1JHFA

Lexa g85d mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAADEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LEXA REPRESSOR
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jhfA02
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jhfA01
2HTJA 2QUFA 3IRRA 4O3MA 4GXOA 3WTWC 2IA1A 3O3KA 4K2EA 2ZJ2A 1YW7A 4OIQF 4O5VA 4HX4A 4D0PA 3WTUC 4HOBA 3V4GA 1S6LA 2FOKA 2EB7A 5LHHA 3W6KB 3QOPA 2PLYA 2L4MA 1T2KA 4IPAA 2QBYA 1J2XA 2W85A 1HKQA 3DQVC 2FMYA 5FFZA 3FWEA 1UHWA 4AIKA 2QWWA 1R5GA 3R61A 2FNAA 2XAHA 3RIRA 2HNFA 2HOEA 1O3RA 4WWCA 2RN7A 5FD5A 1S7OA 4EJUA 2MBFA 4AWXB 3JSOA 3KP5A 3BY6A 5LRSA 2MLKA 3FZVA 1ZAOA 1A04A 4U7BA 1Q1HA 3VOEA 2DBBA 2RNJA 1F1ZA 1K79A 3MAJA 3RKYA 4EVIA 2CGPA 1XN7A 4IJAA 4BXUA 2EJRA 2H6CA 4MNUA 4M72A 2A6HF 3RPQA 1RZ4A 2L4AA 2Z5UA 4ZZDA 5IT3A 3F8BA 4I0BA 2RGVA 4G9YA 3TQNA 2QQBA 1BOAA 4MGRA 4IF4A 1R23A 3BP8A 4BHBA 4EV0A 1HXDA 1TQIA 3ML6A 3DP7A 2VN2A 4ZYGA 3S04A 1S7AA 2VONA 2CO5A 1Z6RA 5HS9A 1SMTA 1YS6A 2Z33A 1IXCA 2H6BA 2IVMA 2HZTA 5ICEA 4O6JA 2BE5F 1QGPA 1KCAA 1KGSA 2K86A 2EK5A 1XGOA 1SFEA 4KN4X 4UV8A 2BBYA 5E1WA 3TO7A 3CJNA 3L2CA 3BJAA 1SD6A 3WTTC 2GXGA 2L01A 3J81K 5BPIA 2RKHA 1WQ2A 4L0YB 2QBYB 1PUEE 4KICA 3GF2A 2D1HA 1JGSA 3JTHA 5LGUA 2FU4A 3C3WA 3ERED 2RC4A 1E2XA 1B59A 5CVUA 2JRTA 3E5XA 2VBXA 3JW4A 4Y13A 5JI6A 1DDNA 4EM0B 3ZP5A 3GFIA 3WE2A 4QLCU 2HFHA 4IRHA 1USSA 5J8FA 2DQLA 1G6NA 2D45A 1OYWA 1ULYA 4RB2C 5LGTA 3FM3A 3KZYA 2L3DA 1P92A 5KVRA 1B4AA 3E6CC 2TDXA 1SMYF 4Q5SF 3PQKA 2IW5A 1ZGJA 1S8NA 4KIFA 1FLIA 1TQPA 4YFXF 1MDMB 2FJRA 2M5WA 3E5QA 3I54A 1MKMA 1XMKA 2K27A 3HTUA 1I6XA 1KQ8A 2GA1A 4KIGA 3BOQA 2VODA 2O03A 5JR3A 2P8TA 1Z6TA 3T5XA 1LDJA 3L09A 2XUBA 3L7WA 2DK5A 3LAPA 2KKOA 2GA2A 4F7ZA 5TJJA 2P6SA 4MEXF 2ZBKA 2V1XA 1TNSA 3WODF 4HBLA 2A69F 3FHZA 3CUQC 3LA7A 2O6GE 2UZKA 1GVJA 3GX4X 2RDPA 3I5UA 4AIHA 4B8XA 1QO0D 4A0ZA 1KYWA 3DEUA 5HOOA 3GZ5A 3RYRA 3ULQB 4GYIA 2QENA 1R36A 3HYIA 5D5VB 2STWA 2G7HA 4LFUA 2MH2A 2W24A 4KMUX 1P4AA 2J5PA 5EEGA 3LWFA 1G4DA 1IAWA 4YFKF 4B09A 4OIRF 2X4HA 1GXPA 2ZMEB 4U7DA 1B1BA 3Q9VA 4A0YA 2H27A 5HLGA 4A6DA 2R7DA 3WTVC 2O61A 1J0RA 3GFLA 1JHFA 3SQNA 5L3EA 2XAFA 2K02A 4ZYEA 1MDMA 2FBKA 3DFGA 5ILSA 1T38A 4IXAA 2FRHA 3GLXA 3PQJA 2HS5A 2ELHA 4HF0A 1D8JA 2HYFA 2EFNA 3VEPA 4MTEA 2NNYA 4LLLA 3MQ0A 2DAOA 4RB1A 1KQ9A 3E6BA 3C18A 3ZPLA 1DPRA 1R1VA 3WTYC 2KIUA 4M73A 5LBQA 3CO6C 2DW4A 2PI0A 1D5VA 3RTRA 5LHIA 5IT9K 2A61A 3P7NA 2B0LA 3QPTA 1FYKA 5DEQA 3JSPA 2FBHA 4HQEA 1XCVA 5CLSA 4MQ9F 2IA0A 1D8KA 2A68F 4L0ZB 1J59A 3FMRA 2ZCWA 1E17A 1TLHB 2DQRA 3F21A 4M6YA 3J81Z 5FGMA 1TW2A 3PFIA 3LA2A 4CICA 1FZPB 3K1MA 2LF8A 2Z9OA 5J6XA 4LGWA 4S04A 4L18B 2DK8A 2HTSA 3I59B 1SFUA 2M8EA 1LDDA 3HRUA 4U0WA 4YFNF 1AWCA 1OR7A 2VC1A 1K78A 1FP2A 2LDUA 5E1XA 1RNLA 5FO5A 3O2PE 4MHGA 3F6OA 1U5TC 5JFRA 4LB6B 3L9FA 2P6TA 2VBYA 1KU7A 2V79A 3LFKA 1PP7U 3CDHA 4EM2A 1ZRCA 3KEQA 1HQCA 4EJTA 1XSVA 4HF1A 3F22A 1CF7B 1XMAA 3Q9SA 2HWVA 1IN8A 3QP6A 1B6AA 3KETA 1FWZA 3RYPA 2K4BA 3VFZA 3ABUA 4ZH4F 1QQIA 2ZO4A 3N97A 2M30A 3ABTA 1S29A 2KJBA 4KNYA 3RKWA 1FP1D 4XSXF 3C7JA 2DPDA 1FYMA 2D2WA 2P5VA 5BPDA 3RDIA 2G7UA 2XKPA 2OU2A 2NAZA 1ZN2A 5IT9Z 4HQMA 3K1NA 1QPMA 2Q2EA 4I09A 4G6QA 1YYVA 2NNNA 1BN5A 4BHCA 2QQ9A 3FM5A 5HS7A 1LEBA 1EH7A 3T8TA 4Y15A 4U88A 1XGMA 2V1UA 1KU3A 4NB5A 1HKTA 3QAHA 2A5YB 2Z99A 5A2QK 3E6DA 2J5OA 2QQAA 2CG4A 3F8NA 4CDGA 3K0LA 3RI4A 1PDNC 3IKVA 4IVNA 4A6EA 3WU0A 4JK1X 5E8IA 1HW2A 4RAYA 1SD7A 2CYYA 1W7PB 2EV5A 3M8EA 3GXOA 1Z1DA 1SFXA 3R0JA 1JHEA 1BI2A 2JTVA 2NS0A 4MEYF 1I5ZA 3E97A 3S2WA 5ICCA 2EA2A 1LDKB 2JSCA 3L00A 4M74A 1ZLJA 4GO1A 2LF7A 2PBIA 3KP2A 2PJPA 5CVRA 1MJAA 5K1YA 2HKXA 1XD7A 4OIPF 2YU3A 2W25A 5LEKA 4LG0A 4OMYA 3R4KA 1U2WA 1IF1A 2F5FA 3DF8A 2P5LC 2XRNA 4FX0A 4P9FA 1QZYA 2WTEA 2BV6A 2ZKZA 1ON1A 2ZNZA 4G7ZF 4IHSA 2DT5A 1QNTA 1SD5A 1LB2A 3C1DA 3DKWA 2HKOA 2H09A 4S05A 4M9XA 5D6EA 1G3YA 3OOPA 2LKPA 1Z7UA 4IRIA 2JT1A 5ICFA 1O7LA 1TBXA 4BNCA 4A5MA 3HSEA 4M6XA 2M45A 2VXZA 5K5OA 1HSJA 4HA8A 3TO9A 1IXRC 2YR2A 1ZYRF 2MA3A 5HDGA 4HAMA 3ISPA 3H3UA 3LSTA 3HTSB 5DCMB 1IW7F 1AY9A 4Q4ZF 2M87A 3LA3A 3ECHA 3Q5FA 2XGXA 4I7HA 2KIMA 1F9NA 3V7SA 1FY7A 4CZZA 1O3TA 3TO6A 4ON0A 4RGUA 3WGIA 4RGRA 4IHTA 2O0YA 1WSUA 5LRRA 3U1DA 3KLNA 2GIVA 4E70A 4CO8A 5J8CA 3QU6A 2P7VB 3H92A 2PFBA 5HLHA 3P9IA 2R3SA 2BEOA 4L9JA 2A07F 2YX7A 3HSFA 3QRFF 3GW2A 2HGCA 1YS7A 4WXCA 5BOXA 2XKOA 2GXBA 1X3UA 4EQQA 4L5JA 3R60A 3E5UA 2ISZA 3EQLF 1J9IA 2MH9A 4A12A 4WX9A 5F64A 5F1RA 4CYDA 1FBQA 3LQQA 5D8KB 3TOBA 2OA4A 2CFXA 1KQ0A 2DTRA 3COAC 3HOSA 3GO5A 2OQGA 2IPQX 1USTA 5CYVA 1VTNC 4P96A 1BC8C 1LNWA 4NV4A 1WKMA 4I98B 3WE3A 3WG9A 3O6BB 2XHKA 4ENJA 1I4VA 1K7AA 3MZYA 5LEJA 4EJWA 3MZHA 1XDUA 2F5DA 4N9IA 2DFIA 3R6SA 1U5TB 3EDPA 5CVJA 3EUHA 3VB2A 3IIQA 3J80Z 3CUOA 4EGZA 2LSOA 4HV6A 5D6FA 3SXYA 2X0LA 3MWMA 2OZ6A 3QU3A 1R5HA 4ESFA 3CUQA 5DD8A 2P7CB 2ZFWA 4KIBA 2FSWA 3B73A 2XV4S 2VT2A 2IJLA 1FX7A 2FA5A 3HHHA 3ZQ7A 2OD5A 3BJOA 3ZMUA 3KLOA 2ZXJA 1T6SA 4PGHA 1O3QA 2EV0A 4GGGA 3U9GA 5HS8A 1B9MA 2E7XA 3H3ZA 5ICGA 2COMA 4A5NA 2ESHA 1BJAA 1OPCA 4UHTA 4LJZF 3BPXA 4HDVA 2QLZA 4ZYDA 4RB3C 2ADUA 3F3XA 4LMYA 1MJBA 2EA4A 3K69A 3E3VA 2MC3A 4UNOA 3I0TA 3EETA 1LVAA 3I53A 1JXSA 5L3FA 3WGHA 1CGPA 4I0AA 3ZN1A 1Y0UA 1SD4A 1DP7P 2STTA 1SAXA 3REOA 3IHUA 2EWNA 2OZUA 2RQPA 2LNBA 4N31A 5CJ9A 1D3YA 3F8MA 1V4RA 2E7WA 3V8LA 3WTSC 2DPUA 2FNPA 2OQRA 4FHTA 2A3SA 1IN4A 2HR3A 1I1SA 5DV5A 2A6EF 5TRDA 2V1DA 4KFCA 4ZZLA 5BQTA 3RPUA 2D1VA 2Q0OA 1TTYA 1UHMA 1KN9A 1YIOA 1WWXA 4HZFA 1XGNA 3P9KA 5FB2A 3GVAA 3BWGA 3V7RA 4ENMA 2XIGA 4PZJA 5BS6A 3KP3A 2E1CA 1YW8A 2BGCA 2FBIA 5LLQA 4HF2A 1W5TA 1T98A 4XLPF 1BIBA 2CQKA 3KP6A 5A2QZ 5K5RA 4LG0B 3FMQA 5HVQC 2BYVE 4ME8A 3FXQA 4ENNA 5ERIA 1ZG1A 1UCRA 3U2RA 1HW5A 2NYXA 3ZMTA 4G8XA 1YG2A 1UFMA 5E1ZB 5ILUA 4EJVA 2WV0A 1BIAA 1Z91A 5AIQA 4UVBA 3M8FA 2XAGA 1IRGA 3T1BA 4LLGF 1BI0A 3IC7A 2AS5F 2PN6A 4RGXA 3FXUA 4JQFA 2O3FA 1NHAA 1DUXC 4U0YA 4NHJA 1HW1A 3V7CA 4RAZA 1LEAA 3D0SA 2KJCA 2FXAA 1S3JA 2JPBA 3V8KA 2Y48A 5D5UB 2Y0MA 3E6MA 3FMSA 1STZA 3T8RA 4KYWA 4ZYHA 1HSTA 3MEXA 3JAMK 1YLFA 1U78A 2QZ8A 1ZG5A 3WTXC 2XAQA 2RV8A 5DYMA 3M7GA 1FOKA 1R22A 4K8WA 4AVPA 1ZLKA 4I02A 3IWZA 1YTYA 2ISYA 3IRQA 4YIIA 3KFWX 3MCZA 4UXNA 4UVCA 1P4WA 2KRFA 3NEUA 1R58A 1L3LA 1I27A 3QP5A 1U5TA 3D5LA 1IZ1A 1F4KA 5D5XB 1IUYA 3GEZA 1G3SA 1LJ9A 1IN5A 2EV6A 3V8JA 1T0FA 2H94A 4HX8A 1U3EM 4G94A 2JZYA 5JVTA 2YSRA 1FT9A 4IRGA 5E18F 2V9VA 3F8FA 4Y17A 2HDCA 4HW0A 2E1NA 5LGNA 1FBSA 4LD5A 3J7AO 1HKSA 3EYIA 3CUQB 2RVCA 4AD9A 1T39A 1BI3A 1RIOH 3F6VA 1K78B 3BROA 4L9NA 4BH9A 1KU9A 5HDKA 2F5EA 5D4RA 2GAUA 2W57A 3RJPA 1JHHA 4FX4A 1RI7A 4WXDA 2VE8A 2AXLA 4OIOF 2DO7A 4KA4A 2FQ3A 5BMZA 5D5WB 1R1UA 4DQ2A 1XCBA 2XAJA 3P9CA 4OU0A 4RGSA 1FC3A 4RS8A 3LAJA 4KDPA 1BI1A 2P4WA 1MJ9A 3BZ6A 1P4XA 4UUVA 4EMSA 4UVAA 3IWFA 2QVOA 1DPUA 1K6OA 2L54A 1YO5C 2NRAC 3BDNA 4I2OA 4Q48A 1GHCA 4BHPA 2VT3A 1FYLA 1UMUA 3SZTA 5E20A 1R7JA 4JBAA 3DXJF 5FFXA 1IXSB 5K5QA 5DCMA 4G6DA 4HYEA 3GWZA 1ZARA 2KIFA 4CGZA 1H0MA 3FXRA 1OMIA 2VE9A 1H9TA 1J75A 3HIFA 1B9NA 2VC0A 4WXHA 3GUDA 6PAXA 4LLNA 2HQRA 1C0WA 1KA8A 5JHUA 2W84A 4YG2F 3B02A 1O7FA 4N0BA 3TKYA 2ZMEA 3AAFA 1O3SA 3ZN0A 1Z05A 1G3TA 2PEXA 3F72A 3CLOA 2FEZA 4L9TA 3WTZA 3FX3A 5DUKA 1WI9A 3ECOA 2IRFG 1U8RA 1FBUA 1ON2A 4QWQA 4H0EA 4N9HA 4HX7A 2IP2A 4ESBA 2F5CA 1ZH5A 4BAYA 2Z3YA 2OBPA 3TOAA 1F5TA 2EFQA 1H9GA 1ODDA 4YIFA 1JE8A 4P55A 1EV7A 2L02A 2K7LA 1OKRA 3GYHX 5HLIA 2C6YA 1XB4A 2UWMA 1BM9A 4HLXA 4Z2YA 1QBJA 2HO0A 2GWRA 1W4MA 4PCQA 1UB9A 1TQMA 2HYGD 1TNTA 1TW3A 4EGYA 1J5YA 3FF5A 5EEHA 3N4MA 1AOYA 3BDDA 5AIPA 1PP8F 2YPRA 1REPC 3MFKA 3IKTA 2PMHA 1ZREA 4P9UA 2YX4A 1O57A 5H6QA 3DPLC 3KEOA 4NQWA 4RB0A 2IA2A 4MQVA 3HOTA 4Q47A 3DPTA 5HDNA 5CVIA 3HSRA 1IN6A 3QPHA 5ILVA 3LQRA 1FSHA 1P2FA 5KK1A 5L3GA 5L3CA 5FLXK 5E17F 1IN7A 3TDZC 2PG4A 4A2UA 5DD4A 1W7PA 4M9ZA 3W6JB 4ESJA 2F2EA 2DLLA 4EJOA 2QM3A 1MGTA 1P6RA 4XSZF 3TDUC 3HUGA 2MD5A 3WGGA 2CW0F 1GXQA 1JHCA 1RUNA 3ZMVA 4G7OF 4CHUA 4KMFA 2ETHA 4GCVA 1FPQA 3ELKA 5D8LB 5DUIA 4WK8F 1F39A 2ESNA 3M1EA 3JAMZ 3HHGA 1J7KA 4OOIA 2Q8KA 1OYIA 4L9VA 4UV9A 3SHFA 3TGNA 4ENKA 4M9SA 4LK1F 3RKXA 2VOPA 3SZPA 4OMZA 2ZNYA 2CSOA 3J80K 1KYZA 5FD6A 3K9TA 3HRTA 3WU1B 1V3FA 1IRFA 4XBFA 4MTDA 2IT0A 3HRMA 2K4JA 1CF7A 2OAZA 1W5SA 4KN7X 4PDKA 4FT8A 1XSXA 2JPCA 1LQ1A 4XLNF 2PMUA 1W7PD 3KCCA 2XROA 3KP7A 4KT5C 5AONA 1WRJA 5L3DA 1U6GA 3IL2A 4U0VA 3F23A 3CO7C 2HEOA 1FSEA 5FLXZ 4WF2A 3I59A 2EFPA 3KE2A 2WWYA 2UXXA 4CXFA 2FMLA 1L0OC 3I71A 5H20A 1ONVA 1HBXG 4GYGA 2WC2A 2XASA 2CWEA 5D4SA 2VOOA 4XRFA 1ZRDA 5LHGA 1R00A 4OINF 1ZG3A 2G9WA 3EYYA 3I58A 1KU2A 3K1PA 4HLYA 4KUMA 1QZZA 1ZRFA 1G3WA 3HRSA 3SFZA 4WCGA 4EM1A 1RUOA 4LK0F 3KP4A 2UXNA 2DI3A 4A0XA 5ED4A 4L5IA 3F8CA 4PGGA 1MD0A 3ZMDA 2FF4A 4R8HA 4R79A 1Z9CA 2DU9A 5F6FA 1OYYA 1EH6A 1I1GA 4TV7A 4AIJA 3T0YA 3CTAA 3OV8A 1FNNA 2FKDA 2QYOA 2Y75A 1XSDA 2GZWA 3NRVA 4G7HF 2O8XA 2PQ8A 3ZMZA 1YW9A 3G73A 3M9AA 2VBZA 4P5OA 1MZBA 4ASNA 1B12A 2EFOA 5L3BA 3BPVA 4DNCA 1BC7C 5DDGA 2GQQA 3G3ZA 2VBWA 5DCFA 1XDSA 4ETSA 3GFJA 3DV8A 3ROUA 4LB5A 3R0AA 2MLGA 1YFHA 3ZMSA 1EH8A 2ACJA 2V6CA 5H6RA 2P5KA 3K2ZA 4HV5A 2HQNA 1ZGAA 3I4PA 1YQAA 1XGSA 2XVCA 3JTGA 1T7DA 1BBYA 4I01A 2EFWA 2FE3A 3GZ6A 4BQAA 5E8GA 2R7FA 5CVVA 3KZZA 4BYYA 1R1TA 3VODA 1ZHFA 4HDUA 4M71A 3NQOA 4R1HA 2M1BA 3I64A 3BJ6A 3GFMA
chains in the Genus database with same CATH superfamily
4IHWA 2HTJA 4IQJA 3KEYA 2QUFA 3IRRA 4HNUA 2ZXHA 2GM4A 1W1WE 2LK2A 4O3MA 4JX4A 4GXOA 3WTWC 2KL4A 4XIDA 2M4GA 3TP3A 2IA1A 2BVMA 3LSJA 3A1YA 3O3KA 3TW7A 4K2EA 2ZJ2A 3QYFA 1YW7A 4OIQF 4W1UA 4O5VA 4HX4A 4D0PA 5EYRA 4IL6C 2QCOA 3WTUC 4HOBA 3V4GA 1K4TA 3C2BA 2NXNB 3G71I 1S6LA 2FOKA 2EB7A 5LHHA 3LNQA 3W6KB 4PJMA 3QOPA 2PLYA 2DA3A 3RSNA 2L4MA 4A3KJ 2VQGA 1T2KA 4IPAA 4IQ4A 5H2FC 2QBYA 1PVEA 2DOFA 5IY5H 1IV6A 1J2XA 2W85A 4XLHA 1HKQA 3IH2A 2MGQA 1VQNI 4DZJA 3HM5A 5HLTA 3DQVC 3U1KA 3BR6A 2FMYA 5FFZA 2W7NA 3FWEA 2E35A 1UHWA 4BQQA 4CCLA 4AIKA 3U21A 2QWWA 1R5GA 3R61A 2BHZA 2FNAA 5FKKA 5GADJ 1ETOA 2XAHA 3RIRA 4IHVA 2HNFA 2HOEA 1X2MA 1O3RA 4WWCA 2R5YB 2RN7A 1XTAA 4B3AA 5DTDA 4XN0A 5FD5A 1IRZA 3JRIA 1S7OA 2EIMH 4EJUA 3OYBA 2MBFA 2M3AA 4AWXB 3JSOA 1H8AC 1QVTA 3KP5A 3BY6A 5LRSA 2X1DA 5GPCA 2MLKA 3FZVA 2QEXI 4NC7A 2M34A 2CJJA 3HC7A 1ZAOA 1A04A 4U7BA 1V5GA 1Q1HA 1OISA 3VOEA 5GTHC 2DBBA 2JRMA 2RNJA 1F1ZA 1K79A 5EJCA 3MAJA 1Z3XA 1FTZA 1Y6IA 3RKYA 4EVIA 2CGPA 1XN7A 3CJQB 2M7BA 4IJAA 1WH7A 2ZXWH 4BXUA 2EJRA 2H6CA 4MNUA 4RM2A 4M72A 4BDZA 2A6HF 4NC6A 3M3YJ 3A03A 3RPQA 1JUPA 1EA3A 1RZ4A 2L4AA 2Z5UA 1UHSA 4ZZDA 5IT3A 2XSDC 3F8BA 4I0BA 4BU2A 4DYCA 2RGVA 2X48A 2HZDA 4G9YA 1N75A 3CMYA 3TQNA 5IYDJ 2LD5A 2GXAA 3OYGA 2QQBA 3C2GA 1BOAA 2V1NA 3FXJA 1I39A 3QYBA 3OS0A 4MGRA 3FXMA 1VQMI 4IF4A 1R23A 3BP8A 3GTPJ 3K4NA 4BHBA 2ICWG 3W2VA 4EV0A 4B47A 3ZQHA 5EDNA 3ZQFA 3ABKH 1HXDA 3ZRGA 1TQIA 3ML6A 1PUFB 3DP7A 2VN2A 4ZYGA 1W36C 1S7AA 3S04A 2VONA 4XORA 2CO5A 1Z6RA 1UJ8A 3OYHA 4XNFA 3OS2A 1HDPA 3I4MJ 1VFCA 5HS9A 4C9YA 1SMTA 5B1AH 3CF5F 4A3IJ 4BY1J 1YS6A 3HKZN 1E3OC 2Z33A 4AC0A 1IXCA 2H6BA 4ZDLA 2IVMA 5IPAA 1PUFA 3H5NA 4BBRJ 2HZTA 5ICEA 5JLXA 1A6QA 2ECBA 5K7ZA 1D0XA 3FBNB 4O6JA 2BE5F 1SFKA 1TC3C 1QGPA 1KCAA 1KGSA 1UG0A 1SC7A 1G8XA 2K86A 3OYKA 2EK5A 2IEKA 5JLWA 1A31A 1XGOA 1SFEA 2R5YA 4KN4X 2EIKH 2BBYA 4UV8A 2LFBA 4IOAF 4XRMA 5E1WA 3TO7A 3DBRB 3S32A 2DT6A 3CJNA 2OCEA 3L2CA 3BJAA 3HUGB 1SD6A 3WTTC 3K7AJ 5DS9A 2GXGA 3S1MJ 5EEAA 3MN2A 2L01A 3L2QA 3J81K 5BPIA 3GTMJ 2EZHA 2RKHA 3Q3SA 1WQ2A 1MBJA 4L0YB 2QBYB 1PUEE 3A02A 1YI2I 5J47A 4KICA 3GF2A 2M0MA 4PJNA 4IKFA 2D1HA 1JGSA 1G59A 3JTHA 2QKLB 3QPLA 2FU4A 5LGUA 3C3WA 2DMPA 5F0CA 1U9NA 1R71A 5IYBJ 3ERED 2RC4A 1E2XA 4LOCA 1Y1WJ 1B59A 5CVUA 2JRTA 3E5XA 2VBXA 3JW4A 4Y13A 5JI6A 5E3NA 3J7ZI 1DDNA 3HOYJ 2DJIA 4EM0B 