1JHCA

Lexa s119a c-terminal tryptic fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
130
Chain Sequence
GLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMAMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LEXA REPRESSOR
total genus 25
structure length 130
sequence length 130
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jhcA00
2HNFA 2FKDA 1I4VA 4K8WA 1T7DA 1KN9A 3IIQA 3S04A 1AY9A 3K2ZA 1UMUA 2FJRA 4N31A 3JSOA 1JHHA 1KCAA 4ME8A 1JHFA 1B12A 1JHEA 2HO0A 1JHCA 3JSPA 1F39A 4NV4A 3BDNA
chains in the Genus database with same CATH superfamily
2HNFA 2FKDA 1I4VA 4K8WA 1T7DA 1KN9A 3IIQA 3S04A 1AY9A 3K2ZA 1UMUA 2FJRA 4N31A 3JSOA 1JHHA 1KCAA 4ME8A 1JHFA 1B12A 1JHEA 2HO0A 1JHCA 3JSPA 1F39A 4NV4A 3BDNA
chains in the Genus database with same CATH topology
2HNFA 2FKDA 1I4VA 4K8WA 1T7DA 1KN9A 3IIQA 3S04A 1AY9A 3K2ZA 1UMUA 2FJRA 4N31A 3JSOA 1JHHA 1KCAA 4ME8A 1JHFA 1B12A 1JHEA 2HO0A 1JHCA 3JSPA 1F39A 4NV4A 3BDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNF A;  2FKD A;  1I4V A;  4K8W A;  1T7D A;  1KN9 A;  3IIQ A;  3S04 A;  1AY9 A;  3K2Z A;  1UMU A;  2FJR A;  4N31 A;  3JSO A;  1JHH A;  1KCA A;  4ME8 A;  1JHF A;  1B12 A;  1JHE A;  2HO0 A;  1JHC A;  3JSP A;  1F39 A;  4NV4 A;  3BDN A; 
#chains in the Genus database with same CATH topology
 2HNF A;  2FKD A;  1I4V A;  4K8W A;  1T7D A;  1KN9 A;  3IIQ A;  3S04 A;  1AY9 A;  3K2Z A;  1UMU A;  2FJR A;  4N31 A;  3JSO A;  1JHH A;  1KCA A;  4ME8 A;  1JHF A;  1B12 A;  1JHE A;  2HO0 A;  1JHC A;  3JSP A;  1F39 A;  4NV4 A;  3BDN A; 
#chains in the Genus database with same CATH homology
 2HNF A;  2FKD A;  1I4V A;  4K8W A;  1T7D A;  1KN9 A;  3IIQ A;  3S04 A;  1AY9 A;  3K2Z A;  1UMU A;  2FJR A;  4N31 A;  3JSO A;  1JHH A;  1KCA A;  4ME8 A;  1JHF A;  1B12 A;  1JHE A;  2HO0 A;  1JHC A;  3JSP A;  1F39 A;  4NV4 A;  3BDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...