1JGVL

Structural basis for disfavored elimination reaction in catalytic antibody 1d4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
220
structure length
220
Chain Sequence
EVVMTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Structural basis for a disfavored elimination reaction in catalytic antibody 1D4.
pubmed doi rcsb
molecule tags Immune system
total genus 54
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgvL01
4I77H 4RISH 3GJEA 3M07A 1ZEAL 1B3JA 4WGVB 1KIPA 2BCKB 4XAWL 1LGVA 1MJJA 4YDVA 5J6HA 4POUB 4FMFA 2F53B 1BBDL 5EUKA 4S1SH 1QSEA 1UZ8A 3P4NA 5EU6E 3WS3B 5C08E 2NXYD 4YC2B 3HZKA 3BAEL 3EZ8A 2AAVA 4MSWB 4OM0L 3QRFM 4M1DH 1IT9H 1TNNA 4IM8A 4MLSA 3VI4F 4KDWA 3TGXA 4KJQC 2RQ8A 2L7JA 1J10A 4HFUH 4M93C 2P7TB 1I9RL 4PJBB 1MWAH 4ZOCA 3TPKA 1K8DA 4HWBA 5E00A 1A7RH 3HN3A 3MLUL 3P73B 2ZPKH 2IH3B 3KPQA 3T0DA 4WUKH 1S7VA 4J7RA 4WJ5B 1EEYB 3VFPA 3ROLA 3E2HC 3VMPA 3MUGA 1BM3H 2NY4C 1KJ2H 1EVUA 3NABH 3QXDB 4P3DB 5ENWA 2JB6B 3QHFL 2VLRE 2I26N 2H9GB 3HE6A 3AM8A 1G6RB 4K71B 4XNZC 4AG4H 4NKIH 2VZTA 4KY1H 5D7JA 4OFVA 5HYSG 2V6HA 2UV3A 4MD0A 3OPZL 1E6OH 1EAPA 1U8HA 4JGJA 2QHRL 1A1OA 1SYVB 1ZHLA 1YUHB 2MCG1 1I3VA 3S8WA 5ID1B 3VCLA 4TUKL 4K23H 2E27H 3PWNA 4M7JL 4GRWF 4LPUA 5I1EH 5SV3A 4A2LA 4QOKA 3LKPB 4IJ3C 4HJJL 5T1DH 3IFLL 3RGHA 3IT8D 1YYMH 3FFCE 1FIGL 4ELME 4FFZL 1IGCL 5FUZH 3VFNA 3IDJA 4N0UA 1T89A 3FT3B 2C3WA 1ZXQA 5HXMA 2XACC 1LO5A 4HWEH 4G6AC 1QBLL 2XICA 4NO0B 3NFSL 5E8DH 3ULVC 2H8PB 4CAGA 2Y06H 3ZHKA 1WQVT 2J88H 3IDGA 4PRHE 1AIFA 3UPRB 2NY1C 2FD6L 2DQGH 3GSXB 1I8MA 3U6RA 4HHAA 4ERSH 5EBGA 4ZFZB 3OKEB 5CSBA 4U7KA 1INQB 1QVOB 1A6ZB 5FOBA 3O8XD 3DIFB 4J3SA 1JPFA 3BKJH 3MACH 2HT4D 3I9GL 1CD0A 3QUMH 3U9UA 3VXUB 1FL5B 3T4YB 1S9WB 5DF0A 4V2CB 1MJUH 2EDEA 2QJDA 2B1HH 1R5WA 4Z7WB 4NZRH 5DJ8A 1ZGLM 2X4QB 4I0PA 1T3FA 4FABH 5E0QA 3ZLQC 4HUWA 5I6XC 4YR6B 2X41A 1DE4A 4XBGA 1JGDB 1NFIB 3VFWB 2DB8A 3MYJA 4TRPL 2ZSVA 2V2XA 3DXAD 3OTTA 3C5SB 3O2VH 1DLFL 2DQHL 4ZQKA 5A16A 3BQUC 2MHAB 3FL7A 4H0IA 2WLYA 4G8FA 1RFDH 4FQLL 4WWKC 4HJGB 2IAMB 4BYHA 1KTRL 3HS0A 1B88A 3H0TA 3Q5OA 1JPSL 3G5ZB 1FORH 1L4IA 3GHEL 5CGYC 3TBTA 1KPVA 4PY7A 3MSPA 4DW2H 3U1SL 1OARL 4GAJH 2PO6D 2CMRH 3AAZB 5D5MB 5JTWA 3MFFB 3FRUA 1BF8A 1S7SB 5D1QA 4PPTA 4GKNB 4NC2B 4ZFOL 3AREC 3QDJE 1B9ZA 3FAWA 4XH2A 4TN9A 3HMWH 5M7QA 4XVTL 1BOYA 2F15A 3MRCB 3S37L 2QSTA 4Y19D 4D9RD 4UIKH 1CGYA 1PQZB 4OT1H 1X5ZA 2NY2C 5DI8B 1WBYA 3KYAA 2R0WL 4XCYB 4R7DA 1TPXB 5F9WB 4UDUA 2WIIB 3LN9A 5IMOB 5E2TH 1N7MH 4K3JH 3FO9A 4U1GB 4K3EH 4WFEE 2I07B 3VRJA 4DQOH 1CFSA 4S1DD 1ONQB 4NRZA 4NOFA 1HOCA 4P4RA 1P7KB 4CW1B 4JRXE 3T4AB 1NH6A 1A4KA 3UJJH 1AR2A 4QHKJ 1Q9WB 1UJ3B 4YDJB 4G80B 4AIZB 5DYOB 3P4MA 5EOCH 1MCJA 1HYRC 3UBXI 1FNEA 3KYNA 2EYTA 1A5FH 5J7CC 3QNYB 4EUPA 5HGDA 1OTUD 1MQKH 1QRNE 2KDGA 2R29H 4L4VB 4Y88A 2E9BA 4M7ZB 5T33L 4DKAA 5E99L 5LKNA 1MAKA 1ED3B 2WUCH 3RGVD 5JLZA 1ORQB 3KHOA 3C60D 1I3RB 3WN5A 5KJRL 1NC4D 4S2SB 5E4IA 3HE6C 1A6VL 1JNLL 5KS9E 5F89B 1CICD 5D7JC 5IROA 1A4JB 2QQLH 2EH8H 4MA7L 3RPIA 4ZDHA 3MLRH 2FB4L 4HK0B 1FHGA 5EO1A 1UWXK 4JZNA 3QPQC 1NGWB 4FQIL 5FECB 3IDYC 4WFHD 4KV5F 1N8ZB 4PJ9A 2IANE 3LKSB 4MD5B 2E7LC 5SWZD 4QHMB 4BH8A 4Y2OA 4NM4L 1RURH 1MFBH 4XAKE 4UNUA 5D7IB 3JUZA 4ODSH 1U36A 2YA0A 1J05B 3CC5B 3AY4A 3IFNL 3ZTJH 1U8PA 4OM1L 2NW2B 2F8XC 4J1UA 2UWEA 2G75B 4MGXA 5C0RH 2H6PB 1ZA3B 4BQ9A 1T89C 1F90H 3QFJD 2HP4A 4MDJB 4Z95H 4L3CB 5HYIA 4RZCB 3FQXA 4XPGL 2IH1B 3BD4A 1KEML 3PP4H 2VN4A 4KJQD 3O41B 4HH9A 4YHZH 4YO0A 1NEUA 1YNTB 5ANMA 5E8EA 4NN7B 3QUKA 2XXMB 5DRZA 2OTUA 5DD6B 4W81A 5J12B 3FT4A 1DVFB 4HUUB 3ZDYF 3OXRA 3S98A 2HJFB 3DX7B 3HMXA 4YBQC 4P2RA 2GJZA 3IF1A 3S3JA 5C0CA 2NY4D 3GIZH 1A21A 2DKSA 1P7QD 1UXSA 4Z7OE 4JRWA 4I0PC 1LDPL 2QKIA 2NCMA 2HKFL 1P84J 3WFCH 1LO2L 1A7QL 3ROOA 3DVGA 4YUEH 1GRWA 1TITA 3QUYA 4LL9A 2V9RA 3QNZB 5K9QG 1KEGL 1A7NL 3UTSD 4Z7UF 4GJTB 3VFMA 4HWZB 5DA0B 2PKDA 2XY1A 3SOBH 5D7KD 3EOTL 1MCLA 2YMXH 4G3YH 2NX5A 4JM2A 2BNUA 4MXWL 5CZXC 5HHPB 1U0QA 2LQRA 2QHLA 4XPFH 5BV7B 4HIJB 3SKNA 4NNXA 4ODHH 1BIHA 3RVUC 5D1QC 5GHWL 4NQEB 1J8HB 2E3VA 4KAQL 1A1MA 4G6AD 5C2BH 3L6FB 4CRPA 3ULVD 3MBEA 3O6KH 4X6EB 5ERWB 2ESVB 4XP4H 1CD8A 5IEKB 5JR1H 4WCYH 2E7HA 2NY1D 4F8TA 2XQBL 1JNNH 2B4CC 4NKDB 4Q7DA 4WW2B 3ORJA 1Z3GH 4UINH 3L7EB 3TO4B 3B8SA 1CT8B 5FCUH 4R7NB 4W6WB 1IC5H 2FJGB 1FNAA 3T3PE 4PJDF 4BZ2H 2VZSA 1EUTA 4JQIH 1GZQA 2F74A 3HCVA 5TH2B 1VESA 1N4XL 5D7LB 3W81A 1T22B 2X9WA 2AABL 1E27A 2JJWA 4IS6A 1XGUB 3V6OE 5AWNL 5TE4L 1IAKA 1UVQA 4NC1E 5KTEL 1V8HA 5TE6L 5LVEA 1D6VL 4G9FD 4HBCH 3U30B 3GSNB 1FZOA 1JWUB 3OAZK 5JHDB 4Y1AE 3OGCA 3PWPA 1AJ7H 5LBSH 1C5DB 4Z0XA 1NCBH 3MA9H 5B3JE 5J11C 2CRMA 3BP7A 3R06A 4GW1A 4OQTH 2V7NB 1JV5A 5D7SH 4YAQB 5HBBA 3H2WA 4ZXBB 2N7BA 5EO9B 1JZ2A 3WIHA 2Q76B 3OBAA 3BQUD 2V2WA 3KNBB 1E4KA 4ZTOH 4WWKD 3MRKA 1J5OH 3CLEH 3WEXB 5IROC 4YQXH 1P69B 4JO4H 4HUKB 4PLOB 3DWTA 4K7FA 5K33A 4QWWD 3O4OB 5CGYD 1K6QL 3BO8B 2DQCH 2R1WA 4MJ4A 5FYKU 1NL0H 3HUJF 1P6AB 4P2QE 4U1HA 3CFJA 2VC2H 4HPOH 2DMKA 5HHQB 4R97C 4H20H 4MA1B 1BREA 1FO0B 3ARED 3VXRE 3K80A 3SQOH 