1JHFA

Lexa g85d mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAADEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LEXA REPRESSOR
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jhfA02
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jhfA01
1P92A 1YQAA 3KP3A 5ED4A 4MTEA 4JBAA 2W57A 4GGGA 3ZMTA 3WG9A 1FP2A 2VBYA 3G3ZA 4ESJA 3PQJA 3KE2A 1R1UA 3KZYA 2M87A 1FP1D 3F8BA 1G3WA 4GXOA 5DUKA 3ULQB 3QPHA 1MJAA 2HTSA 2HQRA 1XGMA 4UHTA 1T0FA 2RQPA 1BI2A 3ZN0A 2PI0A 4MEXF 1ZGAA 2KRFA 4XLPF 2XAJA 3V8LA 4OOIA 2FE3A 5ICGA 4OIQF 1V4RA 1J2XA 2NAZA 1ZLJA 1U2WA 2OAZA 1Z91A 3WU0A 3G73A 1RI7A 1R1TA 2OZ6A 4L0ZB 4RGUA 3M9AA 3K69A 5L3EA 3DP7A 5FLXZ 3COAC 2NNYA 2YPRA 1ZREA 2OQRA 3R0JA 1U5TA 5LHIA 1W7PD 1SMTA 2XV4S 4S04A 2HYFA 5D6EA 1FBSA 1R23A 3F8NA 3L00A 3WTUC 1DP7P 4R79A 5D4SA 3D5LA 1P2FA 4OU0A 3HOSA 4M73A 1LEAA 4M71A 4BNCA 2OU2A 3PQKA 5L3BA 3WGIA 4XLNF 3AAFA 5DCMB 1UHMA 5F6FA 4ETSA 4N9HA 4KN7X 4UVCA 3M8EA 2LDUA 4EM2A 1K6OA 3F8MA 1J9IA 4RB1A 2FMYA 4BYYA 4Q4ZF 2O03A 2A3SA 3DEUA 4Q5SF 4FX4A 1O3SA 3F6VA 4N31A 2J5OA 2P7CB 1OYYA 3T8TA 4N9IA 4IJAA 6PAXA 3P9CA 1SFUA 1IN7A 3V7RA 4KMUX 1ZRDA 1S6LA 2DPUA 1HW2A 2F5FA 2M5WA 5FFZA 5HS7A 3W6KB 5LLQA 1JHEA 3Q9VA 1U5TB 1ZGJA 2G7HA 2VBWA 3J81Z 2TDXA 2HO0A 2DK5A 1F5TA 3WTZA 4BAYA 2DK8A 1XMKA 4CO8A 2O0YA 5BPIA 3S04A 1HBXG 2JPBA 1HSTA 3DF8A 1S7AA 3VEPA 2HWVA 3K0LA 1T7DA 3V7SA 2QENA 5CVIA 2XGXA 3GVAA 3LA7A 3HHHA 5ILSA 3HRMA 2VT3A 3SHFA 3TQNA 4RGRA 3RKWA 3JAMK 4U88A 4HOBA 2VOOA 3I5UA 4NV4A 1TNTA 3ISPA 5E1XA 4YFNF 1W5SA 3KP5A 3H3UA 4IHSA 2CG4A 1CF7A 3HIFA 1WI9A 2V6CA 3DV8A 2XIGA 1KU9A 5E8GA 5A2QZ 1F39A 4FHTA 2F5EA 1R7JA 4S05A 5E1WA 3H92A 2JPCA 2M30A 5FD5A 2O61A 3HOTA 4M9SA 3MCZA 1R58A 2XROA 5FFXA 3MAJA 5J6XA 2L3DA 5AONA 4OIOF 5LGUA 1B9MA 3CUOA 3L7WA 4RB3C 2QWWA 1JE8A 1HQCA 2D1HA 1IW7F 2L4MA 1YFHA 1T6SA 5HDKA 4G94A 1REPC 1QQIA 2BYVE 4AVPA 5CLSA 2H6CA 2Q2EA 1FYKA 3E6CC 1J75A 5LGTA 1TNSA 4JQFA 4B8XA 5AIQA 3BP8A 4MTDA 4L5JA 4YFKF 1K79A 1TQIA 3FZVA 3BPXA 4LLGF 2GXBA 5IT9K 3C3WA 5FLXK 1IXRC 3ELKA 2HR3A 2FQ3A 2QUFA 3IKVA 1SFEA 2VE9A 2Z3YA 1AOYA 4HX4A 1V3FA 4IXAA 3ECHA 3SFZA 2KJBA 5F1RA 4EJOA 1S7OA 1LNWA 1IXCA 2XAGA 1GVJA 4HW0A 1MZBA 1XGOA 3B73A 1C0WA 3FX3A 5DCMA 5F64A 3I53A 1LQ1A 4RGXA 4AIKA 4P5OA 4AD9A 1T39A 4LD5A 2Y75A 1HW5A 1ZAOA 3HSEA 2MBFA 4KT5C 1MDMB 2GIVA 4ENJA 3U2RA 4YFXF 4KDPA 2MH2A 2V1XA 2FU4A 2YU3A 5L3DA 3LA3A 4XSXF 2P5VA 3DPTA 1JXSA 3SZPA 4QWQA 3V4GA 4IRIA 2AXLA 3FMSA 2GWRA 3FXUA 5CYVA 3F72A 4U0WA 2XASA 1U5TC 1UFMA 2G9WA 3E5QA 2HGCA 1HKQA 2LF8A 1LDDA 2HQNA 3WTWC 3WTTC 1Z9CA 2XAQA 2FBHA 5KK1A 3GF2A 1XB4A 1BI0A 1L3LA 1XGNA 2CWEA 4HLXA 3DPLC 4U7BA 3CO6C 3BOQA 3RKXA 4LGWA 1X3UA 3WTVC 1YW8A 3MWMA 5HS8A 3E5XA 3QU3A 3MZYA 2FEZA 1Z1DA 3JTHA 1XSVA 2P5LC 2OBPA 3KLNA 4BHCA 3QOPA 3I59A 1RUOA 1OMIA 3J81K 4IVNA 1TTYA 1I27A 3R6SA 2LSOA 1Z7UA 1J59A 4HF1A 1UB9A 2GQQA 4L9JA 4MEYF 2MC3A 3KCCA 3ZMZA 3K1NA 4RB0A 4CHUA 1ON2A 2J5PA 4HQEA 3L09A 2O6GE 4E70A 1BM9A 2CYYA 1I1SA 3GEZA 4Q48A 2W24A 3HRTA 2DW4A 3N4MA 3HSFA 1ODDA 1JGSA 5E20A 3TDUC 2CFXA 3NRVA 3L2CA 1T98A 1ON1A 5IT3A 2WC2A 4HA8A 2ISYA 1LVAA 5BOXA 2OD5A 1J5YA 1W5TA 4XRFA 1IN8A 4UXNA 1R5HA 3IKTA 4O5VA 1EH7A 4HV5A 2VONA 3ZPLA 3I59B 3KETA 1KYWA 1R22A 4YIFA 5JHUA 1Q1HA 3GFMA 3I58A 1DPRA 4DNCA 1G4DA 3I71A 2K4JA 3CO7C 2DLLA 3H3ZA 5D8LB 4H0EA 5CVUA 3K1PA 5D5UB 3P9IA 4HZFA 1G3TA 4LG0A 4WX9A 5JI6A 3VOEA 1RUNA 4ZH4F 2EFOA 1SD5A 2BGCA 1U78A 2STWA 3LSTA 2H94A 2IA0A 5JFRA 2F2EA 2QQ9A 4AIJA 5IT9Z 1DPUA 4RAZA 4KMFA 3JAMZ 1F1ZA 1BIAA 1B4AA 3RDIA 3DXJF 5LHHA 2PLYA 1ZG5A 1O7FA 1T38A 5DEQA 1P4WA 4A2UA 5DCFA 3RPQA 1FT9A 4BH9A 3L9FA 2ELHA 1IUYA 3I4PA 4ENMA 5H20A 4CGZA 3CDHA 1YYVA 1GXPA 3HTUA 4BXUA 2UXNA 2EFNA 4KNYA 3J7AO 5D8KB 3T0YA 3F6OA 3JTGA 4M6YA 2R7FA 1TW2A 1I6XA 5CVJA 3RYRA 3ZMDA 2QBYA 2FBKA 2PG4A 4HLYA 1B59A 2Z33A 1FZPB 2LF7A 2V1DA 3WGGA 2IT0A 1BBYA 4G7ZF 2FXAA 1WQ2A 3TKYA 4CXFA 1ZH5A 3GWZA 3IRQA 3KZZA 4BHBA 4EV0A 3HRUA 2A6EF 1Z6RA 1YG2A 3IWFA 2Q0OA 1QNTA 3EUHA 4NQWA 3ZMUA 3F3XA 2WV0A 3CUQC 2BBYA 4G8XA 4ZYHA 3V8KA 2DAOA 4MGRA 1FYMA 3MQ0A 3Q9SA 1S29A 1HXDA 2ZMEA 1FOKA 3I54A 5D5VB 4UNOA 1F9NA 3IRRA 3BJ6A 3D0SA 4EJUA 2VBZA 4A0ZA 3FMQA 3SZTA 4MQ9F 4I7HA 3RJPA 2IA1A 3C1DA 3DFGA 3WTYC 5D4RA 5D6FA 1SFXA 4KIFA 3VODA 1R00A 3P9KA 4G7HF 1U6GA 3MZHA 3PFIA 4PGHA 1IN6A 5LRSA 1OYIA 4EQQA 4EGYA 4XBFA 2NRAC 3RTRA 3TO7A 2UXXA 4IHTA 1W7PB 1L0OC 3ECOA 3KP2A 3FM3A 4ZZLA 3FXRA 4G9YA 3RKYA 3FF5A 2RVCA 4KFCA 4ME8A 3REOA 2PMUA 3F8FA 3GUDA 1ZYRF 1XMAA 1QPMA 4PGGA 1KU2A 3DKWA 3WE2A 4CZZA 2EWNA 2PMHA 4A6DA 1DDNA 4F7ZA 2MH9A 3GZ6A 3R61A 2JRTA 3QRFF 1ONVA 4HF2A 4M9ZA 1AWCA 1LB2A 3J80K 3TOBA 4CYDA 1WRJA 4M72A 5TJJA 2YR2A 1USTA 3FXQA 1K78A 3O3KA 4HV6A 1FBUA 4BQAA 2VN2A 2ESNA 2XKPA 1XCVA 3QPTA 2IJLA 3EYYA 3U9GA 2LNBA 3GZ5A 2ZKZA 3BDDA 3GFLA 2EA2A 2GA1A 1B9NA 1OR7A 2DI3A 2DQLA 2ZNYA 2QLZA 1G6NA 2ISZA 3S2WA 4WWCA 3LWFA 5K1YA 1FC3A 5FO5A 1B6AA 3B02A 1HKSA 1S3JA 3CTAA 1SMYF 5A2QK 4LLNA 2YX7A 4XSZF 2NYXA 3CUQA 2L54A 2O8XA 1JHFA 4PDKA 4A0XA 1CF7B 5DDGA 4EJWA 1D3YA 4U7DA 5KVRA 2FKDA 1E17A 1SD7A 2D1VA 2HNFA 1RIOH 4EM1A 1BIBA 1IN5A 3KLOA 1P4AA 1BOAA 1S8NA 4GYIA 1RZ4A 4IPAA 4DQ2A 5BQTA 2RKHA 2DQRA 4LMYA 1QZZA 5HOOA 3TGNA 4BHPA 3DQVC 1FSHA 1KQ8A 5LGNA 1FBQA 1KYZA 1ZG1A 2L01A 2KJCA 3F8CA 1E2XA 2RDPA 1NHAA 5JVTA 3EQLF 4WCGA 4I09A 1PDNC 4B09A 5LEKA 3E6BA 2FBIA 2P7VB 4UVAA 3K2ZA 1BC7C 2HKOA 3E5UA 1JHHA 3RI4A 3N97A 1LDKB 1XSDA 2CW0F 5J8CA 3TDZC 3ZP5A 2Y0MA 4JK1X 4KYWA 2VC1A 2GXGA 2RNJA 4KICA 5K5OA 1MDMA 1F4KA 3BWGA 5DD8A 4OMYA 2QBYB 4HBLA 5L3CA 3WTXC 5ILUA 4HX8A 3RIRA 4LLLA 2AS5F 3T5XA 2E1NA 4FT8A 3V7CA 4I02A 3WODF 3W6JB 1ZG3A 5H6RA 4M6XA 3C7JA 2DU9A 2D2WA 5HLHA 3IIQA 1XCBA 5ERIA 4IF4A 1SD6A 1LDJA 1ZLKA 2Q8KA 3BZ6A 2HKXA 3QP6A 4IRHA 5EEGA 3R60A 3P7NA 2GZWA 1XD7A 2DTRA 5J8FA 4O3MA 1K78B 2P6SA 3WE3A 2VBXA 1MGTA 2EK5A 1YS6A 5L3GA 3GFIA 3FMRA 1D8JA 2QYOA 1H9TA 2XKOA 2PQ8A 3HRSA 2ZJ2A 2A68F 1YLFA 3RYPA 5HLGA 3Q5FA 2IW5A 2ZMEB 2EB7A 1EV7A 4R1HA 3VB2A 2V9VA 3KFWX 1ZRFA 1SAXA 5HLIA 4L9NA 3SQNA 1HW1A 1TBXA 2PFBA 3M1EA 4M9XA 2XAFA 1W7PA 1GXQA 1FSEA 3GW2A 2H6BA 3QP5A 2W85A 5LRRA 2FOKA 3I0TA 2FNPA 1STZA 3ABUA 2DFIA 1KQ9A 3F22A 3HSRA 2W25A 4EMSA 1D8KA 4I01A 2FJRA 2EFPA 3QU6A 2HS5A 2UZKA 3ZMSA 3TO9A 2VE8A 4M74A 4IRGA 2ACJA 5LEJA 2ETHA 3CJNA 4I2OA 4A0YA 2K4BA 5LHGA 2C6YA 4L9TA 2E7WA 4ENKA 1R5GA 1ULYA 3HHGA 1W4MA 3WGHA 2QVOA 1H9GA 3IC7A 1ZHFA 1DUXC 4QLCU 3M7GA 4EM0B 2K27A 1JHCA 1BI1A 2B0LA 4TV7A 4MHGA 1TQMA 2P8TA 3OOPA 4GCVA 1OKRA 1PP7U 1KN9A 4LB5A 2O3FA 2YSRA 1BJAA 4G6DA 4ZYGA 3CUQB 1FYLA 1I1GA 5ICEA 3GXOA 2HYGD 1TQPA 2F5DA 4I98B 2ZO4A 4LG0B 3E6DA 1PUEE 2CO5A 4MQVA 2EFWA 2KIMA 5HS9A 1LJ9A 1ZN2A 3O2PE 1QGPA 2EV0A 4HAMA 2A6HF 5CVVA 1T2KA 1KGSA 2EFQA 1MJBA 1Z05A 2WWYA 3ZQ7A 1UCRA 5DV5A 2GAUA 4RAYA 5E17F 1IZ1A 1HSJA 3BJAA 5ILVA 5DUIA 3KEQA 3MFKA 2QM3A 4P55A 1I4VA 5H6QA 4OIPF 4K2EA 2K86A 2EJRA 3EETA 5HDGA 4YG2F 1P4XA 4OINF 1BN5A 1HKTA 1KU7A 4L9VA 2UWMA 3ERED 2DO7A 4A5NA 3BDNA 1WKMA 4WXHA 4LK0F 4LJZF 4L5IA 2Z5UA 2D45A 4ENNA 1FLIA 1YIOA 3E3VA 1YO5C 2K7LA 2HFHA 3HTSB 4LK1F 2RC4A 1MKMA 2LKPA 1IAWA 2W84A 4P9UA 4GO1A 3OV8A 1LEBA 3M8FA 5ICCA 1IN4A 1O3TA 1KU3A 1YS7A 4A6EA 2ESHA 2H09A 2EV6A 3IHUA 1QZYA 2P6TA 2HTJA 5FD6A 2BEOA 1O3QA 3JW4A 2RN7A 2OZUA 3F21A 4U0VA 2YX4A 3LQRA 3R0AA 1UHWA 1O7LA 1IRGA 1O3RA 2A5YB 2K02A 3NEUA 4HDVA 4HX7A 4WXCA 5HDNA 3BJOA 5CJ9A 3WTSC 2RV8A 1RNLA 1CGPA 4A12A 2KIFA 3ML6A 5E1ZB 2KKOA 3K9TA 3T8RA 4GYGA 2ZBKA 4D0PA 4UV9A 2Z9OA 1EH8A 4ZYEA 5BMZA 2V79A 4EVIA 5BPDA 4ZYDA 4WK8F 2M8EA 4PCQA 2PN6A 3FWEA 3GX4X 1YW9A 3BY6A 3FHZA 4Q47A 2P5KA 1XN7A 5DD4A 2PEXA 1D5VA 2HZTA 2CGPA 5FB2A 3U1DA 2M45A 1PP8F 1MJ9A 1YTYA 1XGSA 2PJPA 4UVBA 3ROUA 4CICA 1I5ZA 5LBQA 4P96A 2WTEA 4WF2A 5BS6A 2R7DA 2PBIA 1ZARA 1GHCA 4ESFA 4N0BA 5L3FA 2ZNZA 3EDPA 2VC0A 2Y48A 5TRDA 4KA4A 3NQOA 1H0MA 3QAHA 5DYMA 1XDSA 1A04A 1YW7A 2BE5F 2M1BA 1QO0D 5HVQC 2FMLA 3CLOA 1MD0A 4KIBA 2ADUA 3KP7A 3E6MA 3R4KA 5AIPA 4O6JA 3I64A 5K5QA 1Y0UA 4L0YB 4UUVA 1U8RA 2ZXJA 1FY7A 5D5XB 3K1MA 3GFJA 1ZRCA 4HDUA 1J7KA 4CDGA 4UV8A 1SD4A 3T1BA 5E18F 2L4AA 1WSUA 4PZJA 3C18A 1TW3A 1BI3A 2QQBA 4L18B 2FNAA 2JZYA 4AIHA 2A69F 2XVCA 3O6BB 4MNUA 1QBJA 4KUMA 2E1CA 2XUBA 2BV6A 3KEOA 1O57A 4KIGA 3HUGA 4Y17A 3GYHX 2H27A 5E8IA 2VODA 3ZMVA 2MD5A 4P9FA 3WU1B 4I0AA 5D5WB 4HQMA 4Y13A 4HYEA 3IL2A 3ABTA 2ZFWA 1KCAA 2Z99A 3GLXA 3ZN1A 1FNNA 4G7OF 1XSXA 3LA2A 4RB2C 2X0LA 4I0BA 2QZ8A 2X4HA 2DT5A 2STTA 5CVRA 2A07F 3FM5A 1Z6TA 3HYIA 4ESBA 5K5RA 2JTVA 2OA4A 1IF1A 2KIUA 4OIRF 3SXYA 4R8HA 4OMZA 2MLKA 2NS0A 1KQ0A 3TOAA 2F5CA 2G7UA 2RGVA 4RGSA 4NHJA 1R1VA 1AY9A 1VTNC 2XRNA 2COMA 2MLGA 2DBBA 2IRFG 2R3SA 5JR3A 2ZCWA 4Y15A 4LFUA 3JSOA 1IRFA 2HOEA 4U0YA 3LFKA 2XHKA 4LB6B 1B1BA 1UMUA 1J0RA 2DPDA 4WXDA 2IPQX 4K8WA 2FSWA 2VXZA 3EYIA 1BC8C 2MA3A 2XAHA 1R36A 2A61A 1P6RA 4EJTA 2L02A 1FX7A 4EJVA 4NB5A 2FA5A 3V8JA 4FX0A 5FGMA 3LAPA 4RS8A 2NNNA 4A5MA 1U3EM 3BROA 5ICFA 4Z2YA 1G3YA 2FRHA 2JT1A 1TLHB 1K7AA 1WWXA 3RPUA 3VFZA 2HEOA 4AWXB 2EA4A 1G3SA 3JSPA 1XDUA 1KA8A 4ZZDA 4KN4X 4G6QA 3MEXA 2GA2A 1FPQA 2V1UA 2OQGA 2FF4A 2P4WA 1IXSB 3F23A 1OYWA 4HF0A 3KP6A 2CSOA 2EV5A 3J80Z 2CQKA 2VOPA 4EGZA 2VT2A 1OPCA 4ON0A 4ASNA 3GO5A 1FWZA 2E7XA 4YIIA 2JSCA 1EH6A 2IP2A 3KP4A 1B12A 1USSA 3LQQA 5EEHA 2IA2A 2HDCA 2IVMA 3BPVA 2QQAA 3IWZA 3TO6A 3LAJA 3E97A
chains in the Genus database with same CATH superfamily
1P92A 1YQAA 2EINH 1ITYA 3FISA 3KP3A 4XM3A 5ED4A 4MTEA 2R7ZJ 4JBAA 4CZCA 3C2BA 2HYJA 4A3GJ 2W57A 4GGGA 1F36A 3ZMTA 3WG9A 1FP2A 2VBYA 3G3ZA 4ESJA 1IGNA 3PQJA 2XF7A 3KE2A 1R1UA 2CV0A 1M1EB 2KZVA 1FTTA 3IH2A 3IV5A 3KZYA 2M87A 1FP1D 4IHXA 1D1CA 1H8AC 4D1QA 3FBNB 3F8BA 4IHVA 1G3WA 4GXOA 5DUKA 3ULQB 3CMYA 3QPHA 1MJAA 2HTSA 2CUFA 4XRMA 2HQRA 4CA0A 2WV1A 4I76A 5F0FA 3S3NA 1EF4A 2ZB9A 1XGMA 2F48A 2PMZN 4UHTA 2NVXJ 1T0FA 1BR1A 2OUMA 2CU7A 1K83J 1XTAA 2RQPA 1BI2A 3KZIC 3ZR8X 3AL0B 3ZN0A 3AG4H 2PI0A 4E7LA 4MEXF 1ZGAA 2KRFA 2ZMEC 4XLPF 3BR1A 2BVMA 2XAJA 1FOWA 3V8LA 4OOIA 2FE3A 5EYRA 5ICGA 1YJ9I 4OIQF 1V4RA 3EPZA 1J2XA 1U0JA 2IS2A 2NAZA 1ZLJA 1U2WA 3RSNA 3S17J 1TZLA 2OAZA 3OL4A 1Z7LA 1Z91A 3WU0A 3G73A 1RI7A 5GAGJ 3KEYA 1A6QA 1R1TA 2OZ6A 4RGUA 4L0ZB 3M9AA 3K69A 5L3EA 3DP7A 1BOBA 5FLXZ 3COAC 2NNYA 2YPRA 1ZREA 2OQRA 2VI6A 1X3ZB 3FK7A 3R0JA 1U5TA 5LHIA 1W7PD 3PSFA 1SMTA 1MNEA 2XV4S 3CQZJ 4S04A 1R9TJ 1WJDA 1IUFA 2HYFA 2EIJH 1Y56A 2TRTA 3H5NA 5D6EA 2A5WA 2W48A 1FBSA 2LR8A 1R23A 1B72B 3F8NA 3L00A 3WTUC 2QKMB 1DP7P 2XAUA 4R79A 5D4SA 1FIPA 3D5LA 1E0EA 1P2FA 4OU0A 2CRGA 3AKZA 3HOSA 4BJ6C 4M73A 1EJ9A 1LEAA 4M71A 1T95A 4RAFA 1NK3P 3ABMH 2FX0A 4BNCA 2VJ5A 2OU2A 2KZGA 1LEBA 3K4BA 4GFBA 2K3PA 2Y0SN 2R5ZB 2HOAA 3PQKA 5L3BA 3WGIA 4P1WA 3M1CA 4XLNF 2DODA 3AAFA 5DCMB 1CQTA 4V2GA 1UHMA 5F6FA 4ETSA 1AHDP 4QPQA 5K7FA 2XGEA 2YUSA 4OAZA 2WB1N 3VYUB 2MFZA 2BXYA 4KN7X 4N9HA 5GAEJ 4UVCA 3CC2I 3M8EA 1WJFA 2VUMJ 2LDUA 4EM2A 1JGGA 2R0QC 1K6OA 2F4MB 3F8MA 1J9IA 4RB1A 2FMYA 4BYYA 4Q4ZF 2O03A 2A3SA 3DEUA 4Q5SF 1FOXA 4FX4A 3OYBA 1O3SA 4A3FJ 1W36C 3F6VA 4N31A 2J5OA 2WAQA 2LKSA 2KP6A 3ZQFA 3SEZA 1OYYA 2P7CB 3T8TA 4N9IA 4IJAA 3ASNH 6PAXA 2VIXA 4OAYA 2MG4A 3P9CA 3GTPJ 5JVGF 1SFUA 1IN7A 2W1OA 1WPKA 3ONQA 2R5YA 3V7RA 4KMUX 1ZRDA 4IHWA 1OQYA 1S6LA 4IHYA 4ABZA 1HW2A 2DPUA 2F5FA 1ENHA 4X0GA 3K4NA 2XGCA 2M5WA 2W00A 4UB6C 5FFZA 5HS7A 3W6KB 5LLQA 1JHEA 3Q9VA 2NVUB 4FASD 1U5TB 4PJNA 1ZGJA 2G7HA 1R5ID 2K9QA 1HDPA 2VBWA 4C3IJ 4LG3A 3J81Z 2R7OA 2K85A 2TDXA 3OSFA 2HO0A 2DK5A 2LBFB 2KISA 1ZR4A 1F5TA 4XR6A 3WTZA 1VQ5I 4BAYA 4B44A 2DK8A 2X6OA 3ESWB 1XMKA 3KIOA 4BKXA 3FXOA 4CO8A 5B1BH 2O0YA 5BPIA 3S04A 1OLTA 1HBXG 3S3OA 2ECCA 1HSTA 2JPBA 2FQ4A 3DF8A 1S7AA 3VEPA 2AXTC 4HNUA 2HWVA 2CV2A 3K0LA 1VQNI 1T7DA 3V7SA 2QENA 5CVIA 2I5UA 2E1MC 2XGXA 3GVAA 3LA7A 3HHHA 4FE4A 2R7XA 