1JHFA

Lexa g85d mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAADEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEXA REPRESSOR
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jhfA02
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jhfA01
1B9NA 3W6JB 2PLYA 2K4JA 4DQ2A 3K1PA 2LKPA 3QRFF 3KP7A 2HYGD 1NHAA 3CTAA 4N0BA 3I53A 2V9VA 5D5WB 2P6SA 2F5DA 3L09A 3M8FA 1RI7A 1CGPA 2IA2A 3OOPA 2O03A 4MQ9F 4K2EA 1PP8F 4XRFA 4L9TA 4EJVA 4RGXA 1OR7A 4RB2C 3QP6A 1BM9A 1YO5C 1FX7A 5ICCA 5FGMA 4AIHA 2DTRA 4EJTA 1I1GA 4HX7A 2CGPA 3BJAA 3LSTA 3ERED 2QVOA 4XSXF 3F6OA 5BS6A 2OQRA 1TW3A 2A6HF 4N31A 2BYVE 3GZ6A 3WGGA 1I5ZA 5LBQA 3DV8A 2DQRA 2RV8A 3RKWA 2XGXA 1B6AA 2HKXA 3SQNA 4AIKA 1HKTA 3PQKA 4M6XA 3FXQA 5ILVA 3ZMDA 2BBYA 1IW7F 1F4KA 1ZREA 1SMTA 4BHBA 5FLXK 2XIGA 1W4MA 1IF1A 3KP3A 5HDKA 2RNJA 2W24A 2EFQA 2D1HA 3LAJA 2L4MA 3COAC 4KA4A 4LLGF 4R8HA 1XB4A 4Q47A 2Q0OA 4NQWA 2D1VA 4KDPA 2KJBA 4FT8A 3C7JA 1PUEE 4ZZDA 2LF8A 2R7DA 2ELHA 2CO5A 5LLQA 3GX4X 3JAMK 3F8MA 1RUNA 2MH2A 5A2QK 3V8LA 1V3FA 3HRTA 2QQBA 4KIBA 1YYVA 4PZJA 2QENA 4R1HA 3SZTA 2L4AA 2KKOA 4QLCU 3FHZA 3R0JA 3ZP5A 4HF1A 2OBPA 4LK0F 4HOBA 3LQQA 3LAPA 3E5QA 1F1ZA 3PFIA 1O3QA 1LDJA 1WI9A 3RYRA 2HWVA 4UV9A 4M9SA 1J59A 4P9UA 3J80K 2WC2A 4XBFA 1BI0A 3NQOA 1XGOA 4U0YA 1ZLKA 1E2XA 4OU0A 3JTHA 1XCVA 1X3UA 1HW5A 4U7BA 1Z9CA 3FM3A 1ULYA 1W7PA 1O57A 4HDUA 3QU3A 1WWXA 2FSWA 2EA4A 1FYMA 4F7ZA 2VONA 3KP2A 5DUIA 2XUBA 1L3LA 1J2XA 3GEZA 4LB5A 3I64A 4I01A 3LA3A 3FZVA 1FLIA 3H92A 2DW4A 3ZN0A 1HQCA 1R58A 3TDZC 4RGUA 4A0YA 1LB2A 5FLXZ 3VEPA 2V79A 3WE3A 3E6CC 1P4AA 2W25A 1Z6RA 2ESHA 1BI2A 1UMUA 2CFXA 4WXHA 1OYYA 2K86A 4XLPF 4FX0A 1Z91A 2WWYA 2Z33A 5K1YA 2O0YA 1ZARA 4GO1A 2PN6A 3GFJA 2JT1A 3E5XA 1DP7P 5H20A 3JAMZ 3I58A 4WWCA 1QZZA 3JSOA 2XASA 4LK1F 5A2QZ 4D0PA 2ISZA 2A61A 1YW9A 3I0TA 3HSFA 4TV7A 2VXZA 3GWZA 1S3JA 5L3CA 4ESBA 3Q9SA 2FEZA 3HUGA 2HFHA 1GHCA 1S6LA 4M74A 4BH9A 2BGCA 5LHGA 3DKWA 3KETA 3QP5A 2Q8KA 1FNNA 3M7GA 3BPVA 4Y13A 2A5YB 5H6QA 4EJUA 3EUHA 3LA2A 2KIMA 3FXRA 1C0WA 2FKDA 1IAWA 1ZGJA 1CF7A 1I1SA 1R36A 4LG0B 4KFCA 3I59A 2A07F 4JK1X 4G6QA 2CW0F 5FB2A 2E7WA 2UWMA 2HEOA 3DQVC 3D5LA 1MGTA 3L00A 3VB2A 1XMAA 2LNBA 3QPHA 5DV5A 4N9HA 1LVAA 1ZGAA 4MTEA 1KU7A 4RB0A 3BDDA 4IHTA 4PGHA 2L01A 5K5RA 2DLLA 2YSRA 5D8KB 2ZJ2A 1H9TA 4AVPA 5DD8A 2XKPA 5FD5A 1JE8A 1R1VA 2XV4S 4MHGA 1IZ1A 1HKQA 4KNYA 2RDPA 3S2WA 4QWQA 3IC7A 1O7LA 1UHMA 1R7JA 3U1DA 2G9WA 5D8LB 2JZYA 2VT3A 2TDXA 2DI3A 5EEGA 4IXAA 3VFZA 1FY7A 3FXUA 3FWEA 2G7UA 1R00A 2VBZA 1FPQA 5DCMB 3F8FA 1O3SA 2QBYA 3KLOA 5LHHA 1REPC 1WSUA 2QUFA 2RN7A 5HLHA 1F5TA 1K7AA 5ICFA 3RPUA 2DAOA 2XAQA 2CYYA 2ISYA 3V8JA 3BJ6A 1DPUA 2A69F 2WTEA 5HDNA 3P7NA 3DP7A 2MBFA 2FMYA 2YPRA 3RI4A 3WG9A 3W6KB 1ZN2A 2HQRA 3CUQA 1DPRA 1J0RA 4WK8F 1H0MA 2BE5F 4A6DA 3HRSA 2YR2A 1IXCA 2FOKA 2HYFA 4HLYA 3ELKA 1G3WA 4YIFA 3WGHA 2E1CA 4KUMA 1Z6TA 2G7HA 4E70A 4ENNA 5JFRA 3ZMZA 4YFKF 2BEOA 1OMIA 2R3SA 2STTA 5HOOA 1T38A 2NRAC 1YQAA 3U9GA 1BI3A 1D8KA 1XDUA 3SHFA 3HTUA 1UFMA 2M45A 4YG2F 4S05A 1LNWA 4M9ZA 2ZFWA 2VBYA 3RDIA 4L18B 1BIAA 3ZMVA 2HTSA 1P4XA 4L5IA 2F2EA 5LHIA 4OIOF 1MZBA 2RKHA 2JPCA 2FXAA 5D6EA 2A6EF 3K2ZA 3B02A 5JVTA 4P96A 4IHSA 1QQIA 2UZKA 4UVAA 3J81Z 2CG4A 2O8XA 2EFWA 1RIOH 3NEUA 2EWNA 2PFBA 3FMRA 3U2RA 3LA7A 4O5VA 4IPAA 2L54A 3GFLA 2FQ3A 3ZMSA 1IN4A 3GLXA 3HHHA 4OIPF 2IJLA 4I7HA 4P9FA 3P9KA 3K1NA 4KT5C 1FOKA 2GXBA 5E20A 4HX8A 4RAZA 1B12A 4I02A 2RGVA 4MEXF 1P92A 4EJOA 4I98B 4BYYA 1R22A 3HHGA 5IT9Z 1PP7U 4KYWA 4ME8A 1USTA 1KQ9A 3VOEA 4ETSA 1G4DA 3V4GA 1S7AA 5F64A 1FSHA 3BJOA 2X0LA 4EVIA 4EGYA 5HS7A 4ASNA 4L0YB 2YX7A 4HA8A 2OA4A 2VBXA 2HGCA 1ZG1A 3BWGA 4M73A 3WODF 1MDMB 2PJPA 3H3ZA 1QNTA 4HQEA 5DCFA 4ZYHA 4GXOA 4KN4X 3IRQA 5L3GA 1R5GA 2Z9OA 1OYWA 3GZ5A 3VODA 4P55A 4M71A 1JHHA 2VC1A 4CO8A 1GVJA 4Q5SF 3HRMA 4A5NA 5E18F 2JSCA 5D5XB 1S7OA 2FU4A 3GUDA 4WF2A 2PI0A 5E1WA 2YX4A 2UXNA 2ZCWA 2QLZA 5DD4A 1TNTA 2ACJA 1XD7A 3H3UA 5FD6A 2JTVA 5TRDA 4Q48A 4O3MA 2IRFG 3KLNA 2MH9A 2M1BA 3KP6A 4LLLA 1YW8A 3JSPA 1HW2A 1ZRDA 2FF4A 3E5UA 3F8CA 5FO5A 5E8GA 1G3TA 4A12A 2KJCA 5LGTA 3Q5FA 4G7OF 1MJ9A 5HS9A 2EFOA 4UHTA 2GQQA 2XAFA 4EV0A 3WTWC 4YIIA 5HVQC 1HSTA 5CVJA 3DXJF 1W7PD 2FBIA 3HRUA 1S29A 3M9AA 3TOBA 2H6BA 5E1XA 2ZKZA 1H9GA 3CJNA 3K0LA 3R0AA 2YU3A 1IN6A 3P9CA 1MJBA 3KE2A 1KCAA 3IL2A 4U0VA 6PAXA 2EA2A 1T7DA 2P6TA 2VE9A 3MCZA 1OYIA 1HSJA 4CYDA 4HX4A 1G3SA 1HBXG 4UVCA 2DBBA 4DNCA 3WU0A 2VN2A 1USSA 2CSOA 1QBJA 2DU9A 1FBSA 2OAZA 3F23A 2VOOA 5J6XA 3WTVC 4HZFA 3ABTA 2GIVA 2K4BA 1B9MA 1W5SA 4YFXF 4ZYGA 1SD5A 4KMFA 3HOTA 5J8CA 1KQ0A 1ON2A 3M1EA 1ZYRF 5LRRA 4NV4A 1K78B 2K7LA 1WKMA 2FNAA 4CXFA 1JGSA 4GCVA 1FWZA 3QPTA 4U7DA 4LGWA 5ERIA 4UVBA 2P7CB 4G7ZF 3S04A 5H6RA 2Y48A 2LDUA 4ZH4F 2ZMEB 4BQAA 3RIRA 3CLOA 4KMUX 3TO6A 2Z3YA 2GA2A 1B4AA 4WX9A 1UHWA 1QZYA 1R1TA 2VBWA 3FMQA 1Z1DA 2Z99A 1KQ8A 1FC3A 4AD9A 4AWXB 3TDUC 1TTYA 2UXXA 4MTDA 1RNLA 1D5VA 3R6SA 2NS0A 3GW2A 2LSOA 4EJWA 4G94A 2FMLA 4EM1A 5HDGA 1XN7A 5LGNA 3ZMUA 4CHUA 1IN7A 3R60A 3ABUA 5D6FA 5BMZA 4HYEA 2STWA 3I71A 3REOA 4R79A 3BROA 1U5TC 3GVAA 3T1BA 5J8FA 2EK5A 1R5HA 1XCBA 2XVCA 2OZUA 2E1NA 4S04A 1ODDA 4L9VA 1SD4A 4XLNF 3WTTC 3V8KA 4LJZF 4WXCA 2AXLA 1R23A 2IVMA 2GXGA 3FX3A 3BDNA 1IUYA 4IRGA 2P5KA 5BOXA 5D4SA 1OKRA 1MKMA 1LJ9A 5CVIA 1K78A 1D8JA 5BQTA 1OPCA 3MZHA 2HO0A 3KFWX 4CICA 4FHTA 5DDGA 1TQMA 2P7VB 5AIQA 4I0BA 2V1XA 4ZYDA 3ML6A 4YFNF 4H0EA 2M8EA 2H09A 2VODA 5HLGA 3K69A 1EH6A 3WTZA 3R4KA 1GXPA 2IT0A 4CDGA 3GF2A 1U5TB 3F8NA 1HXDA 1ZG3A 2ZMEA 2C6YA 3E97A 2DK8A 4EMSA 1U8RA 3I54A 5K5OA 5EEHA 2RQPA 3T8TA 2D2WA 2NYXA 5CVUA 2W57A 3TQNA 3DF8A 1A04A 3BP8A 3HIFA 5L3FA 3EYYA 2Y75A 1BOAA 1W5TA 3SZPA 4IRIA 3WTSC 1IRGA 4LLNA 2ZNZA 3C18A 3J81K 3C1DA 4KIFA 1KYZA 5KVRA 1SFXA 3O2PE 2IA0A 2H94A 3ECOA 2OQGA 5LEJA 2RVCA 5HS8A 1UCRA 5BPIA 4I0AA 3WU1B 4BHCA 4LG0A 3IHUA 2HR3A 2FNPA 2P4WA 5IT9K 1FP2A 1U78A 3BOQA 2XAJA 5JHUA 1WRJA 4B8XA 4GYGA 3CO7C 4IJAA 3JTGA 2HOEA 3OV8A 4KICA 2O6GE 3C3WA 2OD5A 3HSEA 3R61A 3HOSA 4OMZA 4GYIA 4L5JA 1KU2A 3FM5A 3MFKA 4JQFA 1IN8A 2V6CA 3QOPA 4A6EA 5DUKA 4EGZA 3WTUC 2L02A 4IF4A 3DPTA 2KIUA 4ENKA 5ED4A 3KCCA 2HTJA 3CDHA 3ULQB 3SFZA 1ZRFA 5JR3A 3E6DA 1P4WA 2ZBKA 3P9IA 3MAJA 3ROUA 5CVRA 4RGSA 4RB3C 1KU9A 1XMKA 3DFGA 1RUOA 2PMUA 2A68F 3WGIA 2MC3A 1O3RA 1FZPB 3RPQA 3RYPA 4IVNA 1IXRC 5DCMA 2MD5A 3I4PA 4OOIA 3PQJA 1XSVA 3GYHX 1RZ4A 4OMYA 5LEKA 1MJAA 1YFHA 1D3YA 4EQQA 3HYIA 2PBIA 2WV0A 2L3DA 5F6FA 3RKYA 2DT5A 3F8BA 1U3EM 4Z2YA 1G6NA 3FMSA 2COMA 4P5OA 2CQKA 5DEQA 1ZH5A 4I09A 3GO5A 2VT2A 5KK1A 1S8NA 2OU2A 3MZYA 1YS6A 1J7KA 5L3BA 3ECHA 1SFEA 5D5UB 1SFUA 2DK5A 1LDKB 1TBXA 4HQMA 4L9NA 1QGPA 2GZWA 3TO7A 3HSRA 1JHEA 4BNCA 4A2UA 1T2KA 4A0XA 2XAGA 1XSDA 5FFZA 3V7CA 1FT9A 5ILSA 4LD5A 1O7FA 2NNNA 3G3ZA 1QPMA 1KGSA 1W7PB 1KU3A 5DYMA 3D0SA 2DFIA 4G7HF 2EB7A 3IWZA 2VOPA 2M30A 1STZA 5HLIA 1XDSA 1AOYA 3KP4A 1MD0A 2E7XA 4EM0B 1YTYA 2B0LA 3M8EA 2FRHA 3E6BA 1FSEA 1I6XA 5D5VB 3WE2A 4RAYA 1ZRCA 4RGRA 2XRNA 1GXQA 1BBYA 1U6GA 4RS8A 3TOAA 1ON1A 5FFXA 3IRRA 2BV6A 1F39A 1PDNC 2FBKA 4WXDA 4KN7X 2EV0A 5LGUA 5CYVA 1Z05A 3Q9VA 4ENJA 2Y0MA 1R1UA 3J7AO 4NB5A 2JPBA 3EETA 2GWRA 3I5UA 1FYLA 5AIPA 1VTNC 1XGSA 3EQLF 2QYOA 5IT3A 2V1UA 2HKOA 2FBHA 2EFNA 2XHKA 1G3YA 1LDDA 4UNOA 2PG4A 4ESJA 3T8RA 3F22A 2GA1A 4PDKA 5AONA 3N97A 3EDPA 1JHCA 4O6JA 5K5QA 1LEBA 4UXNA 1IXSB 3F21A 1LEAA 4MQVA 3WTYC 1JHFA 4I2OA 1L0OC 2QQ9A 4K8WA 3K1MA 2HDCA 1XSXA 2KRFA 1SD6A 1CF7B 3MEXA 1T6SA 1MDMA 2PMHA 4Q4ZF 3BY6A 2MLKA 3KP5A 3I59B 3QAHA 2FJRA 3F6VA 1AWCA 2Q2EA 1SD7A 4Y17A 2FE3A 4OINF 4LFUA 4BAYA 4L9JA 2F5CA 2J5PA 2HNFA 3BZ6A 1EH8A 1ONVA 4BHPA 3LQRA 5BPDA 3BPXA 4HBLA 1TW2A 1ZG5A 1TQPA 2QZ8A 2Z5UA 1TNSA 2ETHA 1FYKA 2ADUA 2DPDA 2CWEA 1P2FA 2ESNA 2JRTA 4EM2A 3IKVA 1YLFA 5ICEA 5L3DA 3O6BB 5L3EA 1J75A 4KIGA 2F5FA 1B59A 3CUQC 4M9XA 2J5OA 1XGNA 1YW7A 4HF0A 4BXUA 4HW0A 3IIQA 2R7FA 2K27A 3QU6A 2DQLA 3KEQA 4HF2A 1EH7A 4CGZA 2H6CA 2QBYB 4UV8A 5E8IA 2P5VA 1YS7A 2ZXJA 2IW5A 3J80Z 2EV5A 2HS5A 2H27A 3MWMA 4ZZLA 1K6OA 2FA5A 2KIFA 2O61A 1BIBA 2ZNYA 4LMYA 1FBUA 4JBAA 1T39A 3KZZA 3CUQB 1K79A 3E3VA 4XSZF 2PEXA 3ZPLA 1E17A 3O3KA 4OIQF 2IP2A 3ZN1A 4PGGA 1J9IA 2W85A 4MEYF 5E17F 2P5LC 1BC7C 4L0ZB 2EV6A 1HW1A 2HZTA 3WTXC 3B73A 1IN5A 2A3SA 4G8XA 2MA3A 2LF7A 2PQ8A 4A5MA 1U2WA 4MNUA 2XKOA 3TO9A 4HLXA 3L7WA 2DPUA 1T98A 2V1DA 1TLHB 2M5WA 2AS5F 3K9TA 2F5EA 4A0ZA 3ZQ7A 2HQNA 3GFMA 3AAFA 1DUXC 4U0WA 1BN5A 3IWFA 2EJRA 4M72A 2M87A 4HV5A 2RC4A 3V7SA 2MLGA 4N9IA 2NAZA 4M6YA 4B09A 5ILUA 4IRHA 3TGNA 3MQ0A 1IRFA 4ESFA 1ZAOA 2EFPA 2NNYA 3ISPA 3EYIA 5D4RA 3G73A 4NHJA 5CLSA 1BI1A 1O3TA 1F9NA 5F1RA 3LWFA 2X4HA 1HKSA 1SMYF 1ZLJA 2QM3A 1I4VA 4AIJA 4LB6B 2K02A 3RJPA 3NRVA 3DEUA 2DO7A 4OIRF 3CO6C 1I27A 1T0FA 1SAXA 3L9FA 3SXYA 1FP1D 2QWWA 3GXOA 4FX4A 4U88A 3F3XA 2IPQX 5E1ZB 3V7RA 1WQ2A 1ZHFA 2W84A 2XAHA 1QO0D 2XROA 5ICGA 4Y15A 4CZZA 4ZYEA 4RB1A 3N4MA 1JXSA 5TJJA 3IKTA 4HAMA 1B1BA 3TKYA 5LRSA 1P6RA 2QQAA 1BJAA 1BC8C 1Y0UA 3KZYA 3T5XA 1J5YA 3L2CA 1Q1HA 1EV7A 4MGRA 1YIOA 1Z7UA 2ZO4A 2D45A 4G6DA 4ON0A 1U5TA 1KN9A 1KA8A 1YG2A 2VC0A 1FBQA 4HV6A 4PCQA 3F72A 4UUVA 2OZ6A 2IA1A 4HDVA 3RKXA 5CVVA 1AY9A 3RTRA 1TQIA 4GGGA 3KEOA 5CJ9A 3E6MA 2O3FA 4G9YA 1UB9A 3CUOA 2P8TA 1KYWA 1LQ1A 3GFIA 4ENMA 3HTSB 1XGMA 3ZMTA 5JI6A 2GAUA 4WCGA 3JW4A 3LFKA 3FF5A 1DDNA 1V4RA 3T0YA 3DPLC 2VE8A
chains in the Genus database with same CATH superfamily
4NUBA 2CQ7A 3S93A 1B9NA 3LL7A 3W6JB 5GAGJ 2HU9A 2WB1A 4BY1J 3G2BA 2PLYA 2K4JA 4DIQA 4DQ2A 3K1PA 4YELA 2LKPA 3QRFF 1S9HA 2IGKA 2M2EA 3KP7A 1VQ8I 2HYGD 1NHAA 2O7OA 1VF9A 4J00A 3CTAA 2JA7J 4N0BA 3QQAA 2VJJA 3I53A 2V9VA 5D5WB 2P6SA 4PK4A 2F5DA 3L09A 3BG3A 4AIDA 3M8FA 1QHGA 2CRGA 4FISA 3NARA 1RI7A 3L2WA 2KDZA 1CGPA 2IA2A 3KEYA 3OOPA 2O03A 5F1JA 3CC7I 4MQ9F 4K2EA 1PP8F 4UB8C 2DMUA 5M5XJ 3HGYA 2M3AA 1HOMA 4XRFA 4L9TA 4EJVA 4RGXA 1OR7A 4RB2C 2K9MA 3QP6A 1BM9A 5IP9J 1YO5C 1MMAA 2V26A 1FX7A 5ICCA 3OYGA 2IAIA 1UHSA 5FGMA 4AIHA 4PUSA 2DTRA 3DTIA 1G2HA 1Y8QB 4EJTA 4KISA 2MW8A 2NVUB 2HOTA 1I1GA 4HX7A 4XN0A 2CGPA 4XKBA 2X6YA 3BJAA 3LSTA 1Q1VA 3CMAI 3ERED 2QVOA 4XSXF 3FKJA 3SDBA 3S1QJ 3F6OA 3QWLA 1QA6A 5BS6A 1ZGWA 2EZIA 2OQRA 1TW3A 2A6HF 4N31A 2BYVE 3GZ6A 3WGGA 2E1OA 3LFUA 3K7AJ 1RKTA 2WADA 2CV1A 1I5ZA 2JWTA 4MIMA 1Z7LA 5LBQA 3DV8A 2DQRA 4A69C 1T08B 3TL4X 2RV8A 1GT0C 3MKWB 2DA5A 3RKWA 2XGXA 5LFAA 1B6AA 2HKXA 3S1NJ 3A03A 3QPSA 4BGDA 3SQNA 4AIKA 1HKTA 3PQKA 1V5FA 3OYJA 3MKYB 4CYCB 3ABLH 3B6AA 3J7YJ 4M6XA 3FXQA 5FKMA 5ILVA 3ZMDA 2BBYA 1IW7F 1F4KA 1ZREA 1Z67A 2XC7A 1SMTA 4BHBA 1A35A 3BR1A 5FLXK 2XIGA 1W36D 1W4MA 2LR8A 1IF1A 2JVGA 3A0BC 3A0HC 2ZB9A 3KP3A 5J40A 2RNJA 5HDKA 2W24A 3OYIA 1JT0A 4PSWA 2EFQA 1WVRA 2A05A 2D1HA 3LAJA 2L4MA 3COAC 4KA4A 4LLGF 4DBRA 2Y2ZA 4R8HA 1IRZA 1BR4A 1XB4A 1YX5A 2KFDA 1Z0XA 4Q47A 3PM1A 2Q0OA 4NQWA 2D1VA 1X58A 2KJBA 4KDPA 1LFUP 4FT8A 2KQRA 2K40A 3C7JA 1PUEE 3PFYA 4ZZDA 2LF8A 2R7DA 3OYEA 1MH3A 4L5EA 2LRDA 2ELHA 3CESA 2CO5A 2Y30A 5LLQA 3NAUA 5C44J 3GX4X 3JAMK 2Y69H 4IO9F 5F27A 1LUJB 2XF6A 5TISC 1I3QJ 3F8MA 3SEQA 1RUNA 2MH2A 1X2MA 3CQZJ 1JTYA 5A2QK 3V8LA 4BXFA 1V3FA 2V6EA 3HRTA 2QQBA 3HUGB 4KIBA 3SYTA 1YYVA 4PZJA 2QENA 2CH0A 3IAS2 4R1HA 3SZTA 2L4AA 1ETXA 2FQ4A 2OCEA 2W7NA 1MNMC 2KKOA 4QLCU 4E7HA 3S8PA 4AC0A 3FHZA 2GIZA 3HPGA 3R0JA 1AU7A 3K2AA 3ZP5A 1ZR4A 4HF1A 2OBPA 4MFDA 4LK0F 4HOBA 1HCRA 3LQQA 3LAPA 3WHCA 3E5QA 3AG4H 1F1ZA 2X1EA 3PFIA 1O3QA 1LDJA 1WI9A 3RYRA 2HWVA 4UV9A 4M9SA 5B5EC 1J59A 4P9UA 3J80K 2WC2A 4XBFA 1ETKA 1BI0A 3H36A 3NQOA 4C9YA 5B1AH 4PSXA 1XGOA 4U0YA 1ZLKA 1E2XA 4OU0A 1BW5A 3JTHA 1XCVA 3KZIC 1X3UA 3Q3SA 1HW5A 4U7BA 1Z9CA 2ZMEC 3K4MA 1T7DA 1UMQA 1WFXA 3FM3A 2QSHX 1ULYA 2HYJA 3SZGA 1W7PA 4ZTJA 1UJ8A 1NTCA 2CW8A 1OQYA 1O57A 4HDUA 2Z2SB 3QU3A 1WWXA 2PJRB 4GFBA 2FSWA 1BOBA 2EA4A 1FYMA 