1JHEA

Lexa l89p q92w e152a k156a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
GLPLVGRVAAGEPLPAQWHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDAVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LEXA REPRESSOR
total genus 29
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jheA00
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH superfamily
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH topology
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
#chains in the Genus database with same CATH topology
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
#chains in the Genus database with same CATH homology
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...