4D5FA 5ILSA 3G1OA 3HRMA 2VT3A 3PUFA 4IL6C 5IYCJ 3SHFA 3TQNA 4RGRA 3RKWA 3JAMK 4U88A 2RQQA 3BG3A 1S72I 4KISA 2ICWG 4HOBA 2VOOA 1LE8B 3I5UA 1X2NA 5KAFC 5EG0A 4NV4A 3M07A 5DTDA 1TNTA 5GP9A 3B6AA 3ISPA 5E1XA 2OV7A 4YFNF 1X4OA 1W5SA 3KP5A 3H3UA 5M5XJ 4IHSA 2CG4A 4BJ5C 3BZCA 1CF7A 3GBGA 3H9JA 1WI9A 3HIFA 2V6CA 3DV8A 3QPSA 2XIGA 5IP9J 3HM5A 1KU9A 1MBFA 4BY7J 5H2FC 1ZK8A 2JA5J 3OY9A 5E8GA 1WHUA 5A2QZ 2DN0A 5LD2C 1F39A 4FHTA 2F5EA 1R7JA 3S15J 4S05A 3HUGB 5E1WA 1VQ7I 1MSFC 3H92A 4ZDOA 2JPCA 1QZEA 2HVQA 2WB1A 2M30A 1X1BA 4MO7A 5FD5A 4Z6YA 2O61A 2EZKA 3J7ZI 3HOTA 1ACIA 1S5LC 2BHZA 4M9SA 5FRNA 2ZXHA 3MCZA 2CS3A 3H0GJ 2ID6A 1R58A 2XROA 4MFDA 3CDLA 5FFXA 3HGYA 3MAJA 2CUEA 2Y69H 5J6XA 2L3DA 5AONA 3LSIA 3AL0C 4OIOF 2E2IJ 5LGUA 1B9MA 1RKWA 3CUOA 3L7WA 2DOAA 4RB3C 2QWWA 1JE8A 4JP0A 1HQCA 2D1HA 1QPIA 1IW7F 2L4MA 1YFHA 3ZGKA 1T6SA 5TGTA 5HDKA 4G94A 2CQQA 2BW3A 2DXIA 9ANTA 1REPC 1QQIA 2BYVE 2HZDA 4AVPA 4BBSJ 2KDOA 2QGUA 5CLSA 2H6CA 2Q2EA 1FYKA 3E6CC 1J75A 2EILH 5LGTA 3DU5A 1TNSA 3CC7I 4JQFA 4B8XA 5AIQA 1QHGA 3BP8A 4MTDA 4L5JA 1IRZA 5JLXA 2ELKA 2R4GA 4DGWB 4YFKF 1K79A 3K6GA 1X1CA 1TQIA 3FZVA 3BPXA 4LLGF 2QQ8A 2GXBA 1PYVA 5IT9K 3C3WA 5FLXK 3PIPF 2DMUA 1IXRC 3ELKA 2ZJPF 2HR3A 1GT0C 2E2JJ 2FQ3A 2QUFA 1UAAA 3W6VA 4IX7A 3CCLI 3IKVA 5JLWA 1EA3A 3HOVJ 2VQGA 1SFEA 3Q0VA 1IO2A 2VE9A 2Z3YA 1AOYA 4HX4A 1V3FA 2EIMH 3DKXA 4IXAA 3ECHA 3SFZA 2KJBA 2VPRA 4AU7A 5GADJ 5F1RA 2F4IA 4XLFA 1YOVB 1VQLI 4EJOA 1S7OA 3QODA 1LNWA 1IXCA 3NAUA 2LY9A 3HXLA 4MFEA 5GTIC 2XAGA 1GVJA 2LP0A 4HW0A 5E3LA 2LMDA 1MZBA 1XGOA 4X1EA 1Y8RB 2JMWA 3B73A 4JOMA 5FRMA 3HB9A 1BW5A 1HC8A 5C4JJ 2Y0SA 1C0WA 3FX3A 3E0JB 5DCMA 3Q0WA 5F64A 3GLLA 3I53A 1LQ1A 3BR2A 4RGXA 3S3MA 4AIKA 4P5OA 4AD9A 1T39A 3FBIB 3OYAA 4LD5A 2Y75A 1HW5A 2WY7Q 1ZAOA 3HSEA 2MBFA 4KT5C 1MDMB 2GIVA 3PNVA 4ENJA 3U2RA 4YFXF 2DYSH 3SFIA 2MH2A 4KDPA 2V1XA 2FU4A 1IJWC 1FMVA 2YU3A 2ELJA 2EH3A 3W2AA 5L3DA 1HLVA 3LA3A 4XSXF 2P5VA 3H36A 3DPTA 2VKHA 1JXSA 1T08B 4ZJZA 4W97A 3OSGA 3QYFA 4BUPA 3BC8A 3SZPA 4QWQA 3V4GA 1DP3A 1MMAA 4IRIA 1NTCA 2AXLA 3FMSA 1XS9A 2GWRA 3LMMA 2L9VA 3U1KA 3FXUA 1W0UA 5CYVA 3F72A 2M9HA 4BGDA 2L7MP 1S7EA 1YE9A 3SYTA 5KHDA 3HGGA 2WAEA 4U0WA 3K4JA 2XASA 3DWLE 1U5TC 2RREA 1IDYA 1ETVA 1UFMA 2G9WA 3E5QA 2HGCA 1HKQA 2LF8A 4DYQA 1LDDA 2HQNA 3WTWC 3WTTC 1Z9CA 2XAQA 1ZELA 3A2KA 1GV2A 3VPRA 5E79C 2FBHA 4QTRA 2W7NA 5KK1A 1OCTC 2X9DA 3GF2A 1XB4A 2JA6J 2HNHA 4EEFG 3GTOJ 2WA0A 1BI0A 1L3LA 3G1MA 3OS0A 1XGNA 2CWEA 3PNTA 3EUHC 3CF5F 4HLXA 3DPLC 4U7BA 3CO6C 1JT6A 4CCOA 2BY0A 3BOQA 3RKXA 4LGWA 4RM3A 1D0YA 1X3UA 3WTVC 1AA7A 1YW8A 4AM3A 3OS1A 3MWMA 2JA2A 5HS8A 3Q3SA 3PO3J 3E5XA 3QU3A 3JR9A 3RCOA 1R4NB 2ZFUA 3E1SA 3MZYA 2FEZA 1DQUA 1Z1DA 2XF6A 3D5SC 3CMEI 3JTHA 1XSVA 2P5LC 2OBPA 3KLNA 4BHCA 5IYBJ 3W2WA 2HOSA 3QOPA 4C9YA 1ETYA 2EIKH 3I59A 2VLAA 2DMNA 3H35A 2LFBA 1RUOA 4XLAA 1OMIA 1UG2A 3RQIA 3OYFA 1TWCJ 3H5RA 3J81K 4IVNA 5BNGA 1ETKA 1TTYA 1I27A 3R6SA 2LSOA 1Z7UA 1J59A 2V4JC 4HF1A 4IKFA 3G2BA 1UB9A 2GQQA 4L9JA 2A05A 4II2A 4MEYF 2MC3A 2DCEA 3KCCA 2IGKA 3ZMZA 5F0CA 2MW8A 3HEFA 3K1NA 4RB0A 4CHUA 3IAS2 1ON2A 2J5PA 4HQEA 1TWGJ 3L09A 3K70D 2O6GE 3CCVI 4E70A 2K9SA 1LFBA 1BM9A 2QSFX 2CYYA 1I1SA 2E5ZA 4AIDA 4XOTA 3GEZA 2HPMA 1X3WB 4Q48A 2W24A 3HRTA 1N25A 2DW4A 3M4OJ 3N4MA 1QVUA 3TW6A 2DDBA 4ANJA 3HSFA 3G1LA 3HZJA 3OYKA 1ODDA 3ZQQA 1JGSA 5E20A 3TDUC 3ZCOA 3BTJA 4BE0A 4A3IJ 2CFXA 3NRVA 3K4KA 3L2CA 1T98A 1ON1A 3CMMA 4HNTA 5IT3A 2WC2A 1N78A 4HA8A 2ISYA 1LVAA 4II3A 2OF7A 1V55H 4BQQA 2OD5A 4CCKA 5BOXA 2KRCA 1TP4A 1J5YA 4C3HJ 1W5TA 1UZCA 1U8BA 4NQWB 4XRFA 1IN8A 4UXNA 4A3EJ 1R5HA 3AG2H 3IKTA 4O5VA 1SC7A 2V9PA 3V42A 1EH7A 4HV5A 2VONA 3ZPLA 1UELB 2EZHA 1QHHD 3JRBA 3I59B 2BY1A 3KETA 1Y1VJ 3LSRA 1KYWA 1R22A 1RR7A 5F27A 4YIFA 5JHUA 1Q1HA 1ETXA 3GFMA 3C2HA 3I58A 3IH3A 1WH7A 5J47A 5IY5H 1DPRA 5IYDJ 4DNCA 1G4DA 2W4SA 4J01A 3I71A 2KLOA 3HOYJ 5GTHC 2XPUA 2K4JA 4M3EA 3CO7C 2DLLA 2BXZA 1BA5A 1UJ8A 1OISA 4YIRX 1A31A 2DFHA 3H3ZA 4FE7A 5D8LB 4PJMA 2Z16A 5CQGA 1WJCA 2LY1A 3X2QH 2Y9YA 4H0EA 2VQHA 5CVUA 4BBRJ 3K1PA 5D5UB 3P9IA 4HZFA 1JUMA 5FKOA 2RAEA 1G3TA 4LG0A 4XKWA 4WX9A 1V5FA 5JI6A 2V7FA 5EZGA 3VOEA 1RUNA 3HOWJ 3A4CA 5IP7J 4ZH4F 2H1LA 2DA4A 4BEHA 4A3KJ 2EFOA 4AUXA 4XOPA 1SD5A 2BGCA 1U78A 2STWA 3LSTA 2H94A 1A35A 3CCMI 2IA0A 5JFRA 2F2EA 2QQ9A 4AIJA 2EZIA 5IT9Z 4F91B 3K4CA 2JUCA 1DPUA 3MN2A 3BCBA 4RAZA 4F52A 4KMFA 3PUBA 2DT7B 3JAMZ 3KYCB 2AQEA 1F1ZA 2FUG2 1BIAA 4BU2A 1B4AA 3FDYA 1I6HJ 3RDIA 4FQGA 3DXJF 3CESA 4Y3OA 1VQ6I 5LHHA 2PLYA 3S16J 1ZG5A 4QPOA 4PSXA 4H4KC 5CKTA 2WAQN 3MMYB 2A6TA 3BR5A 1O7FA 1XMXA 5DEQA 1T38A 1P4WA 1ZQ3P 2R7SA 4A2UA 5DCFA 3RPQA 1FT9A 3PL8A 1HDDC 4BH9A 1F43A 3L9FA 4BACA 2ELHA 5CPRB 1VNDA 1IUYA 3I4PA 5FLMJ 3CDIA 2M7AA 4ENMA 5H20A 4CGZA 3CDHA 1YYVA 1GXPA 3HTUA 4BXUA 1Z3YA 4IZZA 2UXNA 1FJLA 4UY8I 2EFNA 2MGQA 3WHCA 4RA2A 2KDZA 4KNYA 2R92J 3KPHA 2NS7A 3J7AO 2I10A 1WCMJ 5D8KB 3T0YA 3F6OA 3CP8A 3JTGA 1YHQI 4LIVA 4M6YA 2R7FA 1TW2A 1I6XA 5CVJA 3UKGA 1JKQC 1OFCX 3RYRA 2K9LA 3WG7H 2E71A 3FK6A 3ZMDA 2VL8A 4ZTFA 2QBYA 5K7HA 2M3AA 2FBKA 2CUZA 2PG4A 4HLYA 1G8XA 1B59A 3OR2C 1VQOI 2Z33A 4ZC3A 1FZPB 2LF7A 2V1DA 3WGGA 5M5YJ 2IT0A 1BBYA 4CSWA 4G7ZF 2FXAA 1WQ2A 1V5GA 2G0EA 2KMUA 1H89C 3TKYA 4CXFA 1ZH5A 4C30A 3GWZA 3KZZA 3IRQA 4BHBA 1B72A 4EV0A 3HRUA 2A6EF 1Z6RA 1YG2A 3IWFA 2JRMA 1ETQA 2Q0OA 5FLVA 1QNTA 2BHYA 3EUHA 4NQWA 3ZMUA 3SDBA 3A1YA 3F3XA 3EUKL 2DA2A 2PJRA 2WV0A 3CUQC 4PSWA 2BBYA 4G8XA 3LOCA 2Z2SB 1N77A 3PM1A 4ZYHA 3V8KA 3JRAA 2DAOA 2AO9A 5DM7F 1V54H 4MGRA 3GZNB 2MYSA 1E3OC 2LOOA 1FYMA 3MQ0A 3Q9SA 1BL0A 1S29A 1HXDA 2ZMEA 3H9GA 4KT6A 4F55A 1FOKA 2GBYA 1PUFA 3OYIA 2O7OA 4J19A 1RETA 3I54A 3J7YJ 5D5VB 4UNOA 1F9NA 2VJIA 3IRRA 1T0FC 3BJ6A 3D0SA 3HG9A 3OMYA 1YJNI 4EJUA 1A6IA 2VBZA 4A0ZA 3FMQA 2VQLA 3GTQJ 3I3LA 3I9V2 1MW7A 3SZTA 3VSKA 4MQ9F 3B6CA 2R7UA 4I7HA 3RJPA 2IA1A 3C1DA 3DFGA 3UNGC 4D7NA 3WTYC 4B3AA 5D4RA 5D6FA 1SFXA 5EGOB 1VF9A 4E7SA 4KIFA 3VODA 1DGWY 1MBHA 1R00A 3ZOBA 3P9KA 4G7HF 2KRHA 1U6GA 5B3SH 2HVSA 1JJ8C 1D1BA 2OJED 3PFIA 3MZHA 2IS6A 4PGHA 4PUSA 1IN6A 2GM4A 5LRSA 1OYIA 1POGA 1VQ9I 5E3OA 4X6AJ 4EQQA 4EGYA 4RBOA 4XBFA 1OCRH 2BVLA 2NRAC 3RTRA 2HQAA 3TO7A 2UXXA 4IHTA 4E7HA 1W7PB 3HKZA 5E3MA 1L0OC 1B8IB 2BOLA 3ECOA 2IXSA 3KP2A 4U87A 3MKYB 3H5AA 3FM3A 4ZZLA 3FXRA 4G9YA 1QVTA 3RKYA 4FTHA 3FF5A 3CCSI 1IRXA 2RVCA 4KFCA 1MSEC 4Y33A 4ME8A 4BDZA 3REOA 2PMUA 3FXKA 3F8FA 3GUDA 2KT0A 1MMSA 1ZYRF 4D9JA 1XMAA 3D5RC 1MIJA 1QPMA 1KU2A 4PGGA 3DBRB 3DKWA 4M3FA 3WE2A 4CZZA 1YI2I 2L9NA 4ZDLA 2EWNA 2ZSHB 2PMHA 2DYRH 4JX6A 4A6DA 4B48A 4F7ZA 2MH9A 1DDNA 2EQRA 1ETOA 3MVPA 3GZ6A 4HG2A 3OIQA 1GLNA 3R61A 2JRTA 2JWTA 3QRFF 1ONVA 4HF2A 4M9ZA 1AWCA 1LB2A 3CJQB 3J80K 3TOBA 4CYDA 5J1RA 2IS1A 1WRJA 3ABLH 3DCFA 4M72A 5TJJA 1P9QC 1TWHJ 3BQYA 2YR2A 3H1CA 1USTA 3HL2A 3CCRI 3FXQA 2COBA 1K78A 1WFXA 3O3KA 4HV6A 1FBUA 4BQAA 2VN2A 2DA6A 2PMZA 3FXMA 2ESNA 4NC7A 5HNHA 3OYHA 1IV8A 2DJIA 2XKPA 1XCVA 3QPTA 2IJLA 3EYYA 3QQAA 4BS9A 3U9GA 2LNBA 3GZ5A 2HDWA 2Z1DA 3QOEA 1YITI 2ZKZA 3BDDA 4CCLA 3S1RJ 3IUOA 4CYCB 3S32A 1SAUA 3GFLA 2EA2A 2GA1A 2HVRA 1UG0A 4N4OB 4AC0A 5F08A 1FIAA 4UUSA 1B9NA 2ECBA 1SFKA 1OR7A 2DI3A 4A3MJ 3S1QJ 2DQLA 2ZNYA 2QLZA 1G6NA 2ISZA 3DPUA 3S2WA 4WWCA 3P5JA 2N8GA 1G59A 2K9NA 4HPQA 2V9KA 3LWFA 1LUJB 5K1YA 5FJ8J 1DU6A 1T8IA 1FC3A 3BTLA 3PSIA 5FO5A 2CFOA 2M34A 1B6AA 3B02A 1X58A 1KONA 2ZXWH 1HKSA 1S3JA 2LH9A 3LSMA 3CTAA 1SMYF 3VYRB 5A2QK 4LLNA 2HU9A 2YX7A 3JRGA 4ITVA 2DT6A 4XSZF 2NYXA 3CUQA 2IGOA 2L54A 2O8XA 2WAFA 1JHFA 4PDKA 4A0XA 1QU3A 1CF7B 2MC4A 5DDGA 3JCUC 4EJWA 1GUUA 1D3YA 4U7DA 2FOWA 5KVRA 3DKYA 2DA1A 2FKDA 3K2AA 2BY2A 2IEKA 5EGOA 1E17A 2QF7A 1SD7A 2D1VA 1JTXA 2HNFA 1RIOH 4EM1A 1BIBA 1P7JA 1Z21A 5FKNA 1IN5A 1IV6A 2X1DA 3KLOA 4PK4A 1P4AA 1BOAA 1X1PA 3VYTB 5DM6F 1RESA 1S8NA 3OIOA 4GYIA 1RZ4A 4IPAA 1YJWI 4DQ2A 5BQTA 4XICA 2RKHA 2DQRA 2GOMA 4UB8C 3TW7A 2JQ7A 4V19K 4LMYA 2E1MB 3UR3C 2NVYJ 1LVKA 2LVSA 2NVTJ 1QZZA 4XONA 5HOOA 3TGNA 1R6RA 4BHPA 3PNYA 3DQVC 2VKDA 1FSHA 1KQ8A 2HXIA 2CQ7A 1UHSA 5LGNA 1D1AA 1FBQA 1KYZA 1ZG1A 2KFDA 1LFPA 2L01A 2KJCA 3F8CA 1E2XA 2WBMA 2RDPA 1NHAA 3TMOA 5JVTA 1O4XA 2YS9A 3EQLF 4WCGA 4I09A 1PDNC 4B09A 4CCMA 3BQZA 5LEKA 3H3VK 2E5NA 3E6BA 2FBIA 2P7VB 1OCZH 2CQXA 4FETA 3ABKH 4UVAA 3K2ZA 4AYBN 2IGMA 1BC7C 2ME0A 2HKOA 3QYBA 4RDUA 2CQNA 3E5UA 3LSHA 3L2VA 2KQRA 1JHHA 3RI4A 3N97A 1LDKB 4HSRA 1XSDA 4XNFA 2CW0F 2NOGA 5J8CA 1WZ2A 3TDZC 4XMYA 3ZP5A 2Y0MA 4JK1X 5B5EC 4KYWA 3CLQA 2VC1A 2GXGA 2RNJA 2X48A 4KICA 2MSYA 4E7KA 2L2OA 5K5OA 1R49A 1MDMA 1F4KA 5J1UA 1FTZA 1LE8A 2XRLA 4RLFA 1IDZA 5KNLA 3BWGA 3K7AJ 3AG1H 1MH4A 5DD8A 4OMYA 1WJAA 1WVRA 2ZC2A 4HBLA 2QBYB 1NG7A 5L3CA 3WTXC 5ILUA 4HX8A 3RIRA 4LLLA 1MMDA 4PJJA 5EDNA 2KPMA 2AS5F 3T5XA 1OR7C 2E1NA 4FT8A 3V7CA 2LY2A 4I02A 3WODF 4IOCF 3W6JB 1DU0A 1ZG3A 5H6RA 4QSHA 5IPAA 1ZGWA 4M6XA 3C7JA 2DU9A 2D2WA 4XLEA 2FJ1A 3BTIA 3DBLB 5HLHA 5HNFA 3CCUI 1HA8A 3IIQA 1XCBA 5ERIA 1YRNB 4IF4A 5GAHJ 1SD6A 1LDJA 1ZLKA 2Q8KA 1AKHB 3BZ6A 4XK4A 2DFEA 2ZXIA 1W1WE 2HKXA 3QP6A 3OYNA 3L2RA 2V26A 4IRHA 4CYCA 2ZSIB 4A3BJ 5EEGA 5KAIC 1MNDA 4XQFA 2JK3A 3R60A 4D7MA 1UMQA 2V6EA 5FKLA 3H0DA 3P7NA 3FXLA 4MLOA 2GZWA 1SVOA 1WJ5A 1XD7A 2UUZA 2DTRA 1AU7A 1XG1A 2H1KA 5EF6A 3DU6A 5J8FA 4XN0A 4O3MA 2XDVA 1K78B 2P6SA 2KL4A 3WE3A 2VBXA 1MGTA 2EK5A 1YS6A 2E34A 5L3GA 3GFIA 3FMRA 1NK2P 1D8JA 1QA6A 3GTMJ 2QYOA 1H9TA 1TWFJ 2CW8A 1MBKA 1WI3A 2XKOA 2ID3A 2PQ8A 3HRSA 2ZJ2A 2DJNA 2A68F 4F3QA 1YLFA 3HKZN 3RYPA 3G4SI 4XORA 5HLGA 3Q5FA 2IW5A 2ZMEB 3ZXSA 1EV7A 2EB7A 2H8RA 1K4TA 4R1HA 3VB2A 2V9VA 1PJRA 2L9SA 3KFWX 2M4GA 4B3XA 5DS9A 1BW6A 3IAM2 1SAXA 1ZRFA 5HLIA 4L9NA 2JUGA 3HPHA 3SDGA 3SQNA 1HW1A 2CH0A 4BE2A 1TBXA 2M0CA 3VDXA 2PFBA 2L7FP 3M1EA 3DEEA 3Q0UA 4M9XA 1JTYA 2KHMA 2XAFA 1W7PA 4DYCA 1GXQA 3MD2A 1FSEA 3RKQA 3GW2A 3I55I 1TL8A 5M5WJ 4XKCA 1N75A 2H6BA 5KCMA 3BG5A 3JRFA 4XRSG 3BCAA 4FCYA 2DDAA 3LSJA 2W85A 3QP5A 5LRRA 3DLAA 2FOKA 3I0TA 2FNPA 4B1RA 5C44J 1VQPI 1NH3A 4NNJA 4BXXJ 5EG0B 1STZA 3ABUA 2DFIA 1KQ9A 2UV1A 4XLHA 3HSRA 3F22A 2W25A 4EMSA 5F0HA 3S1MJ 1D8KA 1HF0A 2XGDA 4I01A 2FJRA 2EFPA 5FKKA 3QU6A 2HS5A 3WU2C 1X19A 2VASA 2DFFA 2E19A 2UZKA 1GV5A 3ZMSA 3TO9A 2DA7A 2VE8A 4M74A 2R7WA 2RNGA 4IRGA 3JRCA 2ACJA 2LRDA 2LLKA 1BR2A 3BG7A 5LEJA 1Q1VA 3OR1C 2GXAA 2XF5A 2X6WA 4UUSB 2ETHA 3CJNA 5IOYA 4A0YA 4I2OA 2XPVA 2K4BA 5LHGA 1WJBA 2B7EA 3SJMA 2C6YA 1Y8QB 3RPUD 1G2HA 4L9TA 2E7WA 2M8GX 4ENKA 2GIZA 2EPFA 1DGRM 4Y4RA 1MMNA 1R5GA 4E6KG 1ULYA 3HHGA 2LBFA 4IQJA 2L9RA 1W4MA 3BT9A 3WGHA 3W3CA 2L0KA 2QVOA 3GCMA 1H9GA 3IC7A 5B66C 1ZHFA 3BR3A 1DUXC 2NVQJ 3O8HA 3I56I 4QLCU 3MKZA 3M7GA 4EM0B 2K27A 5E3NA 3JRDA 1JHCA 1BI1A 3PO2J 2B0LA 5IOZA 4HRIA 2XPWA 1LKXA 2XSDC 4TV7A 4MHGA 2VJJA 1TQMA 1Z67A 1SFOJ 2P8TA 4C2MJ 4XKBA 3OOPA 4GCVA 1T33A 5IP6A 1OKRA 1R71A 1PP7U 1KN9A 3A0BC 4LB5A 5C4XJ 2O3FA 2YSRA 3F0CA 1BJAA 4G6DA 4ZYGA 1HCRA 2B63J 3HJEA 1WH5A 3CUQB 4BJTA 1FYLA 1I1GA 3K4LA 5ICEA 3GXOA 1NG6A 3EUAA 2HYGD 1TQPA 2F5DA 1BJZA 4I98B 1I50J 2ZO4A 4LG0B 4NUBA 3HOUJ 2JVGA 3E6DA 1PUEE 1JUSA 4ZDPA 2CO5A 1VQ8I 3TP0A 1ERDA 2OCCH 4MQVA 2EFWA 2KIMA 3U21A 1FEXA 5HS9A 1LJ9A 4BXFA 1ZN2A 3O2PE 1QGPA 2EV0A 4HAMA 2R7TA 2A6HF 5CVVA 3JRHA 2IS4A 3GMEA 1X1AA 2AQFA 1T2KA 1KGSA 1Y6IA 2EFQA 1MJBA 2QKLB 3OYEA 1BR4A 1Z05A 3GTGJ 2WWYA 3RZOJ 2R5ZA 3ZQ7A 1UCRA 5DV5A 3DTEA 2P0WA 1V5EA 2GAUA 4RAYA 3OYGA 2QSGX 5E17F 1IZ1A 5J3LA 1HSJA 2E36A 2VJ4A 3BJAA 5ILVA 5DUIA 3KEQA 2JA7J 3MFKA 2QM3A 5CQEA 4P55A 1I4VA 2M0MA 4XKVA 5H6QA 1TWAJ 5M3MJ 4K2EA 4OIPF 2K86A 1A36A 3PJRA 2VB6A 2DTZA 1JJ6C 3K10A 2EJRA 1RR8C 2M4KA 3EETA 4XLCA 5HDGA 4AYBA 4YG2F 5GPCA 1P4XA 2DMTA 2LYCA 1BN5A 4OINF 3FKIJ 1HKTA 1KU7A 3VWBA 2R7QA 4L9VA 3S1NJ 2UWMA 1SVMA 3ERED 2DO7A 4A5NA 3BDNA 3G6EI 1WKMA 4WXHA 2I8DA 3ZRGA 1Z3XA 4LK0F 4LJZF 3CC4I 4L5IA 3ZQGA 