXCB 4LASL 5C0AB 1GCFA 3X11B 3HPLB 3U1SL 4JKKA 4MDIB 3LQAC 4JFEE 2BY0A 4FQXA 3O4LB 1JHLL 4LVEA 5L8KB 5DK2B 2NTSP 4DOHB 4HAGA 1IGCL 1CL7H 1YEKL 1YYMH 4UIKH 3QCUL 4Q6IB 3OKOB 3W11C 1Q9LA 5D2NE 2XT1B 3F65A 5TE4L 4M3KB 3RKPA 1MFBH 2CKBL 1BFSA 2XPGB 5EC2A 3BP7B 5JW3L 3SKNB 1RU9L 4NQTA 5F7WC 1ZLUK 1KN4H 5D1XB 2HLAA 5IEKB 1I1YA 5D7JA 2HTLD 2ID5A 2UZXB 3TO4D 1AKJA 4I18A 3IAPA 4DW2L 1Q9WA 4I4WB 1KLUB 3OXRB 4RFNC 5FYLL 1N7ML 3MRGB 4P5TB 5JPMB 1FIEA 3OJMB 1D5IH 1KELH 2BNUA 2IALA 4FFZL 1LO5B 1R3HA 3BOVA 5BMFH 1FV1A 4YH6A 2YZ1A 4WHYG 2VC2H 3CX5J 2AEQL 3SGKC 2B20A 4PRIE 1X4XA 2B2XH 4LLVA 1JL8A 3PQYE 3F6IA 5L2KE 2AEIT 4QRSB 3VFTB 4PREB 4JQIH 3VXSE 5FB8A 4ZODA 4M62H 1B6UA 1KJVB 3L3DA 5EU6B 1DANU 3GSQB 4WU7B 3EOBA 3KLSA 3UP1A 2GJ6A 4JREB 3MLYH 4D3CL 3V5KA 5DHYA 3DX8B 4KKLC 3LOWA 4N9OB 4EBQH 3IDIB 4NQDA 2RJMA 5C0GB 4JRWA 1RHHB 4ZTOH 1NCTA 4OZHF 5KN5A 1BFOA 3LN4A 4U33A 1OHQA 2FB4L 3CXHJ 4Y1AD 3T4AB 4QHLA 2AJUH 5BOPA 3VWKA 5MEQB 2VIRB 3LPFA 4APQA 2DM7A 1CLCA 2P8MB 1BLNB 3CIQA 2EDFA 5I66B 4ELMF 5F88A 1S9WA 1CK0H 2JLLA 1AJ7L 4BQ6A 3J7HA 3PWUA 1IJ9A 1KCSL 3T65B 5GRZA 4OZGB 3DJ9A 3CD4A 2FSEB 4RMSA 4XZUB 1DEEB 2HTKC 5EU5B 2NY5L 1VADB 4Y2OA 3MTRA 1LO3L 2P49B 1OTSC 3ZDZF 2D03H 5IQ7H 4LKCB 1F11B 4GMSL 1JPFB 1OAUH 1F97A 1UH3A 3MCLH 2VSDA 2YD3A 1F4YL 1WEJH 3T3PE 4UOJA 3GSVB 2YUZA 1J8HA 3SBWC 1UWXH 3TWCL 3DMMC 2H26B 5E99L 2DD8H 4HC1H 2R69H 1JGVH 1N6UA 3ZT7A 2E7LA 3UAJD 3MV7A 3OMZA 4PRHA 4U1KA 5CIPH 4OUUB 2AJSL 2D4FA 4XVUD 1S9VB 2HFFB 2AERT 3FHAA 3OJVC 2F5AL 2HJKA 3WXWH 4GG8B 3QISA 4GKOA 5TDPB 2E7CA 1CR9L 3JWDL 1DL7L 4NBZB 2ERJB 4QRPE 5FCSH 4GRLB 2ZUXA 4P23C 2OLDA 1S3KL 3MACH 4LPWA 4KUZL 3NH7L 1KPUB 5GGVH 4R4NC 4C58B 1P1ZB 5AAMA 4HUKB 4JN1L 1P7HL 5GS1C 2VLME 4ZMAT 4QTHB 5DC0A 4G6JH 1GOFA 2JCCF 1IAKB 1L0QA 1VKXB 1BREA 4IEFB 1X7QB 2GUOA 1IM9A 5FYJD 1GGBH 1CGXA 5MHSD 4DFHA 5FXCH 2R2BA 4JANA 4IHOA 5D71H 2EEAA 2YBRB 4P2OD 4RRPA 4MDJB 4MJIB 2NZIA 5IB5B 2R29L 1GC1C 2X4OA 4JLRB 5I8CA 4TSBH 3AROA 4KH2A 4ELKB 3LPGA 1U3ZA 3H9SA 5LVEA 4ZS7L 4M1GH 5GSVA 3U46A 3IVKA 1IZJA 5H94A 3V4VH 4KMQA 2OR8A 4LHQB 1JHKH 1W0YT 2I25N 3ULVC 3M1BA 4XVTL 3HUJE 1OP5K 1L4IA 4HWUA 5HYJE 3B9KC 4JKPH 3V5DA 1YEFL 3AREC 4FQ2L 1FDLH 4XBGA 5D7IB 4JO3L 3TYGL 1MWAH 4NZTL 1YEEH 4TUKH 4JQVC 1U6AL 1T0MB 1B0WA 1S8DB 1KN2L 5E2VL 4S1SH 4X6DB 25C8L 1YEJH 1GHFH 3GIVB 5E2UH 2OMBA 2FGWL 1ZA3B 4ZFGL 1JPTH 5I73C 1A1NB 3C60B 3ZE1E 1CVRA 1WWWX 5DGQA 4DGIL 3MGTB 2EYTA 1DZBA 3QEHB 4HFWB 3W0WA 1RUAL 4M00A 2ZSVA 4AEIH 4LSVL 8FABB 5FO8B 1KIRB 2YSSB 3TGXA 2FATL 5FGSA 1MAKA 3MZGB 4H88H 2AP2A 3LKNA 1MCFA 3ARGB 4M6OH 3TF7C 1X3DA 5JIPA 1R5IA 4F80A 2VOTA 4HGKC 4ERSL 3V2AR 3OB0H 4GAJH 