1SJVA 1VENA 4PLJD 3PL6B 3PXJA 3QQ3B 4JY6B 3N1GC 3VG0L 3ULUL 3UTOA 5IB3B 1GGYA 3DURA 5MEPA 3ZDZF 5CBAA 5GS2D 1YDPB 4PRPE 1JZ4A 3S7GA 4PJHF 2ZJSL 2VLLB 3GHBL 4KHXH 4D94A 3PGDB 3Q0HA 1U2CA 3QZWG 5HHOA 4OZIF 1EJOL 2H2SD 4JJHA 5GGTL 4GBXA 2LAGB 1AGDB 1TTFA 1I7ZB 3RNQB 2X89D 4LLVB 5CBEA 3V8CA 3MCLH 4PGCB 4YBLB 3PWJB 1ODAA 2ADFL 1F3JA 1Q8MA 5BZWA 2Y7QA 2YUVA 2A6KB 4XC3H 1MPAH 5IR1A 1DBJL 2DM2A 4GG6B 1S78D 1H8NA 4R6UA 5HJ3A 3O9WA 4CNIB 2AJYH 3STZB 4RA0C 5SWQB 3MV8E 1BVLA 3TPUA 5C6WH 1MI5E 1IM3B 5CCKH 1FL6A 5DHYB 3HE6D 1LEKB 4JPKL 1J1OH 1Z9MA 4R96A 5D7JD 4JO1H 4KMTL 1OT1A 4G5ZL 3T8XB 4PGDB 5F7UA 3QPQD 1MIEH 3QIWA 4X6DF 1XMWA 1C5CH 2X10A 5GXBB 3D2UA 1C1EH 1LP9E 1N64L 5LXGH 5D2NC 4WI6A 3S9DB 5DJYB 1RZJL 4QY8A 5D96B 5EUOA 4JM2C 1IAOB 1BP3B 3F7YA 4QOKD 4CADA 4GQ9L 2AJSL 3SDCA 2VL5A 1OGAA 3VFOA 1LK3H 4Y5YA 4BKLA 3IGAA 5C8JB 3ARDB 1W72L 1N6VA 4XRCA 3AROA 3DHMA 1G7HA 3OB8A 3QRGL 3BP4A 4XBEL 1CL7L 1NGXB 4KI1A 3MBEC 3RDTC 5DUBA 3E6FB 3UYRH 1PG7H 3EOAB 5AAWA 3CXHJ 3BHBB 5ICXB 3DX9B 3MGOA 2XT1B 1Q72H 3O4LB 3WYRA 1NBYA 1XGPB 1NGZA 1GOFA 5I66B 2RCSL 3I3BA 3VFVA 1YEHL 3S35H 3LB6D 2FYYA 5FYKD 3UTQB 1S7XA 3LAFA 2K7QA 4BZYA 1AH1A 1CBVH 1K2DB 4U6HB 1T7YA 4YBQD 2EDXA 4H1LB 5F6IC 1MEXH 2D7TL 1KENH 2HT2C 5ID0B 3SCMB 3QB7C 3C09B 1SY6A 3IJYB 4AQOA 4IIQA 1AGEB 2E8ZA 5F71A 5J1TC 1SEBB 3BFOA 3TVMD 2DOCA 4XCCL 3B6SA 4GS7B 5D8JH 4JB9L 4NZDA 1HEZB 3J7HA 4ENEC 2QL1A 1IEBB 4XMKH 1K5NB 3RWEA 3CVHB 5MENB 4MQ7A 2ZG3A 5HHVL 2DQTH 3QIBB 5ACZB 3P4LA 3CD4A 4JRYD 4UILL 3I6LD 1BJ1H 3X17A 3B43A 3VWKB 1E4KC 3MNVB 5L0QB 2DKMA 3LS5H 1BX2B 3E3QE 3GMRA 3QIUB 4NJAH 5CZXD 1AQDB 1EEQA 3QCUH 2AJUL 4WHYH 1A14H 1CL7I 4WDIB 1UKQA 5CILH 3CZFB 3BVNB 1JHLH 2MJWA 1ZKAA 5EIQA 3QP3A 3AU1A 1R3IH 2NMSA 1JGEA 2FX9H 5CHNB 4BK5A 1TJIL 5GGUB 1EX0A 5EPMB 4IDJH 1H15A 2XOTA 1N3NB 3OAYK 3QEQB 2IGFH 4MJID 1XR8A 5EB9A 4WHTB 4MXVE 1UB5A 2X1WL 1OLZA 1IGMH 5GGSY 1V7NH 5ISZB 4U2YA 1MRFH 1BWWA 3BGFC 1RJZB 1KTLB 3BPLC 4HK3J 4I3SH 1I1YA 4UAOC 1IL1B 4GBXC 4OIAA 5CJOL 3KPSA 3L3KA 1ES0B 2MKWA 4CMMB 5ICYB 1DBBL 1B0RA 1LWRA 3DYOA 4IHOA 4MWFA 4RISL 3ELAT 3EOBB 3SEPA 2X9YA 1NGYA 4M00A 5LGHL 5I76B 5BOPA 1NJ9A 5MEQB 3EUUA 3QUZA 1ZT4A 2WWMC 2Q6WB 2GT9A 3O2DL 1EFXB 3S34H 4RBPK 5JQ6H 3H3BC 4MXQC 4OD2A 5EBMB 3VGBA 2DLGA 3O9WC 1FGNL 3EDKA 2EDNA 3HI1A 4M3JA 4KVNH 4XNYL 1FIEA 4HEME 1E28A 4WI5A 1IT9L 5IVXF 1KELH 4EIGB 4P5KA 1FE8H 1OLLA 3H9SE 3EYUL 3VU2A 3MRDA 5TDPB 3ZT5A 1P4BL 4YX2L 5AYQA 1UT9A 2YR3A 1J88A 3QIWC 1M7DA 3HLAB 2BMKB 5E5UB 5EOCJ 1AGCB 3AMKA 1IGJA 2CUIA 4GW5B 1NCNA 4YHPA 5H35B 3RUGA 1UC6A 2Q86B 4GQPH 1OTSD 4V1DD 5DJZA 2N1KA 1OTTC 2QADB 3OQ3B 1NCWL 1JRHH 3P4OB 3GUTA 2ZUQB 3GMLB 2BY3A 5FHBH 1FFNA 5I1HL 2BVUA 1S9KC 3T0XA 1KCKA 3D25B 5CZVH 4LSUL 1KJ2L 4ZUWA 4LNRB 4U0RC 2VN7A 3BD3A 3ZDXE 3KYOA 1GJIA 5LG1A 3O6FB 1A7OL 4DGYH 1G0DA 4AG4L 1BD2D 2BHYA 1GGUA 2P1YA 3VG9C 4KY1L 1SEQH 4HKZB 4GKOA 4EOWL 4KK6D 2WK2A 4HIIB 4QRRD 2J8UE 5C6TH 1GH7A 1AP2A 1WEJL 5EU3A 1FJ1A 2DIJA 1T1WA 4K23L 4P2OA 5T1KA 1I8LA 1CTOA 4KUZL 3V0VA 5IW3A 2VDKH 4A6YH 1XR9A 1CE6A 4P5TB 2XTJC 3D1MC 3VE0B 5HI4C 1AKJD 4OZFB 5ICZA 2VDLL 1IILE 4P2RD 5FIEA 1CDGA 5C0CD 5IMLB 4L3EA 2X4UA 1UACL 2N7AA 3X3GH 1S7UB 5DZOA 5D71H 3GBML 4WGWB 1NEZB 2XN9A 4OIBA 4IOSD 1I8KB 3IDNB 4HLZG 3WO4C 3X14A 4D9RE 4OZGA 4LCWA 3U79A 1IKFL 4Y4HD 1BWMA 1YMHB 4L8SA 2VDRH 4B7IA 2DQGL 4TNWF 4XP6H 3MJ7B 5DD5L 3U0PB 3DPBA 3NCYP 3MJ9A 4HAGA 1EK3A 3B2VH 5MP6H 5EWIH 3U7WH 3WIFA 1C16B 2YD3A 1HI6B 2L7UA 5INCA 4JM2D 2VXUH 1WVZA 4NGHL 4PV8A 1J86A 4P9HL 1T2QL 3FCTB 1BZ7A 2YPLA 3GMPA 4LSTL 3BZDA 3QUML 1EEZA 1W8NA 2HJLA 4FNLH 5IF0B 3RQ3A 1MJUL 3MZGB 4AM0B 3RWGB 2R15A 3N85H 3N9GH 1BQUA 1AGFA 3SHSA 3LH2H 5E6IA 2NY6B 4NBZB 4MCYB 4NSKA 3DVFA 1KIUA 3BYYA 4O4YH 1P84K 3PV7A 1FLRL 2FDBP 3G6JE 3MLPA 4G8IA 3RDTD 3QZWA 2O5ZH 4Y0GA 3FO2A 3DJ9A 2FL5B 4Y4KA 1FVCA 5I1GH 1IGYB 3QO0A 4PTTA 3EFFB 3AS0A 1FG9C 1YEJH 3QG7L 5DC9B 3L95B 4RGOH 2JJUA 1W0VB 3LSOA 5I2IB 1FORL 3QWOA 4ODWA 3A6BL 3A6CH 3DMMB 4ZO9A 1IAIH 4DFHA 1LEGB 2CMRL 1V3JA 1G9MH 1IGTB 5E24E 3ZYIA 2HT2D 3IDMA 5EH1A 5EO0A 4DKEH 1D6EA 2YWYA 1QQDB 4LEOA 5D2LE 3QUZC 4YNYA 4F58L 1QZ1A 2PTVA 2A6JB 3K1KC 4ENED 3RX5A 1VEPA 1MHCB 1V7MH 5CP3A 4WEMB 5EZLA 2DN7A 4JM4H 1MUJA 2UVFA 3QFJE 1FO0L 2OTWA 4JHBA 4AENB 5FUCE 1CD1B 4RMTA 2XYCA 1DQJB 3DGGB 3T0EC 2WBKA 3I3EA 3WUWG 43C9A 4ONFH 3VGFA 2DBJA 1MFCH 5C0FA 1JYXA 1R24A 3F58H 2XWTB 2OS7A 2EDOA 3HA0A 3FONB 2PYFB 3MUHL 5FDWB 3CCHB 5DMKA 4DVBB 2VSCA 5EOQH 3LQMA 5BZDA 1HILA 3L3HB 4WU5B 1Q0XH 4Y4FB 2VO5A 2CR3A 3U82B 3K2UH 4JO2L 1SYSB 4P5MB 5D93C 4TNVF 2VH5H 3ALXA 4HKJA 1HXYB 1TJGL 5EZOL 2E8YA 1FZJB 4WFFD 4OLYH 5CEZD 4CMHC 1KPRA 2B39A 4QTHA 3M8OH 5D1ZB 1DZBA 4J8RA 4D0CA 3NCJL 3BMVA 5BCAA 1QLRB 5F7DA 4NO5A 5HHNB 2R0ZL 4PRIA 1QR1A 2BJMH 4PB9L 1XZ0A 4GW4A 3A67H 5C0JA 4OIIH 3S97C 3PHOB 5J1SC 4GBXD 2X4PA 4FFYH 3MLRL 1BQLH 3ARBA 3UTSE 3VRIB 1YJDL 2HKHL 2ZNXA 5HDOA 3WFEL 5L7XH 1CGVA 4TNVK 3I75B 5D7KE 3SY0A 5DURD 2CXGA 1YMMD 4P2OC 1I8LC 2LV4A 5JIIA 5HYJB 3QI9B 2IBBA 3S36X 3JTSA 2ZCHH 4YHIB 5GGRY 4NQCB 2WWMD 4YFLI 4J4PA 4HFWA 3QEHA 