2BY2A 4F7ZA 3C2HA 2XGCA 2HI3A 3KP2A 1OJLA 2VONA 4KT6A 5DUIA 3MVPA 5E3LA 2XUBA 1L3LA 1J2XA 3GEZA 5B66C 4LB5A 3I64A 4I01A 3I4MJ 4A3GJ 3LA3A 3FZVA 1FLIA 3H92A 2DW4A 3H5NA 3ZN0A 2R92J 1HQCA 1R58A 3TDZC 4YEJA 2DA4A 1PVEA 1Y39A 4RGUA 3TW7A 3DLLF 4A0YA 4XQFA 4HNTA 3PO2J 1LB2A 1D1AA 2Z1DA 3VEPA 4XR6A 5FLXZ 2KLOA 2LD5A 2CUFA 2V79A 3WE3A 3E6CC 2IGNA 4FASD 1P4AA 2W25A 1Z6RA 2ESHA 1BI2A 1UMUA 2CFXA 1NK2P 4WXHA 2DA2A 1OYYA 2K86A 2CFOA 4XLPF 1SEUA 4FX0A 1Z91A 2WWYA 1TWGJ 1Z21A 4XLAA 2Z33A 3HOXJ 1X1BA 3H9QA 1JKQC 1VQ7I 5DTDA 5K1YA 3Q0WA 2O0YA 1T0FC 3DKXA 1D0XA 2MGQA 3H1CA 3HL2A 5B1BH 1ZARA 4GO1A 1BW6A 1A5JA 2PN6A 3GFJA 2JT1A 3E5XA 3F0CA 1DP7P 5H20A 3JAMZ 3I58A 4E7IA 4QPQA 4WWCA 1X3ZB 2DYSH 1QZZA 3JSOA 3EUKL 2XASA 2EIMH 4LK1F 5A2QZ 3HKZA 1DU0A 4GRIA 4D0PA 4BE1A 2ZXHA 2A61A 2ISZA 1YW9A 1WGXA 3I0TA 2F48A 3QYBA 2R93J 3HSFA 1X2NA 4Y52J 1S5LC 4TV7A 2VXZA 3MN2A 3GWZA 1XMXA 2BHZA 1S3JA 3OIOA 5L3CA 4XKCA 1EA3A 3V42A 4ESBA 3Q9SA 2FEZA 2Z16A 3HUGA 2HFHA 5IY5H 1S6LA 1GHCA 3I3LA 2LH9A 3ABMH 2L7KA 1SVOA 4M74A 2NVXJ 4BH9A 2BGCA 5LHGA 5BNGA 3DKWA 5F0CA 3KETA 3QP5A 2Q8KA 1FNNA 3FDYA 3C2GA 4A3IJ 3M7GA 5CQEA 3BPVA 4Y13A 3SFIA 2A5YB 5H6QA 4EJUA 3EUHA 3LA2A 2KIMA 2LK2A 2ME6A 3FXRA 5EG0A 1C0WA 2FKDA 1NG6A 1IAWA 1ZGJA 2KL4A 3JRIA 3GTJJ 1CF7A 4ZDOA 5FJ8J 1I1SA 2QCOA 1R36A 2IXSA 2B63J 4LG0B 3PSIA 4KFCA 3K70C 1N77A 3C2BA 5FKKA 3I59A 3HB9A 2A07F 2FJ1A 2Y9YA 4JK1X 4G6QA 5EDNA 2NOGA 2HPIA 2CW0F 5C4JJ 3S17J 5FB2A 2E7WA 4M3GA 3FK6A 4JOMA 2UWMA 1OCZH 2HEOA 4C2TA 3DQVC 2OJED 4DOZA 2PJRA 3BCAA 4BACA 2PMZA 3D5LA 1MGTA 3L00A 3VB2A 2RAEA 3WG7H 2IBDA 1XMAA 4XLEA 2LNBA 3QPHA 3PO3J 4B44A 5DV5A 1SVMA 2E1MB 3ABKH 4IOAF 2ICWG 4N9HA 1LVAA 1ZGAA 4MTEA 4IOCF 1KU7A 4OAYA 2X1DA 4RB0A 3H9JA 3LOCA 4E7SA 2ZC2A 3BDDA 4IHTA 4PGHA 2AXTC 4CCMA 2JUCA 2L01A 4MFEA 1EF4A 1JUMA 5K5RA 1FOXA 1LPQA 2DLLA 2X85A 2EH3A 4Z6YA 1FOWA 2RREA 2YSRA 5D8KB 4N4NB 2ZJ2A 1N78A 1H9TA 3OL3A 4AVPA 4DYRA 2KP6A 5DD8A 2HPMA 2XKPA 3FXOA 5FD5A 1JE8A 2NVYJ 4G6TB 1LE8A 1R1VA 1X3WB 2XV4S 4MHGA 2HNHA 1IZ1A 1HKQA 4KNYA 2JA8J 4RA2A 2RDPA 3S2WA 1NK3P 4QWQA 3IC7A 3D1NI 1O7LA 1UHMA 1R7JA 2R7XA 5GAHJ 3CF2A 1TWFJ 3U1DA 2G9WA 5D8LB 3TMOA 1YOVB 2WY8Q 2JZYA 2VT3A 3HKZN 2TDXA 1SAUA 1W0TA 2DI3A 5EEGA 1Y1WJ 3D5SC 1OCCH 4IXAA 3VFZA 1FY7A 4AYBA 3OYBA 3FXUA 1V5GA 3BG5A 1I3AA 1QRYA 4PFPA 3FWEA 1WJCA 2G7UA 1OR7C 1UELB 1R00A 2KHMA 3P5JA 2M0CA 3L2RA 2VBZA 1FPQA 3ZCOA 5DCMB 3TW6A 3F8FA 1YHQI 1O3SA 2QBYA 3KLOA 5LHHA 2VQHA 4XOPA 3DU5A 1APLC 1REPC 5F0FA 4NC8A 4UUSB 3JRAA 1WSUA 2DFFA 4DW6A 2QUFA 1QVUA 2RN7A 1J09A 5HLHA 1F5TA 1K7AA 2VQGA 3E7LA 2TCTA 4DYCA 4AUXA 5ICFA 3RPUA 1HLVA 2DAOA 3AG2H 2IS6A 4B3XA 2XAQA 4CA0A 2CYYA 2ISYA 3V8JA 5KAFC 4IQ4A 4UY8I 3K4KA 4BY7J 1RR8C 3BJ6A 3ESWB 1BR2A 3CCMI 2A69F 1DPUA 2WTEA 3U1KA 5HDNA 3P7NA 1HC8A 2CQQA 3DP7A 2W00A 4C3JJ 2MBFA 2FMYA 2YPRA 3RI4A 2K9QA 3WG9A 3GLLA 3W6KB 3DBRB 4ZTFA 1ZN2A 2HQRA 3CUQA 1DPRA 4E7KA 1J0RA 2PMZN 3FK7A 4WK8F 1H0MA 2BE5F 1B8IA 4A6DA 3HRSA 4XIDA 2YR2A 1X4PA 2XB5A 2MABA 3K70D 2VL8A 1JKOC 4E4HA 2KIQA 3JRFA 1IXCA 2FOKA 2E36A 2HYFA 3S32A 2DOEA 1OISA 2ZSHB 4HLYA 2XPUA 2CUJA 3ELKA 1G3WA 4YIFA 2VIXA 2ZXIA 3WGHA 4II3A 2DT7B 2VKDA 2E1CA 4KUMA 2I8DA 1Z6TA 1W1WE 1R4MB 3S16J 2ID3A 2G7HA 3O8GA 4E70A 3OYAA 2B7EA 1K61A 4ENNA 4LG3A 4RM3A 4F3QA 5JFRA 1JUPA 3ZMZA 2BEOA 4YFKF 1OMIA 3OIQA 2R3SA 1MSEC 3PSFA 4PJNA 2STTA 4C30A 1ETVA 5HOOA 1T38A 1OCPA 2NRAC 2ECBA 1YQAA 3U9GA 1VQ9I 1BI3A 4V2GA 1D0ZA 3BC8A 2X6OA 1D8KA 5DS9A 2CV2A 2EZLA 1XDUA 3OS0A 3SHFA 2QEXI 3HTUA 1UFMA 2EZHA 1W36C 2M45A 1YJ9I 4YG2F 4S05A 1LNWA 3DEWA 2V7FA 4M9ZA 2DDBA 3HXLA 1OCOH 4B3AA 1D0YA 3LNQA 1I6HJ 5FKLA 3ZQLA 4AYBN 3LSHA 2ZFWA 4UB6C 1WPKA 2VBYA 2XF5A 3RDIA 4BBRJ 4L18B 4J01A 1PYVA 1BIAA 3ZMVA 3RSNA 4BE2A 2GLOA 2M7AA 4BS9A 2QGUA 2HTSA 1P4XA 4L5IA 2F2EA 5LHIA 4OIOF 2CMPA 2X6WA 1IV6A 1MZBA 5J1UA 2R5ZB 3BTIA 2RKHA 2JPCA 2FXAA 5D6EA 2A6EF 3K2ZA 3B02A 1D1CA 1FIPA 2AHQA 5JVTA 4P96A 3OYMA 4IHSA 3HDDA 1VQMI 1QQIA 4PJJA 4UVAA 2UZKA 3S15J 3J81Z 2CG4A 1DU6A 2JUGA 2O8XA 2EFWA 1RIOH 4E6KG 3NEUA 2EWNA 3ZOBA 2PFBA 2LP0A 2LMDA 3FMRA 3U2RA 1Z77A 3LA7A 2K9NA 4O5VA 3BLYA 4IPAA 2L54A 4F92B 3GFLA 2M34A 2FQ3A 2HOSA 3ZMSA 2DA6A 2JN6A 1IN4A 3GLXA 3HHHA 3MKLA 1I39A 3DLAA 4XLHA 4OIPF 2DT6A 2IJLA 4I7HA 3H3VK 2BVLA 4P9FA 3P9KA 3K1NA 2ID6A 4KT5C 4A3EJ 5HODA 1FOKA 2GXBA 5E20A 1ERDA 4HX8A 1X19A 4RAZA 1B12A 4D7NA 5E79C 4I02A 2RGVA 4DZJA 1NG7A 3Q0UA 4MEXF 1P92A 4EJOA 4I98B 1XC5A 4BYYA 1R22A 5H2FC 3HHGA 2R5YB 2DA1A 5IT9Z 3BG9A 2Y0SN 4CSWA 2LOOA 3L2QA 1PP7U 3TEDA 1VZ0A 2RNGA 2LY1A 2R7QA 4KYWA 3FBIB 1USTA 4ME8A 4M6VA 5IP6A 1TZLA 1KQ9A 3VOEA 4ETSA 1G4DA 4D5FA 3RZDJ 3I4NJ 3H35A 3V4GA 1S7AA 5F64A 1XX5A 1YE9A 3BJOA 1B72B 1FSHA 2X0LA 4EVIA 2DA7A 4EGYA 2R7UA 5HS7A 4ASNA 4L0YB 2W4SA 2YX7A 4BU2A 4HA8A 1K4SA 2OA4A 2VBXA 3IH4A 2BW3B 2HGCA 1ZG1A 3MKZA 2ECCA 2QQ8A 2VB6A 3GTPJ 3BWGA 4C3IJ 4M73A 2YUSA 3WODF 5JVGF 3L1PA 1MDMB 3PUBA 3A01B 4D1QA 3KPHA 2PJPA 4I76A 3H3ZA 2M4GA 3ZQGA 4ZDPA 3HZJA 1QNTA 4HQEA 5DCFA 4ZYHA 3SJMA 4GXOA 1R6RA 4B1RA 4XRSA 1AKHA 4KN4X 3IRQA 1XPXA 5JLWA 2Q2EB 5L3GA 1IJWC 1R5GA 2NXNB 2Z9OA 1OYWA 4CCOA 3BTJA 3GZ5A 1F36A 1FTTA 3VODA 4P55A 4M71A 1JHHA 1U9OA 2VC1A 4XLFA 4I6ZA 4CO8A 1GVJA 4Q5SF 1GV5A 2KPMA 4RMNA 3HRMA 5E3OA 4A5NA 5E18F 2JSCA 3JR9A 5D5XB 2H1KA 1S7OA 2FU4A 2EQRA 3GUDA 4WF2A 5J4YA 2PI0A 2VPLA 5E1WA 2YX4A 2UXNA 2ZCWA 3OS1A 2QLZA 3TP0A 1WI3A 5KHDA 1TWHJ 2X6XA 5DD4A 2HXOA 3CCEI 1TNTA 2ACJA 4XRMA 2HVSA 1XD7A 3FISA 3H3UA 5IYBJ 1OLTA 2L7ZA 2UV1A 5FKOA 2JTVA 5FD6A 5TRDA 4A3MJ 5IPAA 1PUFB 3S1MJ 1D1BA 2MSYA 4Q48A 4O3MA 1YRNA 1EKEA 2IRFG 2L0KA 3KLNA 1U0JA 2MH9A 2M1BA 3KP6A 2R5ZA 4LLLA 2WB1N 2HQAA 1YW8A 2WY7Q 1M1EB 3JSPA 3WU2C 1HW2A 1ZRDA 2FF4A 3E5UA 3F8CA 2LBFB 4Y3OA 5FO5A 5E8GA 1G3TA 1RR7A 4A12A 2L9SA 5J1YA 2KJCA 5LGTA 5KCMA 5GPCA 3Q5FA 9ANTA 1N25A 5FROA 4G7OF 1MJ9A 3LMMA 1RPWA 5HS9A 2LY2A 2EFOA 4UHTA 3W3CA 2GQQA 1MMNA 2XAFA 2XRLA 4EV0A 1JTXA 4BDZA 2DMNA 2OTLI 3WTWC 4YIIA 5HVQC 1HSTA 2XSDC 5CVJA 3DXJF 1W7PD 2FBIA 3ERMA 1S29A 3HRUA 3M9AA 3J7ZI 3GTKJ 3TOBA 1UZCA 3FXLA 1UG2A 2H6BA 5E1XA 2ZKZA 1H9GA 3CJNA 3PNTA 3K0LA 3W2AA 3R0AA 5M3MJ 2YU3A 1IN6A 2FD5A 3FXMA 3P9CA 2HDWA 1E3HA 1MJBA 4J19A 3CMEI 2K9LA 1TWAJ 3CCQI 3G4SI 3KE2A 1KCAA 5LD2C 3IL2A 3O8HA 2VPRA 4LITA 2XDVA 4U0VA 2EA2A 4BEHB 4IZZA 2P6TA 2VE9A 2VJ5A 2B9SA 6PAXA 3MCZA 1I50J 1B72A 1OYIA 3ZQCA 5FRNA 3BR2A 1HSJA 2M9HA 4CYDA 4HX4A 2R7RA 5EGOB 2GOXB 1G3SA 1HBXG 5C3EJ 4UVCA 2VKEA 1UAAA 2DBBA 4DNCA 1IO2A 3WU0A 2CU7A 2VN2A 2DN0A 4BDYA 1USSA 2CSOA 1K4TA 1PJRA 1QBJA 2DU9A 4C2MJ 1P9QC 1H89C 1FBSA 2OAZA 3F23A 2VOOA 5J6XA 3WTVC 1SFOJ 4HZFA 3ABTA 1BJZA 2GIVA 2K4BA 4Y33A 3FHNA 1B9MA 1WHUA 1VNDA 1W5SA 4YFXF 3DBHB 4ZYGA 3CP8A 1SD5A 4DYQA 4RM2A 4KMFA 3HOTA 3AG3H 1JT6A 3JREA 4CYCA 2IS2A 5J8CA 4BKXA 1IDYA 1KQ0A 1ON2A 3M1EA 1TT0A 1ZYRF 5LRRA 4NV4A 1K78B 3G1LA 2K7LA 1WKMA 1VQPI 2FNAA 4CXFA 3JRDA 4BL0B 4B43A 3LSKA 1JGSA 4QTRA 1WH5A 4GCVA 3TBIA 1FWZA 3QPTA 5EZGA 4U7DA 4LGWA 5ERIA 2HOAA 4UVBA 1X4OA 2P7CB 4G7ZF 5E3NA 3S04A 1ZKGA 1KZHA 3OSGA 1Z3YA 3PL8A 2WV1A 5H6RA 2Y48A 4QSHA 3CCUI 1YJWI 1PUFA 1R49A 2LYCA 2LDUA 2CUEA 4ZH4F 2CQNA 3HGGA 2ZMEB 4BQAA 2KMUA 3RIRA 5K7ZA 3IH3A 3CLOA 2WA0A 4YRVA 3OYDA 4KMUX 3TO6A 2Z3YA 1DGWY 2GA2A 1B4AA 3A4CA 4WX9A 5M3FJ 4D5CA 2L9NA 4IHYA 4M3FA 1UHWA 3OWTA 1QZYA 4F55A 2BXZA 1R1TA 2VBWA 5J47A 3FMQA 1Z1DA 2Z99A 4A3FJ 2NVTJ 1KQ8A 2H8WA 1FC3A 1K6YA 4AD9A 3BQYA 4AWXB 3TDUC 3OR2C 1TTYA 3NWTA 3K10A 4XORA 3ZGKA 4DGWB 2R7VA 2UXXA 1WJBA 2LG4A 2L7FP 4MTDA 1RNLA 1D5VA 3R6SA 4HSRA 2NS0A 3GW2A 5J3LA 3X2QH 2LSOA 4EJWA 4G94A 2FMLA 2RQQA 3BTCA 4EM1A 4X6AJ 5HDGA 4II2A 4BUPA 1WCMJ 1XN7A 5LGNA 4A93J 3ZMUA 4IQJA 4CHUA 1IN7A 2BVMA 3H0DA 3R60A 1HA8A 2M7BA 3ABUA 2AQFA 5D6FA 4IX7A 5BMZA 1N75A 4HYEA 4XOTA 2STWA 2E19A 3GTQJ 3H9GA 3OYNA 3I71A 2MFZA 3OMYA 3KX2A 2L2OA 3REOA 4A3DJ 4B4CA 1K83J 4R79A 2DXIA 4LOCA 3ASNH 4EATA 3BROA 3TP3A 3OS2A 1U5TC 3ZRGA 3KYLA 3GVAA 3T1BA 5J8FA 3FBNB 3ZR8X 5DM7F 2EK5A 1R5HA 2BY3A 3EUAA 2HVRA 1XCBA 2XVCA 2OZUA 2KRHA 1BR1A 2E1NA 4S04A 4CZCA 1ODDA 2LREA 2VKVA 4L9VA 2Y9ZA 3S3NA 3I55I 3OOUA 1SD4A 4XLNF 4LIVA 2HQ5A 3WTTC 3V8KA 3OL4A 4LJZF 2AXLA 1R23A 3KIOA 4WXCA 1MH4A 2IVMA 3CCRI 2GXGA 2CS3A 1JJ8C 2KT0A 3FX3A 5IYDJ 3BDNA 1E0EA 1IUYA 1ITYA 2GM4A 1T95A 2JMWA 2M0MA 1SFKA 4IRGA 2P5KA 5BOXA 2V9KA 5D4SA 1FMWA 2GBYA 4F52A 1OKRA 2D5VA 2N8GA 1MKMA 1LJ9A 5CVIA 3SDGA 3DTEA 1K78A 1VQ5I 1GDTA 2EZKA 5BQTA 1JGGA 1D8JA 1RRJA 1WJ5A 1OPCA 3MZHA 2HO0A 2HXIA 3KFWX 4CICA 1YITI 4FHTA 3IP4B 4ZJZA 2ZJQF 5DDGA 1TQMA 2P7VB 3LSRA 4M3BA 5AIQA 3DWLE 4I0BA 2V1XA 4ZYDA 3ML6A 4YFNF 2Q1ZB 4H0EA 4A3KJ 2M8EA 4A3LJ 2H09A 2VODA 1IRXA 5HLGA 3K69A 1EH6A 2H1LA 2DOAA 3Q0VA 3M07A 3R4KA 3WTZA 1GXPA 2E35A 4CDGA 2IT0A 3GF2A 1U5TB 3F8NA 2I10A 3VYRB 4IHWA 1HXDA 5K7HA 1IG7A 1ZG3A 1JUSA 2ZMEA 2C6YA 3E97A 5GPAA 2DK8A 3HG9A 4EMSA 2WAFA 3DCFA 3OYHA 5HNFA 1U8RA 3I54A 2O9LA 2OPTA 3QPLA 5K5OA 2WAEA 5EEHA 1A36A 2RQPA 3T8TA 2D2WA 5GTHC 4JYKA 1VQNI 2NYXA 3ASOH 4CCJA 1ORKA 5CVUA 2W57A 3TQNA 3DF8A 3CF5F 1A04A 2LLKA 3BP8A 3HIFA 5L3FA 3EYYA 2Y75A 3FXJA 4V19K 1BOAA 1DGRM 1W5TA 3SZPA 4IRIA 4DBQA 3WTSC 4FE7A 1IRGA 4LLNA 2ZNZA 3C18A 3IV5A 3J81K 2DFEA 3C1DA 4KIFA 1KYZA 5KVRA 1SFXA 4PFOA 1QU3A 3O2PE 3RQIA 2IA0A 2OCCH 1WJDA 2H94A 3ECOA 1DQUA 2AO9A 2OQGA 5LEJA 3S3MA 4BE0A 2RVCA 5HS8A 1MW7A 2L7MP 5FKNA 2EPFA 2GOMA 4IHVA 1UCRA 2W82A 4I0AA 3WU1B 4BHCA 5BPIA 3LSIA 4AM3A 3MMYB 3IHUA 4LG0A 1FTZA 2HR3A 2MG4A 3OYFA 2K3FA 2FNPA 2P4WA 4FE4A 5EJCA 2LTPA 5IT9K 2K3PA 1FP2A 1U78A 3BOQA 2XAJA 3L2UA 5JHUA 3OIPA 3CCSI 3JRHA 2KDOA 3S14J 3ZQQA 4XMYA 1ETYA 2OF7A 1WRJA 1O4XA 4B8XA 4HRIA 2QKLB 3QYEA 4PJMA 1XG1A 4GYGA 1LFPA 3CO7C 4IJAA 3JTGA 1X1DA 2HOEA 3OV8A 1XTAA 4KICA 2O6GE 1MBKA 3C3WA 2OD5A 3CJTB 3HSEA 3R61A 3WHBA 3HOSA 4OMZA 4GYIA 4L5JA 5DM6F 1KU2A 3FM5A 3CDLA 3EPZA 3MFKA 4KITB 2MC4A 2DJIA 4JQFA 1IN8A 2V6CA 2VQCA 3BR0A 3QOPA 2GXAA 5GTIC 1JKRC 4A6EA 1E3PA 1P7IA 5DUKA 4EGZA 4B47A 3WTUC 5J1RA 1IDZA 2L02A 4IF4A 4RAGA 2DOFA 3DPTA 3OR1C 2KIUA 4OWRB 3ZQHA 4ENKA 5ED4A 1A6QA 1SC7A 2XF7A 3KCCA 4ZYAA 4RLQA 3PJRA 4PJ0C 2HTJA 2V4JC 3CDHA 3ULQB 2OC6A 3W6VA 5J4VA 2DMTA 3SFZA 1SANA 2M4KA 1VQLI 5FLVA 1ZRFA 3G1OA 5JR3A 3SEZA 1G59A 5IYCJ 3E6DA 3CC2I 1P4WA 2ZBKA 3ZQFA 4JX6A 3P9IA 1R9TJ 3MAJA 4HPQA 3ROUA 3W2WA 1VQOI 5CVRA 2I5UA 4RGSA 2UUZA 1LFBA 4RB3C 2JK3A 1KU9A 2VXDA 1XMKA 3DFGA 1RUOA 3A2KA 2IGMA 2PX9A 1YI2I 2XB0X 5K7FA 3M4OJ 2PMUA 2A68F 3WGIA 2MC3A 2R7ZJ 2DFHA 1O3RA 1MNEA 2QSFX 1FZPB 3RPQA 1ZR2A 4NNJA 3BCBA 3DPUA 2L5QA 3K4LA 3RYPA 2BXYA 4IVNA 1MBEA 1Y56A 1IXRC 2COBA 5DCMA 2E5NA 2MD5A 3HEFA 3I4PA 4OOIA 3PQJA 1JI8A 1XSVA 2QF7A 4OAZA 2R7TA 3GYHX 1FJLA 4UUSA 3CJRB 1RZ4A 1JJ6C 4OMYA 2K9SA 5LEKA 1MJAA 4A3BJ 1GV2A 1ENHA 2R0QC 4NQWB 1YFHA 2P81A 3VWBA 1D3YA 2AQEA 4EQQA 3HYIA 2VKHA 3DBLB 2LC2A 3HM5A 1IUFA 2PBIA 2WV0A 2Y31A 2L3DA 2VLAA 3E1SA 5F6FA 3RKYA 2H8RA 2DT5A 3F8BA 3CCYA 1U3EM 2BHYA 2JVHA 1FMVA 3BZCA 1X1PA 2DODA 2JA5J 4Z2YA 1G6NA 3CLQA 2WBMA 3FMSA 4D7MA 4JP0A 2ZXWH 2COMA 2P0WA 2CQKA 4P5OA 5DEQA 1MIJA 3BQZA 1HDDC 4IEJA 4D9JA 1ZH5A 1TT5B 4I09A 3GO5A 4P1WA 2VT2A 5KK1A 4CCNA 2IGOA 2R7OA 1S8NA 4XKWA 3HJEA 5B3SH 2OU2A 2IS1A 1Y0NA 1W0UA 3BR6A 2W48A 3MZYA 1LVKA 1YS6A 4X0GA 1J7KA 3H0GJ 5L3BA 3ECHA 2CW7A 1SFEA 4MLOA 5D5UB 1SFUA 1RETA 2CQXA 4XLCA 1UG0A 2JRMA 5JLXA 2QA4I 2DK5A 5EZHA 1LDKB 1TBXA 4HQMA 4L9NA 1QGPA 2GZWA 3TO7A 3HSRA 1JHEA 3S1RJ 4BNCA 5CPRB 1X1AA 4A2UA 1T2KA 4MO7A 3A1YA 4AVZA 2F4IA 2XAGA 4A0XA 1XSDA 5FFZA 1AHDP 3V7CA 3HOUJ 1FT9A 4CUGA 5ILSA 2KRCA 4LD5A 1O7FA 2NNNA 1OCTC 3G3ZA 2W1OA 5EEAA 1QPMA 2XGEA 1KGSA 1W7PB 2E2HJ 1KU3A 5DYMA 4B48A 5GADJ 3D0SA 1IGNA 2DFIA 4XICA 1POGA 4G7HF 3IH2A 2EB7A 3IWZA 4HSTA 4U87A 1YJNI 3S2HJ 4HNVA 2VOPA 2M30A 3CD6I 4BJTA 4XRSG 1STZA 5HLIA 1XDSA 1AOYA 3KP4A 2F4OB 