2PX9A 3CCQI 3IH3A 1WGXA 3ZP5A 1HA8A 1W36D 3BTJA 2FX0A 2LLKA 3GFIA 2VL8A 3H9JA 5GP9A 3WE2A 4QLCU 2HFHA 4IRHA 5F27A 1Z21A 1USSA 1D0ZA 5J8FA 1I50J 1SVOA 4B4CA 2DQLA 4PSWA 4PSXA 3ASNH 1G6NA 2D45A 1OYWA 2Y30A 1ULYA 3Q0VA 4RB2C 5LGTA 3FM3A 3KZYA 4OAZA 5GTIC 2L3DA 3OR1C 3VSLA 2JA6J 1P92A 4XM3A 2HXOA 5KVRA 1S7EA 1B4AA 1OLTA 2VQCA 1MH3A 2TDXA 2WA0A 3E6CC 1SMYF 1QA6A 3EUHC 4Q5SF 3PQKA 3V42A 2R92J 2QQ8A 2IW5A 1ZGJA 1WJCA 1S8NA 3IV5A 4KIFA 3DKXA 1FLIA 1TQPA 4YFXF 1MDMB 2FJRA 2M5WA 3E5QA 4DJAA 3I54A 1MKMA 4D9JA 1XMKA 2KP6A 2K27A 3HTUA 4BDYA 3QQAA 1I6XA 1VI0A 1KQ8A 4D1QA 1SVLA 1RR7A 2GA1A 3PSIA 2HVQA 4KIGA 5KAFC 3RKQA 3BOQA 2VODA 5FKMA 2O03A 5JR3A 2P8TA 3OL4A 3LSHA 2EZIA 1YRNA 1Z6TA 3T5XA 1LDJA 3L09A 2XUBA 3L7WA 2L5QA 2DK5A 3LAPA 1R4NB 2KKOA 2GA2A 1MSEC 4F7ZA 4XK4A 5TJJA 2X51A 1Y1VJ 2P6SA 4MEXF 2ZBKA 2KLOA 2V1XA 1TNSA 3WODF 2ZMEC 4HBLA 5KHDA 1I3AA 1G2HA 3FBIB 2A69F 3FHZA 3CUQC 3LA7A 2R7OA 4PJJA 2O6GE 4JX6A 3Q0UA 2UZKA 1GVJA 3GX4X 2RDPA 5M3FJ 3I5UA 2CV0A 4AIHA 2LBFB 4B8XA 1QO0D 4A0ZA 2R7WA 4XONA 3H9QA 1KYWA 3DEUA 2DODA 5HOOA 3GZ5A 3RYRA 3ULQB 4GYIA 2IGMA 1MBKA 2QENA 1R36A 2V26A 3H1CA 3HYIA 5D5VB 2L7ZA 2CW7A 2STWA 3CCSI 3GTLJ 3CDLA 2G7HA 4LFUA 1VZ0A 2MH2A 1LVKA 4E4HA 1N78A 3BC8A 2W24A 4KMUX 2BXZA 1OQYA 1P4AA 2PMZA 3J7YJ 2J5PA 5EEGA 3GMEA 3O8HA 3LWFA 1G4DA 1IAWA 4YFKF 4B09A 4OIRF 2X4HA 1VQPI 1GXPA 2Y69H 1ENHA 2ZMEB 2CS3A 3HPGA 4U7DA 2R5ZB 1B1BA 3Q9VA 4A0YA 2OCCH 2H27A 1ETVA 4A69C 5HLGA 2M8GX 3W2WA 3FISA 2AQEA 4A6DA 5FJ8J 1RESA 3KYDB 5J1UA 2R7DA 3WTVC 3CCEI 3CESA 2O61A 1X2NA 1TWCJ 2ZFUA 4C3HJ 4BUPA 4V2GA 1J0RA 3DLAA 3GFLA 5F0HA 3G6EI 3S15J 1JHFA 3OYDA 4XKCA 3S1RJ 3SQNA 5FKOA 2XAFA 5L3EA 2K02A 2RAEA 3VYSB 2IXSA 3BQZA 3CQZJ 4ZYEA 1MDMA 2FBKA 2KMUA 3DFGA 5ILSA 2HYJA 1T38A 1IUFA 2F4MB 3W3CA 3CD6I 2Y31A 4IXAA 2FRHA 3DU6A 3TL4X 2CUEA 3GLXA 3PQJA 4CCNA 2HS5A 2ELHA 4HF0A 2OC6A 1D8JA 2HYFA 3BLYA 4FISA 2EFNA 1APLC 3VEPA 4MTEA 2NNYA 4I76A 4LLLA 3G4SI 3MQ0A 2DAOA 5F1JA 4RB1A 1ZGWA 1KQ9A 3E6BA 3FIWA 3HPHA 2QSGX 3C18A 3ZPLA 1DPRA 1LE8B 2VXDA 2WB1A 1R1VA 2DMNA 2WY7Q 3WTYC 3BTIA 3G1LA 3CJTB 4HNTA 1ORKA 4RDUA 1OCPA 4BJTA 2KIUA 3ZQCA 4M73A 2NVYJ 5LBQA 3CO6C 2DW4A 4E6KG 2PI0A 3E0JB 1D5VA 2X6YA 5IP9J 1Z7LA 3L1PA 3RTRA 5LHIA 3CMAI 4FASD 1ERDA 4YIRX 5IT9K 3O8GA 2A61A 3P7NA 3CLQA 2B0LA 4AU7A 1WFXA 3QPTA 3VSKA 1FYKA 2FBHA 5DEQA 3JSPA 4HQEA 1XCVA 2ZSIB 5CLSA 2LREA 2OPTA 4MQ9F 1X1PA 2IA0A 1D8KA 2A68F 2B63J 3KZIC 1WJAA 1Q1VA 4L0ZB 1J59A 3FMRA 2W00A 2ZCWA 1E17A 2L9NA 1TLHB 2DQRA 4PUSA 3F21A 2RREA 2X1EA 4CYCB 1R4MB 5CQGA 4M6YA 3J81Z 3W6VA 5FGMA 3WG7H 1EJ9A 2X6XA 4E7HA 1TW2A 3PFIA 3LA2A 4CICA 4F91B 3OYMA 1W0TA 3PO3J 1FZPB 3K1MA 1WZ2A 2LF8A 3IAS2 1MBHA 2QSFX 3BG5A 3E1SA 2Z9OA 5J6XA 4LGWA 4S04A 5J1YA 3MKYB 3HDDA 2DK8A 4L18B 2ZC2A 3CP2A 2HTSA 2JJ7A 3I59B 2MFZA 3RPUD 1SFUA 2M8EA 2LH9A 2JVGA 1DGWY 1LDDA 3HRUA 4U0WA 2AXTC 4YFNF 4E7KA 1AWCA 2R7VA 4D5CA 4X6AJ 3OMYA 1ETXA 1OR7A 3DPUA 2VC1A 1K78A 1FP2A 2LDUA 2VLAA 5E1XA 1RNLA 5FO5A 4B48A 3O2PE 3SFIA 4MHGA 1X58A 3F6OA 2HPMA 1U5TC 3WU2C 1Z0XA 5JFRA 5FRMA 4LB6B 4KITB 1RR8C 3L9FA 4E7JA 1BW5A 2HXIA 3GTKJ 2P6TA 2VBYA 2DOAA 3OYNA 2DMTA 1KU7A 2V79A 2OV7A 4ZC3A 3LFKA 2VASA 1PP7U 3CDHA 4EM2A 1ZRCA 2EZLA 3KEQA 5EG0A 1HQCA 4EJTA 1XSVA 4HF1A 3OSFA 3F22A 1CF7B 1XMAA 3Q9SA 2HWVA 4RAGA 1W0UA 1S9HA 3H5AA 1HLVA 4JX5A 2ZSHB 1IN8A 2ZJQF 4CSWA 3QP6A 1B6AA 3KETA 1VF9A 1FWZA 2Z1DA 4CCJA 4Z6YA 2DYRH 3RYPA 3NAUA 2VIXA 1YE9A 2K4BA 3VFZA 3ABUA 4D5FA 4E7ZA 4ZH4F 3PIPF 3CCLI 1QQIA 2X6OA 2ZO4A 3N97A 1I6HJ 2M30A 2IAIA 2NOGA 3ABTA 1S29A 2KJBA 1ZR4A 4KNYA 1VNDA 1JUSA 4FE7A 3RKWA 3PNTA 1FP1D 4BL0B 4N4NB 4G6TB 3C7JA 4XSXF 4NC8A 2KDZA 2K3FA 5M3MJ 2DPDA 1FYMA 2D2WA 1MMGA 2IGOA 2VUMJ 2VKHA 2P5VA 1FJLA 3JCUC 5BPDA 3RDIA 2G7UA 4IHYA 2XKPA 5F08A 2OU2A 1MBEA 2NAZA 1ZN2A 3KYLA 2F4OB 3AG3H 5IT9Z 1D1AA 1MMNA 4HQMA 2XC7A 3K1NA 1QPMA 2Q2EA 4I09A 5F0FA 1GDTA 2F6CA 4G6QA 4M3GA 1YYVA 2K9SA 2NNNA 2BY1A 2XAUA 3FKIJ 5KAIC 1BN5A 4UUSB 4BHCA 2QQ9A 3E7LA 3FM5A 5HS7A 1LEBA 3KX2A 5C3EJ 1EH7A 3T8TA 1NK2P 3CCMI 4Y15A 2LTPA 3FKJA 4U88A 1XGMA 2V1UA 1KU3A 1KZHA 2ME0A 4PFPA 4NB5A 1HKTA 3QAHA 1YJ9I 2DOEA 3OL3A 1MBFA 1MMSA 3CF2A 3HOZJ 3S2HJ 4CH7A 1FOXA 2A5YB 2Z99A 2VKDA 5A2QK 3E6DA 2GOMA 4CCOA 3CCRI 5FKLA 2J5OA 2QQAA 3FXOA 2CG4A 3F8NA 5JVGF 4LIVA 3OOUA 3K0LA 4CDGA 3RI4A 1PDNC 3IKVA 4IVNA 3S93A 2H8RA 4A6EA 3BTCA 3WU0A 2VJ5A 4JK1X 5E8IA 4BS9A 1HW2A 4RAYA 2HQ5A 3JRCA 1SD7A 2CYYA 1W7PB 2EV5A 3M8EA 2A5WA 2L2OA 2AQFA 5C44J 2P0WA 2O7OA 1Z1DA 3GXOA 1SFXA 3R0JA 1IO2A 1JHEA 1MNMC 1BI2A 2JTVA 2NS0A 4MEYF 1I5ZA 3E97A 3JRDA 3A0BC 3S2WA 5ICCA 2EA2A 2PJRB 1LDKB 2JSCA 5DM7F 2OF7A 3L00A 4M74A 1ZLJA 2CQNA 4GO1A 2LF7A 2PBIA 2Y0SN 2F48A 5K7HA 3KP2A 4IOCF 1V5EA 2PJPA 5CVRA 1MJAA 1WI3A 2L7FP 5K1YA 2R7RA 2HKXA 4IHXA 1XD7A 4OIPF 2YU3A 4CCKA 3OYAA 2W25A 3A4CA 5LEKA 4LG0A 4OMYA 2XB5A 3R4KA 1V5FA 1U2WA 2QA4I 3FXKA 1Z77A 1IF1A 2XF5A 4LIUA 2F5FA 3DF8A 2A05A 3OIPA 2P5LC 2XRNA 3MKLA 4BE0A 4FX0A 4P9FA 1QZYA 2WTEA 4XKVA 3TBIA 2BV6A 2ZKZA 3GTJJ 2H8WA 4NQWB 3AL0B 1ON1A 2ZNZA 4G7ZF 4IHSA 2DT5A 1QNTA 4II3A 4DOZA 4BKXA 1B72B 2QSHX 1SD5A 3L2WA 1YJNI 1LB2A 3C1DA 5EGOA 3M1CA 3DKWA 5B5EC 2HKOA 3JRFA 4A3LJ 2H09A 1RKTA 4M9XA 4S05A 3GTOJ 5D6EA 3VDXA 2R7TA 1G3YA 3OOPA 2V6EA 3D1NI 3HG9A 2LKPA 1Z7UA 4IRIA 2JT1A 2WV1A 3ABMH 3PO2J 5ICFA 4P1WA 2HDWA 1O7LA 1TBXA 4BNCA 4BY7J 3VYUB 4A5MA 3NWSA 3HSEA 4M6XA 5J40A 2DT7B 2M45A 2VXZA 4Y33A 4XRSG 2LC2A 4F3QA 5K5OA 1HSJA 1NG7A 1EKEA 2I10A 4HA8A 2LR8A 5J4VA 1FIAA 4AYBN 1ZQ3P 2JSPA 2HOSA 3TO9A 3BZCA 1IXRC 2XPUA 2YR2A 3MVPA 4W97A 1ZYRF 3AKZA 2MA3A 5HDGA 4HAMA 3ISPA 4UY8I 2VI6A 3F0CA 1EF4A 3H3UA 3LSTA 1MW7A 1RRJA 4JP0A 3HTSB 5DCMB 4FE4A 1IW7F 1E3PA 1FTTA 2PMZN 2M2EA 1X1BA 2WY8Q 1DP3A 1AY9A 3A2KA 1ZTRA 4Q4ZF 2M87A 4X0GA 3CDIA 4B43A 4BEHA 3LA3A 3ECHA 2MW8A 3Q5FA 2XGXA 4BACA 5DM6F 5CKTA 3ESWB 4I7HA 3JRHA 2KIMA 1F9NA 5HNHA 2E1MC 3V7SA 1FY7A 4CZZA 1O3TA 3TO6A 4D7MA 4ON0A 4RGUA 3WGIA 4MO7A 3QODA 4RGRA 4DW6A 4IHTA 2O0YA 2R7ZJ 1WSUA 5LRRA 3S3OA 5E3OA 4V2FA 3U1DA 3KLNA 2GIVA 4E70A 3A01B 4CO8A 4MFEA 4DBQA 5J8CA 3QU6A 1MH4A 2P7VB 3H92A 2PFBA 4U87A 5HLHA 3P9IA 2R3SA 3KPHA 2MG4A 2BEOA 4L9JA 2EIJH 3MD2A 2A07F 1ACIA 2X1CA 2YX7A 1Y0NA 3HSFA 2DFHA 3QRFF 2OTLI 2WAEA 2HU9A 3GW2A 2HGCA 4DYQA 2B7EA 2HNHA 4XOTA 1YS7A 3LSKA 4WXCA 5BOXA 4E7IA 2XKOA 2GXBA 1X3UA 4EQQA 4L5JA 3R60A 3E5UA 2ISZA 4XRSA 3EQLF 4IZZA 1J9IA 2MH9A 4A12A 5GPAA 4WX9A 1LKXA 1XPXA 5F64A 5F1RA 4CYDA 1FBQA 1WJEA 3LQQA 5D8KB 3TOBA 2OA4A 4HRIA 2ELKA 2W1OA 4I99C 2CFXA 2F5VA 1P7JA 1KQ0A 2DTRA 2OJED 3LSGA 2LYCA 3COAC 3HOSA 2DMQA 4NNJA 1D1BA 3GO5A 2OQGA 2IPQX 1USTA 5CYVA 3JRAA 1VTNC 4IO9F 2DJNA 4P96A 2Q1ZB 1BC8C 2LG4A 1LNWA 4S0HB 2K9NA 4HSTA 4NV4A 1WKMA 2BY3A 1TWHJ 3K70D 1B8IB 4I98B 5GAHJ 3WE3A 3WG9A 1S5LC 5E3MA 2L7MP 4KJZA 1ETYA 2ZXIA 2QKMB 2XHKA 2DFEA 3O6BB 4ANJA 4ENJA 1I4VA 1K7AA 4HEA2 3MZYA 2V9KA 5BNGA 3HL2A 5LEJA 3LOCA 4EJWA 2WB1N 3MZHA 1OCZH 1XDUA 2F5DA 4UB6C 4OWRB 1WPKA 4N9IA 2E2JJ 2DFIA 3R6SA 1U5TB 3EDPA 1YX5A 5CVJA 3EUHA 3VB2A 2DXIA 3IIQA 3J80Z 3CUOA 3JRBA 4EGZA 2LSOA 2QGUA 2KRCA 1JGGA 4HV6A 3KYCB 1JTXA 5D6FA 4ZTFA 3SXYA 2ZJPF 2X0LA 3MWMA 2OUMA 2W82A 5J4YA 1T33A 1OJLA 4FETA 2OZ6A 4C2UA 3SDBA 2ID6A 2G0EA 3QU3A 3L2UA 2Y2ZA 2JUGA 1IGNA 1R5HA 4ESFA 4C2TA 3CUQA 5DD8A 2P7CB 2ZFWA 3CMMA 3RZDJ 3FDYA 2IGKA 4KIBA 2FSWA 2E2HJ 2WAQA 1IJWC 3ZQLA 3B73A 3FK6A 2XV4S 2VT2A 2IJLA 5C4XJ 3GZNB 1FX7A 2FA5A 3HHHA 3ZQ7A 2OD5A 1H88C 3BJOA 3ZMUA 3KLOA 2K3PA 2ZXJA 3NWTA 1T6SA 4FTHA 4PGHA 1XS9A 1O3QA 2KPMA 2EV0A 4GGGA 2B9SA 4XKBA 3U9GA 1QHHD 5HS8A 1B9MA 1LUJB 2E7XA 3H3ZA 5ICGA 2COMA 4A5NA 2CH0A 4CUGA 2ESHA 1BJAA 1OPCA 3PFYA 4LJZF 4UHTA 1XX5A 1FOYA 4BE1A 3BPXA 2MABA 4HDVA 2QLZA 4ZYDA 3K4BA 4RB3C 2ADUA 3I3LA 4PJ0C 3F3XA 4LMYA 5K7FA 2K9QA 2XGDA 1MJBA 3OIQA 2EA4A 1FEXA 3K69A 3E3VA 1WJBA 3L2RA 2MC3A 4UNOA 3I0TA 3EETA 1LVAA 3I53A 5IOYA 3BG6A 2DDBA 1JXSA 2UUZA 5L3FA 3JREA 3GTQJ 2EZKA 3WGHA 4IX7A 1CGPA 4I0AA 4C3JJ 4A3MJ 3ZN1A 5FLMJ 2R7UA 4BXFA 4BXXJ 5E79C 1Y0UA 3CCYA 1SD4A 2CU7A 1DP7P 2STTA 2XRLA 4NDLA 1SAXA 1UMQA 3REOA 3IHUA 3PNYA 2EWNA 4XMYA 5FKNA 1NG6A 2OZUA 2RQPA 3X2QH 2RNGA 2LNBA 2K9MA 1SANA 4N31A 5CJ9A 1UELB 3BCBA 1LFPA 2DDAA 1D3YA 2LY2A 3F8MA 1V4RA 2E7WA 3V8LA 1JT0A 3WTSC 1T56A 2DPUA 2FNPA 2OQRA 2VKEA 3I56I 4FHTA 1X4PA 3Q0WA 2A3SA 3BG9A 1IN4A 2HR3A 1I1SA 3PL8A 5DV5A 1GV2A 4M3EA 2A6EF 5EF6A 1YIJI 2HDDA 2JVHA 5TRDA 2E71A 2V1DA 4HSRA 4QPOA 4ZZLA 4KFCA 1Y8RB 3B6CA 3RPUA 5BQTA 1JKOC 1ITYA 2D1VA 2JN6A 5F04A 2Q0OA 4N4OB 2BW3A 1TTYA 3VYRB 1UHMA 1TZLA 5M5XJ 1KN9A 1YIOA 1WWXA 4HZFA 1VQ7I 2M9HA 1XGNA 3DBHB 3P9KA 3SEQA 5FB2A 3GVAA 3BWGA 2K5CA 3ABLH 1B72A 3V7RA 2HOAA 4ENMA 2XIGA 4PZJA 5BS6A 3KP3A 2E1CA 2BXYA 3BG7A 1SVMA 1GT0C 1YW8A 2BGCA 2FBIA 5LLQA 4HF2A 1W5TA 5J3LA 1T98A 3HB9A 4XLPF 1BIBA 2CQKA 1X1CA 3J7AY 3BT9A 2V9PA 1YX3A 5FLVA 3KP6A 1QHGA 4G12A 5A2QZ 3FHNA 3S3NA 1TL8A 5K5RA 2K9LA 3D5SC 3K4CA 4LG0B 2Y9ZA 3FMQA 5HVQC 2BYVE 2DN0A 1YJWI 4AM3A 4B1RA 4A3GJ 3HGGA 3N05A 4ME8A 3FXQA 2R7XA 2ZB9A 4ENNA 2CQQA 5ERIA 3ERMA 3HKZA 1ZG1A 3ZR8X 3DTKA 3M8JA 1DU0A 1UCRA 2XGEA 2XSJC 2EINH 1HW5A 3U2RA 2KISA 2NYXA 3ZMTA 4G8XA 4XLAA 1YG2A 1UFMA 5E1ZB 5ILUA 4EJVA 3QPSA 2WV0A 1BIAA 1Z91A 3UR3C 1V55H 2DYSH 3S8PA 2I5UA 3MKZA 4ZYAA 1BW6A 5AIQA 5E3LA 2E1OA 4UVBA 3M8FA 1JKRC 4EEFG 2XAGA 1IRGA 2CV2A 3T1BA 1TWFJ 4LLGF 4J00A 2IS4A 1BI0A 3IC7A 2AS5F 4L5EA 1JT6A 1B8IA 2PN6A 4RGXA 2DA7A 1ETWA 3FXUA 4JQFA 2O3FA 1NHAA 5CPRB 3OWTA 1DUXC 3ASOH 4U0YA 4NHJA 1HW1A 4BJ5C 3V7CA 4RAZA 1LEAA 3ZCOA 1V54H 3D0SA 4RAFA 2KJCA 4ABZA 2DA6A 2FXAA 1S3JA 2JPBA 3V8KA 2EBIA 2KFDA 2Y48A 4M3BA 5D5UB 1JJ8C 1LPQA 2DMUA 2Y0MA 3E6MA 3FMSA 1QRYA 2K40A 1STZA 3H35A 1XMXA 3T8RA 4KYWA 2E2IJ 4ZYHA 1HSTA 2DA2A 4CCMA 3MEXA 3JAMK 1YLFA 1U78A 3PIOF 2QZ8A 4UUSA 1WHUA 3H9GA 1ZG5A 1NK3P 3WTXC 1A6IA 2WAQN 1NTCA 2XAQA 2FUG2 1PYVA 2Q2EB 3GCMA 2LMDA 2RV8A 1X3ZB 2EQRA 5DYMA 3M7GA 2D5VA 1DGRM 1FOKA 2NVXJ 1R22A 3HZJA 1JTYA 2JK3A 2VPRA 1Y39A 2VQLA 4K8WA 4AVPA 2XGCA 3TMOA 1ZLKA 4I02A 3IWZA 1YTYA 2ISYA 3IRQA 1AU7A 4YIIA 3KFWX 3MCZA 4UXNA 2TCTA 4UVCA 1P4WA 3CC2I 2A6TA 5JHFA 1WVRA 3DTEA 4CZCA 2KRFA 4V19K 5EZGA 3NEUA 4RBOA 1R58A 1L3LA 1I27A 4BQNA 4YRVA 3CP8A 3QP5A 2HI3A 1U5TA 1M1EB 5GAGJ 3QWLA 2JA8J 2LRDA 5M5YJ 1IRXA 3D5LA 1O4XA 2R93J 5HODA 1IZ1A 1F4KA 2MC4A 5D5XB 1OR7C 1IUYA 2H1KA 4F93B 2NS7A 5IOZA 3GEZA 4Y4RA 4BJ6C 1AKHA 1QPIA 3ONQA 2DA5A 1G3SA 1ZKGA 3IAM2 3ZQIA 2W4SA 3H5RA 1LJ9A 3OYCA 1IN5A 2EV6A 2BY2A 1QZEA 1T0FA 3V8JA 2E34A 4HPQA 4JYKA 5EG0B 2H94A 4HX8A 1N25A 4G94A 2JZYA 5JVTA 1U3EM 2YSRA 1FT9A 4IRGA 3WHBA 5E18F 1MIJA 4QTRA 4AIDA 2V9VA 3F8FA 2L9RA 1Y56A 1QU3A 4Y52J 4Y17A 1X1DA 2KHMA 4HW0A 2HDCA 4C2MJ 1FOWA 2E1NA 2VJIA 5LGNA 1FBSA 2HPIA 4LD5A 3HXLA 3J7AO 4ITVA 2BVLA 1HKSA 2CW8A 4ZJZA 1GV5A 3H0GJ 4PFOA 3EYIA 3CUQB 2RVCA 1IDZA 4AD9A 3PJRA 1T39A 1BI3A 1RIOH 1RC9A 2FJ1A 3F6VA 4M3FA 1K78B 3BROA 2LKXA 3BR1A 1WJDA 4L9NA 4BH9A 1KU9A 4AUXA 5HDKA 4MIMA 4B44A 2F5EA 5D4RA 4JOMA 2GAUA 3CMEI 3K10A 1T8IA 2XF7A 3IP4B 2W57A 3RJPA 1JHHA 4FX4A 1RI7A 4WXDA 2VKVA 2VE8A 2AXLA 4OIOF 2DO7A 4KA4A 2FQ3A 3H36A 5BMZA 5KNLA 5D5WB 1R1UA 3OIOA 4DQ2A 3MZ8A 4PK4A 1FMWA 3HOXJ 2E1MB 1XCBA 2XAJA 2BZTA 3P9CA 1WCMJ 4OU0A 4RGSA 1FC3A 1AA7A 4RS8A 5J1RA 2R7SA 3LAJA 4KDPA 2RQQA 1BI1A 2P4WA 1MJ9A 3BZ6A 1IG7A 1P4XA 4A3DJ 3C2HA 4UUVA 1HCRA 4EMSA 4UVAA 3IWFA 3UKGA 1AKHB 2QVOA 1DPUA 1K6OA 4A3JJ 3I4NJ 2L54A 3AG1H 4I6ZA 3OYFA 1S72I 3H3VK 4DIQA 3S14J 1YO5C 2NRAC 3S1QJ 4F55A 2BOLA 4I2OA 3BDNA 4Q48A 1GHCA 2L7KA 1GUUA 5B1BH 4BHPA 2LY9A 2VT3A 3GBGA 2WADA 1BJZA 2CUZA 2KQRA 4QSHA 3SZTA 2K85A 1FYLA 1UMUA 5E20A 1R7JA 3ZQQA 4JBAA 2BHYA 2IS6A 2EPFA 3DXJF 5FFXA 2JQ7A 4GRIA 4ZDPA 2JA7J 2DA1A 2ZJRF 3ZQGA 2LKSA 1IXSB 2I8DA 1T0FC 2CUFA 5K5QA 3LSMA 5DCMA 4G6DA 2VPLA 4IEJA 4HYEA 3GWZA 1K6YA 2ID3A 