2Z35A 3C6LB 1LMKA 3ARFD 3R1GL 5GZOC 3RZCA 4MXQD 3O9WD 1U8NA 4YDIL 4XP9H 5BRZE 2VQ1A 4R4NC 5ALBL 5EBLB 1IE5A 4QNPF 2A0LC 1WTLA 2YEZA 5DWUH 1VFBA 4L8SC 3V0AC 1INEL 1PX4A 4NN6B 4AYFA 4YHZL 2IPKA 4FS0A 1CQYA 4PJDA 2PO6B 3MODL 2BSTA 2CO7B 1HDMA 3O0RH 1LD9A 2LU4A 4S1RH 3FRPG 1FCGA 5IEHB 4HZAA 3TBSA 4ORZC 3EO1B 3LKQB 5JW4M 2ADJA 1OTTD 2RGSA 2FZ3A 4G42A 3CX5J 5F1KC 3U0WH 1OGAD 3VXSA 35C8H 4LKCB 3VXNB 5ESQB 2BRRL 3LEXA 2Z93B 3BJ91 4Q97A 4LPYA 4MCZA 4JFDA 5HGAB 4JY4B 1WBXA 4JFZH 5E6IC 4JO3H 3SN6N 4ELMF 4Y5VB 1LE5A 5DO2C 4XCEB 1LE9A 1JHKH 1DEEA 1KG0B 4OV5A 2X5PA 5DRXA 3T77A 2P5EA 3QO1B 4OF6A 5GS2H 3MO1B 2EC9U 4TPRL 1BEYH 3K7UA 4MNQB 4Y4KC 5TF1H 1QO3A 1I1CA 2VLKD 3SOBL 3U7AA 3T04D 3VXTA 5J13B 4KJYA 2DQJH 4Z8FH 1F5WA 4NYLA 2XTJD 1JVKA 3U0TB 3CMOH 5HI4D 4H25A 5ILTH 3MTRA 1JMXA 1I1RA 1JF1A 2R1YA 3T1FA 4LCYA 4EI5A 5E2VL 4LSPL 3KLSA 1NC4B 5JZ7C 3V79C 4AMKH 3WXWH 1R0AH 2CPCA 2R4SH 1ZLWH 5F9OH 4BELD 1KIRB 2AP2A 3O6KL 2BOBB 1CDUA 4FQHA 5TDNB 5KOMC 5EULV 4WCYL 5F88B 5MI0B 3RWIB 4E5XA 4QRQA 5T3XL 2OK0L 4OZIA 1NC2A 4PP2B 3CXHK 5E5RB 3BZEA 4LAJH 4UV4H 3VFSB 3GSOA 1XGYH 4UINL 2DTML 4EKXA 5FCUL 5SWZB 4S1QL 4EQ3A 1V3MA 4KROB 4ZYKA 1XF4A 4MMXC 1MNUL 2YKLH 2C7UA 2AKRA 4LHUG 4UQ2A 1RIHH 1BGXH 4ZUTA 4YH6A 1FFRA 1I9EA 5E70A 4GFTB 4GMSL 4Z78A 4PRDB 3ZHLA 1N0XH 1RUKL 2RB8A 4X6FA 4NP4L 2VZVA 1BFSA 3DRQB 3V5HA 4PJ5A 5LBSL 1NCBL 3QJFA 1R3KB 4M93B 1B2WH 3ZTNH 2CKBH 5FAAA 1WWCA 2E6JA 4PFEA 1WBZB 3FB7A 1KTDA 2PW2A 1BJ1J 2Q7YB 2ZG1A 3SDDC 3EHBC 4PS4H 3RWCB 3ARWA 3U9PH 2AV1A 5C0BB 1YC7A 1Q9KA 3KPSD 1ZSDA 1BFOB 3TESA 3E2HB 3ARBC 5FM5O 2P5WD 3BGMB 1NANI 4AH2B 1JK8B 3J8F7 5FGCE 1YEFH 2EXYC 3CXDL 2DQCL 3L7FA 1DBMH 3GI8H 1QFOA 1F6AA 3TN0B 4PTUA 2PYEA 3L3GA 1CFNB 1BLNB 3QR2A 2DLEA 3HPLB 2BVYA 4QLRA 2P44B 3S5LB 4H20L 2R69L 4TSCH 3T3ME 5T3ZD 1EUUA 3QUZD 3NAAH 1A6TB 5JA9A 3QDMA 4J3TA 2YXMA 4J4PC 1NGPL 2V7HA 3HNSL 3FB8B 4I5BA 1U8IB 1U3HA 3RZCC 4RGMC 2BVQA 3GSWB 3GMMB 4L8DA 5DQDH 1DJSA 4FQQA 3I02B 4OLZL 1GPOL 3CH1B 2JJTA 5F9DC 4BFIB 3T0ED 3DUHA 3BGAA 3M17A 4HC1A 5JORA 5KN5A 4GUPB 5CIPA 1MELA 4IJ3B 4LF3B 3GI9L 4Y16B 4WI2A 1BOGB 2PXYB 3DV6B 5I1DB 5KS9F 3RBSA 4CN6A 1FYHB 3L3OA 3U7YH 4NWTL 5IQ9A 1ADQH 1F4XH 5DXWA 4OLEA 4M48H 4IDLA 3ZT6A 1MPAL 2OL3A 1T1ZB 1Y18A 2DBLH 5HGHA 4JFQB 5E5MB 3HHRB 3L5WB 5TDOA 5E2JA 5IBTL 2C1PB 3GDBA 1MAJA 2AJYL 3U48A 3OHXB 1J11A 4I3GA 1FFQA 5ETUA 1CG9B 4XI5C 1XGRB 3K2MC 5HY9A 1T2JA 5DHVH 3OF6A 2B4CH 5SWSD 1M7IB 1QNZH 2AEQH 5DUMH 3KWWB 5L2KD 4E0RB 4JRYE 1L7TL 2AI0L 5LXGL 4WV1C 2P42B 4P2OD 1Z9SA 1QEWA 3WLBB 2BNQA 1XIWB 1CXLA 4G8GD 3HNVL 4NUJB 3W0WD 3TYFA 3VRLE 1MCRA 3B9EA 1WWAX 4PRAB 2ICEA 4EI5C 5IQ7L 3QXUA 4L3ED 4YZFE 3LN5A 5CEXB 4LSVL 4AL8H 3RVVC 4L1DA 2AEPL 1JPGA 4Q9RH 4XHJD 1X3DA 4R4ND 4NQXA 2XN9D 2A0LD 1XF1A 4Z7OF 1A9BB 2ICWB 4MJIE 5GS0L 2LABA 4P9MH 3TNMA 5H8DA 5F3BB 4UT7L 3BUYA 2RJMA 2XTLA 3GJEB 4MAYA 5HHMB 4OCXH 4ZD3L 4FZEL 4PV9A 1KIPB 4WU7A 4P3CL 4KHTL 3BN9C 3O3EA 3U4AA 4AT6A 1MJJB 1CBVL 5LCVH 3C2AH 4YDVB 3T2NH 4PJEE 5ITFA 2YPLD 5J6HB 1Q94A 2NY2B 3G6AA 5C0AA 1MEXL 5EUKB 1KENL 2MPAL 8FABA 1QSEB 1UZ8B 2NY5H 1AO7A 3P4NB 1LEIB 3HZKB 4ZUVA 1GGTA 5E6ID 3P9MA 5IFJA 3BWAA 4ZAKA 5DO2D 3W5MA 1DCLA 4RMQA 3QXVA 2YBRA 3JV0A 4RAHA 4PJ8C 4I18A 5IVXA 2CLZA 2A83A 4OZHE 5BJTA 1K8DB 2JB5H 5E00B 3RU8L 3ARGA 3KPQB 5E7BA 5A43C 3TA3A 1FZKA 1NPUA 3LS5L 1R3JA 2FH6A 4YHYC 4JFXA 3TT1H 4KQ4L 3KPOA 1IEAA 3ROLB 3RNKA 5F7EH 3T3PF 4X98B 3MUGB 1SJHA 3BP5B 4L4TA 2M1KA 1QG3A 2KZ1B 4NRXB 2QQNL 2M8XA 3TYGL 3ME0A 5ENWB 1EXUA 1JBJA 4LNVA 3MJ6A 4V1DE 5C0NC 4M61A 1RMFL 4HKXB 1NMBH 3HE6B 4YEFA 5JZ7D 1JZ3A 1RUML 5EC2B 2FX9L 5EFIA 1ZVSA 1FN4A 2HAZA 5FGRA 3AS3A 2FO4A 3MUZ1 2IGFL 3NMEA 4MD0B 1EAPB 1U8HB 1A1OB 5IVOA 1ZHLB 3RVTC 5B3JF 5I8KL 1CIUA 2DTSA 3CFBA 4D9LL 1BD2E 2JJTC 4PYHA 1KC5H 3Q3GA 3PWNB 4UT6H 4U1IA 3WLWC 4JPVH 5GRUH 1T20B 4QOKB 5DFVC 4QRRE 5T5FH 4FFVC 1D7FA 2J8HA 4IRZH 3HC4H 4N0RA 3VFNB 2AEIT 4XWGL 4CDHA 5BMFH 4N0UB 5JW3H 3NPSB 5ALCH 1LO5B 2PCPA 3BX7C 2J6EL 4X8JA 1NFDE 3JWOC 3S34L 1G7JA 1OVZA 3G6DH 5C0CE 1AIFB 5DJCA 4OQ1A 1X5HA 5H94A 1I8MB 3E0GA 4HHAB 2OJZL 4X80H 4FQXA 3SKUD 5C0DA 4KVNL 3TT3H 2Y07H 5KSVA 3SDDD 3DECA 4PRID 3P0VL 2ATKB 5FOBB 1K3IA 1JPFB 5I1IH 3WIIH 3VJ6B 5C0IB 5DD0L 1GGIH 2R1XA 3KPLA 3K8LA 3U9UB 2EXYD 4RGNC 2GCYA 1IFHL 5SX4I 5AYUH 5D2NE 1R5WB 2D31B 3CSPA 1CLCA 4KFZC 5DJ8B 5HGBA 3BRDA 4I0PB 1S8DA 3QDGD 3UJIL 1JRHL 1A1NA 2LU7A 4HUWB 3ZSTA 5K59E 2IFFL 5FHBL 4F15C 4OB5L 5CAYB 1DE4B 2UZIH 4XBGB 4J4PD 5MEOA 4U1SB 4O5LH 5I74C 3MYJB 3NIFE 1KXQE 5EZJA 1W0WA 2V2XB 2IJ0C 3RZCD 3T1WA 5F3HA 2BNRA 4ZQKB 5A16B 4BQBA 4LCUA 3I84A 1BIIA 2HH0L 4G8FB 5HTSA 1QFWH 1C12B 3VFRB 3QHZH 3HS0B 5IBUB 2DDQL 1SEQL 2B7DT 1S7TA 3H0TB 3PWVA 3D48R 4G6KL 2UVEA 4DOHE 1JZ7A 4X8XA 5C6TL 3JWNC 3WFDH 2OCFD 2LTQB 1YEKH 1QP1A 5D1QB 3ESUF 4LHUA 1KXVC 2D7OA 2YOCA 4DUXA 3I3DA 3VDCA 4XH2B 1KLGA 2JCCB 2WP3T 3NFPB 4KVCH 5I18L 2XG4A 2R56H 1ZT1A 1YECL 4PGEA 1Z5LA 5GRWA 2AS5M 1Z9OA 2ZCLH 1WBYB 3T2PA 5I19L 4R7DB 4LCCC 4UDUB 1H3PH 2CLRA 4JFDD 3FO9B 3LEYL 5D71L 4MQXD 5IFHL 4TTDD 5CEZH 5LWYH 1KUMA 3VRJB 