1MD0A 2E7XA 3MD2A 4EM0B 1YTYA 3ZXSA 2B0LA 4FTHA 3H5RA 2JA2A 1WJEA 2O5RA 2ZJRF 3M8EA 3K4BA 3DKYA 3GTMJ 2FRHA 3E6BA 2ZJPF 3S3OA 1FSEA 1I6XA 3GCMA 5D5VB 2CV0A 4GDFA 3WE2A 4RAYA 1ZRCA 4W97A 1WZ2A 4RGRA 2XRNA 1GXQA 1BBYA 3EUHC 1U6GA 2HDDA 1HDPA 3CZ6A 4RS8A 3I56I 1RKWA 2XAUA 3TOAA 1ON1A 2CJJA 5FFXA 2TRTA 3IRRA 2BV6A 1TWCJ 4FETA 1F39A 1PDNC 3CMYA 3IUOA 2FBKA 4WXDA 3CDIA 4KN7X 2EV0A 5LGUA 5CYVA 1Z05A 3UNGC 2FOWA 1ETWA 3AG1H 1Y1VJ 2ELKA 3Q9VA 4ENJA 2Y0MA 1R1UA 4HEA2 2NOJB 2DCEA 4CCLA 3J7AO 4NB5A 1S72I 2JPBA 1VQ6I 3EETA 2GWRA 3I5UA 1U9NA 1FYLA 5AIPA 1VTNC 1SVLA 3BTLA 1XGSA 3EQLF 4BXXJ 2QYOA 3HPHA 5IT3A 2EIKH 4XM3A 2HKOA 2V1UA 1ZTRA 2E2JJ 2FBHA 2EFNA 2XHKA 1G3YA 1ETQA 1LDDA 1W5CC 3M8JA 2R5YA 4UNOA 2PG4A 4ESJA 3T8RA 1ZELA 3F22A 2GA1A 4PDKA 5AONA 3N97A 3EDPA 5FLMJ 2LVSA 3OSFA 2X51A 1JHCA 4O6JA 5K5QA 3HOWJ 1QVTA 1LEBA 2E2IJ 4UXNA 1IXSB 2A5WA 3A02A 3F21A 1LEAA 4MQVA 3WTYC 1JHFA 5HNHA 3VYTB 4I2OA 3LSPA 2DMPA 1MBGA 5CQGA 4F93B 5EG0B 1L0OC 3UR3C 2QQ9A 1A6IA 2BW3A 3K1MA 2HDCA 1XSXA 2KRFA 4K8WA 1SD6A 1CF7B 3MEXA 1T6SA 4NC7A 5JHFA 1MDMA 2PMHA 3GBGA 4F91B 3A01A 2ELJA 4V2FA 3QYFA 2FX0A 4Q4ZF 3K4NA 3BY6A 2MLKA 3KP5A 2X1CA 3I59B 3QAHA 3GTOJ 2FJRA 3HC7A 2F5VA 4NDLA 3F6VA 5KNLA 1AWCA 2DTZA 2Q2EA 3VYSB 3ZQIA 2JQ7A 3GTLJ 1SD7A 4Y17A 1ZK8A 5IOZA 3G6EI 2FE3A 4OINF 4LFUA 3JCUC 4RAFA 4BAYA 4L9JA 2F5CA 2M8GX 4DZPA 3DU6A 2J5PA 5HLTA 1LKXA 2HNFA 4E7LA 2DA3A 3IAM2 2DJNA 3CJQB 1RC9A 3BZ6A 1EH8A 1BA5A 1ONVA 1GUUA 1WH7A 1X1CA 4BHPA 1Y6IA 3LQRA 5BPDA 3BPXA 4BJ5C 4HBLA 2BY0A 1TW2A 1ZG5A 1TQPA 2QZ8A 2Z5UA 3HOZJ 1TNSA 2ETHA 4QPOA 3GMEA 1H88C 1FYKA 2ADUA 2VJIA 2DPDA 2CWEA 3MZ8A 1P2FA 2ESNA 2FUG2 2JRTA 1F43A 2OV7A 1WJAA 4EM2A 1S7EA 3OYKA 3IKVA 3E0JB 1YLFA 4UUTA 3JRCA 5F08A 1LE8B 1TP4A 4AU7A 5ICEA 3G71I 5L3DA 2LBFA 3BR3A 3O6BB 3CCJI 4A3CJ 2DMQA 3AFHA 1QPIA 1T33A 5L3EA 1J75A 4XL9A 4KIGA 2F5FA 1B59A 3CUQC 1E3OC 2NS7A 4IHXA 4QIWN 2LY9A 1IC8A 3K4JA 2HZDA 4RBOA 4M9XA 2J5OA 1XGNA 1YW7A 4HF0A 4BXUA 4HW0A 3IIQA 4XNFA 2R7FA 3GZNB 2K27A 4CCKA 3QU6A 2DQLA 2MYSA 2XSJC 3VPRA 3KEQA 4HF2A 2KZGA 4BBSJ 1EH7A 1MMSA 3F9KA 4CGZA 2H6CA 4S0HB 3HOVJ 4M3DA 2QBYB 3ONQA 2EINH 2E1MC 4UV8A 3PNVA 5TGTA 4I99C 1ZQ3P 2LKSA 1TC3C 5E8IA 5E3MA 2BOLA 1AA7A 2X48A 2VUMJ 4M3EA 2ME0A 3CCLI 4G12A 3BT9A 3JRBA 3HBLA 3H5AA 4BEHA 1ETOA 4IL6C 2P5VA 1YS7A 2ZXJA 4ANJA 4ZC3A 2IW5A 3J80Z 4RLFA 3VSKA 2EV5A 1RESA 2HS5A 1HF0A 2H27A 3VSLA 3RCOA 3MWMA 5EGOA 3CCVI 4ZZLA 1K6OA 2FA5A 1MBJA 1MNDA 2KIFA 2O61A 5M5YJ 1BIBA 2ZNYA 4LMYA 2EILH 4NBQA 1IV8A 2KZVA 4XN3A 1FBUA 4JBAA 1T39A 4Y4RA 3DTKA 3KZZA 2DDAA 3CUQB 1K79A 3E3VA 4XSZF 2PEXA 4XKVA 1B8IB 1A31A 4C3HJ 4E7JA 3ZPLA 4FCYA 1XS9A 1E17A 3O3KA 2LFBA 4OIQF 2IP2A 3ZN1A 4RDUA 4PGGA 1J9IA 2W85A 4MEYF 5IP7J 5E17F 3U21A 1R71A 2P5LC 1BC7C 4L0ZB 2EV6A 2X9DA 4X1EA 1HW1A 1V5EA 2HVQA 2HZTA 3WTXC 3B73A 1IN5A 2R7SA 2A3SA 4G8XA 2MA3A 3RQ4A 1FEXA 1Z3XA 2LF7A 5GP9A 2PQ8A 4A5MA 1U2WA 4MNUA 1FIAA 2V1NA 2XKOA 4PJLA 3M3YJ 3TO9A 4HLXA 3L7WA 2VI6A 2E71A 4ZDLA 5EF6A 2DPUA 1T98A 2V1DA 1G8XA 1TLHB 1MBHA 2M5WA 5KAIC 1DP3A 3W2VA 2AS5F 3K9TA 3RPUD 2F5EA 2JA6J 4A0ZA 2MD0A 3ZQ7A 2HQNA 1V54H 3CMMA 3GFMA 1MMGA 1MSFC 3CC4I 3AAFA 5EYRA 1DUXC 4U0WA 1BN5A 1R4NB 1R5ID 1WJFA 3QOEA 2WAQA 2ZSIB 3IWFA 2EJRA 4M72A 3OYLA 2M87A 4HV5A 1OCRH 2BY1A 4BJ6C 2RC4A 4E7ZA 3V7SA 2MLGA 5IOYA 4N9IA 2NAZA 4HG2A 4M6YA 2YU9J 4B09A 5ILUA 2R4GA 4IKFA 4IRHA 3TGNA 3MQ0A 4W1UA 1IRFA 3PIPF 4ESFA 2G0EA 1ZAOA 2EFPA 3PUFA 2NNYA 3ISPA 3EYIA 5D4RA 3G73A 4NHJA 5CLSA 1BI1A 1O3TA 1F9NA 5F1RA 3LWFA 2X4HA 3QODA 1HKSA 4KJZA 1BL0A 1SMYF 1ZLJA 4N4OB 4JX5A 2QM3A 1I4VA 1P7JA 2EBIA 4AIJA 1OFCX 2LKXA 2VJ4A 4LB6B 2K02A 3RJPA 3NRVA 3S2DJ 3DEUA 1T8IA 3JRGA 3L2VA 2DO7A 3BR5A 2IEKA 4OIRF 3PIOF 4CH7A 3CO6C 1I27A 2XPWA 4Y7NJ 1T0FA 1T56A 3L9FA 1SAXA 2JJ7A 3SXYA 3VYUB 1YIJI 1FP1D 2QWWA 3NWSA 3GXOA 4FX4A 1CQTA 1GLNA 3RZOJ 4U88A 3F3XA 2IPQX 5E1ZB 2CUZA 3V7RA 1WQ2A 3KYDB 1ZHFA 1V55H 2W84A 4BQNA 3AKZA 1EJ9A 2XAHA 2E34A 5M5WJ 2YS9A 4DJAA 5C4XJ 4C2UA 1QO0D 1KONA 3HOYJ 2XROA 4JX4A 4Y15A 5ICGA 2ZFUA 2L9RA 3M1CA 1U8BA 4CZZA 3B6CA 4YIRX 4ABZA 3K4CA 2DYRH 3KYCB 3PNYA 1D5YA 3D5RC 4ZYEA 4RB1A 3N4MA 2OUMA 4A3JJ 1JXSA 2E60A 5F04A 1VFCA 5TJJA 1QZEA 3IKTA 2Y0SA 3OYCA 4EEFG 4HAMA 2A6TA 2K85A 2VASA 2QKMB 3N05A 1B1BA 3AL0C 2O8KA 3TKYA 3CP2A 3DEEA 5LRSA 2R7WA 1P6RA 2XPVA 1H8AC 3OY9A 2QQAA 4XONA 1BJAA 1BC8C 3GTGJ 1Y0UA 3KZYA 1VI0A 5GAEJ 3RKQA 3T5XA 1J5YA 3L2CA 1NH3A 2QSGX 1Q1HA 1EV7A 3VDXA 3FKIJ 3BG7A 1JKPC 4MGRA 2E5ZA 1AKHB 1ACIA 2OTJI 1YIOA 1Z7UA 2ZO4A 2D45A 4G6DA 2L9VA 2NVQJ 1VQKI 4ON0A 5FRMA 1U5TA 2KISA 1FOYA 1KN9A 1KA8A 2NS8A 1YG2A 3BZKA 2VC0A 1FBQA 3LSGA 1MBFA 4HV6A 1VQ4I 2WAQN 1MMDA 4PCQA 4ITVA 3F72A 4UUVA 2JSPA 2OZ6A 1GVDA 5CKTA 3G1MA 4XK4A 2IA1A 4HDVA 2XGDA 4H4KC 3RKXA 3I9V2 5CVVA 4LIUA 4HNUA 1AY9A 3RTRA 1TQIA 4GGGA 3KEOA 2F4MB 5CJ9A 2EIJH 2O3FA 2VQLA 3E6MA 4G9YA 1UB9A 3CUOA 2IS4A 5F0HA 2P8TA 1KYWA 1LQ1A 3GFIA 4ENMA 1Y8RB 4BQQA 3HTSB 2V9PA 1YRNB 1XGMA 3K6GA 1QHHD 3LSMA 2K5CA 1YX3A 4FQGA 2GAUA 3ZMTA 4BQOA 5JI6A 4WCGA 3JW4A 3AL0B 3LFKA 3FF5A 3BG6A 2BZTA 1TL8A 1DDNA 1V4RA 3J7AY 2F6CA 3FIWA 3FXKA 3T0YA 3LSJA 3DPLC 2VE8A 4NC6A 3UKGA
chains in the Genus database with same CATH topology
1B9NA 3W6JB 2PLYA 2K4JA 4DQ2A 3K1PA 2LKPA 3QRFF 3KP7A 2HYGD 1NHAA 3CTAA 4N0BA 3I53A 2V9VA 5D5WB 2P6SA 2F5DA 3L09A 3M8FA 1RI7A 1CGPA 2IA2A 3OOPA 2O03A 4MQ9F 4K2EA 1PP8F 4XRFA 4L9TA 4EJVA 4RGXA 1OR7A 4RB2C 3QP6A 1BM9A 1YO5C 1FX7A 5ICCA 5FGMA 4AIHA 2DTRA 4EJTA 1I1GA 4HX7A 2CGPA 3BJAA 3LSTA 3ERED 2QVOA 4XSXF 3F6OA 5BS6A 2OQRA 1TW3A 2A6HF 4N31A 2BYVE 3GZ6A 3WGGA 1I5ZA 5LBQA 3DV8A 2DQRA 2RV8A 3RKWA 2XGXA 1B6AA 2HKXA 3SQNA 4AIKA 1HKTA 3PQKA 4M6XA 3FXQA 5ILVA 3ZMDA 2BBYA 1IW7F 1F4KA 1ZREA 1SMTA 4BHBA 5FLXK 2XIGA 1W4MA 1IF1A 3KP3A 5HDKA 2RNJA 2W24A 2EFQA 2D1HA 3LAJA 2L4MA 3COAC 4KA4A 4LLGF 4R8HA 1XB4A 4Q47A 2Q0OA 4NQWA 2D1VA 4KDPA 2KJBA 4FT8A 3C7JA 1PUEE 4ZZDA 2LF8A 2R7DA 2ELHA 2CO5A 5LLQA 3GX4X 3JAMK 3F8MA 1RUNA 2MH2A 5A2QK 3V8LA 1V3FA 3HRTA 2QQBA 4KIBA 1YYVA 4PZJA 2QENA 4R1HA 3SZTA 2L4AA 2KKOA 4QLCU 3FHZA 3R0JA 3ZP5A 4HF1A 2OBPA 4LK0F 4HOBA 3LQQA 3LAPA 3E5QA 1F1ZA 3PFIA 1O3QA 1LDJA 1WI9A 3RYRA 2HWVA 4UV9A 4M9SA 1J59A 4P9UA 3J80K 2WC2A 4XBFA 1BI0A 3NQOA 1XGOA 4U0YA 1ZLKA 1E2XA 4OU0A 3JTHA 1XCVA 1X3UA 1HW5A 4U7BA 1Z9CA 3FM3A 1ULYA 1W7PA 1O57A 4HDUA 3QU3A 1WWXA 2FSWA 2EA4A 1FYMA 4F7ZA 2VONA 3KP2A 5DUIA 2XUBA 1L3LA 1J2XA 3GEZA 4LB5A 3I64A 4I01A 3LA3A 3FZVA 1FLIA 3H92A 2DW4A 3ZN0A 1HQCA 1R58A 3TDZC 4RGUA 4A0YA 1LB2A 5FLXZ 3VEPA 2V79A 3WE3A 3E6CC 1P4AA 2W25A 1Z6RA 2ESHA 1BI2A 1UMUA 2CFXA 4WXHA 1OYYA 2K86A 4XLPF 4FX0A 1Z91A 2WWYA 2Z33A 5K1YA 2O0YA 1ZARA 4GO1A 2PN6A 3GFJA 2JT1A 3E5XA 1DP7P 5H20A 3JAMZ 3I58A 4WWCA 1QZZA 3JSOA 2XASA 4LK1F 5A2QZ 4D0PA 2ISZA 2A61A 1YW9A 3I0TA 3HSFA 4TV7A 2VXZA 3GWZA 1S3JA 5L3CA 4ESBA 3Q9SA 2FEZA 3HUGA 2HFHA 1GHCA 1S6LA 4M74A 4BH9A 2BGCA 5LHGA 3DKWA 3KETA 3QP5A 2Q8KA 1FNNA 3M7GA 3BPVA 4Y13A 2A5YB 5H6QA 4EJUA 3EUHA 3LA2A 2KIMA 3FXRA 1C0WA 2FKDA 1IAWA 1ZGJA 1CF7A 1I1SA 1R36A 4LG0B 4KFCA 3I59A 2A07F 4JK1X 4G6QA 2CW0F 5FB2A 2E7WA 2UWMA 2HEOA 3DQVC 3D5LA 1MGTA 3L00A 3VB2A 1XMAA 2LNBA 3QPHA 5DV5A 4N9HA 1LVAA 1ZGAA 4MTEA 1KU7A 4RB0A 3BDDA 4IHTA 4PGHA 2L01A 5K5RA 2DLLA 2YSRA 5D8KB 2ZJ2A 1H9TA 4AVPA 5DD8A 2XKPA 5FD5A 1JE8A 1R1VA 2XV4S 4MHGA 1IZ1A 1HKQA 4KNYA 2RDPA 3S2WA 4QWQA 3IC7A 1O7LA 1UHMA 1R7JA 3U1DA 2G9WA 5D8LB 2JZYA 2VT3A 2TDXA 2DI3A 5EEGA 4IXAA 3VFZA 1FY7A 3FXUA 3FWEA 2G7UA 1R00A 2VBZA 1FPQA 5DCMB 3F8FA 1O3SA 2QBYA 3KLOA 5LHHA 1REPC 1WSUA 2QUFA 2RN7A 5HLHA 1F5TA 1K7AA 5ICFA 3RPUA 2DAOA 2XAQA 2CYYA 2ISYA 3V8JA 3BJ6A 1DPUA 2A69F 2WTEA 5HDNA 3P7NA 3DP7A 2MBFA 2FMYA 2YPRA 3RI4A 3WG9A 3W6KB 1ZN2A 2HQRA 3CUQA 1DPRA 1J0RA 4WK8F 1H0MA 2BE5F 4A6DA 3HRSA 2YR2A 1IXCA 2FOKA 2HYFA 4HLYA 3ELKA 1G3WA 4YIFA 3WGHA 2E1CA 4KUMA 1Z6TA 2G7HA 4E70A 4ENNA 5JFRA 3ZMZA 4YFKF 2BEOA 1OMIA 2R3SA 2STTA 5HOOA 1T38A 2NRAC 1YQAA 3U9GA 1BI3A 1D8KA 1XDUA 3SHFA 3HTUA 1UFMA 2M45A 4YG2F 4S05A 1LNWA 4M9ZA 2ZFWA 2VBYA 3RDIA 4L18B 1BIAA 3ZMVA 2HTSA 1P4XA 4L5IA 2F2EA 5LHIA 4OIOF 1MZBA 2RKHA 2JPCA 2FXAA 5D6EA 2A6EF 3K2ZA 3B02A 5JVTA 4P96A 4IHSA 1QQIA 2UZKA 4UVAA 3J81Z 2CG4A 2O8XA 2EFWA 1RIOH 3NEUA 2EWNA 2PFBA 3FMRA 3U2RA 3LA7A 4O5VA 4IPAA 2L54A 3GFLA 2FQ3A 3ZMSA 1IN4A 3GLXA 3HHHA 4OIPF 2IJLA 4I7HA 4P9FA 3P9KA 3K1NA 4KT5C 1FOKA 2GXBA 5E20A 4HX8A 4RAZA 1B12A 4I02A 2RGVA 4MEXF 1P92A 4EJOA 4I98B 4BYYA 1R22A 3HHGA 5IT9Z 1PP7U 4KYWA 4ME8A 1USTA 1KQ9A 3VOEA 4ETSA 1G4DA 3V4GA 1S7AA 5F64A 1FSHA 3BJOA 2X0LA 4EVIA 4EGYA 5HS7A 4ASNA 4L0YB 2YX7A 4HA8A 2OA4A 2VBXA 2HGCA 1ZG1A 3BWGA 4M73A 3WODF 1MDMB 2PJPA 3H3ZA 1QNTA 4HQEA 5DCFA 4ZYHA 4GXOA 4KN4X 3IRQA 5L3GA 1R5GA 2Z9OA 1OYWA 3GZ5A 3VODA 4P55A 4M71A 1JHHA 2VC1A 4CO8A 1GVJA 4Q5SF 3HRMA 4A5NA 5E18F 2JSCA 5D5XB 1S7OA 2FU4A 3GUDA 4WF2A 2PI0A 5E1WA 2YX4A 2UXNA 2ZCWA 2QLZA 5DD4A 1TNTA 2ACJA 1XD7A 3H3UA 5FD6A 2JTVA 5TRDA 4Q48A 4O3MA 2IRFG 3KLNA 2MH9A 2M1BA 3KP6A 4LLLA 1YW8A 3JSPA 1HW2A 1ZRDA 2FF4A 3E5UA 3F8CA 5FO5A 5E8GA 1G3TA 4A12A 2KJCA 5LGTA 3Q5FA 4G7OF 1MJ9A 5HS9A 2EFOA 4UHTA 2GQQA 2XAFA 4EV0A 3WTWC 4YIIA 5HVQC 1HSTA 5CVJA 3DXJF 1W7PD 2FBIA 3HRUA 1S29A 3M9AA 3TOBA 2H6BA 5E1XA 2ZKZA 1H9GA 3CJNA 3K0LA 3R0AA 2YU3A 1IN6A 3P9CA 1MJBA 3KE2A 1KCAA 3IL2A 4U0VA 6PAXA 2EA2A 1T7DA 2P6TA 2VE9A 3MCZA 1OYIA 1HSJA 4CYDA 4HX4A 1G3SA 1HBXG 4UVCA 2DBBA 4DNCA 3WU0A 2VN2A 1USSA 2CSOA 1QBJA 2DU9A 1FBSA 2OAZA 3F23A 2VOOA 5J6XA 3WTVC 4HZFA 3ABTA 2GIVA 2K4BA 1B9MA 1W5SA 4YFXF 4ZYGA 1SD5A 4KMFA 3HOTA 5J8CA 1KQ0A 1ON2A 3M1EA 1ZYRF 5LRRA 4NV4A 1K78B 2K7LA 1WKMA 2FNAA 4CXFA 1JGSA 4GCVA 1FWZA 3QPTA 4U7DA 4LGWA 5ERIA 4UVBA 2P7CB 4G7ZF 3S04A 5H6RA 2Y48A 2LDUA 4ZH4F 2ZMEB 4BQAA 3RIRA 3CLOA 4KMUX 3TO6A 2Z3YA 2GA2A 1B4AA 4WX9A 1UHWA 1QZYA 1R1TA 2VBWA 3FMQA 1Z1DA 2Z99A 1KQ8A 1FC3A 4AD9A 4AWXB 3TDUC 1TTYA 2UXXA 4MTDA 1RNLA 1D5VA 3R6SA 2NS0A 3GW2A 2LSOA 4EJWA 4G94A 2FMLA 4EM1A 5HDGA 1XN7A 5LGNA 3ZMUA 4CHUA 1IN7A 3R60A 3ABUA 5D6FA 5BMZA 4HYEA 2STWA 3I71A 3REOA 4R79A 3BROA 1U5TC 3GVAA 3T1BA 5J8FA 2EK5A 1R5HA 1XCBA 2XVCA 2OZUA 2E1NA 4S04A 1ODDA 4L9VA 1SD4A 4XLNF 3WTTC 3V8KA 4LJZF 4WXCA 2AXLA 1R23A 2IVMA 2GXGA 3FX3A 3BDNA 1IUYA 4IRGA 2P5KA 5BOXA 5D4SA 1OKRA 1MKMA 1LJ9A 5CVIA 1K78A 1D8JA 5BQTA 1OPCA 3MZHA 2HO0A 3KFWX 4CICA 4FHTA 5DDGA 1TQMA 2P7VB 5AIQA 4I0BA 2V1XA 4ZYDA 3ML6A 4YFNF 4H0EA 2M8EA 2H09A 2VODA 5HLGA 3K69A 1EH6A 3WTZA 3R4KA 1GXPA 2IT0A 4CDGA 3GF2A 1U5TB 3F8NA 1HXDA 1ZG3A 2ZMEA 2C6YA 3E97A 2DK8A 4EMSA 1U8RA 3I54A 5K5OA 5EEHA 2RQPA 3T8TA 2D2WA 2NYXA 5CVUA 2W57A 3TQNA 3DF8A 1A04A 3BP8A 3HIFA 5L3FA 3EYYA 2Y75A 1BOAA 1W5TA 3SZPA 4IRIA 3WTSC 1IRGA 4LLNA 2ZNZA 3C18A 3J81K 3C1DA 4KIFA 1KYZA 5KVRA 1SFXA 3O2PE 2IA0A 2H94A 3ECOA 2OQGA 5LEJA 2RVCA 5HS8A 1UCRA 5BPIA 4I0AA 3WU1B 4BHCA 4LG0A 3IHUA 2HR3A 2FNPA 2P4WA 5IT9K 1FP2A 1U78A 3BOQA 2XAJA 5JHUA 1WRJA 4B8XA 4GYGA 3CO7C 4IJAA 3JTGA 2HOEA 3OV8A 4KICA 2O6GE 3C3WA 2OD5A 3HSEA 3R61A 3HOSA 4OMZA 4GYIA 4L5JA 1KU2A 3FM5A 3MFKA 4JQFA 1IN8A 2V6CA 3QOPA 4A6EA 5DUKA 4EGZA 3WTUC 2L02A 4IF4A 3DPTA 2KIUA 4ENKA 5ED4A 3KCCA 2HTJA 3CDHA 3ULQB 3SFZA 1ZRFA 5JR3A 3E6DA 1P4WA 2ZBKA 3P9IA 3MAJA 3ROUA 5CVRA 4RGSA 4RB3C 1KU9A 1XMKA 3DFGA 1RUOA 2PMUA 2A68F 3WGIA 2MC3A 1O3RA 1FZPB 3RPQA 3RYPA 4IVNA 1IXRC 5DCMA 2MD5A 3I4PA 4OOIA 3PQJA 1XSVA 3GYHX 1RZ4A 4OMYA 5LEKA 1MJAA 1YFHA 1D3YA 4EQQA 3HYIA 2PBIA 2WV0A 2L3DA 5F6FA 3RKYA 2DT5A 3F8BA 1U3EM 4Z2YA 1G6NA 3FMSA 2COMA 4P5OA 2CQKA 5DEQA 1ZH5A 4I09A 3GO5A 2VT2A 5KK1A 1S8NA 2OU2A 3MZYA 1YS6A 1J7KA 5L3BA 3ECHA 1SFEA 5D5UB 1SFUA 2DK5A 1LDKB 1TBXA 4HQMA 4L9NA 1QGPA 2GZWA 3TO7A 3HSRA 1JHEA 4BNCA 4A2UA 1T2KA 4A0XA 2XAGA 1XSDA 5FFZA 3V7CA 1FT9A 5ILSA 4LD5A 1O7FA 2NNNA 3G3ZA 1QPMA 1KGSA 1W7PB 1KU3A 5DYMA 3D0SA 2DFIA 4G7HF 