4II2A 1ZARA 4H4KC 2KIFA 4CGZA 1UZCA 4QPQA 5M5WJ 4AYBA 1H0MA 3NARA 2YS9A 3FXRA 1OMIA 2VE9A 4RA2A 1H9TA 1VQKI 1F43A 3HGYA 1J75A 5IYCJ 1BOBA 3S17J 3HIFA 1B9NA 3DTIA 1D5YA 2VC0A 1K61A 3IUOA 3G1MA 4WXHA 3GUDA 1UAAA 3H0DA 6PAXA 4LLNA 2Z2SB 1WH5A 2HQRA 2HVRA 1Z3YA 1C0WA 2F4IA 1KA8A 3KIOA 3A01A 3DLLF 3SJMA 5JHUA 2W84A 4M6VA 4BBSJ 4YG2F 1ZK8A 1O7FA 3B02A 4N0BA 3JRGA 3M4OJ 1DQUA 2CMPA 3PUBA 2MD0A 4ZDOA 3VWBA 5TGTA 2GBYA 4XLEA 3CC4I 1E0EA 3ZOBA 3TKYA 2ZMEA 2DTZA 1TT0A 5IP7J 3OS1A 1R6RA 3AAFA 1O3SA 3ZN0A 3DU5A 1Z05A 1G3TA 2PEXA 5EZHA 1VQ5I 3F72A 3CLOA 2FEZA 2CV1A 3W2AA 4L9TA 2O5RA 1OFCX 2NS8A 3WTZA 1ZELA 4C30A 3FX3A 3MMYB 4XKWA 3L2VA 5DUKA 1GLNA 1BR2A 3OYEA 1WI9A 3OYLA 3EPZA 4BE2A 3ECOA 4E7LA 3K2AA 4A3BJ 3BQYA 4UUTA 3AFHA 1HC8A 2IRFG 5C4JJ 1FBUA 4H0EA 1ON2A 4QWQA 2VJ4A 1U8RA 4N9HA 4E7SA 2HOTA 4HX7A 1OCOH 2IP2A 4ESBA 2F5CA 1ZH5A 3K4KA 2Y0SA 4BAYA 2N8GA 2GLOA 2X9DA 2Z3YA 4RM3A 2OBPA 2X85A 3TOAA 1LFUP 1F5TA 1IV8A 2EFQA 1H9GA 1ODDA 4NUBA 4YIFA 1SAUA 4P55A 1EV7A 1JE8A 3DCFA 1AHDP 2L02A 2K7LA 1OKRA 3RQIA 3GYHX 5HLIA 2LP0A 2X6WA 2CUJA 3K6GA 2C6YA 1J09A 2DA4A 1XB4A 2UWMA 1BM9A 4HLXA 4Z2YA 5B66C 1QBJA 2HO0A 4RMNA 1MBGA 1P7IA 1TT5B 1X3WB 1W4MA 2GWRA 4PCQA 1UB9A 1TQMA 2HYGD 4BGDA 1POGA 3DEEA 1TNTA 1MMDA 1TW3A 4EGYA 2IS2A 1J5YA 3FF5A 5EEHA 4F92B 3N4MA 1AOYA 3BDDA 5AIPA 1KONA 1PP8F 2KZGA 3OYIA 2YPRA 2HVSA 1REPC 3SYTA 4AVZA 3MFKA 3S16J 3IKTA 3LSPA 3MKWB 3HOVJ 2LVSA 1R9TJ 2PMHA 3HJEA 2IS1A 1YOVB 1ZREA 4P9UA 2W48A 2TRTA 2YX4A 1O57A 5H6QA 3DPLC 3KEOA 4NQWA 4RB0A 2IA2A 1R5ID 4A3CJ 4MQVA 2BW3B 1VQ6I 3HOTA 4Y3OA 3S1NJ 3PUFA 4Q47A 2R4GA 2AHQA 3DPTA 2JMWA 4OAYA 4FCYA 3A0HC 5HDNA 5CVIA 4J01A 3HSRA 4A3EJ 2KZVA 4CA0A 4XN3A 5GAEJ 3QOEA 5B3SH 1IN6A 2CRGA 4B3XA 3QPHA 5ILVA 1RPWA 3CCVI 1TWGJ 3AG2H 4BQOA 4C3IJ 1GVDA 1VQOI 3LQRA 1VQLI 3BR0A 1FSHA 2JUCA 2H1LA 1P2FA 2FQ4A 5KK1A 1TWAJ 5L3GA 2PJRA 1SFOJ 5L3CA 4HNVA 3ZXSA 5FLXK 3PNVA 2KIQA 4RLQA 4DZPA 3BTLA 5E17F 3LSRA 1IN7A 3BG3A 3TDZC 5HNFA 4M3DA 4GFBA 2PG4A 3CJRB 4DGWB 2HQAA 2XPWA 4A2UA 3OY9A 4KISA 5DD4A 1W7PA 4M9ZA 4MFDA 3W6JB 2XB0X 4ESJA 2F2EA 2YU9J 2DLLA 4EJOA 1YITI 3BZKA 2FOWA 2QM3A 2EILH 1IDYA 1MGTA 3HEFA 1P6RA 5FROA 3JR9A 4XSZF 3TDUC 3BR2A 3DEWA 2COBA 3HUGA 2JA2A 4XR6A 2MYSA 2CFOA 1X19A 2MD5A 3WGGA 2CW0F 3K70C 1GXQA 3S2DJ 2CQXA 4DYRA 1RUNA 1VQ9I 1JHCA 1QVUA 3ZMVA 2QF7A 4G7OF 4CHUA 4KMFA 2ETHA 2IBDA 4GCVA 1T08B 4HG2A 1FPQA 1XG1A 3ELKA 5D8LB 3OR2C 2NVQJ 4A93J 5DUIA 4WK8F 1RKWA 1K83J 1A36A 1F39A 1K4SA 2ESNA 3M1EA 3VPRA 1JKPC 1X4OA 3JAMZ 3HHGA 1J7KA 4OOIA 2Q8KA 2KRHA 1NH3A 1OYIA 1BR1A 4L9VA 2FD5A 4UV9A 3SEZA 3CCUI 3SHFA 1MNDA 2WBMA 2NVTJ 1SEUA 2DFFA 3TGNA 4ENKA 4M9SA 4YEJA 3LL7A 4LK1F 3RKXA 2VOPA 2KDOA 3SZPA 1U9OA 4OMZA 3GTGJ 2E5NA 2GIZA 4GDFA 2AO9A 2ZNYA 1VQ4I 2CSOA 1BR4A 3J80K 1KYZA 5FD6A 2L9VA 3K9TA 2XDVA 3HRTA 3WU1B 1TP4A 1IRFA 1V3FA 1UG2A 5CQEA 4XBFA 2O8KA 4XL9A 4MTDA 2IT0A 9ANTA 3S3MA 3HRMA 1RETA 4NBQA 1FIPA 2K4JA 4XLCA 1CF7A 3VYTB 3BR3A 2Y9YA 2OAZA 1W5SA 3WHCA 3TW6A 2LY1A 1BL0A 1CQTA 4KN7X 4PDKA 1H89C 2XPVA 4FT8A 1XSXA 2JPCA 1LQ1A 4XLNF 2PMUA 1W7PD 4FQGA 2L0KA 4LITA 1YHQI 3KCCA 3DWLE 2XROA 3KP7A 4KT5C 4PJLA 3TP0A 3LFUA 5AONA 1WRJA 3SDGA 5L3DA 1U6GA 1E3HA 3IL2A 4U0VA 2M0CA 1ZR2A 3CCJI 3F23A 2ELJA 3D5RC 2VB6A 3CO7C 4J19A 2HEOA 3DKYA 1ETKA 1FSEA 5FLXZ 3HOWJ 2LOOA 4WF2A 3I59A 2EFPA 3KE2A 3OYJA 4EATA 2WWYA 2UXXA 4CXFA 1A5JA 2MSYA 2E60A 3EUKL 2FMLA 2V7FA 3RCOA 2R7QA 1R49A 2E19A 1L0OC 1Y8QB 1MMAA 3CC7I 3HOUJ 3I71A 3AL0C 5H20A 3CZ6A 1ONVA 3GLLA 2O9LA 3ZGKA 1HBXG 5TISC 4GYGA 2WC2A 3I55I 1JJ6C 2IGNA 4CYCA 1IC8A 2XASA 2CWEA 3PSFA 5D4SA 2WAFA 4ZTJA 3FXLA 3P5JA 2VOOA 1JKQC 4XRFA 1ZRDA 2M7AA 5LHGA 1BA5A 1JUMA 2BY0A 3QYEA 3UNGC 1R00A 4OINF 1ZG3A 2G9WA 3BR5A 3EYYA 3I58A 1HDDC 2P81A 3LSIA 1KU2A 3K1PA 4HLYA 1VQ8I 1T95A 2YUSA 4RLFA 4KUMA 1DU6A 1QZZA 3G1OA 3K4LA 1HF0A 1ZRFA 1G3WA 3HRSA 3SFZA 4WCGA 1A35A 4EM1A 2KT0A 1I3QJ 1RUOA 2UV1A 4UB8C 4LK0F 1HOMA 3IH4A 4LG3A 3OSGA 3LMMA 3AG4H 3KP4A 2UXNA 2DI3A 4A0XA 4QIWN 4L5IA 4XQFA 5ED4A 2ECCA 3F8CA 2OTJI 4PGGA 1MD0A 3ZMDA 4X1EA 2FF4A 4R8HA 4R79A 1Z9CA 2VJJA 1FMVA 2DU9A 5F6FA 1OYYA 1EH6A 1I1GA 2R0QC 4TV7A 4AIJA 3T0YA 3M07A 4BEHB 3CTAA 5FRNA 1OCCH 3K4JA 1X1AA 4Y7NJ 3G2BA 3OV8A 1FNNA 2EH3A 1LE8A 1OCTC 1MSFC 5LD2C 4DBRA 1MNEA 5LFAA 3RQ4A 2DCEA 1P9QC 1N77A 2FKDA 2JWTA 2QYOA 2JA5J 2Y75A 2CQ7A 1XSDA 2GZWA 2M4KA 3NRVA 4G7HF 3F9KA 3HBLA 2O8XA 1JI8A 2PQ8A 3ZMZA 1U0JA 1YW9A 2LBFA 3G73A 2Z16A 3M9AA 2NOJB 2GOXB 2VBZA 4P5OA 1MZBA 1WJFA 4ASNA 1B12A 2EFOA 5L3BA 1LFBA 3BPVA 1ETQA 5KCMA 4DNCA 4XOPA 1U8BA 1W5CC 3RZOJ 1BC7C 5DDGA 2GQQA 3G3ZA 2VBWA 5DCFA 4A3FJ 1XC5A 1XDSA 4ETSA 3DBLB 3FK7A 3GFJA 4YELA 3DV8A 1YRNB 2L9SA 3B6AA 3ROUA 4LB5A 3R0AA 2E36A 2E5ZA 3PM1A 2MLGA 4MLOA 1F36A 1YFHA 1PJRA 2R5ZA 3ZMSA 1EH8A 2ACJA 2V6CA 5H6RA 3SZGA 2P5KA 3K2ZA 4HV5A 2HQNA 1ZGAA 3BCAA 2XF6A 5EGOB 5IP6A 4XICA 4F52A 3I4PA 1YQAA 1XGSA 2XVCA 1Z67A 4KT6A 1WJ5A 4D7NA 2ME6A 3JTGA 1D0YA 1T7DA 1BBYA 4I01A 2EFWA 2FE3A 3K4MA 3TEDA 3GZ6A 4BQAA 2NVUB 3I9V2 5E8GA 2R7FA 5CVVA 3KZZA 4BYYA 1R1TA 3VODA 1ZHFA 1OCRH 3EUAA 4HDUA 4M71A 3NQOA 4R1HA 4XLFA 2VQHA 2M1BA 1D1CA 3I64A 3BJ6A 2V4JC 3GFMA
chains in the Genus database with same CATH topology
2HTJA 2QUFA 3IRRA 4O3MA 4GXOA 3WTWC 2IA1A 3O3KA 4K2EA 2ZJ2A 1YW7A 4OIQF 4O5VA 4HX4A 4D0PA 3WTUC 4HOBA 3V4GA 1S6LA 2FOKA 2EB7A 5LHHA 3W6KB 3QOPA 2PLYA 2L4MA 1T2KA 4IPAA 2QBYA 1J2XA 2W85A 1HKQA 3DQVC 2FMYA 5FFZA 3FWEA 1UHWA 4AIKA 2QWWA 1R5GA 3R61A 2FNAA 2XAHA 3RIRA 2HNFA 2HOEA 1O3RA 4WWCA 2RN7A 5FD5A 1S7OA 4EJUA 2MBFA 4AWXB 3JSOA 3KP5A 3BY6A 5LRSA 2MLKA 3FZVA 1ZAOA 1A04A 4U7BA 1Q1HA 3VOEA 2DBBA 2RNJA 1F1ZA 1K79A 3MAJA 3RKYA 4EVIA 2CGPA 1XN7A 4IJAA 4BXUA 2EJRA 2H6CA 4MNUA 4M72A 2A6HF 3RPQA 1RZ4A 2L4AA 2Z5UA 4ZZDA 5IT3A 3F8BA 4I0BA 2RGVA 4G9YA 3TQNA 2QQBA 1BOAA 4MGRA 4IF4A 1R23A 3BP8A 4BHBA 4EV0A 1HXDA 1TQIA 3ML6A 3DP7A 2VN2A 4ZYGA 3S04A 1S7AA 2VONA 2CO5A 1Z6RA 5HS9A 1SMTA 1YS6A 2Z33A 1IXCA 2H6BA 2IVMA 2HZTA 5ICEA 4O6JA 2BE5F 1QGPA 1KCAA 1KGSA 2K86A 2EK5A 1XGOA 1SFEA 4KN4X 4UV8A 2BBYA 5E1WA 3TO7A 3CJNA 3L2CA 3BJAA 1SD6A 3WTTC 2GXGA 2L01A 3J81K 5BPIA 2RKHA 1WQ2A 4L0YB 2QBYB 1PUEE 4KICA 3GF2A 2D1HA 1JGSA 3JTHA 5LGUA 2FU4A 3C3WA 3ERED 2RC4A 1E2XA 1B59A 5CVUA 2JRTA 3E5XA 2VBXA 3JW4A 4Y13A 5JI6A 1DDNA 4EM0B 3ZP5A 3GFIA 3WE2A 4QLCU 2HFHA 4IRHA 1USSA 5J8FA 2DQLA 1G6NA 2D45A 1OYWA 1ULYA 4RB2C 5LGTA 3FM3A 3KZYA 2L3DA 1P92A 5KVRA 1B4AA 3E6CC 2TDXA 1SMYF 4Q5SF 3PQKA 2IW5A 1ZGJA 1S8NA 4KIFA 1FLIA 1TQPA 4YFXF 1MDMB 2FJRA 2M5WA 3E5QA 3I54A 1MKMA 1XMKA 2K27A 3HTUA 1I6XA 1KQ8A 2GA1A 4KIGA 3BOQA 2VODA 2O03A 5JR3A 2P8TA 1Z6TA 3T5XA 1LDJA 3L09A 2XUBA 3L7WA 2DK5A 3LAPA 2KKOA 2GA2A 4F7ZA 5TJJA 2P6SA 4MEXF 2ZBKA 2V1XA 1TNSA 3WODF 4HBLA 2A69F 3FHZA 3CUQC 3LA7A 2O6GE 2UZKA 1GVJA 3GX4X 2RDPA 3I5UA 4AIHA 4B8XA 1QO0D 4A0ZA 1KYWA 3DEUA 5HOOA 3GZ5A 3RYRA 3ULQB 4GYIA 2QENA 1R36A 3HYIA 5D5VB 2STWA 2G7HA 4LFUA 2MH2A 2W24A 4KMUX 1P4AA 2J5PA 5EEGA 3LWFA 1G4DA 1IAWA 4YFKF 4B09A 4OIRF 2X4HA 1GXPA 2ZMEB 4U7DA 1B1BA 3Q9VA 4A0YA 2H27A 5HLGA 4A6DA 2R7DA 3WTVC 2O61A 1J0RA 3GFLA 1JHFA 3SQNA 5L3EA 2XAFA 2K02A 4ZYEA 1MDMA 2FBKA 3DFGA 5ILSA 1T38A 4IXAA 2FRHA 3GLXA 3PQJA 2HS5A 2ELHA 4HF0A 1D8JA 2HYFA 2EFNA 3VEPA 4MTEA 2NNYA 4LLLA 3MQ0A 2DAOA 4RB1A 1KQ9A 3E6BA 3C18A 3ZPLA 1DPRA 1R1VA 3WTYC 2KIUA 4M73A 5LBQA 3CO6C 2DW4A 2PI0A 1D5VA 3RTRA 5LHIA 5IT9K 2A61A 3P7NA 2B0LA 3QPTA 1FYKA 5DEQA 3JSPA 2FBHA 4HQEA 1XCVA 5CLSA 4MQ9F 2IA0A 1D8KA 2A68F 4L0ZB 1J59A 3FMRA 2ZCWA 1E17A 1TLHB 2DQRA 3F21A 4M6YA 3J81Z 5FGMA 1TW2A 3PFIA 3LA2A 4CICA 1FZPB 3K1MA 2LF8A 2Z9OA 5J6XA 4LGWA 4S04A 4L18B 2DK8A 2HTSA 3I59B 1SFUA 2M8EA 1LDDA 3HRUA 4U0WA 4YFNF 1AWCA 1OR7A 2VC1A 1K78A 1FP2A 2LDUA 5E1XA 1RNLA 5FO5A 3O2PE 4MHGA 3F6OA 1U5TC 5JFRA 4LB6B 3L9FA 2P6TA 2VBYA 1KU7A 2V79A 3LFKA 1PP7U 3CDHA 4EM2A 1ZRCA 3KEQA 1HQCA 4EJTA 1XSVA 4HF1A 3F22A 1CF7B 1XMAA 3Q9SA 2HWVA 1IN8A 3QP6A 1B6AA 3KETA 1FWZA 3RYPA 2K4BA 3VFZA 3ABUA 4ZH4F 1QQIA 2ZO4A 3N97A 2M30A 3ABTA 1S29A 2KJBA 4KNYA 3RKWA 1FP1D 4XSXF 3C7JA 2DPDA 1FYMA 2D2WA 2P5VA 5BPDA 3RDIA 2G7UA 2XKPA 2OU2A 2NAZA 1ZN2A 5IT9Z 4HQMA 3K1NA 1QPMA 2Q2EA 4I09A 4G6QA 1YYVA 2NNNA 1BN5A 4BHCA 2QQ9A 3FM5A 5HS7A 1LEBA 1EH7A 3T8TA 4Y15A 4U88A 1XGMA 2V1UA 1KU3A 4NB5A 1HKTA 3QAHA 2A5YB 2Z99A 5A2QK 3E6DA 2J5OA 2QQAA 2CG4A 3F8NA 4CDGA 3K0LA 3RI4A 1PDNC 3IKVA 4IVNA 4A6EA 3WU0A 4JK1X 5E8IA 1HW2A 4RAYA 1SD7A 2CYYA 1W7PB 2EV5A 3M8EA 3GXOA 1Z1DA 1SFXA 3R0JA 1JHEA 1BI2A 2JTVA 2NS0A 4MEYF 1I5ZA 3E97A 3S2WA 5ICCA 2EA2A 1LDKB 2JSCA 3L00A 4M74A 1ZLJA 4GO1A 2LF7A 2PBIA 3KP2A 2PJPA 5CVRA 1MJAA 5K1YA 2HKXA 1XD7A 4OIPF 2YU3A 2W25A 5LEKA 4LG0A 4OMYA 3R4KA 1U2WA 1IF1A 2F5FA 3DF8A 2P5LC 2XRNA 4FX0A 4P9FA 1QZYA 2WTEA 2BV6A 2ZKZA 1ON1A 2ZNZA 4G7ZF 4IHSA 2DT5A 1QNTA 1SD5A 1LB2A 3C1DA 3DKWA 2HKOA 2H09A 4S05A 4M9XA 5D6EA 1G3YA 3OOPA 2LKPA 1Z7UA 4IRIA 2JT1A 5ICFA 1O7LA 1TBXA 4BNCA 4A5MA 3HSEA 4M6XA 2M45A 2VXZA 5K5OA 1HSJA 4HA8A 3TO9A 1IXRC 2YR2A 1ZYRF 2MA3A 5HDGA 4HAMA 3ISPA 3H3UA 3LSTA 3HTSB 5DCMB 1IW7F 1AY9A 4Q4ZF 2M87A 3LA3A 3ECHA 3Q5FA 2XGXA 4I7HA 2KIMA 1F9NA 3V7SA 1FY7A 4CZZA 1O3TA 3TO6A 4ON0A 4RGUA 3WGIA 4RGRA 4IHTA 2O0YA 1WSUA 5LRRA 3U1DA 3KLNA 2GIVA 4E70A 4CO8A 5J8CA 3QU6A 2P7VB 3H92A 2PFBA 5HLHA 3P9IA 2R3SA 2BEOA 4L9JA 2A07F 2YX7A 3HSFA 3QRFF 3GW2A 2HGCA 1YS7A 4WXCA 5BOXA 2XKOA 2GXBA 1X3UA 4EQQA 4L5JA 3R60A 3E5UA 2ISZA 3EQLF 1J9IA 2MH9A 4A12A 4WX9A 5F64A 5F1RA 4CYDA 1FBQA 3LQQA 5D8KB 3TOBA 2OA4A 2CFXA 1KQ0A 2DTRA 3COAC 3HOSA 3GO5A 2OQGA 2IPQX 1USTA 5CYVA 1VTNC 4P96A 1BC8C 1LNWA 4NV4A 1WKMA 4I98B 3WE3A 3WG9A 3O6BB 2XHKA 4ENJA 1I4VA 1K7AA 3MZYA 5LEJA 4EJWA 3MZHA 1XDUA 2F5DA 4N9IA 2DFIA 3R6SA 1U5TB 3EDPA 5CVJA 3EUHA 3VB2A 3IIQA 3J80Z 3CUOA 4EGZA 2LSOA 4HV6A 5D6FA 3SXYA 2X0LA 3MWMA 2OZ6A 3QU3A 1R5HA 4ESFA 3CUQA 5DD8A 2P7CB 2ZFWA 4KIBA 2FSWA 3B73A 2XV4S 2VT2A 2IJLA 1FX7A 2FA5A 3HHHA 3ZQ7A 2OD5A 3BJOA 3ZMUA 3KLOA 2ZXJA 1T6SA 4PGHA 1O3QA 2EV0A 4GGGA 3U9GA 5HS8A 1B9MA 2E7XA 3H3ZA 5ICGA 2COMA 4A5NA 2ESHA 1BJAA 1OPCA 4UHTA 4LJZF 3BPXA 4HDVA 2QLZA 4ZYDA 4RB3C 2ADUA 3F3XA 4LMYA 1MJBA 2EA4A 3K69A 3E3VA 2MC3A 4UNOA 3I0TA 3EETA 1LVAA 3I53A 1JXSA 5L3FA 3WGHA 1CGPA 4I0AA 3ZN1A 1Y0UA 1SD4A 1DP7P 2STTA 1SAXA 3REOA 3IHUA 2EWNA 2OZUA 2RQPA 2LNBA 4N31A 5CJ9A 1D3YA 3F8MA 1V4RA 2E7WA 3V8LA 3WTSC 2DPUA 2FNPA 2OQRA 4FHTA 2A3SA 1IN4A 2HR3A 1I1SA 5DV5A 2A6EF 5TRDA 2V1DA 4KFCA 4ZZLA 5BQTA 3RPUA 2D1VA 2Q0OA 1TTYA 1UHMA 1KN9A 1YIOA 1WWXA 4HZFA 1XGNA 3P9KA 5FB2A 3GVAA 3BWGA 3V7RA 4ENMA 2XIGA 4PZJA 5BS6A 3KP3A 2E1CA 1YW8A 2BGCA 2FBIA 5LLQA 4HF2A 1W5TA 1T98A 4XLPF 1BIBA 2CQKA 3KP6A 5A2QZ 5K5RA 4LG0B 3FMQA 5HVQC 2BYVE 4ME8A 3FXQA 4ENNA 5ERIA 1ZG1A 1UCRA 3U2RA 1HW5A 2NYXA 3ZMTA 4G8XA 1YG2A 1UFMA 5E1ZB 5ILUA 4EJVA 2WV0A 1BIAA 1Z91A 5AIQA 4UVBA 3M8FA 2XAGA 1IRGA 3T1BA 4LLGF 1BI0A 3IC7A 2AS5F 2PN6A 4RGXA 3FXUA 4JQFA 2O3FA 1NHAA 1DUXC 4U0YA 4NHJA 1HW1A 3V7CA 4RAZA 1LEAA 3D0SA 2KJCA 2FXAA 1S3JA 2JPBA 3V8KA 2Y48A 5D5UB 2Y0MA 3E6MA 3FMSA 1STZA 3T8RA 4KYWA 4ZYHA 1HSTA 3MEXA 3JAMK 1YLFA 1U78A 2QZ8A 1ZG5A 3WTXC 2XAQA 2RV8A 5DYMA 3M7GA 1FOKA 1R22A 4K8WA 4AVPA 1ZLKA 4I02A 3IWZA 1YTYA 2ISYA 3IRQA 4YIIA 3KFWX 3MCZA 4UXNA 4UVCA 1P4WA 2KRFA 3NEUA 1R58A 1L3LA 1I27A 3QP5A 1U5TA 3D5LA 1IZ1A 1F4KA 5D5XB 1IUYA 3GEZA 1G3SA 1LJ9A 1IN5A 2EV6A 3V8JA 1T0FA 2H94A 4HX8A 1U3EM 4G94A 2JZYA 5JVTA 2YSRA 1FT9A 4IRGA 5E18F 2V9VA 3F8FA 4Y17A 2HDCA 4HW0A 2E1NA 5LGNA 1FBSA 4LD5A 3J7AO 1HKSA 3EYIA 3CUQB 2RVCA 4AD9A 1T39A 1BI3A 1RIOH 3F6VA 1K78B 3BROA 4L9NA 4BH9A 1KU9A 5HDKA 2F5EA 5D4RA 2GAUA 2W57A 3RJPA 1JHHA 4FX4A 1RI7A 4WXDA 2VE8A 2AXLA 4OIOF 2DO7A 4KA4A 2FQ3A 5BMZA 5D5WB 1R1UA 4DQ2A 1XCBA 2XAJA 3P9CA 4OU0A 4RGSA 1FC3A 4RS8A 3LAJA 4KDPA 1BI1A 2P4WA 1MJ9A 3BZ6A 1P4XA 4UUVA 4EMSA 4UVAA 3IWFA 