3KPRA 1FORL 5J9PB 5HXMA 5MEOB 1FRGH 4JGJA 1TLKA 1ORSA 3ROOB 3V6FB 1FL6B 3QUXA 5C09B 3IF1A 5F8RC 3AU1B 3D85B 4PYGA 2N7BA 5IBUB 5EA0L 4OD3H 4WO4B 1AP2B 5HYFA 2VDOH 2GTWA 3B5HA 3REVA 1NFDE 4O51A 3RPKA 4Q9QH 2EICA 1BQLL 4YHIB 4UNVA 1OM3L 5DGRA 2Z31D 4QRQA 5DUML 3QI9D 1LK3L 1OAXL 4H1LG 3PWVA 2MQ3A 3OZ9L 5DC4B 3TIDA 3FQRB 3MNWA 4JPKL 3QULA 1NBQA 5EWIH 5T3ZL 4J3OC 4KVNL 3SDXF 2BC4B 3QZWA 4X7EC 5DQDH 5C0DA 3WL9B 1PDKA 1HIML 3RVUD 2CQVA 4GBXA 2IAND 3V95A 1FCCA 2GSGA 4JM2A 3VG9C 1V7NL 4HIJA 2AV7B 1TVDA 4CMHC 2Y6SD 4HWBH 4J6RL 1MFDL 4M1CC 4NRYB 4PGDB 5CEZL 4BELD 1HOCB 1OGAD 1A4KB 1OGTB 3MRQA 1AIFA 4P2QA 2A73B 3VWJB 3W9DA 5JXEC 3E3QC 3LKOA 1X5JA 5FKAB 2QQKH 4K3GA 1XIWB 4HT1L 3LKQA 1G7IA 1JVKA 4LCIH 2AQ2A 5I74C 4Q2ZA 3P4LA 4G6KL 4FQCH 1S7VA 1T2XA 1U3HD 2DQTH 2G2RB 3IKKA 4YC2B 3TFKC 3UEZA 4OCSL 1ZT4A 5CZXD 1MCSA 1UH4A 3MV8D 3NPSC 1VGKB 3G04A 2DYPD 1NC4B 5AUMA 1OWRM 5DRXA 1CLOH 4OLUL 5EOTA 5H35B 2AK4B 1INDH 4C55A 2PNDA 3BP6B 1ZT1A 5JO5B 2GIYA 1QSFE 4I2XE 1QSVA 4HUWA 4R2GD 4OGZA 3O3DB 4IRJB 1KIUA 4LSRH 4X5WB 1RIHH 2FX8H 3LD8B 2XACC 5A2FA 2BRRL 3HAEG 2NY0D 1LK2B 3VG0H 1FYTA 4IIQB 1AGCA 4I9WD 2VRAA 3RAJL 2X4RA 1MLBB 4WWKB 3HZKB 3HPLA 1A9EB 4IRSB 1RZ7L 3RZWA 2X4UB 4HBCH 4XPFH 3MUGB 2G5RA 4WFED 1HINH 3BKYH 5DWUL 3O4LA 1BGXL 1GGTA 3HE7C 3GSUB 1UH2A 1ZANH 4XRCA 4DAGL 2Z8SA 3TCLB 3R1GH 5LGKA 4M8QA 4FS0A 3KHOA 1V8HA 5D7LB 1KPVB 5GGTL 1OOAA 4EI5B 2XPGA 5I1IH 3BP7A 2Z35B 3PGFL 3C08L 4U49A 1TQBC 3KJ6L 3MPCA 1G0XA 4MMZC 5D1XA 1XGUB 1QRNB 3D2UD 4WTXA 5J3HD 4G6FD 3QWRA 3VFNA 4QRUB 3QDMA 3CDCA 3KAAA 4MAYD 1JGDB 4CMMB 3OXRA 5D72H 2EDOA 5CWSB 4XP1L 3MRGA 4PB9L 4P5TA 5JPMA 1RUMH 1RPQA 1V3KA 3LDBC 2EDEA 3UJTH 3LKRB 3QUZB 4RWYL 1HYSC 5DMKA 3B2VL 5DVOA 3VMNA 1SHMA 5EORH 1UWEL 1ZEAL 5ID0B 4QRSA 2HWZH 5DEZA 2ZOKB 3NAAL 4MGXA 3L3GB 4GXUN 2DM2A 1MELA 5I1DA 1OSPH 4DQOH 1KJVA 4JM2C 2VDNL 2DKMA 1J10A 4LNVA 2O93L 4LCWE 4NKQB 4HZAA 3QDGA 4R8WH 1UM5L 2A9ML 1UKTA 1LEIA 3VI3F 4YUEL 3ULUC 2DQCH 4R97B 3LEYH 2BCKB 3VFRB 1YEDA 4OCNC 3NOIA 4GRWE 5C0GA 3OAUH 1RHHA 5IFAH 3IJSB 1UA6H 4RIRB 5GGTA 1FFPB 5MP6L 4P3CL 2CK2A 5KZCD 3GSXB 3C6SB 2YRLA 3T4AA 2YWYA 3ROLB 1H3PL 1KTLA 4GW5B 2JB5L 1GOGA 2VIRA 1MJJA 2P8MA 5T5FH 3E1F1 2BOCB 3EO1A 5MI0B 5IV2B 1WITA 3T65A 4OZGA 3SHSA 3MJ9A 2BJML 3QUMH 4PJAF 4YHNB 2O5YL 1X6LA 2FSEA 1FO0H 1UQSB 4XZUA 5AYUL 1ZGLB 1IQWH 3T0EC 4AEFA 5F7UA 2VDRL 4LKCA 4KVCH 1DUZB 2DQIL 1JPFA 5IGXH 1DN0B 3RWDB 4JHBA 5B8CB 1OD9A 2JB6B 3GSVA 2VXSH 1MJ7L 2LU4A 4ZAKD 2H26A 4ZS6D 3SQOH 4TULL 1AO7A 5I2IB 3BESR 5F9WC 5GJSL 4E41B 5IK3A 5JQ6L 6FABH 1G1YA 1I8IB 4TTDC 4PLJC 4UT7L 1S9VA 1YNTA 2HFFA 5KVMC 3G9AB 2DICA 3O9WD 4ONFH 1KNOA 4Q6IC 