2EB7A 3IWZA 2VOPA 2M30A 1STZA 5HLIA 1XDSA 1AOYA 3KP4A 1MD0A 2E7XA 4EM0B 1YTYA 2B0LA 3M8EA 2FRHA 3E6BA 1FSEA 1I6XA 5D5VB 3WE2A 4RAYA 1ZRCA 4RGRA 2XRNA 1GXQA 1BBYA 1U6GA 4RS8A 3TOAA 1ON1A 5FFXA 3IRRA 2BV6A 1F39A 1PDNC 2FBKA 4WXDA 4KN7X 2EV0A 5LGUA 5CYVA 1Z05A 3Q9VA 4ENJA 2Y0MA 1R1UA 3J7AO 4NB5A 2JPBA 3EETA 2GWRA 3I5UA 1FYLA 5AIPA 1VTNC 1XGSA 3EQLF 2QYOA 5IT3A 2V1UA 2HKOA 2FBHA 2EFNA 2XHKA 1G3YA 1LDDA 4UNOA 2PG4A 4ESJA 3T8RA 3F22A 2GA1A 4PDKA 5AONA 3N97A 3EDPA 1JHCA 4O6JA 5K5QA 1LEBA 4UXNA 1IXSB 3F21A 1LEAA 4MQVA 3WTYC 1JHFA 4I2OA 1L0OC 2QQ9A 4K8WA 3K1MA 2HDCA 1XSXA 2KRFA 1SD6A 1CF7B 3MEXA 1T6SA 1MDMA 2PMHA 4Q4ZF 3BY6A 2MLKA 3KP5A 3I59B 3QAHA 2FJRA 3F6VA 1AWCA 2Q2EA 1SD7A 4Y17A 2FE3A 4OINF 4LFUA 4BAYA 4L9JA 2F5CA 2J5PA 2HNFA 3BZ6A 1EH8A 1ONVA 4BHPA 3LQRA 5BPDA 3BPXA 4HBLA 1TW2A 1ZG5A 1TQPA 2QZ8A 2Z5UA 1TNSA 2ETHA 1FYKA 2ADUA 2DPDA 2CWEA 1P2FA 2ESNA 2JRTA 4EM2A 3IKVA 1YLFA 5ICEA 5L3DA 3O6BB 5L3EA 1J75A 4KIGA 2F5FA 1B59A 3CUQC 4M9XA 2J5OA 1XGNA 1YW7A 4HF0A 4BXUA 4HW0A 3IIQA 2R7FA 2K27A 3QU6A 2DQLA 3KEQA 4HF2A 1EH7A 4CGZA 2H6CA 2QBYB 4UV8A 5E8IA 2P5VA 1YS7A 2ZXJA 2IW5A 3J80Z 2EV5A 2HS5A 2H27A 3MWMA 4ZZLA 1K6OA 2FA5A 2KIFA 2O61A 1BIBA 2ZNYA 4LMYA 1FBUA 4JBAA 1T39A 3KZZA 3CUQB 1K79A 3E3VA 4XSZF 2PEXA 3ZPLA 1E17A 3O3KA 4OIQF 2IP2A 3ZN1A 4PGGA 1J9IA 2W85A 4MEYF 5E17F 2P5LC 1BC7C 4L0ZB 2EV6A 1HW1A 2HZTA 3WTXC 3B73A 1IN5A 2A3SA 4G8XA 2MA3A 2LF7A 2PQ8A 4A5MA 1U2WA 4MNUA 2XKOA 3TO9A 4HLXA 3L7WA 2DPUA 1T98A 2V1DA 1TLHB 2M5WA 2AS5F 3K9TA 2F5EA 4A0ZA 3ZQ7A 2HQNA 3GFMA 3AAFA 1DUXC 4U0WA 1BN5A 3IWFA 2EJRA 4M72A 2M87A 4HV5A 2RC4A 3V7SA 2MLGA 4N9IA 2NAZA 4M6YA 4B09A 5ILUA 4IRHA 3TGNA 3MQ0A 1IRFA 4ESFA 1ZAOA 2EFPA 2NNYA 3ISPA 3EYIA 5D4RA 3G73A 4NHJA 5CLSA 1BI1A 1O3TA 1F9NA 5F1RA 3LWFA 2X4HA 1HKSA 1SMYF 1ZLJA 2QM3A 1I4VA 4AIJA 4LB6B 2K02A 3RJPA 3NRVA 3DEUA 2DO7A 4OIRF 3CO6C 1I27A 1T0FA 1SAXA 3L9FA 3SXYA 1FP1D 2QWWA 3GXOA 4FX4A 4U88A 3F3XA 2IPQX 5E1ZB 3V7RA 1WQ2A 1ZHFA 2W84A 2XAHA 1QO0D 2XROA 5ICGA 4Y15A 4CZZA 4ZYEA 4RB1A 3N4MA 1JXSA 5TJJA 3IKTA 4HAMA 1B1BA 3TKYA 5LRSA 1P6RA 2QQAA 1BJAA 1BC8C 1Y0UA 3KZYA 3T5XA 1J5YA 3L2CA 1Q1HA 1EV7A 4MGRA 1YIOA 1Z7UA 2ZO4A 2D45A 4G6DA 4ON0A 1U5TA 1KN9A 1KA8A 1YG2A 2VC0A 1FBQA 4HV6A 4PCQA 3F72A 4UUVA 2OZ6A 2IA1A 4HDVA 3RKXA 5CVVA 1AY9A 3RTRA 1TQIA 4GGGA 3KEOA 5CJ9A 3E6MA 2O3FA 4G9YA 1UB9A 3CUOA 2P8TA 1KYWA 1LQ1A 3GFIA 4ENMA 3HTSB 1XGMA 3ZMTA 5JI6A 2GAUA 4WCGA 3JW4A 3LFKA 3FF5A 1DDNA 1V4RA 3T0YA 3DPLC 2VE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9N A;  3W6J B;  2PLY A;  2K4J A;  4DQ2 A;  3K1P A;  2LKP A;  3QRF F;  3KP7 A;  2HYG D;  1NHA A;  3CTA A;  4N0B A;  3I53 A;  2V9V A;  5D5W B;  2P6S A;  2F5D A;  3L09 A;  3M8F A;  1RI7 A;  1CGP A;  2IA2 A;  3OOP A;  2O03 A;  4MQ9 F;  4K2E A;  1PP8 F;  4XRF A;  4L9T A;  4EJV A;  4RGX A;  1OR7 A;  4RB2 C;  3QP6 A;  1BM9 A;  1YO5 C;  1FX7 A;  5ICC A;  5FGM A;  4AIH A;  2DTR A;  4EJT A;  1I1G A;  4HX7 A;  2CGP A;  3BJA A;  3LST A;  3ERE D;  2QVO A;  4XSX F;  3F6O A;  5BS6 A;  2OQR A;  1TW3 A;  2A6H F;  4N31 A;  2BYV E;  3GZ6 A;  3WGG A;  1I5Z A;  5LBQ A;  3DV8 A;  2DQR A;  2RV8 A;  3RKW A;  2XGX A;  1B6A A;  2HKX A;  3SQN A;  4AIK A;  1HKT A;  3PQK A;  4M6X A;  3FXQ A;  5ILV A;  3ZMD A;  2BBY A;  1IW7 F;  1F4K A;  1ZRE A;  1SMT A;  4BHB A;  5FLX K;  2XIG A;  1W4M A;  1IF1 A;  3KP3 A;  5HDK A;  2RNJ A;  2W24 A;  2EFQ A;  2D1H A;  3LAJ A;  2L4M A;  3COA C;  4KA4 A;  4LLG F;  4R8H A;  1XB4 A;  4Q47 A;  2Q0O A;  4NQW A;  2D1V A;  4KDP A;  2KJB A;  4FT8 A;  3C7J A;  1PUE E;  4ZZD A;  2LF8 A;  2R7D A;  2ELH A;  2CO5 A;  5LLQ A;  3GX4 X;  3JAM K;  3F8M A;  1RUN A;  2MH2 A;  5A2Q K;  3V8L A;  1V3F A;  3HRT A;  2QQB A;  4KIB A;  1YYV A;  4PZJ A;  2QEN A;  4R1H A;  3SZT A;  2L4A A;  2KKO A;  4QLC U;  3FHZ A;  3R0J A;  3ZP5 A;  4HF1 A;  2OBP A;  4LK0 F;  4HOB A;  3LQQ A;  3LAP A;  3E5Q A;  1F1Z A;  3PFI A;  1O3Q A;  1LDJ A;  1WI9 A;  3RYR A;  2HWV A;  4UV9 A;  4M9S A;  1J59 A;  4P9U A;  3J80 K;  2WC2 A;  4XBF A;  1BI0 A;  3NQO A;  1XGO A;  4U0Y A;  1ZLK A;  1E2X A;  4OU0 A;  3JTH A;  1XCV A;  1X3U A;  1HW5 A;  4U7B A;  1Z9C A;  3FM3 A;  1ULY A;  1W7P A;  1O57 A;  4HDU A;  3QU3 A;  1WWX A;  2FSW A;  2EA4 A;  1FYM A;  4F7Z A;  2VON A;  3KP2 A;  5DUI A;  2XUB A;  1L3L A;  1J2X A;  3GEZ A;  4LB5 A;  3I64 A;  4I01 A;  3LA3 A;  3FZV A;  1FLI A;  3H92 A;  2DW4 A;  3ZN0 A;  1HQC A;  1R58 A;  3TDZ C;  4RGU A;  4A0Y A;  1LB2 A;  5FLX Z;  3VEP A;  2V79 A;  3WE3 A;  3E6C C;  1P4A A;  2W25 A;  1Z6R A;  2ESH A;  1BI2 A;  1UMU A;  2CFX A;  4WXH A;  1OYY A;  2K86 A;  4XLP F;  4FX0 A;  1Z91 A;  2WWY A;  2Z33 A;  5K1Y A;  2O0Y A;  1ZAR A;  4GO1 A;  2PN6 A;  3GFJ A;  2JT1 A;  3E5X A;  1DP7 P;  5H20 A;  3JAM Z;  3I58 A;  4WWC A;  1QZZ A;  3JSO A;  2XAS A;  4LK1 F;  5A2Q Z;  4D0P A;  2ISZ A;  2A61 A;  1YW9 A;  3I0T A;  3HSF A;  4TV7 A;  2VXZ A;  3GWZ A;  1S3J A;  5L3C A;  4ESB A;  3Q9S A;  2FEZ A;  3HUG A;  2HFH A;  1GHC A;  1S6L A;  4M74 A;  4BH9 A;  2BGC A;  5LHG A;  3DKW A;  3KET A;  3QP5 A;  2Q8K A;  1FNN A;  3M7G A;  3BPV A;  4Y13 A;  2A5Y B;  5H6Q A;  4EJU A;  3EUH A;  3LA2 A;  2KIM A;  3FXR A;  1C0W A;  2FKD A;  1IAW A;  1ZGJ A;  1CF7 A;  1I1S A;  1R36 A;  4LG0 B;  4KFC A;  3I59 A;  2A07 F;  4JK1 X;  4G6Q A;  2CW0 F;  5FB2 A;  2E7W A;  2UWM A;  2HEO A;  3DQV C;  3D5L A;  1MGT A;  3L00 A;  3VB2 A;  1XMA A;  2LNB A;  3QPH A;  5DV5 A;  4N9H A;  1LVA A;  1ZGA A;  4MTE A;  1KU7 A;  4RB0 A;  3BDD A;  4IHT A;  4PGH A;  2L01 A;  5K5R A;  2DLL A;  2YSR A;  5D8K B;  2ZJ2 A;  1H9T A;  4AVP A;  5DD8 A;  2XKP A;  5FD5 A;  1JE8 A;  1R1V A;  2XV4 S;  4MHG A;  1IZ1 A;  1HKQ A;  4KNY A;  2RDP A;  3S2W A;  4QWQ A;  3IC7 A;  1O7L A;  1UHM A;  1R7J A;  3U1D A;  2G9W A;  5D8L B;  2JZY A;  2VT3 A;  2TDX A;  2DI3 A;  5EEG A;  4IXA A;  3VFZ A;  1FY7 A;  3FXU A;  3FWE A;  2G7U A;  1R00 A;  2VBZ A;  1FPQ A;  5DCM B;  3F8F A;  1O3S A;  2QBY A;  3KLO A;  5LHH A;  1REP C;  1WSU A;  2QUF A;  2RN7 A;  5HLH A;  1F5T A;  1K7A A;  5ICF A;  3RPU A;  2DAO A;  2XAQ A;  2CYY A;  2ISY A;  3V8J A;  3BJ6 A;  1DPU A;  2A69 F;  2WTE A;  5HDN A;  3P7N A;  3DP7 A;  2MBF A;  2FMY A;  2YPR A;  3RI4 A;  3WG9 A;  3W6K B;  1ZN2 A;  2HQR A;  3CUQ A;  1DPR A;  1J0R A;  4WK8 F;  1H0M A;  2BE5 F;  4A6D A;  3HRS A;  2YR2 A;  1IXC A;  2FOK A;  2HYF A;  4HLY A;  3ELK A;  1G3W A;  4YIF A;  3WGH A;  2E1C A;  4KUM A;  1Z6T A;  2G7H A;  4E70 A;  4ENN A;  5JFR A;  3ZMZ A;  4YFK F;  2BEO A;  1OMI A;  2R3S A;  2STT A;  5HOO A;  1T38 A;  2NRA C;  1YQA A;  3U9G A;  1BI3 A;  1D8K A;  1XDU A;  3SHF A;  3HTU A;  1UFM A;  2M45 A;  4YG2 F;  4S05 A;  1LNW A;  4M9Z A;  2ZFW A;  2VBY A;  3RDI A;  4L18 B;  1BIA A;  3ZMV A;  2HTS A;  1P4X A;  4L5I A;  2F2E A;  5LHI A;  4OIO F;  1MZB A;  2RKH A;  2JPC A;  2FXA A;  5D6E A;  2A6E F;  3K2Z A;  3B02 A;  5JVT A;  4P96 A;  4IHS A;  1QQI A;  2UZK A;  4UVA A;  3J81 Z;  2CG4 A;  2O8X A;  2EFW A;  1RIO H;  3NEU A;  2EWN A;  2PFB A;  3FMR A;  3U2R A;  3LA7 A;  4O5V A;  4IPA A;  2L54 A;  3GFL A;  2FQ3 A;  3ZMS A;  1IN4 A;  3GLX A;  3HHH A;  4OIP F;  2IJL A;  4I7H A;  4P9F A;  3P9K A;  3K1N A;  4KT5 C;  1FOK A;  2GXB A;  5E20 A;  4HX8 A;  4RAZ A;  1B12 A;  4I02 A;  2RGV A;  4MEX F;  1P92 A;  4EJO A;  4I98 B;  4BYY A;  1R22 A;  3HHG A;  5IT9 Z;  1PP7 U;  4KYW A;  4ME8 A;  1UST A;  1KQ9 A;  3VOE A;  4ETS A;  1G4D A;  3V4G A;  1S7A A;  5F64 A;  1FSH A;  3BJO A;  2X0L A;  4EVI A;  4EGY A;  5HS7 A;  4ASN A;  4L0Y B;  2YX7 A;  4HA8 A;  2OA4 A;  2VBX A;  2HGC A;  1ZG1 A;  3BWG A;  4M73 A;  3WOD F;  1MDM B;  2PJP A;  3H3Z A;  1QNT A;  4HQE A;  5DCF A;  4ZYH A;  4GXO A;  4KN4 X;  3IRQ A;  5L3G A;  1R5G A;  2Z9O A;  1OYW A;  3GZ5 A;  3VOD A;  4P55 A;  4M71 A;  1JHH A;  2VC1 A;  4CO8 A;  1GVJ A;  4Q5S F;  3HRM A;  4A5N A;  5E18 F;  2JSC A;  5D5X B;  1S7O A;  2FU4 A;  3GUD A;  4WF2 A;  2PI0 A;  5E1W A;  2YX4 A;  2UXN A;  2ZCW A;  2QLZ A;  5DD4 A;  1TNT A;  2ACJ A;  1XD7 A;  3H3U A;  5FD6 A;  2JTV A;  5TRD A;  4Q48 A;  4O3M A;  2IRF G;  3KLN A;  2MH9 A;  2M1B A;  3KP6 A;  4LLL A;  1YW8 A;  3JSP A;  1HW2 A;  1ZRD A;  2FF4 A;  3E5U A;  3F8C A;  5FO5 A;  5E8G A;  1G3T A;  4A12 A;  2KJC A;  5LGT A;  3Q5F A;  4G7O F;  1MJ9 A;  5HS9 A;  2EFO A;  4UHT A;  2GQQ A;  2XAF A;  4EV0 A;  3WTW C;  4YII A;  5HVQ C;  1HST A;  5CVJ A;  3DXJ F;  1W7P D;  2FBI A;  3HRU A;  1S29 A;  3M9A A;  3TOB A;  2H6B A;  5E1X A;  2ZKZ A;  1H9G A;  3CJN A;  3K0L A;  3R0A A;  2YU3 A;  1IN6 A;  3P9C A;  1MJB A;  3KE2 A;  1KCA A;  3IL2 A;  4U0V A;  6PAX A;  2EA2 A;  1T7D A;  2P6T A;  2VE9 A;  3MCZ A;  1OYI A;  1HSJ A;  4CYD A;  4HX4 A;  1G3S A;  1HBX G;  4UVC A;  2DBB A;  4DNC A;  3WU0 A;  2VN2 A;  1USS A;  2CSO A;  1QBJ A;  2DU9 A;  1FBS A;  2OAZ A;  3F23 A;  2VOO A;  5J6X A;  3WTV C;  4HZF A;  3ABT A;  2GIV A;  2K4B A;  1B9M A;  1W5S A;  4YFX F;  4ZYG A;  1SD5 A;  4KMF A;  3HOT A;  5J8C A;  1KQ0 A;  1ON2 A;  3M1E A;  1ZYR F;  5LRR A;  4NV4 A;  1K78 B;  2K7L A;  1WKM A;  2FNA A;  4CXF A;  1JGS A;  4GCV A;  1FWZ A;  3QPT A;  4U7D A;  4LGW A;  5ERI A;  4UVB A;  2P7C B;  4G7Z F;  3S04 A;  5H6R A;  2Y48 A;  2LDU A;  4ZH4 F;  2ZME B;  4BQA A;  3RIR A;  3CLO A;  4KMU X;  3TO6 A;  2Z3Y A;  2GA2 A;  1B4A A;  4WX9 A;  1UHW A;  1QZY A;  1R1T A;  2VBW A;  3FMQ A;  1Z1D A;  2Z99 A;  1KQ8 A;  1FC3 A;  4AD9 A;  4AWX B;  3TDU C;  1TTY A;  2UXX A;  4MTD A;  1RNL A;  1D5V A;  3R6S A;  2NS0 A;  3GW2 A;  2LSO A;  4EJW A;  4G94 A;  2FML A;  4EM1 A;  5HDG A;  1XN7 A;  5LGN A;  3ZMU A;  4CHU A;  1IN7 A;  3R60 A;  3ABU A;  5D6F A;  5BMZ A;  4HYE A;  2STW A;  3I71 A;  3REO A;  4R79 A;  3BRO A;  1U5T C;  3GVA A;  3T1B A;  5J8F A;  2EK5 A;  1R5H A;  1XCB A;  2XVC A;  2OZU A;  2E1N A;  4S04 A;  1ODD A;  4L9V A;  1SD4 A;  4XLN F;  3WTT C;  3V8K A;  4LJZ F;  4WXC A;  2AXL A;  1R23 A;  2IVM A;  2GXG A;  3FX3 A;  3BDN A;  1IUY A;  4IRG A;  2P5K A;  5BOX A;  5D4S A;  1OKR A;  1MKM A;  1LJ9 A;  5CVI A;  1K78 A;  1D8J A;  5BQT A;  1OPC A;  3MZH A;  2HO0 A;  3KFW X;  4CIC A;  4FHT A;  5DDG A;  1TQM A;  2P7V B;  5AIQ A;  4I0B A;  2V1X A;  4ZYD A;  3ML6 A;  4YFN F;  4H0E A;  2M8E A;  2H09 A;  2VOD A;  5HLG A;  3K69 A;  1EH6 A;  3WTZ A;  3R4K A;  1GXP A;  2IT0 A;  4CDG A;  3GF2 A;  1U5T B;  3F8N A;  1HXD A;  1ZG3 A;  2ZME A;  2C6Y A;  3E97 A;  2DK8 A;  4EMS A;  1U8R A;  3I54 A;  5K5O A;  5EEH A;  2RQP A;  3T8T A;  2D2W A;  2NYX A;  5CVU A;  2W57 A;  3TQN A;  3DF8 A;  1A04 A;  3BP8 A;  3HIF A;  5L3F A;  3EYY A;  2Y75 A;  1BOA A;  1W5T A;  3SZP A;  4IRI A;  3WTS C;  1IRG A;  4LLN A;  2ZNZ A;  3C18 A;  3J81 K;  3C1D A;  4KIF A;  1KYZ A;  5KVR A;  1SFX A;  3O2P E;  2IA0 A;  2H94 A;  3ECO A;  2OQG A;  5LEJ A;  2RVC A;  5HS8 A;  1UCR A;  5BPI A;  4I0A A;  3WU1 B;  4BHC A;  4LG0 A;  3IHU A;  2HR3 A;  2FNP A;  2P4W A;  5IT9 K;  1FP2 A;  1U78 A;  3BOQ A;  2XAJ A;  5JHU A;  1WRJ A;  4B8X A;  4GYG A;  3CO7 C;  4IJA A;  3JTG A;  2HOE A;  3OV8 A;  4KIC A;  2O6G E;  3C3W A;  2OD5 A;  3HSE A;  3R61 A;  3HOS A;  4OMZ A;  4GYI A;  4L5J A;  1KU2 A;  3FM5 A;  3MFK A;  4JQF A;  1IN8 A;  2V6C A;  3QOP A;  4A6E A;  5DUK A;  4EGZ A;  3WTU C;  2L02 A;  4IF4 A;  3DPT A;  2KIU A;  4ENK A;  5ED4 A;  3KCC A;  2HTJ A;  3CDH A;  3ULQ B;  3SFZ A;  1ZRF A;  5JR3 A;  3E6D A;  1P4W A;  2ZBK A;  3P9I A;  3MAJ A;  3ROU A;  5CVR A;  4RGS A;  4RB3 C;  1KU9 A;  1XMK A;  3DFG A;  1RUO A;  2PMU A;  2A68 F;  3WGI A;  2MC3 A;  1O3R A;  1FZP B;  3RPQ A;  3RYP A;  4IVN A;  1IXR C;  5DCM A;  2MD5 A;  3I4P A;  4OOI A;  3PQJ A;  1XSV A;  3GYH X;  1RZ4 A;  4OMY A;  5LEK A;  1MJA A;  1YFH A;  1D3Y A;  4EQQ A;  