2QVOA 1DPUA 1K6OA 2L54A 1YO5C 2NRAC 3BDNA 4I2OA 4Q48A 1GHCA 4BHPA 2VT3A 1FYLA 1UMUA 3SZTA 5E20A 1R7JA 4JBAA 3DXJF 5FFXA 1IXSB 5K5QA 5DCMA 4G6DA 4HYEA 3GWZA 1ZARA 2KIFA 4CGZA 1H0MA 3FXRA 1OMIA 2VE9A 1H9TA 1J75A 3HIFA 1B9NA 2VC0A 4WXHA 3GUDA 6PAXA 4LLNA 2HQRA 1C0WA 1KA8A 5JHUA 2W84A 4YG2F 3B02A 1O7FA 4N0BA 3TKYA 2ZMEA 3AAFA 1O3SA 3ZN0A 1Z05A 1G3TA 2PEXA 3F72A 3CLOA 2FEZA 4L9TA 3WTZA 3FX3A 5DUKA 1WI9A 3ECOA 2IRFG 1U8RA 1FBUA 1ON2A 4QWQA 4H0EA 4N9HA 4HX7A 2IP2A 4ESBA 2F5CA 1ZH5A 4BAYA 2Z3YA 2OBPA 3TOAA 1F5TA 2EFQA 1H9GA 1ODDA 4YIFA 1JE8A 4P55A 1EV7A 2L02A 2K7LA 1OKRA 3GYHX 5HLIA 2C6YA 1XB4A 2UWMA 1BM9A 4HLXA 4Z2YA 1QBJA 2HO0A 2GWRA 1W4MA 4PCQA 1UB9A 1TQMA 2HYGD 1TNTA 1TW3A 4EGYA 1J5YA 3FF5A 5EEHA 3N4MA 1AOYA 3BDDA 5AIPA 1PP8F 2YPRA 1REPC 3MFKA 3IKTA 2PMHA 1ZREA 4P9UA 2YX4A 1O57A 5H6QA 3DPLC 3KEOA 4NQWA 4RB0A 2IA2A 4MQVA 3HOTA 4Q47A 3DPTA 5HDNA 5CVIA 3HSRA 1IN6A 3QPHA 5ILVA 3LQRA 1FSHA 1P2FA 5KK1A 5L3GA 5L3CA 5FLXK 5E17F 1IN7A 3TDZC 2PG4A 4A2UA 5DD4A 1W7PA 4M9ZA 3W6JB 4ESJA 2F2EA 2DLLA 4EJOA 2QM3A 1MGTA 1P6RA 4XSZF 3TDUC 3HUGA 2MD5A 3WGGA 2CW0F 1GXQA 1JHCA 1RUNA 3ZMVA 4G7OF 4CHUA 4KMFA 2ETHA 4GCVA 1FPQA 3ELKA 5D8LB 5DUIA 4WK8F 1F39A 2ESNA 3M1EA 3JAMZ 3HHGA 1J7KA 4OOIA 2Q8KA 1OYIA 4L9VA 4UV9A 3SHFA 3TGNA 4ENKA 4M9SA 4LK1F 3RKXA 2VOPA 3SZPA 4OMZA 2ZNYA 2CSOA 3J80K 1KYZA 5FD6A 3K9TA 3HRTA 3WU1B 1V3FA 1IRFA 4XBFA 4MTDA 2IT0A 3HRMA 2K4JA 1CF7A 2OAZA 1W5SA 4KN7X 4PDKA 4FT8A 1XSXA 2JPCA 1LQ1A 4XLNF 2PMUA 1W7PD 3KCCA 2XROA 3KP7A 4KT5C 5AONA 1WRJA 5L3DA 1U6GA 3IL2A 4U0VA 3F23A 3CO7C 2HEOA 1FSEA 5FLXZ 4WF2A 3I59A 2EFPA 3KE2A 2WWYA 2UXXA 4CXFA 2FMLA 1L0OC 3I71A 5H20A 1ONVA 1HBXG 4GYGA 2WC2A 2XASA 2CWEA 5D4SA 2VOOA 4XRFA 1ZRDA 5LHGA 1R00A 4OINF 1ZG3A 2G9WA 3EYYA 3I58A 1KU2A 3K1PA 4HLYA 4KUMA 1QZZA 1ZRFA 1G3WA 3HRSA 3SFZA 4WCGA 4EM1A 1RUOA 4LK0F 3KP4A 2UXNA 2DI3A 4A0XA 5ED4A 4L5IA 3F8CA 4PGGA 1MD0A 3ZMDA 2FF4A 4R8HA 4R79A 1Z9CA 2DU9A 5F6FA 1OYYA 1EH6A 1I1GA 4TV7A 4AIJA 3T0YA 3CTAA 3OV8A 1FNNA 2FKDA 2QYOA 2Y75A 1XSDA 2GZWA 3NRVA 4G7HF 2O8XA 2PQ8A 3ZMZA 1YW9A 3G73A 3M9AA 2VBZA 4P5OA 1MZBA 4ASNA 1B12A 2EFOA 5L3BA 3BPVA 4DNCA 1BC7C 5DDGA 2GQQA 3G3ZA 2VBWA 5DCFA 1XDSA 4ETSA 3GFJA 3DV8A 3ROUA 4LB5A 3R0AA 2MLGA 1YFHA 3ZMSA 1EH8A 2ACJA 2V6CA 5H6RA 2P5KA 3K2ZA 4HV5A 2HQNA 1ZGAA 3I4PA 1YQAA 1XGSA 2XVCA 3JTGA 1T7DA 1BBYA 4I01A 2EFWA 2FE3A 3GZ6A 4BQAA 5E8GA 2R7FA 5CVVA 3KZZA 4BYYA 1R1TA 3VODA 1ZHFA 4HDUA 4M71A 3NQOA 4R1HA 2M1BA 3I64A 3BJ6A 3GFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTJ A;  2QUF A;  3IRR A;  4O3M A;  4GXO A;  3WTW C;  2IA1 A;  3O3K A;  4K2E A;  2ZJ2 A;  1YW7 A;  4OIQ F;  4O5V A;  4HX4 A;  4D0P A;  3WTU C;  4HOB A;  3V4G A;  1S6L A;  2FOK A;  2EB7 A;  5LHH A;  3W6K B;  3QOP A;  2PLY A;  2L4M A;  1T2K A;  4IPA A;  2QBY A;  1J2X A;  2W85 A;  1HKQ A;  3DQV C;  2FMY A;  5FFZ A;  3FWE A;  1UHW A;  4AIK A;  2QWW A;  1R5G A;  3R61 A;  2FNA A;  2XAH A;  3RIR A;  2HNF A;  2HOE A;  1O3R A;  4WWC A;  2RN7 A;  5FD5 A;  1S7O A;  4EJU A;  2MBF A;  4AWX B;  3JSO A;  3KP5 A;  3BY6 A;  5LRS A;  2MLK A;  3FZV A;  1ZAO A;  1A04 A;  4U7B A;  1Q1H A;  3VOE A;  2DBB A;  2RNJ A;  1F1Z A;  1K79 A;  3MAJ A;  3RKY A;  4EVI A;  2CGP A;  1XN7 A;  4IJA A;  4BXU A;  2EJR A;  2H6C A;  4MNU A;  4M72 A;  2A6H F;  3RPQ A;  1RZ4 A;  2L4A A;  2Z5U A;  4ZZD A;  5IT3 A;  3F8B A;  4I0B A;  2RGV A;  4G9Y A;  3TQN A;  2QQB A;  1BOA A;  4MGR A;  4IF4 A;  1R23 A;  3BP8 A;  4BHB A;  4EV0 A;  1HXD A;  1TQI A;  3ML6 A;  3DP7 A;  2VN2 A;  4ZYG A;  3S04 A;  1S7A A;  2VON A;  2CO5 A;  1Z6R A;  5HS9 A;  1SMT A;  1YS6 A;  2Z33 A;  1IXC A;  2H6B A;  2IVM A;  2HZT A;  5ICE A;  4O6J A;  2BE5 F;  1QGP A;  1KCA A;  1KGS A;  2K86 A;  2EK5 A;  1XGO A;  1SFE A;  4KN4 X;  4UV8 A;  2BBY A;  5E1W A;  3TO7 A;  3CJN A;  3L2C A;  3BJA A;  1SD6 A;  3WTT C;  2GXG A;  2L01 A;  3J81 K;  5BPI A;  2RKH A;  1WQ2 A;  4L0Y B;  2QBY B;  1PUE E;  4KIC A;  3GF2 A;  2D1H A;  1JGS A;  3JTH A;  5LGU A;  2FU4 A;  3C3W A;  3ERE D;  2RC4 A;  1E2X A;  1B59 A;  5CVU A;  2JRT A;  3E5X A;  2VBX A;  3JW4 A;  4Y13 A;  5JI6 A;  1DDN A;  4EM0 B;  3ZP5 A;  3GFI A;  3WE2 A;  4QLC U;  2HFH A;  4IRH A;  1USS A;  5J8F A;  2DQL A;  1G6N A;  2D45 A;  1OYW A;  1ULY A;  4RB2 C;  5LGT A;  3FM3 A;  3KZY A;  2L3D A;  1P92 A;  5KVR A;  1B4A A;  3E6C C;  2TDX A;  1SMY F;  4Q5S F;  3PQK A;  2IW5 A;  1ZGJ A;  1S8N A;  4KIF A;  1FLI A;  1TQP A;  4YFX F;  1MDM B;  2FJR A;  2M5W A;  3E5Q A;  3I54 A;  1MKM A;  1XMK A;  2K27 A;  3HTU A;  1I6X A;  1KQ8 A;  2GA1 A;  4KIG A;  3BOQ A;  2VOD A;  2O03 A;  5JR3 A;  2P8T A;  1Z6T A;  3T5X A;  1LDJ A;  3L09 A;  2XUB A;  3L7W A;  2DK5 A;  3LAP A;  2KKO A;  2GA2 A;  4F7Z A;  5TJJ A;  2P6S A;  4MEX F;  2ZBK A;  2V1X A;  1TNS A;  3WOD F;  4HBL A;  2A69 F;  3FHZ A;  3CUQ C;  3LA7 A;  2O6G E;  2UZK A;  1GVJ A;  3GX4 X;  2RDP A;  3I5U A;  4AIH A;  4B8X A;  1QO0 D;  4A0Z A;  1KYW A;  3DEU A;  5HOO A;  3GZ5 A;  3RYR A;  3ULQ B;  4GYI A;  2QEN A;  1R36 A;  3HYI A;  5D5V B;  2STW A;  2G7H A;  4LFU A;  2MH2 A;  2W24 A;  4KMU X;  1P4A A;  2J5P A;  5EEG A;  3LWF A;  1G4D A;  1IAW A;  4YFK F;  4B09 A;  4OIR F;  2X4H A;  1GXP A;  2ZME B;  4U7D A;  1B1B A;  3Q9V A;  4A0Y A;  2H27 A;  5HLG A;  4A6D A;  2R7D A;  3WTV C;  2O61 A;  1J0R A;  3GFL A;  1JHF A;  3SQN A;  5L3E A;  2XAF A;  2K02 A;  4ZYE A;  1MDM A;  2FBK A;  3DFG A;  5ILS A;  1T38 A;  4IXA A;  2FRH A;  3GLX A;  3PQJ A;  2HS5 A;  2ELH A;  4HF0 A;  1D8J A;  2HYF A;  2EFN A;  3VEP A;  4MTE A;  2NNY A;  4LLL A;  3MQ0 A;  2DAO A;  4RB1 A;  1KQ9 A;  3E6B A;  3C18 A;  3ZPL A;  1DPR A;  1R1V A;  3WTY C;  2KIU A;  4M73 A;  5LBQ A;  3CO6 C;  2DW4 A;  2PI0 A;  1D5V A;  3RTR A;  5LHI A;  5IT9 K;  2A61 A;  3P7N A;  2B0L A;  3QPT A;  1FYK A;  5DEQ A;  3JSP A;  2FBH A;  4HQE A;  1XCV A;  5CLS A;  4MQ9 F;  2IA0 A;  1D8K A;  2A68 F;  4L0Z B;  1J59 A;  3FMR A;  2ZCW A;  1E17 A;  1TLH B;  2DQR A;  3F21 A;  4M6Y A;  3J81 Z;  5FGM A;  1TW2 A;  3PFI A;  3LA2 A;  4CIC A;  1FZP B;  3K1M A;  2LF8 A;  2Z9O A;  5J6X A;  4LGW A;  4S04 A;  4L18 B;  2DK8 A;  2HTS A;  3I59 B;  1SFU A;  2M8E A;  1LDD A;  3HRU A;  4U0W A;  4YFN F;  1AWC A;  1OR7 A;  2VC1 A;  1K78 A;  1FP2 A;  2LDU A;  5E1X A;  1RNL A;  5FO5 A;  3O2P E;  4MHG A;  3F6O A;  1U5T C;  5JFR A;  4LB6 B;  3L9F A;  2P6T A;  2VBY A;  1KU7 A;  2V79 A;  3LFK A;  1PP7 U;  3CDH A;  4EM2 A;  1ZRC A;  3KEQ A;  1HQC A;  4EJT A;  1XSV A;  4HF1 A;  3F22 A;  1CF7 B;  1XMA A;  3Q9S A;  2HWV A;  1IN8 A;  3QP6 A;  1B6A A;  3KET A;  1FWZ A;  3RYP A;  2K4B A;  3VFZ A;  3ABU A;  4ZH4 F;  1QQI A;  2ZO4 A;  3N97 A;  2M30 A;  3ABT A;  1S29 A;  2KJB A;  4KNY A;  3RKW A;  1FP1 D;  4XSX F;  3C7J A;  2DPD A;  1FYM A;  2D2W A;  2P5V A;  5BPD A;  3RDI A;  2G7U A;  2XKP A;  2OU2 A;  2NAZ A;  1ZN2 A;  5IT9 Z;  4HQM A;  3K1N A;  1QPM A;  2Q2E A;  4I09 A;  4G6Q A;  1YYV A;  2NNN A;  1BN5 A;  4BHC A;  2QQ9 A;  3FM5 A;  5HS7 A;  1LEB A;  1EH7 A;  3T8T A;  4Y15 A;  4U88 A;  1XGM A;  2V1U A;  1KU3 A;  4NB5 A;  1HKT A;  3QAH A;  2A5Y B;  2Z99 A;  5A2Q K;  3E6D A;  2J5O A;  2QQA A;  2CG4 A;  3F8N A;  4CDG A;  3K0L A;  3RI4 A;  1PDN C;  3IKV A;  4IVN A;  4A6E A;  3WU0 A;  4JK1 X;  5E8I A;  1HW2 A;  4RAY A;  1SD7 A;  2CYY A;  1W7P B;  2EV5 A;  3M8E A;  3GXO A;  1Z1D A;  1SFX A;  3R0J A;  1JHE A;  1BI2 A;  2JTV A;  2NS0 A;  4MEY F;  1I5Z A;  3E97 A;  3S2W A;  5ICC A;  2EA2 A;  1LDK B;  2JSC A;  3L00 A;  4M74 A;  1ZLJ A;  4GO1 A;  2LF7 A;  2PBI A;  3KP2 A;  2PJP A;  5CVR A;  1MJA A;  5K1Y A;  2HKX A;  1XD7 A;  4OIP F;  2YU3 A;  2W25 A;  5LEK A;  4LG0 A;  4OMY A;  3R4K A;  1U2W A;  1IF1 A;  2F5F A;  3DF8 A;  2P5L C;  2XRN A;  4FX0 A;  4P9F A;  1QZY A;  2WTE A;  2BV6 A;  2ZKZ A;  1ON1 A;  2ZNZ A;  4G7Z F;  4IHS A;  2DT5 A;  1QNT A;  1SD5 A;  1LB2 A;  3C1D A;  3DKW A;  2HKO A;  2H09 A;  4S05 A;  4M9X A;  5D6E A;  1G3Y A;  3OOP A;  2LKP A;  1Z7U A;  4IRI A;  2JT1 A;  5ICF A;  1O7L A;  1TBX A;  4BNC A;  4A5M A;  3HSE A;  4M6X A;  2M45 A;  2VXZ A;  5K5O A;  1HSJ A;  4HA8 A;  3TO9 A;  1IXR C;  2YR2 A;  1ZYR F;  2MA3 A;  5HDG A;  4HAM A;  3ISP A;  3H3U A;  3LST A;  3HTS B;  5DCM B;  1IW7 F;  1AY9 A;  4Q4Z F;  2M87 A;  3LA3 A;  3ECH A;  3Q5F A;  2XGX A;  4I7H A;  2KIM A;  1F9N A;  3V7S A;  1FY7 A;  4CZZ A;  1O3T A;  3TO6 A;  4ON0 A;  4RGU A;  3WGI A;  4RGR A;  4IHT A;  2O0Y A;  1WSU A;  5LRR A;  3U1D A;  3KLN A;  2GIV A;  4E70 A;  4CO8 A;  5J8C A;  3QU6 A;  2P7V B;  3H92 A;  2PFB A;  5HLH A;  3P9I A;  2R3S A;  2BEO A;  4L9J A;  2A07 F;  2YX7 A;  3HSF A;  3QRF F;  3GW2 A;  2HGC A;  1YS7 A;  4WXC A;  5BOX A;  2XKO A;  2GXB A;  1X3U A;  4EQQ A;  4L5J A;  3R60 A;  3E5U A;  2ISZ A;  3EQL F;  1J9I A;  2MH9 A;  4A12 A;  4WX9 A;  5F64 A;  5F1R A;  4CYD A;  1FBQ A;  3LQQ A;  5D8K B;  3TOB A;  2OA4 A;  2CFX A;  1KQ0 A;  2DTR A;  3COA C;  3HOS A;  3GO5 A;  2OQG A;  2IPQ X;  1UST A;  5CYV A;  1VTN C;  4P96 A;  1BC8 C;  1LNW A;  4NV4 A;  1WKM A;  4I98 B;  3WE3 A;  3WG9 A;  3O6B B;  2XHK A;  4ENJ A;  1I4V A;  1K7A A;  3MZY A;  5LEJ A;  4EJW A;  3MZH A;  1XDU A;  2F5D A;  4N9I A;  2DFI A;  3R6S A;  1U5T B;  3EDP A;  5CVJ A;  3EUH A;  3VB2 A;  3IIQ A;  3J80 Z;  3CUO A;  4EGZ A;  2LSO A;  4HV6 A;  5D6F A;  3SXY A;  2X0L A;  3MWM A;  2OZ6 A;  3QU3 A;  1R5H A;  4ESF A;  3CUQ A;  5DD8 A;  2P7C B;  2ZFW A;  4KIB A;  2FSW A;  3B73 A;  2XV4 S;  2VT2 A;  2IJL A;  1FX7 A;  2FA5 A;  3HHH A;  3ZQ7 A;  2OD5 A;  3BJO A;  3ZMU A;  3KLO A;  2ZXJ A;  1T6S A;  4PGH A;  1O3Q A;  2EV0 A;  4GGG A;  3U9G A;  5HS8 A;  1B9M A;  2E7X A;  3H3Z A;  5ICG A;  2COM A;  4A5N A;  2ESH A;  1BJA A;  1OPC A;  4UHT A;  4LJZ F;  3BPX A;  4HDV A;  2QLZ A;  4ZYD A;  4RB3 C;  2ADU A;  3F3X A;  4LMY A;  1MJB A;  2EA4 A;  3K69 A;  3E3V A;  2MC3 A;  4UNO A;  3I0T A;  3EET A;  1LVA A;  3I53 A;  1JXS A;  5L3F A;  3WGH A;  1CGP A;  4I0A A;  3ZN1 A;  1Y0U A;  1SD4 A;  1DP7 P;  2STT A;  1SAX A;  3REO A;  3IHU A;  2EWN A;  2OZU A;  2RQP A;  2LNB A;  4N31 A;  5CJ9 A;  1D3Y A;  3F8M A;  1V4R A;  2E7W A;  3V8L A;  3WTS C;  2DPU A;  2FNP A;  2OQR A;  4FHT A;  2A3S A;  1IN4 A;  2HR3 A;  1I1S A;  5DV5 A;  2A6E F;  5TRD A;  2V1D A;  4KFC A;  4ZZL A;  5BQT A;  3RPU A;  2D1V A;  2Q0O A;  1TTY A;  1UHM A;  1KN9 A;  1YIO A;  1WWX A;  4HZF A;  1XGN A;  3P9K A;  5FB2 A;  3GVA A;  3BWG A;  3V7R A;  4ENM A;  2XIG A;  4PZJ A;  5BS6 A;  3KP3 A;  2E1C A;  1YW8 A;  2BGC A;  2FBI A;  5LLQ A;  4HF2 A;  1W5T A;  1T98 A;  4XLP F;  1BIB A;  2CQK A;  3KP6 A;  5A2Q Z;  5K5R A;  4LG0 B;  3FMQ A;  5HVQ C;  2BYV E;  4ME8 A;  3FXQ A;  4ENN A;  5ERI A;  1ZG1 A;  1UCR A;  3U2R A;  1HW5 A;  2NYX A;  3ZMT A;  4G8X A;  1YG2 A;  1UFM A;  5E1Z B;  5ILU A;  4EJV A;  2WV0 A;  1BIA A;  1Z91 A;  5AIQ A;  4UVB A;  3M8F A;  2XAG A;  1IRG A;  3T1B A;  4LLG F;  1BI0 A;  3IC7 A;  2AS5 F;  2PN6 A;  4RGX A;  3FXU A;  4JQF A;  2O3F A;  1NHA A;  1DUX C;  4U0Y A;  4NHJ A;  1HW1 A;  3V7C A;  4RAZ A;  1LEA A;  3D0S A;  2KJC A;  2FXA A;  1S3J A;  2JPB A;  3V8K A;  2Y48 A;  5D5U B;  2Y0M A;  3E6M A;  3FMS A;  1STZ A;  3T8R A;  4KYW A;  4ZYH A;  1HST A;  3MEX A;  3JAM K;  1YLF A;  1U78 A;  2QZ8 A;  1ZG5 A;  3WTX C;  2XAQ A;  2RV8 A;  5DYM A;  3M7G A;  1FOK A;  1R22 A;  4K8W A;  4AVP A;  1ZLK A;  4I02 A;  3IWZ A;  1YTY A;  2ISY A;  3IRQ A;  4YII A;  3KFW X;  3MCZ A;  4UXN A;  4UVC A;  1P4W A;  2KRF A;  3NEU A;  1R58 A;  1L3L A;  1I27 A;  3QP5 A;  1U5T A;  3D5L A;  1IZ1 A;  1F4K A;  5D5X B;  1IUY A;  3GEZ A;  1G3S A;  1LJ9 A;  1IN5 A;  2EV6 A;  3V8J A;  1T0F A;  2H94 A;  4HX8 A;  1U3E M;  4G94 A;  2JZY A;  5JVT A;  2YSR A;  1FT9 A;  4IRG A;  