4KQ4H 5JDSB 5D2LE 5TDPA 3U0TB 2LU7A 3WFBH 1G9NC 4X6EB 4QHNB 4JFFD 3KYMB 4TTGA 2LQRA 3S34L 4OZIB 3AAZA 1Q9OB 1TMCB 5GGRB 3TIEA 4WTZA 5KVFL 3EAKA 3Q6FB 4JCMA 2COQA 5LGHH 5TQ0L 4YQXL 3CVHL 3RVTC 1I7ZA 3RZCD 4Q7DA 2D2OA 4QTHA 2AV1B 5DQJB 1ZA6B 3Q6GH 1NMAH 2FH8A 1IAKA 2HFEA 4PJDF 5J0BA 2E9BA 2XZCH 1JWSA 4YXKH 3BZFA 5KSBB 3KYNB 2H2SC 1DQLL 3MXWL 4AY0A 1B6DA 5H37G 3O3EB 4MDJA 3U30B 4MJIA 3BAEH 4RNRA 4UT9L 4X6CF 3WO3B 5IB5A 1WBZB 3IJHA 4YZFE 1RUKH 1I3GL 1I9RH 1PKQA 1RK0B 3MA9H 4JLRA 4NC0B 1QVOB 3ZHDA 3MUHL 1T3FA 1JGLL 4PY8I 2ESVA 3K0WA 4ETYA 4YFLI 4F7MB 4PPTA 3VGGA 2X6MA 1H3XA 3G6DH 5L7XL 3PDGA 4EQ2A 1B2WH 1QFUH 5E8NB 5HGAB 5C0BD 3T08A 3KPLA 1J86A 2JE8A 2X44D 3TA3C 4QF1B 5DUBB 5DI8B 1QR1B 1T0MA 1S8DA 4L8SA 1H3WM 4GSDL 4JFZH 3O2VH 3GIVA 4N5UA 4BQCA 3F5WA 4LASH 1ZA3A 3THML 4NCC1 1A1NA 4U1HB 1UB6B 2E7MA 3U1SH 4UMGA 4DVBB 4JFXB 4KY1L 3IAGC 3QEHA 2BP3A 4HS3A 1JHLH 2FJHB 1PD6A 4ZYKA 4JRXE 1KT2B 1T2QL 2FHCA 1IGCH 1YEKH 4S2SB 1W8NA 5J11B 3ARGA 4LLUA 2VLJA 3W81A 3CFEB 4HK3J 3MV01 5TE4H 4MJ4A 3SE3C 4ZUSB 3EYQD 2CKBH 5HI5D 3E6FB 5JW3H 1KCLA 1RU9H 3R06B 2HVKB 5MEOA 4YHLL 3ROOA 1FL6A 1TXKA 1FFOB 5C09A 1CBVH 4LF3B 4U6TA 3AU1A 3D85A 2MKWA 4N8PA 4DW2H 4NRZB 5B39B 4WO4A 2R1YB 2DQUL 1AP2A 3DO3A 4UUJB 1NEZG 1N7MH 2E7HA 3GZKA 4I0KA 5FYLH 1YPZB 4L4VD 4JN2B 4FFZH 4FQ1L 5IROA 2VXQL 4IJ3C 4L8CB 5JHDE 2QQNL 1YQVH 2AEQH 4P2OB 4IDJL 4CBPA 3HNTL 2EC9T 1EO5A 3PJSB 2BC4A 4Y4HD 3VXRE 3RX8A 2RCSL 4NQED 5I8OL 3CLFL 3WL9A 1CFSA 1XF4B 4DUXA 1JTTA 1ZHBB 4XNQA 1MHCB 1YDPB 3F6LA 1WIOA 3VFVB 1JGEB 1U8QB 3S97C 4EN3C 2YA0A 2YA2A 4GRLC 5FO7B 1V7ML 5HYEA 1U3YA 3NIDE 4NRYA 4PGDA 3MREB 4C83B 4D3CH 2H2PD 3B6SB 2AXJA 1A4KA 1CU4H 4I0CC 1NGQL 2GK0A 4PJFE 4BFGA 1DBBL 5DD1L 2A73A 3SKJL 5ABDE 5FKAA 3MGOA 1XIWA 2NXYD 4U3CA 4CVWA 1MCLA 5IJVA 2FB4H 4QGTA 3RI5K 3ZKMC 1J1XL 3T2QA 5KANI 4G5ZH 5IB1B 2DWDA 4XPHL 2C7UB 3FMGL 2CGRH 2GITA 1AJ7H 1IZKA 1KCSH 2XIDA 3BZDA 4RGND 4KKBC 4KDWA 2JJTA 6CGTA 5H35A 2W60B 2AK4A 4YDJA 3BP6A 4LIQL 5JO5A 2EE3A 2NY5H 4XXDB 4PTTB 3RA7L 1LO3H 3O3DA 4IRJA 4X5WA 4GMSH 4LCCB 1ACZA 2P8PB 3QCTL 4NNYB 3BWUC 3KYKL 3GSNL 1G0DA 5ELIA 1LK2A 4F8TA 4GT7A 3NCMA 1RZGA 1M71B 2Y06H 2VZOA 5CSZA 4JFDA 3RY6C 3WNKA 1ZSDA 4WWKA 3C60C 3HZKA 2C1PB 1NCBL 4IRSA 5DJ2A 2V17L 3QI9B 2AJSH 4PS4L 1F4AA 3ARPA 1H15B 4FMKA 4KHTL 3R8QA 3S4SG 4LNRB 3DUHA 4WW2B 1L0XA 5HGBA 3GSUA 5T33L 4J3UA 2WIMA 1NL0L 2F5AH 1E6OL 2VR4A 3TCLA 3T3PF 3JWDH 1RJLB 2YRPA 5D7LA 5IHLB 1KPVA 2OJEA 1S3KH 1RZKC 4ODUA 5C70A 4EI5A 5IMLA 1A6AB 3NH7H 3RDTC 3P9LB 4MNGE 4JG1L 3UX9B 5IQ9B 2YXMA 5DHVH 2RAMA 5ALBL 5HDBE 4JN1H 3U7AA 1XGUA 4M1DL 1X5LA 1QRNA 1YEHL 3DGGA 4XXCA 4ZO8A 5IVXB 3OKDB 5HD8D 