1TT5B 3O8GA 3QYEA 5EZHA 2Z5UA 2D45A 4LOCA 4ENNA 1I39A 2OTLI 3KYDB 1FLIA 1YIOA 3E3VA 3RQ4A 1LFUP 1YO5C 4RM2A 3S8PA 1FMWA 3ZQLA 2K7LA 2HFHA 3HTSB 4LK1F 3HDDA 5J40A 3NWSA 2QCOA 4M3DA 3OYCA 1JKRC 4A3DJ 4NC8A 4BDYA 3CF2A 3JREA 3HOXJ 4RMNA 2RC4A 1MKMA 5F1JA 3NWTA 3TBIA 2LKPA 2VQCA 2W84A 4P9UA 1IAWA 4GO1A 2DMQA 2X51A 3OV8A 1JT0A 3CCEI 2FD5A 2PJRB 2OTJI 3M8FA 3SEQA 5J4VA 1VQKI 3C2GA 5HLTA 1KZHA 2L7ZA 5ICCA 1IN4A 1KU3A 1O3TA 1YS7A 2ESHA 4A6EA 2H09A 3DTKA 4IQ4A 2EV6A 2GOXB 4Y7NJ 3VSLA 3IHUA 4DYRA 1QZYA 2P6TA 4MIMA 2HTJA 4E7ZA 3LSGA 5FD6A 2ZJQF 2BEOA 1WJEA 1O3QA 3JW4A 2Y31A 2RN7A 2OZUA 2Y2ZA 3F21A 3DTIA 4U0VA 2YX4A 4C3JJ 4D5CA 3CP2A 4A3CJ 3LQRA 3R0AA 1UHWA 1O7LA 1IRGA 1O3RA 2A5YB 1TT0A 2D5VA 1D0XA 2IGNA 2K02A 3NEUA 1GDTA 4HDVA 2QEXI 4HX7A 4WXCA 5HDNA 4JX4A 3BJOA 1XPXA 5CJ9A 3WTSC 4IO9F 2RV8A 1OCOH 1RNLA 1CGPA 1E3HA 4A12A 1X4PA 2KIFA 3ML6A 5E1ZB 2KKOA 1J09A 4HNVA 3K9TA 1OCCH 3T8RA 2ME6A 4GYGA 3J7AY 4LITA 2ZBKA 2NOJB 2R93J 4D0PA 2E35A 2CV1A 4CUGA 2HDDA 4UV9A 1TC3C 2Z9OA 1EH8A 4ZYEA 1RPWA 5BMZA 3S2DJ 3S93A 3LSPA 2V79A 4EVIA 2DA3A 2LK2A 5EEAA 1X2MA 4ZYDA 4WK8F 5BPDA 4M3BA 2M8EA 4PCQA 2PN6A 3QPLA 2H8WA 5TISC 3FWEA 3GX4X 1YW9A 2O9LA 2TCTA 3BY6A 4GDFA 1YIJI 3FHZA 4Q47A 2MD0A 2P5KA 1XN7A 1QRYA 1X1DA 2EZLA 5DD4A 1PVEA 1H88C 4KJZA 2PEXA 3IH4A 2DOEA 1D5VA 2HZTA 2CGPA 3CJTB 1MBEA 3HOZJ 3OYMA 2KIQA 5FB2A 2EBIA 3FIWA 5F04A 2IAIA 2JJ7A 3U1DA 2M45A 3MKLA 2E2HJ 2OC6A 1PP8F 1MJ9A 4E7IA 1YTYA 3L2QA 1XGSA 2E1OA 3HC7A 2PJPA 4UVBA 1IG7A 1VQ4I 3ROUA 4CICA 1I5ZA 4NC6A 1W5CC 2O5RA 3MKWB 3TEDA 2V1NA 2X1EA 3BTCA 3D1NI 4XN3A 3FKJA 1JKOC 3CZ6A 5LBQA 3CCQI 2LG4A 4P96A 2WTEA 3N05A 3A01B 4WF2A 5BS6A 4IOAF 3OL3A 4BEHB 1U9OA 2LC2A 2R7DA 2PBIA 1MBJA 1AKHA 3TP3A 1ZARA 1GHCA 4ESFA 2M7BA 2NS8A 3M3YJ 4N0BA 5L3FA 2ZNZA 3EDPA 5JHFA 1ORKA 2VC0A 2R7RA 2WADA 2Y48A 4PFPA 4JYKA 4BQNA 5B1AH 3M8JA 5K7ZA 2DA5A 3JRIA 4DBRA 1D5YA 5TRDA 4KA4A 4A69C 3NQOA 1H0MA 5FKMA 3QAHA 5DYMA 1K61A 4ZTJA 1XDSA 1B8IA 1A04A 1YW7A 1R4MB 3I4NJ 2IBDA 3OYDA 4OWRB 2BE5F 2M1BA 4QIWN 3LL7A 1QO0D 1YX3A 2E60A 2YU9J 5HVQC 2FMLA 3CLOA 1MD0A 4G6TB 4KIBA 1XC5A 3S2HJ 2ADUA 3KP7A 2K40A 3E6MA 2AHQA 2JSPA 3R4KA 1SEUA 2CMPA 1FOYA 5AIPA 1RRJA 4O6JA 3DLLF 3I64A 5K5QA 4Y52J 1Y0UA 2X1CA 5FROA 5M3FJ 2M2EA 2GLOA 4L0YB 4UUVA 1U8RA 1MH3A 3ZQIA 2ZXJA 3G71I 1FY7A 5D5XB 3K1MA 3GFJA 3F9KA 2X6XA 4YRVA 1ZRCA 3CCYA 4DZJA 4HDUA 4HSTA 4IEJA 1J7KA 4CDGA 4UV8A 4DZPA 1U9NA 1SD4A 2B9SA 3ASOH 3T1BA 2OPTA 5E18F 4RAGA 1JUPA 2L4AA 1WSUA 1P7IA 1PUFB 4PZJA 3C18A 1TW3A 2Q1ZB 1BI3A 2VKVA 2QQBA 2NXNB 3PIOF 1K4SA 4L18B 1E3PA 2FNAA 2JZYA 2K9MA 4AIHA 1YRNA 2A69F 2VKEA 2XVCA 3O6BB 4MNUA 4NBQA 3SZGA 1QBJA 4KUMA 2LREA 2E1CA 4F93B 4I99C 1VZ0A 2F5VA 2XUBA 2BV6A 3KEOA 1O57A 1T56A 4KIGA 2XB0X 3HUGA 3LNQA 4Y17A 3GYHX 2CJJA 3BG6A 2H27A 4W1UA 5E8IA 2VODA 1XX5A 4GRIA 3ZMVA 1GVDA 2MD5A 3BR0A 1EKEA 3A0HC 3LSKA 4P9FA 4E7JA 3WU1B 1LPQA 4I0AA 5D5WB 4HQMA 4Y13A 4HYEA 3A01A 2OCEA 3BLYA 3IL2A 4C2UA 3ABTA 1I3QJ 2X85A 1I3AA 2ZFWA 2L5QA 2ZJRF 3MZ8A 1KCAA 1YX5A 2Z99A 4M6VA 1RKTA 1WGXA 3GLXA 3ZN1A 4DJAA 1FNNA 4G7OF 1XSXA 4PJ0C 1K6YA 3OYLA 2QSHX 3LA2A 4RB2C 2X0LA 4I0BA 2QZ8A 3GTLJ 1MMGA 4A3LJ 3KYLA 2X4HA 2VXDA 5C3EJ 2DT5A 2STTA 5CVRA 2A07F 1Y1WJ 3FM5A 1VI0A 1Z6TA 4C2TA 3HYIA 4ESBA 3VYSB 5K5RA 2JTVA 2R7VA 2OA4A 4KITB 4RLQA 1IF1A 4XIDA 1SVLA 1Z0XA 2PX9A 2KIUA 3HBLA 4OIRF 4G12A 3SXYA 4R8HA 4E4HA 3CMAI 2K5CA 4B4CA 4OMZA 2MLKA 2NS0A 2Y9ZA 3ERMA 1ETWA 4JX5A 3L1PA 1IC8A 1KQ0A 3OIPA 4DW6A 3TOAA 3K70C 5EJCA 2L7KA 4YELA 4A3JJ 4CCJA 2F5CA 2G7UA 1OJLA 4L5EA 4S0HB 2RGVA 4B47A 4CH7A 4RGSA 3HPGA 4EATA 2F6CA 2XSJC 4NHJA 3TL4X 1R1VA 1AY9A 1VTNC 3K4MA 2XRNA 2HPIA 2COMA 4A93J 2MLGA 2DBBA 4BL0B 2IRFG 3FXJA 4LIUA 2O8KA 2R3SA 5JR3A 2ZCWA 4Y15A 1MBGA 3QWLA 4LFUA 3JSOA 1IRFA 4N4NB 2HOEA 4J00A 4U0YA 3LFKA 2XHKA 4LB6B 2BZTA 1B1BA 2R5YB 4PFOA 3E7LA 1UMUA 1J0RA 2DPDA 2LTPA 3AFHA 2X6YA 3BG9A 4DBQA 2QA4I 4WXDA 2XC7A 2IPQX 2BY3A 4UUTA 3PFYA 2P81A 4K8WA 2FSWA 2VXZA 3EYIA 1BC8C 2HOTA 3RZDJ 2LKXA 2MA3A 2XAHA 1R36A 3OOUA 4BY1J 3CD6I 2A61A 1P6RA 4EJTA 3OS2A 2HI3A 2L02A 5GPAA 1FX7A 2HQ5A 4EJVA 3AG3H 3DBHB 2VPLA 2HXOA 4NB5A 2DOFA 2FA5A 4DOZA 4FX0A 3V8JA 2LD5A 5FGMA 3LAPA 3I4MJ 1Z77A 4RS8A 2K3FA 1HOMA 2NNNA 4NDLA 4A5MA 3BROA 4FISA 5ICFA 1U3EM 3GTKJ 4Z2YA 1G3YA 2FRHA 2JT1A 1TLHB 1K7AA 4XRSA 1ZTRA 4XL9A 4ZYAA 1WWXA 3IP4B 1A5JA 1ZR2A 1JI8A 3A02A 4I6ZA 3RPUA 3CJRB 4BE1A 3VFZA 2HEOA 4AWXB 4YEJA 2EA4A 1G3SA 1XDUA 3JSPA 2WY8Q 1KA8A 4ZZDA 4KN4X 5J1YA 3FHNA 2JA8J 4CCNA 1SANA 2MABA 4G6QA 3S14J 3MEXA 2CUJA 2GA2A 1FPQA 2V1UA 1RC9A 1ZKGA 4V2FA 2OQGA 1APLC 1VFCA 2FF4A 4DIQA 2P4WA 1IXSB 3F23A 1W36D 1OYWA 3W2VA 4HF0A 1W0TA 3KP6A 1MNMC 2JVHA 2CSOA 1D0ZA 5J4YA 2EV5A 3J80Z 2CQKA 3ZQHA 2Q2EB 3BZKA 4F92B 4AVZA 1OCPA 2VOPA 4EGZA 2VT2A 2CW7A 3KX2A 1OPCA 4ON0A 2BW3B 4ASNA 3GO5A 2F4OB 3NARA 4BQOA 3LFUA 4B43A 4HEA2 3GTJJ 3OYJA 3L2UA 3BR6A 3H9QA 1FWZA 2Y30A 2E7XA 3L2WA 1Y39A 3OWTA 2JSCA 4YIIA 1EH6A 2IP2A 3KP4A 1Y0NA 2XB5A 2DMPA 3A03A 3CCJI 1S9HA 1B12A 1USSA 2JN6A 3ZQCA 3DEWA 5LFAA 3LQQA 5EEHA 1JKPC 2IA2A 2HDCA 2IVMA 3BPVA 1VQMI 2QQAA 3WHBA 4M3GA 3IWZA 3TO6A 3LAJA 5HODA 3E97A 4PJLA 2W82A
chains in the Genus database with same CATH topology
1P92A 1YQAA 3KP3A 5ED4A 4MTEA 4JBAA 2W57A 4GGGA 3ZMTA 3WG9A 1FP2A 2VBYA 3G3ZA 4ESJA 3PQJA 3KE2A 1R1UA 3KZYA 2M87A 1FP1D 3F8BA 1G3WA 4GXOA 5DUKA 3ULQB 3QPHA 1MJAA 2HTSA 2HQRA 1XGMA 4UHTA 1T0FA 2RQPA 1BI2A 3ZN0A 2PI0A 4MEXF 1ZGAA 2KRFA 4XLPF 2XAJA 3V8LA 4OOIA 2FE3A 5ICGA 4OIQF 1V4RA 1J2XA 2NAZA 1ZLJA 1U2WA 2OAZA 1Z91A 3WU0A 3G73A 1RI7A 1R1TA 2OZ6A 4L0ZB 4RGUA 3M9AA 3K69A 5L3EA 3DP7A 5FLXZ 3COAC 2NNYA 2YPRA 1ZREA 2OQRA 3R0JA 1U5TA 5LHIA 1W7PD 1SMTA 2XV4S 4S04A 2HYFA 5D6EA 1FBSA 1R23A 3F8NA 3L00A 3WTUC 1DP7P 4R79A 5D4SA 3D5LA 1P2FA 4OU0A 3HOSA 4M73A 1LEAA 4M71A 4BNCA 2OU2A 3PQKA 5L3BA 3WGIA 4XLNF 3AAFA 5DCMB 1UHMA 5F6FA 4ETSA 4N9HA 4KN7X 4UVCA 3M8EA 2LDUA 4EM2A 1K6OA 3F8MA 1J9IA 4RB1A 2FMYA 4BYYA 4Q4ZF 2O03A 2A3SA 3DEUA 4Q5SF 4FX4A 1O3SA 3F6VA 4N31A 2J5OA 2P7CB 1OYYA 3T8TA 4N9IA 4IJAA 6PAXA 3P9CA 1SFUA 1IN7A 3V7RA 4KMUX 1ZRDA 1S6LA 2DPUA 1HW2A 2F5FA 2M5WA 5FFZA 5HS7A 3W6KB 5LLQA 1JHEA 3Q9VA 1U5TB 1ZGJA 2G7HA 2VBWA 3J81Z 2TDXA 2HO0A 2DK5A 1F5TA 3WTZA 4BAYA 2DK8A 1XMKA 4CO8A 2O0YA 5BPIA 3S04A 1HBXG 2JPBA 1HSTA 3DF8A 1S7AA 3VEPA 2HWVA 3K0LA 1T7DA 3V7SA 2QENA 5CVIA 2XGXA 3GVAA 3LA7A 3HHHA 5ILSA 3HRMA 2VT3A 3SHFA 3TQNA 4RGRA 3RKWA 3JAMK 4U88A 4HOBA 2VOOA 3I5UA 4NV4A 1TNTA 3ISPA 5E1XA 4YFNF 1W5SA 3KP5A 3H3UA 4IHSA 2CG4A 1CF7A 3HIFA 1WI9A 2V6CA 3DV8A 2XIGA 1KU9A 5E8GA 5A2QZ 1F39A 4FHTA 2F5EA 1R7JA 4S05A 5E1WA 3H92A 2JPCA 2M30A 5FD5A 2O61A 3HOTA 4M9SA 3MCZA 1R58A 2XROA 5FFXA 3MAJA 5J6XA 2L3DA 5AONA 4OIOF 5LGUA 1B9MA 3CUOA 3L7WA 4RB3C 2QWWA 1JE8A 1HQCA 2D1HA 1IW7F 2L4MA 1YFHA 1T6SA 5HDKA 4G94A 1REPC 1QQIA 2BYVE 4AVPA 5CLSA 2H6CA 2Q2EA 1FYKA 3E6CC 1J75A 5LGTA 1TNSA 4JQFA 4B8XA 5AIQA 3BP8A 4MTDA 4L5JA 4YFKF 1K79A 1TQIA 3FZVA 3BPXA 4LLGF 2GXBA 5IT9K 3C3WA 5FLXK 1IXRC 3ELKA 2HR3A 2FQ3A 2QUFA 3IKVA 1SFEA 2VE9A 2Z3YA 1AOYA 4HX4A 1V3FA 4IXAA 3ECHA 3SFZA 2KJBA 5F1RA 4EJOA 1S7OA 1LNWA 1IXCA 2XAGA 1GVJA 4HW0A 1MZBA 1XGOA 3B73A 1C0WA 3FX3A 5DCMA 5F64A 3I53A 1LQ1A 4RGXA 4AIKA 4P5OA 4AD9A 1T39A 4LD5A 2Y75A 1HW5A 1ZAOA 3HSEA 2MBFA 4KT5C 1MDMB 2GIVA 4ENJA 3U2RA 4YFXF 4KDPA 2MH2A 2V1XA 2FU4A 2YU3A 5L3DA 3LA3A 4XSXF 2P5VA 3DPTA 1JXSA 3SZPA 4QWQA 3V4GA 4IRIA 2AXLA 3FMSA 2GWRA 3FXUA 5CYVA 3F72A 4U0WA 2XASA 1U5TC 1UFMA 2G9WA 3E5QA 2HGCA 1HKQA 2LF8A 1LDDA 2HQNA 3WTWC 3WTTC 1Z9CA 2XAQA 2FBHA 5KK1A 3GF2A 1XB4A 1BI0A 1L3LA 1XGNA 2CWEA 4HLXA 3DPLC 4U7BA 3CO6C 3BOQA 3RKXA 4LGWA 1X3UA 3WTVC 1YW8A 3MWMA 5HS8A 3E5XA 3QU3A 3MZYA 2FEZA 1Z1DA 3JTHA 1XSVA 2P5LC 2OBPA 3KLNA 4BHCA 3QOPA 3I59A 1RUOA 1OMIA 3J81K 4IVNA 1TTYA 1I27A 3R6SA 2LSOA 1Z7UA 1J59A 4HF1A 1UB9A 2GQQA 4L9JA 4MEYF 2MC3A 3KCCA 3ZMZA 3K1NA 4RB0A 4CHUA 1ON2A 2J5PA 4HQEA 3L09A 2O6GE 4E70A 1BM9A 2CYYA 1I1SA 3GEZA 4Q48A 2W24A 3HRTA 2DW4A 3N4MA 3HSFA 1ODDA 1JGSA 5E20A 3TDUC 2CFXA 3NRVA 3L2CA 1T98A 1ON1A 5IT3A 2WC2A 4HA8A 2ISYA 1LVAA 5BOXA 2OD5A 1J5YA 1W5TA 4XRFA 1IN8A 4UXNA 1R5HA 3IKTA 4O5VA 1EH7A 4HV5A 2VONA 3ZPLA 3I59B 3KETA 1KYWA 1R22A 4YIFA 5JHUA 1Q1HA 3GFMA 3I58A 1DPRA 4DNCA 1G4DA 3I71A 2K4JA 3CO7C 2DLLA 3H3ZA 5D8LB 4H0EA 5CVUA 3K1PA 5D5UB 3P9IA 4HZFA 1G3TA 4LG0A 4WX9A 5JI6A 3VOEA 1RUNA 4ZH4F 2EFOA 1SD5A 2BGCA 1U78A 2STWA 3LSTA 2H94A 2IA0A 5JFRA 2F2EA 2QQ9A 4AIJA 5IT9Z 1DPUA 4RAZA 4KMFA 3JAMZ 1F1ZA 1BIAA 1B4AA 3RDIA 3DXJF 5LHHA 2PLYA 1ZG5A 1O7FA 1T38A 5DEQA 1P4WA 4A2UA 5DCFA 3RPQA 1FT9A 4BH9A 3L9FA 2ELHA 1IUYA 3I4PA 4ENMA 5H20A 4CGZA 3CDHA 1YYVA 1GXPA 3HTUA 4BXUA 2UXNA 2EFNA 4KNYA 3J7AO 5D8KB 3T0YA 3F6OA 3JTGA 4M6YA 2R7FA 1TW2A 1I6XA 5CVJA 3RYRA 3ZMDA 2QBYA 2FBKA 2PG4A 4HLYA 1B59A 2Z33A 1FZPB 2LF7A 2V1DA 3WGGA 2IT0A 1BBYA 4G7ZF 2FXAA 1WQ2A 3TKYA 4CXFA 1ZH5A 3GWZA 3IRQA 3KZZA 4BHBA 4EV0A 3HRUA 2A6EF 1Z6RA 1YG2A 3IWFA 2Q0OA 1QNTA 3EUHA 4NQWA 3ZMUA 3F3XA 2WV0A 3CUQC 2BBYA 4G8XA 4ZYHA 3V8KA 2DAOA 4MGRA 1FYMA 3MQ0A 3Q9SA 1S29A 1HXDA 2ZMEA 1FOKA 3I54A 5D5VB 4UNOA 1F9NA 3IRRA 3BJ6A 3D0SA 4EJUA 2VBZA 4A0ZA 3FMQA 3SZTA 4MQ9F 4I7HA 3RJPA 2IA1A 3C1DA 3DFGA 3WTYC 5D4RA 5D6FA 1SFXA 4KIFA 3VODA 1R00A 3P9KA 4G7HF 1U6GA 3MZHA 3PFIA 4PGHA 1IN6A 5LRSA 1OYIA 4EQQA 4EGYA 4XBFA 2NRAC 3RTRA 3TO7A 2UXXA 4IHTA 1W7PB 1L0OC 3ECOA 3KP2A 3FM3A 4ZZLA 3FXRA 4G9YA 3RKYA 3FF5A 2RVCA 4KFCA 4ME8A 3REOA 2PMUA 3F8FA 3GUDA 1ZYRF 1XMAA 1QPMA 4PGGA 1KU2A 3DKWA 3WE2A 4CZZA 2EWNA 2PMHA 4A6DA 1DDNA 4F7ZA 2MH9A 3GZ6A 3R61A 2JRTA 3QRFF 1ONVA 4HF2A 4M9ZA 1AWCA 1LB2A 3J80K 3TOBA 4CYDA 1WRJA 4M72A 5TJJA 2YR2A 1USTA 3FXQA 1K78A 3O3KA 4HV6A 1FBUA 4BQAA 2VN2A 2ESNA 2XKPA 1XCVA 3QPTA 2IJLA 3EYYA 3U9GA 2LNBA 3GZ5A 2ZKZA 3BDDA 3GFLA 2EA2A 2GA1A 1B9NA 1OR7A 2DI3A 2DQLA 2ZNYA 2QLZA 1G6NA 2ISZA 3S2WA 4WWCA 3LWFA 5K1YA 1FC3A 5FO5A 1B6AA 3B02A 1HKSA 1S3JA 3CTAA 1SMYF 5A2QK 4LLNA 2YX7A 4XSZF 2NYXA 3CUQA 2L54A 2O8XA 1JHFA 4PDKA 4A0XA 1CF7B 5DDGA 4EJWA 1D3YA 4U7DA 5KVRA 2FKDA 1E17A 1SD7A 2D1VA 2HNFA 1RIOH 4EM1A 1BIBA 1IN5A 3KLOA 1P4AA 1BOAA 1S8NA 4GYIA 1RZ4A 4IPAA 4DQ2A 5BQTA 2RKHA 2DQRA 4LMYA 1QZZA 5HOOA 3TGNA 4BHPA 3DQVC 1FSHA 1KQ8A 5LGNA 1FBQA 1KYZA 1ZG1A 2L01A 2KJCA 3F8CA 1E2XA 2RDPA 1NHAA 5JVTA 3EQLF 4WCGA 4I09A 1PDNC 4B09A 5LEKA 3E6BA 2FBIA 2P7VB 4UVAA 3K2ZA 1BC7C 2HKOA 3E5UA 1JHHA 3RI4A 3N97A 1LDKB 1XSDA 2CW0F 5J8CA 3TDZC 3ZP5A 2Y0MA 4JK1X 4KYWA 2VC1A 2GXGA 2RNJA 4KICA 5K5OA 1MDMA 1F4KA 3BWGA 5DD8A 4OMYA 2QBYB 4HBLA 5L3CA 3WTXC 5ILUA 4HX8A 3RIRA 4LLLA 2AS5F 3T5XA 2E1NA 4FT8A 3V7CA 4I02A 3WODF 3W6JB 1ZG3A 5H6RA 4M6XA 3C7JA 2DU9A 2D2WA 5HLHA 3IIQA 1XCBA 5ERIA 4IF4A 1SD6A 1LDJA 1ZLKA 2Q8KA 3BZ6A 2HKXA 3QP6A 4IRHA 5EEGA 3R60A 3P7NA 2GZWA 1XD7A 2DTRA 5J8FA 4O3MA 1K78B 2P6SA 3WE3A 2VBXA 1MGTA 2EK5A 1YS6A 5L3GA 3GFIA 3FMRA 1D8JA 2QYOA 1H9TA 2XKOA 2PQ8A 3HRSA 2ZJ2A 2A68F 1YLFA 3RYPA 5HLGA 3Q5FA 2IW5A 2ZMEB 2EB7A 1EV7A 4R1HA 3VB2A 2V9VA 3KFWX 1ZRFA 1SAXA 5HLIA 4L9NA 3SQNA 1HW1A 1TBXA 2PFBA 3M1EA 4M9XA 2XAFA 1W7PA 1GXQA 1FSEA 3GW2A 2H6BA 3QP5A 2W85A 5LRRA 2FOKA 3I0TA 2FNPA 1STZA 3ABUA 2DFIA 1KQ9A 3F22A 3HSRA 2W25A 4EMSA 1D8KA 4I01A 2FJRA 2EFPA 3QU6A 2HS5A 2UZKA 3ZMSA 3TO9A 2VE8A 4M74A 4IRGA 2ACJA 5LEJA 2ETHA 3CJNA 4I2OA 4A0YA 2K4BA 5LHGA 2C6YA 4L9TA 2E7WA 4ENKA 1R5GA 1ULYA 3HHGA 1W4MA 3WGHA 2QVOA 1H9GA 3IC7A 1ZHFA 1DUXC 4QLCU 3M7GA 4EM0B 2K27A 1JHCA 1BI1A 2B0LA 4TV7A 4MHGA 1TQMA 2P8TA 3OOPA 4GCVA 1OKRA 1PP7U 1KN9A 4LB5A 2O3FA 2YSRA 1BJAA 4G6DA 4ZYGA 3CUQB 1FYLA 1I1GA 5ICEA 3GXOA 2HYGD 1TQPA 2F5DA 4I98B 2ZO4A 4LG0B 3E6DA 1PUEE 2CO5A 4MQVA 2EFWA 2KIMA 5HS9A 1LJ9A 1ZN2A 3O2PE 1QGPA 2EV0A 4HAMA 2A6HF 5CVVA 1T2KA 1KGSA 2EFQA 1MJBA 1Z05A 2WWYA 3ZQ7A 1UCRA 5DV5A 2GAUA 4RAYA 5E17F 1IZ1A 1HSJA 3BJAA 