1DN0B 2Q8BH 1CFSB 1M7XA 4NRZB 4JFED 1HOCB 4P4RB 2H32A 1A4KB 2P5ED 1CDCA 1DQTA 1JRHI 4I18C 1IM9A 3ZMRA 4Z7NE 3MMEA 2SEBA 3FQRA 4LVOC 2A6IA 3P4MB 4K7PL 4OD1L 2BVOA 3ARGC 5F6HJ 3RL1A 5MP6L 4U0QB 5C7XH 3D85A 1JNJA 3U7WL 1U8LB 3G04A 3TA3C 3KYNB 4OFYA 4FQ2L 5MERB 4EUPB 4U3CA 3EW3B 2FHFA 5C07D 4ESKA 5J11B 1AXIB 4FNLL 3F7PC 3CX5K 4ISVA 2EDQA 4JN2A 4EI5D 5A3IC 2IEPA 5JLZB 1B4RA 3WN5B 2J7LA 5JW4Q 4HEPG 3LH2L 2KL6A 3IKCB 1UQSA 1GIGH 4XCFL 1J0KA 4WFFE 1UWGL 4FXKA 1AXTH 3GMOB 4O4YL 5CEZE 3FOMA 2C4FU 4MQSB 3RPIB 2O5ZL 4X83A 5B4MC 5I16A 1IGFH 4JZNB 5EO1B 4PJCE 3UJTH 3JVGA 5L8KB 3FZUC 4PJ9B 5EU6A 2VISA 4JG1L 5C08A 4RDQF 1YEJL 2VDPH 1YYLH 4ODXB 4BH8B 4R4FL 2H2PD 4KK8C 2EEDA 1MFEH 3OGOE 2VSDA 1W0YT 2YD1A 3V6ZA 3BN9D 4FA8A 1P53A 1A0QH 1U8PB 4NBYB 4WHCA 5DJDB 1YMME 2AJVL 3PABB 3PGCB 1SJXA 4JGUA 4J1UB 2UWEB 4X9BA 1PG7W 3MV9D 4DKEL 5AZEH 2HG5A 3MQIA 2R2HA 5E4EC 3QULA 4DAGL 4PJ5D 1AY1H 1AFVH 4N9GA 4XXDA 1XH3B 1H0DA 1V7ML 4LAQH 5E7FA 2Y23A 1HHIB 4HH9B 2NPLX 3MCG1 4PJ8D 2DLHA 5BOZG 4JM4L 4YO0B 1ZTXH 5ANMB 5E8EB 2VR4A 3QUKB 4FQXC 1OCWH 3MXWH 4TULH 3Q5TA 2OXHA 1WIUA 5DRZB 2OTUB 4NKMA 1PLGL 1JPTH 2D0FA 1Q9OA 3TIDB 3OXRB 1RK0A 3S4SG 4NO3A 3GSRA 5FYLD 4P2RB 5JOEA 4WO4A 5GPRA 5T1MA 3EYSL 1T83A 1MWAA 3LQZA 4X9FA 3C5JB 1UXSB 2PYED 3KPRB 4F57L 2J4WH 1Q0XL 2D4DA 2QKIB 4I2XB 1PZUB 3SGDH 3ALWA 4NKQB 4U05A 1RZJC 2OR9L 3D0LA 3ZE1F 2DQFA 3DVGB 5H2BB 4OLYL 1MSPA 4HKBA 3QUYB 1H8OA 3FFCA 4ELMA 1KJ2A 3RVTD 5GIRA 3ULVL 1MRDH 2BJML 3LDBC 3OJDA 4HGMA 2NX5B 4OD3L 2R0KH 2BNUB 1IGIL 2EDKA 4JPWH 2G5BA 1JTPA 4FXGA 3P30L 1BQLL 4PRHA 5D1XB 5DFVD 3DETC 4YHKH 3DOSA 3ZKXB 1T80A 3SKNB 3ULSA 2VLKE 3WFBH 4FFVD 1VADA 1YEIH 1T7VA 2F8OA 2CSPA 2DWEA 3EIFA 1WT5A 3U83A 1A1MB 4MNHA 1MJ7L 1UB6A 2VUYA 2XWBB 1RJLA 1G7LA 3MBEB 1EO8H 2Q87A 4UTBH 1NAMH 1WZKA 3SKMA 4LLUA 4XP9L 3IDIA 4AJ0A 2EE2A 2VIRA 4MS8C 3F5WB 1QBAA 2F58L 1IAMA 4WWID 1MJ8L 2ED7A 3ESVF 5JOPD 3KYMA 4LEXL 1A6UH 1GZQB 2F74B 2UZYB 2A6DA 3EO0A 3HCVB 3BZ4A 5CJ8A 3OF6D 1OWWA 2CK2A 2MNUA 4IS6B 1L0QA 5CD3A 3O3AA 4JFYA 1UVQB 4Q9BA 4RGND 3VI4E 5F6IB 5L6YH 4S1RL 5BO1L 5C0GA 1FZOB 3EJZC 4WNQA 3OGCB 1S9VA 2VTFA 3PWPB 5E94A 4Z0XB 4GRWH 3TNNB 3BP7B 3R06B 1HSBA 4GRMA 1DDHA 4KU1A 3QUMA 1ZT7A 4JE4B 3GJFH 7CGTA 5F7YC 3SDXE 3C5ZA 2V2WB 5GRJH 3QDJA 1CLZH 1NBQA 3MRKB 2B2XH 1JHKL 1J9CT 3I50H 3BXNB 3TC9A 1IC4H 2J8OA 2CIKA 3GEWB 3F6LA 2C26A 3JVGC 2FGWH 3K46A 4K7FB 1FH5H 2R1WB 1UENA 5TF1L 3QAZB 1LNUB 2V9QA 4F8QA 1HINL 4XCNA 2WZPD 4KZEH 1WGOA 4Z8FL 1RJYB 2BY1A 3EJJX 3V6FA 2APXA 3MV7D 4K9EH 3CSBA 3BP6A 4JRXA 2P5WE 3RWHA 2AV7A 4APQA 5DZLA 4HWBL 1OL0A 3F7RA 4GRWE 5DUPL 5MEPB 3DURB 5F7LB 5C0AD 1FNGA 5JPNA 3G5XB 3DBXB 4K94H 3L3DA 1MCKA 4DFIA 3WXWL 1SJEB 5HHOB 1N5AA 4UAOB 4R2GC 1H5BA 3MR9B 1QRNA 2XPGA 1CF8H 2YZ1A 4ODUA 4OCRL 4YHOH 2EIZA 3G6JF 4NCC1 1S5IH 5CBEB 3KGRA 4QT5A 3ULUF 4EN3A 3P11H 3CVIH 3T0EE 4H8WH 3ARGD 4LQFL 4RDQG 6FABH 5JIKA 1XF5A 2D2OA 3HAEG 4PYGA 1MCFA 5KS9A 4MB4A 2YRLA 5IR1B 2YKLL 2O61B 2CRZA 4WO4C 4WIQA 1T83C 2R2EA 1PGRB 3D39E 4L4TD 1BGXL 2IANA 3O9WB 2VE6A 4M9PA 1D5XA 1F4YL 2B1AH 4DEPB 5A3ID 5DMIL 1BVLB 4K2UH 3TPUB 2RFXA 3HG1D 3LRGA 5DLML 2D4FA 5A2FA 4MVBC 4JFFB 1FZMA 3BMWA 1TZGH 4R96B 4ZOBA 5D2LF 4NO2B 1FSKB 1RULH 2CKBL 1FAKT 4WTZG 3QIWB 3HC3H 3FZUD 3D2UB 1D9KA 2MWCA 3VWJA 4MLIA 1MCOH 4PS4L 1J1XH 3ZYJA 4QY8B 5EUOB 3K8MA 5GJTH 3TJEL 3F7YB 5SWSE 1DFBH 2NY0C 4OF8A 4CADB 1B90A 4JAMA 4M3KB 4WI8A 3SDCB 5L2KE 2VL5B 4LSSH 3VFOB 2ZKHH 4EXKA 2ARJB 3BPNB 4LPCA 4Y5YB 4FTVD 3F8UB 4U0RB 2ZUYA 1S9YB 4BKLB 1F11A 4Y2DC 5FYKL 4N8PA 1CFTA 4N0YL 2VAAA 4YDKH 3W11D 4XRCB 3WKML 1G7HB 4TSCL 1UKTA 5CFHA 4G8GE 1GAFL 3NAAL 3W0WE 4MQTB 1T6WA 3EJYC 4MNQE 3VGAC 3VG9B 1TCRB 2DJSA 2XNAB 5KSBE 5DUBB 4OKVA 3FQTA 1TTUA 1ZMYA 5FA4A 3QWQB 3D9AH 4KRPC 2DQDL 2EE9A 4FQXD 1JE6A 2DD8L 3SDAC 4CUCA 1NGZB 1RZKH 5DEFB 5HSFA 4GO6B 2RBLA 4MA8L 1NMCC 4KKAC 2FYYB 4LLDA 2XTJB 1S7XB 3LS4H 4IRSA 1JGLH 4Q6IC 1OAZL 2X4NB 1JF5A 5FB8B 3CFCL 5J0BA 3X3FH 2QSCH 4GAYB 4Z7WF 2YD9A 2ADIB 4WTXA 4ALAL 4IIQB 2IF7A 4HXBL 4NWUH 1IBGH 2VYRE 4M5ZH 3FO0L 4HG4J 4M48L 1YY9C 3OWEA 4MDIB 5I1KH 3O3DA 5GGVH 4HUXA 3WXVL 5EIIA 4G6MH 4UOW0 4MQ7B 3LIZH 2VDNH 2BNRD 1F4WH 3WV0A 4JDTH 4O58L 2HTLC 4JFOB 4NPYA 4UB0L 2BSED 2DQIH 5CP3H 3GMRB 4J23A 3OKNA 2B4CL 2VXQL 3PWUA 4P3WA 1AHWB 12E8H 2A1WH 3DETD 5DUML 1VFAA 1F4HA 3HFMH 4P49A 2G5RA 5D5MF 2Y36L 5ABDE 4P23A 4XXCA 4ZPVA 1DUYA 4LHUD 3MV11 4MJ5A 1CDBA 1JGEB 4QRSA 2VZ1A 4LVNC 4RQQA 3RZWA 4APQC 3NTCH 1H15B 2HWZH 1XR8B 4NQDD 1N2RA 2F5BH 4F7MA 1I7UB 15C8L 4AL8L 3BW9A 4Q9RL 4MS8D 4PJFB 4XNUL 1NBZB 1I1YB 1D5IH 1SM3L 1UADC 4KTDL 3L1OL 1H5BC 5JHLH 1OW0A 3KXFE 4KC3B 3L3KB 2EZ0C 5A2KH 1T5WA 1IQWL 3B9KA 1IM9D 1B0RB 1F02I 4MWFB 4XVJH 1YPZE 1HYSC 4EN3C 2FBJH 1DQML 3KJ6L 3QCVL 3D85D 1NGYB 1FYTD 3MC0A 1NJ9B 4OFYD 1ZT4B 1GC1H 3GSVA 4H26A 3T2NL 5C92A 2DWDA 4YHLH 1NSNH 3REWB 2W9DH 2QLVB 3TZVD 4BFEA 3V95A 3HI1B 5DFWH 4PY8I 5IOPA 2YA2A 1QRKA 4MD4B 3VXRA 2PN5A 2FIRT 3MJGX 4XVSL 3LKOB 3MRDB 3SJVB 3SE9H 2CKNA 1CVRA 1TJHH 3N06B 2O5YL 5DQ9A 1MCWW 1J18A 3BPCB 3HC0B 4OQTA 4UTAL 5BXFA 1XCTA 5EU6D 