3HYI A;  2PBI A;  2WV0 A;  2L3D A;  5F6F A;  3RKY A;  2DT5 A;  3F8B A;  1U3E M;  4Z2Y A;  1G6N A;  3FMS A;  2COM A;  4P5O A;  2CQK A;  5DEQ A;  1ZH5 A;  4I09 A;  3GO5 A;  2VT2 A;  5KK1 A;  1S8N A;  2OU2 A;  3MZY A;  1YS6 A;  1J7K A;  5L3B A;  3ECH A;  1SFE A;  5D5U B;  1SFU A;  2DK5 A;  1LDK B;  1TBX A;  4HQM A;  4L9N A;  1QGP A;  2GZW A;  3TO7 A;  3HSR A;  1JHE A;  4BNC A;  4A2U A;  1T2K A;  4A0X A;  2XAG A;  1XSD A;  5FFZ A;  3V7C A;  1FT9 A;  5ILS A;  4LD5 A;  1O7F A;  2NNN A;  3G3Z A;  1QPM A;  1KGS A;  1W7P B;  1KU3 A;  5DYM A;  3D0S A;  2DFI A;  4G7H F;  2EB7 A;  3IWZ A;  2VOP A;  2M30 A;  1STZ A;  5HLI A;  1XDS A;  1AOY A;  3KP4 A;  1MD0 A;  2E7X A;  4EM0 B;  1YTY A;  2B0L A;  3M8E A;  2FRH A;  3E6B A;  1FSE A;  1I6X A;  5D5V B;  3WE2 A;  4RAY A;  1ZRC A;  4RGR A;  2XRN A;  1GXQ A;  1BBY A;  1U6G A;  4RS8 A;  3TOA A;  1ON1 A;  5FFX A;  3IRR A;  2BV6 A;  1F39 A;  1PDN C;  2FBK A;  4WXD A;  4KN7 X;  2EV0 A;  5LGU A;  5CYV A;  1Z05 A;  3Q9V A;  4ENJ A;  2Y0M A;  1R1U A;  3J7A O;  4NB5 A;  2JPB A;  3EET A;  2GWR A;  3I5U A;  1FYL A;  5AIP A;  1VTN C;  1XGS A;  3EQL F;  2QYO A;  5IT3 A;  2V1U A;  2HKO A;  2FBH A;  2EFN A;  2XHK A;  1G3Y A;  1LDD A;  4UNO A;  2PG4 A;  4ESJ A;  3T8R A;  3F22 A;  2GA1 A;  4PDK A;  5AON A;  3N97 A;  3EDP A;  1JHC A;  4O6J A;  5K5Q A;  1LEB A;  4UXN A;  1IXS B;  3F21 A;  1LEA A;  4MQV A;  3WTY C;  1JHF A;  4I2O A;  1L0O C;  2QQ9 A;  4K8W A;  3K1M A;  2HDC A;  1XSX A;  2KRF A;  1SD6 A;  1CF7 B;  3MEX A;  1T6S A;  1MDM A;  2PMH A;  4Q4Z F;  3BY6 A;  2MLK A;  3KP5 A;  3I59 B;  3QAH A;  2FJR A;  3F6V A;  1AWC A;  2Q2E A;  1SD7 A;  4Y17 A;  2FE3 A;  4OIN F;  4LFU A;  4BAY A;  4L9J A;  2F5C A;  2J5P A;  2HNF A;  3BZ6 A;  1EH8 A;  1ONV A;  4BHP A;  3LQR A;  5BPD A;  3BPX A;  4HBL A;  1TW2 A;  1ZG5 A;  1TQP A;  2QZ8 A;  2Z5U A;  1TNS A;  2ETH A;  1FYK A;  2ADU A;  2DPD A;  2CWE A;  1P2F A;  2ESN A;  2JRT A;  4EM2 A;  3IKV A;  1YLF A;  5ICE A;  5L3D A;  3O6B B;  5L3E A;  1J75 A;  4KIG A;  2F5F A;  1B59 A;  3CUQ C;  4M9X A;  2J5O A;  1XGN A;  1YW7 A;  4HF0 A;  4BXU A;  4HW0 A;  3IIQ A;  2R7F A;  2K27 A;  3QU6 A;  2DQL A;  3KEQ A;  4HF2 A;  1EH7 A;  4CGZ A;  2H6C A;  2QBY B;  4UV8 A;  5E8I A;  2P5V A;  1YS7 A;  2ZXJ A;  2IW5 A;  3J80 Z;  2EV5 A;  2HS5 A;  2H27 A;  3MWM A;  4ZZL A;  1K6O A;  2FA5 A;  2KIF A;  2O61 A;  1BIB A;  2ZNY A;  4LMY A;  1FBU A;  4JBA A;  1T39 A;  3KZZ A;  3CUQ B;  1K79 A;  3E3V A;  4XSZ F;  2PEX A;  3ZPL A;  1E17 A;  3O3K A;  4OIQ F;  2IP2 A;  3ZN1 A;  4PGG A;  1J9I A;  2W85 A;  4MEY F;  5E17 F;  2P5L C;  1BC7 C;  4L0Z B;  2EV6 A;  1HW1 A;  2HZT A;  3WTX C;  3B73 A;  1IN5 A;  2A3S A;  4G8X A;  2MA3 A;  2LF7 A;  2PQ8 A;  4A5M A;  1U2W A;  4MNU A;  2XKO A;  3TO9 A;  4HLX A;  3L7W A;  2DPU A;  1T98 A;  2V1D A;  1TLH B;  2M5W A;  2AS5 F;  3K9T A;  2F5E A;  4A0Z A;  3ZQ7 A;  2HQN A;  3GFM A;  3AAF A;  1DUX C;  4U0W A;  1BN5 A;  3IWF A;  2EJR A;  4M72 A;  2M87 A;  4HV5 A;  2RC4 A;  3V7S A;  2MLG A;  4N9I A;  2NAZ A;  4M6Y A;  4B09 A;  5ILU A;  4IRH A;  3TGN A;  3MQ0 A;  1IRF A;  4ESF A;  1ZAO A;  2EFP A;  2NNY A;  3ISP A;  3EYI A;  5D4R A;  3G73 A;  4NHJ A;  5CLS A;  1BI1 A;  1O3T A;  1F9N A;  5F1R A;  3LWF A;  2X4H A;  1HKS A;  1SMY F;  1ZLJ A;  2QM3 A;  1I4V A;  4AIJ A;  4LB6 B;  2K02 A;  3RJP A;  3NRV A;  3DEU A;  2DO7 A;  4OIR F;  3CO6 C;  1I27 A;  1T0F A;  1SAX A;  3L9F A;  3SXY A;  1FP1 D;  2QWW A;  3GXO A;  4FX4 A;  4U88 A;  3F3X A;  2IPQ X;  5E1Z B;  3V7R A;  1WQ2 A;  1ZHF A;  2W84 A;  2XAH A;  1QO0 D;  2XRO A;  5ICG A;  4Y15 A;  4CZZ A;  4ZYE A;  4RB1 A;  3N4M A;  1JXS A;  5TJJ A;  3IKT A;  4HAM A;  1B1B A;  3TKY A;  5LRS A;  1P6R A;  2QQA A;  1BJA A;  1BC8 C;  1Y0U A;  3KZY A;  3T5X A;  1J5Y A;  3L2C A;  1Q1H A;  1EV7 A;  4MGR A;  1YIO A;  1Z7U A;  2ZO4 A;  2D45 A;  4G6D A;  4ON0 A;  1U5T A;  1KN9 A;  1KA8 A;  1YG2 A;  2VC0 A;  1FBQ A;  4HV6 A;  4PCQ A;  3F72 A;  4UUV A;  2OZ6 A;  2IA1 A;  4HDV A;  3RKX A;  5CVV A;  1AY9 A;  3RTR A;  1TQI A;  4GGG A;  3KEO A;  5CJ9 A;  3E6M A;  2O3F A;  4G9Y A;  1UB9 A;  3CUO A;  2P8T A;  1KYW A;  1LQ1 A;  3GFI A;  4ENM A;  3HTS B;  1XGM A;  3ZMT A;  5JI6 A;  2GAU A;  4WCG A;  3JW4 A;  3LFK A;  3FF5 A;  1DDN A;  1V4R A;  3T0Y A;  3DPL C;  2VE8 A; 
#chains in the Genus database with same CATH topology
 4NUB A;  2CQ7 A;  3S93 A;  1B9N A;  3LL7 A;  3W6J B;  5GAG J;  2HU9 A;  2WB1 A;  4BY1 J;  3G2B A;  2PLY A;  2K4J A;  4DIQ A;  4DQ2 A;  3K1P A;  4YEL A;  2LKP A;  3QRF F;  1S9H A;  2IGK A;  2M2E A;  3KP7 A;  1VQ8 I;  2HYG D;  1NHA A;  2O7O A;  1VF9 A;  4J00 A;  3CTA A;  2JA7 J;  4N0B A;  3QQA A;  2VJJ A;  3I53 A;  2V9V A;  5D5W B;  2P6S A;  4PK4 A;  2F5D A;  3L09 A;  3BG3 A;  4AID A;  3M8F A;  1QHG A;  2CRG A;  4FIS A;  3NAR A;  1RI7 A;  3L2W A;  2KDZ A;  1CGP A;  2IA2 A;  3KEY A;  3OOP A;  2O03 A;  5F1J A;  3CC7 I;  4MQ9 F;  4K2E A;  1PP8 F;  4UB8 C;  2DMU A;  5M5X J;  3HGY A;  2M3A A;  1HOM A;  4XRF A;  4L9T A;  4EJV A;  4RGX A;  1OR7 A;  4RB2 C;  2K9M A;  3QP6 A;  1BM9 A;  5IP9 J;  1YO5 C;  1MMA A;  2V26 A;  1FX7 A;  5ICC A;  3OYG A;  2IAI A;  1UHS A;  5FGM A;  4AIH A;  4PUS A;  2DTR A;  3DTI A;  1G2H A;  1Y8Q B;  4EJT A;  4KIS A;  2MW8 A;  2NVU B;  2HOT A;  1I1G A;  4HX7 A;  4XN0 A;  2CGP A;  4XKB A;  2X6Y A;  3BJA A;  3LST A;  1Q1V A;  3CMA I;  3ERE D;  2QVO A;  4XSX F;  3FKJ A;  3SDB A;  3S1Q J;  3F6O A;  3QWL A;  1QA6 A;  5BS6 A;  1ZGW A;  2EZI A;  2OQR A;  1TW3 A;  2A6H F;  4N31 A;  2BYV E;  3GZ6 A;  3WGG A;  2E1O A;  3LFU A;  3K7A J;  1RKT A;  2WAD A;  2CV1 A;  1I5Z A;  2JWT A;  4MIM A;  1Z7L A;  5LBQ A;  3DV8 A;  2DQR A;  4A69 C;  1T08 B;  3TL4 X;  2RV8 A;  1GT0 C;  3MKW B;  2DA5 A;  3RKW A;  2XGX A;  5LFA A;  1B6A A;  2HKX A;  3S1N J;  3A03 A;  3QPS A;  4BGD A;  3SQN A;  4AIK A;  1HKT A;  3PQK A;  1V5F A;  3OYJ A;  3MKY B;  4CYC B;  3ABL H;  3B6A A;  3J7Y J;  4M6X A;  3FXQ A;  5FKM A;  5ILV A;  3ZMD A;  2BBY A;  1IW7 F;  1F4K A;  1ZRE A;  1Z67 A;  2XC7 A;  1SMT A;  4BHB A;  1A35 A;  3BR1 A;  5FLX K;  2XIG A;  1W36 D;  1W4M A;  2LR8 A;  1IF1 A;  2JVG A;  3A0B C;  3A0H C;  2ZB9 A;  3KP3 A;  5J40 A;  2RNJ A;  5HDK A;  2W24 A;  3OYI A;  1JT0 A;  4PSW A;  2EFQ A;  1WVR A;  2A05 A;  2D1H A;  3LAJ A;  2L4M A;  3COA C;  4KA4 A;  4LLG F;  4DBR A;  2Y2Z A;  4R8H A;  1IRZ A;  1BR4 A;  1XB4 A;  1YX5 A;  2KFD A;  1Z0X A;  4Q47 A;  3PM1 A;  2Q0O A;  4NQW A;  2D1V A;  1X58 A;  2KJB A;  4KDP A;  1LFU P;  4FT8 A;  2KQR A;  2K40 A;  3C7J A;  1PUE E;  3PFY A;  4ZZD A;  2LF8 A;  2R7D A;  3OYE A;  1MH3 A;  4L5E A;  2LRD A;  2ELH A;  3CES A;  2CO5 A;  2Y30 A;  5LLQ A;  3NAU A;  5C44 J;  3GX4 X;  3JAM K;  2Y69 H;  4IO9 F;  5F27 A;  1LUJ B;  2XF6 A;  5TIS C;  1I3Q J;  3F8M A;  3SEQ A;  1RUN A;  2MH2 A;  1X2M A;  3CQZ J;  1JTY A;  5A2Q K;  3V8L A;  4BXF A;  1V3F A;  2V6E A;  3HRT A;  2QQB A;  3HUG B;  4KIB A;  3SYT A;  1YYV A;  4PZJ A;  2QEN A;  2CH0 A;  3IAS 2;  4R1H A;  3SZT A;  2L4A A;  1ETX A;  2FQ4 A;  2OCE A;  2W7N A;  1MNM C;  2KKO A;  4QLC U;  4E7H A;  3S8P A;  4AC0 A;  3FHZ A;  2GIZ A;  3HPG A;  3R0J A;  1AU7 A;  3K2A A;  3ZP5 A;  1ZR4 A;  4HF1 A;  2OBP A;  4MFD A;  4LK0 F;  4HOB A;  1HCR A;  3LQQ A;  3LAP A;  3WHC A;  3E5Q A;  3AG4 H;  1F1Z A;  2X1E A;  3PFI A;  1O3Q A;  1LDJ A;  1WI9 A;  3RYR A;  2HWV A;  4UV9 A;  4M9S A;  5B5E C;  1J59 A;  4P9U A;  3J80 K;  2WC2 A;  4XBF A;  1ETK A;  1BI0 A;  3H36 A;  3NQO A;  4C9Y A;  5B1A H;  4PSX A;  1XGO A;  4U0Y A;  1ZLK A;  1E2X A;  4OU0 A;  1BW5 A;  3JTH A;  1XCV A;  3KZI C;  1X3U A;  3Q3S A;  1HW5 A;  4U7B A;  1Z9C A;  2ZME C;  3K4M A;  1T7D A;  1UMQ A;  1WFX A;  3FM3 A;  2QSH X;  1ULY A;  2HYJ A;  3SZG A;  1W7P A;  4ZTJ A;  1UJ8 A;  1NTC A;  2CW8 A;  1OQY A;  1O57 A;  4HDU A;  2Z2S B;  3QU3 A;  1WWX A;  2PJR B;  4GFB A;  2FSW A;  1BOB A;  2EA4 A;  1FYM A;  2BY2 A;  4F7Z A;  3C2H A;  2XGC A;  2HI3 A;  3KP2 A;  1OJL A;  2VON A;  4KT6 A;  5DUI A;  3MVP A;  5E3L A;  2XUB A;  1L3L A;  1J2X A;  3GEZ A;  5B66 C;  4LB5 A;  3I64 A;  4I01 A;  3I4M J;  4A3G J;  3LA3 A;  3FZV A;  1FLI A;  3H92 A;  2DW4 A;  3H5N A;  3ZN0 A;  2R92 J;  1HQC A;  1R58 A;  3TDZ C;  4YEJ A;  2DA4 A;  1PVE A;  1Y39 A;  4RGU A;  3TW7 A;  3DLL F;  4A0Y A;  4XQF A;  4HNT A;  3PO2 J;  1LB2 A;  1D1A A;  2Z1D A;  3VEP A;  4XR6 A;  5FLX Z;  2KLO A;  2LD5 A;  2CUF A;  2V79 A;  3WE3 A;  3E6C C;  2IGN A;  4FAS D;  1P4A A;  2W25 A;  1Z6R A;  2ESH A;  1BI2 A;  1UMU A;  2CFX A;  1NK2 P;  4WXH A;  2DA2 A;  1OYY A;  2K86 A;  2CFO A;  4XLP F;  1SEU A;  4FX0 A;  1Z91 A;  2WWY A;  1TWG J;  1Z21 A;  4XLA A;  2Z33 A;  3HOX J;  1X1B A;  3H9Q A;  1JKQ C;  1VQ7 I;  5DTD A;  5K1Y A;  3Q0W A;  2O0Y A;  1T0F C;  3DKX A;  1D0X A;  2MGQ A;  3H1C A;  3HL2 A;  5B1B H;  1ZAR A;  4GO1 A;  1BW6 A;  1A5J A;  2PN6 A;  3GFJ A;  2JT1 A;  3E5X A;  3F0C A;  1DP7 P;  5H20 A;  3JAM Z;  3I58 A;  4E7I A;  4QPQ A;  4WWC A;  1X3Z B;  2DYS H;  1QZZ A;  3JSO A;  3EUK L;  2XAS A;  2EIM H;  4LK1 F;  5A2Q Z;  3HKZ A;  1DU0 A;  4GRI A;  4D0P A;  4BE1 A;  2ZXH A;  2A61 A;  2ISZ A;  1YW9 A;  1WGX A;  3I0T A;  2F48 A;  3QYB A;  2R93 J;  3HSF A;  1X2N A;  4Y52 J;  1S5L C;  4TV7 A;  2VXZ A;  3MN2 A;  3GWZ A;  1XMX A;  2BHZ A;  1S3J A;  3OIO A;  5L3C A;  4XKC A;  1EA3 A;  3V42 A;  4ESB A;  3Q9S A;  2FEZ A;  2Z16 A;  3HUG A;  2HFH A;  5IY5 H;  1S6L A;  1GHC A;  3I3L A;  2LH9 A;  3ABM H;  2L7K A;  1SVO A;  4M74 A;  2NVX J;  4BH9 A;  2BGC A;  5LHG A;  5BNG A;  3DKW A;  5F0C A;  3KET A;  3QP5 A;  2Q8K A;  1FNN A;  3FDY A;  3C2G A;  4A3I J;  3M7G A;  5CQE A;  3BPV A;  4Y13 A;  3SFI A;  2A5Y B;  5H6Q A;  4EJU A;  3EUH A;  3LA2 A;  2KIM A;  2LK2 A;  2ME6 A;  3FXR A;  5EG0 A;  1C0W A;  2FKD A;  1NG6 A;  1IAW A;  1ZGJ A;  2KL4 A;  3JRI A;  3GTJ J;  1CF7 A;  4ZDO A;  5FJ8 J;  1I1S A;  2QCO A;  1R36 A;  2IXS A;  2B63 J;  4LG0 B;  3PSI A;  4KFC A;  3K70 C;  1N77 A;  3C2B A;  5FKK A;  3I59 A;  3HB9 A;  2A07 F;  2FJ1 A;  2Y9Y A;  4JK1 X;  4G6Q A;  5EDN A;  2NOG A;  2HPI A;  2CW0 F;  5C4J J;  3S17 J;  5FB2 A;  2E7W A;  4M3G A;  3FK6 A;  4JOM A;  2UWM A;  1OCZ H;  2HEO A;  4C2T A;  3DQV C;  2OJE D;  4DOZ A;  2PJR A;  3BCA A;  4BAC A;  2PMZ A;  3D5L A;  1MGT A;  3L00 A;  3VB2 A;  2RAE A;  3WG7 H;  2IBD A;  1XMA A;  4XLE A;  2LNB A;  3QPH A;  3PO3 J;  4B44 A;  5DV5 A;  1SVM A;  2E1M B;  3ABK H;  4IOA F;  2ICW G;  4N9H A;  1LVA A;  1ZGA A;  4MTE A;  4IOC F;  1KU7 A;  4OAY A;  2X1D A;  4RB0 A;  3H9J A;  3LOC A;  4E7S A;  2ZC2 A;  3BDD A;  4IHT A;  4PGH A;  2AXT C;  4CCM A;  2JUC A;  2L01 A;  4MFE A;  1EF4 A;  1JUM A;  5K5R A;  1FOX A;  1LPQ A;  2DLL A;  2X85 A;  2EH3 A;  4Z6Y A;  1FOW A;  2RRE A;  2YSR A;  5D8K B;  4N4N B;  2ZJ2 A;  1N78 A;  1H9T A;  3OL3 A;  4AVP A;  4DYR A;  2KP6 A;  5DD8 A;  2HPM A;  2XKP A;  3FXO A;  5FD5 A;  1JE8 A;  2NVY J;  4G6T B;  1LE8 A;  1R1V A;  1X3W B;  2XV4 S;  4MHG A;  2HNH A;  1IZ1 A;  1HKQ A;  4KNY A;  2JA8 J;  4RA2 A;  2RDP A;  3S2W A;  1NK3 P;  4QWQ A;  3IC7 A;  3D1N I;  1O7L A;  1UHM A;  1R7J A;  2R7X A;  5GAH J;  3CF2 A;  1TWF J;  3U1D A;  2G9W A;  5D8L B;  3TMO A;  1YOV B;  2WY8 Q;  2JZY A;  2VT3 A;  3HKZ N;  2TDX A;  1SAU A;  1W0T A;  2DI3 A;  5EEG A;  1Y1W J;  3D5S C;  1OCC H;  4IXA A;  3VFZ A;  1FY7 A;  4AYB A;  3OYB A;  3FXU A;  1V5G A;  3BG5 A;  1I3A A;  1QRY A;  4PFP A;  3FWE A;  1WJC A;  2G7U A;  1OR7 C;  1UEL B;  1R00 A;  2KHM A;  3P5J A;  2M0C A;  3L2R A;  2VBZ A;  1FPQ A;  3ZCO A;  5DCM B;  3TW6 A;  3F8F A;  1YHQ I;  1O3S A;  2QBY A;  3KLO A;  5LHH A;  2VQH A;  4XOP A;  3DU5 A;  1APL C;  1REP C;  5F0F A;  4NC8 A;  