5ILVA 5DUIA 3KEQA 3MFKA 2QM3A 4P55A 1I4VA 5H6QA 4OIPF 4K2EA 2K86A 2EJRA 3EETA 5HDGA 4YG2F 1P4XA 4OINF 1BN5A 1HKTA 1KU7A 4L9VA 2UWMA 3ERED 2DO7A 4A5NA 3BDNA 1WKMA 4WXHA 4LK0F 4LJZF 4L5IA 2Z5UA 2D45A 4ENNA 1FLIA 1YIOA 3E3VA 1YO5C 2K7LA 2HFHA 3HTSB 4LK1F 2RC4A 1MKMA 2LKPA 1IAWA 2W84A 4P9UA 4GO1A 3OV8A 1LEBA 3M8FA 5ICCA 1IN4A 1O3TA 1KU3A 1YS7A 4A6EA 2ESHA 2H09A 2EV6A 3IHUA 1QZYA 2P6TA 2HTJA 5FD6A 2BEOA 1O3QA 3JW4A 2RN7A 2OZUA 3F21A 4U0VA 2YX4A 3LQRA 3R0AA 1UHWA 1O7LA 1IRGA 1O3RA 2A5YB 2K02A 3NEUA 4HDVA 4HX7A 4WXCA 5HDNA 3BJOA 5CJ9A 3WTSC 2RV8A 1RNLA 1CGPA 4A12A 2KIFA 3ML6A 5E1ZB 2KKOA 3K9TA 3T8RA 4GYGA 2ZBKA 4D0PA 4UV9A 2Z9OA 1EH8A 4ZYEA 5BMZA 2V79A 4EVIA 5BPDA 4ZYDA 4WK8F 2M8EA 4PCQA 2PN6A 3FWEA 3GX4X 1YW9A 3BY6A 3FHZA 4Q47A 2P5KA 1XN7A 5DD4A 2PEXA 1D5VA 2HZTA 2CGPA 5FB2A 3U1DA 2M45A 1PP8F 1MJ9A 1YTYA 1XGSA 2PJPA 4UVBA 3ROUA 4CICA 1I5ZA 5LBQA 4P96A 2WTEA 4WF2A 5BS6A 2R7DA 2PBIA 1ZARA 1GHCA 4ESFA 4N0BA 5L3FA 2ZNZA 3EDPA 2VC0A 2Y48A 5TRDA 4KA4A 3NQOA 1H0MA 3QAHA 5DYMA 1XDSA 1A04A 1YW7A 2BE5F 2M1BA 1QO0D 5HVQC 2FMLA 3CLOA 1MD0A 4KIBA 2ADUA 3KP7A 3E6MA 3R4KA 5AIPA 4O6JA 3I64A 5K5QA 1Y0UA 4L0YB 4UUVA 1U8RA 2ZXJA 1FY7A 5D5XB 3K1MA 3GFJA 1ZRCA 4HDUA 1J7KA 4CDGA 4UV8A 1SD4A 3T1BA 5E18F 2L4AA 1WSUA 4PZJA 3C18A 1TW3A 1BI3A 2QQBA 4L18B 2FNAA 2JZYA 4AIHA 2A69F 2XVCA 3O6BB 4MNUA 1QBJA 4KUMA 2E1CA 2XUBA 2BV6A 3KEOA 1O57A 4KIGA 3HUGA 4Y17A 3GYHX 2H27A 5E8IA 2VODA 3ZMVA 2MD5A 4P9FA 3WU1B 4I0AA 5D5WB 4HQMA 4Y13A 4HYEA 3IL2A 3ABTA 2ZFWA 1KCAA 2Z99A 3GLXA 3ZN1A 1FNNA 4G7OF 1XSXA 3LA2A 4RB2C 2X0LA 4I0BA 2QZ8A 2X4HA 2DT5A 2STTA 5CVRA 2A07F 3FM5A 1Z6TA 3HYIA 4ESBA 5K5RA 2JTVA 2OA4A 1IF1A 2KIUA 4OIRF 3SXYA 4R8HA 4OMZA 2MLKA 2NS0A 1KQ0A 3TOAA 2F5CA 2G7UA 2RGVA 4RGSA 4NHJA 1R1VA 1AY9A 1VTNC 2XRNA 2COMA 2MLGA 2DBBA 2IRFG 2R3SA 5JR3A 2ZCWA 4Y15A 4LFUA 3JSOA 1IRFA 2HOEA 4U0YA 3LFKA 2XHKA 4LB6B 1B1BA 1UMUA 1J0RA 2DPDA 4WXDA 2IPQX 4K8WA 2FSWA 2VXZA 3EYIA 1BC8C 2MA3A 2XAHA 1R36A 2A61A 1P6RA 4EJTA 2L02A 1FX7A 4EJVA 4NB5A 2FA5A 3V8JA 4FX0A 5FGMA 3LAPA 4RS8A 2NNNA 4A5MA 1U3EM 3BROA 5ICFA 4Z2YA 1G3YA 2FRHA 2JT1A 1TLHB 1K7AA 1WWXA 3RPUA 3VFZA 2HEOA 4AWXB 2EA4A 1G3SA 3JSPA 1XDUA 1KA8A 4ZZDA 4KN4X 4G6QA 3MEXA 2GA2A 1FPQA 2V1UA 2OQGA 2FF4A 2P4WA 1IXSB 3F23A 1OYWA 4HF0A 3KP6A 2CSOA 2EV5A 3J80Z 2CQKA 2VOPA 4EGZA 2VT2A 1OPCA 4ON0A 4ASNA 3GO5A 1FWZA 2E7XA 4YIIA 2JSCA 1EH6A 2IP2A 3KP4A 1B12A 1USSA 3LQQA 5EEHA 2IA2A 2HDCA 2IVMA 3BPVA 2QQAA 3IWZA 3TO6A 3LAJA 3E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P92 A;  1YQA A;  3KP3 A;  5ED4 A;  4MTE A;  4JBA A;  2W57 A;  4GGG A;  3ZMT A;  3WG9 A;  1FP2 A;  2VBY A;  3G3Z A;  4ESJ A;  3PQJ A;  3KE2 A;  1R1U A;  3KZY A;  2M87 A;  1FP1 D;  3F8B A;  1G3W A;  4GXO A;  5DUK A;  3ULQ B;  3QPH A;  1MJA A;  2HTS A;  2HQR A;  1XGM A;  4UHT A;  1T0F A;  2RQP A;  1BI2 A;  3ZN0 A;  2PI0 A;  4MEX F;  1ZGA A;  2KRF A;  4XLP F;  2XAJ A;  3V8L A;  4OOI A;  2FE3 A;  5ICG A;  4OIQ F;  1V4R A;  1J2X A;  2NAZ A;  1ZLJ A;  1U2W A;  2OAZ A;  1Z91 A;  3WU0 A;  3G73 A;  1RI7 A;  1R1T A;  2OZ6 A;  4L0Z B;  4RGU A;  3M9A A;  3K69 A;  5L3E A;  3DP7 A;  5FLX Z;  3COA C;  2NNY A;  2YPR A;  1ZRE A;  2OQR A;  3R0J A;  1U5T A;  5LHI A;  1W7P D;  1SMT A;  2XV4 S;  4S04 A;  2HYF A;  5D6E A;  1FBS A;  1R23 A;  3F8N A;  3L00 A;  3WTU C;  1DP7 P;  4R79 A;  5D4S A;  3D5L A;  1P2F A;  4OU0 A;  3HOS A;  4M73 A;  1LEA A;  4M71 A;  4BNC A;  2OU2 A;  3PQK A;  5L3B A;  3WGI A;  4XLN F;  3AAF A;  5DCM B;  1UHM A;  5F6F A;  4ETS A;  4N9H A;  4KN7 X;  4UVC A;  3M8E A;  2LDU A;  4EM2 A;  1K6O A;  3F8M A;  1J9I A;  4RB1 A;  2FMY A;  4BYY A;  4Q4Z F;  2O03 A;  2A3S A;  3DEU A;  4Q5S F;  4FX4 A;  1O3S A;  3F6V A;  4N31 A;  2J5O A;  2P7C B;  1OYY A;  3T8T A;  4N9I A;  4IJA A;  6PAX A;  3P9C A;  1SFU A;  1IN7 A;  3V7R A;  4KMU X;  1ZRD A;  1S6L A;  2DPU A;  1HW2 A;  2F5F A;  2M5W A;  5FFZ A;  5HS7 A;  3W6K B;  5LLQ A;  1JHE A;  3Q9V A;  1U5T B;  1ZGJ A;  2G7H A;  2VBW A;  3J81 Z;  2TDX A;  2HO0 A;  2DK5 A;  1F5T A;  3WTZ A;  4BAY A;  2DK8 A;  1XMK A;  4CO8 A;  2O0Y A;  5BPI A;  3S04 A;  1HBX G;  2JPB A;  1HST A;  3DF8 A;  1S7A A;  3VEP A;  2HWV A;  3K0L A;  1T7D A;  3V7S A;  2QEN A;  5CVI A;  2XGX A;  3GVA A;  3LA7 A;  3HHH A;  5ILS A;  3HRM A;  2VT3 A;  3SHF A;  3TQN A;  4RGR A;  3RKW A;  3JAM K;  4U88 A;  4HOB A;  2VOO A;  3I5U A;  4NV4 A;  1TNT A;  3ISP A;  5E1X A;  4YFN F;  1W5S A;  3KP5 A;  3H3U A;  4IHS A;  2CG4 A;  1CF7 A;  3HIF A;  1WI9 A;  2V6C A;  3DV8 A;  2XIG A;  1KU9 A;  5E8G A;  5A2Q Z;  1F39 A;  4FHT A;  2F5E A;  1R7J A;  4S05 A;  5E1W A;  3H92 A;  2JPC A;  2M30 A;  5FD5 A;  2O61 A;  3HOT A;  4M9S A;  3MCZ A;  1R58 A;  2XRO A;  5FFX A;  3MAJ A;  5J6X A;  2L3D A;  5AON A;  4OIO F;  5LGU A;  1B9M A;  3CUO A;  3L7W A;  4RB3 C;  2QWW A;  1JE8 A;  1HQC A;  2D1H A;  1IW7 F;  2L4M A;  1YFH A;  1T6S A;  5HDK A;  4G94 A;  1REP C;  1QQI A;  2BYV E;  4AVP A;  5CLS A;  2H6C A;  2Q2E A;  1FYK A;  3E6C C;  1J75 A;  5LGT A;  1TNS A;  4JQF A;  4B8X A;  5AIQ A;  3BP8 A;  4MTD A;  4L5J A;  4YFK F;  1K79 A;  1TQI A;  3FZV A;  3BPX A;  4LLG F;  2GXB A;  5IT9 K;  3C3W A;  5FLX K;  1IXR C;  3ELK A;  2HR3 A;  2FQ3 A;  2QUF A;  3IKV A;  1SFE A;  2VE9 A;  2Z3Y A;  1AOY A;  4HX4 A;  1V3F A;  4IXA A;  3ECH A;  3SFZ A;  2KJB A;  5F1R A;  4EJO A;  1S7O A;  1LNW A;  1IXC A;  2XAG A;  1GVJ A;  4HW0 A;  1MZB A;  1XGO A;  3B73 A;  1C0W A;  3FX3 A;  5DCM A;  5F64 A;  3I53 A;  1LQ1 A;  4RGX A;  4AIK A;  4P5O A;  4AD9 A;  1T39 A;  4LD5 A;  2Y75 A;  1HW5 A;  1ZAO A;  3HSE A;  2MBF A;  4KT5 C;  1MDM B;  2GIV A;  4ENJ A;  3U2R A;  4YFX F;  4KDP A;  2MH2 A;  2V1X A;  2FU4 A;  2YU3 A;  5L3D A;  3LA3 A;  4XSX F;  2P5V A;  3DPT A;  1JXS A;  3SZP A;  4QWQ A;  3V4G A;  4IRI A;  2AXL A;  3FMS A;  2GWR A;  3FXU A;  5CYV A;  3F72 A;  4U0W A;  2XAS A;  1U5T C;  1UFM A;  2G9W A;  3E5Q A;  2HGC A;  1HKQ A;  2LF8 A;  1LDD A;  2HQN A;  3WTW C;  3WTT C;  1Z9C A;  2XAQ A;  2FBH A;  5KK1 A;  3GF2 A;  1XB4 A;  1BI0 A;  1L3L A;  1XGN A;  2CWE A;  4HLX A;  3DPL C;  4U7B A;  3CO6 C;  3BOQ A;  3RKX A;  4LGW A;  1X3U A;  3WTV C;  1YW8 A;  3MWM A;  5HS8 A;  3E5X A;  3QU3 A;  3MZY A;  2FEZ A;  1Z1D A;  3JTH A;  1XSV A;  2P5L C;  2OBP A;  3KLN A;  4BHC A;  3QOP A;  3I59 A;  1RUO A;  1OMI A;  3J81 K;  4IVN A;  1TTY A;  1I27 A;  3R6S A;  2LSO A;  1Z7U A;  1J59 A;  4HF1 A;  1UB9 A;  2GQQ A;  4L9J A;  4MEY F;  2MC3 A;  3KCC A;  3ZMZ A;  3K1N A;  4RB0 A;  4CHU A;  1ON2 A;  2J5P A;  4HQE A;  3L09 A;  2O6G E;  4E70 A;  1BM9 A;  2CYY A;  1I1S A;  3GEZ A;  4Q48 A;  2W24 A;  3HRT A;  2DW4 A;  3N4M A;  3HSF A;  1ODD A;  1JGS A;  5E20 A;  3TDU C;  2CFX A;  3NRV A;  3L2C A;  1T98 A;  1ON1 A;  5IT3 A;  2WC2 A;  4HA8 A;  2ISY A;  1LVA A;  5BOX A;  2OD5 A;  1J5Y A;  1W5T A;  4XRF A;  1IN8 A;  4UXN A;  1R5H A;  3IKT A;  4O5V A;  1EH7 A;  4HV5 A;  2VON A;  3ZPL A;  3I59 B;  3KET A;  1KYW A;  1R22 A;  4YIF A;  5JHU A;  1Q1H A;  3GFM A;  3I58 A;  1DPR A;  4DNC A;  1G4D A;  3I71 A;  2K4J A;  3CO7 C;  2DLL A;  3H3Z A;  5D8L B;  4H0E A;  5CVU A;  3K1P A;  5D5U B;  3P9I A;  4HZF A;  1G3T A;  4LG0 A;  4WX9 A;  5JI6 A;  3VOE A;  1RUN A;  4ZH4 F;  2EFO A;  1SD5 A;  2BGC A;  1U78 A;  2STW A;  3LST A;  2H94 A;  2IA0 A;  5JFR A;  2F2E A;  2QQ9 A;  4AIJ A;  5IT9 Z;  1DPU A;  4RAZ A;  4KMF A;  3JAM Z;  1F1Z A;  1BIA A;  1B4A A;  3RDI A;  3DXJ F;  5LHH A;  2PLY A;  1ZG5 A;  1O7F A;  1T38 A;  5DEQ A;  1P4W A;  4A2U A;  5DCF A;  3RPQ A;  1FT9 A;  4BH9 A;  3L9F A;  2ELH A;  1IUY A;  3I4P A;  4ENM A;  5H20 A;  4CGZ A;  3CDH A;  1YYV A;  1GXP A;  3HTU A;  4BXU A;  2UXN A;  2EFN A;  4KNY A;  3J7A O;  5D8K B;  3T0Y A;  3F6O A;  3JTG A;  4M6Y A;  2R7F A;  1TW2 A;  1I6X A;  5CVJ A;  3RYR A;  3ZMD A;  2QBY A;  2FBK A;  2PG4 A;  4HLY A;  1B59 A;  2Z33 A;  1FZP B;  2LF7 A;  2V1D A;  3WGG A;  2IT0 A;  1BBY A;  4G7Z F;  2FXA A;  1WQ2 A;  3TKY A;  4CXF A;  1ZH5 A;  3GWZ A;  3IRQ A;  3KZZ A;  4BHB A;  4EV0 A;  3HRU A;  2A6E F;  1Z6R A;  1YG2 A;  3IWF A;  2Q0O A;  1QNT A;  3EUH A;  4NQW A;  3ZMU A;  3F3X A;  2WV0 A;  3CUQ C;  2BBY A;  4G8X A;  4ZYH A;  3V8K A;  2DAO A;  4MGR A;  1FYM A;  3MQ0 A;  3Q9S A;  1S29 A;  1HXD A;  2ZME A;  1FOK A;  3I54 A;  5D5V B;  4UNO A;  1F9N A;  3IRR A;  3BJ6 A;  3D0S A;  4EJU A;  2VBZ A;  4A0Z A;  3FMQ A;  3SZT A;  4MQ9 F;  4I7H A;  3RJP A;  2IA1 A;  3C1D A;  3DFG A;  3WTY C;  5D4R A;  5D6F A;  1SFX A;  4KIF A;  3VOD A;  1R00 A;  3P9K A;  4G7H F;  1U6G A;  3MZH A;  3PFI A;  4PGH A;  1IN6 A;  5LRS A;  1OYI A;  4EQQ A;  4EGY A;  4XBF A;  2NRA C;  3RTR A;  3TO7 A;  2UXX A;  4IHT A;  1W7P B;  1L0O C;  3ECO A;  3KP2 A;  3FM3 A;  4ZZL A;  3FXR A;  4G9Y A;  3RKY A;  3FF5 A;  2RVC A;  4KFC A;  4ME8 A;  3REO A;  2PMU A;  3F8F A;  3GUD A;  1ZYR F;  1XMA A;  1QPM A;  4PGG A;  1KU2 A;  3DKW A;  3WE2 A;  4CZZ A;  2EWN A;  2PMH A;  4A6D A;  1DDN A;  4F7Z A;  2MH9 A;  3GZ6 A;  3R61 A;  2JRT A;  3QRF F;  1ONV A;  4HF2 A;  4M9Z A;  1AWC A;  1LB2 A;  3J80 K;  3TOB A;  4CYD A;  1WRJ A;  4M72 A;  5TJJ A;  2YR2 A;  1UST A;  3FXQ A;  1K78 A;  3O3K A;  4HV6 A;  1FBU A;  4BQA A;  2VN2 A;  2ESN A;  2XKP A;  1XCV A;  3QPT A;  2IJL A;  3EYY A;  3U9G A;  2LNB A;  3GZ5 A;  2ZKZ A;  3BDD A;  3GFL A;  2EA2 A;  2GA1 A;  1B9N A;  1OR7 A;  2DI3 A;  2DQL A;  2ZNY A;  2QLZ A;  1G6N A;  2ISZ A;  3S2W A;  4WWC A;  3LWF A;  5K1Y A;  1FC3 A;  5FO5 A;  1B6A A;  3B02 A;  1HKS A;  1S3J A;  3CTA A;  1SMY F;  5A2Q K;  4LLN A;  2YX7 A;  4XSZ F;  2NYX A;  3CUQ A;  2L54 A;  2O8X A;  1JHF A;  4PDK A;  4A0X A;  1CF7 B;  5DDG A;  4EJW A;  1D3Y A;  4U7D A;  5KVR A;  2FKD A;  1E17 A;  1SD7 A;  2D1V A;  2HNF A;  1RIO H;  4EM1 A;  1BIB A;  1IN5 A;  3KLO A;  1P4A A;  1BOA A;  1S8N A;  4GYI A;  1RZ4 A;  4IPA A;  4DQ2 A;  5BQT A;  2RKH A;  2DQR A;  4LMY A;  1QZZ A;  5HOO A;  3TGN A;  4BHP A;  3DQV C;  1FSH A;  1KQ8 A;  5LGN A;  1FBQ A;  1KYZ A;  1ZG1 A;  2L01 A;  2KJC A;  3F8C A;  1E2X A;  2RDP A;  1NHA A;  5JVT A;  3EQL F;  4WCG A;  4I09 A;  1PDN C;  4B09 A;  5LEK A;  3E6B A;  2FBI A;  2P7V B;  4UVA A;  3K2Z A;  1BC7 C;  2HKO A;  3E5U A;  1JHH A;  3RI4 A;  3N97 A;  1LDK B;  1XSD A;  2CW0 F;  5J8C A;  3TDZ C;  3ZP5 A;  2Y0M A;  4JK1 X;  4KYW A;  2VC1 A;  2GXG A;  2RNJ A;  4KIC A;  5K5O A;  1MDM A;  1F4K A;  3BWG A;  5DD8 A;  4OMY A;  2QBY B;  4HBL A;  5L3C A;  3WTX C;  5ILU A;  4HX8 A;  3RIR A;  4LLL A;  2AS5 F;  3T5X A;  2E1N A;  4FT8 A;  3V7C A;  4I02 A;  3WOD F;  3W6J B;  1ZG3 A;  5H6R A;  4M6X A;  3C7J A;  2DU9 A;  2D2W A;  5HLH A;  3IIQ A;  1XCB A;  5ERI A;  4IF4 A;  1SD6 A;  1LDJ A;  1ZLK A;  2Q8K A;  3BZ6 A;  2HKX A;  3QP6 A;  4IRH A;  5EEG A;  3R60 A;  3P7N A;  2GZW A;  1XD7 A;  2DTR A;  5J8F A;  4O3M A;  1K78 B;  2P6S A;  3WE3 A;  2VBX A;  1MGT A;  2EK5 A;  1YS6 A;  5L3G A;  3GFI A;  3FMR A;  1D8J A;  2QYO A;  1H9T A;  2XKO A;  2PQ8 A;  3HRS A;  2ZJ2 A;  2A68 F;  1YLF A;  3RYP A;  5HLG A;  3Q5F A;  2IW5 A;  2ZME B;  2EB7 A;  1EV7 A;  4R1H A;  3VB2 A;  2V9V A;  3KFW X;  1ZRF A;  1SAX A;  5HLI A;  4L9N A;  3SQN A;  1HW1 A;  1TBX A;  2PFB A;  3M1E A;  4M9X A;  2XAF A;  1W7P A;  1GXQ A;  1FSE A;  3GW2 A;  2H6B A;  3QP5 A;  2W85 A;  5LRR A;  2FOK A;  3I0T A;  2FNP A;  1STZ A;  3ABU A;  2DFI A;  1KQ9 A;  3F22 A;  3HSR A;  2W25 A;  4EMS A;  1D8K A;  4I01 A;  2FJR A;  2EFP A;  3QU6 A;  2HS5 A;  2UZK A;  3ZMS A;  3TO9 A;  2VE8 A;  4M74 A;  4IRG A;  2ACJ A;  5LEJ A;  2ETH A;  3CJN A;  4I2O A;  4A0Y A;  2K4B A;  5LHG A;  2C6Y A;  4L9T A;  2E7W A;  4ENK A;  1R5G A;  1ULY A;  3HHG A;  1W4M A;  3WGH A;  2QVO A;  1H9G A;  3IC7 A;  1ZHF A;  1DUX C;  