5E18 F;  2V9V A;  3F8F A;  4Y17 A;  2HDC A;  4HW0 A;  2E1N A;  5LGN A;  1FBS A;  4LD5 A;  3J7A O;  1HKS A;  3EYI A;  3CUQ B;  2RVC A;  4AD9 A;  1T39 A;  1BI3 A;  1RIO H;  3F6V A;  1K78 B;  3BRO A;  4L9N A;  4BH9 A;  1KU9 A;  5HDK A;  2F5E A;  5D4R A;  2GAU A;  2W57 A;  3RJP A;  1JHH A;  4FX4 A;  1RI7 A;  4WXD A;  2VE8 A;  2AXL A;  4OIO F;  2DO7 A;  4KA4 A;  2FQ3 A;  5BMZ A;  5D5W B;  1R1U A;  4DQ2 A;  1XCB A;  2XAJ A;  3P9C A;  4OU0 A;  4RGS A;  1FC3 A;  4RS8 A;  3LAJ A;  4KDP A;  1BI1 A;  2P4W A;  1MJ9 A;  3BZ6 A;  1P4X A;  4UUV A;  4EMS A;  4UVA A;  3IWF A;  2QVO A;  1DPU A;  1K6O A;  2L54 A;  1YO5 C;  2NRA C;  3BDN A;  4I2O A;  4Q48 A;  1GHC A;  4BHP A;  2VT3 A;  1FYL A;  1UMU A;  3SZT A;  5E20 A;  1R7J A;  4JBA A;  3DXJ F;  5FFX A;  1IXS B;  5K5Q A;  5DCM A;  4G6D A;  4HYE A;  3GWZ A;  1ZAR A;  2KIF A;  4CGZ A;  1H0M A;  3FXR A;  1OMI A;  2VE9 A;  1H9T A;  1J75 A;  3HIF A;  1B9N A;  2VC0 A;  4WXH A;  3GUD A;  6PAX A;  4LLN A;  2HQR A;  1C0W A;  1KA8 A;  5JHU A;  2W84 A;  4YG2 F;  3B02 A;  1O7F A;  4N0B A;  3TKY A;  2ZME A;  3AAF A;  1O3S A;  3ZN0 A;  1Z05 A;  1G3T A;  2PEX A;  3F72 A;  3CLO A;  2FEZ A;  4L9T A;  3WTZ A;  3FX3 A;  5DUK A;  1WI9 A;  3ECO A;  2IRF G;  1U8R A;  1FBU A;  1ON2 A;  4QWQ A;  4H0E A;  4N9H A;  4HX7 A;  2IP2 A;  4ESB A;  2F5C A;  1ZH5 A;  4BAY A;  2Z3Y A;  2OBP A;  3TOA A;  1F5T A;  2EFQ A;  1H9G A;  1ODD A;  4YIF A;  1JE8 A;  4P55 A;  1EV7 A;  2L02 A;  2K7L A;  1OKR A;  3GYH X;  5HLI A;  2C6Y A;  1XB4 A;  2UWM A;  1BM9 A;  4HLX A;  4Z2Y A;  1QBJ A;  2HO0 A;  2GWR A;  1W4M A;  4PCQ A;  1UB9 A;  1TQM A;  2HYG D;  1TNT A;  1TW3 A;  4EGY A;  1J5Y A;  3FF5 A;  5EEH A;  3N4M A;  1AOY A;  3BDD A;  5AIP A;  1PP8 F;  2YPR A;  1REP C;  3MFK A;  3IKT A;  2PMH A;  1ZRE A;  4P9U A;  2YX4 A;  1O57 A;  5H6Q A;  3DPL C;  3KEO A;  4NQW A;  4RB0 A;  2IA2 A;  4MQV A;  3HOT A;  4Q47 A;  3DPT A;  5HDN A;  5CVI A;  3HSR A;  1IN6 A;  3QPH A;  5ILV A;  3LQR A;  1FSH A;  1P2F A;  5KK1 A;  5L3G A;  5L3C A;  5FLX K;  5E17 F;  1IN7 A;  3TDZ C;  2PG4 A;  4A2U A;  5DD4 A;  1W7P A;  4M9Z A;  3W6J B;  4ESJ A;  2F2E A;  2DLL A;  4EJO A;  2QM3 A;  1MGT A;  1P6R A;  4XSZ F;  3TDU C;  3HUG A;  2MD5 A;  3WGG A;  2CW0 F;  1GXQ A;  1JHC A;  1RUN A;  3ZMV A;  4G7O F;  4CHU A;  4KMF A;  2ETH A;  4GCV A;  1FPQ A;  3ELK A;  5D8L B;  5DUI A;  4WK8 F;  1F39 A;  2ESN A;  3M1E A;  3JAM Z;  3HHG A;  1J7K A;  4OOI A;  2Q8K A;  1OYI A;  4L9V A;  4UV9 A;  3SHF A;  3TGN A;  4ENK A;  4M9S A;  4LK1 F;  3RKX A;  2VOP A;  3SZP A;  4OMZ A;  2ZNY A;  2CSO A;  3J80 K;  1KYZ A;  5FD6 A;  3K9T A;  3HRT A;  3WU1 B;  1V3F A;  1IRF A;  4XBF A;  4MTD A;  2IT0 A;  3HRM A;  2K4J A;  1CF7 A;  2OAZ A;  1W5S A;  4KN7 X;  4PDK A;  4FT8 A;  1XSX A;  2JPC A;  1LQ1 A;  4XLN F;  2PMU A;  1W7P D;  3KCC A;  2XRO A;  3KP7 A;  4KT5 C;  5AON A;  1WRJ A;  5L3D A;  1U6G A;  3IL2 A;  4U0V A;  3F23 A;  3CO7 C;  2HEO A;  1FSE A;  5FLX Z;  4WF2 A;  3I59 A;  2EFP A;  3KE2 A;  2WWY A;  2UXX A;  4CXF A;  2FML A;  1L0O C;  3I71 A;  5H20 A;  1ONV A;  1HBX G;  4GYG A;  2WC2 A;  2XAS A;  2CWE A;  5D4S A;  2VOO A;  4XRF A;  1ZRD A;  5LHG A;  1R00 A;  4OIN F;  1ZG3 A;  2G9W A;  3EYY A;  3I58 A;  1KU2 A;  3K1P A;  4HLY A;  4KUM A;  1QZZ A;  1ZRF A;  1G3W A;  3HRS A;  3SFZ A;  4WCG A;  4EM1 A;  1RUO A;  4LK0 F;  3KP4 A;  2UXN A;  2DI3 A;  4A0X A;  5ED4 A;  4L5I A;  3F8C A;  4PGG A;  1MD0 A;  3ZMD A;  2FF4 A;  4R8H A;  4R79 A;  1Z9C A;  2DU9 A;  5F6F A;  1OYY A;  1EH6 A;  1I1G A;  4TV7 A;  4AIJ A;  3T0Y A;  3CTA A;  3OV8 A;  1FNN A;  2FKD A;  2QYO A;  2Y75 A;  1XSD A;  2GZW A;  3NRV A;  4G7H F;  2O8X A;  2PQ8 A;  3ZMZ A;  1YW9 A;  3G73 A;  3M9A A;  2VBZ A;  4P5O A;  1MZB A;  4ASN A;  1B12 A;  2EFO A;  5L3B A;  3BPV A;  4DNC A;  1BC7 C;  5DDG A;  2GQQ A;  3G3Z A;  2VBW A;  5DCF A;  1XDS A;  4ETS A;  3GFJ A;  3DV8 A;  3ROU A;  4LB5 A;  3R0A A;  2MLG A;  1YFH A;  3ZMS A;  1EH8 A;  2ACJ A;  2V6C A;  5H6R A;  2P5K A;  3K2Z A;  4HV5 A;  2HQN A;  1ZGA A;  3I4P A;  1YQA A;  1XGS A;  2XVC A;  3JTG A;  1T7D A;  1BBY A;  4I01 A;  2EFW A;  2FE3 A;  3GZ6 A;  4BQA A;  5E8G A;  2R7F A;  5CVV A;  3KZZ A;  4BYY A;  1R1T A;  3VOD A;  1ZHF A;  4HDU A;  4M71 A;  3NQO A;  4R1H A;  2M1B A;  3I64 A;  3BJ6 A;  3GFM A; 
#chains in the Genus database with same CATH topology
 4IHW A;  2HTJ A;  4IQJ A;  3KEY A;  2QUF A;  3IRR A;  4HNU A;  2ZXH A;  2GM4 A;  1W1W E;  2LK2 A;  4O3M A;  4JX4 A;  4GXO A;  3WTW C;  2KL4 A;  4XID A;  2M4G A;  3TP3 A;  2IA1 A;  2BVM A;  3LSJ A;  3A1Y A;  3O3K A;  3TW7 A;  4K2E A;  2ZJ2 A;  3QYF A;  1YW7 A;  4OIQ F;  4W1U A;  4O5V A;  4HX4 A;  4D0P A;  5EYR A;  4IL6 C;  2QCO A;  3WTU C;  4HOB A;  3V4G A;  1K4T A;  3C2B A;  2NXN B;  3G71 I;  1S6L A;  2FOK A;  2EB7 A;  5LHH A;  3LNQ A;  3W6K B;  4PJM A;  3QOP A;  2PLY A;  2DA3 A;  3RSN A;  2L4M A;  4A3K J;  2VQG A;  1T2K A;  4IPA A;  4IQ4 A;  5H2F C;  2QBY A;  1PVE A;  2DOF A;  5IY5 H;  1IV6 A;  1J2X A;  2W85 A;  4XLH A;  1HKQ A;  3IH2 A;  2MGQ A;  1VQN I;  4DZJ A;  3HM5 A;  5HLT A;  3DQV C;  3U1K A;  3BR6 A;  2FMY A;  5FFZ A;  2W7N A;  3FWE A;  2E35 A;  1UHW A;  4BQQ A;  4CCL A;  4AIK A;  3U21 A;  2QWW A;  1R5G A;  3R61 A;  2BHZ A;  2FNA A;  5FKK A;  5GAD J;  1ETO A;  2XAH A;  3RIR A;  4IHV A;  2HNF A;  2HOE A;  1X2M A;  1O3R A;  4WWC A;  2R5Y B;  2RN7 A;  1XTA A;  4B3A A;  5DTD A;  4XN0 A;  5FD5 A;  1IRZ A;  3JRI A;  1S7O A;  2EIM H;  4EJU A;  3OYB A;  2MBF A;  2M3A A;  4AWX B;  3JSO A;  1H8A C;  1QVT A;  3KP5 A;  3BY6 A;  5LRS A;  2X1D A;  5GPC A;  2MLK A;  3FZV A;  2QEX I;  4NC7 A;  2M34 A;  2CJJ A;  3HC7 A;  1ZAO A;  1A04 A;  4U7B A;  1V5G A;  1Q1H A;  1OIS A;  3VOE A;  5GTH C;  2DBB A;  2JRM A;  2RNJ A;  1F1Z A;  1K79 A;  5EJC A;  3MAJ A;  1Z3X A;  1FTZ A;  1Y6I A;  3RKY A;  4EVI A;  2CGP A;  1XN7 A;  3CJQ B;  2M7B A;  4IJA A;  1WH7 A;  2ZXW H;  4BXU A;  2EJR A;  2H6C A;  4MNU A;  4RM2 A;  4M72 A;  4BDZ A;  2A6H F;  4NC6 A;  3M3Y J;  3A03 A;  3RPQ A;  1JUP A;  1EA3 A;  1RZ4 A;  2L4A A;  2Z5U A;  1UHS A;  4ZZD A;  5IT3 A;  2XSD C;  3F8B A;  4I0B A;  4BU2 A;  4DYC A;  2RGV A;  2X48 A;  2HZD A;  4G9Y A;  1N75 A;  3CMY A;  3TQN A;  5IYD J;  2LD5 A;  2GXA A;  3OYG A;  2QQB A;  3C2G A;  1BOA A;  2V1N A;  3FXJ A;  1I39 A;  3QYB A;  3OS0 A;  4MGR A;  3FXM A;  1VQM I;  4IF4 A;  1R23 A;  3BP8 A;  3GTP J;  3K4N A;  4BHB A;  2ICW G;  3W2V A;  4EV0 A;  4B47 A;  3ZQH A;  5EDN A;  3ZQF A;  3ABK H;  1HXD A;  3ZRG A;  1TQI A;  3ML6 A;  1PUF B;  3DP7 A;  2VN2 A;  4ZYG A;  1W36 C;  1S7A A;  3S04 A;  2VON A;  4XOR A;  2CO5 A;  1Z6R A;  1UJ8 A;  3OYH A;  4XNF A;  3OS2 A;  1HDP A;  3I4M J;  1VFC A;  5HS9 A;  4C9Y A;  1SMT A;  5B1A H;  3CF5 F;  4A3I J;  4BY1 J;  1YS6 A;  3HKZ N;  1E3O C;  2Z33 A;  4AC0 A;  1IXC A;  2H6B A;  4ZDL A;  2IVM A;  5IPA A;  1PUF A;  3H5N A;  4BBR J;  2HZT A;  5ICE A;  5JLX A;  1A6Q A;  2ECB A;  5K7Z A;  1D0X A;  3FBN B;  4O6J A;  2BE5 F;  1SFK A;  1TC3 C;  1QGP A;  1KCA A;  1KGS A;  1UG0 A;  1SC7 A;  1G8X A;  2K86 A;  3OYK A;  2EK5 A;  2IEK A;  5JLW A;  1A31 A;  1XGO A;  1SFE A;  2R5Y A;  4KN4 X;  2EIK H;  2BBY A;  4UV8 A;  2LFB A;  4IOA F;  4XRM A;  5E1W A;  3TO7 A;  3DBR B;  3S32 A;  2DT6 A;  3CJN A;  2OCE A;  3L2C A;  3BJA A;  3HUG B;  1SD6 A;  3WTT C;  3K7A J;  5DS9 A;  2GXG A;  3S1M J;  5EEA A;  3MN2 A;  2L01 A;  3L2Q A;  3J81 K;  5BPI A;  3GTM J;  2EZH A;  2RKH A;  3Q3S A;  1WQ2 A;  1MBJ A;  4L0Y B;  2QBY B;  1PUE E;  3A02 A;  1YI2 I;  5J47 A;  4KIC A;  3GF2 A;  2M0M A;  4PJN A;  4IKF A;  2D1H A;  1JGS A;  1G59 A;  3JTH A;  2QKL B;  3QPL A;  2FU4 A;  5LGU A;  3C3W A;  2DMP A;  5F0C A;  1U9N A;  1R71 A;  5IYB J;  3ERE D;  2RC4 A;  1E2X A;  4LOC A;  1Y1W J;  1B59 A;  5CVU A;  2JRT A;  3E5X A;  2VBX A;  3JW4 A;  4Y13 A;  5JI6 A;  5E3N A;  3J7Z I;  1DDN A;  3HOY J;  2DJI A;  4EM0 B;  2PX9 A;  3CCQ I;  3IH3 A;  1WGX A;  3ZP5 A;  1HA8 A;  1W36 D;  3BTJ A;  2FX0 A;  2LLK A;  3GFI A;  2VL8 A;  3H9J A;  5GP9 A;  3WE2 A;  4QLC U;  2HFH A;  4IRH A;  5F27 A;  1Z21 A;  1USS A;  1D0Z A;  5J8F A;  1I50 J;  1SVO A;  4B4C A;  2DQL A;  4PSW A;  4PSX A;  3ASN H;  1G6N A;  2D45 A;  1OYW A;  2Y30 A;  1ULY A;  3Q0V A;  4RB2 C;  5LGT A;  3FM3 A;  3KZY A;  4OAZ A;  5GTI C;  2L3D A;  3OR1 C;  3VSL A;  2JA6 J;  1P92 A;  4XM3 A;  2HXO A;  5KVR A;  1S7E A;  1B4A A;  1OLT A;  2VQC A;  1MH3 A;  2TDX A;  2WA0 A;  3E6C C;  1SMY F;  1QA6 A;  3EUH C;  4Q5S F;  3PQK A;  3V42 A;  2R92 J;  2QQ8 A;  2IW5 A;  1ZGJ A;  1WJC A;  1S8N A;  3IV5 A;  4KIF A;  3DKX A;  1FLI A;  1TQP A;  4YFX F;  1MDM B;  2FJR A;  2M5W A;  3E5Q A;  4DJA A;  3I54 A;  1MKM A;  4D9J A;  1XMK A;  2KP6 A;  2K27 A;  3HTU A;  4BDY A;  3QQA A;  1I6X A;  1VI0 A;  1KQ8 A;  4D1Q A;  1SVL A;  1RR7 A;  2GA1 A;  3PSI A;  2HVQ A;  4KIG A;  5KAF C;  3RKQ A;  3BOQ A;  2VOD A;  5FKM A;  2O03 A;  5JR3 A;  2P8T A;  3OL4 A;  3LSH A;  2EZI A;  1YRN A;  1Z6T A;  3T5X A;  1LDJ A;  3L09 A;  2XUB A;  3L7W A;  2L5Q A;  2DK5 A;  3LAP A;  1R4N B;  2KKO A;  2GA2 A;  1MSE C;  4F7Z A;  4XK4 A;  5TJJ A;  2X51 A;  1Y1V J;  2P6S A;  4MEX F;  2ZBK A;  2KLO A;  2V1X A;  1TNS A;  3WOD F;  2ZME C;  4HBL A;  5KHD A;  1I3A A;  1G2H A;  3FBI B;  2A69 F;  3FHZ A;  3CUQ C;  3LA7 A;  2R7O A;  4PJJ A;  2O6G E;  4JX6 A;  3Q0U A;  2UZK A;  1GVJ A;  3GX4 X;  2RDP A;  5M3F J;  3I5U A;  2CV0 A;  4AIH A;  2LBF B;  4B8X A;  1QO0 D;  4A0Z A;  2R7W A;  4XON A;  3H9Q A;  1KYW A;  3DEU A;  2DOD A;  5HOO A;  3GZ5 A;  3RYR A;  3ULQ B;  4GYI A;  2IGM A;  1MBK A;  2QEN A;  1R36 A;  2V26 A;  3H1C A;  3HYI A;  5D5V B;  2L7Z A;  2CW7 A;  2STW A;  3CCS I;  3GTL J;  3CDL A;  2G7H A;  4LFU A;  1VZ0 A;  2MH2 A;  1LVK A;  4E4H A;  1N78 A;  3BC8 A;  2W24 A;  4KMU X;  2BXZ A;  1OQY A;  1P4A A;  2PMZ A;  3J7Y J;  2J5P A;  5EEG A;  3GME A;  3O8H A;  3LWF A;  1G4D A;  1IAW A;  4YFK F;  4B09 A;  4OIR F;  2X4H A;  1VQP I;  1GXP A;  2Y69 H;  1ENH A;  2ZME B;  2CS3 A;  3HPG A;  4U7D A;  2R5Z B;  1B1B A;  3Q9V A;  4A0Y A;  2OCC H;  2H27 A;  1ETV A;  4A69 C;  5HLG A;  2M8G X;  3W2W A;  3FIS A;  2AQE A;  4A6D A;  5FJ8 J;  1RES A;  3KYD B;  5J1U A;  2R7D A;  3WTV C;  3CCE I;  3CES A;  2O61 A;  1X2N A;  1TWC J;  2ZFU A;  4C3H J;  4BUP A;  4V2G A;  1J0R A;  3DLA A;  3GFL A;  5F0H A;  3G6E I;  3S15 J;  1JHF A;  3OYD A;  4XKC A;  3S1R J;  3SQN A;  5FKO A;  2XAF A;  5L3E A;  2K02 A;  2RAE A;  3VYS B;  2IXS A;  3BQZ A;  3CQZ J;  4ZYE A;  1MDM A;  2FBK A;  2KMU A;  3DFG A;  5ILS A;  2HYJ A;  1T38 A;  1IUF A;  2F4M B;  3W3C A;  3CD6 I;  2Y31 A;  4IXA A;  2FRH A;  3DU6 A;  3TL4 X;  2CUE A;  3GLX A;  3PQJ A;  4CCN A;  2HS5 A;  2ELH A;  4HF0 A;  2OC6 A;  1D8J A;  2HYF A;  3BLY A;  4FIS A;  2EFN A;  1APL C;  3VEP A;  4MTE A;  2NNY A;  4I76 A;  4LLL A;  3G4S I;  3MQ0 A;  2DAO A;  5F1J A;  4RB1 A;  1ZGW A;  1KQ9 A;  3E6B A;  3FIW A;  3HPH A;  2QSG X;  3C18 A;  3ZPL A;  1DPR A;  1LE8 B;  2VXD A;  2WB1 A;  1R1V A;  2DMN A;  2WY7 Q;  3WTY C;  3BTI A;  3G1L A;  3CJT B;  4HNT A;  1ORK A;  4RDU A;  1OCP A;  4BJT A;  2KIU A;  3ZQC A;  4M73 A;  2NVY J;  5LBQ A;  3CO6 C;  2DW4 A;  4E6K G;  2PI0 A;  3E0J B;  1D5V A;  2X6Y A;  5IP9 J;  1Z7L A;  3L1P A;  3RTR A;  5LHI A;  3CMA I;  4FAS D;  1ERD A;  4YIR X;  5IT9 K;  3O8G A;  2A61 A;  3P7N A;  3CLQ A;  2B0L A;  4AU7 A;  1WFX A;  3QPT A;  3VSK A;  1FYK A;  2FBH A;  5DEQ A;  3JSP A;  4HQE A;  1XCV A;  2ZSI B;  5CLS A;  2LRE A;  2OPT A;  4MQ9 F;  1X1P A;  2IA0 A;  1D8K A;  2A68 F;  2B63 J;  3KZI C;  1WJA A;  1Q1V A;  4L0Z B;  1J59 A;  3FMR A;  2W00 A;  2ZCW A;  1E17 A;  2L9N A;  1TLH B;  2DQR