4UUS B;  3JRA A;  1WSU A;  2DFF A;  4DW6 A;  2QUF A;  1QVU A;  2RN7 A;  1J09 A;  5HLH A;  1F5T A;  1K7A A;  2VQG A;  3E7L A;  2TCT A;  4DYC A;  4AUX A;  5ICF A;  3RPU A;  1HLV A;  2DAO A;  3AG2 H;  2IS6 A;  4B3X A;  2XAQ A;  4CA0 A;  2CYY A;  2ISY A;  3V8J A;  5KAF C;  4IQ4 A;  4UY8 I;  3K4K A;  4BY7 J;  1RR8 C;  3BJ6 A;  3ESW B;  1BR2 A;  3CCM I;  2A69 F;  1DPU A;  2WTE A;  3U1K A;  5HDN A;  3P7N A;  1HC8 A;  2CQQ A;  3DP7 A;  2W00 A;  4C3J J;  2MBF A;  2FMY A;  2YPR A;  3RI4 A;  2K9Q A;  3WG9 A;  3GLL A;  3W6K B;  3DBR B;  4ZTF A;  1ZN2 A;  2HQR A;  3CUQ A;  1DPR A;  4E7K A;  1J0R A;  2PMZ N;  3FK7 A;  4WK8 F;  1H0M A;  2BE5 F;  1B8I A;  4A6D A;  3HRS A;  4XID A;  2YR2 A;  1X4P A;  2XB5 A;  2MAB A;  3K70 D;  2VL8 A;  1JKO C;  4E4H A;  2KIQ A;  3JRF A;  1IXC A;  2FOK A;  2E36 A;  2HYF A;  3S32 A;  2DOE A;  1OIS A;  2ZSH B;  4HLY A;  2XPU A;  2CUJ A;  3ELK A;  1G3W A;  4YIF A;  2VIX A;  2ZXI A;  3WGH A;  4II3 A;  2DT7 B;  2VKD A;  2E1C A;  4KUM A;  2I8D A;  1Z6T A;  1W1W E;  1R4M B;  3S16 J;  2ID3 A;  2G7H A;  3O8G A;  4E70 A;  3OYA A;  2B7E A;  1K61 A;  4ENN A;  4LG3 A;  4RM3 A;  4F3Q A;  5JFR A;  1JUP A;  3ZMZ A;  2BEO A;  4YFK F;  1OMI A;  3OIQ A;  2R3S A;  1MSE C;  3PSF A;  4PJN A;  2STT A;  4C30 A;  1ETV A;  5HOO A;  1T38 A;  1OCP A;  2NRA C;  2ECB A;  1YQA A;  3U9G A;  1VQ9 I;  1BI3 A;  4V2G A;  1D0Z A;  3BC8 A;  2X6O A;  1D8K A;  5DS9 A;  2CV2 A;  2EZL A;  1XDU A;  3OS0 A;  3SHF A;  2QEX I;  3HTU A;  1UFM A;  2EZH A;  1W36 C;  2M45 A;  1YJ9 I;  4YG2 F;  4S05 A;  1LNW A;  3DEW A;  2V7F A;  4M9Z A;  2DDB A;  3HXL A;  1OCO H;  4B3A A;  1D0Y A;  3LNQ A;  1I6H J;  5FKL A;  3ZQL A;  4AYB N;  3LSH A;  2ZFW A;  4UB6 C;  1WPK A;  2VBY A;  2XF5 A;  3RDI A;  4BBR J;  4L18 B;  4J01 A;  1PYV A;  1BIA A;  3ZMV A;  3RSN A;  4BE2 A;  2GLO A;  2M7A A;  4BS9 A;  2QGU A;  2HTS A;  1P4X A;  4L5I A;  2F2E A;  5LHI A;  4OIO F;  2CMP A;  2X6W A;  1IV6 A;  1MZB A;  5J1U A;  2R5Z B;  3BTI A;  2RKH A;  2JPC A;  2FXA A;  5D6E A;  2A6E F;  3K2Z A;  3B02 A;  1D1C A;  1FIP A;  2AHQ A;  5JVT A;  4P96 A;  3OYM A;  4IHS A;  3HDD A;  1VQM I;  1QQI A;  4PJJ A;  4UVA A;  2UZK A;  3S15 J;  3J81 Z;  2CG4 A;  1DU6 A;  2JUG A;  2O8X A;  2EFW A;  1RIO H;  4E6K G;  3NEU A;  2EWN A;  3ZOB A;  2PFB A;  2LP0 A;  2LMD A;  3FMR A;  3U2R A;  1Z77 A;  3LA7 A;  2K9N A;  4O5V A;  3BLY A;  4IPA A;  2L54 A;  4F92 B;  3GFL A;  2M34 A;  2FQ3 A;  2HOS A;  3ZMS A;  2DA6 A;  2JN6 A;  1IN4 A;  3GLX A;  3HHH A;  3MKL A;  1I39 A;  3DLA A;  4XLH A;  4OIP F;  2DT6 A;  2IJL A;  4I7H A;  3H3V K;  2BVL A;  4P9F A;  3P9K A;  3K1N A;  2ID6 A;  4KT5 C;  4A3E J;  5HOD A;  1FOK A;  2GXB A;  5E20 A;  1ERD A;  4HX8 A;  1X19 A;  4RAZ A;  1B12 A;  4D7N A;  5E79 C;  4I02 A;  2RGV A;  4DZJ A;  1NG7 A;  3Q0U A;  4MEX F;  1P92 A;  4EJO A;  4I98 B;  1XC5 A;  4BYY A;  1R22 A;  5H2F C;  3HHG A;  2R5Y B;  2DA1 A;  5IT9 Z;  3BG9 A;  2Y0S N;  4CSW A;  2LOO A;  3L2Q A;  1PP7 U;  3TED A;  1VZ0 A;  2RNG A;  2LY1 A;  2R7Q A;  4KYW A;  3FBI B;  1UST A;  4ME8 A;  4M6V A;  5IP6 A;  1TZL A;  1KQ9 A;  3VOE A;  4ETS A;  1G4D A;  4D5F A;  3RZD J;  3I4N J;  3H35 A;  3V4G A;  1S7A A;  5F64 A;  1XX5 A;  1YE9 A;  3BJO A;  1B72 B;  1FSH A;  2X0L A;  4EVI A;  2DA7 A;  4EGY A;  2R7U A;  5HS7 A;  4ASN A;  4L0Y B;  2W4S A;  2YX7 A;  4BU2 A;  4HA8 A;  1K4S A;  2OA4 A;  2VBX A;  3IH4 A;  2BW3 B;  2HGC A;  1ZG1 A;  3MKZ A;  2ECC A;  2QQ8 A;  2VB6 A;  3GTP J;  3BWG A;  4C3I J;  4M73 A;  2YUS A;  3WOD F;  5JVG F;  3L1P A;  1MDM B;  3PUB A;  3A01 B;  4D1Q A;  3KPH A;  2PJP A;  4I76 A;  3H3Z A;  2M4G A;  3ZQG A;  4ZDP A;  3HZJ A;  1QNT A;  4HQE A;  5DCF A;  4ZYH A;  3SJM A;  4GXO A;  1R6R A;  4B1R A;  4XRS A;  1AKH A;  4KN4 X;  3IRQ A;  1XPX A;  5JLW A;  2Q2E B;  5L3G A;  1IJW C;  1R5G A;  2NXN B;  2Z9O A;  1OYW A;  4CCO A;  3BTJ A;  3GZ5 A;  1F36 A;  1FTT A;  3VOD A;  4P55 A;  4M71 A;  1JHH A;  1U9O A;  2VC1 A;  4XLF A;  4I6Z A;  4CO8 A;  1GVJ A;  4Q5S F;  1GV5 A;  2KPM A;  4RMN A;  3HRM A;  5E3O A;  4A5N A;  5E18 F;  2JSC A;  3JR9 A;  5D5X B;  2H1K A;  1S7O A;  2FU4 A;  2EQR A;  3GUD A;  4WF2 A;  5J4Y A;  2PI0 A;  2VPL A;  5E1W A;  2YX4 A;  2UXN A;  2ZCW A;  3OS1 A;  2QLZ A;  3TP0 A;  1WI3 A;  5KHD A;  1TWH J;  2X6X A;  5DD4 A;  2HXO A;  3CCE I;  1TNT A;  2ACJ A;  4XRM A;  2HVS A;  1XD7 A;  3FIS A;  3H3U A;  5IYB J;  1OLT A;  2L7Z A;  2UV1 A;  5FKO A;  2JTV A;  5FD6 A;  5TRD A;  4A3M J;  5IPA A;  1PUF B;  3S1M J;  1D1B A;  2MSY A;  4Q48 A;  4O3M A;  1YRN A;  1EKE A;  2IRF G;  2L0K A;  3KLN A;  1U0J A;  2MH9 A;  2M1B A;  3KP6 A;  2R5Z A;  4LLL A;  2WB1 N;  2HQA A;  1YW8 A;  2WY7 Q;  1M1E B;  3JSP A;  3WU2 C;  1HW2 A;  1ZRD A;  2FF4 A;  3E5U A;  3F8C A;  2LBF B;  4Y3O A;  5FO5 A;  5E8G A;  1G3T A;  1RR7 A;  4A12 A;  2L9S A;  5J1Y A;  2KJC A;  5LGT A;  5KCM A;  5GPC A;  3Q5F A;  9ANT A;  1N25 A;  5FRO A;  4G7O F;  1MJ9 A;  3LMM A;  1RPW A;  5HS9 A;  2LY2 A;  2EFO A;  4UHT A;  3W3C A;  2GQQ A;  1MMN A;  2XAF A;  2XRL A;  4EV0 A;  1JTX A;  4BDZ A;  2DMN A;  2OTL I;  3WTW C;  4YII A;  5HVQ C;  1HST A;  2XSD C;  5CVJ A;  3DXJ F;  1W7P D;  2FBI A;  3ERM A;  1S29 A;  3HRU A;  3M9A A;  3J7Z I;  3GTK J;  3TOB A;  1UZC A;  3FXL A;  1UG2 A;  2H6B A;  5E1X A;  2ZKZ A;  1H9G A;  3CJN A;  3PNT A;  3K0L A;  3W2A A;  3R0A A;  5M3M J;  2YU3 A;  1IN6 A;  2FD5 A;  3FXM A;  3P9C A;  2HDW A;  1E3H A;  1MJB A;  4J19 A;  3CME I;  2K9L A;  1TWA J;  3CCQ I;  3G4S I;  3KE2 A;  1KCA A;  5LD2 C;  3IL2 A;  3O8H A;  2VPR A;  4LIT A;  2XDV A;  4U0V A;  2EA2 A;  4BEH B;  4IZZ A;  2P6T A;  2VE9 A;  2VJ5 A;  2B9S A;  6PAX A;  3MCZ A;  1I50 J;  1B72 A;  1OYI A;  3ZQC A;  5FRN A;  3BR2 A;  1HSJ A;  2M9H A;  4CYD A;  4HX4 A;  2R7R A;  5EGO B;  2GOX B;  1G3S A;  1HBX G;  5C3E J;  4UVC A;  2VKE A;  1UAA A;  2DBB A;  4DNC A;  1IO2 A;  3WU0 A;  2CU7 A;  2VN2 A;  2DN0 A;  4BDY A;  1USS A;  2CSO A;  1K4T A;  1PJR A;  1QBJ A;  2DU9 A;  4C2M J;  1P9Q C;  1H89 C;  1FBS A;  2OAZ A;  3F23 A;  2VOO A;  5J6X A;  3WTV C;  1SFO J;  4HZF A;  3ABT A;  1BJZ A;  2GIV A;  2K4B A;  4Y33 A;  3FHN A;  1B9M A;  1WHU A;  1VND A;  1W5S A;  4YFX F;  3DBH B;  4ZYG A;  3CP8 A;  1SD5 A;  4DYQ A;  4RM2 A;  4KMF A;  3HOT A;  3AG3 H;  1JT6 A;  3JRE A;  4CYC A;  2IS2 A;  5J8C A;  4BKX A;  1IDY A;  1KQ0 A;  1ON2 A;  3M1E A;  1TT0 A;  1ZYR F;  5LRR A;  4NV4 A;  1K78 B;  3G1L A;  2K7L A;  1WKM A;  1VQP I;  2FNA A;  4CXF A;  3JRD A;  4BL0 B;  4B43 A;  3LSK A;  1JGS A;  4QTR A;  1WH5 A;  4GCV A;  3TBI A;  1FWZ A;  3QPT A;  5EZG A;  4U7D A;  4LGW A;  5ERI A;  2HOA A;  4UVB A;  1X4O A;  2P7C B;  4G7Z F;  5E3N A;  3S04 A;  1ZKG A;  1KZH A;  3OSG A;  1Z3Y A;  3PL8 A;  2WV1 A;  5H6R A;  2Y48 A;  4QSH A;  3CCU I;  1YJW I;  1PUF A;  1R49 A;  2LYC A;  2LDU A;  2CUE A;  4ZH4 F;  2CQN A;  3HGG A;  2ZME B;  4BQA A;  2KMU A;  3RIR A;  5K7Z A;  3IH3 A;  3CLO A;  2WA0 A;  4YRV A;  3OYD A;  4KMU X;  3TO6 A;  2Z3Y A;  1DGW Y;  2GA2 A;  1B4A A;  3A4C A;  4WX9 A;  5M3F J;  4D5C A;  2L9N A;  4IHY A;  4M3F A;  1UHW A;  3OWT A;  1QZY A;  4F55 A;  2BXZ A;  1R1T A;  2VBW A;  5J47 A;  3FMQ A;  1Z1D A;  2Z99 A;  4A3F J;  2NVT J;  1KQ8 A;  2H8W A;  1FC3 A;  1K6Y A;  4AD9 A;  3BQY A;  4AWX B;  3TDU C;  3OR2 C;  1TTY A;  3NWT A;  3K10 A;  4XOR A;  3ZGK A;  4DGW B;  2R7V A;  2UXX A;  1WJB A;  2LG4 A;  2L7F P;  4MTD A;  1RNL A;  1D5V A;  3R6S A;  4HSR A;  2NS0 A;  3GW2 A;  5J3L A;  3X2Q H;  2LSO A;  4EJW A;  4G94 A;  2FML A;  2RQQ A;  3BTC A;  4EM1 A;  4X6A J;  5HDG A;  4II2 A;  4BUP A;  1WCM J;  1XN7 A;  5LGN A;  4A93 J;  3ZMU A;  4IQJ A;  4CHU A;  1IN7 A;  2BVM A;  3H0D A;  3R60 A;  1HA8 A;  2M7B A;  3ABU A;  2AQF A;  5D6F A;  4IX7 A;  5BMZ A;  1N75 A;  4HYE A;  4XOT A;  2STW A;  2E19 A;  3GTQ J;  3H9G A;  3OYN A;  3I71 A;  2MFZ A;  3OMY A;  3KX2 A;  2L2O A;  3REO A;  4A3D J;  4B4C A;  1K83 J;  4R79 A;  2DXI A;  4LOC A;  3ASN H;  4EAT A;  3BRO A;  3TP3 A;  3OS2 A;  1U5T C;  3ZRG A;  3KYL A;  3GVA A;  3T1B A;  5J8F A;  3FBN B;  3ZR8 X;  5DM7 F;  2EK5 A;  1R5H A;  2BY3 A;  3EUA A;  2HVR A;  1XCB A;  2XVC A;  2OZU A;  2KRH A;  1BR1 A;  2E1N A;  4S04 A;  4CZC A;  1ODD A;  2LRE A;  2VKV A;  4L9V A;  2Y9Z A;  3S3N A;  3I55 I;  3OOU A;  1SD4 A;  4XLN F;  4LIV A;  2HQ5 A;  3WTT C;  3V8K A;  3OL4 A;  4LJZ F;  2AXL A;  1R23 A;  3KIO A;  4WXC A;  1MH4 A;  2IVM A;  3CCR I;  2GXG A;  2CS3 A;  1JJ8 C;  2KT0 A;  3FX3 A;  5IYD J;  3BDN A;  1E0E A;  1IUY A;  1ITY A;  2GM4 A;  1T95 A;  2JMW A;  2M0M A;  1SFK A;  4IRG A;  2P5K A;  5BOX A;  2V9K A;  5D4S A;  1FMW A;  2GBY A;  4F52 A;  1OKR A;  2D5V A;  2N8G A;  1MKM A;  1LJ9 A;  5CVI A;  3SDG A;  3DTE A;  1K78 A;  1VQ5 I;  1GDT A;  2EZK A;  5BQT A;  1JGG A;  1D8J A;  1RRJ A;  1WJ5 A;  1OPC A;  3MZH A;  2HO0 A;  2HXI A;  3KFW X;  4CIC A;  1YIT I;  4FHT A;  3IP4 B;  4ZJZ A;  2ZJQ F;  5DDG A;  1TQM A;  2P7V B;  3LSR A;  4M3B A;  5AIQ A;  3DWL E;  4I0B A;  2V1X A;  4ZYD A;  3ML6 A;  4YFN F;  2Q1Z B;  4H0E A;  4A3K J;  2M8E A;  4A3L J;  2H09 A;  2VOD A;  1IRX A;  5HLG A;  3K69 A;  1EH6 A;  2H1L A;  2DOA A;  3Q0V A;  3M07 A;  3R4K A;  3WTZ A;  1GXP A;  2E35 A;  4CDG A;  2IT0 A;  3GF2 A;  1U5T B;  3F8N A;  2I10 A;  3VYR B;  4IHW A;  1HXD A;  5K7H A;  1IG7 A;  1ZG3 A;  1JUS A;  2ZME A;  2C6Y A;  3E97 A;  5GPA A;  2DK8 A;  3HG9 A;  4EMS A;  2WAF A;  3DCF A;  3OYH A;  5HNF A;  1U8R A;  3I54 A;  2O9L A;  2OPT A;  3QPL A;  5K5O A;  2WAE A;  5EEH A;  1A36 A;  2RQP A;  3T8T A;  2D2W A;  5GTH C;  4JYK A;  1VQN I;  2NYX A;  3ASO H;  4CCJ A;  1ORK A;  5CVU A;  2W57 A;  3TQN A;  3DF8 A;  3CF5 F;  1A04 A;  2LLK A;  3BP8 A;  3HIF A;  5L3F A;  3EYY A;  2Y75 A;  3FXJ A;  4V19 K;  1BOA A;  1DGR M;  1W5T A;  3SZP A;  4IRI A;  4DBQ A;  3WTS C;  4FE7 A;  1IRG A;  4LLN A;  2ZNZ A;  3C18 A;  3IV5 A;  3J81 K;  2DFE A;  3C1D A;  4KIF A;  1KYZ A;  5KVR A;  1SFX A;  4PFO A;  1QU3 A;  3O2P E;  3RQI A;  2IA0 A;  2OCC H;  1WJD A;  2H94 A;  3ECO A;  1DQU A;  2AO9 A;  2OQG A;  5LEJ A;  3S3M A;  4BE0 A;  2RVC A;  5HS8 A;  1MW7 A;  2L7M P;  5FKN A;  2EPF A;  2GOM A;  4IHV A;  1UCR A;  2W82 A;  4I0A A;  3WU1 B;  4BHC A;  5BPI A;  3LSI A;  4AM3 A;  3MMY B;  3IHU A;  4LG0 A;  1FTZ A;  2HR3 A;  2MG4 A;  3OYF A;  2K3F A;  2FNP A;  2P4W A;  4FE4 A;  5EJC A;  2LTP A;  5IT9 K;  2K3P A;  1FP2 A;  1U78 A;  3BOQ A;  2XAJ A;  3L2U A;  5JHU A;  3OIP A;  3CCS I;  3JRH A;  2KDO A;  3S14 J;  3ZQQ A;  4XMY A;  1ETY A;  2OF7 A;  1WRJ A;  1O4X A;  4B8X A;  4HRI A;  2QKL B;  3QYE A;  4PJM A;  1XG1 A;  4GYG A;  1LFP A;  3CO7 C;  4IJA A;  3JTG A;  1X1D A;  2HOE A;  3OV8 A;  1XTA A;  4KIC A;  2O6G E;  1MBK A;  3C3W A;  2OD5 A;  3CJT B;  3HSE A;  3R61 A;  3WHB A;  3HOS A;  4OMZ A;  4GYI A;  4L5J A;  5DM6 F;  1KU2 A;  3FM5 A;  3CDL A;  3EPZ A;  3MFK A;  4KIT B;  2MC4 A;  2DJI A;  4JQF A;  1IN8 A;  2V6C A;  2VQC A;  3BR0 A;  3QOP A;  2GXA A;  5GTI C;  1JKR C;  4A6E A;  1E3P A;  1P7I A;  5DUK A;  4EGZ A;  4B47 A;  3WTU C;  5J1R A;  1IDZ A;  2L02 A;  4IF4 A;  4RAG A;  2DOF A;  3DPT A;  3OR1 C;  2KIU A;  4OWR B;  3ZQH A;  4ENK A;  5ED4 A;  1A6Q A;  1SC7 A;  2XF7 A;  3KCC A;  4ZYA A;  4RLQ A;  3PJR A;  4PJ0 C;  2HTJ A;  2V4J C;  3CDH A;  3ULQ B;  2OC6 A;  3W6V A;  5J4V A;  2DMT A;  3SFZ A;  1SAN A;  2M4K A;  1VQL I;  5FLV A;  1ZRF A;  3G1O A;  5JR3 A;  3SEZ A;  1G59 A;  5IYC J;  3E6D A;  3CC2 I;  1P4W A;  2ZBK A;  3ZQF A;  4JX6 A;  3P9I A;  1R9T J;  3MAJ A;  4HPQ A;  3ROU A;  3W2W A;  1VQO I;  5CVR A;  2I5U A;  4RGS A;  2UUZ A;  1LFB A;  4RB3 C;  2JK3 A;  1KU9 A;  2VXD A;  1XMK A;  3DFG A;  1RUO A;  3A2K