4QLC U;  3M7G A;  4EM0 B;  2K27 A;  1JHC A;  1BI1 A;  2B0L A;  4TV7 A;  4MHG A;  1TQM A;  2P8T A;  3OOP A;  4GCV A;  1OKR A;  1PP7 U;  1KN9 A;  4LB5 A;  2O3F A;  2YSR A;  1BJA A;  4G6D A;  4ZYG A;  3CUQ B;  1FYL A;  1I1G A;  5ICE A;  3GXO A;  2HYG D;  1TQP A;  2F5D A;  4I98 B;  2ZO4 A;  4LG0 B;  3E6D A;  1PUE E;  2CO5 A;  4MQV A;  2EFW A;  2KIM A;  5HS9 A;  1LJ9 A;  1ZN2 A;  3O2P E;  1QGP A;  2EV0 A;  4HAM A;  2A6H F;  5CVV A;  1T2K A;  1KGS A;  2EFQ A;  1MJB A;  1Z05 A;  2WWY A;  3ZQ7 A;  1UCR A;  5DV5 A;  2GAU A;  4RAY A;  5E17 F;  1IZ1 A;  1HSJ A;  3BJA A;  5ILV A;  5DUI A;  3KEQ A;  3MFK A;  2QM3 A;  4P55 A;  1I4V A;  5H6Q A;  4OIP F;  4K2E A;  2K86 A;  2EJR A;  3EET A;  5HDG A;  4YG2 F;  1P4X A;  4OIN F;  1BN5 A;  1HKT A;  1KU7 A;  4L9V A;  2UWM A;  3ERE D;  2DO7 A;  4A5N A;  3BDN A;  1WKM A;  4WXH A;  4LK0 F;  4LJZ F;  4L5I A;  2Z5U A;  2D45 A;  4ENN A;  1FLI A;  1YIO A;  3E3V A;  1YO5 C;  2K7L A;  2HFH A;  3HTS B;  4LK1 F;  2RC4 A;  1MKM A;  2LKP A;  1IAW A;  2W84 A;  4P9U A;  4GO1 A;  3OV8 A;  1LEB A;  3M8F A;  5ICC A;  1IN4 A;  1O3T A;  1KU3 A;  1YS7 A;  4A6E A;  2ESH A;  2H09 A;  2EV6 A;  3IHU A;  1QZY A;  2P6T A;  2HTJ A;  5FD6 A;  2BEO A;  1O3Q A;  3JW4 A;  2RN7 A;  2OZU A;  3F21 A;  4U0V A;  2YX4 A;  3LQR A;  3R0A A;  1UHW A;  1O7L A;  1IRG A;  1O3R A;  2A5Y B;  2K02 A;  3NEU A;  4HDV A;  4HX7 A;  4WXC A;  5HDN A;  3BJO A;  5CJ9 A;  3WTS C;  2RV8 A;  1RNL A;  1CGP A;  4A12 A;  2KIF A;  3ML6 A;  5E1Z B;  2KKO A;  3K9T A;  3T8R A;  4GYG A;  2ZBK A;  4D0P A;  4UV9 A;  2Z9O A;  1EH8 A;  4ZYE A;  5BMZ A;  2V79 A;  4EVI A;  5BPD A;  4ZYD A;  4WK8 F;  2M8E A;  4PCQ A;  2PN6 A;  3FWE A;  3GX4 X;  1YW9 A;  3BY6 A;  3FHZ A;  4Q47 A;  2P5K A;  1XN7 A;  5DD4 A;  2PEX A;  1D5V A;  2HZT A;  2CGP A;  5FB2 A;  3U1D A;  2M45 A;  1PP8 F;  1MJ9 A;  1YTY A;  1XGS A;  2PJP A;  4UVB A;  3ROU A;  4CIC A;  1I5Z A;  5LBQ A;  4P96 A;  2WTE A;  4WF2 A;  5BS6 A;  2R7D A;  2PBI A;  1ZAR A;  1GHC A;  4ESF A;  4N0B A;  5L3F A;  2ZNZ A;  3EDP A;  2VC0 A;  2Y48 A;  5TRD A;  4KA4 A;  3NQO A;  1H0M A;  3QAH A;  5DYM A;  1XDS A;  1A04 A;  1YW7 A;  2BE5 F;  2M1B A;  1QO0 D;  5HVQ C;  2FML A;  3CLO A;  1MD0 A;  4KIB A;  2ADU A;  3KP7 A;  3E6M A;  3R4K A;  5AIP A;  4O6J A;  3I64 A;  5K5Q A;  1Y0U A;  4L0Y B;  4UUV A;  1U8R A;  2ZXJ A;  1FY7 A;  5D5X B;  3K1M A;  3GFJ A;  1ZRC A;  4HDU A;  1J7K A;  4CDG A;  4UV8 A;  1SD4 A;  3T1B A;  5E18 F;  2L4A A;  1WSU A;  4PZJ A;  3C18 A;  1TW3 A;  1BI3 A;  2QQB A;  4L18 B;  2FNA A;  2JZY A;  4AIH A;  2A69 F;  2XVC A;  3O6B B;  4MNU A;  1QBJ A;  4KUM A;  2E1C A;  2XUB A;  2BV6 A;  3KEO A;  1O57 A;  4KIG A;  3HUG A;  4Y17 A;  3GYH X;  2H27 A;  5E8I A;  2VOD A;  3ZMV A;  2MD5 A;  4P9F A;  3WU1 B;  4I0A A;  5D5W B;  4HQM A;  4Y13 A;  4HYE A;  3IL2 A;  3ABT A;  2ZFW A;  1KCA A;  2Z99 A;  3GLX A;  3ZN1 A;  1FNN A;  4G7O F;  1XSX A;  3LA2 A;  4RB2 C;  2X0L A;  4I0B A;  2QZ8 A;  2X4H A;  2DT5 A;  2STT A;  5CVR A;  2A07 F;  3FM5 A;  1Z6T A;  3HYI A;  4ESB A;  5K5R A;  2JTV A;  2OA4 A;  1IF1 A;  2KIU A;  4OIR F;  3SXY A;  4R8H A;  4OMZ A;  2MLK A;  2NS0 A;  1KQ0 A;  3TOA A;  2F5C A;  2G7U A;  2RGV A;  4RGS A;  4NHJ A;  1R1V A;  1AY9 A;  1VTN C;  2XRN A;  2COM A;  2MLG A;  2DBB A;  2IRF G;  2R3S A;  5JR3 A;  2ZCW A;  4Y15 A;  4LFU A;  3JSO A;  1IRF A;  2HOE A;  4U0Y A;  3LFK A;  2XHK A;  4LB6 B;  1B1B A;  1UMU A;  1J0R A;  2DPD A;  4WXD A;  2IPQ X;  4K8W A;  2FSW A;  2VXZ A;  3EYI A;  1BC8 C;  2MA3 A;  2XAH A;  1R36 A;  2A61 A;  1P6R A;  4EJT A;  2L02 A;  1FX7 A;  4EJV A;  4NB5 A;  2FA5 A;  3V8J A;  4FX0 A;  5FGM A;  3LAP A;  4RS8 A;  2NNN A;  4A5M A;  1U3E M;  3BRO A;  5ICF A;  4Z2Y A;  1G3Y A;  2FRH A;  2JT1 A;  1TLH B;  1K7A A;  1WWX A;  3RPU A;  3VFZ A;  2HEO A;  4AWX B;  2EA4 A;  1G3S A;  3JSP A;  1XDU A;  1KA8 A;  4ZZD A;  4KN4 X;  4G6Q A;  3MEX A;  2GA2 A;  1FPQ A;  2V1U A;  2OQG A;  2FF4 A;  2P4W A;  1IXS B;  3F23 A;  1OYW A;  4HF0 A;  3KP6 A;  2CSO A;  2EV5 A;  3J80 Z;  2CQK A;  2VOP A;  4EGZ A;  2VT2 A;  1OPC A;  4ON0 A;  4ASN A;  3GO5 A;  1FWZ A;  2E7X A;  4YII A;  2JSC A;  1EH6 A;  2IP2 A;  3KP4 A;  1B12 A;  1USS A;  3LQQ A;  5EEH A;  2IA2 A;  2HDC A;  2IVM A;  3BPV A;  2QQA A;  3IWZ A;  3TO6 A;  3LAJ A;  3E97 A; 
#chains in the Genus database with same CATH topology
 1P92 A;  1YQA A;  2EIN H;  1ITY A;  3FIS A;  3KP3 A;  4XM3 A;  5ED4 A;  4MTE A;  2R7Z J;  4JBA A;  4CZC A;  3C2B A;  2HYJ A;  4A3G J;  2W57 A;  4GGG A;  1F36 A;  3ZMT A;  3WG9 A;  1FP2 A;  2VBY A;  3G3Z A;  4ESJ A;  1IGN A;  3PQJ A;  2XF7 A;  3KE2 A;  1R1U A;  2CV0 A;  1M1E B;  2KZV A;  1FTT A;  3IH2 A;  3IV5 A;  3KZY A;  2M87 A;  1FP1 D;  4IHX A;  1D1C A;  1H8A C;  4D1Q A;  3FBN B;  3F8B A;  4IHV A;  1G3W A;  4GXO A;  5DUK A;  3ULQ B;  3CMY A;  3QPH A;  1MJA A;  2HTS A;  2CUF A;  4XRM A;  2HQR A;  4CA0 A;  2WV1 A;  4I76 A;  5F0F A;  3S3N A;  1EF4 A;  2ZB9 A;  1XGM A;  2F48 A;  2PMZ N;  4UHT A;  2NVX J;  1T0F A;  1BR1 A;  2OUM A;  2CU7 A;  1K83 J;  1XTA A;  2RQP A;  1BI2 A;  3KZI C;  3ZR8 X;  3AL0 B;  3ZN0 A;  3AG4 H;  2PI0 A;  4E7L A;  4MEX F;  1ZGA A;  2KRF A;  2ZME C;  4XLP F;  3BR1 A;  2BVM A;  2XAJ A;  1FOW A;  3V8L A;  4OOI A;  2FE3 A;  5EYR A;  5ICG A;  1YJ9 I;  4OIQ F;  1V4R A;  3EPZ A;  1J2X A;  1U0J A;  2IS2 A;  2NAZ A;  1ZLJ A;  1U2W A;  3RSN A;  3S17 J;  1TZL A;  2OAZ A;  3OL4 A;  1Z7L A;  1Z91 A;  3WU0 A;  3G73 A;  1RI7 A;  5GAG J;  3KEY A;  1A6Q A;  1R1T A;  2OZ6 A;  4RGU A;  4L0Z B;  3M9A A;  3K69 A;  5L3E A;  3DP7 A;  1BOB A;  5FLX Z;  3COA C;  2NNY A;  2YPR A;  1ZRE A;  2OQR A;  2VI6 A;  1X3Z B;  3FK7 A;  3R0J A;  1U5T A;  5LHI A;  1W7P D;  3PSF A;  1SMT A;  1MNE A;  2XV4 S;  3CQZ J;  4S04 A;  1R9T J;  1WJD A;  1IUF A;  2HYF A;  2EIJ H;  1Y56 A;  2TRT A;  3H5N A;  5D6E A;  2A5W A;  2W48 A;  1FBS A;  2LR8 A;  1R23 A;  1B72 B;  3F8N A;  3L00 A;  3WTU C;  2QKM B;  1DP7 P;  2XAU A;  4R79 A;  5D4S A;  1FIP A;  3D5L A;  1E0E A;  1P2F A;  4OU0 A;  2CRG A;  3AKZ A;  3HOS A;  4BJ6 C;  4M73 A;  1EJ9 A;  1LEA A;  4M71 A;  1T95 A;  4RAF A;  1NK3 P;  3ABM H;  2FX0 A;  4BNC A;  2VJ5 A;  2OU2 A;  2KZG A;  1LEB A;  3K4B A;  4GFB A;  2K3P A;  2Y0S N;  2R5Z B;  2HOA A;  3PQK A;  5L3B A;  3WGI A;  4P1W A;  3M1C A;  4XLN F;  2DOD A;  3AAF A;  5DCM B;  1CQT A;  4V2G A;  1UHM A;  5F6F A;  4ETS A;  1AHD P;  4QPQ A;  5K7F A;  2XGE A;  2YUS A;  4OAZ A;  2WB1 N;  3VYU B;  2MFZ A;  2BXY A;  4KN7 X;  4N9H A;  5GAE J;  4UVC A;  3CC2 I;  3M8E A;  1WJF A;  2VUM J;  2LDU A;  4EM2 A;  1JGG A;  2R0Q C;  1K6O A;  2F4M B;  3F8M A;  1J9I A;  4RB1 A;  2FMY A;  4BYY A;  4Q4Z F;  2O03 A;  2A3S A;  3DEU A;  4Q5S F;  1FOX A;  4FX4 A;  3OYB A;  1O3S A;  4A3F J;  1W36 C;  3F6V A;  4N31 A;  2J5O A;  2WAQ A;  2LKS A;  2KP6 A;  3ZQF A;  3SEZ A;  1OYY A;  2P7C B;  3T8T A;  4N9I A;  4IJA A;  3ASN H;  6PAX A;  2VIX A;  4OAY A;  2MG4 A;  3P9C A;  3GTP J;  5JVG F;  1SFU A;  1IN7 A;  2W1O A;  1WPK A;  3ONQ A;  2R5Y A;  3V7R A;  4KMU X;  1ZRD A;  4IHW A;  1OQY A;  1S6L A;  4IHY A;  4ABZ A;  1HW2 A;  2DPU A;  2F5F A;  1ENH A;  4X0G A;  3K4N A;  2XGC A;  2M5W A;  2W00 A;  4UB6 C;  5FFZ A;  5HS7 A;  3W6K B;  5LLQ A;  1JHE A;  3Q9V A;  2NVU B;  4FAS D;  1U5T B;  4PJN A;  1ZGJ A;  2G7H A;  1R5I D;  2K9Q A;  1HDP A;  2VBW A;  4C3I J;  4LG3 A;  3J81 Z;  2R7O A;  2K85 A;  2TDX A;  3OSF A;  2HO0 A;  2DK5 A;  2LBF B;  2KIS A;  1ZR4 A;  1F5T A;  4XR6 A;  3WTZ A;  1VQ5 I;  4BAY A;  4B44 A;  2DK8 A;  2X6O A;  3ESW B;  1XMK A;  3KIO A;  4BKX A;  3FXO A;  4CO8 A;  5B1B H;  2O0Y A;  5BPI A;  3S04 A;  1OLT A;  1HBX G;  3S3O A;  2ECC A;  1HST A;  2JPB A;  2FQ4 A;  3DF8 A;  1S7A A;  3VEP A;  2AXT C;  4HNU A;  2HWV A;  2CV2 A;  3K0L A;  1VQN I;  1T7D A;  3V7S A;  2QEN A;  5CVI A;  2I5U A;  2E1M C;  2XGX A;  3GVA A;  3LA7 A;  3HHH A;  4FE4 A;  2R7X A;  4D5F A;  5ILS A;  3G1O A;  3HRM A;  2VT3 A;  3PUF A;  4IL6 C;  5IYC J;  3SHF A;  3TQN A;  4RGR A;  3RKW A;  3JAM K;  4U88 A;  2RQQ A;  3BG3 A;  1S72 I;  4KIS A;  2ICW G;  4HOB A;  2VOO A;  1LE8 B;  3I5U A;  1X2N A;  5KAF C;  5EG0 A;  4NV4 A;  3M07 A;  5DTD A;  1TNT A;  5GP9 A;  3B6A A;  3ISP A;  5E1X A;  2OV7 A;  4YFN F;  1X4O A;  1W5S A;  3KP5 A;  3H3U A;  5M5X J;  4IHS A;  2CG4 A;  4BJ5 C;  3BZC A;  1CF7 A;  3GBG A;  3H9J A;  1WI9 A;  3HIF A;  2V6C A;  3DV8 A;  3QPS A;  2XIG A;  5IP9 J;  3HM5 A;  1KU9 A;  1MBF A;  4BY7 J;  5H2F C;  1ZK8 A;  2JA5 J;  3OY9 A;  5E8G A;  1WHU A;  5A2Q Z;  2DN0 A;  5LD2 C;  1F39 A;  4FHT A;  2F5E A;  1R7J A;  3S15 J;  4S05 A;  3HUG B;  5E1W A;  1VQ7 I;  1MSF C;  3H92 A;  4ZDO A;  2JPC A;  1QZE A;  2HVQ A;  2WB1 A;  2M30 A;  1X1B A;  4MO7 A;  5FD5 A;  4Z6Y A;  2O61 A;  2EZK A;  3J7Z I;  3HOT A;  1ACI A;  1S5L C;  2BHZ A;  4M9S A;  5FRN A;  2ZXH A;  3MCZ A;  2CS3 A;  3H0G J;  2ID6 A;  1R58 A;  2XRO A;  4MFD A;  3CDL A;  5FFX A;  3HGY A;  3MAJ A;  2CUE A;  2Y69 H;  5J6X A;  2L3D A;  5AON A;  3LSI A;  3AL0 C;  4OIO F;  2E2I J;  5LGU A;  1B9M A;  1RKW A;  3CUO A;  3L7W A;  2DOA A;  4RB3 C;  2QWW A;  1JE8 A;  4JP0 A;  1HQC A;  2D1H A;  1QPI A;  1IW7 F;  2L4M A;  1YFH A;  3ZGK A;  1T6S A;  5TGT A;  5HDK A;  4G94 A;  2CQQ A;  2BW3 A;  2DXI A;  9ANT A;  1REP C;  1QQI A;  2BYV E;  2HZD A;  4AVP A;  4BBS J;  2KDO A;  2QGU A;  5CLS A;  2H6C A;  2Q2E A;  1FYK A;  3E6C C;  1J75 A;  2EIL H;  5LGT A;  3DU5 A;  1TNS A;  3CC7 I;  4JQF A;  4B8X A;  5AIQ A;  1QHG A;  3BP8 A;  4MTD A;  4L5J A;  1IRZ A;  5JLX A;  2ELK A;  2R4G A;  4DGW B;  4YFK F;  1K79 A;  3K6G A;  1X1C A;  1TQI A;  3FZV A;  3BPX A;  4LLG F;  2QQ8 A;  2GXB A;  1PYV A;  5IT9 K;  3C3W A;  5FLX K;  3PIP F;  2DMU A;  1IXR C;  3ELK A;  2ZJP F;  2HR3 A;  1GT0 C;  2E2J J;  2FQ3 A;  2QUF A;  1UAA A;  3W6V A;  4IX7 A;  3CCL I;  3IKV A;  5JLW A;  1EA3 A;  3HOV J;  2VQG A;  1SFE A;  3Q0V A;  1IO2 A;  2VE9 A;  2Z3Y A;  1AOY A;  4HX4 A;  1V3F A;  2EIM H;  3DKX A;  4IXA A;  3ECH A;  3SFZ A;  2KJB A;  2VPR A;  4AU7 A;  5GAD J;  5F1R A;  2F4I A;  4XLF A;  1YOV B;  1VQL I;  4EJO A;  1S7O A;  3QOD A;  1LNW A;  1IXC A;  3NAU A;  2LY9 A;  3HXL A;  4MFE A;  5GTI C;  2XAG A;  1GVJ A;  2LP0 A;  4HW0 A;  5E3L A;  2LMD A;  1MZB A;  1XGO A;  4X1E A;  1Y8R B;  2JMW A;  3B73 A;  4JOM A;  5FRM A;  3HB9 A;  1BW5 A;  1HC8 A;  5C4J J;  2Y0S A;  1C0W A;  3FX3 A;  3E0J B;  5DCM A;  3Q0W A;  5F64 A;  3GLL A;  3I53 A;  1LQ1 A;  3BR2 A;  4RGX A;  3S3M A;  4AIK A;  4P5O A;  4AD9 A;  1T39 A;  3FBI B;  3OYA A;  4LD5 A;  2Y75 A;  1HW5 A;  2WY7 Q;  1ZAO A;  3HSE A;  2MBF A;  4KT5 C;  1MDM B;  2GIV A;  3PNV A;  4ENJ A;  3U2R A;  4YFX F;  2DYS H;  3SFI A;  2MH2 A;  4KDP A;  2V1X A;  2FU4 A;  1IJW C;  1FMV A;  2YU3 A;  2ELJ A;  2EH3 A;  3W2A A;  5L3D A;  1HLV A;  3LA3 A;  4XSX F;  2P5V A;  3H36 A;  3DPT A;  2VKH A;  1JXS A;  1T08 B;  4ZJZ A;  4W97 A;  3OSG A;  3QYF A;  4BUP A;  3BC8 A;  3SZP A;  4QWQ A;  3V4G A;  1DP3 A;  1MMA A;  4IRI A;  1NTC A;  2AXL A;  3FMS A;  1XS9 A;  2GWR A;  3LMM A;  2L9V A;  3U1K A;  3FXU A;  1W0U A;  5CYV A;  3F72 A;  2M9H A;  4BGD A;  2L7M P;  1S7E A;  1YE9 A;  3SYT A;  5KHD A;  3HGG A;  2WAE A;  4U0W A;  3K4J A;  2XAS A;  3DWL E;  1U5T C;  2RRE A;  1IDY A;  1ETV A;  1UFM A;  2G9W A;  3E5Q A;  2HGC A;  1HKQ A;  2LF8 A;  4DYQ A;  1LDD A;  2HQN A;  3WTW C;  3WTT C;  1Z9C A;  2XAQ A;  1ZEL A;  3A2K A;  1GV2 A;  3VPR A;  5E79 C;  2FBH A;  4QTR A;  2W7N A;  5KK1 A;  1OCT C;  2X9D A;  3GF2 A;  1XB4 A;  2JA6 J;  2HNH A;  4EEF G;  3GTO J;  2WA0 A;  1BI0 A;  1L3L A;  3G1M A;  3OS0 A;  1XGN A;  2CWE A;  3PNT A;  3EUH C;  3CF5 F;  4HLX A;  3DPL