1OGAB 4ZFOB 5IT2H 4JG0L 3BP4B 2P48B 4HKBA 1BFVL 5ID1A 5FGCB 4M5YL 4K7PL 4N0UB 3S36L 1T89A 3JWOL 3NABL 3LKRA 2AQ1A 4AJ0A 5ICYB 1ERNA 3TYFB 1WK0A 1DLFH 2R29H 4XMLH 5J12B 3KR3L 5HVFB 1MJUH 3GSNA 1U3HB 4OLVL 1LDPL 2OCFD 5ID0A 4ZS7H 3AS1A 3MV8B 3BIAX 5GS2D 5IEHB 5HSFA 2NTFB 3D48R 2DYPB 1OPGH 2ZOKA 5FYKD 4Z7UB 2A6JB 4XVTH 4FXGB 5AG8A 4KWUA 3SJVD 1JYXA 5GS3A 3LKPB 1YEFH 35C8L 4UT6L 2HJFB 3OAZK 4JO3H 4R2GB 3TYGH 4HBQA 1NBZB 3ILQD 4NZTH 1X44A 4LRIA 3QDAA 5HBBA 1KN2H 5E2VH 4ZPTB 25C8H 1K8IB 3VFRA 1MCOH 3VWJC 3KWWA 2FGWH 5KOMC 1QO3B 4XCYB 4ZFGH 2E3VA 3IJSA 5IOPA 4RIRA 1ETZA 1FFPA 4DGIH 5IHBA 3PGCA 1IC1A 4O2FB 4TNWK 3TVMC 3GSXA 3C6SA 1RUAH 4LKXB 3HUJF 1ZK9A 4LSVH 3ROLA 4YC2C 1E4KA 3SGJA 2Y07L 1TETL 2XN9D 3JBG7 3BQUD 3ZYOA 3LKSB 4JVWA 4AEEA 2BOCA 2V2WB 4ERSH 4XHJD 3FRPA 3BP5B 1FORH 2IADA 3FONA 3GJEB 4YHNA 2Q8BL 1ZGLA 3ZE1F 1K4CB 2DBLL 3LD8C 4X7DC 5EA0H 2EECA 4GOSA 3D2UB 4LMQI 4G6FB 5B8CA 2JB6A 3SPVB 1BQLH 4IIQC 3TO4A 5IB2B 1M1SA 1OM3H 4MAYB 5DURD 2PYFA 4HLJA 5FECB 5DUMH 1P5VA 1LK3H 1OAXH 4HGWB 3X13A 1D6EB 1TPXC 3OZ9H 2CLRB 4KK9D 3FAWA 5I2IA 2YWZA 4JPKH 4RAVB 5T3ZH 2Q7YA 2CIKA 4KVNH 1J18A 2VUYA 1I8IA 4H8WL 1N0XL 3GSRB 3KLHD 4KRPD 5BV7B 4B5EA 1EEUA 1HIMH 1UB5B 5LWYL 4K8RC 5F71A 3BX7C 4MMXC 5JDSA 3I6LE 3TJEH 1NFDF 3OJ2C 4UB0H 1V7NH 3OXSB 1JF1A 3KYMA 3HR6A 2WWKO 2BNQD 4J6RH 3WYRA 1MFDH 4NHUA 4WVRA 5GGRA 4FFYL 2FWOA 3JV6A 4LVHC 1AQKL 2NY7L 4LCUB 1DSFL 2ARJB 3ULSB 3C5SA 4S1DC 4D9RE 1PX3A 1EH9A 2AV1A 4BQBA 4YNYB 1XCQB 5DQJA 4I3RL 2UYLB 4Y2DC 2CUMA 3GKZA 5I76B 4U4BA 2Q76A 1R3KB 5KSBA 1I1FB 4WGWB 4Y19E 3F12B 5FEBA 3FO9A 1EAJA 4PJGA 1T1XB 1XR8A 3QUZC 4YE4L 4XWGL 4CN1A 2I07A 4OCSH 1T83C 5C92A 1YMME 1WBZA 4Y1AA 5ENWB 3DNKA 3FCTA 3IFNL 4HUVB 1JNLL 1SYSA 4OLUH 2ADFL 3MYZA 3Q1SL 4F7MA 5D2NC 1S7TB 3WCYA 2W38A 4X8JA 1EHXA 2RB8A 3KXFD 4LQFH 1BQHG 4ZXBD 3DX9A 5FYJL 4EXPX 5D9SA 5E8NA 3EJZC 5HGAA 1SVCP 4RBPK 3L5XL 2JK5A 4QF1A 2BRRH 2FL5B 1JF6A 5HY9A 2APWA 2ILLA 4W70A 1FN4A 2EE9A 3U82B 3RAJH 2ED8A 1QSED 3WHXB 5BS0E 3RWGB 1RZ7H 4OCYL 1EFXD 2W0PA 5D5ME 5E00A 4JFXA 1AFVL 3RTQD 4F9LA 5DWUH 5IWLC 4PJXE 2DLIA 1IGJA 1MCEA 2XA8L 5INCA 4WI2A 3GM8A 1KIPB 2R2EB 1RK1B 1T7XA 3VXNB 4DAGH 5MI0C 4M03A 3AS3A 3CFEA 2WBJC 3S35X 3L5WB 2GHWB 1ZHLA 3BH8A 4ZUSA 4JFED 1T03L 4U1NA 1MHEA 4MA3B 4WHDA 3W2DL 3C08H 4JFFB 3KJ6H 3T0WA 3K1KC 1BZQK 4I5BB 1DN2A 2DLGA 3GFUA 4H1LB 1PKOA 1CIUA 3DXAE 5B39A 2DM4A 1YECL 3N85L 3C8KB 4PB9H 5I8EA 1AHWC 1BVKB 1UJ3B 4DVRL 4KDTC 1D3CA 2B0SL 4JN2A 4PJEE 4DJMA 1J0HA 1K6QL 3V8CA 4L8CA 1T66D 4RWYH 1CGVA 2H3NA 5JW4M 2RQ8A 3B2VH 2FD6L 4P2OA 1GC1L 5FGBA 1UWEH 1ZEAH 3HHRB 1SY6L 5GRWA 5CD3A 5IBLC 1KC5L 2J8UE 2KDGA 3NAAH 1OP9A 