A;  2IGM A;  2PX9 A;  1YI2 I;  2XB0 X;  5K7F A;  3M4O J;  2PMU A;  2A68 F;  3WGI A;  2MC3 A;  2R7Z J;  2DFH A;  1O3R A;  1MNE A;  2QSF X;  1FZP B;  3RPQ A;  1ZR2 A;  4NNJ A;  3BCB A;  3DPU A;  2L5Q A;  3K4L A;  3RYP A;  2BXY A;  4IVN A;  1MBE A;  1Y56 A;  1IXR C;  2COB A;  5DCM A;  2E5N A;  2MD5 A;  3HEF A;  3I4P A;  4OOI A;  3PQJ A;  1JI8 A;  1XSV A;  2QF7 A;  4OAZ A;  2R7T A;  3GYH X;  1FJL A;  4UUS A;  3CJR B;  1RZ4 A;  1JJ6 C;  4OMY A;  2K9S A;  5LEK A;  1MJA A;  4A3B J;  1GV2 A;  1ENH A;  2R0Q C;  4NQW B;  1YFH A;  2P81 A;  3VWB A;  1D3Y A;  2AQE A;  4EQQ A;  3HYI A;  2VKH A;  3DBL B;  2LC2 A;  3HM5 A;  1IUF A;  2PBI A;  2WV0 A;  2Y31 A;  2L3D A;  2VLA A;  3E1S A;  5F6F A;  3RKY A;  2H8R A;  2DT5 A;  3F8B A;  3CCY A;  1U3E M;  2BHY A;  2JVH A;  1FMV A;  3BZC A;  1X1P A;  2DOD A;  2JA5 J;  4Z2Y A;  1G6N A;  3CLQ A;  2WBM A;  3FMS A;  4D7M A;  4JP0 A;  2ZXW H;  2COM A;  2P0W A;  2CQK A;  4P5O A;  5DEQ A;  1MIJ A;  3BQZ A;  1HDD C;  4IEJ A;  4D9J A;  1ZH5 A;  1TT5 B;  4I09 A;  3GO5 A;  4P1W A;  2VT2 A;  5KK1 A;  4CCN A;  2IGO A;  2R7O A;  1S8N A;  4XKW A;  3HJE A;  5B3S H;  2OU2 A;  2IS1 A;  1Y0N A;  1W0U A;  3BR6 A;  2W48 A;  3MZY A;  1LVK A;  1YS6 A;  4X0G A;  1J7K A;  3H0G J;  5L3B A;  3ECH A;  2CW7 A;  1SFE A;  4MLO A;  5D5U B;  1SFU A;  1RET A;  2CQX A;  4XLC A;  1UG0 A;  2JRM A;  5JLX A;  2QA4 I;  2DK5 A;  5EZH A;  1LDK B;  1TBX A;  4HQM A;  4L9N A;  1QGP A;  2GZW A;  3TO7 A;  3HSR A;  1JHE A;  3S1R J;  4BNC A;  5CPR B;  1X1A A;  4A2U A;  1T2K A;  4MO7 A;  3A1Y A;  4AVZ A;  2F4I A;  2XAG A;  4A0X A;  1XSD A;  5FFZ A;  1AHD P;  3V7C A;  3HOU J;  1FT9 A;  4CUG A;  5ILS A;  2KRC A;  4LD5 A;  1O7F A;  2NNN A;  1OCT C;  3G3Z A;  2W1O A;  5EEA A;  1QPM A;  2XGE A;  1KGS A;  1W7P B;  2E2H J;  1KU3 A;  5DYM A;  4B48 A;  5GAD J;  3D0S A;  1IGN A;  2DFI A;  4XIC A;  1POG A;  4G7H F;  3IH2 A;  2EB7 A;  3IWZ A;  4HST A;  4U87 A;  1YJN I;  3S2H J;  4HNV A;  2VOP A;  2M30 A;  3CD6 I;  4BJT A;  4XRS G;  1STZ A;  5HLI A;  1XDS A;  1AOY A;  3KP4 A;  2F4O B;  1MD0 A;  2E7X A;  3MD2 A;  4EM0 B;  1YTY A;  3ZXS A;  2B0L A;  4FTH A;  3H5R A;  2JA2 A;  1WJE A;  2O5R A;  2ZJR F;  3M8E A;  3K4B A;  3DKY A;  3GTM J;  2FRH A;  3E6B A;  2ZJP F;  3S3O A;  1FSE A;  1I6X A;  3GCM A;  5D5V B;  2CV0 A;  4GDF A;  3WE2 A;  4RAY A;  1ZRC A;  4W97 A;  1WZ2 A;  4RGR A;  2XRN A;  1GXQ A;  1BBY A;  3EUH C;  1U6G A;  2HDD A;  1HDP A;  3CZ6 A;  4RS8 A;  3I56 I;  1RKW A;  2XAU A;  3TOA A;  1ON1 A;  2CJJ A;  5FFX A;  2TRT A;  3IRR A;  2BV6 A;  1TWC J;  4FET A;  1F39 A;  1PDN C;  3CMY A;  3IUO A;  2FBK A;  4WXD A;  3CDI A;  4KN7 X;  2EV0 A;  5LGU A;  5CYV A;  1Z05 A;  3UNG C;  2FOW A;  1ETW A;  3AG1 H;  1Y1V J;  2ELK A;  3Q9V A;  4ENJ A;  2Y0M A;  1R1U A;  4HEA 2;  2NOJ B;  2DCE A;  4CCL A;  3J7A O;  4NB5 A;  1S72 I;  2JPB A;  1VQ6 I;  3EET A;  2GWR A;  3I5U A;  1U9N A;  1FYL A;  5AIP A;  1VTN C;  1SVL A;  3BTL A;  1XGS A;  3EQL F;  4BXX J;  2QYO A;  3HPH A;  5IT3 A;  2EIK H;  4XM3 A;  2HKO A;  2V1U A;  1ZTR A;  2E2J J;  2FBH A;  2EFN A;  2XHK A;  1G3Y A;  1ETQ A;  1LDD A;  1W5C C;  3M8J A;  2R5Y A;  4UNO A;  2PG4 A;  4ESJ A;  3T8R A;  1ZEL A;  3F22 A;  2GA1 A;  4PDK A;  5AON A;  3N97 A;  3EDP A;  5FLM J;  2LVS A;  3OSF A;  2X51 A;  1JHC A;  4O6J A;  5K5Q A;  3HOW J;  1QVT A;  1LEB A;  2E2I J;  4UXN A;  1IXS B;  2A5W A;  3A02 A;  3F21 A;  1LEA A;  4MQV A;  3WTY C;  1JHF A;  5HNH A;  3VYT B;  4I2O A;  3LSP A;  2DMP A;  1MBG A;  5CQG A;  4F93 B;  5EG0 B;  1L0O C;  3UR3 C;  2QQ9 A;  1A6I A;  2BW3 A;  3K1M A;  2HDC A;  1XSX A;  2KRF A;  4K8W A;  1SD6 A;  1CF7 B;  3MEX A;  1T6S A;  4NC7 A;  5JHF A;  1MDM A;  2PMH A;  3GBG A;  4F91 B;  3A01 A;  2ELJ A;  4V2F A;  3QYF A;  2FX0 A;  4Q4Z F;  3K4N A;  3BY6 A;  2MLK A;  3KP5 A;  2X1C A;  3I59 B;  3QAH A;  3GTO J;  2FJR A;  3HC7 A;  2F5V A;  4NDL A;  3F6V A;  5KNL A;  1AWC A;  2DTZ A;  2Q2E A;  3VYS B;  3ZQI A;  2JQ7 A;  3GTL J;  1SD7 A;  4Y17 A;  1ZK8 A;  5IOZ A;  3G6E I;  2FE3 A;  4OIN F;  4LFU A;  3JCU C;  4RAF A;  4BAY A;  4L9J A;  2F5C A;  2M8G X;  4DZP A;  3DU6 A;  2J5P A;  5HLT A;  1LKX A;  2HNF A;  4E7L A;  2DA3 A;  3IAM 2;  2DJN A;  3CJQ B;  1RC9 A;  3BZ6 A;  1EH8 A;  1BA5 A;  1ONV A;  1GUU A;  1WH7 A;  1X1C A;  4BHP A;  1Y6I A;  3LQR A;  5BPD A;  3BPX A;  4BJ5 C;  4HBL A;  2BY0 A;  1TW2 A;  1ZG5 A;  1TQP A;  2QZ8 A;  2Z5U A;  3HOZ J;  1TNS A;  2ETH A;  4QPO A;  3GME A;  1H88 C;  1FYK A;  2ADU A;  2VJI A;  2DPD A;  2CWE A;  3MZ8 A;  1P2F A;  2ESN A;  2FUG 2;  2JRT A;  1F43 A;  2OV7 A;  1WJA A;  4EM2 A;  1S7E A;  3OYK A;  3IKV A;  3E0J B;  1YLF A;  4UUT A;  3JRC A;  5F08 A;  1LE8 B;  1TP4 A;  4AU7 A;  5ICE A;  3G71 I;  5L3D A;  2LBF A;  3BR3 A;  3O6B B;  3CCJ I;  4A3C J;  2DMQ A;  3AFH A;  1QPI A;  1T33 A;  5L3E A;  1J75 A;  4XL9 A;  4KIG A;  2F5F A;  1B59 A;  3CUQ C;  1E3O C;  2NS7 A;  4IHX A;  4QIW N;  2LY9 A;  1IC8 A;  3K4J A;  2HZD A;  4RBO A;  4M9X A;  2J5O A;  1XGN A;  1YW7 A;  4HF0 A;  4BXU A;  4HW0 A;  3IIQ A;  4XNF A;  2R7F A;  3GZN B;  2K27 A;  4CCK A;  3QU6 A;  2DQL A;  2MYS A;  2XSJ C;  3VPR A;  3KEQ A;  4HF2 A;  2KZG A;  4BBS J;  1EH7 A;  1MMS A;  3F9K A;  4CGZ A;  2H6C A;  4S0H B;  3HOV J;  4M3D A;  2QBY B;  3ONQ A;  2EIN H;  2E1M C;  4UV8 A;  3PNV A;  5TGT A;  4I99 C;  1ZQ3 P;  2LKS A;  1TC3 C;  5E8I A;  5E3M A;  2BOL A;  1AA7 A;  2X48 A;  2VUM J;  4M3E A;  2ME0 A;  3CCL I;  4G12 A;  3BT9 A;  3JRB A;  3HBL A;  3H5A A;  4BEH A;  1ETO A;  4IL6 C;  2P5V A;  1YS7 A;  2ZXJ A;  4ANJ A;  4ZC3 A;  2IW5 A;  3J80 Z;  4RLF A;  3VSK A;  2EV5 A;  1RES A;  2HS5 A;  1HF0 A;  2H27 A;  3VSL A;  3RCO A;  3MWM A;  5EGO A;  3CCV I;  4ZZL A;  1K6O A;  2FA5 A;  1MBJ A;  1MND A;  2KIF A;  2O61 A;  5M5Y J;  1BIB A;  2ZNY A;  4LMY A;  2EIL H;  4NBQ A;  1IV8 A;  2KZV A;  4XN3 A;  1FBU A;  4JBA A;  1T39 A;  4Y4R A;  3DTK A;  3KZZ A;  2DDA A;  3CUQ B;  1K79 A;  3E3V A;  4XSZ F;  2PEX A;  4XKV A;  1B8I B;  1A31 A;  4C3H J;  4E7J A;  3ZPL A;  4FCY A;  1XS9 A;  1E17 A;  3O3K A;  2LFB A;  4OIQ F;  2IP2 A;  3ZN1 A;  4RDU A;  4PGG A;  1J9I A;  2W85 A;  4MEY F;  5IP7 J;  5E17 F;  3U21 A;  1R71 A;  2P5L C;  1BC7 C;  4L0Z B;  2EV6 A;  2X9D A;  4X1E A;  1HW1 A;  1V5E A;  2HVQ A;  2HZT A;  3WTX C;  3B73 A;  1IN5 A;  2R7S A;  2A3S A;  4G8X A;  2MA3 A;  3RQ4 A;  1FEX A;  1Z3X A;  2LF7 A;  5GP9 A;  2PQ8 A;  4A5M A;  1U2W A;  4MNU A;  1FIA A;  2V1N A;  2XKO A;  4PJL A;  3M3Y J;  3TO9 A;  4HLX A;  3L7W A;  2VI6 A;  2E71 A;  4ZDL A;  5EF6 A;  2DPU A;  1T98 A;  2V1D A;  1G8X A;  1TLH B;  1MBH A;  2M5W A;  5KAI C;  1DP3 A;  3W2V A;  2AS5 F;  3K9T A;  3RPU D;  2F5E A;  2JA6 J;  4A0Z A;  2MD0 A;  3ZQ7 A;  2HQN A;  1V54 H;  3CMM A;  3GFM A;  1MMG A;  1MSF C;  3CC4 I;  3AAF A;  5EYR A;  1DUX C;  4U0W A;  1BN5 A;  1R4N B;  1R5I D;  1WJF A;  3QOE A;  2WAQ A;  2ZSI B;  3IWF A;  2EJR A;  4M72 A;  3OYL A;  2M87 A;  4HV5 A;  1OCR H;  2BY1 A;  4BJ6 C;  2RC4 A;  4E7Z A;  3V7S A;  2MLG A;  5IOY A;  4N9I A;  2NAZ A;  4HG2 A;  4M6Y A;  2YU9 J;  4B09 A;  5ILU A;  2R4G A;  4IKF A;  4IRH A;  3TGN A;  3MQ0 A;  4W1U A;  1IRF A;  3PIP F;  4ESF A;  2G0E A;  1ZAO A;  2EFP A;  3PUF A;  2NNY A;  3ISP A;  3EYI A;  5D4R A;  3G73 A;  4NHJ A;  5CLS A;  1BI1 A;  1O3T A;  1F9N A;  5F1R A;  3LWF A;  2X4H A;  3QOD A;  1HKS A;  4KJZ A;  1BL0 A;  1SMY F;  1ZLJ A;  4N4O B;  4JX5 A;  2QM3 A;  1I4V A;  1P7J A;  2EBI A;  4AIJ A;  1OFC X;  2LKX A;  2VJ4 A;  4LB6 B;  2K02 A;  3RJP A;  3NRV A;  3S2D J;  3DEU A;  1T8I A;  3JRG A;  3L2V A;  2DO7 A;  3BR5 A;  2IEK A;  4OIR F;  3PIO F;  4CH7 A;  3CO6 C;  1I27 A;  2XPW A;  4Y7N J;  1T0F A;  1T56 A;  3L9F A;  1SAX A;  2JJ7 A;  3SXY A;  3VYU B;  1YIJ I;  1FP1 D;  2QWW A;  3NWS A;  3GXO A;  4FX4 A;  1CQT A;  1GLN A;  3RZO J;  4U88 A;  3F3X A;  2IPQ X;  5E1Z B;  2CUZ A;  3V7R A;  1WQ2 A;  3KYD B;  1ZHF A;  1V55 H;  2W84 A;  4BQN A;  3AKZ A;  1EJ9 A;  2XAH A;  2E34 A;  5M5W J;  2YS9 A;  4DJA A;  5C4X J;  4C2U A;  1QO0 D;  1KON A;  3HOY J;  2XRO A;  4JX4 A;  4Y15 A;  5ICG A;  2ZFU A;  2L9R A;  3M1C A;  1U8B A;  4CZZ A;  3B6C A;  4YIR X;  4ABZ A;  3K4C A;  2DYR H;  3KYC B;  3PNY A;  1D5Y A;  3D5R C;  4ZYE A;  4RB1 A;  3N4M A;  2OUM A;  4A3J J;  1JXS A;  2E60 A;  5F04 A;  1VFC A;  5TJJ A;  1QZE A;  3IKT A;  2Y0S A;  3OYC A;  4EEF G;  4HAM A;  2A6T A;  2K85 A;  2VAS A;  2QKM B;  3N05 A;  1B1B A;  3AL0 C;  2O8K A;  3TKY A;  3CP2 A;  3DEE A;  5LRS A;  2R7W A;  1P6R A;  2XPV A;  1H8A C;  3OY9 A;  2QQA A;  4XON A;  1BJA A;  1BC8 C;  3GTG J;  1Y0U A;  3KZY A;  1VI0 A;  5GAE J;  3RKQ A;  3T5X A;  1J5Y A;  3L2C A;  1NH3 A;  2QSG X;  1Q1H A;  1EV7 A;  3VDX A;  3FKI J;  3BG7 A;  1JKP C;  4MGR A;  2E5Z A;  1AKH B;  1ACI A;  2OTJ I;  1YIO A;  1Z7U A;  2ZO4 A;  2D45 A;  4G6D A;  2L9V A;  2NVQ J;  1VQK I;  4ON0 A;  5FRM A;  1U5T A;  2KIS A;  1FOY A;  1KN9 A;  1KA8 A;  2NS8 A;  1YG2 A;  3BZK A;  2VC0 A;  1FBQ A;  3LSG A;  1MBF A;  4HV6 A;  1VQ4 I;  2WAQ N;  1MMD A;  4PCQ A;  4ITV A;  3F72 A;  4UUV A;  2JSP A;  2OZ6 A;  1GVD A;  5CKT A;  3G1M A;  4XK4 A;  2IA1 A;  4HDV A;  2XGD A;  4H4K C;  3RKX A;  3I9V 2;  5CVV A;  4LIU A;  4HNU A;  1AY9 A;  3RTR A;  1TQI A;  4GGG A;  3KEO A;  2F4M B;  5CJ9 A;  2EIJ H;  2O3F A;  2VQL A;  3E6M A;  4G9Y A;  1UB9 A;  3CUO A;  2IS4 A;  5F0H A;  2P8T A;  1KYW A;  1LQ1 A;  3GFI A;  4ENM A;  1Y8R B;  4BQQ A;  3HTS B;  2V9P A;  1YRN B;  1XGM A;  3K6G A;  1QHH D;  3LSM A;  2K5C A;  1YX3 A;  4FQG A;  2GAU A;  3ZMT A;  4BQO A;  5JI6 A;  4WCG A;  3JW4 A;  3AL0 B;  3LFK A;  3FF5 A;  3BG6 A;  2BZT A;  1TL8 A;  1DDN A;  1V4R A;  3J7A Y;  2F6C A;  3FIW A;  3FXK A;  3T0Y A;  3LSJ A;  3DPL C;  2VE8 A;  4NC6 A;  3UKG A; 
#chains in the Genus database with same CATH homology
 1B9N A;  3W6J B;  2PLY A;  2K4J A;  4DQ2 A;  3K1P A;  2LKP A;  3QRF F;  3KP7 A;  2HYG D;  1NHA A;  3CTA A;  4N0B A;  3I53 A;  2V9V A;  5D5W B;  2P6S A;  2F5D A;  3L09 A;  3M8F A;  1RI7 A;  1CGP A;  2IA2 A;  3OOP A;  2O03 A;  4MQ9 F;  4K2E A;  1PP8 F;  4XRF A;  4L9T A;  4EJV A;  4RGX A;  1OR7 A;  4RB2 C;  3QP6 A;  1BM9 A;  1YO5 C;  1FX7 A;  5ICC A;  5FGM A;  4AIH A;  2DTR A;  4EJT A;  1I1G A;  4HX7 A;  2CGP A;  3BJA A;  3LST A;  3ERE D;  2QVO A;  4XSX F;  3F6O A;  5BS6 A;  2OQR A;  1TW3 A;  2A6H F;  4N31 A;  2BYV E;  3GZ6 A;  3WGG A;  1I5Z A;  5LBQ A;  3DV8 A;  2DQR A;  2RV8 A;  3RKW A;  2XGX A;  1B6A A;  2HKX A;  3SQN A;  4AIK A;  1HKT A;  3PQK A;  4M6X A;  3FXQ A;  5ILV A;  3ZMD A;  2BBY A;  1IW7 F;  1F4K A;  1ZRE A;  1SMT A;  4BHB A;  5FLX K;  2XIG A;  1W4M A;  1IF1 A;  3KP3 A;  5HDK A;  2RNJ A;  2W24 A;  2EFQ A;  2D1H A;  3LAJ A;  2L4M A;  3COA C;  4KA4 A;  4LLG F;  4R8H A;  1XB4 A;  4Q47 A;  2Q0O A;  4NQW A;  2D1V A;  4KDP A;  2KJB A;  4FT8 A;  3C7J A;  1PUE E;  4ZZD A;  2LF8 A;  2R7D A;  2ELH A;  2CO5 A;  5LLQ A;  3GX4 X;  3JAM K;  3F8M A;  1RUN A;  2MH2 A;  5A2Q K;  3V8L A;  1V3F A;  3HRT A;  2QQB A;  4KIB A;  1YYV A;  4PZJ A;  2QEN A;  4R1H A;  3SZT A;  2L4A A;  2KKO A;  4QLC U;  3FHZ A;  3R0J A;  3ZP5 A;  4HF1 A;  2OBP A;  4LK0 F;  4HOB A;  3LQQ A;  3LAP A;  3E5Q A;  1F1Z A;  3PFI A;  1O3Q A;  1LDJ A;  1WI9 A;  3RYR A;  2HWV A;  4UV9 A;  4M9S A;  1J59 A;  4P9U A;  3J80 K;  2WC2 A;  4XBF A;  1BI0 A;  3NQO A;  1XGO A;  4U0Y A;  1ZLK A;  1E2X A;  4OU0 A;  3JTH A;  1XCV A;  1X3U A;  1HW5 A;  4U7B A;  1Z9C A;  3FM3 A;  1ULY A;  1W7P A;  1O57 A;  4HDU A;  3QU3 A;  1WWX A;  2FSW A;  2EA4 A;  1FYM A;  4F7Z A;  2VON A;  3KP2 A;  5DUI A;  2XUB A;  1L3L A;  1J2X A;  3GEZ A;  4LB5 A;  3I64 A;  4I01 A;  3LA3 A;  3FZV A;  1FLI