C;  4U7B A;  3CO6 C;  1JT6 A;  4CCO A;  2BY0 A;  3BOQ A;  3RKX A;  4LGW A;  4RM3 A;  1D0Y A;  1X3U A;  3WTV C;  1AA7 A;  1YW8 A;  4AM3 A;  3OS1 A;  3MWM A;  2JA2 A;  5HS8 A;  3Q3S A;  3PO3 J;  3E5X A;  3QU3 A;  3JR9 A;  3RCO A;  1R4N B;  2ZFU A;  3E1S A;  3MZY A;  2FEZ A;  1DQU A;  1Z1D A;  2XF6 A;  3D5S C;  3CME I;  3JTH A;  1XSV A;  2P5L C;  2OBP A;  3KLN A;  4BHC A;  5IYB J;  3W2W A;  2HOS A;  3QOP A;  4C9Y A;  1ETY A;  2EIK H;  3I59 A;  2VLA A;  2DMN A;  3H35 A;  2LFB A;  1RUO A;  4XLA A;  1OMI A;  1UG2 A;  3RQI A;  3OYF A;  1TWC J;  3H5R A;  3J81 K;  4IVN A;  5BNG A;  1ETK A;  1TTY A;  1I27 A;  3R6S A;  2LSO A;  1Z7U A;  1J59 A;  2V4J C;  4HF1 A;  4IKF A;  3G2B A;  1UB9 A;  2GQQ A;  4L9J A;  2A05 A;  4II2 A;  4MEY F;  2MC3 A;  2DCE A;  3KCC A;  2IGK A;  3ZMZ A;  5F0C A;  2MW8 A;  3HEF A;  3K1N A;  4RB0 A;  4CHU A;  3IAS 2;  1ON2 A;  2J5P A;  4HQE A;  1TWG J;  3L09 A;  3K70 D;  2O6G E;  3CCV I;  4E70 A;  2K9S A;  1LFB A;  1BM9 A;  2QSF X;  2CYY A;  1I1S A;  2E5Z A;  4AID A;  4XOT A;  3GEZ A;  2HPM A;  1X3W B;  4Q48 A;  2W24 A;  3HRT A;  1N25 A;  2DW4 A;  3M4O J;  3N4M A;  1QVU A;  3TW6 A;  2DDB A;  4ANJ A;  3HSF A;  3G1L A;  3HZJ A;  3OYK A;  1ODD A;  3ZQQ A;  1JGS A;  5E20 A;  3TDU C;  3ZCO A;  3BTJ A;  4BE0 A;  4A3I J;  2CFX A;  3NRV A;  3K4K A;  3L2C A;  1T98 A;  1ON1 A;  3CMM A;  4HNT A;  5IT3 A;  2WC2 A;  1N78 A;  4HA8 A;  2ISY A;  1LVA A;  4II3 A;  2OF7 A;  1V55 H;  4BQQ A;  2OD5 A;  4CCK A;  5BOX A;  2KRC A;  1TP4 A;  1J5Y A;  4C3H J;  1W5T A;  1UZC A;  1U8B A;  4NQW B;  4XRF A;  1IN8 A;  4UXN A;  4A3E J;  1R5H A;  3AG2 H;  3IKT A;  4O5V A;  1SC7 A;  2V9P A;  3V42 A;  1EH7 A;  4HV5 A;  2VON A;  3ZPL A;  1UEL B;  2EZH A;  1QHH D;  3JRB A;  3I59 B;  2BY1 A;  3KET A;  1Y1V J;  3LSR A;  1KYW A;  1R22 A;  1RR7 A;  5F27 A;  4YIF A;  5JHU A;  1Q1H A;  1ETX A;  3GFM A;  3C2H A;  3I58 A;  3IH3 A;  1WH7 A;  5J47 A;  5IY5 H;  1DPR A;  5IYD J;  4DNC A;  1G4D A;  2W4S A;  4J01 A;  3I71 A;  2KLO A;  3HOY J;  5GTH C;  2XPU A;  2K4J A;  4M3E A;  3CO7 C;  2DLL A;  2BXZ A;  1BA5 A;  1UJ8 A;  1OIS A;  4YIR X;  1A31 A;  2DFH A;  3H3Z A;  4FE7 A;  5D8L B;  4PJM A;  2Z16 A;  5CQG A;  1WJC A;  2LY1 A;  3X2Q H;  2Y9Y A;  4H0E A;  2VQH A;  5CVU A;  4BBR J;  3K1P A;  5D5U B;  3P9I A;  4HZF A;  1JUM A;  5FKO A;  2RAE A;  1G3T A;  4LG0 A;  4XKW A;  4WX9 A;  1V5F A;  5JI6 A;  2V7F A;  5EZG A;  3VOE A;  1RUN A;  3HOW J;  3A4C A;  5IP7 J;  4ZH4 F;  2H1L A;  2DA4 A;  4BEH A;  4A3K J;  2EFO A;  4AUX A;  4XOP A;  1SD5 A;  2BGC A;  1U78 A;  2STW A;  3LST A;  2H94 A;  1A35 A;  3CCM I;  2IA0 A;  5JFR A;  2F2E A;  2QQ9 A;  4AIJ A;  2EZI A;  5IT9 Z;  4F91 B;  3K4C A;  2JUC A;  1DPU A;  3MN2 A;  3BCB A;  4RAZ A;  4F52 A;  4KMF A;  3PUB A;  2DT7 B;  3JAM Z;  3KYC B;  2AQE A;  1F1Z A;  2FUG 2;  1BIA A;  4BU2 A;  1B4A A;  3FDY A;  1I6H J;  3RDI A;  4FQG A;  3DXJ F;  3CES A;  4Y3O A;  1VQ6 I;  5LHH A;  2PLY A;  3S16 J;  1ZG5 A;  4QPO A;  4PSX A;  4H4K C;  5CKT A;  2WAQ N;  3MMY B;  2A6T A;  3BR5 A;  1O7F A;  1XMX A;  5DEQ A;  1T38 A;  1P4W A;  1ZQ3 P;  2R7S A;  4A2U A;  5DCF A;  3RPQ A;  1FT9 A;  3PL8 A;  1HDD C;  4BH9 A;  1F43 A;  3L9F A;  4BAC A;  2ELH A;  5CPR B;  1VND A;  1IUY A;  3I4P A;  5FLM J;  3CDI A;  2M7A A;  4ENM A;  5H20 A;  4CGZ A;  3CDH A;  1YYV A;  1GXP A;  3HTU A;  4BXU A;  1Z3Y A;  4IZZ A;  2UXN A;  1FJL A;  4UY8 I;  2EFN A;  2MGQ A;  3WHC A;  4RA2 A;  2KDZ A;  4KNY A;  2R92 J;  3KPH A;  2NS7 A;  3J7A O;  2I10 A;  1WCM J;  5D8K B;  3T0Y A;  3F6O A;  3CP8 A;  3JTG A;  1YHQ I;  4LIV A;  4M6Y A;  2R7F A;  1TW2 A;  1I6X A;  5CVJ A;  3UKG A;  1JKQ C;  1OFC X;  3RYR A;  2K9L A;  3WG7 H;  2E71 A;  3FK6 A;  3ZMD A;  2VL8 A;  4ZTF A;  2QBY A;  5K7H A;  2M3A A;  2FBK A;  2CUZ A;  2PG4 A;  4HLY A;  1G8X A;  1B59 A;  3OR2 C;  1VQO I;  2Z33 A;  4ZC3 A;  1FZP B;  2LF7 A;  2V1D A;  3WGG A;  5M5Y J;  2IT0 A;  1BBY A;  4CSW A;  4G7Z F;  2FXA A;  1WQ2 A;  1V5G A;  2G0E A;  2KMU A;  1H89 C;  3TKY A;  4CXF A;  1ZH5 A;  4C30 A;  3GWZ A;  3KZZ A;  3IRQ A;  4BHB A;  1B72 A;  4EV0 A;  3HRU A;  2A6E F;  1Z6R A;  1YG2 A;  3IWF A;  2JRM A;  1ETQ A;  2Q0O A;  5FLV A;  1QNT A;  2BHY A;  3EUH A;  4NQW A;  3ZMU A;  3SDB A;  3A1Y A;  3F3X A;  3EUK L;  2DA2 A;  2PJR A;  2WV0 A;  3CUQ C;  4PSW A;  2BBY A;  4G8X A;  3LOC A;  2Z2S B;  1N77 A;  3PM1 A;  4ZYH A;  3V8K A;  3JRA A;  2DAO A;  2AO9 A;  5DM7 F;  1V54 H;  4MGR A;  3GZN B;  2MYS A;  1E3O C;  2LOO A;  1FYM A;  3MQ0 A;  3Q9S A;  1BL0 A;  1S29 A;  1HXD A;  2ZME A;  3H9G A;  4KT6 A;  4F55 A;  1FOK A;  2GBY A;  1PUF A;  3OYI A;  2O7O A;  4J19 A;  1RET A;  3I54 A;  3J7Y J;  5D5V B;  4UNO A;  1F9N A;  2VJI A;  3IRR A;  1T0F C;  3BJ6 A;  3D0S A;  3HG9 A;  3OMY A;  1YJN I;  4EJU A;  1A6I A;  2VBZ A;  4A0Z A;  3FMQ A;  2VQL A;  3GTQ J;  3I3L A;  3I9V 2;  1MW7 A;  3SZT A;  3VSK A;  4MQ9 F;  3B6C A;  2R7U A;  4I7H A;  3RJP A;  2IA1 A;  3C1D A;  3DFG A;  3UNG C;  4D7N A;  3WTY C;  4B3A A;  5D4R A;  5D6F A;  1SFX A;  5EGO B;  1VF9 A;  4E7S A;  4KIF A;  3VOD A;  1DGW Y;  1MBH A;  1R00 A;  3ZOB A;  3P9K A;  4G7H F;  2KRH A;  1U6G A;  5B3S H;  2HVS A;  1JJ8 C;  1D1B A;  2OJE D;  3PFI A;  3MZH A;  2IS6 A;  4PGH A;  4PUS A;  1IN6 A;  2GM4 A;  5LRS A;  1OYI A;  1POG A;  1VQ9 I;  5E3O A;  4X6A J;  4EQQ A;  4EGY A;  4RBO A;  4XBF A;  1OCR H;  2BVL A;  2NRA C;  3RTR A;  2HQA A;  3TO7 A;  2UXX A;  4IHT A;  4E7H A;  1W7P B;  3HKZ A;  5E3M A;  1L0O C;  1B8I B;  2BOL A;  3ECO A;  2IXS A;  3KP2 A;  4U87 A;  3MKY B;  3H5A A;  3FM3 A;  4ZZL A;  3FXR A;  4G9Y A;  1QVT A;  3RKY A;  4FTH A;  3FF5 A;  3CCS I;  1IRX A;  2RVC A;  4KFC A;  1MSE C;  4Y33 A;  4ME8 A;  4BDZ A;  3REO A;  2PMU A;  3FXK A;  3F8F A;  3GUD A;  2KT0 A;  1MMS A;  1ZYR F;  4D9J A;  1XMA A;  3D5R C;  1MIJ A;  1QPM A;  1KU2 A;  4PGG A;  3DBR B;  3DKW A;  4M3F A;  3WE2 A;  4CZZ A;  1YI2 I;  2L9N A;  4ZDL A;  2EWN A;  2ZSH B;  2PMH A;  2DYR H;  4JX6 A;  4A6D A;  4B48 A;  4F7Z A;  2MH9 A;  1DDN A;  2EQR A;  1ETO A;  3MVP A;  3GZ6 A;  4HG2 A;  3OIQ A;  1GLN A;  3R61 A;  2JRT A;  2JWT A;  3QRF F;  1ONV A;  4HF2 A;  4M9Z A;  1AWC A;  1LB2 A;  3CJQ B;  3J80 K;  3TOB A;  4CYD A;  5J1R A;  2IS1 A;  1WRJ A;  3ABL H;  3DCF A;  4M72 A;  5TJJ A;  1P9Q C;  1TWH J;  3BQY A;  2YR2 A;  3H1C A;  1UST A;  3HL2 A;  3CCR I;  3FXQ A;  2COB A;  1K78 A;  1WFX A;  3O3K A;  4HV6 A;  1FBU A;  4BQA A;  2VN2 A;  2DA6 A;  2PMZ A;  3FXM A;  2ESN A;  4NC7 A;  5HNH A;  3OYH A;  1IV8 A;  2DJI A;  2XKP A;  1XCV A;  3QPT A;  2IJL A;  3EYY A;  3QQA A;  4BS9 A;  3U9G A;  2LNB A;  3GZ5 A;  2HDW A;  2Z1D A;  3QOE A;  1YIT I;  2ZKZ A;  3BDD A;  4CCL A;  3S1R J;  3IUO A;  4CYC B;  3S32 A;  1SAU A;  3GFL A;  2EA2 A;  2GA1 A;  2HVR A;  1UG0 A;  4N4O B;  4AC0 A;  5F08 A;  1FIA A;  4UUS A;  1B9N A;  2ECB A;  1SFK A;  1OR7 A;  2DI3 A;  4A3M J;  3S1Q J;  2DQL A;  2ZNY A;  2QLZ A;  1G6N A;  2ISZ A;  3DPU A;  3S2W A;  4WWC A;  3P5J A;  2N8G A;  1G59 A;  2K9N A;  4HPQ A;  2V9K A;  3LWF A;  1LUJ B;  5K1Y A;  5FJ8 J;  1DU6 A;  1T8I A;  1FC3 A;  3BTL A;  3PSI A;  5FO5 A;  2CFO A;  2M34 A;  1B6A A;  3B02 A;  1X58 A;  1KON A;  2ZXW H;  1HKS A;  1S3J A;  2LH9 A;  3LSM A;  3CTA A;  1SMY F;  3VYR B;  5A2Q K;  4LLN A;  2HU9 A;  2YX7 A;  3JRG A;  4ITV A;  2DT6 A;  4XSZ F;  2NYX A;  3CUQ A;  2IGO A;  2L54 A;  2O8X A;  2WAF A;  1JHF A;  4PDK A;  4A0X A;  1QU3 A;  1CF7 B;  2MC4 A;  5DDG A;  3JCU C;  4EJW A;  1GUU A;  1D3Y A;  4U7D A;  2FOW A;  5KVR A;  3DKY A;  2DA1 A;  2FKD A;  3K2A A;  2BY2 A;  2IEK A;  5EGO A;  1E17 A;  2QF7 A;  1SD7 A;  2D1V A;  1JTX A;  2HNF A;  1RIO H;  4EM1 A;  1BIB A;  1P7J A;  1Z21 A;  5FKN A;  1IN5 A;  1IV6 A;  2X1D A;  3KLO A;  4PK4 A;  1P4A A;  1BOA A;  1X1P A;  3VYT B;  5DM6 F;  1RES A;  1S8N A;  3OIO A;  4GYI A;  1RZ4 A;  4IPA A;  1YJW I;  4DQ2 A;  5BQT A;  4XIC A;  2RKH A;  2DQR A;  2GOM A;  4UB8 C;  3TW7 A;  2JQ7 A;  4V19 K;  4LMY A;  2E1M B;  3UR3 C;  2NVY J;  1LVK A;  2LVS A;  2NVT J;  1QZZ A;  4XON A;  5HOO A;  3TGN A;  1R6R A;  4BHP A;  3PNY A;  3DQV C;  2VKD A;  1FSH A;  1KQ8 A;  2HXI A;  2CQ7 A;  1UHS A;  5LGN A;  1D1A A;  1FBQ A;  1KYZ A;  1ZG1 A;  2KFD A;  1LFP A;  2L01 A;  2KJC A;  3F8C A;  1E2X A;  2WBM A;  2RDP A;  1NHA A;  3TMO A;  5JVT A;  1O4X A;  2YS9 A;  3EQL F;  4WCG A;  4I09 A;  1PDN C;  4B09 A;  4CCM A;  3BQZ A;  5LEK A;  3H3V K;  2E5N A;  3E6B A;  2FBI A;  2P7V B;  1OCZ H;  2CQX A;  4FET A;  3ABK H;  4UVA A;  3K2Z A;  4AYB N;  2IGM A;  1BC7 C;  2ME0 A;  2HKO A;  3QYB A;  4RDU A;  2CQN A;  3E5U A;  3LSH A;  3L2V A;  2KQR A;  1JHH A;  3RI4 A;  3N97 A;  1LDK B;  4HSR A;  1XSD A;  4XNF A;  2CW0 F;  2NOG A;  5J8C A;  1WZ2 A;  3TDZ C;  4XMY A;  3ZP5 A;  2Y0M A;  4JK1 X;  5B5E C;  4KYW A;  3CLQ A;  2VC1 A;  2GXG A;  2RNJ A;  2X48 A;  4KIC A;  2MSY A;  4E7K A;  2L2O A;  5K5O A;  1R49 A;  1MDM A;  1F4K A;  5J1U A;  1FTZ A;  1LE8 A;  2XRL A;  4RLF A;  1IDZ A;  5KNL A;  3BWG A;  3K7A J;  3AG1 H;  1MH4 A;  5DD8 A;  4OMY A;  1WJA A;  1WVR A;  2ZC2 A;  4HBL A;  2QBY B;  1NG7 A;  5L3C A;  3WTX C;  5ILU A;  4HX8 A;  3RIR A;  4LLL A;  1MMD A;  4PJJ A;  5EDN A;  2KPM A;  2AS5 F;  3T5X A;  1OR7 C;  2E1N A;  4FT8 A;  3V7C A;  2LY2 A;  4I02 A;  3WOD F;  4IOC F;  3W6J B;  1DU0 A;  1ZG3 A;  5H6R A;  4QSH A;  5IPA A;  1ZGW A;  4M6X A;  3C7J A;  2DU9 A;  2D2W A;  4XLE A;  2FJ1 A;  3BTI A;  3DBL B;  5HLH A;  5HNF A;  3CCU I;  1HA8 A;  3IIQ A;  1XCB A;  5ERI A;  1YRN B;  4IF4 A;  5GAH J;  1SD6 A;  1LDJ A;  1ZLK A;  2Q8K A;  1AKH B;  3BZ6 A;  4XK4 A;  2DFE A;  2ZXI A;  1W1W E;  2HKX A;  3QP6 A;  3OYN A;  3L2R A;  2V26 A;  4IRH A;  4CYC A;  2ZSI B;  4A3B J;  5EEG A;  5KAI C;  1MND A;  4XQF A;  2JK3 A;  3R60 A;  4D7M A;  1UMQ A;  2V6E A;  5FKL A;  3H0D A;  3P7N A;  3FXL A;  4MLO A;  2GZW A;  1SVO A;  1WJ5 A;  1XD7 A;  2UUZ A;  2DTR A;  1AU7 A;  1XG1 A;  2H1K A;  5EF6 A;  3DU6 A;  5J8F A;  4XN0 A;  4O3M A;  2XDV A;  1K78 B;  2P6S A;  2KL4 A;  3WE3 A;  2VBX A;  1MGT A;  2EK5 A;  1YS6 A;  2E34 A;  5L3G A;  3GFI A;  3FMR A;  1NK2 P;  1D8J A;  1QA6 A;  3GTM J;  2QYO A;  1H9T A;  1TWF J;  2CW8 A;  1MBK A;  1WI3 A;  2XKO A;  2ID3 A;  2PQ8 A;  3HRS A;  2ZJ2 A;  2DJN A;  2A68 F;  4F3Q A;  1YLF A;  3HKZ N;  3RYP A;  3G4S I;  4XOR A;  5HLG A;  3Q5F A;  2IW5 A;  2ZME B;  3ZXS A;  1EV7 A;  2EB7 A;  2H8R A;  1K4T A;  4R1H A;  3VB2 A;  2V9V A;  1PJR A;  2L9S A;  3KFW X;  2M4G A;  4B3X A;  5DS9 A;  1BW6 A;  3IAM 2;  1SAX A;  1ZRF A;  5HLI A;  4L9N A;  2JUG A;  3HPH A;  3SDG A;  3SQN A;  1HW1 A;  2CH0 A;  4BE2 A;  1TBX A;  2M0C A;  3VDX A;  2PFB A;  2L7F P;  3M1E A;  3DEE A;  3Q0U A;  4M9X A;  1JTY A;  2KHM A;  2XAF A;  1W7P A;  4DYC A;  1GXQ A;  3MD2 A;  1FSE A;  3RKQ A;  3GW2 A;  3I55 I;  1TL8 A;  5M5W J;  4XKC A;  1N75 A;  2H6B A;  5KCM A;  3BG5 A;  3JRF A;  4XRS G;  3BCA A;  4FCY A;  2DDA A;  3LSJ A;  2W85 A;  3QP5 A;  5LRR A;  3DLA A;  2FOK A;  3I0T A;  2FNP A;  4B1R A;  5C44 J;  1VQP I;  1NH3 A;  4NNJ A;  4BXX J;  5EG0 B;  1STZ A;  3ABU A;  2DFI A;  1KQ9 A;  2UV1 A;  4XLH A;  3HSR A;  3F22 A;  2W25 A;  4EMS A;  5F0H A;  3S1M J;  1D8K A;  1HF0 A;  2XGD A;  4I01 A;  2FJR A;  2EFP A;  5FKK A;  3QU6 A;  2HS5 A;  3WU2 C;  1X19 A;  2VAS A;  2DFF A;  2E19 A;  2UZK A;  1GV5 A;  3ZMS A;  3TO9 A;  2DA7 A;  2VE8 A;  4M74 A;  2R7W A;  2RNG A;  4IRG A;  3JRC A;  2ACJ A;  2LRD A;  2LLK A;  1BR2 A;  3BG7 A;  5LEJ A;  1Q1V A;  3OR1 C;  2GXA A;  2XF5 A;  2X6W A;  4UUS B;  2ETH A;  3CJN A;  5IOY A;  4A0Y A;  4I2O A;  2XPV A;  2K4B A;  5LHG A;  1WJB A;  2B7E A;  3SJM A;  2C6Y A;  1Y8Q B;  3RPU