5DJXB 1ZHBA 2ICWB 2VDNH 1MHCA 5IG7B 1YDPA 3FQWB 3I75A 2A83B 5E95B 1FH5H 3ULVL 3VFVA 1U8QA 4PRID 2NY3D 2Z4QB 3PQYD 1UM5H 4L4JA 2R1XB 3VXUD 5IM7A 1OSZB 5L2KD 2CRZA 3EIFA 3JWNC 3MREA 1LO0L 4YUEH 4C83A 3LQZA 4CU7A 5C0BB 3VXSD 3B6SA 3P73A 4PTUB 3LRGA 5F1NB 3HMWL 2IFFH 2VB5A 1Q72L 1UEYA 3BW9B 5IVZB 2MCPL 3FL7A 5MP6H 4P3CH 5C3TA 3W82A 4RMQA 1UGNA 3QEQE 4YK4B 2O5ZH 4X9FA 1H3PH 1HH6A 2JB5H 2JJUA 4OIBA 5IB1A 3M8OH 2SEBB 4OGAC 2C7UA 1ZHNB 3CFBA 4AM0B 4L3CB 3FB8A 2WMPA 4LLDB 3CFIC 4ZUVA 1EERB 3FQTB 5HGDB 5TFSL 3WE6A 4GRWF 2PETA 1QLFA 1SQ2N 4XXDA 4PTTA 3G5YB 1WAAE 2VDRH 3VGDA 3OX8B 2DQIH 4PV8B 4OKDA 1SY6A 4NNYA 3CU7A 5DYOB 4PJBE 1JPGB 3EYVB 2PCPB 1FG2B 3HFML 2EXYC 5BCAA 4HIEB 3DVIA 1KF9B 1YYLL 2CIIB 4L4VB 3MOBL 4DGYL 5GJSH 5JQ6H 2C1PA 3MCKA 3HB3D 5C0JB 1KTRL 2Z31A 3B4NA 3CFJA 3QI9A 2L4OA 2AXHA 4Y4FC 5AG9A 3K4AA 1MHPL 1H15A 4UT7H 4LNRA 1AQDA 5BZWB 3BRGC 4Y4HB 3QAZB 4M4PA 2X9WA 5DD0L 4FFVC 5EBMA 1RJLA 3S34H 4MXQC 2IANA 4U0QB 1A6AA 1AXSA 5BZDB 3KLAB 2CSPA 3P9LA 5IQ9A 3DVGB 3D3VB 3CVHH 3L9RA 4B41A 8CGTA 5IVXA 3OKDA 3BWAB 1OGAA 3HC4L 3CPLB 1NGXB 2UWEE 1N3NB 2RR3A 1CXEA 4N0UA 5D2LF 1DQLH 1FL3B 3A67H 3MXWH 2NXYB 2ADIB 4A6YB 1ZLWK 4D2NA 4UT9H 5ICYA 2VLMD 2PTTB 1R24A 1I3GH 2E6QA 2AGJH 1U3HA 3VJ6B 1WWBX 1JGLH 1GYAA 1F6LL 3ZZ1A 4ODTL 3MJ8B 5DA0B 5TE6L 3SGEH 3RWJB 4EOWL 3MV8A 4J4PD 2NTFA 2DYPA 4QLRA 5I9QC 3KJ4B 2V7HA 4RGNB 4QTIL 4Z7UA 2A6JA 3EZ8A 4FXGA 4PLKD 5L7XH 3CGTA 2H1PL 2IBGA 5E5MB 1HI6B 1KUMA 3DV6B 4NKDB 4PGBB 5GRVK 1ZLVH 4MQXC 3WLWC 1NBZA 5DVMA 1CQYA 3LV3B 2BMKA 4XCEB 4DKFL 1Q38A 4YZFF 4ZQKB 4GSDH 1K8IA 4HPYL 4PJ8D 1WJ3A 4V1DD 3VXTB 1I3UA 4M9OA 1W0VA 1JP5A 4QXUL 4XCYA 3QUYC 1JZ5A 2XWBB 4HX1B 5ITFA 4KY1H 4O2FA 2QADC 3VH8G 4LKXA 3QHTC 5GHWL 1QPXA 5SX5K 1Y6MR 1RIUL 1ZGLM 1T2QH 5L8JB 2QEJA 1J11A 1A6TB 4M48L 2NLJB 4HWZB 4OBSA 3D0VA 3C6LB 4L3EE 2V2WA 3O4OB 2A6IB 3BP5A 4JHZA 4WI6A 5SX4I 3BH9A 3GJEA 4BJLA 4YHLH 4OT1H 1U8JB 5F6IC 1VFBB 3QRGL 1K4CA 4LCCC 4GG6E 2X1PA 3ZSTA 4Y16B 4YGAB 5J13B 1UADC 2N56A 4TNVF 2DQUH 5INDA 5F7EL 3D2UA 2R2CA 3SPVA 3PABB 5FUCE 2YKLL 4K3DL 4FQ1H 2E7BA 2VXQH 1UZ8A 4MAYA 5FV1L 1OF2B 5GIRB 4S1RL 2VQUA 1D6EA 2X05A 2CLRA 1A6WH 1IARB 2M2DA 4IDJH 3HNTH 3MRRB 1SJEA 1A6ZB 2X70B 5EZIL 2RCSH 1D9KC 5I8OH 3CLFH 2HT2D 3UMTA 4JFOB 4WW2C 5EUKA 2XWJA 1I85C 2VXTL 4XAWL 1F4WL 4RMTA 1UVQB 3UYRL 3OXSA 1V7MH 3B9EA 2P5WE 3ARUA 1U93B 2I26N 3DYMA 5FCUL 5FDYA 4XBEH 1CLZL 1NGQH 4WTWA 4M02A 3MRJB 2ARJA 3ULSA 2W65B 1TZIA 1DBBH 5DD1H 1B0RB 5L88L 4YNYA 4JZNB 1TZHB 3FT4B 3U0PB 1HSAA 1AC6A 1OWWA 2LVEA 3VE0B 5JXAL 1CFQA 1R3KA 1I1FA 2QLVB 3F12A 1LP9B 1J1XH 4NZUL 1FJ1B 1RZJC 5J12C 4ELMA 2FYYA 4Z7QE 3NIDF 5JZ7C 1J7VR 