A;  3H92 A;  2DW4 A;  3ZN0 A;  1HQC A;  1R58 A;  3TDZ C;  4RGU A;  4A0Y A;  1LB2 A;  5FLX Z;  3VEP A;  2V79 A;  3WE3 A;  3E6C C;  1P4A A;  2W25 A;  1Z6R A;  2ESH A;  1BI2 A;  1UMU A;  2CFX A;  4WXH A;  1OYY A;  2K86 A;  4XLP F;  4FX0 A;  1Z91 A;  2WWY A;  2Z33 A;  5K1Y A;  2O0Y A;  1ZAR A;  4GO1 A;  2PN6 A;  3GFJ A;  2JT1 A;  3E5X A;  1DP7 P;  5H20 A;  3JAM Z;  3I58 A;  4WWC A;  1QZZ A;  3JSO A;  2XAS A;  4LK1 F;  5A2Q Z;  4D0P A;  2ISZ A;  2A61 A;  1YW9 A;  3I0T A;  3HSF A;  4TV7 A;  2VXZ A;  3GWZ A;  1S3J A;  5L3C A;  4ESB A;  3Q9S A;  2FEZ A;  3HUG A;  2HFH A;  1GHC A;  1S6L A;  4M74 A;  4BH9 A;  2BGC A;  5LHG A;  3DKW A;  3KET A;  3QP5 A;  2Q8K A;  1FNN A;  3M7G A;  3BPV A;  4Y13 A;  2A5Y B;  5H6Q A;  4EJU A;  3EUH A;  3LA2 A;  2KIM A;  3FXR A;  1C0W A;  2FKD A;  1IAW A;  1ZGJ A;  1CF7 A;  1I1S A;  1R36 A;  4LG0 B;  4KFC A;  3I59 A;  2A07 F;  4JK1 X;  4G6Q A;  2CW0 F;  5FB2 A;  2E7W A;  2UWM A;  2HEO A;  3DQV C;  3D5L A;  1MGT A;  3L00 A;  3VB2 A;  1XMA A;  2LNB A;  3QPH A;  5DV5 A;  4N9H A;  1LVA A;  1ZGA A;  4MTE A;  1KU7 A;  4RB0 A;  3BDD A;  4IHT A;  4PGH A;  2L01 A;  5K5R A;  2DLL A;  2YSR A;  5D8K B;  2ZJ2 A;  1H9T A;  4AVP A;  5DD8 A;  2XKP A;  5FD5 A;  1JE8 A;  1R1V A;  2XV4 S;  4MHG A;  1IZ1 A;  1HKQ A;  4KNY A;  2RDP A;  3S2W A;  4QWQ A;  3IC7 A;  1O7L A;  1UHM A;  1R7J A;  3U1D A;  2G9W A;  5D8L B;  2JZY A;  2VT3 A;  2TDX A;  2DI3 A;  5EEG A;  4IXA A;  3VFZ A;  1FY7 A;  3FXU A;  3FWE A;  2G7U A;  1R00 A;  2VBZ A;  1FPQ A;  5DCM B;  3F8F A;  1O3S A;  2QBY A;  3KLO A;  5LHH A;  1REP C;  1WSU A;  2QUF A;  2RN7 A;  5HLH A;  1F5T A;  1K7A A;  5ICF A;  3RPU A;  2DAO A;  2XAQ A;  2CYY A;  2ISY A;  3V8J A;  3BJ6 A;  1DPU A;  2A69 F;  2WTE A;  5HDN A;  3P7N A;  3DP7 A;  2MBF A;  2FMY A;  2YPR A;  3RI4 A;  3WG9 A;  3W6K B;  1ZN2 A;  2HQR A;  3CUQ A;  1DPR A;  1J0R A;  4WK8 F;  1H0M A;  2BE5 F;  4A6D A;  3HRS A;  2YR2 A;  1IXC A;  2FOK A;  2HYF A;  4HLY A;  3ELK A;  1G3W A;  4YIF A;  3WGH A;  2E1C A;  4KUM A;  1Z6T A;  2G7H A;  4E70 A;  4ENN A;  5JFR A;  3ZMZ A;  4YFK F;  2BEO A;  1OMI A;  2R3S A;  2STT A;  5HOO A;  1T38 A;  2NRA C;  1YQA A;  3U9G A;  1BI3 A;  1D8K A;  1XDU A;  3SHF A;  3HTU A;  1UFM A;  2M45 A;  4YG2 F;  4S05 A;  1LNW A;  4M9Z A;  2ZFW A;  2VBY A;  3RDI A;  4L18 B;  1BIA A;  3ZMV A;  2HTS A;  1P4X A;  4L5I A;  2F2E A;  5LHI A;  4OIO F;  1MZB A;  2RKH A;  2JPC A;  2FXA A;  5D6E A;  2A6E F;  3K2Z A;  3B02 A;  5JVT A;  4P96 A;  4IHS A;  1QQI A;  2UZK A;  4UVA A;  3J81 Z;  2CG4 A;  2O8X A;  2EFW A;  1RIO H;  3NEU A;  2EWN A;  2PFB A;  3FMR A;  3U2R A;  3LA7 A;  4O5V A;  4IPA A;  2L54 A;  3GFL A;  2FQ3 A;  3ZMS A;  1IN4 A;  3GLX A;  3HHH A;  4OIP F;  2IJL A;  4I7H A;  4P9F A;  3P9K A;  3K1N A;  4KT5 C;  1FOK A;  2GXB A;  5E20 A;  4HX8 A;  4RAZ A;  1B12 A;  4I02 A;  2RGV A;  4MEX F;  1P92 A;  4EJO A;  4I98 B;  4BYY A;  1R22 A;  3HHG A;  5IT9 Z;  1PP7 U;  4KYW A;  4ME8 A;  1UST A;  1KQ9 A;  3VOE A;  4ETS A;  1G4D A;  3V4G A;  1S7A A;  5F64 A;  1FSH A;  3BJO A;  2X0L A;  4EVI A;  4EGY A;  5HS7 A;  4ASN A;  4L0Y B;  2YX7 A;  4HA8 A;  2OA4 A;  2VBX A;  2HGC A;  1ZG1 A;  3BWG A;  4M73 A;  3WOD F;  1MDM B;  2PJP A;  3H3Z A;  1QNT A;  4HQE A;  5DCF A;  4ZYH A;  4GXO A;  4KN4 X;  3IRQ A;  5L3G A;  1R5G A;  2Z9O A;  1OYW A;  3GZ5 A;  3VOD A;  4P55 A;  4M71 A;  1JHH A;  2VC1 A;  4CO8 A;  1GVJ A;  4Q5S F;  3HRM A;  4A5N A;  5E18 F;  2JSC A;  5D5X B;  1S7O A;  2FU4 A;  3GUD A;  4WF2 A;  2PI0 A;  5E1W A;  2YX4 A;  2UXN A;  2ZCW A;  2QLZ A;  5DD4 A;  1TNT A;  2ACJ A;  1XD7 A;  3H3U A;  5FD6 A;  2JTV A;  5TRD A;  4Q48 A;  4O3M A;  2IRF G;  3KLN A;  2MH9 A;  2M1B A;  3KP6 A;  4LLL A;  1YW8 A;  3JSP A;  1HW2 A;  1ZRD A;  2FF4 A;  3E5U A;  3F8C A;  5FO5 A;  5E8G A;  1G3T A;  4A12 A;  2KJC A;  5LGT A;  3Q5F A;  4G7O F;  1MJ9 A;  5HS9 A;  2EFO A;  4UHT A;  2GQQ A;  2XAF A;  4EV0 A;  3WTW C;  4YII A;  5HVQ C;  1HST A;  5CVJ A;  3DXJ F;  1W7P D;  2FBI A;  3HRU A;  1S29 A;  3M9A A;  3TOB A;  2H6B A;  5E1X A;  2ZKZ A;  1H9G A;  3CJN A;  3K0L A;  3R0A A;  2YU3 A;  1IN6 A;  3P9C A;  1MJB A;  3KE2 A;  1KCA A;  3IL2 A;  4U0V A;  6PAX A;  2EA2 A;  1T7D A;  2P6T A;  2VE9 A;  3MCZ A;  1OYI A;  1HSJ A;  4CYD A;  4HX4 A;  1G3S A;  1HBX G;  4UVC A;  2DBB A;  4DNC A;  3WU0 A;  2VN2 A;  1USS A;  2CSO A;  1QBJ A;  2DU9 A;  1FBS A;  2OAZ A;  3F23 A;  2VOO A;  5J6X A;  3WTV C;  4HZF A;  3ABT A;  2GIV A;  2K4B A;  1B9M A;  1W5S A;  4YFX F;  4ZYG A;  1SD5 A;  4KMF A;  3HOT A;  5J8C A;  1KQ0 A;  1ON2 A;  3M1E A;  1ZYR F;  5LRR A;  4NV4 A;  1K78 B;  2K7L A;  1WKM A;  2FNA A;  4CXF A;  1JGS A;  4GCV A;  1FWZ A;  3QPT A;  4U7D A;  4LGW A;  5ERI A;  4UVB A;  2P7C B;  4G7Z F;  3S04 A;  5H6R A;  2Y48 A;  2LDU A;  4ZH4 F;  2ZME B;  4BQA A;  3RIR A;  3CLO A;  4KMU X;  3TO6 A;  2Z3Y A;  2GA2 A;  1B4A A;  4WX9 A;  1UHW A;  1QZY A;  1R1T A;  2VBW A;  3FMQ A;  1Z1D A;  2Z99 A;  1KQ8 A;  1FC3 A;  4AD9 A;  4AWX B;  3TDU C;  1TTY A;  2UXX A;  4MTD A;  1RNL A;  1D5V A;  3R6S A;  2NS0 A;  3GW2 A;  2LSO A;  4EJW A;  4G94 A;  2FML A;  4EM1 A;  5HDG A;  1XN7 A;  5LGN A;  3ZMU A;  4CHU A;  1IN7 A;  3R60 A;  3ABU A;  5D6F A;  5BMZ A;  4HYE A;  2STW A;  3I71 A;  3REO A;  4R79 A;  3BRO A;  1U5T C;  3GVA A;  3T1B A;  5J8F A;  2EK5 A;  1R5H A;  1XCB A;  2XVC A;  2OZU A;  2E1N A;  4S04 A;  1ODD A;  4L9V A;  1SD4 A;  4XLN F;  3WTT C;  3V8K A;  4LJZ F;  4WXC A;  2AXL A;  1R23 A;  2IVM A;  2GXG A;  3FX3 A;  3BDN A;  1IUY A;  4IRG A;  2P5K A;  5BOX A;  5D4S A;  1OKR A;  1MKM A;  1LJ9 A;  5CVI A;  1K78 A;  1D8J A;  5BQT A;  1OPC A;  3MZH A;  2HO0 A;  3KFW X;  4CIC A;  4FHT A;  5DDG A;  1TQM A;  2P7V B;  5AIQ A;  4I0B A;  2V1X A;  4ZYD A;  3ML6 A;  4YFN F;  4H0E A;  2M8E A;  2H09 A;  2VOD A;  5HLG A;  3K69 A;  1EH6 A;  3WTZ A;  3R4K A;  1GXP A;  2IT0 A;  4CDG A;  3GF2 A;  1U5T B;  3F8N A;  1HXD A;  1ZG3 A;  2ZME A;  2C6Y A;  3E97 A;  2DK8 A;  4EMS A;  1U8R A;  3I54 A;  5K5O A;  5EEH A;  2RQP A;  3T8T A;  2D2W A;  2NYX A;  5CVU A;  2W57 A;  3TQN A;  3DF8 A;  1A04 A;  3BP8 A;  3HIF A;  5L3F A;  3EYY A;  2Y75 A;  1BOA A;  1W5T A;  3SZP A;  4IRI A;  3WTS C;  1IRG A;  4LLN A;  2ZNZ A;  3C18 A;  3J81 K;  3C1D A;  4KIF A;  1KYZ A;  5KVR A;  1SFX A;  3O2P E;  2IA0 A;  2H94 A;  3ECO A;  2OQG A;  5LEJ A;  2RVC A;  5HS8 A;  1UCR A;  5BPI A;  4I0A A;  3WU1 B;  4BHC A;  4LG0 A;  3IHU A;  2HR3 A;  2FNP A;  2P4W A;  5IT9 K;  1FP2 A;  1U78 A;  3BOQ A;  2XAJ A;  5JHU A;  1WRJ A;  4B8X A;  4GYG A;  3CO7 C;  4IJA A;  3JTG A;  2HOE A;  3OV8 A;  4KIC A;  2O6G E;  3C3W A;  2OD5 A;  3HSE A;  3R61 A;  3HOS A;  4OMZ A;  4GYI A;  4L5J A;  1KU2 A;  3FM5 A;  3MFK A;  4JQF A;  1IN8 A;  2V6C A;  3QOP A;  4A6E A;  5DUK A;  4EGZ A;  3WTU C;  2L02 A;  4IF4 A;  3DPT A;  2KIU A;  4ENK A;  5ED4 A;  3KCC A;  2HTJ A;  3CDH A;  3ULQ B;  3SFZ A;  1ZRF A;  5JR3 A;  3E6D A;  1P4W A;  2ZBK A;  3P9I A;  3MAJ A;  3ROU A;  5CVR A;  4RGS A;  4RB3 C;  1KU9 A;  1XMK A;  3DFG A;  1RUO A;  2PMU A;  2A68 F;  3WGI A;  2MC3 A;  1O3R A;  1FZP B;  3RPQ A;  3RYP A;  4IVN A;  1IXR C;  5DCM A;  2MD5 A;  3I4P A;  4OOI A;  3PQJ A;  1XSV A;  3GYH X;  1RZ4 A;  4OMY A;  5LEK A;  1MJA A;  1YFH A;  1D3Y A;  4EQQ A;  3HYI A;  2PBI A;  2WV0 A;  2L3D A;  5F6F A;  3RKY A;  2DT5 A;  3F8B A;  1U3E M;  4Z2Y A;  1G6N A;  3FMS A;  2COM A;  4P5O A;  2CQK A;  5DEQ A;  1ZH5 A;  4I09 A;  3GO5 A;  2VT2 A;  5KK1 A;  1S8N A;  2OU2 A;  3MZY A;  1YS6 A;  1J7K A;  5L3B A;  3ECH A;  1SFE A;  5D5U B;  1SFU A;  2DK5 A;  1LDK B;  1TBX A;  4HQM A;  4L9N A;  1QGP A;  2GZW A;  3TO7 A;  3HSR A;  1JHE A;  4BNC A;  4A2U A;  1T2K A;  4A0X A;  2XAG A;  1XSD A;  5FFZ A;  3V7C A;  1FT9 A;  5ILS A;  4LD5 A;  1O7F A;  2NNN A;  3G3Z A;  1QPM A;  1KGS A;  1W7P B;  1KU3 A;  5DYM A;  3D0S A;  2DFI A;  4G7H F;  2EB7 A;  3IWZ A;  2VOP A;  2M30 A;  1STZ A;  5HLI A;  1XDS A;  1AOY A;  3KP4 A;  1MD0 A;  2E7X A;  4EM0 B;  1YTY A;  2B0L A;  3M8E A;  2FRH A;  3E6B A;  1FSE A;  1I6X A;  5D5V B;  3WE2 A;  4RAY A;  1ZRC A;  4RGR A;  2XRN A;  1GXQ A;  1BBY A;  1U6G A;  4RS8 A;  3TOA A;  1ON1 A;  5FFX A;  3IRR A;  2BV6 A;  1F39 A;  1PDN C;  2FBK A;  4WXD A;  4KN7 X;  2EV0 A;  5LGU A;  5CYV A;  1Z05 A;  3Q9V A;  4ENJ A;  2Y0M A;  1R1U A;  3J7A O;  4NB5 A;  2JPB A;  3EET A;  2GWR A;  3I5U A;  1FYL A;  5AIP A;  1VTN C;  1XGS A;  3EQL F;  2QYO A;  5IT3 A;  2V1U A;  2HKO A;  2FBH A;  2EFN A;  2XHK A;  1G3Y A;  1LDD A;  4UNO A;  2PG4 A;  4ESJ A;  3T8R A;  3F22 A;  2GA1 A;  4PDK A;  5AON A;  3N97 A;  3EDP A;  1JHC A;  4O6J A;  5K5Q A;  1LEB A;  4UXN A;  1IXS B;  3F21 A;  1LEA A;  4MQV A;  3WTY C;  1JHF A;  4I2O A;  1L0O C;  2QQ9 A;  4K8W A;  3K1M A;  2HDC A;  1XSX A;  2KRF A;  1SD6 A;  1CF7 B;  3MEX A;  1T6S A;  1MDM A;  2PMH A;  4Q4Z F;  3BY6 A;  2MLK A;  3KP5 A;  3I59 B;  3QAH A;  2FJR A;  3F6V A;  1AWC A;  2Q2E A;  1SD7 A;  4Y17 A;  2FE3 A;  4OIN F;  4LFU A;  4BAY A;  4L9J A;  2F5C A;  2J5P A;  2HNF A;  3BZ6 A;  1EH8 A;  1ONV A;  4BHP A;  3LQR A;  5BPD A;  3BPX A;  4HBL A;  1TW2 A;  1ZG5 A;  1TQP A;  2QZ8 A;  2Z5U A;  1TNS A;  2ETH A;  1FYK A;  2ADU A;  2DPD A;  2CWE A;  1P2F A;  2ESN A;  2JRT A;  4EM2 A;  3IKV A;  1YLF A;  5ICE A;  5L3D A;  3O6B B;  5L3E A;  1J75 A;  4KIG A;  2F5F A;  1B59 A;  3CUQ C;  4M9X A;  2J5O A;  1XGN A;  1YW7 A;  4HF0 A;  4BXU A;  4HW0 A;  3IIQ A;  2R7F A;  2K27 A;  3QU6 A;  2DQL A;  3KEQ A;  4HF2 A;  1EH7 A;  4CGZ A;  2H6C A;  2QBY B;  4UV8 A;  5E8I A;  2P5V A;  1YS7 A;  2ZXJ A;  2IW5 A;  3J80 Z;  2EV5 A;  2HS5 A;  2H27 A;  3MWM A;  4ZZL A;  1K6O A;  2FA5 A;  2KIF A;  2O61 A;  1BIB A;  2ZNY A;  4LMY A;  1FBU A;  4JBA A;  1T39 A;  3KZZ A;  3CUQ B;  1K79 A;  3E3V A;  4XSZ F;  2PEX A;  3ZPL A;  1E17 A;  3O3K A;  4OIQ F;  2IP2 A;  3ZN1 A;  4PGG A;  1J9I A;  2W85 A;  4MEY F;  5E17 F;  2P5L C;  1BC7 C;  4L0Z B;  2EV6 A;  1HW1 A;  2HZT A;  3WTX C;  3B73 A;  1IN5 A;  2A3S A;  4G8X A;  2MA3 A;  2LF7 A;  2PQ8 A;  4A5M A;  1U2W A;  4MNU A;  2XKO A;  3TO9 A;  4HLX A;  3L7W A;  2DPU A;  1T98 A;  2V1D A;  1TLH B;  2M5W A;  2AS5 F;  3K9T A;  2F5E A;  4A0Z A;  3ZQ7 A;  2HQN A;  3GFM A;  3AAF A;  1DUX C;  4U0W A;  1BN5 A;  3IWF A;  2EJR A;  4M72 A;  2M87 A;  4HV5 A;  2RC4 A;  3V7S A;  2MLG A;  4N9I A;  2NAZ A;  4M6Y A;  4B09 A;  5ILU A;  4IRH A;  3TGN A;  3MQ0 A;  1IRF A;  4ESF A;  1ZAO A;  2EFP A;  2NNY A;  3ISP A;  3EYI A;  5D4R A;  3G73 A;  4NHJ A;  5CLS A;  1BI1 A;  1O3T A;  1F9N A;  5F1R A;  3LWF A;  2X4H A;  1HKS A;  1SMY F;  1ZLJ A;  2QM3 A;  1I4V A;  4AIJ A;  4LB6 B;  2K02 A;  3RJP A;  3NRV A;  3DEU A;  2DO7 A;  4OIR F;  3CO6 C;  1I27 A;  1T0F A;  1SAX A;  3L9F A;  3SXY A;  1FP1 D;  2QWW A;  3GXO A;  4FX4 A;  4U88 A;  3F3X A;  2IPQ X;  5E1Z B;  3V7R A;  1WQ2 A;  1ZHF A;  2W84 A;  2XAH A;  1QO0 D;  2XRO A;  5ICG A;  4Y15 A;  4CZZ A;  4ZYE A;  4RB1 A;  3N4M A;  1JXS A;  5TJJ A;  3IKT A;  4HAM A;  1B1B A;  3TKY A;  5LRS A;  1P6R A;  2QQA A;  1BJA A;  1BC8 C;  1Y0U A;  3KZY A;  3T5X A;  1J5Y A;  3L2C A;  1Q1H A;  1EV7 A;  4MGR A;  1YIO A;  1Z7U A;  2ZO4 A;  2D45 A;  4G6D A;  4ON0 A;  1U5T A;  1KN9 A;  1KA8 A;  1YG2 A;  2VC0 A;  1FBQ A;  4HV6 A;  4PCQ A;  3F72 A;  4UUV A;  2OZ6 A;  2IA1 A;  4HDV A;  3RKX A;  5CVV A;  1AY9 A;  3RTR A;  1TQI A;  4GGG A;  3KEO A;  5CJ9 A;  3E6M A;  2O3F A;  4G9Y A;  1UB9 A;  3CUO A;  2P8T A;  1KYW A;  1LQ1 A;  3GFI A;  4ENM A;  3HTS B;  1XGM A;  3ZMT A;  5JI6 A;  2GAU A;  4WCG A;  3JW4 A;  3LFK A;  3FF5 A;  1DDN A;  1V4R A;  3T0Y A;  3DPL C;  2VE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...