1D9KC 4PRPA 5C08D 4U4BA 2EDTA 1IGJB 3VWJC 3T2OA 3GSQA 1WCBA 3VXOB 5JW4N 2EEBA 3RUGB 4DGIL 5C09B 5D7IF 4Z7UE 4ZFFA 3TT1L 3QUXB 1WCQA 4NZUH 5F7EL 3BKCH 1FFNB 1BFVH 3SKJL 4ZUWB 4WY7H 1CGWA 3KYOB 3V0WH 4L8CA 5JO5B 3QDGE 1OP9A 1NMBL 3HMXL 4JHWH 4KQ3H 3RTQB 4YBHA 5CJQH 1LDSA 5IB5A 1MLBA 1NQBA 5D70H 2IALA 3VFTB 1EVTC 5IJVA 5C0EB 5I30L 1AP2B 2W0KA 5BS0B 3MV8A 1FJ1B 1FCCA 1T1WB 1MI5A 1KC5L 1RHHA 2ZNWA 4P2OB 5T1KB 1JWSB 4PJGB 4UT6L 3V0VB 1KN4L 1UG9A 5HYEA 1MHHB 1XR9B 1CE6B 1ZA6A 1F42A 5FK9B 5ICZB 3H9HA 4IRSC 2IQAA 1KF9B 2YN3A 4P4KC 1TETL 3P9LA 3TBYA 1PVHA 4JR9L 1X5LA 2P8LA 1UEYA 3X12A 4XP5L 4L3EB 3B5HA 2X4UB 5GSRA 3OKDA 1LP9A 1L7IH 1KJ3H 1IZJA 1UXWB 2R23A 4JJ5A 5FO9A 1FFOA 1TVBA 3S3PA 3NFNA 5EOTA 5J89A 4FZ8L 4HMCA 1ZLWK 3X14B 1DQLL 4OZGB 4LCWB 4MVBD 1F2XK 4L8SB 1AGBA 3W9EA 5CD5C 4X80L 2NY3C 3HI5L 4AZ8A 3TT3L 1I1AA 25C8L 4QXWA 5F1NA 4Z77A 1ZHNB 4JFEE 3WIFB 5INCB 3GIVA 3P9WB 1F2QA 2A74A 3QCTL 1TZHA 2NY0D 1BZ7B 2YPLB 4PRHD 3MRGA 4UQ3A 5E08L 3FQWA 1EEZB 2HJLB 2XI9A 4HF5H 3HI6H 3SKOB 5E9DD 1B4JL 4K55A 4Y2DD 4JREC 4P23C 2APTA 1EZVY 4XXCC 2VLJB 4E41B 2X4TA 2XV6B 3BH9A 5E6IB 4NSKB 5C07E 3QBTB 4K8RH 1UYWH 3HUJE 2XZQH 2CRIA 2UZIL 4X7CC 3TCLA 4G8IB 4O5LL 1NLDH 3RI5F 3WFHA 3FO2B 4LLYA 4Y4KB 1FVCB 1D3CA 2V17L 4NC1C 3QO0B 4PTTB 4U6VH 3C6SB 2BXYA 2VERN 2VDQH 4X4MA 4MZ2A 3SDAD 3MXVH 3QHZL 4KMLB 5DD1H 1OW0C 4K7PY 4PJHE 1G6VK 2D9QB 3QWOB 3WIHL 1A2YA 1LVEA 1DL7H 4OZIE 3U36A 3B9KC 5IV2A 3IRZA 3RIAF 1T66C 1OGTA 2HTKD 4XPBH 1ZWIB 3KLHC 2FEDC 3IDMB 5EO0B 3PJSA 1RK1A 5M94B 3VGEA 1KCUL 4LEOB 1JGVL 32C2A 3DYPA 4YNYB 1OAYH 1NBVH 2R56L 2O5XL 1QSFA 3WSQL 5I9QC 1CDHA 3GRWH 5B8CA 1L9NA 3MV9E 2F54D 2VAJA 3FKUS 1MUJB 3MLXH 1J0ZA 3VRLF 1H3PL 2OTWB 2CDGB 5DEGA 2HTLD 5LAXA 1VPOH 3D3VD 4PJ5E 5CEZL 3MLTB 3QDJD 4B5EA 3DRTA 5ADPH 3RIAK 1R24B 3BPOB 3DSFH 1ZAGA 1P4LA 2FHBA 4HIXL 5GGSB 3Q1SL 2GSGA 4LASH 3BKYH 2ZWLT 2CR6A 5DMKB 1D5ZA 1I1FB 5BZDB 1LK2A 3H7BA 3WD5H 1X5JA 4X6DE 4MB5A 1HHJA 4UU9A 3VA6A 4EEEA 5DC4B 4APQD 4FQJH 5KVEH 4X7TA 1KPRB 4Z5RA 4XT1C 5JIHA 1TVHB 3PUCA 4QRUB 1HSAB 2VDOH 4J8RB 4D0CB 2NTFB 1KSRA 4UV7H 4F3FA 1BJMA 2M2DA 3JWOH 2OL3H 5F7DB 4I48A 2OJEB 1QR1B 1XZ0B 1Y0LA 4GW4B 3IB4A 4X99B 5F1IA 2DYPD 3K3QA 1YEEH 3QH3A 1H3VA 3BDXA 3NA9H 1JL8A 1CGSH 4PG9A 3ARBB 1GGBH 2NW3B 1QSVA 1CS6A 5ITBH 3SY0B 2N56A 1D5MA 1YEGL 5E2WL 1HYSD 3H9YA 3GKWL 3M45A 1G7IA 1YYLL 4G43A 1VCAA 1MFEL 4OZHF 2M26A 4DVRH 3H9SA 3ZL4H 1MCBA 3JTSB 2KPNA 4PJ7B 3EYOA 5HDBE 3BKMH 4NBXB 1PW3A 4IRJD 4UDTA 2Z35B 3RZCB 5DK0B 4RGMB 1UM5H 2IAND 1F00I 1U8NB 3BT2L 4XNQA 1PAMA 3O8XA 2VQ1B 3OKMA 1BZ9A 2AERT 2CJUL 2VXSH 1E4WH 1AY1L 4PJAE 4BFGA 1VFBB 4EBQL 2Q8AL 3TJHD 4DKFH 2IPKB 1QOKA 1ZTXL 2Q20A 4DGVL 3S36H 1DQDH 2IADA 2KKQA 4ONGH 4PJDB 1OCWL 3MXWL 4TULL 5AD0A 1I1AC 2BSTB 4NQVB 1HDMB 1LD9B 1RIUL 1U3JA 3VWJD 5JOPE 1R3HA 1FNHA 4EZMA 1GYAA 2ADJB 4L1HA 2WP3O 1KLUA 2YSSA 3DI3B 4G42B 1XCQB 4GG8A 1QPXA 1TQCB 4M02A 3SE3A 4YHMH 2XA8H 4RGNE 2H41A 3VXSB 2J8UA 4DN3L 5GRZA 3STBA 3SGEI 1OPGH 3LEXB 1NCUA 5AUMA 5KZCD 4MCZB 4JFDB 4ZS7H 4ZUSA 1WBXB 4AEIH 3P77B 2WBJC 3QQ4A 1LO3H 2VR9A 4M7KH 2FH8A 1LE9B 3CGTA 4OV5B 3BYTA 1OD7A 1OP3H 3HE7D 2R2CA 3QG6B 4M03A 5DRXB 2P5EB 1PKQE 1RVFH 3T77B 1SY6L 1CCZA 4QGYA 1A3LH 1FV1A 4HCRH 1E6JL 1QO3B 2GI7A 2NY7H 3UBXB 4CVZA 3EBAA 3VXTB 1SBSL 4KJYB 4NC0B 2DI7A 2ZUXA 4NYLB 2H26A 5IESL 5DMGC 1EERB 3O6LL 4H25B 4IRSD 4YHKL 4P4KD 1JF1B 4PJXE 3WJLC 3NZHH 3T1FB 2NXYC 3WFBL 4LCYB 4EI5B 1H3GA 1KCRL 1RIVL 5DR5H 4KI5E 1CXEA 4J3XA 3MV7E 1R3LA 3E3QC 4A6YA 3BOVA 2YD7A 4O00A 1GZPB 2IPUK 4ZPTB 5SV4A 4FQHB 4M62L 1A6WL 5B8CC 1NAML 4N8CL 5C0AE 3OR7A 4QRQB 2XZCL 4JPIA 1NC2B 3BZEB 2NY3D 2I60H 3ABZA 3NIFF 4PB0H 1VGKB 3BIAX 4KK5C 4ZYKB 1N59A 1Q0YH 3WHXB 1RUAH 1XF4B 3G6JA 1T4KB 3DO7B 1F58H 2C7UB 3RGVA 3F6IA 3FHQA 1PKOA 4HZLA 4WJ5A 2F5AH 4ZUTB 1CGUA 4Z78B 1T0MA 5LJYH 5DK3A 1CFVL 3PQYB 1I3GH 1T21B 1FG2B 3V5HB 3WNOA 2GITA 4P3DA 4HG4K 2JB6A 1V5JA 1TCMA 1NGQL 4Z9KB 4Y5XA 1G6RA 5DRNA 3FB7B 5T3ZL 5IHZA 3HG1E 3DUSA 2PW2B 3OAUH 5GRJL 3NN8A 2DIBA 5D2LA 4QO1A 2AV1B 1Q9KB 4JHZA 1IC4L 1S9XA 1ZSDB 3CDGA 2NR6C 4JLRA 3CFEA 4I2XE 3B9KD 1VSCA 4M6OH 3L7FB 3QFJA 3LN4A 1RZ7H 4Y8DC 4PTUB 2PYEB 3L3GB 3L5IA 1U3YA 7FABL 2D7QA 4J6RL 2FEDD 5IK3A 1TENA 4DKDC 3AGVA 5E1HB 3QDMB 2V7HB 3Q6FA 4Y7MA 4I5BB 4FTVE 1U3HB 2MCPL 4ETQA 4HQQH 2BVQB 4L8DB 3IETB 2H8PA 1M1SA 4JY5L 3LD8C 5J06A 4U1NA 2YWZA 3UEZA 4Q2ZB 1OF2A 1T7WA 4JHAL 5JMRA 3UO1H 2XZAH 3M17B 5JORB 3VXRD 4YXHH 4ZFZA 1A9EA 3OKEA 5CIPB 2W60B 4ZSOE 1BPVA 3ZKMD 3G5VA 3BDYH 1ZLSH 1QVOA 3DIFA 2Z31C 2GY5A 4RRPA 2EH7H 5JOFA 4PJCF 3D5OF 2HRLA 2IMMA 2R8SL 1ETZA 3H42H 3L3OB 4JKPL 1RUQL 5IQ9B 1FL5A 3QT2A 4BFBD 1I85C 3QYCA 1Y18B 2J2ZA 5HGHB 4UNTA 4Z7WA 3UTSA 3SE3C 2X4QA 2I5YH 4KRNA 2ADGA 5TE7L 1MF2H 4P46B 3VA2C 3IXTB 2FATL 2B1AL 1B6UA 1JFQL 5ETUB 1NFIA 1ZVYA 1KPUB 4XC1H 2H1PH 1QACA 4LRNL 5GGRB 4YE4L 4DZBA 2UY7A 3C9NA 5HY9B 3Q48A 2MHAA 1NCCH 4ODVL 1CLOH 5EU7E 2IPTH 4HS3A 2GSIA 4R90H 2FR4A 1FPTL 4RSVA 3MV8D 2EDJA 4HAFA 5BRZA 1MI5D 4GRLB 4HUVB 1QEWB 1FVEB 2VUOA 4OGXH 4AEHH 3RPKA 5GJTL 1KB5H 2BNQB 2ZUTA 1DFBL 