3FN3A 3PL6D 3VD9A 4HUVA 4HUNB 4ETQB 3QSKB 4PJFF 4WRLA 4Y4KD 2FJFA 3BQUB 1L6XA 3RUGE 1U8KB 2BSED 4BQ8A 1HXMB 3BYYA 4RMRA 4XHQA 3GNML 3RA7H 5B4MD 2ATKB 4K2UL 1T6WA 4ZO7A 3P0YL 1KXTB 3O8XD 3U4AA 4PY7B 3QCTH 5AAWA 2HJLB 1QNZL 1MCDA 3KYKH 2BNRE 2GAZB 3P2TA 1VEMA 2FL5A 1F2XK 1BAFL 1QSFD 4NM8L 5CBEA 3GBNL 5MERB 3A0OA 3P9WB 5EIQA 3G6JE 4NRXB 4GW4B 2CDEB 2LV4A 2ZSWB 5F70A 3WHXA 3BZEB 1NCBH 2E9JA 4ZAKA 3QQ4B 1NC2B 4GRMA 5KS9E 1CZ8L 4JY5L 3VRJA 4PS4H 2EE6A 4QOKE 4KHTH 4KJPC 1NLDL 2GTZB 2P43B 1P4BL 5T33H 2BY2A 1E6OH 2FEDD 2KUTA 3GHEL 3K3QA 4LGPB 4N0CD 4ZO6A 3MRPA 1G9NL 3O9WA 1NEZB 2P44B 4YLQT 1RD6A 3EDDA 5DRNB 4JG1H 1CDIA 4JFFA 5FM5M 4K71C 5ALBH 2BNQB 4LSSL 4M1DH 1YEHH 4PJHB 2V5SA 3O0RL 4H1LA 4DZBB 5HHNB 3WBDA 4JG0H 3EKCA 1WISA 4OJFL 1BFVH 3RZCA 3F7RA 1RZIA 3HTLX 3QFJE 1CF8L 2A9NL 4K7PH 4M5YH 4ZUWA 1OW0C 3DLQR 4K3EL 3TN0D 4C56E 1MCHA 3JWOH 3NABH 2EDWA 2NX5D 5DO2C 3W9EA 3S36X 3FB7B 3O6FB 3KR3H 5JOPE 1PAMA 5DLML 4OLVH 3WKNA 3UTZA 4Y5XB 1LDPH 5HDBF 4POYA 4LGRB 4PLOB 1KJMA 1LE5A 4PJIE 4L4TD 3QPXL 5E8OB 3PP3H 5DJXA 1YY8A 2ICWA 5IG7A 2VZSA 3FQWA 5IMKA 35C8H 2Z4QA 4UT6H 3JTSB 1IMHC 2DQDL 1OSZA 3HRZB 1MI5B 4ZXBB 5IW6B 4PJ9D 5EPMA 5I1HL 1Z6JT 2OR7A 4RCAA 5C0BA 5JORB 2AVGA 1G7LA 3TBSB 4G3YL 2H8PB 1V3MA 2ZUQC 4F2MB 1O7VA 3NFSL 2AK1L 1UEMA 4LCWD 1WTGT 2HG5B 3JV5A 3SOBH 1Z2KA 1BX2B 2H32H 1QSEB 4NQCE 4Z78B 3LQAH 5ANMA 5TJWK 5KVEL 5M7QA 5ADPL 4PRAB 1U8OB 2HKHL 2Y07H 4N5EC 4NN7C 2L7UA 2SEBA 3AM8C 4HIXL 1ZHNA 4L3CA 1TDQA 2HN7B 4LLDA 1YN7B 2JJWA 1S7UB 3WLBA 3EDKA 3HAEA 1S7QB 5SWZE 1X5YA 4N0FB 2Q8BH 5FDWA 5EU7C 1E28B 3ARQA 3J8F7 2EYRB 3G5YA 3JXAA 3OR6B 2DBLH 4ZD3L 1KG0A 3IETB 5HHOE 2MCG1 1A9BA 1A5FH 4F9PC 4PP2A 2XZZA 5DYOA 1I1CA 1JPGA 5BJTB 4XP5L 3EDFA 3S4SB 4JAMA 3JUZA 4NQUA 2CIIA 4L4VA 4UV7L 1EXUA 1H5BA 4ZFZB 1EEZB 1H0DA 3NPZB 1W72B 4S1QL 5E0QA 1WICA 4WUKL 3C5JB 4H8WH 1ZTXL 1NMBL 1N0XH 1T04B 3MBXH 3FQNB 3U2SB 5LWYH 2E8YA 4M6ML 5EC1B 3U9UA 4Y4HA 3OG6B 4NQEA 2KBGA 4JQXC 3MFGB 2YR3A 3E2HB 4K23L 5I1LA 4WI9A 4FFYH 4MNHA 2NY3B 3G5XA 1AQKH 3VXUB 1DSFH 4HWNA 4YAQB 4HIIB 3ARXA 4I3RH 1MVUB 4MS8D 1MCCA 2A0LC 3BWAA 5LAXA 1UJ3C 3GJFK 1NGXA 3HRPA 2J1KA 5HJ3A 1N3NA 5D1QD 4NPYB 4YDKL 4YE4H 2BSRA 4XWGH 2ADIA 2Y7QB 4U3HA 3CSBA 4Z6AT 3TJHD 3GMPB 2AJXH 5GZNC 3SO5A 4HHAB 3L3IB 5GRVL 5K9QG 3IFNH 1JNLH 5IFJA 2ADFH 3Q1SH 3MJ8A 1JHTB 4NQSB 4HDIA 3QXAB 4Z7OE 1ZV5A 3WNNA 1HI6A 3DV6A 4NKDA 4PGBA 5L9DH 2XY2A 4CKVX 4PV9B 3KPMA 1CLYL 4NFBA 1BOYA 2E6JA 3NCBB 2DKUA 4PB0L 4ZQKA 1J1PH 3MSPA 2X1OA 1A7PL 4JFQA 1IKFH 4HJ0D 1G6RL 3GJFB 2PYED 2WQ8A 2XWBA 5IHZA 4HX1A 3QQ9C 4WI7A 4YK4C 1AFVH 3IDUA 3H9YA 5FYKL 2IH1B 1SBSL 3L3JB 4RFEB 2F5BL 2PF6A 3JTTA 1A6TA 