A;  4PUS A;  3F21 A;  2RRE A;  2X1E A;  4CYC B;  1R4M B;  5CQG A;  4M6Y A;  3J81 Z;  3W6V A;  5FGM A;  3WG7 H;  1EJ9 A;  2X6X A;  4E7H A;  1TW2 A;  3PFI A;  3LA2 A;  4CIC A;  4F91 B;  3OYM A;  1W0T A;  3PO3 J;  1FZP B;  3K1M A;  1WZ2 A;  2LF8 A;  3IAS 2;  1MBH A;  2QSF X;  3BG5 A;  3E1S A;  2Z9O A;  5J6X A;  4LGW A;  4S04 A;  5J1Y A;  3MKY B;  3HDD A;  2DK8 A;  4L18 B;  2ZC2 A;  3CP2 A;  2HTS A;  2JJ7 A;  3I59 B;  2MFZ A;  3RPU D;  1SFU A;  2M8E A;  2LH9 A;  2JVG A;  1DGW Y;  1LDD A;  3HRU A;  4U0W A;  2AXT C;  4YFN F;  4E7K A;  1AWC A;  2R7V A;  4D5C A;  4X6A J;  3OMY A;  1ETX A;  1OR7 A;  3DPU A;  2VC1 A;  1K78 A;  1FP2 A;  2LDU A;  2VLA A;  5E1X A;  1RNL A;  5FO5 A;  4B48 A;  3O2P E;  3SFI A;  4MHG A;  1X58 A;  3F6O A;  2HPM A;  1U5T C;  3WU2 C;  1Z0X A;  5JFR A;  5FRM A;  4LB6 B;  4KIT B;  1RR8 C;  3L9F A;  4E7J A;  1BW5 A;  2HXI A;  3GTK J;  2P6T A;  2VBY A;  2DOA A;  3OYN A;  2DMT A;  1KU7 A;  2V79 A;  2OV7 A;  4ZC3 A;  3LFK A;  2VAS A;  1PP7 U;  3CDH A;  4EM2 A;  1ZRC A;  2EZL A;  3KEQ A;  5EG0 A;  1HQC A;  4EJT A;  1XSV A;  4HF1 A;  3OSF A;  3F22 A;  1CF7 B;  1XMA A;  3Q9S A;  2HWV A;  4RAG A;  1W0U A;  1S9H A;  3H5A A;  1HLV A;  4JX5 A;  2ZSH B;  1IN8 A;  2ZJQ F;  4CSW A;  3QP6 A;  1B6A A;  3KET A;  1VF9 A;  1FWZ A;  2Z1D A;  4CCJ A;  4Z6Y A;  2DYR H;  3RYP A;  3NAU A;  2VIX A;  1YE9 A;  2K4B A;  3VFZ A;  3ABU A;  4D5F A;  4E7Z A;  4ZH4 F;  3PIP F;  3CCL I;  1QQI A;  2X6O A;  2ZO4 A;  3N97 A;  1I6H J;  2M30 A;  2IAI A;  2NOG A;  3ABT A;  1S29 A;  2KJB A;  1ZR4 A;  4KNY A;  1VND A;  1JUS A;  4FE7 A;  3RKW A;  3PNT A;  1FP1 D;  4BL0 B;  4N4N B;  4G6T B;  3C7J A;  4XSX F;  4NC8 A;  2KDZ A;  2K3F A;  5M3M J;  2DPD A;  1FYM A;  2D2W A;  1MMG A;  2IGO A;  2VUM J;  2VKH A;  2P5V A;  1FJL A;  3JCU C;  5BPD A;  3RDI A;  2G7U A;  4IHY A;  2XKP A;  5F08 A;  2OU2 A;  1MBE A;  2NAZ A;  1ZN2 A;  3KYL A;  2F4O B;  3AG3 H;  5IT9 Z;  1D1A A;  1MMN A;  4HQM A;  2XC7 A;  3K1N A;  1QPM A;  2Q2E A;  4I09 A;  5F0F A;  1GDT A;  2F6C A;  4G6Q A;  4M3G A;  1YYV A;  2K9S A;  2NNN A;  2BY1 A;  2XAU A;  3FKI J;  5KAI C;  1BN5 A;  4UUS B;  4BHC A;  2QQ9 A;  3E7L A;  3FM5 A;  5HS7 A;  1LEB A;  3KX2 A;  5C3E J;  1EH7 A;  3T8T A;  1NK2 P;  3CCM I;  4Y15 A;  2LTP A;  3FKJ A;  4U88 A;  1XGM A;  2V1U A;  1KU3 A;  1KZH A;  2ME0 A;  4PFP A;  4NB5 A;  1HKT A;  3QAH A;  1YJ9 I;  2DOE A;  3OL3 A;  1MBF A;  1MMS A;  3CF2 A;  3HOZ J;  3S2H J;  4CH7 A;  1FOX A;  2A5Y B;  2Z99 A;  2VKD A;  5A2Q K;  3E6D A;  2GOM A;  4CCO A;  3CCR I;  5FKL A;  2J5O A;  2QQA A;  3FXO A;  2CG4 A;  3F8N A;  5JVG F;  4LIV A;  3OOU A;  3K0L A;  4CDG A;  3RI4 A;  1PDN C;  3IKV A;  4IVN A;  3S93 A;  2H8R A;  4A6E A;  3BTC A;  3WU0 A;  2VJ5 A;  4JK1 X;  5E8I A;  4BS9 A;  1HW2 A;  4RAY A;  2HQ5 A;  3JRC A;  1SD7 A;  2CYY A;  1W7P B;  2EV5 A;  3M8E A;  2A5W A;  2L2O A;  2AQF A;  5C44 J;  2P0W A;  2O7O A;  1Z1D A;  3GXO A;  1SFX A;  3R0J A;  1IO2 A;  1JHE A;  1MNM C;  1BI2 A;  2JTV A;  2NS0 A;  4MEY F;  1I5Z A;  3E97 A;  3JRD A;  3A0B C;  3S2W A;  5ICC A;  2EA2 A;  2PJR B;  1LDK B;  2JSC A;  5DM7 F;  2OF7 A;  3L00 A;  4M74 A;  1ZLJ A;  2CQN A;  4GO1 A;  2LF7 A;  2PBI A;  2Y0S N;  2F48 A;  5K7H A;  3KP2 A;  4IOC F;  1V5E A;  2PJP A;  5CVR A;  1MJA A;  1WI3 A;  2L7F P;  5K1Y A;  2R7R A;  2HKX A;  4IHX A;  1XD7 A;  4OIP F;  2YU3 A;  4CCK A;  3OYA A;  2W25 A;  3A4C A;  5LEK A;  4LG0 A;  4OMY A;  2XB5 A;  3R4K A;  1V5F A;  1U2W A;  2QA4 I;  3FXK A;  1Z77 A;  1IF1 A;  2XF5 A;  4LIU A;  2F5F A;  3DF8 A;  2A05 A;  3OIP A;  2P5L C;  2XRN A;  3MKL A;  4BE0 A;  4FX0 A;  4P9F A;  1QZY A;  2WTE A;  4XKV A;  3TBI A;  2BV6 A;  2ZKZ A;  3GTJ J;  2H8W A;  4NQW B;  3AL0 B;  1ON1 A;  2ZNZ A;  4G7Z F;  4IHS A;  2DT5 A;  1QNT A;  4II3 A;  4DOZ A;  4BKX A;  1B72 B;  2QSH X;  1SD5 A;  3L2W A;  1YJN I;  1LB2 A;  3C1D A;  5EGO A;  3M1C A;  3DKW A;  5B5E C;  2HKO A;  3JRF A;  4A3L J;  2H09 A;  1RKT A;  4M9X A;  4S05 A;  3GTO J;  5D6E A;  3VDX A;  2R7T A;  1G3Y A;  3OOP A;  2V6E A;  3D1N I;  3HG9 A;  2LKP A;  1Z7U A;  4IRI A;  2JT1 A;  2WV1 A;  3ABM H;  3PO2 J;  5ICF A;  4P1W A;  2HDW A;  1O7L A;  1TBX A;  4BNC A;  4BY7 J;  3VYU B;  4A5M A;  3NWS A;  3HSE A;  4M6X A;  5J40 A;  2DT7 B;  2M45 A;  2VXZ A;  4Y33 A;  4XRS G;  2LC2 A;  4F3Q A;  5K5O A;  1HSJ A;  1NG7 A;  1EKE A;  2I10 A;  4HA8 A;  2LR8 A;  5J4V A;  1FIA A;  4AYB N;  1ZQ3 P;  2JSP A;  2HOS A;  3TO9 A;  3BZC A;  1IXR C;  2XPU A;  2YR2 A;  3MVP A;  4W97 A;  1ZYR F;  3AKZ A;  2MA3 A;  5HDG A;  4HAM A;  3ISP A;  4UY8 I;  2VI6 A;  3F0C A;  1EF4 A;  3H3U A;  3LST A;  1MW7 A;  1RRJ A;  4JP0 A;  3HTS B;  5DCM B;  4FE4 A;  1IW7 F;  1E3P A;  1FTT A;  2PMZ N;  2M2E A;  1X1B A;  2WY8 Q;  1DP3 A;  1AY9 A;  3A2K A;  1ZTR A;  4Q4Z F;  2M87 A;  4X0G A;  3CDI A;  4B43 A;  4BEH A;  3LA3 A;  3ECH A;  2MW8 A;  3Q5F A;  2XGX A;  4BAC A;  5DM6 F;  5CKT A;  3ESW B;  4I7H A;  3JRH A;  2KIM A;  1F9N A;  5HNH A;  2E1M C;  3V7S A;  1FY7 A;  4CZZ A;  1O3T A;  3TO6 A;  4D7M A;  4ON0 A;  4RGU A;  3WGI A;  4MO7 A;  3QOD A;  4RGR A;  4DW6 A;  4IHT A;  2O0Y A;  2R7Z J;  1WSU A;  5LRR A;  3S3O A;  5E3O A;  4V2F A;  3U1D A;  3KLN A;  2GIV A;  4E70 A;  3A01 B;  4CO8 A;  4MFE A;  4DBQ A;  5J8C A;  3QU6 A;  1MH4 A;  2P7V B;  3H92 A;  2PFB A;  4U87 A;  5HLH A;  3P9I A;  2R3S A;  3KPH A;  2MG4 A;  2BEO A;  4L9J A;  2EIJ H;  3MD2 A;  2A07 F;  1ACI A;  2X1C A;  2YX7 A;  1Y0N A;  3HSF A;  2DFH A;  3QRF F;  2OTL I;  2WAE A;  2HU9 A;  3GW2 A;  2HGC A;  4DYQ A;  2B7E A;  2HNH A;  4XOT A;  1YS7 A;  3LSK A;  4WXC A;  5BOX A;  4E7I A;  2XKO A;  2GXB A;  1X3U A;  4EQQ A;  4L5J A;  3R60 A;  3E5U A;  2ISZ A;  4XRS A;  3EQL F;  4IZZ A;  1J9I A;  2MH9 A;  4A12 A;  5GPA A;  4WX9 A;  1LKX A;  1XPX A;  5F64 A;  5F1R A;  4CYD A;  1FBQ A;  1WJE A;  3LQQ A;  5D8K B;  3TOB A;  2OA4 A;  4HRI A;  2ELK A;  2W1O A;  4I99 C;  2CFX A;  2F5V A;  1P7J A;  1KQ0 A;  2DTR A;  2OJE D;  3LSG A;  2LYC A;  3COA C;  3HOS A;  2DMQ A;  4NNJ A;  1D1B A;  3GO5 A;  2OQG A;  2IPQ X;  1UST A;  5CYV A;  3JRA A;  1VTN C;  4IO9 F;  2DJN A;  4P96 A;  2Q1Z B;  1BC8 C;  2LG4 A;  1LNW A;  4S0H B;  2K9N A;  4HST A;  4NV4 A;  1WKM A;  2BY3 A;  1TWH J;  3K70 D;  1B8I B;  4I98 B;  5GAH J;  3WE3 A;  3WG9 A;  1S5L C;  5E3M A;  2L7M P;  4KJZ A;  1ETY A;  2ZXI A;  2QKM B;  2XHK A;  2DFE A;  3O6B B;  4ANJ A;  4ENJ A;  1I4V A;  1K7A A;  4HEA 2;  3MZY A;  2V9K A;  5BNG A;  3HL2 A;  5LEJ A;  3LOC A;  4EJW A;  2WB1 N;  3MZH A;  1OCZ H;  1XDU A;  2F5D A;  4UB6 C;  4OWR B;  1WPK A;  4N9I A;  2E2J J;  2DFI A;  3R6S A;  1U5T B;  3EDP A;  1YX5 A;  5CVJ A;  3EUH A;  3VB2 A;  2DXI A;  3IIQ A;  3J80 Z;  3CUO A;  3JRB A;  4EGZ A;  2LSO A;  2QGU A;  2KRC A;  1JGG A;  4HV6 A;  3KYC B;  1JTX A;  5D6F A;  4ZTF A;  3SXY A;  2ZJP F;  2X0L A;  3MWM A;  2OUM A;  2W82 A;  5J4Y A;  1T33 A;  1OJL A;  4FET A;  2OZ6 A;  4C2U A;  3SDB A;  2ID6 A;  2G0E A;  3QU3 A;  3L2U A;  2Y2Z A;  2JUG A;  1IGN A;  1R5H A;  4ESF A;  4C2T A;  3CUQ A;  5DD8 A;  2P7C B;  2ZFW A;  3CMM A;  3RZD J;  3FDY A;  2IGK A;  4KIB A;  2FSW A;  2E2H J;  2WAQ A;  1IJW C;  3ZQL A;  3B73 A;  3FK6 A;  2XV4 S;  2VT2 A;  2IJL A;  5C4X J;  3GZN B;  1FX7 A;  2FA5 A;  3HHH A;  3ZQ7 A;  2OD5 A;  1H88 C;  3BJO A;  3ZMU A;  3KLO A;  2K3P A;  2ZXJ A;  3NWT A;  1T6S A;  4FTH A;  4PGH A;  1XS9 A;  1O3Q A;  2KPM A;  2EV0 A;  4GGG A;  2B9S A;  4XKB A;  3U9G A;  1QHH D;  5HS8 A;  1B9M A;  1LUJ B;  2E7X A;  3H3Z A;  5ICG A;  2COM A;  4A5N A;  2CH0 A;  4CUG A;  2ESH A;  1BJA A;  1OPC A;  3PFY A;  4LJZ F;  4UHT A;  1XX5 A;  1FOY A;  4BE1 A;  3BPX A;  2MAB A;  4HDV A;  2QLZ A;  4ZYD A;  3K4B A;  4RB3 C;  2ADU A;  3I3L A;  4PJ0 C;  3F3X A;  4LMY A;  5K7F A;  2K9Q A;  2XGD A;  1MJB A;  3OIQ A;  2EA4 A;  1FEX A;  3K69 A;  3E3V A;  1WJB A;  3L2R A;  2MC3 A;  4UNO A;  3I0T A;  3EET A;  1LVA A;  3I53 A;  5IOY A;  3BG6 A;  2DDB A;  1JXS A;  2UUZ A;  5L3F A;  3JRE A;  3GTQ J;  2EZK A;  3WGH A;  4IX7 A;  1CGP A;  4I0A A;  4C3J J;  4A3M J;  3ZN1 A;  5FLM J;  2R7U A;  4BXF A;  4BXX J;  5E79 C;  1Y0U A;  3CCY A;  1SD4 A;  2CU7 A;  1DP7 P;  2STT A;  2XRL A;  4NDL A;  1SAX A;  1UMQ A;  3REO A;  3IHU A;  3PNY A;  2EWN A;  4XMY A;  5FKN A;  1NG6 A;  2OZU A;  2RQP A;  3X2Q H;  2RNG A;  2LNB A;  2K9M A;  1SAN A;  4N31 A;  5CJ9 A;  1UEL B;  3BCB A;  1LFP A;  2DDA A;  1D3Y A;  2LY2 A;  3F8M A;  1V4R A;  2E7W A;  3V8L A;  1JT0 A;  3WTS C;  1T56 A;  2DPU A;  2FNP A;  2OQR A;  2VKE A;  3I56 I;  4FHT A;  1X4P A;  3Q0W A;  2A3S A;  3BG9 A;  1IN4 A;  2HR3 A;  1I1S A;  3PL8 A;  5DV5 A;  1GV2 A;  4M3E A;  2A6E F;  5EF6 A;  1YIJ I;  2HDD A;  2JVH A;  5TRD A;  2E71 A;  2V1D A;  4HSR A;  4QPO A;  4ZZL A;  4KFC A;  1Y8R B;  3B6C A;  3RPU A;  5BQT A;  1JKO C;  1ITY A;  2D1V A;  2JN6 A;  5F04 A;  2Q0O A;  4N4O B;  2BW3 A;  1TTY A;  3VYR B;  1UHM A;  1TZL A;  5M5X J;  1KN9 A;  1YIO A;  1WWX A;  4HZF A;  1VQ7 I;  2M9H A;  1XGN A;  3DBH B;  3P9K A;  3SEQ A;  5FB2 A;  3GVA A;  3BWG A;  2K5C A;  3ABL H;  1B72 A;  3V7R A;  2HOA A;  4ENM A;  2XIG A;  4PZJ A;  5BS6 A;  3KP3 A;  2E1C A;  2BXY A;  3BG7 A;  1SVM A;  1GT0 C;  1YW8 A;  2BGC A;  2FBI A;  5LLQ A;  4HF2 A;  1W5T A;  5J3L A;  1T98 A;  3HB9 A;  4XLP F;  1BIB A;  2CQK A;  1X1C A;  3J7A Y;  3BT9 A;  2V9P A;  1YX3 A;  5FLV A;  3KP6 A;  1QHG A;  4G12 A;  5A2Q Z;  3FHN A;  3S3N A;  1TL8 A;  5K5R A;  2K9L A;  3D5S C;  3K4C A;  4LG0 B;  2Y9Z A;  3FMQ A;  5HVQ C;  2BYV E;  2DN0 A;  1YJW I;  4AM3 A;  4B1R A;  4A3G J;  3HGG A;  3N05 A;  4ME8 A;  3FXQ A;  2R7X A;  2ZB9 A;  4ENN A;  2CQQ A;  5ERI A;  3ERM A;  3HKZ A;  1ZG1 A;  3ZR8 X;  3DTK A;  3M8J A;  1DU0 A;  1UCR A;  2XGE A;  2XSJ C;  2EIN H;  1HW5 A;  3U2R A;  2KIS A;  2NYX A;  3ZMT A;  4G8X A;  4XLA A;  1YG2 A;  1UFM A;  5E1Z B;  5ILU A;  4EJV A;  3QPS A;  2WV0 A;  1BIA A;  1Z91 A;  3UR3 C;  1V55 H;  2DYS H;  3S8P A;  2I5U A;  3MKZ A;  4ZYA A;  1BW6 A;  5AIQ A;  5E3L A;  2E1O A;  4UVB A;  3M8F A;  1JKR C;  4EEF G;  2XAG A;  1IRG A;  2CV2 A;  3T1B A;  1TWF J;  4LLG F;  4J00 A;  2IS4 A;  1BI0 A;  3IC7 A;  2AS5 F;  4L5E A;  1JT6 A;  1B8I A;  2PN6 A;  4RGX A;  2DA7 A;  1ETW A;  3FXU A;  4JQF A;  2O3F A;  1NHA A;  5CPR B;  3OWT A;  1DUX C;  3ASO H;  4U0Y A;  4NHJ A;  1HW1 A;  4BJ5 C;  3V7C A;  4RAZ A;  1LEA A;  3ZCO A;  1V54 H;  3D0S A;  4RAF A;  2KJC A;  4ABZ A;  2DA6 A;  2FXA A;  1S3J A;  2JPB A;  3V8K A;  2EBI A;  2KFD A;  2Y48 A;  4M3B A;  5D5U B;  1JJ8 C;  1LPQ A;  2DMU A;  2Y0M A;  3E6M A;  3FMS A;  1QRY A;  2K40 A;  1STZ A;  3H35 A;  1XMX A;  3T8R A;  4KYW A;  2E2I J;  4ZYH A;  1HST A;  2DA2 A;  4CCM A;  3MEX A;  3JAM K;  1YLF A;  1U78 A;  3PIO F;  2QZ8 A;  4UUS A;  1WHU A;  3H9G A;  1ZG5 A;  1NK3 P;  3WTX C;  1A6I A;  2WAQ N;  1NTC A;  2XAQ A;  2FUG 2;  1PYV A;  2Q2E B;  3GCM A;  2LMD A;  2RV8 A;  1X3Z B;  2EQR A;  5DYM A;  3M7G A;  2D5V A;  1DGR M;  1FOK A;  2NVX J;  1R22 A;  3HZJ A;  1JTY A;  2JK3 A;  2VPR A;  1Y39 A;  2VQL A;  4K8W A;  4AVP A;  2XGC A;  3TMO A;  1ZLK A;  4I02 A;  3IWZ A;  1YTY A;  2ISY A;  3IRQ A;  1AU7 A;  4YII A;  3KFW X;  3MCZ A;  4UXN A;  2TCT A;  4UVC A;  1P4W A;  3CC2 I;  2A6T A;  5JHF A;  1WVR A;  3DTE A;  4CZC A;  2KRF A;  4V19 K;  5EZG A;  3NEU A;  4RBO A;  1R58 A;  1L3L A;  1I27 A;  4BQN A;  4YRV A;  3CP8 A;  3QP5 A;  2HI3 A;  1U5T A;  1M1E B;  5GAG J;  3QWL A;  2JA8 J;  2LRD A;  5M5Y J;  1IRX A;  3D5L A;  1O4X A;  2R93 J;  5HOD A;  1IZ1 A;  1F4K A;  2MC4 A;  5D5X B;  1OR7 C;  1IUY A;  2H1K A;  4F93 B;  2NS7 A;  5IOZ A;  3GEZ A;  4Y4R A;  4BJ6 C;  1AKH A;  1QPI A;  3ONQ A;  2DA5 