4Z7VB 5T1LD 3MFFA 4F15B 3TYFB 4LSSL 1S7SA 3T0AA 3MJ9L 4N8VA 2AXHA 2YRPA 3WBDA 2ICEB 4U1JB 5GJSL 1P9MA 3RFZC 4YDKL 1JPGB 5F44A 2GJ6E 2NXZC 2VABA 1GGCL 2FWOB 4XCYA 1ZLUH 4YC2C 3CK0H 2X1PA 1NCAL 3TNMB 4NQDE 3WMSA 1G84A 5L8JB 3MRHB 2A73B 1DANT 1K4DA 3V4PH 5A2JH 4J3WA 4O9HL 1I1AD 4LIQH 4MAYB 4JGMA 2IPUG 4K3DH 1AI1L 3VXMB 4UUJA 1BQHG 4Y89A 4WU7B 4XZUA 4F7PA 3HRPA 4YDJA 5INDB 2JE8A 4AT6B 1AD9A 1JGLL 5I1CH 5HGGS 5ITFB 1S7RA 2Y5EA 2ENSA 1Q94B 5A2LH 3RGVC 3BQUA 3X3FL 1U41A 4H1LG 4OGYH 4RFEA 2W07A 3IFPA 4C57C 4OCSH 8FABB 1AO7B 1FYTE 1EGJH 4BZ1H 1PYWA 1QHOA 2WBJD 4M5ZL 2DLFH 4DUWA 5IFJB 3BE1L 3BWAB 3O3UN 4GMTH 4ZAKB 5JQHC 4TOYL 3L5HA 5I1KL 1ORQA 1I3RA 1KFAH 3AS1A 4Y5XC 3SGKC 4RAVA 5IVXB 2CLZB 4B7LA 5BJTB 4LVOB 1A4JA 4NZJA 3AREA 2AVGA 4LIQE 4MAUH 1NGWA 3TA3B 1FZKB 2HFFB 1R3JB 1MREH 4JKKA 1HH6B 1U3ZA 4JFXB 4HUMB 2HT3C 3RNKB 5DMGD 4YIQA 1DQQA 12E8L 1UM6H 2ILLA 4X7EC 4XNMA 2OP4H 4CKVX 1SJHB 4F2MA 5KW9H 3HFML 4QEGA 1N5YL 1JI1A 4JFFE 5FUCC 3CC5A 1EXUB 1U6AH 4GAGH 2GK0A 4M61B 4WI7A 3AFLA 4HULB 2HFEA 2GQHA 4OGAC 5EFIB 4YXKH 1ZVSB 1FN4B 1OSZA 2CUMA 1EBPA 3B3IA 2ARJQ 3MLVL 1QSFD 2X89A 2FO4B 2JELL 4U1MA 4C56B 5HVHB 4MDJA 2IQ9H 2F5BL 3SO3C 1X7QA 1PY4A 4IEFB 1G9MC 3CFBB 3KR3L 1NCDH 3O41A 3Q3GB 3MOAH 1MIMH 4ZUUA 4U1IB 3SDXF 4KK5D 3P2TA 1MVFA 3P0GB 1KN2H 2ED9A 4NRYA 5F7NC 4QNPE 2V9TA 1UFUA 4XVJL 4X5LA 5IT2L 4FQPA 1WZMA 3BI9X 3E6HA 4UMGA 4HPYH 3DX7A 3CLFL 3HTLX 2OQJA 5IVZA 1ZS8A 5E4EB 2PCPB 2YD6A 2W0FA 1G7JB 1NSNL 3MRBB 4KMQA 5EDXA 3F7VB 2E7LA 5HDQH 1EAJA 4FQXB 4D3CL 4E42A 5C0DB 5J9PA 1JUFA 4HT1L 2LE9A 3ARZA 5KSVB 1OSPH 4ODTL 4CN4A 1QFHA 2BDNH 2FSEB 3O45A 4TSBL 4NNYA 4I3RL 5HHXH 5GSVA 5KVFH 3CZJA 1ZOXA 5I1AA 3PHQA 3KPLB 2NR6D 2H3NA 2VDML 4LLMA 5TPWH 2AQ3A 2CKBA 5B39A 1V3KA 3H6JA 3RIFF 1EMTL 5HGBB 1XGTA 4QXUH 1S8DB 4HMEA 5IW6A 1A1NB 3H9SD 4EI6A 4NZUL 1MFDL 3L9RB 3RA7H 1RHFA 3MV01 3NVQA 1UWEH 5EZJB 1U8KA 5E9DE 3DX6A 4Z0BH 3JV6A 3AVEA 3V0WL 2BNRB 1P9MC 3X11A 4LCUB 2YUZA 1NLBH 3GJFK 4JG0L 1O7VA 5I15H 4R0LA 1W72B 4BSVB 1CZ8L 4O51A 3UTTE 2ZSWA 1P1ZB 4NKDA 1S7TB 4UT9L 2HVKB 1CT8A 2B5IB 4U3XA 1LHZA 4OCYH 2OMNA 2XG5A 2Z31D 1KT2A 2CLVA 1I9JH 2XZZA 1QFUL 1UH3A 3TVMA 1X4YA 1KBGL 1KLGB 3V7AE 3VH8B 2AJXL 4PGEB 3Q6GH 3B2UC 5KSUA 2OMBA 4C59B 5I8OH 4OZFG 1G9NC 1GXEA 4DK6A 5L88H 4JRYA 3LEVL 1T5XB 2FJFA 3JWDH 3GGWB 4H88H 4D9QE 5EO9A 1ADQA 1NEZG 4QWWC 1JIBA 2H32B 4M5YH 2I9LB 4LOUC 1QKZH 2F54E 3KNBA 4U7SA 2BERA 1IM9B 1G7MA 1MY5A 3IDXH 4XMPL 3FQRB 5TFSL 5KSBF 2W9EH 3D3VE 3RL1B 1OM3H 3JV4B 3G04B 2HFTA 4PLJC 5F9AC 1CQKA 1ZHKA 3N50A 2HMID 3FN0H 3HB3C 4MJIA 3E1F1 1I8IA 3V4VH 3GO1L 5DHVA 3I2CH 3HRZA 4HF5L 4LARH 5HHQA 2Z4QB 2IG2L 4JN2B 3PHSA 3FMGH 3PDOB 2H2SC 4LSRH 3QQ3A 4JY6A 4M8VA 1RQ5A 2WUBH 3VI3E 5MHSD 3PGFH 2NXZD 2GIYA 5IB3A 2F53D 1UYWL 3DNKA 3TWCL 2XZQL 4FXKB 3RX8A 3FOMB 2P45B 3IDUA 4PJEA 1IC7H 4Q9CA 3OX8A 5I16B 3ECBA 5F7KC 1Q38A 3FQNA 1XGQB 5C09E 5EU6B 2VISB 4YWGL 5TQ0L 5C08B 1YEDA 3V7MA 2NZ9C 1KV3A 1X5YA 4RWYL 3MBXH 2YD8A 2XIDA 4LLVA 5DT1H 3STLA 2UYLA 4XPTL 2X2YA 1S78C 4HWNA 3V6ZB 5DVKA 3ULUD 1DL7L 3PWJA 3BN3B 1DVFC 1T03L 4OZHA 3EOYG 3GK8H 4QGTA 4HS8H 1VGEH 5D72L 3T65B 3W2DL 2HG5B 3DTXA 4G6JL 2ZOKA 2R2HB 4H0GA 5FYLL 3SDYH 2R0LH 3IAPA 3QULB 4R2GB 4CNIA 5LQBL 3STZA 5A40E 2IBGA 4N9GB 4JN1L 4XXDB 1H0DB 4PUBH 4PJGE 4F33A 5CGMA 1QLEL 3IU3B 2VLRB 4V1DA 2XRAL 3THML 3V4UH 5ADPL 1KIQB 1Q9OB 5HPOA 3S96A 1RK0B 2YD5A 3GBNL 4JZJA 4OJFH 4EDWL 2Y6SC 4L29A 4NO3B 1VFUA 2HT3D 3GSRB 4WO4B 2B0SH 2X1QA 5T1MB 1L0YA 5EA0L 2F8VA 1MWAB 4I4WA 1ZGLP 2WLZA 5DRWB 4HC1L 3EO9H 1BD2A 1FGVL 5BV7C 1S5HB 3INUH 1YPZF 4TVPD 1Q1JH 1BBJA 1OB1B 4OGAD 2EYSA 2ZUSA 2FHCA 5CGTA 2YPVH 5C8JA 2AXFA 1AQKL 4M1GH 4QRRA 5KVEL 2ZP0T 3OJMB 4HKBB 1JTTA 2OR7A 1F6FB 4KRMB 3FFCB 4ELMB 1AXSA 1IZKA 1KJ2B 3SQBA 5GIRB 3LB6C 2OTPA 4R0LC 3JWOL 2OL3L 3GFUA 1AKJA 5F9JA 4KKCD 3DARA 4G7VH 1RZ8A 2CGRH 3DX9A 4EVNB 1NFDA 1HKLH 5GQBA 2G5BB 4FXGB 3C8KA 1XGPA 5BVPL 4JDZA 1BQHA 1TVDA 2VLJE 4E41E 3GMNA 1ZEAH 1UM4L 4X5WA 2J5LB 2Z8RA 1YY8A 5DJ2A 3ULSB 5C1MB 5IW1A 4MNGE 4XAWH 1VADB 4HH8A 1KJMA 4QHNA 1O0VA 3TLRA 3TVMC 4U6HA 1H3XA 2DWEB 4X6CE 3QXWA 3AB0C 3GNMH 4Y4HA 4QXGL 1YQVL 1RZIB 3VXUD 3ZL4L 3CJJA 3OZ9H 4MNHB 1BBDH 1F8TL 1BHGA 3VGAB 1J0YA 1M71B 1RJLB 1G7LB 5IBLC 4X7DC 1HCVA 3B9AA 1I9IH 3QWRD 4OLXL 1CR9L 5CEYA 3UTZB 3U30C 4ZODA 4JQXA 3SKMB 1SQ2N 4KRPB 4LLUB 1KCSH 5D2NA 2VIRB 1HEZA 1U92A 4BUHA 4BSWA 2DM4A 3MRPA 1I9RH 1HQ4A 1NMCB 3U4BL 3KYMB 3EO0B 3JXAA 5ACZA 3BZ4B 3MLUH 1DQDL 5CD3B 4ONGL 3O3AB 2IAMD 4JFYB 3UZVB 2FBOJ 4XHQA 2DICA 1NKOA 1N6QL 5BRZD 1X44A 5K9JH 1U58A 3O4OC 5JNYA 3KPMA 2HFGL 4WDIA 4OI7A 4WNQB 3RDTA 1MHEA 2X05A 1D5BA 3OKYA 5GRYA 3QHFH 4YHML 2XA8L 3BSZH 2G2RA 1HSBB 4MX7B 1HHHA 4GRMB 5ADOL 3QUMB 1FAIL 4OCWL 3LHPH 3WHE1 1ZT7B 1JMZA 3NCCB 5FO7A 2XA3A 3C5ZB 3A6OA 1LO3L 4M7KL 4TSAH 3QDJB 5EU4B 3OPZH 4LPWA 2QHRH 3H3PH 43CAA 3GB7A 1RVFL 2CIKB 3UC0L 4TUKH 1TIUA 1A3LL 3MRRA 4KKLC 2NY7L 1G7QA 4XCNB 3WDJA 4HJJH 3IFLH 2VQTA 1KCVH 3BWUC 3V6FB 4W4OA 3K74B 5HVFB 4RMVA 4JRXB 5DTFA 3L5XL 3CNKA 4LVNB 2FNBA 3RWHB 5E2UH 1IGCH 3BISA 3B2UD 1UA6L 