1HSBA 2NLJA 4HWZA 4M4RA 1EVUA 1NANI 1BOGA 2OZ4A 1FL5B 1BJMA 1FC1A 1T03H 5KJRL 1N2RA 3LRHA 1RZKL 4LL9A 2F19L 3BDBA 3W2DH 3WHE1 1T1WB 1GXEA 3K4ZA 1U8JA 2NZ9C 1VFBA 1QG3A 4YBQC 4P4KD 5D5MF 4MA1B 1PSKL 1WCBB 2DQJL 3QR2A 3JVGC 1YECH 3A6BH 4JZJA 4PJXF 3N85H 3NGBC 4DVRH 3PABA 1K6QH 4GS7C 4GH7B 3V79C 4U1LB 1OF2A 4YBHA 3MLTB 1MCIA 5I17A 1WBXA 2FD6H 1VFUA 1DUYB 5DD6A 4LLAA 1GC1H 1FPTL 1A6ZA 1GPOL 2X70A 5GRXG 2W59A 3OR7B 3KPSE 4WNQB 1KC5H 1CVSC 2W0FA 4JFOA 2XG4A 5T1LB 2FR4A 2MWCA 3QAZC 4GO6B 4OZFG 5JHDD 3ULVH 3S5LB 1UVQA 3IS0X 4BUHA 1FNLA 2EXWD 3GKWL 3WN5B 3X14B 4PJEF 5DDHA 5E2JA 3SJVA 1U93A 3MRHB 2EDTA 1LO0H 1IKNC 2CR6A 2NY6D 4QXGH 2DQFA 2Q3AA 2W65A 3HMWH 1Q72H 3GRWL 4HKJA 1TZHA 3FT4A 3U0PA 1XGTB 2J8UF 1KJ3L 3L1OL 4V1DB 2VQ1A 3N9GL 2VLKE 4HJJL 5DZLA 1EA9C 3GM0A 2FECI 1NFKA 2O26U 5MENE 4KRLB 4LMQE 2OI9C 1HH9B 2JELL 3QT2A 3Q3GA 4WHYH 4CAGA 5IJKC 1KTDB 4PJAA 3DHMA 3EO0A 3STZB 4ETQA 2XN9A 5TFSH 1C12B 1I9IL 3BQUA 4JM4L 3KJ4C 4PJCB 3FZUD 3KDMA 1U8KA 1HXMA 5GQBA 3D0LB 3E8UL 4XX1G 4EXKA 5C08B 5E6IC 4YHOL 2AEPL 2HJLA 4E0RA 4U1JB 2F54E 5ESAA 3VFUB 3CUPB 5DFVD 3DRQB 5JHLL 7FABL 2PXYB 1YYLH 1X5GA 3MOBH 4DGYH 4NRXA 2CDEA 2ZSWA 5C0NC 5F9AC 5ITBL 2ICES 1UC6A 2BHYA 3MLPA 4LVNB 1W0WA 2YUWA 4N1HB 1WAAF 2XKUA 4X5LA 4WWID 1T20A 1A7QL 2NY4D 3SDCD 2GTZA 3GRWA 3PWPE 4PJBF 4XWOC 3C6LC 4X7TB 3MODH 4B0MM 3U0WL 2A77H 3G08A 1NEZA 2VLRD 2EDKA 3OHXB 3QIUD 2OSLB 4LP4A 4ENEC 4G8GE 2BNQA 1G7JB 3NZHH 4Y16C 5J13C 4GQPH 2X2YA 4DZBA 4EKXA 5HHNA 4TVSa 3IJYA 5TDOB 4CVZB 4JZOB 2A74B 1HHKA 3VFPA 1QKZL 5CLWA 4Y5YA 3PHOB 1QLRB 5DJ8B 4X6CA 3DARA 3FOMB 3FB7A 4JVPA 1NGYA 1V05A 1F45A 1OQOA 4OCMC 4LLMA 4ODTH 4Y5XA 4YX2L 5TE6H 2ZZUT 3MOQA 1QTYT 4OM1L 2P1YA 3T09A 5HGHB 4IRZL 1Y0LB 4WV1C 3PL6B 2XRAL 4QTIH 3UJJL 5JQHC 4CVXA 4Y4KB 2H1PH 3TM6A 2UWEF 1Q94B 3V0AC 3SQBA 3KXFA 5HHPB 3HRZA 1KB5A 4ZXBA 5IW6A 3O8XB 3PE9A 2X7LB 2XV6B 4WHCA 2VNCA 1QA9B 4EEEA 5JORA 4DKFH 1JI2A 3JSSA 4L8BA 3RL2B 2V2TB 3GDBA 4HPYH 3EHBC 3SDAD 2IPKB 3IFLH 5C07D 2H8PA 3DUSB 4GJTB 4QXUH 1WIUA 4F2MA 3BVNA 4X4MA 2HG5A 4JDZB 5C86A 3C9NB 1BX2A 1QSEA 5GHWH 4Z78A 1S7SB 3C2AL 3I9GL 4MA7L 4PRPD 1RIUH 5KSAC 2DQHL 1EFXA 3T0DA 2HVJB 5GXBB 4M48H 3RTQA 1UWXK 1WT5A 1GVIA 1CFVH 4J8RA 2HN7A 3IDGB 1YN7A 1S7UA 4KI5E 4NGHH 2AXGB 4M7ZB 1P7QD 2EYRA 4MCYB 4JFEA 3OR6A 3NA9L 3QRGH 4OQTL 4ZNEE 1T5XB 1QLEL 4Z7WB 1H9VA 3GMRA 5LXGL 1BVZA 1OY3B 2YKLH 4K3DH 4UTBL 5JW5A 3S4SA 1TJGL 3RJQB 1AGBA 4JPVL 4S1RH 1EEZA 2NX5B 3OKLA 1R5VB 3QJHB 5EZIH 3C5JA 4FN0A 5L8LB 4JKMA 4RMUA 4GG6F 1HQ4A 4GQ9L 2BSSA 2XQBH 2OTUA 1CICD 1NCWL 4XVSH 4ODSL 4XAWH 1F4WH 3IB4A 3UYRH 2FHFA 4TN9A 4HH8A 4DKDC 3BHBB 3LAFA 1RFDL 4L4TB 1NAML 