D;  1G2H A;  4L9T A;  2E7W A;  2M8G X;  4ENK A;  2GIZ A;  2EPF A;  1DGR M;  4Y4R A;  1MMN A;  1R5G A;  4E6K G;  1ULY A;  3HHG A;  2LBF A;  4IQJ A;  2L9R A;  1W4M A;  3BT9 A;  3WGH A;  3W3C A;  2L0K A;  2QVO A;  3GCM A;  1H9G A;  3IC7 A;  5B66 C;  1ZHF A;  3BR3 A;  1DUX C;  2NVQ J;  3O8H A;  3I56 I;  4QLC U;  3MKZ A;  3M7G A;  4EM0 B;  2K27 A;  5E3N A;  3JRD A;  1JHC A;  1BI1 A;  3PO2 J;  2B0L A;  5IOZ A;  4HRI A;  2XPW A;  1LKX A;  2XSD C;  4TV7 A;  4MHG A;  2VJJ A;  1TQM A;  1Z67 A;  1SFO J;  2P8T A;  4C2M J;  4XKB A;  3OOP A;  4GCV A;  1T33 A;  5IP6 A;  1OKR A;  1R71 A;  1PP7 U;  1KN9 A;  3A0B C;  4LB5 A;  5C4X J;  2O3F A;  2YSR A;  3F0C A;  1BJA A;  4G6D A;  4ZYG A;  1HCR A;  2B63 J;  3HJE A;  1WH5 A;  3CUQ B;  4BJT A;  1FYL A;  1I1G A;  3K4L A;  5ICE A;  3GXO A;  1NG6 A;  3EUA A;  2HYG D;  1TQP A;  2F5D A;  1BJZ A;  4I98 B;  1I50 J;  2ZO4 A;  4LG0 B;  4NUB A;  3HOU J;  2JVG A;  3E6D A;  1PUE E;  1JUS A;  4ZDP A;  2CO5 A;  1VQ8 I;  3TP0 A;  1ERD A;  2OCC H;  4MQV A;  2EFW A;  2KIM A;  3U21 A;  1FEX A;  5HS9 A;  1LJ9 A;  4BXF A;  1ZN2 A;  3O2P E;  1QGP A;  2EV0 A;  4HAM A;  2R7T A;  2A6H F;  5CVV A;  3JRH A;  2IS4 A;  3GME A;  1X1A A;  2AQF A;  1T2K A;  1KGS A;  1Y6I A;  2EFQ A;  1MJB A;  2QKL B;  3OYE A;  1BR4 A;  1Z05 A;  3GTG J;  2WWY A;  3RZO J;  2R5Z A;  3ZQ7 A;  1UCR A;  5DV5 A;  3DTE A;  2P0W A;  1V5E A;  2GAU A;  4RAY A;  3OYG A;  2QSG X;  5E17 F;  1IZ1 A;  5J3L A;  1HSJ A;  2E36 A;  2VJ4 A;  3BJA A;  5ILV A;  5DUI A;  3KEQ A;  2JA7 J;  3MFK A;  2QM3 A;  5CQE A;  4P55 A;  1I4V A;  2M0M A;  4XKV A;  5H6Q A;  1TWA J;  5M3M J;  4K2E A;  4OIP F;  2K86 A;  1A36 A;  3PJR A;  2VB6 A;  2DTZ A;  1JJ6 C;  3K10 A;  2EJR A;  1RR8 C;  2M4K A;  3EET A;  4XLC A;  5HDG A;  4AYB A;  4YG2 F;  5GPC A;  1P4X A;  2DMT A;  2LYC A;  1BN5 A;  4OIN F;  3FKI J;  1HKT A;  1KU7 A;  3VWB A;  2R7Q A;  4L9V A;  3S1N J;  2UWM A;  1SVM A;  3ERE D;  2DO7 A;  4A5N A;  3BDN A;  3G6E I;  1WKM A;  4WXH A;  2I8D A;  3ZRG A;  1Z3X A;  4LK0 F;  4LJZ F;  3CC4 I;  4L5I A;  3ZQG A;  1TT5 B;  3O8G A;  3QYE A;  5EZH A;  2Z5U A;  2D45 A;  4LOC A;  4ENN A;  1I39 A;  2OTL I;  3KYD B;  1FLI A;  1YIO A;  3E3V A;  3RQ4 A;  1LFU P;  1YO5 C;  4RM2 A;  3S8P A;  1FMW A;  3ZQL A;  2K7L A;  2HFH A;  3HTS B;  4LK1 F;  3HDD A;  5J40 A;  3NWS A;  2QCO A;  4M3D A;  3OYC A;  1JKR C;  4A3D J;  4NC8 A;  4BDY A;  3CF2 A;  3JRE A;  3HOX J;  4RMN A;  2RC4 A;  1MKM A;  5F1J A;  3NWT A;  3TBI A;  2LKP A;  2VQC A;  2W84 A;  4P9U A;  1IAW A;  4GO1 A;  2DMQ A;  2X51 A;  3OV8 A;  1JT0 A;  3CCE I;  2FD5 A;  2PJR B;  2OTJ I;  3M8F A;  3SEQ A;  5J4V A;  1VQK I;  3C2G A;  5HLT A;  1KZH A;  2L7Z A;  5ICC A;  1IN4 A;  1KU3 A;  1O3T A;  1YS7 A;  2ESH A;  4A6E A;  2H09 A;  3DTK A;  4IQ4 A;  2EV6 A;  2GOX B;  4Y7N J;  3VSL A;  3IHU A;  4DYR A;  1QZY A;  2P6T A;  4MIM A;  2HTJ A;  4E7Z A;  3LSG A;  5FD6 A;  2ZJQ F;  2BEO A;  1WJE A;  1O3Q A;  3JW4 A;  2Y31 A;  2RN7 A;  2OZU A;  2Y2Z A;  3F21 A;  3DTI A;  4U0V A;  2YX4 A;  4C3J J;  4D5C A;  3CP2 A;  4A3C J;  3LQR A;  3R0A A;  1UHW A;  1O7L A;  1IRG A;  1O3R A;  2A5Y B;  1TT0 A;  2D5V A;  1D0X A;  2IGN A;  2K02 A;  3NEU A;  1GDT A;  4HDV A;  2QEX I;  4HX7 A;  4WXC A;  5HDN A;  4JX4 A;  3BJO A;  1XPX A;  5CJ9 A;  3WTS C;  4IO9 F;  2RV8 A;  1OCO H;  1RNL A;  1CGP A;  1E3H A;  4A12 A;  1X4P A;  2KIF A;  3ML6 A;  5E1Z B;  2KKO A;  1J09 A;  4HNV A;  3K9T A;  1OCC H;  3T8R A;  2ME6 A;  4GYG A;  3J7A Y;  4LIT A;  2ZBK A;  2NOJ B;  2R93 J;  4D0P A;  2E35 A;  2CV1 A;  4CUG A;  2HDD A;  4UV9 A;  1TC3 C;  2Z9O A;  1EH8 A;  4ZYE A;  1RPW A;  5BMZ A;  3S2D J;  3S93 A;  3LSP A;  2V79 A;  4EVI A;  2DA3 A;  2LK2 A;  5EEA A;  1X2M A;  4ZYD A;  4WK8 F;  5BPD A;  4M3B A;  2M8E A;  4PCQ A;  2PN6 A;  3QPL A;  2H8W A;  5TIS C;  3FWE A;  3GX4 X;  1YW9 A;  2O9L A;  2TCT A;  3BY6 A;  4GDF A;  1YIJ I;  3FHZ A;  4Q47 A;  2MD0 A;  2P5K A;  1XN7 A;  1QRY A;  1X1D A;  2EZL A;  5DD4 A;  1PVE A;  1H88 C;  4KJZ A;  2PEX A;  3IH4 A;  2DOE A;  1D5V A;  2HZT A;  2CGP A;  3CJT B;  1MBE A;  3HOZ J;  3OYM A;  2KIQ A;  5FB2 A;  2EBI A;  3FIW A;  5F04 A;  2IAI A;  2JJ7 A;  3U1D A;  2M45 A;  3MKL A;  2E2H J;  2OC6 A;  1PP8 F;  1MJ9 A;  4E7I A;  1YTY A;  3L2Q A;  1XGS A;  2E1O A;  3HC7 A;  2PJP A;  4UVB A;  1IG7 A;  1VQ4 I;  3ROU A;  4CIC A;  1I5Z A;  4NC6 A;  1W5C C;  2O5R A;  3MKW B;  3TED A;  2V1N A;  2X1E A;  3BTC A;  3D1N I;  4XN3 A;  3FKJ A;  1JKO C;  3CZ6 A;  5LBQ A;  3CCQ I;  2LG4 A;  4P96 A;  2WTE A;  3N05 A;  3A01 B;  4WF2 A;  5BS6 A;  4IOA F;  3OL3 A;  4BEH B;  1U9O A;  2LC2 A;  2R7D A;  2PBI A;  1MBJ A;  1AKH A;  3TP3 A;  1ZAR A;  1GHC A;  4ESF A;  2M7B A;  2NS8 A;  3M3Y J;  4N0B A;  5L3F A;  2ZNZ A;  3EDP A;  5JHF A;  1ORK A;  2VC0 A;  2R7R A;  2WAD A;  2Y48 A;  4PFP A;  4JYK A;  4BQN A;  5B1A H;  3M8J A;  5K7Z A;  2DA5 A;  3JRI A;  4DBR A;  1D5Y A;  5TRD A;  4KA4 A;  4A69 C;  3NQO A;  1H0M A;  5FKM A;  3QAH A;  5DYM A;  1K61 A;  4ZTJ A;  1XDS A;  1B8I A;  1A04 A;  1YW7 A;  1R4M B;  3I4N J;  2IBD A;  3OYD A;  4OWR B;  2BE5 F;  2M1B A;  4QIW N;  3LL7 A;  1QO0 D;  1YX3 A;  2E60 A;  2YU9 J;  5HVQ C;  2FML A;  3CLO A;  1MD0 A;  4G6T B;  4KIB A;  1XC5 A;  3S2H J;  2ADU A;  3KP7 A;  2K40 A;  3E6M A;  2AHQ A;  2JSP A;  3R4K A;  1SEU A;  2CMP A;  1FOY A;  5AIP A;  1RRJ A;  4O6J A;  3DLL F;  3I64 A;  5K5Q A;  4Y52 J;  1Y0U A;  2X1C A;  5FRO A;  5M3F J;  2M2E A;  2GLO A;  4L0Y B;  4UUV A;  1U8R A;  1MH3 A;  3ZQI A;  2ZXJ A;  3G71 I;  1FY7 A;  5D5X B;  3K1M A;  3GFJ A;  3F9K A;  2X6X A;  4YRV A;  1ZRC A;  3CCY A;  4DZJ A;  4HDU A;  4HST A;  4IEJ A;  1J7K A;  4CDG A;  4UV8 A;  4DZP A;  1U9N A;  1SD4 A;  2B9S A;  3ASO H;  3T1B A;  2OPT A;  5E18 F;  4RAG A;  1JUP A;  2L4A A;  1WSU A;  1P7I A;  1PUF B;  4PZJ A;  3C18 A;  1TW3 A;  2Q1Z B;  1BI3 A;  2VKV A;  2QQB A;  2NXN B;  3PIO F;  1K4S A;  4L18 B;  1E3P A;  2FNA A;  2JZY A;  2K9M A;  4AIH A;  1YRN A;  2A69 F;  2VKE A;  2XVC A;  3O6B B;  4MNU A;  4NBQ A;  3SZG A;  1QBJ A;  4KUM A;  2LRE A;  2E1C A;  4F93 B;  4I99 C;  1VZ0 A;  2F5V A;  2XUB A;  2BV6 A;  3KEO A;  1O57 A;  1T56 A;  4KIG A;  2XB0 X;  3HUG A;  3LNQ A;  4Y17 A;  3GYH X;  2CJJ A;  3BG6 A;  2H27 A;  4W1U A;  5E8I A;  2VOD A;  1XX5 A;  4GRI A;  3ZMV A;  1GVD A;  2MD5 A;  3BR0 A;  1EKE A;  3A0H C;  3LSK A;  4P9F A;  4E7J A;  3WU1 B;  1LPQ A;  4I0A A;  5D5W B;  4HQM A;  4Y13 A;  4HYE A;  3A01 A;  2OCE A;  3BLY A;  3IL2 A;  4C2U A;  3ABT A;  1I3Q J;  2X85 A;  1I3A A;  2ZFW A;  2L5Q A;  2ZJR F;  3MZ8 A;  1KCA A;  1YX5 A;  2Z99 A;  4M6V A;  1RKT A;  1WGX A;  3GLX A;  3ZN1 A;  4DJA A;  1FNN A;  4G7O F;  1XSX A;  4PJ0 C;  1K6Y A;  3OYL A;  2QSH X;  3LA2 A;  4RB2 C;  2X0L A;  4I0B A;  2QZ8 A;  3GTL J;  1MMG A;  4A3L J;  3KYL A;  2X4H A;  2VXD A;  5C3E J;  2DT5 A;  2STT A;  5CVR A;  2A07 F;  1Y1W J;  3FM5 A;  1VI0 A;  1Z6T A;  4C2T A;  3HYI A;  4ESB A;  3VYS B;  5K5R A;  2JTV A;  2R7V A;  2OA4 A;  4KIT B;  4RLQ A;  1IF1 A;  4XID A;  1SVL A;  1Z0X A;  2PX9 A;  2KIU A;  3HBL A;  4OIR F;  4G12 A;  3SXY A;  4R8H A;  4E4H A;  3CMA I;  2K5C A;  4B4C A;  4OMZ A;  2MLK A;  2NS0 A;  2Y9Z A;  3ERM A;  1ETW A;  4JX5 A;  3L1P A;  1IC8 A;  1KQ0 A;  3OIP A;  4DW6 A;  3TOA A;  3K70 C;  5EJC A;  2L7K A;  4YEL A;  4A3J J;  4CCJ A;  2F5C A;  2G7U A;  1OJL A;  4L5E A;  4S0H B;  2RGV A;  4B47 A;  4CH7 A;  4RGS A;  3HPG A;  4EAT A;  2F6C A;  2XSJ C;  4NHJ A;  3TL4 X;  1R1V A;  1AY9 A;  1VTN C;  3K4M A;  2XRN A;  2HPI A;  2COM A;  4A93 J;  2MLG A;  2DBB A;  4BL0 B;  2IRF G;  3FXJ A;  4LIU A;  2O8K A;  2R3S A;  5JR3 A;  2ZCW A;  4Y15 A;  1MBG A;  3QWL A;  4LFU A;  3JSO A;  1IRF A;  4N4N B;  2HOE A;  4J00 A;  4U0Y A;  3LFK A;  2XHK A;  4LB6 B;  2BZT A;  1B1B A;  2R5Y B;  4PFO A;  3E7L A;  1UMU A;  1J0R A;  2DPD A;  2LTP A;  3AFH A;  2X6Y A;  3BG9 A;  4DBQ A;  2QA4 I;  4WXD A;  2XC7 A;  2IPQ X;  2BY3 A;  4UUT A;  3PFY A;  2P81 A;  4K8W A;  2FSW A;  2VXZ A;  3EYI A;  1BC8 C;  2HOT A;  3RZD J;  2LKX A;  2MA3 A;  2XAH A;  1R36 A;  3OOU A;  4BY1 J;  3CD6 I;  2A61 A;  1P6R A;  4EJT A;  3OS2 A;  2HI3 A;  2L02 A;  5GPA A;  1FX7 A;  2HQ5 A;  4EJV A;  3AG3 H;  3DBH B;  2VPL A;  2HXO A;  4NB5 A;  2DOF A;  2FA5 A;  4DOZ A;  4FX0 A;  3V8J A;  2LD5 A;  5FGM A;  3LAP A;  3I4M J;  1Z77 A;  4RS8 A;  2K3F A;  1HOM A;  2NNN A;  4NDL A;  4A5M A;  3BRO A;  4FIS A;  5ICF A;  1U3E M;  3GTK J;  4Z2Y A;  1G3Y A;  2FRH A;  2JT1 A;  1TLH B;  1K7A A;  4XRS A;  1ZTR A;  4XL9 A;  4ZYA A;  1WWX A;  3IP4 B;  1A5J A;  1ZR2 A;  1JI8 A;  3A02 A;  4I6Z A;  3RPU A;  3CJR B;  4BE1 A;  3VFZ A;  2HEO A;  4AWX B;  4YEJ A;  2EA4 A;  1G3S A;  1XDU A;  3JSP A;  2WY8 Q;  1KA8 A;  4ZZD A;  4KN4 X;  5J1Y A;  3FHN A;  2JA8 J;  4CCN A;  1SAN A;  2MAB A;  4G6Q A;  3S14 J;  3MEX A;  2CUJ A;  2GA2 A;  1FPQ A;  2V1U A;  1RC9 A;  1ZKG A;  4V2F A;  2OQG A;  1APL C;  1VFC A;  2FF4 A;  4DIQ A;  2P4W A;  1IXS B;  3F23 A;  1W36 D;  1OYW A;  3W2V A;  4HF0 A;  1W0T A;  3KP6 A;  1MNM C;  2JVH A;  2CSO A;  1D0Z A;  5J4Y A;  2EV5 A;  3J80 Z;  2CQK A;  3ZQH A;  2Q2E B;  3BZK A;  4F92 B;  4AVZ A;  1OCP A;  2VOP A;  4EGZ A;  2VT2 A;  2CW7 A;  3KX2 A;  1OPC A;  4ON0 A;  2BW3 B;  4ASN A;  3GO5 A;  2F4O B;  3NAR A;  4BQO A;  3LFU A;  4B43 A;  4HEA 2;  3GTJ J;  3OYJ A;  3L2U A;  3BR6 A;  3H9Q A;  1FWZ A;  2Y30 A;  2E7X A;  3L2W A;  1Y39 A;  3OWT A;  2JSC A;  4YII A;  1EH6 A;  2IP2 A;  3KP4 A;  1Y0N A;  2XB5 A;  2DMP A;  3A03 A;  3CCJ I;  1S9H A;  1B12 A;  1USS A;  2JN6 A;  3ZQC A;  3DEW A;  5LFA A;  3LQQ A;  5EEH A;  1JKP C;  2IA2 A;  2HDC A;  2IVM A;  3BPV A;  1VQM I;  2QQA A;  3WHB A;  4M3G A;  3IWZ A;  3TO6 A;  3LAJ A;  5HOD A;  3E97 A;  4PJL A;  2W82 A; 
#chains in the Genus database with same CATH homology
 1P92 A;  1YQA A;  3KP3 A;  5ED4 A;  4MTE A;  4JBA A;  2W57 A;  4GGG A;  3ZMT A;  3WG9 A;  1FP2 A;  2VBY A;  3G3Z A;  4ESJ A;  3PQJ A;  3KE2 A;  1R1U A;  3KZY A;  2M87 A;  1FP1 D;  3F8B A;  1G3W A;  4GXO A;  5DUK A;  3ULQ B;  3QPH A;  1MJA A;  2HTS A;  2HQR A;  1XGM A;  4UHT A;  1T0F A;  2RQP A;  1BI2 A;  3ZN0 A;  2PI0 A;  4MEX F;  1ZGA A;  2KRF A;  4XLP F;  2XAJ A;  3V8L A;  4OOI A;  2FE3 A;  5ICG A;  4OIQ F;  1V4R A;  1J2X A;  2NAZ A;  1ZLJ A;  1U2W A;  2OAZ A;  1Z91 A;  3WU0 A;  3G73 A;  1RI7 A;  1R1T A;  2OZ6 A;  4L0Z B;  4RGU A;  3M9A A;  3K69 A;  5L3E A;  3DP7 A;  5FLX Z;  3COA C;  2NNY A;  2YPR A;  1ZRE A;  2OQR A;  3R0J A;  1U5T A;  5LHI A;  1W7P D;  1SMT A;  2XV4 S;  4S04 A;  2HYF A;  5D6E A;  1FBS A;  1R23 A;  3F8N A;  3L00 A;  3WTU C;  1DP7 P;  4R79 A;  5D4S A;  3D5L A;  1P2F A;  4OU0 A;  3HOS A;  4M73 A;  1LEA A;  4M71 A;  4BNC A;  2OU2 A;  3PQK A;  5L3B A;  3WGI A;  4XLN F;  3AAF A;  5DCM B;  1UHM A;  5F6F A;  4ETS A;  4N9H A;  4KN7 X;  4UVC A;  3M8E A;  2LDU A;  4EM2 A;  1K6O A;  3F8M A;  1J9I A;  4RB1 A;  2FMY A;  4BYY A;  4Q4Z F;  2O03 A;  2A3S A;  3DEU A;  4Q5S F;  4FX4 A;  1O3S A;  3F6V A;  4N31 A;  2J5O A;  2P7C B;  1OYY A;  3T8T A;  4N9I A;  4IJA A;  6PAX A;  3P9C A;  1SFU A;  1IN7 A;  3V7R A;  4KMU X;  1ZRD A;  1S6L A;  2DPU A;  1HW2 A;  2F5F A;  2M5W A;  5FFZ A;  5HS7 A;  3W6K B;  5LLQ A;  1JHE A;  3Q9V A;  1U5T B;  1ZGJ A;  2G7H A;  2VBW A;  3J81 Z;  2TDX A;  2HO0 A;  2DK5 A;  1F5T A;  3WTZ A;  4BAY A;  2DK8 A;  1XMK A;  4CO8 A;  2O0Y A;  5BPI A;  3S04 A;  1HBX G;  2JPB A;  1HST A;  3DF8 A;  1S7A A;  3VEP A;  2HWV A;  3K0L A;  1T7D A;  3V7S A;  2QEN A;  5CVI A;  2XGX A;  3GVA A;  3LA7 A;  3HHH A;  5ILS A;  3HRM A;  2VT3 A;  3SHF A;  3TQN A;  4RGR A;  3RKW A;  3JAM K;  4U88 A;  4HOB A;  2VOO A;  3I5U