3RBGA 3QSKB 1FFPB 5IMKA 5I76A 5HYSA 3KDMB 4TUJA 1FNGB 1DTUA 4W68A 5JPNB 1GSMA 1QBLH 2UY6A 3RL2A 2Y9RT 3BH8B 4RNRB 3L3DB 3MLZH 1EFXA 3HNTH 4L4VD 4X5XA 1N5AB 5EBMA 5B21A 3NIGF 1QRNB 1T1XA 4ODUB 4LOUD 1OAUL 3VD5A 3ZE2E 1HKFA 3QFDA 1TQBB 4J12A 1HZHL 2I60L 2EIZB 5CWSB 5TQ2L 2JJSA 4QT5B 4EN3B 3CFIC 2NY5C 1OTSC 3I9GH 2D7MA 4PB0L 1XF5B 3HB3D 4KGLA 3QDHA 3HLAA 4JZJC 1CD9B 4GLRI 5J56B 3BUTA 1XEDA 5KVGL 4R8WL 1J8KA 1F58L 4GW5A 4PJCA 5H35A 5D96C 2HVJA 2Q86A 3WE6A 2IANB 4QHKI 2VE6B 1D5XB 3CUPB 5GRXG 3GMLA 2RFXB 1LO4L 5EZIH 3JTTA 1S3KL 4OBRA 4HMDA 4C4KT 1MFAL 4KK6C 5K93A 1FZMB 1DLFH 2DQHH 1UJTA 5GZND 3NBNA 2AK1L 4Q9QL 4HLJA 2AJ3A 4FQLH 3VXQA 1YMMA 3EYVA 2L4OA 5FF6A 1XF2A 1D9KB 3OAUL 5H37G 1YNKL 2NZ9D 1JPSH 1OAKH 4UOJA 1B0WA 4PR5A 3MRQB 5EORL 1OARH 1DBAL 3QA3B 3ARFA 4JAMB 1JGUL 2HRPH 3RAJL 5I17B 2Z8WC 4M6OL 4U49A 1DVFD 3P3YA 3DVNA 5DEZA 1RZ7L 4LGPB 3VE0A 1CFTB 2VAAB 4XVTH 1QA9A 1H9VA 2R4RL 3CU7A 4K7PX 3LZFH 4Y4HC 1I4FA 1T0PB 4QF1A 3S5LG 3HPJB 2R0WH 3C09C 3N1MC 2V2TB 4JQXC 4OKVB 3FQTB 4N5UA 1NEZA 5FA4B 4NQUA 4LVHC 3DUUB 3V52L 1G9EA 4RMRA 1DN2A 4DZ8A 3MOBL 1EBAA 3KPNB 4YXHL 4LLDB 3CMGA 2CK0L 3DHJA 4J3OC 2Y6SD 4BUGA 4X9GA 1QBBA 5GS1A 5ELIA 1UCBL 1RJCA 2EH7L 3ZE0E 3C08L 3MLYL 3FCTA 3S3SA 4U6TA 5IF0A 1L6XA 4CBPA 3FFDA 3HAEH 5E99H 4M43H 4NFBA 3O3DB 5DVOA 4HUXB 4NQED 4FG6C 2VLKA 1J8HD 1A6VH 4AEFA 2EDWA 5HDBF 4I9WD 3QNXB 5ESVB 1J1PL 2ESVD 2H1PL 3NZ8B 1NKRA 4MA7H 1RU9H 3DROA 1IGYA 3IU4H 3OKNB 1QYGL 4GT7A 3EFFA 4L8BA 2AK4B 3ARXA 3IVKA 2QQKL 2VWEE 3TO4D 5B38G 4M6NL 4R90L 4PJAF 1EV2E 2EO9A 1VFAB 4KZDL 4X4ME 2P24A 4EIZC 1W0VA 5I2IA 4P23B 3KVQA 3IFNH 1DUYB 4OGXL 4ZPVB 4AEHL 3WS6C 1BAFL 2JCCF 4MJ5B 2AXGA 4QRSB 1LEGA 4OM1H 4W4OC 4P59L 4RQQB 1UCTA 2YRZA 3IXAA 1O5DT 5IBLD 4KJWD 1MHPH 5JHDD 4XPGH 1MCDA 1N6UA 3BW9B 1HHKB 2Y72A 1A47A 4LLQB 1ZHBB 4O2FB 4Y1AB 5FFLA 5A1AA 1QSFE 4P2CG 4ZXBD 5I75C 4JFHD 3DGCR 3CK0L 2OI9C 2EDLA 4XPHL 4AENA 1CD1A 2EDDA 3G08B 1NAMA 3FQUA 4RFOL 4IBLT 3RKDC 3SDXA 2JJSC 4M7LL 1QSZA 5FDWA 5L2JA 1NMAH 4MJ6B 4NKOA 3GSVB 5J1AA 2FX7L 4H26B 1FVDA 2DWDB 5I9QB 1LDPH 4QRPE 4R4BA 1NDGA 1J0HA 2OZ4H 2QADC 3DVIA 4Q0XL 1F6LL 1MCSA 1EPFA 1LO2H 2ZUQC 1A7QH 1EGJL 4WUUE 4P2QB 4PJXF 4X4YB 1R5VA 5IOPB 4OCLC 4M6ML 5LGJA 1FC2D 2ICES 4GMTL 1A7NH 2P5WA 4KI5F 1KFAL 3O6FC 2D03L 5DQ9B 4I77L 1K8IB 5SX5H 1IARB 3ZE1E 5IKCA 1NDMA 4KKLD 1XCTB 4PRPB 1OY3B 3GJFA 4MXWH 2E6PA 3FO1B 1WCBB 3GSQB 4NNPH 1MREL 4I1NB 5EN2A 5JW5A 2E7CA 4ZFFB 3KLAB 3O3BA 4S11A 3ARFC 5B22A 4BM7A 1UM6L 4S1SL 2VL4A 3B9VA 1WUNT 5GHWH 1R5IA 3B8YA 3QI9A 2FIKA 2EKJA 4KAQH 2HLAB 4L8CB 4M1DL 3T0EA 1FNLA 4HSQA 2EE6A 1P2CA 4YXKL 3SPVA 4HFUL 2XQBH 4ORGB 1MLBB 1MWAL 3ALPA 3DO3A 3N0PB 5FYJU 2IALB 1OP3K 1A7RL 4NCC2 3WNKA 3D39A 5IJVB 2ZPKL 4MA3B 1MCPH 1KULA 2WM0A 5BQ7A 4D0DA 4WUKL 1J87A 1MI5B 1NCDL 1RHHB 4F7TA 4I8DA 3D69A 3MOAL 5E56A 1G1CA 2AABH 1ZA6B 4OKDA 5FKPA 5AWNH 5TE4H 1BM3L 1KN2L 3H9HB 3VDAA 2IQAB 3OKKA 4NM8H 2HN7B 3NABL 3P9LB 3TBYB 1D6VH 5GS1C 3SO5A 3EO1A 5GSRB 4QXTA 1LP9B 4HPYL 2WBWB 5F7FA 3UAJC 1ZV5A 2R23B 4NKIL 4JJ5B 1URLA 2ED8A 5AZ2H 1SVZA 5FO9B 1FFOB 1TVBB 3NFNB 2BSSB 5SWSA 1E6OL 1DEDA 4H5SA 1AGBB 3PV6A 5L2KA 1T2XA 1G1YA 4X0KA 2ENYA 3W9EB 5EIVA 3UPAA 4XCEA 2E27L 4OGZA 3VD7A 1KG0A 5I1EL 2CQVA 3CSYA 5F1NB 3QO1A 2GAZA 4G8GA 4GXVH 3W0WA 4MNQA 3GIVB 3EGSA 5T1DL 4LSDA 3KPPB 5FA3B 5KSBA 2J3SA 1TZHB 1YYML 3MRGB 4UQ3B 3FQWB 3FTGA 5JMOC 2CIIB 5FUZL 5TPWL 1MLCA 3FHAA 3U0TA 4HWEL 2X4TB 5E8DL 4QXUL 4RAUA 3DMMC 3ULUH 2Y06L 2J88L 1HHGA 1YA5A 2VOTA 2FLRT 3VGGA 2HA1A 3TCLB 4WI9A 4ERSL 4U33A 2ZJSH 5KBNC 3WFHB 4NJ9H 1F4AA 4FFWC 5DD3H 4LLYB 5JPMA 2PETA 5IIEA 1NLBL 1T6VN 1KIRA 5GGTH 5MHSE 5I15L 5TDNA 3MACL 3BKJL 2F53E 3RWIA 4WW1B 5MEND 3MREA 1JI2A 4PP2A 4OFPA 1G6RH 3QIBD 5IBUG 1JHTB 1GOGA 4NZTH 1A2YB 3U36B 2ADFH 2B1HL 3VWKD 5IV2B 2X42A 1OGTB 2NXYB 4NZRL 4HGWA 3QIUD 3RWFA 3I85A 4PGBA 4FABL 1U2HA 4PJBE 4TNWK 2K1MA 3PJSB 1RK1B 4K3GA 2XWJB 1DBJH 2JF1A 3ULUE 2VR5A 4M1CD 1X5KA 4PRDA 3O2VL 4Y4FC 5L88L 4YDLB 5C9JA 1O7SA 4FG6D 3WHE0 1RFDL 5C3TA 1MCEA 3VMNA 5I71C 4TVPH 4OAWA 5FYJD 1HWGB 3K8KA 2E9WA 1FC1A 1CFQB 5LAXB 4KMTH 4BJLA 3OJ2C 4G5ZH 5D1ZC 5JUEH 5F93C 4M5YL 2K7PA 4DW2L 2IFGA 5J6GA 3MCKB 1P4LB 1N64H 4GAJL 4XPAH 4ZG1A 2GSGB 4KTYA 2FGZA 2DI9A 5C0BA 1LK2B 1X5GA 2ARWA 3CIQA 2IWGA 4GQ9H 2AJSH 4N90D 3HMWL 1VEMA 1DBKH 4YHNA 2Z92A 1HHJB 4UIKL 2LVEA 4GKZA 4OT1L 3KXFA 3V4VL 1HK6A 1PEWA 1CFNA 1W72H 4X7TB 4LARL 3QI9C 4U6YB 3S5LA 4Z5RB 1MRCH 5E2TL 1N7ML 1YPZA 4K3JL 2C3VB 4XBEH 5F8RC 4K3EL 1CL7H 5JIPA 4DQOL 4C54A 4F3FB 4TVPE 2L0DA 1EFXD 3VGDA 3C6LC 2DM7A 4I48B 5I8CA 1Y0LB 5F1IB 3UJJL 3KAAA 4K9EC 3QH3B 1IC7L 1BZQK 2XKNA 3W9DA 2PR4H 1WFNA 4PGJA 5F7HA 3OB0H 3CH1A 3FOLA 2JK5A 2PW1A 2RCSH 4N68A 5EOCL 1YEHH 2X1XR 1HXMA 4GUPA 1F45A 3RKDD 4X9HA 1A02N 1A5FL 4NN6C 4UIMA 4K94C 4LF3A 4RMUA 1G7IB 4G43B 5BW7A 5DT1L 1MQKL 3LKRA 2R29L 3H9SB 5EBWA 4MHHG 2APWA 5CP7A 2EDHA 2WUCL 2AW2A 5F21B 1AD0A 2BC4B 5K9OA 2QADD 4DCQA 3MX0A 3SDDA 3SE4A 3O8XB 3LD8B 4JB9H 4ZFGH 3VXUE 1SBBA 4ZOAA 3OKMB 1BZ9B 4H8WC 2QQLL 2EH8L 4Z7UA 5ACLA 2C1PA 3VW3H 4Z7WE 