3INUL 1LGVA 4NWTL 3QIBC 5D1ZB 5CIPB 3FAXA 4PRIA 2OTWA 3HZVB 1I8LC 1CLZH 3ULUH 3PQYA 3VXUA 4Q9RH 5L2KA 4HIIA 4YHKL 3KHQA 5L88H 1MVUA 5DD5L 3MRDB 3VXSA 2D4DA 2VAJA 4D0BA 3QDJB 5JXAH 4NPYA 4LDLB 5FM4A 4ALAL 3UTTB 3ARFD 2BRQA 3O6FC 4OD2B 3RWIB 3GMPA 4IOFD 5FYLD 3SDDC 1TCRB 1AGDA 5DJDB 2UZIL 3GMMB 3C5ZD 12E8L 1BIIB 2APTA 4NYLB 4Y19D 3CX5K 3MRBA 1FSKC 4X4XB 1JHTA 3GNMH 1YMMD 2Q86A 4HCRL 2GJ6E 1MAML 1H3VA 2FIRT 4LSQL 4PV9A 3FFDA 3DUUB 3QPQD 1QNZH 3SKMA 3GSWA 4AK1A 3VGBA 2PTUA 4Z7QF 4HXAL 1TNMA 1D5BB 4NQDE 1BAFH 3OB0K 4NM8H 3GBNH 4KK6D 1F3JA 1J1OH 1LD9A 1A0QH 5JDJA 1CWVA 3QUKB 2HLFD 3GJFA 1JZ3A 5EUOA 1NUDA 3RUGF 1CZ8H 1G7MB 2IAMD 4JY5H 3WS3B 3EDEA 4YDVB 3VD3A 4XI5D 1Q0YL 3L3JA 3SGDH 1NLDH 1P4BH 1Q9KB 2OX5A 1NJ9A 1YN6A 3P4OA 3BKCH 4QWWD 2OL3B 3LIZL 3CXHK 4IDLA 3T4YB 4YDLB 2R0KH 3GHEH 4KTEL 1G9NH 1N4XL 3RKDD 3HMXA 2FBOJ 1FNEB 1MFEL 5I15L 3G6JF 1YY9D 4YHZH 5BRZD 1P9MC 4WHTA 1IEBB 5T1DH 3O0RH 5GGUB 1LEKB 5L2JB 1WCBA 5KS9F 1J8HE 3NN8B 4OV6F 1FNSL 4OJFH 1JGUL 1CF8H 2A9NH 1PGRB 2VH5L 3BMWA 4K3EH 4FQQB 5TE7H 1NGZB 2F58L 2J8OA 4U1LA 4FQLL 1F00I 3P0VH 4PRHE 3MLTA 5GRUL 3DXAD 1XH3B 2I9TB 2P5EE 1DUYA 2OXHA 5DLMH 1QOKA 5C6PB 4KU1A 4IOIA 2OP4L 3C87A 4WNQA 3NCFB 4YFLF 2HKFL 5T1LA 5ISZE 3QPXH 4XNZC 4QHUB 3E2HC 1FLTX 2EKSB 4J4PA 3BIKB 3X14A 4TNVK 4N90E 3ARBB 1FYHB 2XI9A 3VD5A 2DQDH 3GK8L 5HPMB 1ZLUH 2IBZX 3MRHA 5I1HH 3MLVH 3PUCA 4G3YH 2R0ZL 2C3HA 2QL1A 3NFSH 1XGTA 3CFKB 1PY4A 2ZCLL 4PJ8A 3ELAT 4NO5A 3HUJA 4V1DA 4PJIF 3PGDA 4DK6A 3IDJB 4Q9BA 1ZWIA 2A6DB 1S5HA 3D39B 5KVEH 3IDMB 2PYEB 3RVVD 5SWSE 5KW9L 2BVPB 3O45B 2HKHH 3I3BA 1CE1L 1HH9A 4HIXH 3KPSB 1E4XI 3WIHA 1BEYL 3QEQD 3STZA 2PKDA 4CN6A 1C12A 4R4BB 4ODWB 1J8KA 2D0FA 4RX4D 2VMFA 3RVWD 3X3GL 2DI9A 4D94A 3ARDC 2E8ZA 1Z5LB 1KN4L 4MB3A 4EZMA 1N8ZB 1WC7B 1IFHL 2VJXA 2X4QB 4PRNB 4R3SB 4R0LC 2APBA 3CUPA 2A6KA 2XTJD 4XP5H 3DRQA 4KK5C 3EFDL 2ZUTA 1A1OA 4UV7H 4CADA 1KELL 1U8MB 4PP1C 3NZ8A 3D18A 3MV9E 3W0WE 4S1QH 1PG7W 4DK3A 2YPKA 1ZTXH 1TITA 1NMBH 4U31A 1NGWA 5CJXC 4QY8B 2DIBA 4LRNL 1IAIL 4M6MH 3HG1D 3T2NH 4HEME 1JNHB 2J6EL 3KPRE 4K23H 3UC0L 4YEEA 3VFMB 1W2KT 4XBPB 4KV5E 3RVXC 1BZ7B 3RHWF 5IF0A 2HT4D 4P46B 1ZHKB 1ZAGA 3PWLB 1MCQA 3WS6A 1G7JA 4U6YB 4MA1C 4W4OA 1OAQL 4I0PD 5EIIB 4CW1B 3O41B 4ZFOL 3IGAB 3OTTA 5TDOA 4JZOA 2A74A 4XNMA 3HE6C 4NUJA 5CP7B 2B5IB 3RBSA 2MHAB 3WHE0 1QLRA 5DJ8A 3WJJC 4YDKH 4W6WB 1AR1D 1DANT 3FOMA 1HILB 5FGRA 1JWUA 3AXLA 1GGCH 1JV5B 1F02I 3MO1B 1KGCE 5HI4C 4DTGL 2EE2A 1U91B 2P45B 1CK0L 3UTSD 2NXZB 3FQXB 3ZE2E 4WY7L 5HGHA 2WWKT 4UV4L 1Y0LA 3PL6A 5F1KC 1DVFD 2D7MA 4JPIB 4LOUC 1LDSA 3MBED 4Y4KA 3WN5C 3TZVD 3UBXG 4TUOB 1JI1A 1S7RB 3K2UL 1NQBA 2D03L 3ULUE