A;  4NV4 A;  1TNT A;  3ISP A;  5E1X A;  4YFN F;  1W5S A;  3KP5 A;  3H3U A;  4IHS A;  2CG4 A;  1CF7 A;  3HIF A;  1WI9 A;  2V6C A;  3DV8 A;  2XIG A;  1KU9 A;  5E8G A;  5A2Q Z;  1F39 A;  4FHT A;  2F5E A;  1R7J A;  4S05 A;  5E1W A;  3H92 A;  2JPC A;  2M30 A;  5FD5 A;  2O61 A;  3HOT A;  4M9S A;  3MCZ A;  1R58 A;  2XRO A;  5FFX A;  3MAJ A;  5J6X A;  2L3D A;  5AON A;  4OIO F;  5LGU A;  1B9M A;  3CUO A;  3L7W A;  4RB3 C;  2QWW A;  1JE8 A;  1HQC A;  2D1H A;  1IW7 F;  2L4M A;  1YFH A;  1T6S A;  5HDK A;  4G94 A;  1REP C;  1QQI A;  2BYV E;  4AVP A;  5CLS A;  2H6C A;  2Q2E A;  1FYK A;  3E6C C;  1J75 A;  5LGT A;  1TNS A;  4JQF A;  4B8X A;  5AIQ A;  3BP8 A;  4MTD A;  4L5J A;  4YFK F;  1K79 A;  1TQI A;  3FZV A;  3BPX A;  4LLG F;  2GXB A;  5IT9 K;  3C3W A;  5FLX K;  1IXR C;  3ELK A;  2HR3 A;  2FQ3 A;  2QUF A;  3IKV A;  1SFE A;  2VE9 A;  2Z3Y A;  1AOY A;  4HX4 A;  1V3F A;  4IXA A;  3ECH A;  3SFZ A;  2KJB A;  5F1R A;  4EJO A;  1S7O A;  1LNW A;  1IXC A;  2XAG A;  1GVJ A;  4HW0 A;  1MZB A;  1XGO A;  3B73 A;  1C0W A;  3FX3 A;  5DCM A;  5F64 A;  3I53 A;  1LQ1 A;  4RGX A;  4AIK A;  4P5O A;  4AD9 A;  1T39 A;  4LD5 A;  2Y75 A;  1HW5 A;  1ZAO A;  3HSE A;  2MBF A;  4KT5 C;  1MDM B;  2GIV A;  4ENJ A;  3U2R A;  4YFX F;  4KDP A;  2MH2 A;  2V1X A;  2FU4 A;  2YU3 A;  5L3D A;  3LA3 A;  4XSX F;  2P5V A;  3DPT A;  1JXS A;  3SZP A;  4QWQ A;  3V4G A;  4IRI A;  2AXL A;  3FMS A;  2GWR A;  3FXU A;  5CYV A;  3F72 A;  4U0W A;  2XAS A;  1U5T C;  1UFM A;  2G9W A;  3E5Q A;  2HGC A;  1HKQ A;  2LF8 A;  1LDD A;  2HQN A;  3WTW C;  3WTT C;  1Z9C A;  2XAQ A;  2FBH A;  5KK1 A;  3GF2 A;  1XB4 A;  1BI0 A;  1L3L A;  1XGN A;  2CWE A;  4HLX A;  3DPL C;  4U7B A;  3CO6 C;  3BOQ A;  3RKX A;  4LGW A;  1X3U A;  3WTV C;  1YW8 A;  3MWM A;  5HS8 A;  3E5X A;  3QU3 A;  3MZY A;  2FEZ A;  1Z1D A;  3JTH A;  1XSV A;  2P5L C;  2OBP A;  3KLN A;  4BHC A;  3QOP A;  3I59 A;  1RUO A;  1OMI A;  3J81 K;  4IVN A;  1TTY A;  1I27 A;  3R6S A;  2LSO A;  1Z7U A;  1J59 A;  4HF1 A;  1UB9 A;  2GQQ A;  4L9J A;  4MEY F;  2MC3 A;  3KCC A;  3ZMZ A;  3K1N A;  4RB0 A;  4CHU A;  1ON2 A;  2J5P A;  4HQE A;  3L09 A;  2O6G E;  4E70 A;  1BM9 A;  2CYY A;  1I1S A;  3GEZ A;  4Q48 A;  2W24 A;  3HRT A;  2DW4 A;  3N4M A;  3HSF A;  1ODD A;  1JGS A;  5E20 A;  3TDU C;  2CFX A;  3NRV A;  3L2C A;  1T98 A;  1ON1 A;  5IT3 A;  2WC2 A;  4HA8 A;  2ISY A;  1LVA A;  5BOX A;  2OD5 A;  1J5Y A;  1W5T A;  4XRF A;  1IN8 A;  4UXN A;  1R5H A;  3IKT A;  4O5V A;  1EH7 A;  4HV5 A;  2VON A;  3ZPL A;  3I59 B;  3KET A;  1KYW A;  1R22 A;  4YIF A;  5JHU A;  1Q1H A;  3GFM A;  3I58 A;  1DPR A;  4DNC A;  1G4D A;  3I71 A;  2K4J A;  3CO7 C;  2DLL A;  3H3Z A;  5D8L B;  4H0E A;  5CVU A;  3K1P A;  5D5U B;  3P9I A;  4HZF A;  1G3T A;  4LG0 A;  4WX9 A;  5JI6 A;  3VOE A;  1RUN A;  4ZH4 F;  2EFO A;  1SD5 A;  2BGC A;  1U78 A;  2STW A;  3LST A;  2H94 A;  2IA0 A;  5JFR A;  2F2E A;  2QQ9 A;  4AIJ A;  5IT9 Z;  1DPU A;  4RAZ A;  4KMF A;  3JAM Z;  1F1Z A;  1BIA A;  1B4A A;  3RDI A;  3DXJ F;  5LHH A;  2PLY A;  1ZG5 A;  1O7F A;  1T38 A;  5DEQ A;  1P4W A;  4A2U A;  5DCF A;  3RPQ A;  1FT9 A;  4BH9 A;  3L9F A;  2ELH A;  1IUY A;  3I4P A;  4ENM A;  5H20 A;  4CGZ A;  3CDH A;  1YYV A;  1GXP A;  3HTU A;  4BXU A;  2UXN A;  2EFN A;  4KNY A;  3J7A O;  5D8K B;  3T0Y A;  3F6O A;  3JTG A;  4M6Y A;  2R7F A;  1TW2 A;  1I6X A;  5CVJ A;  3RYR A;  3ZMD A;  2QBY A;  2FBK A;  2PG4 A;  4HLY A;  1B59 A;  2Z33 A;  1FZP B;  2LF7 A;  2V1D A;  3WGG A;  2IT0 A;  1BBY A;  4G7Z F;  2FXA A;  1WQ2 A;  3TKY A;  4CXF A;  1ZH5 A;  3GWZ A;  3IRQ A;  3KZZ A;  4BHB A;  4EV0 A;  3HRU A;  2A6E F;  1Z6R A;  1YG2 A;  3IWF A;  2Q0O A;  1QNT A;  3EUH A;  4NQW A;  3ZMU A;  3F3X A;  2WV0 A;  3CUQ C;  2BBY A;  4G8X A;  4ZYH A;  3V8K A;  2DAO A;  4MGR A;  1FYM A;  3MQ0 A;  3Q9S A;  1S29 A;  1HXD A;  2ZME A;  1FOK A;  3I54 A;  5D5V B;  4UNO A;  1F9N A;  3IRR A;  3BJ6 A;  3D0S A;  4EJU A;  2VBZ A;  4A0Z A;  3FMQ A;  3SZT A;  4MQ9 F;  4I7H A;  3RJP A;  2IA1 A;  3C1D A;  3DFG A;  3WTY C;  5D4R A;  5D6F A;  1SFX A;  4KIF A;  3VOD A;  1R00 A;  3P9K A;  4G7H F;  1U6G A;  3MZH A;  3PFI A;  4PGH A;  1IN6 A;  5LRS A;  1OYI A;  4EQQ A;  4EGY A;  4XBF A;  2NRA C;  3RTR A;  3TO7 A;  2UXX A;  4IHT A;  1W7P B;  1L0O C;  3ECO A;  3KP2 A;  3FM3 A;  4ZZL A;  3FXR A;  4G9Y A;  3RKY A;  3FF5 A;  2RVC A;  4KFC A;  4ME8 A;  3REO A;  2PMU A;  3F8F A;  3GUD A;  1ZYR F;  1XMA A;  1QPM A;  4PGG A;  1KU2 A;  3DKW A;  3WE2 A;  4CZZ A;  2EWN A;  2PMH A;  4A6D A;  1DDN A;  4F7Z A;  2MH9 A;  3GZ6 A;  3R61 A;  2JRT A;  3QRF F;  1ONV A;  4HF2 A;  4M9Z A;  1AWC A;  1LB2 A;  3J80 K;  3TOB A;  4CYD A;  1WRJ A;  4M72 A;  5TJJ A;  2YR2 A;  1UST A;  3FXQ A;  1K78 A;  3O3K A;  4HV6 A;  1FBU A;  4BQA A;  2VN2 A;  2ESN A;  2XKP A;  1XCV A;  3QPT A;  2IJL A;  3EYY A;  3U9G A;  2LNB A;  3GZ5 A;  2ZKZ A;  3BDD A;  3GFL A;  2EA2 A;  2GA1 A;  1B9N A;  1OR7 A;  2DI3 A;  2DQL A;  2ZNY A;  2QLZ A;  1G6N A;  2ISZ A;  3S2W A;  4WWC A;  3LWF A;  5K1Y A;  1FC3 A;  5FO5 A;  1B6A A;  3B02 A;  1HKS A;  1S3J A;  3CTA A;  1SMY F;  5A2Q K;  4LLN A;  2YX7 A;  4XSZ F;  2NYX A;  3CUQ A;  2L54 A;  2O8X A;  1JHF A;  4PDK A;  4A0X A;  1CF7 B;  5DDG A;  4EJW A;  1D3Y A;  4U7D A;  5KVR A;  2FKD A;  1E17 A;  1SD7 A;  2D1V A;  2HNF A;  1RIO H;  4EM1 A;  1BIB A;  1IN5 A;  3KLO A;  1P4A A;  1BOA A;  1S8N A;  4GYI A;  1RZ4 A;  4IPA A;  4DQ2 A;  5BQT A;  2RKH A;  2DQR A;  4LMY A;  1QZZ A;  5HOO A;  3TGN A;  4BHP A;  3DQV C;  1FSH A;  1KQ8 A;  5LGN A;  1FBQ A;  1KYZ A;  1ZG1 A;  2L01 A;  2KJC A;  3F8C A;  1E2X A;  2RDP A;  1NHA A;  5JVT A;  3EQL F;  4WCG A;  4I09 A;  1PDN C;  4B09 A;  5LEK A;  3E6B A;  2FBI A;  2P7V B;  4UVA A;  3K2Z A;  1BC7 C;  2HKO A;  3E5U A;  1JHH A;  3RI4 A;  3N97 A;  1LDK B;  1XSD A;  2CW0 F;  5J8C A;  3TDZ C;  3ZP5 A;  2Y0M A;  4JK1 X;  4KYW A;  2VC1 A;  2GXG A;  2RNJ A;  4KIC A;  5K5O A;  1MDM A;  1F4K A;  3BWG A;  5DD8 A;  4OMY A;  2QBY B;  4HBL A;  5L3C A;  3WTX C;  5ILU A;  4HX8 A;  3RIR A;  4LLL A;  2AS5 F;  3T5X A;  2E1N A;  4FT8 A;  3V7C A;  4I02 A;  3WOD F;  3W6J B;  1ZG3 A;  5H6R A;  4M6X A;  3C7J A;  2DU9 A;  2D2W A;  5HLH A;  3IIQ A;  1XCB A;  5ERI A;  4IF4 A;  1SD6 A;  1LDJ A;  1ZLK A;  2Q8K A;  3BZ6 A;  2HKX A;  3QP6 A;  4IRH A;  5EEG A;  3R60 A;  3P7N A;  2GZW A;  1XD7 A;  2DTR A;  5J8F A;  4O3M A;  1K78 B;  2P6S A;  3WE3 A;  2VBX A;  1MGT A;  2EK5 A;  1YS6 A;  5L3G A;  3GFI A;  3FMR A;  1D8J A;  2QYO A;  1H9T A;  2XKO A;  2PQ8 A;  3HRS A;  2ZJ2 A;  2A68 F;  1YLF A;  3RYP A;  5HLG A;  3Q5F A;  2IW5 A;  2ZME B;  2EB7 A;  1EV7 A;  4R1H A;  3VB2 A;  2V9V A;  3KFW X;  1ZRF A;  1SAX A;  5HLI A;  4L9N A;  3SQN A;  1HW1 A;  1TBX A;  2PFB A;  3M1E A;  4M9X A;  2XAF A;  1W7P A;  1GXQ A;  1FSE A;  3GW2 A;  2H6B A;  3QP5 A;  2W85 A;  5LRR A;  2FOK A;  3I0T A;  2FNP A;  1STZ A;  3ABU A;  2DFI A;  1KQ9 A;  3F22 A;  3HSR A;  2W25 A;  4EMS A;  1D8K A;  4I01 A;  2FJR A;  2EFP A;  3QU6 A;  2HS5 A;  2UZK A;  3ZMS A;  3TO9 A;  2VE8 A;  4M74 A;  4IRG A;  2ACJ A;  5LEJ A;  2ETH A;  3CJN A;  4I2O A;  4A0Y A;  2K4B A;  5LHG A;  2C6Y A;  4L9T A;  2E7W A;  4ENK A;  1R5G A;  1ULY A;  3HHG A;  1W4M A;  3WGH A;  2QVO A;  1H9G A;  3IC7 A;  1ZHF A;  1DUX C;  4QLC U;  3M7G A;  4EM0 B;  2K27 A;  1JHC A;  1BI1 A;  2B0L A;  4TV7 A;  4MHG A;  1TQM A;  2P8T A;  3OOP A;  4GCV A;  1OKR A;  1PP7 U;  1KN9 A;  4LB5 A;  2O3F A;  2YSR A;  1BJA A;  4G6D A;  4ZYG A;  3CUQ B;  1FYL A;  1I1G A;  5ICE A;  3GXO A;  2HYG D;  1TQP A;  2F5D A;  4I98 B;  2ZO4 A;  4LG0 B;  3E6D A;  1PUE E;  2CO5 A;  4MQV A;  2EFW A;  2KIM A;  5HS9 A;  1LJ9 A;  1ZN2 A;  3O2P E;  1QGP A;  2EV0 A;  4HAM A;  2A6H F;  5CVV A;  1T2K A;  1KGS A;  2EFQ A;  1MJB A;  1Z05 A;  2WWY A;  3ZQ7 A;  1UCR A;  5DV5 A;  2GAU A;  4RAY A;  5E17 F;  1IZ1 A;  1HSJ A;  3BJA A;  5ILV A;  5DUI A;  3KEQ A;  3MFK A;  2QM3 A;  4P55 A;  1I4V A;  5H6Q A;  4OIP F;  4K2E A;  2K86 A;  2EJR A;  3EET A;  5HDG A;  4YG2 F;  1P4X A;  4OIN F;  1BN5 A;  1HKT A;  1KU7 A;  4L9V A;  2UWM A;  3ERE D;  2DO7 A;  4A5N A;  3BDN A;  1WKM A;  4WXH A;  4LK0 F;  4LJZ F;  4L5I A;  2Z5U A;  2D45 A;  4ENN A;  1FLI A;  1YIO A;  3E3V A;  1YO5 C;  2K7L A;  2HFH A;  3HTS B;  4LK1 F;  2RC4 A;  1MKM A;  2LKP A;  1IAW A;  2W84 A;  4P9U A;  4GO1 A;  3OV8 A;  1LEB A;  3M8F A;  5ICC A;  1IN4 A;  1O3T A;  1KU3 A;  1YS7 A;  4A6E A;  2ESH A;  2H09 A;  2EV6 A;  3IHU A;  1QZY A;  2P6T A;  2HTJ A;  5FD6 A;  2BEO A;  1O3Q A;  3JW4 A;  2RN7 A;  2OZU A;  3F21 A;  4U0V A;  2YX4 A;  3LQR A;  3R0A A;  1UHW A;  1O7L A;  1IRG A;  1O3R A;  2A5Y B;  2K02 A;  3NEU A;  4HDV A;  4HX7 A;  4WXC A;  5HDN A;  3BJO A;  5CJ9 A;  3WTS C;  2RV8 A;  1RNL A;  1CGP A;  4A12 A;  2KIF A;  3ML6 A;  5E1Z B;  2KKO A;  3K9T A;  3T8R A;  4GYG A;  2ZBK A;  4D0P A;  4UV9 A;  2Z9O A;  1EH8 A;  4ZYE A;  5BMZ A;  2V79 A;  4EVI A;  5BPD A;  4ZYD A;  4WK8 F;  2M8E A;  4PCQ A;  2PN6 A;  3FWE A;  3GX4 X;  1YW9 A;  3BY6 A;  3FHZ A;  4Q47 A;  2P5K A;  1XN7 A;  5DD4 A;  2PEX A;  1D5V A;  2HZT A;  2CGP A;  5FB2 A;  3U1D A;  2M45 A;  1PP8 F;  1MJ9 A;  1YTY A;  1XGS A;  2PJP A;  4UVB A;  3ROU A;  4CIC A;  1I5Z A;  5LBQ A;  4P96 A;  2WTE A;  4WF2 A;  5BS6 A;  2R7D A;  2PBI A;  1ZAR A;  1GHC A;  4ESF A;  4N0B A;  5L3F A;  2ZNZ A;  3EDP A;  2VC0 A;  2Y48 A;  5TRD A;  4KA4 A;  3NQO A;  1H0M A;  3QAH A;  5DYM A;  1XDS A;  1A04 A;  1YW7 A;  2BE5 F;  2M1B A;  1QO0 D;  5HVQ C;  2FML A;  3CLO A;  1MD0 A;  4KIB A;  2ADU A;  3KP7 A;  3E6M A;  3R4K A;  5AIP A;  4O6J A;  3I64 A;  5K5Q A;  1Y0U A;  4L0Y B;  4UUV A;  1U8R A;  2ZXJ A;  1FY7 A;  5D5X B;  3K1M A;  3GFJ A;  1ZRC A;  4HDU A;  1J7K A;  4CDG A;  4UV8 A;  1SD4 A;  3T1B A;  5E18 F;  2L4A A;  1WSU A;  4PZJ A;  3C18 A;  1TW3 A;  1BI3 A;  2QQB A;  4L18 B;  2FNA A;  2JZY A;  4AIH A;  2A69 F;  2XVC A;  3O6B B;  4MNU A;  1QBJ A;  4KUM A;  2E1C A;  2XUB A;  2BV6 A;  3KEO A;  1O57 A;  4KIG A;  3HUG A;  4Y17 A;  3GYH X;  2H27 A;  5E8I A;  2VOD A;  3ZMV A;  2MD5 A;  4P9F A;  3WU1 B;  4I0A A;  5D5W B;  4HQM A;  4Y13 A;  4HYE A;  3IL2 A;  3ABT A;  2ZFW A;  1KCA A;  2Z99 A;  3GLX A;  3ZN1 A;  1FNN A;  4G7O F;  1XSX A;  3LA2 A;  4RB2 C;  2X0L A;  4I0B A;  2QZ8 A;  2X4H A;  2DT5 A;  2STT A;  5CVR A;  2A07 F;  3FM5 A;  1Z6T A;  3HYI A;  4ESB A;  5K5R A;  2JTV A;  2OA4 A;  1IF1 A;  2KIU A;  4OIR F;  3SXY A;  4R8H A;  4OMZ A;  2MLK A;  2NS0 A;  1KQ0 A;  3TOA A;  2F5C A;  2G7U A;  2RGV A;  4RGS A;  4NHJ A;  1R1V A;  1AY9 A;  1VTN C;  2XRN A;  2COM A;  2MLG A;  2DBB A;  2IRF G;  2R3S A;  5JR3 A;  2ZCW A;  4Y15 A;  4LFU A;  3JSO A;  1IRF A;  2HOE A;  4U0Y A;  3LFK A;  2XHK A;  4LB6 B;  1B1B A;  1UMU A;  1J0R A;  2DPD A;  4WXD A;  2IPQ X;  4K8W A;  2FSW A;  2VXZ A;  3EYI A;  1BC8 C;  2MA3 A;  2XAH A;  1R36 A;  2A61 A;  1P6R A;  4EJT A;  2L02 A;  1FX7 A;  4EJV A;  4NB5 A;  2FA5 A;  3V8J A;  4FX0 A;  5FGM A;  3LAP A;  4RS8 A;  2NNN A;  4A5M A;  1U3E M;  3BRO A;  5ICF A;  4Z2Y A;  1G3Y A;  2FRH A;  2JT1 A;  1TLH B;  1K7A A;  1WWX A;  3RPU A;  3VFZ A;  2HEO A;  4AWX B;  2EA4 A;  1G3S A;  3JSP A;  1XDU A;  1KA8 A;  4ZZD A;  4KN4 X;  4G6Q A;  3MEX A;  2GA2 A;  1FPQ A;  2V1U A;  2OQG A;  2FF4 A;  2P4W A;  1IXS B;  3F23 A;  1OYW A;  4HF0 A;  3KP6 A;  2CSO A;  2EV5 A;  3J80 Z;  2CQK A;  2VOP A;  4EGZ A;  2VT2 A;  1OPC A;  4ON0 A;  4ASN A;  3GO5 A;  1FWZ A;  2E7X A;  4YII A;  2JSC A;  1EH6 A;  2IP2 A;  3KP4 A;  1B12 A;  1USS A;  3LQQ A;  5EEH A;  2IA2 A;  2HDC A;  2IVM A;  3BPV A;  2QQA A;  3IWZ A;  3TO6 A;  3LAJ A;  3E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...