4B0MM 3OHXA 2C3GA 3HZYA 4ZO7A 4RIRA 3O6FD 5HI5C 2P49B 4PUBL 4UILH 2PTTA 3KHQA 4WVRA 1H3UA 4C58B 4OZ4B 1XGRA 2IADB 1MOEA 5AD0B 3QDGA 1V05A 1RURL 1MFBL 2VXTH 5B38A 3EDDA 4ODSL 4D8PA 4YGAB 5EUOF 3FN9A 3IS0X 4OF3A 2YSSB 3DXAB 1CDIA 5C0RL 2J8UB 2BSRA 4P5TD 1F90L 4PLKC 4XHJC 4G7YH 4Z95L 1XIWA 2FJHA 5AUMB 5E8OA 2EIBA 3M1BA 1YN7A 1TJIH 4ZUSB 3INUL 3QQ4B 3PP4L 5D5ME 1G9NH 4RX4D 1JF6A 2AQ1A 2NNAA 1FV1B 1GCFA 3TM6A 5CJOH 4CVZB 4CU6A 5F3BA 2CGRL 4TVSa 2H26B 4KJPC 4Y19B 1DBBH 2GTZA 3GIZL 1I7RA 3HZVA 4KROC 5LGHH 4HDIA 3DX8A 2X1OA 1W8OA 1RSFA 3WFCL 5CMAA 3O2DH 4HX1A 3UAJD 4JFEA 3GNML 1RZKC 2NXZB 1R3LB 3OZ9L 4A6YB 3IJSA 1ROWA 4YUEL 5GS0D 1FGNH 2ITDA 4ELKA 1I9IL 1LEIA 5F72S 1KACB 1EHNA 2GHWB 3OR7B 2AGJH 4XNYH 2EKSA 4LMQE 2NY6D 4JPIB 5LGKA 1WIOA 1KCSL 4WV1A 1XAUA 4KUCF 2X70A 2YMXL 4G3YL 4L4VE 3EYUH 1K4CA 1P4BH 5C07A 3RVWC 2R2BB 4XPFL 4YX2H 1N59B 4HIEB 3EYFA 3HUJA 3MRFA 3G6JB 3JBG7 4ODHL 3DV4A 1RAMA 2YK1H 3G9AB 3RGVB 2OLDA 3C60B 2CXKA 4HZLB 4X4XB 4YPJA 1NCWH 2E6QA 3UZEA 4CVXA 2VQUA 2EC9T 1T0MB 5K9JL 2Y5TA 5C2BL 4DJMA 4PJIB 4X98A 5I1HH 1CICB 3BP5A 1PZ5A 4LSUH 3DMMD 4XP4L 3JSSA 5E6ZA 3TN0C 4NRXA 4PJHA 5JR1L 2GITB 5TGBB 1JNNL 5I0ZA 3BSZL 4POZD 1I7TA 3I6KB 1A7OH 3MRIA 3D0VA 4Y5XB 4HKXA 5D7IE 2W65A 1Z3GL 1C5BH 3LHPL 4FFWD 4PD4J 5EC2A 5ESAB 3RY5A 1A7BA 5DRNB 4GKSB 1IC5L 2DL9A 5IHZB 4KTEH 1YN6A 3DUSB 4PJFF 4BZ2L 4TSAL 2DL2A 3NN8B 4JQIL 1NUDA 4EOWH 5D2LB 3H3PL 2GTWA 4IMKA 4TQEH 1S9XB 1T04A 1WEJH 3MOQA 3CDGB 4JLRB 3CFEB 4KUZH 3MV9A 2KUTA 4HBCL 4M6AA 2NLJA 3QFJB 4O2CA 4B41A 1T20A 3LN4B 4Y16C 2VDLH 3WNNA 4WEUD 5BW7C 1AJ7L 4K07A 1G7PB 2PXYC 5BVJA 3MA9L 1KCVL 2MQCA 5IK3B 3F7QA 4OQTL 5E2UL 4PJ8A 5D7SL 1J0JA 1DR9A 1UACH 3Q6FB 4Y4FD 4ETQB 1MH5A 3GBMH 3REVA 5BV7H 3SO3B 3LQAH 1FRGH 3SE4C 4ZTOL 3MLZL 1J5OL 3CLEL 5T5NF 1OHQA 1IKFH 4U1NB 3HNTL 1OF2B 1HIMH 4X6DA 4YQXL 4JO4L 2PNDA 4OLWH 1GC1C 5DD5H 1A9EB 4KDTC 5D1ZD 3VI3F 1U8MB 2NY4B 3G5VB 1NL0L 4J3UA 4JCMA 5D6CB 1P7QB 3LKNB 3GRWA 3OR6A 2ATKA 2VC2L 1KNOB 3VFGH 3VJ6A 4HPOL 1BVKA 5C0IA 4BSJA 2KQMA 3QEUA 5JOFB 4NGHH 4XNZB 4P9HH 1T2QH 1TZIB 3SQOL 1ETZB 3RUGF 4LSTH 1PD6A 4QRTA 3ARUA 4MJ2A 2EYRA 5CZKA 2KBGA 2D31A 3UTSB 3QQ9C 1UZ6F 5HYJD 3QJHB 2ADGB 5DJAA 3T2QA 1SMAA 3QI9D 3O6MH 4KHXL 1XIWC 4W6YB 4MB3A 4NQCD 1FLRH 5EZIL 4U1SA 3C6LD 3GSNH 1EO7A 3AC0A 2IBZY 3C9NB 3IJHA 4DZBB 1TLKA 2X09A 4NQEE 1J8HE 4GAFB 3PWLA 4HS3B 3HR5A 3QG7H 2GSIB 3MCLL 4I9WE 1C12A 3D39D 3VFRA 2FR4B 4NFCA 1MY7A 2Z0BA 2ESVE 5BRZB 4PJGF 2X4OA 1OAKL 4XC3L 1HH9A 3A6BH 4PJAA 2YC1A 3RJDA 1WITA 2NY1B 3BIKA 2HRPL 1KJVA 2VITB 4N8VB 4KK9C 4P57A 1RZGB 1JWMB 2W38A 2JCCA 3NFPA 1U95A 5CCKL 4F58H 4MQXC 4TTDC 5D7LE 3LZFL 5IB1A 3QXTA 1M05A 1J1OL 2VABB 4JO1L 2FO1A 4Y8AA 4OZGF 2I27N 5I1JH 1FO0H 1MIEL 4BH7B 3OJVC 5JHDE 1ND0A 1C5CL 5HI5D 5I73C 1C1EL 1PBYA 1DN0A 1K4DB 4G9FB 3VD3A 4QHUA 4XX1G 1U93A 1TXKA 3W5NA 2BVPB 4UUJB 4JFHE 5I6XB 4MNQD 4F7PB 4XZUB 4F7EA 1ZVHA 2OXGA 1AD9B 4OCNC 1LK3L 4KDVA 5IM7A 1PKQA 4PRBA 1S7RB 2BVEA 3C8HA 1U8LA 1U8JA 3BQUB 3B4NA 4RFEB 5MERA 4JO2H 1UKSA 3B5GA 2F19H 3ILQC 4PLKD 3IFPB 3QHTC 1TJGH 4WWKB 5EZOH 1FDLH 1PYWB 1TTGA 2YPKA 3GSUA 2Y25A 3UYRL 1PG7L 4M43L 3WUWA 3NCMA 2ATPA 3OKOB 3WL9A 3ET9F 4X6CF 4PJXA 3NCJH 3UROR 1Q72L 5DJXA 5DJ0A 1WC7A 4NIKB 3IKCA 3AM8C 4LPXA 4RAVB 3PIQA 2R0ZH 4PB9H 1IRAY 3MZTA 3GMOA 2H2PC 3S35L 4CJ1A 2JJVA 3AREB 1RU9L 3MV7A 2ITCA 1YJDH 2HKHH 3WFEH 2P8PA 3IU4L 4IMKC 4K8RC 4KJPD 3X13A 4YIQB 1DQQB 4XNMB 4F2MB 1INDH 4LCCA 4ODXA 4FQ1H 4KROD 2WINA 4HCRA 3LPWA 5D8JL 2GK0B 2HFEB 4XMKL 3R1GH 5DJDA 1OSZB 3B3IB 3PABA 2DKUA 3PGCA 4YDIH 4C4KO 2Z91A 4U1MB 3NPSC 1MHPL 2DQTL 4KH2A 5KVMC 5ALBH 3RRQA 4C83A 4S0TD 5JXAH 1RD6A 3V7AG 1X7QB 1NFKA 4OBSA 4GG6E 1XH3A 1INEH 1S7VB 1V3LA 3O2WH 3ES6A 4NJAL 1HHIA 2WWKT 4ZUUB 5FGSA 3VFPB 3QCUL 3RVWD 1AC6A 1WJ3A 1X5XA 3TIEA 1A14L 3MODH 5F7MC 5KSAA 3U2SA 1REIA 4NRYB 5CILL 5DA4A 1DLHA 1JHLL 3LRSA 3TIDA 3HG1A 5C0BD 3E6HB 1CK0H 1R3IL 1NMAL 4X6BA 2OQJB 5IVZB 1ZS8B 4IDJL 2QSQA 1CGTA 4LLAA 4NDMA 4QCIA 5D7JB 2BRRH 4HJ0C 3KXFD 2P46B 3TN0D 1CFBA 3C5JA 2W0FB 5IG7A 3KPRA 5GISH 1IGML 5CSGA 3IDYB 4I2XA 1V7NL 5FGCB 2OZ4L 1MRFL 3VCLB 4I3SL 1VDGA 1T1YA 4H1LH 4E42B 3GKZA 5DK2A 4U3HA 4YEEA 3ZKSD 5H2BA 5J9PB 1JUFB 1WAAE 4WI3A 5T5NG 3FRPA 4TPRH 3O45B 2YD2A 4NNYB 1VHPA 5GSVB 1DUZA 5I1AB 4FTVA 3PHQB 2W59A 4ZNEE 2H3NB 4LLMB 3IDJB 2CKBB 1XT5A 5B39B 1U8QA 3CVHH 5D1XA 3ZE2F 2BHUA 4Y16D 4O2EA 4NNPL 1XGTB 1MCQA 2PXYD 5IW6B 3O4LE 5JQ6L 3IDGB 4PJ7F 4ZSOA 3ARPA 4EI6B 4N9OB 2ICCA 3EAKA 2LTQC 5E2VH 3KYKH 1IQDA 4LSPH 3U6RB 1U8KB 3DX6B 3JV6B 4JQVA 1IAIM 1NANH 3LMJH 3X11B 1JZ6A 1KELL 3W82A 2XWBA 2AK4E 1FE8L 4R0LB 4F9LA 1CE1H 3OV6A 4O51B 3WNMA 2ZSWB 2C9AA 5T3XH 2OK0H 1OQXA 2WMPA 2DTMH 3F5WA 3T0BA 4S1QH 5FYJH 1MCPL 3V9FA 1KT2B 1T3FB 2CLVB 2C4XA 1DSFH 1MNUH 3TVMB 5AG8A 5MENE 4KWUA 4ZTPH 2WSKA 3GM0A 3AB0B 5CZVL 4EDXA 5C6PB 3E8UH 2ZSVB 4NM8L 4UOW1 5KSUB 4GMSH 5CLTA 4LU5H 3QQ9D 3V5DA 5JXEA 1RUKH 4JRYB 2FJFB 4DGYL 4NP4H 1XIWD 1YC8A 4HW6A 2OSLA 3TNNA 5AZ2L 4MMZC 4NHUA 1AC0A 5T3XE 2X4SA 1KPVB 4PY7B 3TBTB 3WN5C 4B50A 1GOHA 1ZLVH 4RMSA 1G7MB 1WF5A <