A;  1G3S A;  1ZKG A;  3IAM 2;  3ZQI A;  2W4S A;  3H5R A;  1LJ9 A;  3OYC A;  1IN5 A;  2EV6 A;  2BY2 A;  1QZE A;  1T0F A;  3V8J A;  2E34 A;  4HPQ A;  4JYK A;  5EG0 B;  2H94 A;  4HX8 A;  1N25 A;  4G94 A;  2JZY A;  5JVT A;  1U3E M;  2YSR A;  1FT9 A;  4IRG A;  3WHB A;  5E18 F;  1MIJ A;  4QTR A;  4AID A;  2V9V A;  3F8F A;  2L9R A;  1Y56 A;  1QU3 A;  4Y52 J;  4Y17 A;  1X1D A;  2KHM A;  4HW0 A;  2HDC A;  4C2M J;  1FOW A;  2E1N A;  2VJI A;  5LGN A;  1FBS A;  2HPI A;  4LD5 A;  3HXL A;  3J7A O;  4ITV A;  2BVL A;  1HKS A;  2CW8 A;  4ZJZ A;  1GV5 A;  3H0G J;  4PFO A;  3EYI A;  3CUQ B;  2RVC A;  1IDZ A;  4AD9 A;  3PJR A;  1T39 A;  1BI3 A;  1RIO H;  1RC9 A;  2FJ1 A;  3F6V A;  4M3F A;  1K78 B;  3BRO A;  2LKX A;  3BR1 A;  1WJD A;  4L9N A;  4BH9 A;  1KU9 A;  4AUX A;  5HDK A;  4MIM A;  4B44 A;  2F5E A;  5D4R A;  4JOM A;  2GAU A;  3CME I;  3K10 A;  1T8I A;  2XF7 A;  3IP4 B;  2W57 A;  3RJP A;  1JHH A;  4FX4 A;  1RI7 A;  4WXD A;  2VKV A;  2VE8 A;  2AXL A;  4OIO F;  2DO7 A;  4KA4 A;  2FQ3 A;  3H36 A;  5BMZ A;  5KNL A;  5D5W B;  1R1U A;  3OIO A;  4DQ2 A;  3MZ8 A;  4PK4 A;  1FMW A;  3HOX J;  2E1M B;  1XCB A;  2XAJ A;  2BZT A;  3P9C A;  1WCM J;  4OU0 A;  4RGS A;  1FC3 A;  1AA7 A;  4RS8 A;  5J1R A;  2R7S A;  3LAJ A;  4KDP A;  2RQQ A;  1BI1 A;  2P4W A;  1MJ9 A;  3BZ6 A;  1IG7 A;  1P4X A;  4A3D J;  3C2H A;  4UUV A;  1HCR A;  4EMS A;  4UVA A;  3IWF A;  3UKG A;  1AKH B;  2QVO A;  1DPU A;  1K6O A;  4A3J J;  3I4N J;  2L54 A;  3AG1 H;  4I6Z A;  3OYF A;  1S72 I;  3H3V K;  4DIQ A;  3S14 J;  1YO5 C;  2NRA C;  3S1Q J;  4F55 A;  2BOL A;  4I2O A;  3BDN A;  4Q48 A;  1GHC A;  2L7K A;  1GUU A;  5B1B H;  4BHP A;  2LY9 A;  2VT3 A;  3GBG A;  2WAD A;  1BJZ A;  2CUZ A;  2KQR A;  4QSH A;  3SZT A;  2K85 A;  1FYL A;  1UMU A;  5E20 A;  1R7J A;  3ZQQ A;  4JBA A;  2BHY A;  2IS6 A;  2EPF A;  3DXJ F;  5FFX A;  2JQ7 A;  4GRI A;  4ZDP A;  2JA7 J;  2DA1 A;  2ZJR F;  3ZQG A;  2LKS A;  1IXS B;  2I8D A;  1T0F C;  2CUF A;  5K5Q A;  3LSM A;  5DCM A;  4G6D A;  2VPL A;  4IEJ A;  4HYE A;  3GWZ A;  1K6Y A;  2ID3 A;  4II2 A;  1ZAR A;  4H4K C;  2KIF A;  4CGZ A;  1UZC A;  4QPQ A;  5M5W J;  4AYB A;  1H0M A;  3NAR A;  2YS9 A;  3FXR A;  1OMI A;  2VE9 A;  4RA2 A;  1H9T A;  1VQK I;  1F43 A;  3HGY A;  1J75 A;  5IYC J;  1BOB A;  3S17 J;  3HIF A;  1B9N A;  3DTI A;  1D5Y A;  2VC0 A;  1K61 A;  3IUO A;  3G1M A;  4WXH A;  3GUD A;  1UAA A;  3H0D A;  6PAX A;  4LLN A;  2Z2S B;  1WH5 A;  2HQR A;  2HVR A;  1Z3Y A;  1C0W A;  2F4I A;  1KA8 A;  3KIO A;  3A01 A;  3DLL F;  3SJM A;  5JHU A;  2W84 A;  4M6V A;  4BBS J;  4YG2 F;  1ZK8 A;  1O7F A;  3B02 A;  4N0B A;  3JRG A;  3M4O J;  1DQU A;  2CMP A;  3PUB A;  2MD0 A;  4ZDO A;  3VWB A;  5TGT A;  2GBY A;  4XLE A;  3CC4 I;  1E0E A;  3ZOB A;  3TKY A;  2ZME A;  2DTZ A;  1TT0 A;  5IP7 J;  3OS1 A;  1R6R A;  3AAF A;  1O3S A;  3ZN0 A;  3DU5 A;  1Z05 A;  1G3T A;  2PEX A;  5EZH A;  1VQ5 I;  3F72 A;  3CLO A;  2FEZ A;  2CV1 A;  3W2A A;  4L9T A;  2O5R A;  1OFC X;  2NS8 A;  3WTZ A;  1ZEL A;  4C30 A;  3FX3 A;  3MMY B;  4XKW A;  3L2V A;  5DUK A;  1GLN A;  1BR2 A;  3OYE A;  1WI9 A;  3OYL A;  3EPZ A;  4BE2 A;  3ECO A;  4E7L A;  3K2A A;  4A3B J;  3BQY A;  4UUT A;  3AFH A;  1HC8 A;  2IRF G;  5C4J J;  1FBU A;  4H0E A;  1ON2 A;  4QWQ A;  2VJ4 A;  1U8R A;  4N9H A;  4E7S A;  2HOT A;  4HX7 A;  1OCO H;  2IP2 A;  4ESB A;  2F5C A;  1ZH5 A;  3K4K A;  2Y0S A;  4BAY A;  2N8G A;  2GLO A;  2X9D A;  2Z3Y A;  4RM3 A;  2OBP A;  2X85 A;  3TOA A;  1LFU P;  1F5T A;  1IV8 A;  2EFQ A;  1H9G A;  1ODD A;  4NUB A;  4YIF A;  1SAU A;  4P55 A;  1EV7 A;  1JE8 A;  3DCF A;  1AHD P;  2L02 A;  2K7L A;  1OKR A;  3RQI A;  3GYH X;  5HLI A;  2LP0 A;  2X6W A;  2CUJ A;  3K6G A;  2C6Y A;  1J09 A;  2DA4 A;  1XB4 A;  2UWM A;  1BM9 A;  4HLX A;  4Z2Y A;  5B66 C;  1QBJ A;  2HO0 A;  4RMN A;  1MBG A;  1P7I A;  1TT5 B;  1X3W B;  1W4M A;  2GWR A;  4PCQ A;  1UB9 A;  1TQM A;  2HYG D;  4BGD A;  1POG A;  3DEE A;  1TNT A;  1MMD A;  1TW3 A;  4EGY A;  2IS2 A;  1J5Y A;  3FF5 A;  5EEH A;  4F92 B;  3N4M A;  1AOY A;  3BDD A;  5AIP A;  1KON A;  1PP8 F;  2KZG A;  3OYI A;  2YPR A;  2HVS A;  1REP C;  3SYT A;  4AVZ A;  3MFK A;  3S16 J;  3IKT A;  3LSP A;  3MKW B;  3HOV J;  2LVS A;  1R9T J;  2PMH A;  3HJE A;  2IS1 A;  1YOV B;  1ZRE A;  4P9U A;  2W48 A;  2TRT A;  2YX4 A;  1O57 A;  5H6Q A;  3DPL C;  3KEO A;  4NQW A;  4RB0 A;  2IA2 A;  1R5I D;  4A3C J;  4MQV A;  2BW3 B;  1VQ6 I;  3HOT A;  4Y3O A;  3S1N J;  3PUF A;  4Q47 A;  2R4G A;  2AHQ A;  3DPT A;  2JMW A;  4OAY A;  4FCY A;  3A0H C;  5HDN A;  5CVI A;  4J01 A;  3HSR A;  4A3E J;  2KZV A;  4CA0 A;  4XN3 A;  5GAE J;  3QOE A;  5B3S H;  1IN6 A;  2CRG A;  4B3X A;  3QPH A;  5ILV A;  1RPW A;  3CCV I;  1TWG J;  3AG2 H;  4BQO A;  4C3I J;  1GVD A;  1VQO I;  3LQR A;  1VQL I;  3BR0 A;  1FSH A;  2JUC A;  2H1L A;  1P2F A;  2FQ4 A;  5KK1 A;  1TWA J;  5L3G A;  2PJR A;  1SFO J;  5L3C A;  4HNV A;  3ZXS A;  5FLX K;  3PNV A;  2KIQ A;  4RLQ A;  4DZP A;  3BTL A;  5E17 F;  3LSR A;  1IN7 A;  3BG3 A;  3TDZ C;  5HNF A;  4M3D A;  4GFB A;  2PG4 A;  3CJR B;  4DGW B;  2HQA A;  2XPW A;  4A2U A;  3OY9 A;  4KIS A;  5DD4 A;  1W7P A;  4M9Z A;  4MFD A;  3W6J B;  2XB0 X;  4ESJ A;  2F2E A;  2YU9 J;  2DLL A;  4EJO A;  1YIT I;  3BZK A;  2FOW A;  2QM3 A;  2EIL H;  1IDY A;  1MGT A;  3HEF A;  1P6R A;  5FRO A;  3JR9 A;  4XSZ F;  3TDU C;  3BR2 A;  3DEW A;  2COB A;  3HUG A;  2JA2 A;  4XR6 A;  2MYS A;  2CFO A;  1X19 A;  2MD5 A;  3WGG A;  2CW0 F;  3K70 C;  1GXQ A;  3S2D J;  2CQX A;  4DYR A;  1RUN A;  1VQ9 I;  1JHC A;  1QVU A;  3ZMV A;  2QF7 A;  4G7O F;  4CHU A;  4KMF A;  2ETH A;  2IBD A;  4GCV A;  1T08 B;  4HG2 A;  1FPQ A;  1XG1 A;  3ELK A;  5D8L B;  3OR2 C;  2NVQ J;  4A93 J;  5DUI A;  4WK8 F;  1RKW A;  1K83 J;  1A36 A;  1F39 A;  1K4S A;  2ESN A;  3M1E A;  3VPR A;  1JKP C;  1X4O A;  3JAM Z;  3HHG A;  1J7K A;  4OOI A;  2Q8K A;  2KRH A;  1NH3 A;  1OYI A;  1BR1 A;  4L9V A;  2FD5 A;  4UV9 A;  3SEZ A;  3CCU I;  3SHF A;  1MND A;  2WBM A;  2NVT J;  1SEU A;  2DFF A;  3TGN A;  4ENK A;  4M9S A;  4YEJ A;  3LL7 A;  4LK1 F;  3RKX A;  2VOP A;  2KDO A;  3SZP A;  1U9O A;  4OMZ A;  3GTG J;  2E5N A;  2GIZ A;  4GDF A;  2AO9 A;  2ZNY A;  1VQ4 I;  2CSO A;  1BR4 A;  3J80 K;  1KYZ A;  5FD6 A;  2L9V A;  3K9T A;  2XDV A;  3HRT A;  3WU1 B;  1TP4 A;  1IRF A;  1V3F A;  1UG2 A;  5CQE A;  4XBF A;  2O8K A;  4XL9 A;  4MTD A;  2IT0 A;  9ANT A;  3S3M A;  3HRM A;  1RET A;  4NBQ A;  1FIP A;  2K4J A;  4XLC A;  1CF7 A;  3VYT B;  3BR3 A;  2Y9Y A;  2OAZ A;  1W5S A;  3WHC A;  3TW6 A;  2LY1 A;  1BL0 A;  1CQT A;  4KN7 X;  4PDK A;  1H89 C;  2XPV A;  4FT8 A;  1XSX A;  2JPC A;  1LQ1 A;  4XLN F;  2PMU A;  1W7P D;  4FQG A;  2L0K A;  4LIT A;  1YHQ I;  3KCC A;  3DWL E;  2XRO A;  3KP7 A;  4KT5 C;  4PJL A;  3TP0 A;  3LFU A;  5AON A;  1WRJ A;  3SDG A;  5L3D A;  1U6G A;  1E3H A;  3IL2 A;  4U0V A;  2M0C A;  1ZR2 A;  3CCJ I;  3F23 A;  2ELJ A;  3D5R C;  2VB6 A;  3CO7 C;  4J19 A;  2HEO A;  3DKY A;  1ETK A;  1FSE A;  5FLX Z;  3HOW J;  2LOO A;  4WF2 A;  3I59 A;  2EFP A;  3KE2 A;  3OYJ A;  4EAT A;  2WWY A;  2UXX A;  4CXF A;  1A5J A;  2MSY A;  2E60 A;  3EUK L;  2FML A;  2V7F A;  3RCO A;  2R7Q A;  1R49 A;  2E19 A;  1L0O C;  1Y8Q B;  1MMA A;  3CC7 I;  3HOU J;  3I71 A;  3AL0 C;  5H20 A;  3CZ6 A;  1ONV A;  3GLL A;  2O9L A;  3ZGK A;  1HBX G;  5TIS C;  4GYG A;  2WC2 A;  3I55 I;  1JJ6 C;  2IGN A;  4CYC A;  1IC8 A;  2XAS A;  2CWE A;  3PSF A;  5D4S A;  2WAF A;  4ZTJ A;  3FXL A;  3P5J A;  2VOO A;  1JKQ C;  4XRF A;  1ZRD A;  2M7A A;  5LHG A;  1BA5 A;  1JUM A;  2BY0 A;  3QYE A;  3UNG C;  1R00 A;  4OIN F;  1ZG3 A;  2G9W A;  3BR5 A;  3EYY A;  3I58 A;  1HDD C;  2P81 A;  3LSI A;  1KU2 A;  3K1P A;  4HLY A;  1VQ8 I;  1T95 A;  2YUS A;  4RLF A;  4KUM A;  1DU6 A;  1QZZ A;  3G1O A;  3K4L A;  1HF0 A;  1ZRF A;  1G3W A;  3HRS A;  3SFZ A;  4WCG A;  1A35 A;  4EM1 A;  2KT0 A;  1I3Q J;  1RUO A;  2UV1 A;  4UB8 C;  4LK0 F;  1HOM A;  3IH4 A;  4LG3 A;  3OSG A;  3LMM A;  3AG4 H;  3KP4 A;  2UXN A;  2DI3 A;  4A0X A;  4QIW N;  4L5I A;  4XQF A;  5ED4 A;  2ECC A;  3F8C A;  2OTJ I;  4PGG A;  1MD0 A;  3ZMD A;  4X1E A;  2FF4 A;  4R8H A;  4R79 A;  1Z9C A;  2VJJ A;  1FMV A;  2DU9 A;  5F6F A;  1OYY A;  1EH6 A;  1I1G A;  2R0Q C;  4TV7 A;  4AIJ A;  3T0Y A;  3M07 A;  4BEH B;  3CTA A;  5FRN A;  1OCC H;  3K4J A;  1X1A A;  4Y7N J;  3G2B A;  3OV8 A;  1FNN A;  2EH3 A;  1LE8 A;  1OCT C;  1MSF C;  5LD2 C;  4DBR A;  1MNE A;  5LFA A;  3RQ4 A;  2DCE A;  1P9Q C;  1N77 A;  2FKD A;  2JWT A;  2QYO A;  2JA5 J;  2Y75 A;  2CQ7 A;  1XSD A;  2GZW A;  2M4K A;  3NRV A;  4G7H F;  3F9K A;  3HBL A;  2O8X A;  1JI8 A;  2PQ8 A;  3ZMZ A;  1U0J A;  1YW9 A;  2LBF A;  3G73 A;  2Z16 A;  3M9A A;  2NOJ B;  2GOX B;  2VBZ A;  4P5O A;  1MZB A;  1WJF A;  4ASN A;  1B12 A;  2EFO A;  5L3B A;  1LFB A;  3BPV A;  1ETQ A;  5KCM A;  4DNC A;  4XOP A;  1U8B A;  1W5C C;  3RZO J;  1BC7 C;  5DDG A;  2GQQ A;  3G3Z A;  2VBW A;  5DCF A;  4A3F J;  1XC5 A;  1XDS A;  4ETS A;  3DBL B;  3FK7 A;  3GFJ A;  4YEL A;  3DV8 A;  1YRN B;  2L9S A;  3B6A A;  3ROU A;  4LB5 A;  3R0A A;  2E36 A;  2E5Z A;  3PM1 A;  2MLG A;  4MLO A;  1F36 A;  1YFH A;  1PJR A;  2R5Z A;  3ZMS A;  1EH8 A;  2ACJ A;  2V6C A;  5H6R A;  3SZG A;  2P5K A;  3K2Z A;  4HV5 A;  2HQN A;  1ZGA A;  3BCA A;  2XF6 A;  5EGO B;  5IP6 A;  4XIC A;  4F52 A;  3I4P A;  1YQA A;  1XGS A;  2XVC A;  1Z67 A;  4KT6 A;  1WJ5 A;  4D7N A;  2ME6 A;  3JTG A;  1D0Y A;  1T7D A;  1BBY A;  4I01 A;  2EFW A;  2FE3 A;  3K4M A;  3TED A;  3GZ6 A;  4BQA A;  2NVU B;  3I9V 2;  5E8G A;  2R7F A;  5CVV A;  3KZZ A;  4BYY A;  1R1T A;  3VOD A;  1ZHF A;  1OCR H;  3EUA A;  4HDU A;  4M71 A;  3NQO A;  4R1H A;  4XLF A;  2VQH A;  2M1B A;  1D1C A;  3I64 A;  3BJ6 A;  2V4J C;  3GFM A; 
#chains in the Genus database with same CATH homology
 2HTJ A;  2QUF A;  3IRR A;  4O3M A;  4GXO A;  3WTW C;  2IA1 A;  3O3K A;  4K2E A;  2ZJ2 A;  1YW7 A;  4OIQ F;  4O5V A;  4HX4 A;  4D0P A;  3WTU C;  4HOB A;  3V4G A;  1S6L A;  2FOK A;  2EB7 A;  5LHH A;  3W6K B;  3QOP A;  2PLY A;  2L4M A;  1T2K A;  4IPA A;  2QBY A;  1J2X A;  2W85 A;  1HKQ A;  3DQV C;  2FMY A;  5FFZ A;  3FWE A;  1UHW A;  4AIK A;  2QWW A;  1R5G A;  3R61 A;  2FNA A;  2XAH A;  3RIR A;  2HNF A;  2HOE A;  1O3R A;  4WWC A;  2RN7 A;  5FD5 A;  1S7O A;  4EJU A;  2MBF A;  4AWX B;  3JSO A;  3KP5 A;  3BY6 A;  5LRS A;  2MLK A;  3FZV A;  1ZAO A;  1A04 A;  4U7B A;  1Q1H A;  3VOE A;  2DBB A;  2RNJ A;  1F1Z A;  1K79 A;  3MAJ A;  3RKY A;  4EVI A;  2CGP A;  1XN7 A;  4IJA A;  4BXU A;  2EJR A;  2H6C A;  4MNU A;  4M72 A;  2A6H F;  3RPQ A;  1RZ4 A;  2L4A A;  2Z5U A;  4ZZD A;  5IT3 A;  3F8B A;  4I0B A;  2RGV A;  4G9Y A;  3TQN A;  2QQB A;  1BOA A;  4MGR A;  4IF4 A;  1R23 A;  3BP8 A;  4BHB A;  4EV0 A;  1HXD A;  1TQI A;  3ML6 A;  3DP7 A;  2VN2 A;  4ZYG A;  3S04 A;  1S7A A;  2VON A;  2CO5 A;  1Z6R A;  5HS9 A;  1SMT A;  1YS6 A;  2Z33 A;  1IXC A;  2H6B A;  2IVM A;  2HZT A;  5ICE A;  4O6J A;  2BE5 F;  1QGP A;  1KCA A;  1KGS A;  2K86 A;  2EK5 A;  1XGO A;  1SFE A;  4KN4 X;  4UV8 A;  2BBY A;  5E1W A;  3TO7 A;  3CJN A;  3L2C A;  3BJA A;  1SD6 A;  3WTT C;  2GXG A;  2L01 A;  3J81 K;  5BPI A;  2RKH A;  1WQ2 A;  4L0Y B;  2QBY B;  1PUE E;  4KIC A;  3GF2 A;  2D1H A;  1JGS A;  3JTH A;  5LGU A;  2FU4 A;  3C3W A;  3ERE D;  2RC4 A;  1E2X A;  1B59 A;  5CVU A;  2JRT A;  3E5X A;  2VBX A;  3JW4 A;  4Y13 A;  5JI6 A;  1DDN A;  4EM0 B;  3ZP5 A;  3GFI A;  3WE2 A;  4QLC U;  2HFH A;  4IRH A;  1USS A;  5J8F A;  2DQL A;  1G6N A;  2D45 A;  1OYW A;  1ULY A;  4RB2 C;  5LGT A;  3FM3 A;  3KZY A;  2L3D A;  1P92 A;  5KVR A;  1B4A A;  3E6C C;  2TDX A;  1SMY F;  4Q5S F;  3PQK A;  2IW5 A;  1ZGJ A;  1S8N A;  4KIF A;  1FLI A;  1TQP A;  4YFX F;  1MDM B;  2FJR A;  2M5W A;  3E5Q A;  3I54 A;  1MKM A;  1XMK A;  2K27 A;  3HTU A;  1I6X A;  1KQ8 A;  2GA1 A;  4KIG A;  3BOQ A;  2VOD A;  2O03 A;  5JR3 A;  2P8T A;  1Z6T A;  3T5X A;  1LDJ A;  3L09 A;  2XUB A;  3L7W A;  2DK5 A;  3LAP A;  2KKO A;  2GA2 A;  4F7Z A;  5TJJ A;  2P6S A;  4MEX F;  2ZBK A;  2V1X A;  1TNS A;  3WOD F;  4HBL A;  2A69 F;  3FHZ A;  3CUQ C;  3LA7 A;  2O6G E;  2UZK A;  1GVJ A;  3GX4 X;  2RDP A;  3I5U A;  4AIH A;  4B8X A;  1QO0 D;  4A0Z A;  1KYW A;  3DEU A;  5HOO A;  3GZ5 A;  3RYR A;  3ULQ B;  4GYI A;  2QEN A;  1R36 A;  3HYI A;  5D5V B;  2STW A;  2G7H A;  4LFU A;  2MH2 A;  2W24 A;  4KMU X;  1P4A A;  2J5P A;  5EEG A;  3LWF A;  1G4D A;  1IAW A;  4YFK F;  4B09 A;  4OIR F;  2X4H A;  1GXP A;  2ZME B;  4U7D A;  1B1B A;  3Q9V A;  4A0Y A;  2H27 A;  5HLG A;  4A6D A;  2R7D A;  3WTV C;  2O61 A;  1J0R A;  3GFL A;  1JHF A;  3SQN A;  5L3E A;  2XAF A;  2K02 A;  4ZYE A;  1MDM A;  2FBK A;  3DFG A;  5ILS A;  1T38 A;  4IXA A;  2FRH A;  3GLX A;  3PQJ A;  2HS5 A;  2ELH A;  4HF0 A;  1D8J A;  2HYF A;  2EFN A;  3VEP A;  4MTE A;  2NNY A;  4LLL A;  3MQ0 A;  2DAO A;  4RB1 A;  1KQ9 A;  3E6B A;  3C18 A;  3ZPL A;  1DPR A;  1R1V A;  3WTY C;  2KIU A;  4M73 A;  5LBQ A;  3CO6 C;  2DW4 A;  2PI0 A;  1D5V A;  3RTR A;  5LHI A;  5IT9 K;  2A61 A;  3P7N A;  2B0L A;  3QPT A;  1FYK A;  5DEQ A;  3JSP A;  2FBH A;  4HQE A;  1XCV A;  5CLS A;  4MQ9 F;  2IA0 A;  1D8K A;  2A68 F;  4L0Z B;  1J59 A;  3FMR A;  2ZCW A;  1E17 A;  1TLH B;  2DQR A;  3F21 A;  4M6Y A;  3J81 Z;  5FGM A;  1TW2 A;  3PFI A;  3LA2 A;  4CIC A;  1FZP B;  3K1M A;  2LF8 A;  2Z9O A;  5J6X A;  4LGW A;  4S04 A;  4L18 B;  2DK8 A;  2HTS A;  3I59 B;  1SFU A;  2M8E A;  1LDD A;  3HRU A;  4U0W A;  4YFN F;  1AWC A;  1OR7 A;  2VC1 A;  1K78 A;  1FP2 A;  2LDU A;  5E1X A;  1RNL A;  5FO5 A;  3O2P E;  4MHG A;  3F6O A;  1U5T C;  5JFR A;  4LB6 B;  3L9F A;  2P6T A;  2VBY A;  1KU7 A;  2V79 A;  3LFK A;  1PP7 U;  3CDH A;  4EM2 A;  1ZRC A;  3KEQ A;  1HQC A;  4EJT A;  1XSV A;  4HF1 A;  3F22 A;  1CF7 B;  1XMA A;  3Q9S A;  2HWV A;  1IN8 A;  3QP6 A;  1B6A A;  3KET A;  1FWZ A;  3RYP A;  2K4B A;  3VFZ A;  3ABU A;  4ZH4 F;  1QQI A;  2ZO4 A;  3N97 A;  2M30 A;  3ABT A;  1S29 A;  2KJB A;  4KNY A;  3RKW A;  1FP1 D;  4XSX F;  3C7J A;  2DPD A;  1FYM A;  2D2W A;  2P5V A;  5BPD A;  3RDI A;  2G7U A;  2XKP A;  2OU2 A;  2NAZ A;  1ZN2 A;  5IT9 Z;  4HQM A;  3K1N A;  1QPM A;  2Q2E A;  4I09 A;  4G6Q A;  1YYV A;  2NNN A;  1BN5 A;  4BHC A;  2QQ9 A;  3FM5 A;  5HS7 A;  1LEB A;  1EH7 A;  3T8T A;  4Y15 A;  4U88 A;  1XGM A;  2V1U A;  1KU3 A;  4NB5 A;  1HKT A;  3QAH A;  2A5Y B;  2Z99 A;  5A2Q K;  3E6D A;  2J5O A;  2QQA A;  2CG4 A;  3F8N A;  4CDG A;  3K0L A;  3RI4 A;  1PDN C;  3IKV A;  4IVN A;  4A6E A;  3WU0 A;  4JK1 X;  5E8I A;  1HW2 A;  4RAY A;  1SD7 A;  2CYY A;  1W7P B;  2EV5 A;  3M8E A;  3GXO A;  1Z1D A;  1SFX A;  3R0J A;  1JHE A;  1BI2 A;  2JTV A;  2NS0 A;  4MEY F;  1I5Z A;  3E97 A;  3S2W A;  5ICC A;  2EA2 A;  1LDK B;  2JSC A;  3L00 A;  4M74 A;  1ZLJ A;  4GO1 A;  2LF7 A;  2PBI A;  3KP2 A;  2PJP A;  5CVR A;  1MJA A;  5K1Y A;  2HKX A;  1XD7 A;  4OIP F;  2YU3 A;  2W25 A;  5LEK A;  4LG0 A;  4OMY A;  3R4K A;  1U2W A;  1IF1 A;  2F5F A;  3DF8 A;  2P5L C;  2XRN A;  4FX0 A;  4P9F A;  1QZY A;  2WTE A;  2BV6 A;  2ZKZ A;  1ON1 A;  2ZNZ A;  4G7Z F;  4IHS A;  2DT5 A;  1QNT A;  1SD5 A;  1LB2 A;  3C1D A;  3DKW A;  2HKO A;  2H09 A;  4S05 A;  4M9X A;  5D6E A;  1G3Y A;  3OOP A;  2LKP A;  1Z7U A;  4IRI A;  2JT1 A;  5ICF A;  1O7L A;  1TBX A;  4BNC A;  4A5M A;  3HSE A;  4M6X A;  2M45 A;  2VXZ A;  5K5O A;  1HSJ A;  4HA8 A;  3TO9 A;  1IXR C;  2YR2 A;  1ZYR F;  2MA3 A;  5HDG A;  4HAM A;  3ISP A;  3H3U A;  3LST A;  3HTS B;  5DCM B;  1IW7 F;  1AY9 A;  4Q4Z F;  2M87 A;  3LA3 A;  3ECH A;  3Q5F A;  2XGX A;  4I7H A;  2KIM A;  1F9N A;  3V7S A;  1FY7 A;  4CZZ A;  1O3T A;  3TO6 A;  4ON0 A;  4RGU A;  3WGI A;  4RGR A;  4IHT A;  2O0Y A;  1WSU A;  5LRR A;  3U1D A;  3KLN A;  2GIV A;  4E70 A;  4CO8 A;  5J8C A;  3QU6 A;  2P7V B;  3H92 A;  2PFB A;  5HLH A;  3P9I A;  2R3S A;  2BEO A;  4L9J A;  2A07 F;  2YX7 A;  3HSF A;  3QRF F;  3GW2 A;  2HGC A;  1YS7 A;  4WXC A;  5BOX A;  2XKO A;  2GXB A;  1X3U A;  4EQQ A;  4L5J A;  3R60 A;  3E5U A;  2ISZ A;  3EQL F;  1J9I A;  2MH9 A;  4A12 A;  4WX9 A;  5F64 A;  5F1R A;  4CYD A;  1FBQ A;  3LQQ A;  5D8K B;  3TOB A;  2OA4 A;  2CFX A;  1KQ0 A;  2DTR A;  3COA C;  3HOS A;  3GO5 A;  2OQG A;  2IPQ X;  1UST A;  5CYV A;  1VTN C;  4P96 A;  1BC8 C;  1LNW A;  4NV4 A;  1WKM A;  4I98 B;  3WE3 A;  3WG9 A;  3O6B B;  2XHK A;  4ENJ A;  1I4V A;  1K7A A;  3MZY A;  5LEJ A;  4EJW A;  3MZH A;  1XDU A;  2F5D A;  4N9I A;  2DFI A;  3R6S A;  1U5T B;  3EDP A;  5CVJ A;  3EUH A;  3VB2 A;  3IIQ A;  3J80 Z;  3CUO A;  4EGZ A;  2LSO A;  4HV6 A;  5D6F A;  3SXY A;  2X0L A;  3MWM A;  2OZ6 A;  3QU3 A;  1R5H A;  4ESF A;  3CUQ A;  5DD8 A;  2P7C B;  2ZFW A;  4KIB A;  2FSW A;  3B73 A;  2XV4 S;  2VT2 A;  2IJL A;  1FX7 A;  2FA5 A;  3HHH A;  3ZQ7 A;  2OD5 A;  3BJO A;  3ZMU A;  3KLO A;  2ZXJ A;  1T6S A;  4PGH A;  1O3Q A;  2EV0 A;  4GGG A;  3U9G A;  5HS8 A;  1B9M A;  2E7X A;  3H3Z A;  5ICG A;  2COM A;  4A5N A;  2ESH A;  1BJA A;  1OPC A;  4UHT A;  4LJZ F;  3BPX A;  4HDV A;  2QLZ A;  4ZYD A;  4RB3 C;  2ADU A;  3F3X A;  4LMY A;  1MJB A;  2EA4 A;  3K69 A;  3E3V A;  2MC3 A;  4UNO A;  3I0T A;  3EET A;  1LVA A;  3I53 A;  1JXS A;  5L3F A;  3WGH A;  1CGP A;  4I0A A;  3ZN1 A;  1Y0U A;  1SD4 A;  1DP7 P;  2STT A;  1SAX A;  3REO A;  3IHU A;  2EWN A;  2OZU A;  2RQP A;  2LNB A;  4N31 A;  5CJ9 A;  1D3Y A;  3F8M A;  1V4R A;  2E7W A;  3V8L A;  3WTS C;  2DPU A;  2FNP A;  2OQR A;  4FHT A;  2A3S A;  1IN4 A;  2HR3 A;  1I1S A;  5DV5 A;  2A6E F;  5TRD A;  2V1D A;  4KFC A;  4ZZL A;  5BQT A;  3RPU A;  2D1V A;  2Q0O A;  1TTY A;  1UHM A;  1KN9 A;  1YIO A;  1WWX A;  4HZF A;  1XGN A;  3P9K A;  5FB2 A;  3GVA A;  3BWG A;  3V7R A;  4ENM A;  2XIG A;  4PZJ A;  5BS6 A;  3KP3 A;  2E1C A;  1YW8 A;  2BGC A;  2FBI A;  5LLQ A;  4HF2 A;  1W5T A;  1T98 A;  4XLP F;  1BIB A;  2CQK A;  3KP6 A;  5A2Q Z;  5K5R A;  4LG0 B;  3FMQ A;  5HVQ C;  2BYV E;  4ME8 A;  3FXQ A;  4ENN A;  5ERI A;  1ZG1 A;  1UCR A;  3U2R A;  1HW5 A;  2NYX A;  3ZMT A;  4G8X A;  1YG2 A;  1UFM A;  5E1Z B;  5ILU A;  4EJV A;  2WV0 A;  1BIA A;  1Z91 A;  5AIQ A;  4UVB A;  3M8F A;  2XAG A;  1IRG A;  3T1B A;  4LLG F;  1BI0 A;  3IC7 A;  2AS5 F;  2PN6 A;  4RGX A;  3FXU A;  4JQF A;  2O3F A;  1NHA A;  1DUX C;  4U0Y A;  4NHJ A;  1HW1 A;  3V7C A;  4RAZ A;  1LEA A;  3D0S A;  2KJC A;  2FXA A;  1S3J A;  2JPB A;  3V8K A;  2Y48 A;  5D5U B;  2Y0M A;  3E6M A;  3FMS A;  1STZ A;  3T8R A;  4KYW A;  4ZYH A;  1HST A;  3MEX A;  3JAM K;  1YLF A;  1U78 A;  2QZ8 A;  1ZG5 A;  3WTX C;  2XAQ A;  2RV8 A;  5DYM A;  3M7G A;  1FOK A;  1R22 A;  4K8W A;  4AVP A;  1ZLK A;  4I02 A;  3IWZ A;  1YTY A;  2ISY A;  3IRQ A;  4YII A;  3KFW X;  3MCZ A;  4UXN A;  4UVC A;  1P4W A;  2KRF A;  3NEU A;  1R58 A;  1L3L A;  1I27 A;  3QP5 A;  1U5T A;  3D5L A;  1IZ1 A;  1F4K A;  5D5X B;  1IUY A;  3GEZ A;  1G3S A;  1LJ9 A;  1IN5 A;  2EV6 A;  3V8J A;  1T0F A;  2H94 A;  4HX8 A;  1U3E M;  4G94 A;  2JZY A;  5JVT A;  2YSR A;  1FT9 A;  4IRG A;  5E18 F;  2V9V A;  3F8F A;  4Y17 A;  2HDC A;  4HW0 A;  2E1N A;  5LGN A;  1FBS A;  4LD5 A;  3J7A O;  1HKS A;  3EYI A;  3CUQ B;  2RVC A;  4AD9 A;  1T39 A;  1BI3 A;  1RIO H;  3F6V A;  1K78 B;  3BRO A;  4L9N A;  4BH9 A;  1KU9 A;  5HDK A;  2F5E A;  5D4R A;  2GAU A;  2W57 A;  3RJP A;  1JHH A;  4FX4 A;  1RI7 A;  4WXD A;  2VE8 A;  2AXL A;  4OIO F;  2DO7 A;  4KA4 A;  2FQ3 A;  5BMZ A;  5D5W B;  1R1U A;  4DQ2 A;  1XCB A;  2XAJ A;  3P9C A;  4OU0 A;  4RGS A;  1FC3 A;  4RS8 A;  3LAJ A;  4KDP A;  1BI1 A;  2P4W A;  1MJ9 A;  3BZ6 A;  1P4X A;  4UUV A;  4EMS A;  4UVA A;  3IWF A;  2QVO A;  1DPU A;  1K6O A;  2L54 A;  1YO5 C;  2NRA C;  3BDN A;  4I2O A;  4Q48 A;  1GHC A;  4BHP A;  2VT3 A;  1FYL A;  1UMU A;  3SZT A;  5E20 A;  1R7J A;  4JBA A;  3DXJ F;  5FFX A;  1IXS B;  5K5Q A;  5DCM A;  4G6D A;  4HYE A;  3GWZ A;  1ZAR A;  2KIF A;  4CGZ A;  1H0M A;  3FXR A;  1OMI A;  2VE9 A;  1H9T A;  1J75 A;  3HIF A;  1B9N A;  2VC0 A;  4WXH A;  3GUD A;  6PAX A;  4LLN A;  2HQR A;  1C0W A;  1KA8 A;  5JHU A;  2W84 A;  4YG2 F;  3B02 A;  1O7F A;  4N0B A;  3TKY A;  2ZME A;  3AAF A;  1O3S A;  3ZN0 A;  1Z05 A;  1G3T A;  2PEX A;  3F72 A;  3CLO A;  2FEZ A;  4L9T A;  3WTZ A;  3FX3 A;  5DUK A;  1WI9 A;  3ECO A;  2IRF G;  1U8R A;  1FBU A;  1ON2 A;  4QWQ A;  4H0E A;  4N9H A;  4HX7 A;  2IP2 A;  4ESB A;  2F5C A;  1ZH5 A;  4BAY A;  2Z3Y A;  2OBP A;  3TOA A;  1F5T A;  2EFQ A;  1H9G A;  1ODD A;  4YIF A;  1JE8 A;  4P55 A;  1EV7 A;  2L02 A;  2K7L A;  1OKR A;  3GYH X;  5HLI A;  2C6Y A;  1XB4 A;  2UWM A;  1BM9 A;  4HLX A;  4Z2Y A;  1QBJ A;  2HO0 A;  2GWR A;  1W4M A;  4PCQ A;  1UB9 A;  1TQM A;  2HYG D;  1TNT A;  1TW3 A;  4EGY A;  1J5Y A;  3FF5 A;  5EEH A;  3N4M A;  1AOY A;  3BDD A;  5AIP A;  1PP8 F;  2YPR A;  1REP C;  3MFK A;  3IKT A;  2PMH A;  1ZRE A;  4P9U A;  2YX4 A;  1O57 A;  5H6Q A;  3DPL C;  3KEO A;  4NQW A;  4RB0 A;  2IA2 A;  4MQV A;  3HOT A;  4Q47 A;  3DPT A;  5HDN A;  5CVI A;  3HSR A;  1IN6 A;  3QPH A;  5ILV A;  3LQR A;  1FSH A;  1P2F A;  5KK1 A;  5L3G A;  5L3C A;  5FLX K;  5E17 F;  1IN7 A;  3TDZ C;  2PG4 A;  4A2U A;  5DD4 A;  1W7P A;  4M9Z A;  3W6J B;  4ESJ A;  2F2E A;  2DLL A;  4EJO A;  2QM3 A;  1MGT A;  1P6R A;  4XSZ F;  3TDU C;  3HUG A;  2MD5 A;  3WGG A;  2CW0 F;  1GXQ A;  1JHC A;  1RUN A;  3ZMV A;  4G7O F;  4CHU A;  4KMF A;  2ETH A;  4GCV A;  1FPQ A;  3ELK A;  5D8L B;  5DUI A;  4WK8 F;  1F39 A;  2ESN A;  3M1E A;  3JAM Z;  3HHG A;  1J7K A;  4OOI A;  2Q8K A;  1OYI A;  4L9V A;  4UV9 A;  3SHF A;  3TGN A;  4ENK A;  4M9S A;  4LK1 F;  3RKX A;  2VOP A;  3SZP A;  4OMZ A;  2ZNY A;  2CSO A;  3J80 K;  1KYZ A;  5FD6 A;  3K9T A;  3HRT A;  3WU1 B;  1V3F A;  1IRF A;  4XBF A;  4MTD A;  2IT0 A;  3HRM A;  2K4J A;  1CF7 A;  2OAZ A;  1W5S A;  4KN7 X;  4PDK A;  4FT8 A;  1XSX A;  2JPC A;  1LQ1 A;  4XLN F;  2PMU A;  1W7P D;  3KCC A;  2XRO A;  3KP7 A;  4KT5 C;  5AON A;  1WRJ A;  5L3D A;  1U6G A;  3IL2 A;  4U0V A;  3F23 A;  3CO7 C;  2HEO A;  1FSE A;  5FLX Z;  4WF2 A;  3I59 A;  2EFP A;  3KE2 A;  2WWY A;  2UXX A;  4CXF A;  2FML A;  1L0O C;  3I71 A;  5H20 A;  1ONV A;  1HBX G;  4GYG A;  2WC2 A;  2XAS A;  2CWE A;  5D4S A;  2VOO A;  4XRF A;  1ZRD A;  5LHG A;  1R00 A;  4OIN F;  1ZG3 A;  2G9W A;  3EYY A;  3I58 A;  1KU2 A;  3K1P A;  4HLY A;  4KUM A;  1QZZ A;  1ZRF A;  1G3W A;  3HRS A;  3SFZ A;  4WCG A;  4EM1 A;  1RUO A;  4LK0 F;  3KP4 A;  2UXN A;  2DI3 A;  4A0X A;  5ED4 A;  4L5I A;  3F8C A;  4PGG A;  1MD0 A;  3ZMD A;  2FF4 A;  4R8H A;  4R79 A;  1Z9C A;  2DU9 A;  5F6F A;  1OYY A;  1EH6 A;  1I1G A;  4TV7 A;  4AIJ A;  3T0Y A;  3CTA A;  3OV8 A;  1FNN A;  2FKD A;  2QYO A;  2Y75 A;  1XSD A;  2GZW A;  3NRV A;  4G7H F;  2O8X A;  2PQ8 A;  3ZMZ A;  1YW9 A;  3G73 A;  3M9A A;  2VBZ A;  4P5O A;  1MZB A;  4ASN A;  1B12 A;  2EFO A;  5L3B A;  3BPV A;  4DNC A;  1BC7 C;  5DDG A;  2GQQ A;  3G3Z A;  2VBW A;  5DCF A;  1XDS A;  4ETS A;  3GFJ A;  3DV8 A;  3ROU A;  4LB5 A;  3R0A A;  2MLG A;  1YFH A;  3ZMS A;  1EH8 A;  2ACJ A;  2V6C A;  5H6R A;  2P5K A;  3K2Z A;  4HV5 A;  2HQN A;  1ZGA A;  3I4P A;  1YQA A;  1XGS A;  2XVC A;  3JTG A;  1T7D A;  1BBY A;  4I01 A;  2EFW A;  2FE3 A;  3GZ6 A;  4BQA A;  5E8G A;  2R7F A;  5CVV A;  3KZZ A;  4BYY A;  1R1T A;  3VOD A;  1ZHF A;  4HDU A;  4M71 A;  3NQO A;  4R1H A;  2M1B A;  3I64 A;  3BJ6 A;  3GFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...